data_1RZI
# 
_entry.id   1RZI 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1RZI         
RCSB  RCSB021179   
WWPDB D_1000021179 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1RZ7 . unspecified 
PDB 1RZ8 . unspecified 
PDB 1RZF . unspecified 
PDB 1RZG . unspecified 
PDB 1RZJ . unspecified 
PDB 1RZK . unspecified 
# 
_pdbx_database_status.entry_id                        1RZI 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.recvd_initial_deposition_date   2003-12-24 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Huang, C.C.'       1  
'Venturi, M.'       2  
'Majeed, S.'        3  
'Moore, M.J.'       4  
'Phogat, S.'        5  
'Zhang, M.-Y.'      6  
'Dimitrov, D.S.'    7  
'Hendrickson, W.A.' 8  
'Robinson, J.'      9  
'Sodroski, J.'      10 
'Wyatt, R.'         11 
'Choe, H.'          12 
'Farzan, M.'        13 
'Kwong, P.D.'       14 
# 
_citation.id                        primary 
_citation.title                     
;Structural basis of tyrosine sulfation and VH-gene usage in antibodies that recognize the HIV type 1 coreceptor-binding site on gp120
;
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            101 
_citation.page_first                2706 
_citation.page_last                 2711 
_citation.year                      2004 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   14981267 
_citation.pdbx_database_id_DOI      10.1073/pnas.0308527100 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Huang, C.C.'       1  
primary 'Venturi, M.'       2  
primary 'Majeed, S.'        3  
primary 'Moore, M.J.'       4  
primary 'Phogat, S.'        5  
primary 'Zhang, M.-Y.'      6  
primary 'Dimitrov, D.S.'    7  
primary 'Hendrickson, W.A.' 8  
primary 'Robinson, J.'      9  
primary 'Sodroski, J.'      10 
primary 'Wyatt, R.'         11 
primary 'Choe, H.'          12 
primary 'Farzan, M.'        13 
primary 'Kwong, P.D.'       14 
# 
_cell.entry_id           1RZI 
_cell.length_a           73.430 
_cell.length_b           111.645 
_cell.length_c           133.309 
_cell.angle_alpha        85.48 
_cell.angle_beta         90.00 
_cell.angle_gamma        89.71 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1RZI 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.cell_setting                     triclinic 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Fab 47e light chain' 23166.619 8   ? ? ? ? 
2 polymer man 'Fab 47e heavy chain' 24157.945 8   ? ? ? ? 
3 water   nat water                 18.015    391 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;DIQMTQSPSLSASVGDRVTITCRASQSISSYLNWYQQKPGKVPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPE
DFATYYCQQSYSTSHTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQE
SVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGE
;
;DIQMTQSPSLSASVGDRVTITCRASQSISSYLNWYQQKPGKVPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPE
DFATYYCQQSYSTSHTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQE
SVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGE
;
A,C,E,G,I,K,M,O ? 
2 'polypeptide(L)' no no 
;QVQLLQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGGIIPVFGSANYAQKFQGRVTITADEATSTTY
MELSSLRSEDTAVYFCAKGGEDGDYLSDPFYYNHGMDVWGQGTTVTVASASTKGPSVFPLAPSSKSTSGGTAALGCLVKD
YFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
;
;QVQLLQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGGIIPVFGSANYAQKFQGRVTITADEATSTTY
MELSSLRSEDTAVYFCAKGGEDGDYLSDPFYYNHGMDVWGQGTTVTVASASTKGPSVFPLAPSSKSTSGGTAALGCLVKD
YFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
;
B,D,F,H,J,L,N,P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   ILE n 
1 3   GLN n 
1 4   MET n 
1 5   THR n 
1 6   GLN n 
1 7   SER n 
1 8   PRO n 
1 9   SER n 
1 10  LEU n 
1 11  SER n 
1 12  ALA n 
1 13  SER n 
1 14  VAL n 
1 15  GLY n 
1 16  ASP n 
1 17  ARG n 
1 18  VAL n 
1 19  THR n 
1 20  ILE n 
1 21  THR n 
1 22  CYS n 
1 23  ARG n 
1 24  ALA n 
1 25  SER n 
1 26  GLN n 
1 27  SER n 
1 28  ILE n 
1 29  SER n 
1 30  SER n 
1 31  TYR n 
1 32  LEU n 
1 33  ASN n 
1 34  TRP n 
1 35  TYR n 
1 36  GLN n 
1 37  GLN n 
1 38  LYS n 
1 39  PRO n 
1 40  GLY n 
1 41  LYS n 
1 42  VAL n 
1 43  PRO n 
1 44  LYS n 
1 45  LEU n 
1 46  LEU n 
1 47  ILE n 
1 48  TYR n 
1 49  ALA n 
1 50  ALA n 
1 51  SER n 
1 52  SER n 
1 53  LEU n 
1 54  GLN n 
1 55  SER n 
1 56  GLY n 
1 57  VAL n 
1 58  PRO n 
1 59  SER n 
1 60  ARG n 
1 61  PHE n 
1 62  SER n 
1 63  GLY n 
1 64  SER n 
1 65  GLY n 
1 66  SER n 
1 67  GLY n 
1 68  THR n 
1 69  ASP n 
1 70  PHE n 
1 71  THR n 
1 72  LEU n 
1 73  THR n 
1 74  ILE n 
1 75  SER n 
1 76  SER n 
1 77  LEU n 
1 78  GLN n 
1 79  PRO n 
1 80  GLU n 
1 81  ASP n 
1 82  PHE n 
1 83  ALA n 
1 84  THR n 
1 85  TYR n 
1 86  TYR n 
1 87  CYS n 
1 88  GLN n 
1 89  GLN n 
1 90  SER n 
1 91  TYR n 
1 92  SER n 
1 93  THR n 
1 94  SER n 
1 95  HIS n 
1 96  THR n 
1 97  PHE n 
1 98  GLY n 
1 99  GLN n 
1 100 GLY n 
1 101 THR n 
1 102 LYS n 
1 103 LEU n 
1 104 GLU n 
1 105 ILE n 
1 106 LYS n 
1 107 ARG n 
1 108 THR n 
1 109 VAL n 
1 110 ALA n 
1 111 ALA n 
1 112 PRO n 
1 113 SER n 
1 114 VAL n 
1 115 PHE n 
1 116 ILE n 
1 117 PHE n 
1 118 PRO n 
1 119 PRO n 
1 120 SER n 
1 121 ASP n 
1 122 GLU n 
1 123 GLN n 
1 124 LEU n 
1 125 LYS n 
1 126 SER n 
1 127 GLY n 
1 128 THR n 
1 129 ALA n 
1 130 SER n 
1 131 VAL n 
1 132 VAL n 
1 133 CYS n 
1 134 LEU n 
1 135 LEU n 
1 136 ASN n 
1 137 ASN n 
1 138 PHE n 
1 139 TYR n 
1 140 PRO n 
1 141 ARG n 
1 142 GLU n 
1 143 ALA n 
1 144 LYS n 
1 145 VAL n 
1 146 GLN n 
1 147 TRP n 
1 148 LYS n 
1 149 VAL n 
1 150 ASP n 
1 151 ASN n 
1 152 ALA n 
1 153 LEU n 
1 154 GLN n 
1 155 SER n 
1 156 GLY n 
1 157 ASN n 
1 158 SER n 
1 159 GLN n 
1 160 GLU n 
1 161 SER n 
1 162 VAL n 
1 163 THR n 
1 164 GLU n 
1 165 GLN n 
1 166 ASP n 
1 167 SER n 
1 168 LYS n 
1 169 ASP n 
1 170 SER n 
1 171 THR n 
1 172 TYR n 
1 173 SER n 
1 174 LEU n 
1 175 SER n 
1 176 SER n 
1 177 THR n 
1 178 LEU n 
1 179 THR n 
1 180 LEU n 
1 181 SER n 
1 182 LYS n 
1 183 ALA n 
1 184 ASP n 
1 185 TYR n 
1 186 GLU n 
1 187 LYS n 
1 188 HIS n 
1 189 LYS n 
1 190 VAL n 
1 191 TYR n 
1 192 ALA n 
1 193 CYS n 
1 194 GLU n 
1 195 VAL n 
1 196 THR n 
1 197 HIS n 
1 198 GLN n 
1 199 GLY n 
1 200 LEU n 
1 201 SER n 
1 202 SER n 
1 203 PRO n 
1 204 VAL n 
1 205 THR n 
1 206 LYS n 
1 207 SER n 
1 208 PHE n 
1 209 ASN n 
1 210 ARG n 
1 211 GLY n 
1 212 GLU n 
2 1   GLN n 
2 2   VAL n 
2 3   GLN n 
2 4   LEU n 
2 5   LEU n 
2 6   GLN n 
2 7   SER n 
2 8   GLY n 
2 9   ALA n 
2 10  GLU n 
2 11  VAL n 
2 12  LYS n 
2 13  LYS n 
2 14  PRO n 
2 15  GLY n 
2 16  SER n 
2 17  SER n 
2 18  VAL n 
2 19  LYS n 
2 20  VAL n 
2 21  SER n 
2 22  CYS n 
2 23  LYS n 
2 24  ALA n 
2 25  SER n 
2 26  GLY n 
2 27  GLY n 
2 28  THR n 
2 29  PHE n 
2 30  SER n 
2 31  SER n 
2 32  TYR n 
2 33  ALA n 
2 34  ILE n 
2 35  SER n 
2 36  TRP n 
2 37  VAL n 
2 38  ARG n 
2 39  GLN n 
2 40  ALA n 
2 41  PRO n 
2 42  GLY n 
2 43  GLN n 
2 44  GLY n 
2 45  LEU n 
2 46  GLU n 
2 47  TRP n 
2 48  MET n 
2 49  GLY n 
2 50  GLY n 
2 51  ILE n 
2 52  ILE n 
2 53  PRO n 
2 54  VAL n 
2 55  PHE n 
2 56  GLY n 
2 57  SER n 
2 58  ALA n 
2 59  ASN n 
2 60  TYR n 
2 61  ALA n 
2 62  GLN n 
2 63  LYS n 
2 64  PHE n 
2 65  GLN n 
2 66  GLY n 
2 67  ARG n 
2 68  VAL n 
2 69  THR n 
2 70  ILE n 
2 71  THR n 
2 72  ALA n 
2 73  ASP n 
2 74  GLU n 
2 75  ALA n 
2 76  THR n 
2 77  SER n 
2 78  THR n 
2 79  THR n 
2 80  TYR n 
2 81  MET n 
2 82  GLU n 
2 83  LEU n 
2 84  SER n 
2 85  SER n 
2 86  LEU n 
2 87  ARG n 
2 88  SER n 
2 89  GLU n 
2 90  ASP n 
2 91  THR n 
2 92  ALA n 
2 93  VAL n 
2 94  TYR n 
2 95  PHE n 
2 96  CYS n 
2 97  ALA n 
2 98  LYS n 
2 99  GLY n 
2 100 GLY n 
2 101 GLU n 
2 102 ASP n 
2 103 GLY n 
2 104 ASP n 
2 105 TYR n 
2 106 LEU n 
2 107 SER n 
2 108 ASP n 
2 109 PRO n 
2 110 PHE n 
2 111 TYR n 
2 112 TYR n 
2 113 ASN n 
2 114 HIS n 
2 115 GLY n 
2 116 MET n 
2 117 ASP n 
2 118 VAL n 
2 119 TRP n 
2 120 GLY n 
2 121 GLN n 
2 122 GLY n 
2 123 THR n 
2 124 THR n 
2 125 VAL n 
2 126 THR n 
2 127 VAL n 
2 128 ALA n 
2 129 SER n 
2 130 ALA n 
2 131 SER n 
2 132 THR n 
2 133 LYS n 
2 134 GLY n 
2 135 PRO n 
2 136 SER n 
2 137 VAL n 
2 138 PHE n 
2 139 PRO n 
2 140 LEU n 
2 141 ALA n 
2 142 PRO n 
2 143 SER n 
2 144 SER n 
2 145 LYS n 
2 146 SER n 
2 147 THR n 
2 148 SER n 
2 149 GLY n 
2 150 GLY n 
2 151 THR n 
2 152 ALA n 
2 153 ALA n 
2 154 LEU n 
2 155 GLY n 
2 156 CYS n 
2 157 LEU n 
2 158 VAL n 
2 159 LYS n 
2 160 ASP n 
2 161 TYR n 
2 162 PHE n 
2 163 PRO n 
2 164 GLU n 
2 165 PRO n 
2 166 VAL n 
2 167 THR n 
2 168 VAL n 
2 169 SER n 
2 170 TRP n 
2 171 ASN n 
2 172 SER n 
2 173 GLY n 
2 174 ALA n 
2 175 LEU n 
2 176 THR n 
2 177 SER n 
2 178 GLY n 
2 179 VAL n 
2 180 HIS n 
2 181 THR n 
2 182 PHE n 
2 183 PRO n 
2 184 ALA n 
2 185 VAL n 
2 186 LEU n 
2 187 GLN n 
2 188 SER n 
2 189 SER n 
2 190 GLY n 
2 191 LEU n 
2 192 TYR n 
2 193 SER n 
2 194 LEU n 
2 195 SER n 
2 196 SER n 
2 197 VAL n 
2 198 VAL n 
2 199 THR n 
2 200 VAL n 
2 201 PRO n 
2 202 SER n 
2 203 SER n 
2 204 SER n 
2 205 LEU n 
2 206 GLY n 
2 207 THR n 
2 208 GLN n 
2 209 THR n 
2 210 TYR n 
2 211 ILE n 
2 212 CYS n 
2 213 ASN n 
2 214 VAL n 
2 215 ASN n 
2 216 HIS n 
2 217 LYS n 
2 218 PRO n 
2 219 SER n 
2 220 ASN n 
2 221 THR n 
2 222 LYS n 
2 223 VAL n 
2 224 ASP n 
2 225 LYS n 
2 226 LYS n 
2 227 VAL n 
2 228 GLU n 
2 229 PRO n 
2 230 LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 'Epstein-Barr virus' 'Human herpesvirus 4' 10376 
Lymphocryptovirus ? ? ? ? ? ? ? ? ? ? 'IMMORTALIZED B-CELL CLONE FUSED WITH A MURINE B-CELL FUSION PARTNER' ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 'Epstein-Barr virus' 'Human herpesvirus 4' 10376 
Lymphocryptovirus ? ? ? ? ? ? ? ? ? ? 'IMMORTALIZED B-CELL CLONE FUSED WITH A MURINE B-CELL FUSION PARTNER' ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.entity_id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 1 PDB 1RZI 1RZI ? ? ? 
2 2 PDB 1RZI 1RZI ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 1RZI A 1 ? 212 ? 1RZI 1 ? 213 ? 1 213 
2  2 1RZI B 1 ? 230 ? 1RZI 1 ? 214 ? 1 214 
3  1 1RZI C 1 ? 212 ? 1RZI 1 ? 213 ? 1 213 
4  2 1RZI D 1 ? 230 ? 1RZI 1 ? 214 ? 1 214 
5  1 1RZI E 1 ? 212 ? 1RZI 1 ? 213 ? 1 213 
6  2 1RZI F 1 ? 230 ? 1RZI 1 ? 214 ? 1 214 
7  1 1RZI G 1 ? 212 ? 1RZI 1 ? 213 ? 1 213 
8  2 1RZI H 1 ? 230 ? 1RZI 1 ? 214 ? 1 214 
9  1 1RZI I 1 ? 212 ? 1RZI 1 ? 213 ? 1 213 
10 2 1RZI J 1 ? 230 ? 1RZI 1 ? 214 ? 1 214 
11 1 1RZI K 1 ? 212 ? 1RZI 1 ? 213 ? 1 213 
12 2 1RZI L 1 ? 230 ? 1RZI 1 ? 214 ? 1 214 
13 1 1RZI M 1 ? 212 ? 1RZI 1 ? 213 ? 1 213 
14 2 1RZI N 1 ? 230 ? 1RZI 1 ? 214 ? 1 214 
15 1 1RZI O 1 ? 212 ? 1RZI 1 ? 213 ? 1 213 
16 2 1RZI P 1 ? 230 ? 1RZI 1 ? 214 ? 1 214 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1RZI 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   2 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_percent_sol   58.6 
_exptl_crystal.density_Matthews      3.00 
_exptl_crystal.density_meas          ? 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.pH              9.0 
_exptl_crystal_grow.pdbx_details    
'1.2M ammonium citrate, 0.1M Tris-HCl, 4% PEG1000, pH 9.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2003-03-12 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si (220)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.000 
# 
_reflns.entry_id                     1RZI 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20. 
_reflns.d_resolution_high            2.80 
_reflns.number_obs                   84392 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        64.3 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.80 
_reflns_shell.d_res_low              2.91 
_reflns_shell.percent_possible_all   31.1 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1RZI 
_refine.ls_number_reflns_obs                     76315 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               257118.46 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            2.90 
_refine.ls_percent_reflns_obs                    81.8 
_refine.ls_R_factor_obs                          0.2331 
_refine.ls_R_factor_all                          0.2331 
_refine.ls_R_factor_R_work                       0.233 
_refine.ls_R_factor_R_free                       0.321 
_refine.ls_R_factor_R_free_error                 0.004 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.1 
_refine.ls_number_reflns_R_free                  7671 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               57.5 
_refine.aniso_B[1][1]                            -2.11 
_refine.aniso_B[2][2]                            19.17 
_refine.aniso_B[3][3]                            -17.06 
_refine.aniso_B[1][2]                            3.04 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            -7.27 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.267058 
_refine.solvent_model_param_bsol                 38.3048 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1RZI 
_refine_analyze.Luzzati_coordinate_error_obs    0.42 
_refine_analyze.Luzzati_sigma_a_obs             0.56 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.59 
_refine_analyze.Luzzati_sigma_a_free            0.75 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        25582 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             391 
_refine_hist.number_atoms_total               25973 
_refine_hist.d_res_high                       2.90 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.010 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.9   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      26.9  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.10  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.28  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            2.28  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             1.67  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            2.54  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.90 
_refine_ls_shell.d_res_low                        3.08 
_refine_ls_shell.number_reflns_R_work             6011 
_refine_ls_shell.R_factor_R_work                  0.386 
_refine_ls_shell.percent_reflns_obs               43.0 
_refine_ls_shell.R_factor_R_free                  0.457 
_refine_ls_shell.R_factor_R_free_error            0.018 
_refine_ls_shell.percent_reflns_R_free            9.9 
_refine_ls_shell.number_reflns_R_free             658 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM   WATER.TOP   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1RZI 
_struct.title                     'Crystal structure of human anti-HIV-1 gp120-reactive antibody 47e fab' 
_struct.pdbx_descriptor           'Fab 47e light and heavy chains' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1RZI 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
_struct_keywords.text            'HIV-1; gp120; CD4i; antibodies; tyrosine sulfation; VH-gene usage, IMMUNE SYSTEM' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 2 ? 
C  N N 1 ? 
D  N N 2 ? 
E  N N 1 ? 
F  N N 2 ? 
G  N N 1 ? 
H  N N 2 ? 
I  N N 1 ? 
J  N N 2 ? 
K  N N 1 ? 
L  N N 2 ? 
M  N N 1 ? 
N  N N 2 ? 
O  N N 1 ? 
P  N N 2 ? 
Q  N N 3 ? 
R  N N 3 ? 
S  N N 3 ? 
T  N N 3 ? 
U  N N 3 ? 
V  N N 3 ? 
W  N N 3 ? 
X  N N 3 ? 
Y  N N 3 ? 
Z  N N 3 ? 
AA N N 3 ? 
BA N N 3 ? 
CA N N 3 ? 
DA N N 3 ? 
EA N N 3 ? 
FA N N 3 ? 
# 
loop_
_struct_biol.id 
_struct_biol.pdbx_parent_biol_id 
_struct_biol.details 
1 ? ? 
2 ? ? 
3 ? ? 
4 ? ? 
5 ? ? 
6 ? ? 
7 ? ? 
8 ? ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LYS A 182 ? LYS A 187 ? LYS A 183 LYS A 188 1 ? 6 
HELX_P HELX_P2  2  PRO B 53  A GLY B 56  ? PRO B 52  GLY B 55  5 ? 4 
HELX_P HELX_P3  3  GLN B 62  ? GLN B 65  ? GLN B 61  GLN B 64  5 ? 4 
HELX_P HELX_P4  4  SER B 172 ? ALA B 174 ? SER B 156 ALA B 158 5 ? 3 
HELX_P HELX_P5  5  SER B 203 ? GLY B 206 ? SER B 187 GLY B 190 5 ? 4 
HELX_P HELX_P6  6  HIS B 216 ? ASN B 220 ? HIS B 200 ASN B 204 5 ? 5 
HELX_P HELX_P7  7  SER C 120 ? SER C 126 ? SER C 121 SER C 127 1 ? 7 
HELX_P HELX_P8  8  LYS C 182 ? HIS C 188 ? LYS C 183 HIS C 189 1 ? 7 
HELX_P HELX_P9  9  ILE D 52  ? GLY D 56  ? ILE D 52  GLY D 55  5 ? 5 
HELX_P HELX_P10 10 ARG D 87  ? THR D 91  ? ARG D 83  THR D 87  5 ? 5 
HELX_P HELX_P11 11 TRP D 170 ? ALA D 174 ? TRP D 154 ALA D 158 5 ? 5 
HELX_P HELX_P12 12 SER E 120 ? GLY E 127 ? SER E 121 GLY E 128 1 ? 8 
HELX_P HELX_P13 13 LYS E 182 ? HIS E 188 ? LYS E 183 HIS E 189 1 ? 7 
HELX_P HELX_P14 14 ILE F 52  ? GLY F 56  ? ILE F 52  GLY F 55  5 ? 5 
HELX_P HELX_P15 15 TRP F 170 ? ALA F 174 ? TRP F 154 ALA F 158 5 ? 5 
HELX_P HELX_P16 16 SER F 203 ? THR F 207 ? SER F 187 THR F 191 5 ? 5 
HELX_P HELX_P17 17 GLN G 78  ? PHE G 82  ? GLN G 79  PHE G 83  5 ? 5 
HELX_P HELX_P18 18 SER G 120 ? SER G 126 ? SER G 121 SER G 127 1 ? 7 
HELX_P HELX_P19 19 LYS G 182 ? LYS G 187 ? LYS G 183 LYS G 188 1 ? 6 
HELX_P HELX_P20 20 THR H 28  ? TYR H 32  ? THR H 28  TYR H 32  5 ? 5 
HELX_P HELX_P21 21 GLN H 62  ? GLN H 65  ? GLN H 61  GLN H 64  5 ? 4 
HELX_P HELX_P22 22 SER H 203 ? LEU H 205 ? SER H 187 LEU H 189 5 ? 3 
HELX_P HELX_P23 23 GLN I 78  ? PHE I 82  ? GLN I 79  PHE I 83  5 ? 5 
HELX_P HELX_P24 24 SER I 120 ? LYS I 125 ? SER I 121 LYS I 126 1 ? 6 
HELX_P HELX_P25 25 LYS I 182 ? LYS I 187 ? LYS I 183 LYS I 188 1 ? 6 
HELX_P HELX_P26 26 SER J 203 ? LEU J 205 ? SER J 187 LEU J 189 5 ? 3 
HELX_P HELX_P27 27 HIS J 216 ? ASN J 220 ? HIS J 200 ASN J 204 5 ? 5 
HELX_P HELX_P28 28 SER K 120 ? GLY K 127 ? SER K 121 GLY K 128 1 ? 8 
HELX_P HELX_P29 29 SER K 181 ? GLU K 186 ? SER K 182 GLU K 187 1 ? 6 
HELX_P HELX_P30 30 THR L 28  ? TYR L 32  ? THR L 28  TYR L 32  5 ? 5 
HELX_P HELX_P31 31 ALA L 61  ? GLN L 65  ? ALA L 60  GLN L 64  5 ? 5 
HELX_P HELX_P32 32 ARG L 87  ? THR L 91  ? ARG L 83  THR L 87  5 ? 5 
HELX_P HELX_P33 33 TRP L 170 ? ALA L 174 ? TRP L 154 ALA L 158 5 ? 5 
HELX_P HELX_P34 34 SER L 202 ? GLY L 206 ? SER L 186 GLY L 190 1 ? 5 
HELX_P HELX_P35 35 GLN M 78  ? PHE M 82  ? GLN M 79  PHE M 83  5 ? 5 
HELX_P HELX_P36 36 SER M 120 ? LYS M 125 ? SER M 121 LYS M 126 1 ? 6 
HELX_P HELX_P37 37 SER M 181 ? GLU M 186 ? SER M 182 GLU M 187 1 ? 6 
HELX_P HELX_P38 38 GLN N 62  ? GLN N 65  ? GLN N 61  GLN N 64  5 ? 4 
HELX_P HELX_P39 39 SER N 202 ? GLY N 206 ? SER N 186 GLY N 190 1 ? 5 
HELX_P HELX_P40 40 LYS N 217 ? ASN N 220 ? LYS N 201 ASN N 204 5 ? 4 
HELX_P HELX_P41 41 GLN O 78  ? PHE O 82  ? GLN O 79  PHE O 83  5 ? 5 
HELX_P HELX_P42 42 SER O 120 ? LYS O 125 ? SER O 121 LYS O 126 1 ? 6 
HELX_P HELX_P43 43 SER O 181 ? LYS O 187 ? SER O 182 LYS O 188 1 ? 7 
HELX_P HELX_P44 44 ARG P 87  ? THR P 91  ? ARG P 83  THR P 87  5 ? 5 
HELX_P HELX_P45 45 SER P 172 ? ALA P 174 ? SER P 156 ALA P 158 5 ? 3 
HELX_P HELX_P46 46 SER P 203 ? THR P 207 ? SER P 187 THR P 191 5 ? 5 
HELX_P HELX_P47 47 LYS P 217 ? ASN P 220 ? LYS P 201 ASN P 204 5 ? 4 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 22  SG ? ? ? 1_555 A CYS 87  SG ? ? A CYS 23  A CYS 88  1_555 ? ? ? ? ? ? ? 1.988 ? 
disulf2  disulf ? ? A CYS 133 SG ? ? ? 1_555 A CYS 193 SG ? ? A CYS 134 A CYS 194 1_555 ? ? ? ? ? ? ? 2.048 ? 
disulf3  disulf ? ? B CYS 22  SG ? ? ? 1_555 B CYS 96  SG ? ? B CYS 22  B CYS 92  1_555 ? ? ? ? ? ? ? 2.040 ? 
disulf4  disulf ? ? B CYS 156 SG ? ? ? 1_555 B CYS 212 SG ? ? B CYS 140 B CYS 196 1_555 ? ? ? ? ? ? ? 2.040 ? 
disulf5  disulf ? ? C CYS 22  SG ? ? ? 1_555 C CYS 87  SG ? ? C CYS 23  C CYS 88  1_555 ? ? ? ? ? ? ? 2.038 ? 
disulf6  disulf ? ? C CYS 133 SG ? ? ? 1_555 C CYS 193 SG ? ? C CYS 134 C CYS 194 1_555 ? ? ? ? ? ? ? 2.035 ? 
disulf7  disulf ? ? D CYS 22  SG ? ? ? 1_555 D CYS 96  SG ? ? D CYS 22  D CYS 92  1_555 ? ? ? ? ? ? ? 2.030 ? 
disulf8  disulf ? ? D CYS 156 SG ? ? ? 1_555 D CYS 212 SG ? ? D CYS 140 D CYS 196 1_555 ? ? ? ? ? ? ? 2.028 ? 
disulf9  disulf ? ? E CYS 22  SG ? ? ? 1_555 E CYS 87  SG ? ? E CYS 23  E CYS 88  1_555 ? ? ? ? ? ? ? 2.043 ? 
disulf10 disulf ? ? E CYS 133 SG ? ? ? 1_555 E CYS 193 SG ? ? E CYS 134 E CYS 194 1_555 ? ? ? ? ? ? ? 2.026 ? 
disulf11 disulf ? ? F CYS 22  SG ? ? ? 1_555 F CYS 96  SG ? ? F CYS 22  F CYS 92  1_555 ? ? ? ? ? ? ? 2.036 ? 
disulf12 disulf ? ? F CYS 156 SG ? ? ? 1_555 F CYS 212 SG ? ? F CYS 140 F CYS 196 1_555 ? ? ? ? ? ? ? 2.039 ? 
disulf13 disulf ? ? G CYS 22  SG ? ? ? 1_555 G CYS 87  SG ? ? G CYS 23  G CYS 88  1_555 ? ? ? ? ? ? ? 2.054 ? 
disulf14 disulf ? ? G CYS 133 SG ? ? ? 1_555 G CYS 193 SG ? ? G CYS 134 G CYS 194 1_555 ? ? ? ? ? ? ? 2.046 ? 
disulf15 disulf ? ? H CYS 22  SG ? ? ? 1_555 H CYS 96  SG ? ? H CYS 22  H CYS 92  1_555 ? ? ? ? ? ? ? 2.042 ? 
disulf16 disulf ? ? H CYS 156 SG ? ? ? 1_555 H CYS 212 SG ? ? H CYS 140 H CYS 196 1_555 ? ? ? ? ? ? ? 2.036 ? 
disulf17 disulf ? ? I CYS 22  SG ? ? ? 1_555 I CYS 87  SG ? ? I CYS 23  I CYS 88  1_555 ? ? ? ? ? ? ? 2.044 ? 
disulf18 disulf ? ? I CYS 133 SG ? ? ? 1_555 I CYS 193 SG ? ? I CYS 134 I CYS 194 1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf19 disulf ? ? J CYS 22  SG ? ? ? 1_555 J CYS 96  SG ? ? J CYS 22  J CYS 92  1_555 ? ? ? ? ? ? ? 2.037 ? 
disulf20 disulf ? ? J CYS 156 SG ? ? ? 1_555 J CYS 212 SG ? ? J CYS 140 J CYS 196 1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf21 disulf ? ? K CYS 22  SG ? ? ? 1_555 K CYS 87  SG ? ? K CYS 23  K CYS 88  1_555 ? ? ? ? ? ? ? 2.043 ? 
disulf22 disulf ? ? K CYS 133 SG ? ? ? 1_555 K CYS 193 SG ? ? K CYS 134 K CYS 194 1_555 ? ? ? ? ? ? ? 2.044 ? 
disulf23 disulf ? ? L CYS 22  SG ? ? ? 1_555 L CYS 96  SG ? ? L CYS 22  L CYS 92  1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf24 disulf ? ? L CYS 156 SG ? ? ? 1_555 L CYS 212 SG ? ? L CYS 140 L CYS 196 1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf25 disulf ? ? M CYS 22  SG ? ? ? 1_555 M CYS 87  SG ? ? M CYS 23  M CYS 88  1_555 ? ? ? ? ? ? ? 2.044 ? 
disulf26 disulf ? ? M CYS 133 SG ? ? ? 1_555 M CYS 193 SG ? ? M CYS 134 M CYS 194 1_555 ? ? ? ? ? ? ? 2.039 ? 
disulf27 disulf ? ? N CYS 22  SG ? ? ? 1_555 N CYS 96  SG ? ? N CYS 22  N CYS 92  1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf28 disulf ? ? N CYS 156 SG ? ? ? 1_555 N CYS 212 SG ? ? N CYS 140 N CYS 196 1_555 ? ? ? ? ? ? ? 2.028 ? 
disulf29 disulf ? ? O CYS 22  SG ? ? ? 1_555 O CYS 87  SG ? ? O CYS 23  O CYS 88  1_555 ? ? ? ? ? ? ? 2.043 ? 
disulf30 disulf ? ? O CYS 133 SG ? ? ? 1_555 O CYS 193 SG ? ? O CYS 134 O CYS 194 1_555 ? ? ? ? ? ? ? 2.053 ? 
disulf31 disulf ? ? P CYS 22  SG ? ? ? 1_555 P CYS 96  SG ? ? P CYS 22  P CYS 92  1_555 ? ? ? ? ? ? ? 2.035 ? 
disulf32 disulf ? ? P CYS 156 SG ? ? ? 1_555 P CYS 212 SG ? ? P CYS 140 P CYS 196 1_555 ? ? ? ? ? ? ? 2.036 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  TYR 139 A . ? TYR 140 A PRO 140 A ? PRO 141 A 1 0.10   
2  PHE 162 B . ? PHE 146 B PRO 163 B ? PRO 147 B 1 -0.09  
3  GLU 164 B . ? GLU 148 B PRO 165 B ? PRO 149 B 1 -0.02  
4  SER 7   C . ? SER 7   C PRO 8   C ? PRO 8   C 1 2.65   
5  TYR 139 C . ? TYR 140 C PRO 140 C ? PRO 141 C 1 0.16   
6  PHE 162 D . ? PHE 146 D PRO 163 D ? PRO 147 D 1 -0.43  
7  GLU 164 D . ? GLU 148 D PRO 165 D ? PRO 149 D 1 -0.34  
8  SER 7   E . ? SER 7   E PRO 8   E ? PRO 8   E 1 -17.05 
9  TYR 139 E . ? TYR 140 E PRO 140 E ? PRO 141 E 1 -0.11  
10 PHE 162 F . ? PHE 146 F PRO 163 F ? PRO 147 F 1 -0.15  
11 GLU 164 F . ? GLU 148 F PRO 165 F ? PRO 149 F 1 -0.34  
12 SER 7   G . ? SER 7   G PRO 8   G ? PRO 8   G 1 -5.14  
13 TYR 139 G . ? TYR 140 G PRO 140 G ? PRO 141 G 1 0.11   
14 PHE 162 H . ? PHE 146 H PRO 163 H ? PRO 147 H 1 0.01   
15 GLU 164 H . ? GLU 148 H PRO 165 H ? PRO 149 H 1 -0.30  
16 SER 7   I . ? SER 7   I PRO 8   I ? PRO 8   I 1 -18.25 
17 TYR 139 I . ? TYR 140 I PRO 140 I ? PRO 141 I 1 0.09   
18 PHE 162 J . ? PHE 146 J PRO 163 J ? PRO 147 J 1 -0.14  
19 GLU 164 J . ? GLU 148 J PRO 165 J ? PRO 149 J 1 0.36   
20 SER 7   K . ? SER 7   K PRO 8   K ? PRO 8   K 1 8.30   
21 TYR 139 K . ? TYR 140 K PRO 140 K ? PRO 141 K 1 0.02   
22 PHE 162 L . ? PHE 146 L PRO 163 L ? PRO 147 L 1 -0.39  
23 GLU 164 L . ? GLU 148 L PRO 165 L ? PRO 149 L 1 -0.13  
24 SER 7   M . ? SER 7   M PRO 8   M ? PRO 8   M 1 7.98   
25 TYR 139 M . ? TYR 140 M PRO 140 M ? PRO 141 M 1 0.05   
26 PHE 162 N . ? PHE 146 N PRO 163 N ? PRO 147 N 1 0.06   
27 GLU 164 N . ? GLU 148 N PRO 165 N ? PRO 149 N 1 -0.20  
28 SER 7   O . ? SER 7   O PRO 8   O ? PRO 8   O 1 0.19   
29 TYR 139 O . ? TYR 140 O PRO 140 O ? PRO 141 O 1 0.13   
30 PHE 162 P . ? PHE 146 P PRO 163 P ? PRO 147 P 1 -0.10  
31 GLU 164 P . ? GLU 148 P PRO 165 P ? PRO 149 P 1 -0.35  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 4 ? 
B  ? 3 ? 
C  ? 2 ? 
D  ? 5 ? 
E  ? 5 ? 
F  ? 4 ? 
G  ? 4 ? 
H  ? 2 ? 
I  ? 6 ? 
J  ? 3 ? 
K  ? 4 ? 
L  ? 4 ? 
M  ? 2 ? 
N  ? 4 ? 
O  ? 5 ? 
P  ? 6 ? 
Q  ? 4 ? 
R  ? 7 ? 
S  ? 4 ? 
T  ? 4 ? 
U  ? 2 ? 
V  ? 2 ? 
W  ? 4 ? 
X  ? 4 ? 
Y  ? 2 ? 
Z  ? 6 ? 
AA ? 4 ? 
AB ? 3 ? 
AC ? 4 ? 
AD ? 4 ? 
AE ? 6 ? 
AF ? 7 ? 
AG ? 5 ? 
AH ? 2 ? 
AI ? 4 ? 
AJ ? 4 ? 
AK ? 2 ? 
AL ? 2 ? 
AM ? 2 ? 
AN ? 2 ? 
AO ? 6 ? 
AP ? 4 ? 
AQ ? 4 ? 
AR ? 3 ? 
AS ? 6 ? 
AT ? 6 ? 
AU ? 4 ? 
AV ? 3 ? 
AW ? 3 ? 
AX ? 3 ? 
AY ? 6 ? 
AZ ? 4 ? 
BA ? 4 ? 
BB ? 3 ? 
BC ? 4 ? 
BD ? 5 ? 
BE ? 4 ? 
BF ? 3 ? 
BG ? 2 ? 
BH ? 5 ? 
BI ? 4 ? 
BJ ? 3 ? 
BK ? 3 ? 
BL ? 4 ? 
BM ? 5 ? 
BN ? 4 ? 
BO ? 2 ? 
BP ? 4 ? 
BQ ? 6 ? 
BR ? 4 ? 
BS ? 3 ? 
BT ? 6 ? 
BU ? 3 ? 
BV ? 4 ? 
BW ? 4 ? 
BX ? 3 ? 
BY ? 6 ? 
BZ ? 4 ? 
CA ? 2 ? 
CB ? 2 ? 
CC ? 6 ? 
CD ? 3 ? 
CE ? 4 ? 
CF ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? anti-parallel 
A  2 3 ? anti-parallel 
A  3 4 ? anti-parallel 
B  1 2 ? anti-parallel 
B  2 3 ? parallel      
C  1 2 ? parallel      
D  1 2 ? anti-parallel 
D  2 3 ? anti-parallel 
D  3 4 ? anti-parallel 
D  4 5 ? anti-parallel 
E  1 2 ? anti-parallel 
E  2 3 ? anti-parallel 
E  3 4 ? anti-parallel 
E  4 5 ? anti-parallel 
F  1 2 ? anti-parallel 
F  2 3 ? anti-parallel 
F  3 4 ? anti-parallel 
G  1 2 ? anti-parallel 
G  2 3 ? anti-parallel 
G  3 4 ? anti-parallel 
H  1 2 ? anti-parallel 
I  1 2 ? parallel      
I  2 3 ? anti-parallel 
I  3 4 ? anti-parallel 
I  4 5 ? anti-parallel 
I  5 6 ? anti-parallel 
J  1 2 ? anti-parallel 
J  2 3 ? anti-parallel 
K  1 2 ? anti-parallel 
K  2 3 ? anti-parallel 
K  3 4 ? anti-parallel 
L  1 2 ? anti-parallel 
L  2 3 ? anti-parallel 
L  3 4 ? anti-parallel 
M  1 2 ? anti-parallel 
N  1 2 ? anti-parallel 
N  2 3 ? anti-parallel 
N  3 4 ? anti-parallel 
O  1 2 ? anti-parallel 
O  2 3 ? parallel      
O  3 4 ? anti-parallel 
O  4 5 ? anti-parallel 
P  1 2 ? parallel      
P  2 3 ? anti-parallel 
P  3 4 ? anti-parallel 
P  4 5 ? anti-parallel 
P  5 6 ? anti-parallel 
Q  1 2 ? anti-parallel 
Q  2 3 ? anti-parallel 
Q  3 4 ? anti-parallel 
R  1 2 ? anti-parallel 
R  2 3 ? anti-parallel 
R  3 4 ? anti-parallel 
R  4 5 ? parallel      
R  5 6 ? anti-parallel 
R  6 7 ? anti-parallel 
S  1 2 ? anti-parallel 
S  2 3 ? anti-parallel 
S  3 4 ? anti-parallel 
T  1 2 ? anti-parallel 
T  2 3 ? anti-parallel 
T  3 4 ? anti-parallel 
U  1 2 ? anti-parallel 
V  1 2 ? anti-parallel 
W  1 2 ? anti-parallel 
W  2 3 ? anti-parallel 
W  3 4 ? anti-parallel 
X  1 2 ? anti-parallel 
X  2 3 ? anti-parallel 
X  3 4 ? anti-parallel 
Y  1 2 ? anti-parallel 
Z  1 2 ? parallel      
Z  2 3 ? anti-parallel 
Z  3 4 ? anti-parallel 
Z  4 5 ? anti-parallel 
Z  5 6 ? anti-parallel 
AA 1 2 ? parallel      
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AC 3 4 ? parallel      
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AD 3 4 ? anti-parallel 
AE 1 2 ? anti-parallel 
AE 2 3 ? anti-parallel 
AE 3 4 ? anti-parallel 
AE 4 5 ? parallel      
AE 5 6 ? anti-parallel 
AF 1 2 ? anti-parallel 
AF 2 3 ? anti-parallel 
AF 3 4 ? anti-parallel 
AF 4 5 ? parallel      
AF 5 6 ? anti-parallel 
AF 6 7 ? anti-parallel 
AG 1 2 ? anti-parallel 
AG 2 3 ? anti-parallel 
AG 3 4 ? anti-parallel 
AG 4 5 ? anti-parallel 
AH 1 2 ? anti-parallel 
AI 1 2 ? anti-parallel 
AI 2 3 ? anti-parallel 
AI 3 4 ? anti-parallel 
AJ 1 2 ? anti-parallel 
AJ 2 3 ? anti-parallel 
AJ 3 4 ? anti-parallel 
AK 1 2 ? anti-parallel 
AL 1 2 ? anti-parallel 
AM 1 2 ? anti-parallel 
AN 1 2 ? anti-parallel 
AO 1 2 ? parallel      
AO 2 3 ? anti-parallel 
AO 3 4 ? anti-parallel 
AO 4 5 ? anti-parallel 
AO 5 6 ? anti-parallel 
AP 1 2 ? parallel      
AP 2 3 ? anti-parallel 
AP 3 4 ? anti-parallel 
AQ 1 2 ? anti-parallel 
AQ 2 3 ? anti-parallel 
AQ 3 4 ? parallel      
AR 1 2 ? anti-parallel 
AR 2 3 ? anti-parallel 
AS 1 2 ? anti-parallel 
AS 2 3 ? anti-parallel 
AS 3 4 ? parallel      
AS 4 5 ? anti-parallel 
AS 5 6 ? anti-parallel 
AT 1 2 ? parallel      
AT 2 3 ? anti-parallel 
AT 3 4 ? anti-parallel 
AT 4 5 ? anti-parallel 
AT 5 6 ? anti-parallel 
AU 1 2 ? parallel      
AU 2 3 ? anti-parallel 
AU 3 4 ? anti-parallel 
AV 1 2 ? anti-parallel 
AV 2 3 ? anti-parallel 
AW 1 2 ? anti-parallel 
AW 2 3 ? anti-parallel 
AX 1 2 ? anti-parallel 
AX 2 3 ? anti-parallel 
AY 1 2 ? parallel      
AY 2 3 ? anti-parallel 
AY 3 4 ? anti-parallel 
AY 4 5 ? anti-parallel 
AY 5 6 ? anti-parallel 
AZ 1 2 ? anti-parallel 
AZ 2 3 ? anti-parallel 
AZ 3 4 ? anti-parallel 
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BA 3 4 ? anti-parallel 
BB 1 2 ? anti-parallel 
BB 2 3 ? anti-parallel 
BC 1 2 ? anti-parallel 
BC 2 3 ? anti-parallel 
BC 3 4 ? anti-parallel 
BD 1 2 ? anti-parallel 
BD 2 3 ? anti-parallel 
BD 3 4 ? anti-parallel 
BD 4 5 ? anti-parallel 
BE 1 2 ? anti-parallel 
BE 2 3 ? anti-parallel 
BE 3 4 ? anti-parallel 
BF 1 2 ? anti-parallel 
BF 2 3 ? anti-parallel 
BG 1 2 ? anti-parallel 
BH 1 2 ? parallel      
BH 2 3 ? anti-parallel 
BH 3 4 ? anti-parallel 
BH 4 5 ? anti-parallel 
BI 1 2 ? anti-parallel 
BI 2 3 ? anti-parallel 
BI 3 4 ? anti-parallel 
BJ 1 2 ? anti-parallel 
BJ 2 3 ? anti-parallel 
BK 1 2 ? anti-parallel 
BK 2 3 ? anti-parallel 
BL 1 2 ? anti-parallel 
BL 2 3 ? anti-parallel 
BL 3 4 ? anti-parallel 
BM 1 2 ? parallel      
BM 2 3 ? anti-parallel 
BM 3 4 ? anti-parallel 
BM 4 5 ? anti-parallel 
BN 1 2 ? anti-parallel 
BN 2 3 ? anti-parallel 
BN 3 4 ? anti-parallel 
BO 1 2 ? anti-parallel 
BP 1 2 ? anti-parallel 
BP 2 3 ? anti-parallel 
BP 3 4 ? anti-parallel 
BQ 1 2 ? parallel      
BQ 2 3 ? anti-parallel 
BQ 3 4 ? anti-parallel 
BQ 4 5 ? anti-parallel 
BQ 5 6 ? anti-parallel 
BR 1 2 ? anti-parallel 
BR 2 3 ? anti-parallel 
BR 3 4 ? anti-parallel 
BS 1 2 ? anti-parallel 
BS 2 3 ? anti-parallel 
BT 1 2 ? parallel      
BT 2 3 ? anti-parallel 
BT 3 4 ? anti-parallel 
BT 4 5 ? anti-parallel 
BT 5 6 ? anti-parallel 
BU 1 2 ? anti-parallel 
BU 2 3 ? anti-parallel 
BV 1 2 ? anti-parallel 
BV 2 3 ? anti-parallel 
BV 3 4 ? anti-parallel 
BW 1 2 ? anti-parallel 
BW 2 3 ? anti-parallel 
BW 3 4 ? anti-parallel 
BX 1 2 ? anti-parallel 
BX 2 3 ? anti-parallel 
BY 1 2 ? parallel      
BY 2 3 ? anti-parallel 
BY 3 4 ? anti-parallel 
BY 4 5 ? anti-parallel 
BY 5 6 ? anti-parallel 
BZ 1 2 ? anti-parallel 
BZ 2 3 ? anti-parallel 
BZ 3 4 ? anti-parallel 
CA 1 2 ? anti-parallel 
CB 1 2 ? anti-parallel 
CC 1 2 ? parallel      
CC 2 3 ? anti-parallel 
CC 3 4 ? anti-parallel 
CC 4 5 ? anti-parallel 
CC 5 6 ? anti-parallel 
CD 1 2 ? anti-parallel 
CD 2 3 ? anti-parallel 
CE 1 2 ? anti-parallel 
CE 2 3 ? anti-parallel 
CE 3 4 ? anti-parallel 
CF 1 2 ? anti-parallel 
CF 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 MET A 4   ? THR A 5   ? MET A 4   THR A 5   
A  2 ARG A 17  ? ALA A 24  ? ARG A 18  ALA A 25  
A  3 ASP A 69  ? ILE A 74  ? ASP A 70  ILE A 75  
A  4 PHE A 61  ? SER A 64  ? PHE A 62  SER A 65  
B  1 MET A 4   ? THR A 5   ? MET A 4   THR A 5   
B  2 ARG A 17  ? ALA A 24  ? ARG A 18  ALA A 25  
B  3 ALA M 152 ? LEU M 153 ? ALA M 153 LEU M 154 
C  1 SER A 11  ? ALA A 12  ? SER A 12  ALA A 13  
C  2 GLU A 104 ? ILE A 105 ? GLU A 105 ILE A 106 
D  1 SER A 52  ? LEU A 53  ? SER A 53  LEU A 54  
D  2 LYS A 44  ? TYR A 48  ? LYS A 45  TYR A 49  
D  3 LEU A 32  ? GLN A 37  ? LEU A 33  GLN A 38  
D  4 THR A 84  ? GLN A 89  ? THR A 85  GLN A 90  
D  5 THR A 96  ? PHE A 97  ? THR A 97  PHE A 98  
E  1 SER A 52  ? LEU A 53  ? SER A 53  LEU A 54  
E  2 LYS A 44  ? TYR A 48  ? LYS A 45  TYR A 49  
E  3 LEU A 32  ? GLN A 37  ? LEU A 33  GLN A 38  
E  4 THR A 84  ? GLN A 89  ? THR A 85  GLN A 90  
E  5 THR A 101 ? LYS A 102 ? THR A 102 LYS A 103 
F  1 SER A 113 ? PHE A 117 ? SER A 114 PHE A 118 
F  2 THR A 128 ? PHE A 138 ? THR A 129 PHE A 139 
F  3 TYR A 172 ? SER A 181 ? TYR A 173 SER A 182 
F  4 SER A 158 ? GLN A 159 ? SER A 159 GLN A 160 
G  1 ALA A 152 ? LEU A 153 ? ALA A 153 LEU A 154 
G  2 LYS A 144 ? VAL A 149 ? LYS A 145 VAL A 150 
G  3 TYR A 191 ? HIS A 197 ? TYR A 192 HIS A 198 
G  4 LEU A 200 ? LYS A 206 ? LEU A 201 LYS A 207 
H  1 LEU B 4   ? GLN B 6   ? LEU B 4   GLN B 6   
H  2 CYS B 22  ? ALA B 24  ? CYS B 22  ALA B 24  
I  1 GLU B 10  ? LYS B 12  ? GLU B 10  LYS B 12  
I  2 THR B 124 ? VAL B 127 ? THR B 108 VAL B 111 
I  3 ALA B 92  ? ALA B 97  ? ALA B 88  ALA B 93  
I  4 SER B 35  ? GLN B 39  ? SER B 35  GLN B 39  
I  5 GLU B 46  ? ILE B 51  ? GLU B 46  ILE B 51  
I  6 ALA B 58  ? TYR B 60  ? ALA B 57  TYR B 59  
J  1 LYS B 19  ? VAL B 20  ? LYS B 19  VAL B 20  
J  2 THR B 78  ? LEU B 83  ? THR B 77  LEU B 82  
J  3 VAL B 68  ? ASP B 73  ? VAL B 67  ASP B 72  
K  1 SER B 136 ? PRO B 139 ? SER B 120 PRO B 123 
K  2 THR B 151 ? TYR B 161 ? THR B 135 TYR B 145 
K  3 TYR B 192 ? PRO B 201 ? TYR B 176 PRO B 185 
K  4 VAL B 179 ? THR B 181 ? VAL B 163 THR B 165 
L  1 THR B 147 ? SER B 148 ? THR B 131 SER B 132 
L  2 THR B 151 ? TYR B 161 ? THR B 135 TYR B 145 
L  3 TYR B 192 ? PRO B 201 ? TYR B 176 PRO B 185 
L  4 VAL B 185 ? LEU B 186 ? VAL B 169 LEU B 170 
M  1 THR B 167 ? TRP B 170 ? THR B 151 TRP B 154 
M  2 CYS B 212 ? ASN B 215 ? CYS B 196 ASN B 199 
N  1 THR C 5   ? GLN C 6   ? THR C 5   GLN C 6   
N  2 ARG C 17  ? ARG C 23  ? ARG C 18  ARG C 24  
N  3 ASP C 69  ? ILE C 74  ? ASP C 70  ILE C 75  
N  4 GLY C 63  ? SER C 64  ? GLY C 64  SER C 65  
O  1 THR C 5   ? GLN C 6   ? THR C 5   GLN C 6   
O  2 ARG C 17  ? ARG C 23  ? ARG C 18  ARG C 24  
O  3 ALA O 152 ? SER O 155 ? ALA O 153 SER O 156 
O  4 LYS O 144 ? VAL O 149 ? LYS O 145 VAL O 150 
O  5 CYS O 193 ? THR O 196 ? CYS O 194 THR O 197 
P  1 SER C 9   ? ALA C 12  ? SER C 10  ALA C 13  
P  2 THR C 101 ? ILE C 105 ? THR C 102 ILE C 106 
P  3 THR C 84  ? GLN C 89  ? THR C 85  GLN C 90  
P  4 LEU C 32  ? GLN C 37  ? LEU C 33  GLN C 38  
P  5 LYS C 44  ? TYR C 48  ? LYS C 45  TYR C 49  
P  6 SER C 52  ? LEU C 53  ? SER C 53  LEU C 54  
Q  1 VAL C 114 ? PHE C 117 ? VAL C 115 PHE C 118 
Q  2 THR C 128 ? PHE C 138 ? THR C 129 PHE C 139 
Q  3 TYR C 172 ? SER C 181 ? TYR C 173 SER C 182 
Q  4 SER C 158 ? VAL C 162 ? SER C 159 VAL C 163 
R  1 VAL C 204 ? ASN C 209 ? VAL C 205 ASN C 210 
R  2 VAL C 190 ? VAL C 195 ? VAL C 191 VAL C 196 
R  3 VAL C 145 ? VAL C 149 ? VAL C 146 VAL C 150 
R  4 ALA C 152 ? LEU C 153 ? ALA C 153 LEU C 154 
R  5 ARG O 17  ? ARG O 23  ? ARG O 18  ARG O 24  
R  6 ASP O 69  ? ILE O 74  ? ASP O 70  ILE O 75  
R  7 PHE O 61  ? SER O 66  ? PHE O 62  SER O 67  
S  1 LEU D 4   ? GLN D 6   ? LEU D 4   GLN D 6   
S  2 LYS D 19  ? ALA D 24  ? LYS D 19  ALA D 24  
S  3 THR D 78  ? LEU D 83  ? THR D 77  LEU D 82  
S  4 VAL D 68  ? ALA D 72  ? VAL D 67  ALA D 71  
T  1 LEU D 45  ? TRP D 47  ? LEU D 45  TRP D 47  
T  2 VAL D 37  ? GLN D 39  ? VAL D 37  GLN D 39  
T  3 ALA D 92  ? TYR D 94  ? ALA D 88  TYR D 90  
T  4 THR D 123 ? VAL D 125 ? THR D 107 VAL D 109 
U  1 GLY D 49  ? GLY D 50  ? GLY D 49  GLY D 50  
U  2 ASN D 59  ? TYR D 60  ? ASN D 58  TYR D 59  
V  1 ALA D 97  ? LYS D 98  ? ALA D 93  LYS D 94  
V  2 VAL D 118 ? TRP D 119 ? VAL D 102 TRP D 103 
W  1 SER D 136 ? PHE D 138 ? SER D 120 PHE D 122 
W  2 THR D 151 ? TYR D 161 ? THR D 135 TYR D 145 
W  3 TYR D 192 ? PRO D 201 ? TYR D 176 PRO D 185 
W  4 VAL D 179 ? THR D 181 ? VAL D 163 THR D 165 
X  1 SER D 136 ? PHE D 138 ? SER D 120 PHE D 122 
X  2 THR D 151 ? TYR D 161 ? THR D 135 TYR D 145 
X  3 TYR D 192 ? PRO D 201 ? TYR D 176 PRO D 185 
X  4 VAL D 185 ? LEU D 186 ? VAL D 169 LEU D 170 
Y  1 ILE D 211 ? HIS D 216 ? ILE D 195 HIS D 200 
Y  2 THR D 221 ? LYS D 226 ? THR D 205 LYS D 210 
Z  1 LEU E 10  ? ALA E 12  ? LEU E 11  ALA E 13  
Z  2 THR E 101 ? ILE E 105 ? THR E 102 ILE E 106 
Z  3 THR E 84  ? GLN E 89  ? THR E 85  GLN E 90  
Z  4 LEU E 32  ? GLN E 37  ? LEU E 33  GLN E 38  
Z  5 LYS E 44  ? TYR E 48  ? LYS E 45  TYR E 49  
Z  6 SER E 52  ? LEU E 53  ? SER E 53  LEU E 54  
AA 1 LEU E 10  ? ALA E 12  ? LEU E 11  ALA E 13  
AA 2 THR E 101 ? ILE E 105 ? THR E 102 ILE E 106 
AA 3 THR E 84  ? GLN E 89  ? THR E 85  GLN E 90  
AA 4 THR E 96  ? PHE E 97  ? THR E 97  PHE E 98  
AB 1 PHE E 61  ? SER E 62  ? PHE E 62  SER E 63  
AB 2 ASP E 69  ? ILE E 74  ? ASP E 70  ILE E 75  
AB 3 GLY E 65  ? SER E 66  ? GLY E 66  SER E 67  
AC 1 PHE E 61  ? SER E 62  ? PHE E 62  SER E 63  
AC 2 ASP E 69  ? ILE E 74  ? ASP E 70  ILE E 75  
AC 3 VAL E 18  ? ARG E 23  ? VAL E 19  ARG E 24  
AC 4 LEU I 153 ? SER I 155 ? LEU I 154 SER I 156 
AD 1 SER E 113 ? PHE E 117 ? SER E 114 PHE E 118 
AD 2 THR E 128 ? PHE E 138 ? THR E 129 PHE E 139 
AD 3 TYR E 172 ? SER E 181 ? TYR E 173 SER E 182 
AD 4 SER E 158 ? THR E 163 ? SER E 159 THR E 164 
AE 1 VAL E 204 ? ASN E 209 ? VAL E 205 ASN E 210 
AE 2 VAL E 190 ? HIS E 197 ? VAL E 191 HIS E 198 
AE 3 ALA E 143 ? VAL E 149 ? ALA E 144 VAL E 150 
AE 4 ALA E 152 ? SER E 155 ? ALA E 153 SER E 156 
AE 5 VAL I 18  ? ALA I 24  ? VAL I 19  ALA I 25  
AE 6 MET I 4   ? GLN I 6   ? MET I 4   GLN I 6   
AF 1 VAL E 204 ? ASN E 209 ? VAL E 205 ASN E 210 
AF 2 VAL E 190 ? HIS E 197 ? VAL E 191 HIS E 198 
AF 3 ALA E 143 ? VAL E 149 ? ALA E 144 VAL E 150 
AF 4 ALA E 152 ? SER E 155 ? ALA E 153 SER E 156 
AF 5 VAL I 18  ? ALA I 24  ? VAL I 19  ALA I 25  
AF 6 ASP I 69  ? ILE I 74  ? ASP I 70  ILE I 75  
AF 7 SER I 64  ? SER I 66  ? SER I 65  SER I 67  
AG 1 ASN F 59  ? TYR F 60  ? ASN F 58  TYR F 59  
AG 2 GLU F 46  ? ILE F 51  ? GLU F 46  ILE F 51  
AG 3 ILE F 34  ? ARG F 38  ? ILE F 34  ARG F 38  
AG 4 TYR F 94  ? LYS F 98  ? TYR F 90  LYS F 94  
AG 5 VAL F 118 ? TRP F 119 ? VAL F 102 TRP F 103 
AH 1 VAL F 68  ? THR F 71  ? VAL F 67  THR F 70  
AH 2 TYR F 80  ? LEU F 83  ? TYR F 79  LEU F 82  
AI 1 SER F 136 ? LEU F 140 ? SER F 120 LEU F 124 
AI 2 GLY F 155 ? TYR F 161 ? GLY F 139 TYR F 145 
AI 3 TYR F 192 ? VAL F 197 ? TYR F 176 VAL F 181 
AI 4 HIS F 180 ? THR F 181 ? HIS F 164 THR F 165 
AJ 1 SER F 136 ? LEU F 140 ? SER F 120 LEU F 124 
AJ 2 GLY F 155 ? TYR F 161 ? GLY F 139 TYR F 145 
AJ 3 TYR F 192 ? VAL F 197 ? TYR F 176 VAL F 181 
AJ 4 VAL F 185 ? LEU F 186 ? VAL F 169 LEU F 170 
AK 1 THR F 151 ? ALA F 152 ? THR F 135 ALA F 136 
AK 2 VAL F 200 ? PRO F 201 ? VAL F 184 PRO F 185 
AL 1 VAL F 166 ? THR F 167 ? VAL F 150 THR F 151 
AL 2 ASN F 215 ? HIS F 216 ? ASN F 199 HIS F 200 
AM 1 ILE F 211 ? CYS F 212 ? ILE F 195 CYS F 196 
AM 2 LYS F 225 ? LYS F 226 ? LYS F 209 LYS F 210 
AN 1 MET G 4   ? THR G 5   ? MET G 4   THR G 5   
AN 2 ARG G 23  ? ALA G 24  ? ARG G 24  ALA G 25  
AO 1 LEU G 10  ? ALA G 12  ? LEU G 11  ALA G 13  
AO 2 THR G 101 ? ILE G 105 ? THR G 102 ILE G 106 
AO 3 THR G 84  ? GLN G 89  ? THR G 85  GLN G 90  
AO 4 LEU G 32  ? GLN G 37  ? LEU G 33  GLN G 38  
AO 5 LYS G 44  ? TYR G 48  ? LYS G 45  TYR G 49  
AO 6 SER G 52  ? LEU G 53  ? SER G 53  LEU G 54  
AP 1 LEU G 10  ? ALA G 12  ? LEU G 11  ALA G 13  
AP 2 THR G 101 ? ILE G 105 ? THR G 102 ILE G 106 
AP 3 THR G 84  ? GLN G 89  ? THR G 85  GLN G 90  
AP 4 THR G 96  ? PHE G 97  ? THR G 97  PHE G 98  
AQ 1 SER G 62  ? GLY G 65  ? SER G 63  GLY G 66  
AQ 2 PHE G 70  ? ILE G 74  ? PHE G 71  ILE G 75  
AQ 3 ARG G 17  ? THR G 21  ? ARG G 18  THR G 22  
AQ 4 ALA K 152 ? LEU K 153 ? ALA K 153 LEU K 154 
AR 1 THR G 128 ? LEU G 134 ? THR G 129 LEU G 135 
AR 2 LEU G 174 ? SER G 181 ? LEU G 175 SER G 182 
AR 3 SER G 158 ? VAL G 162 ? SER G 159 VAL G 163 
AS 1 TYR G 191 ? VAL G 195 ? TYR G 192 VAL G 196 
AS 2 VAL G 145 ? VAL G 149 ? VAL G 146 VAL G 150 
AS 3 ALA G 152 ? SER G 155 ? ALA G 153 SER G 156 
AS 4 ARG K 17  ? ILE K 20  ? ARG K 18  ILE K 21  
AS 5 THR K 71  ? ILE K 74  ? THR K 72  ILE K 75  
AS 6 PHE K 61  ? SER K 64  ? PHE K 62  SER K 65  
AT 1 GLU H 10  ? VAL H 11  ? GLU H 10  VAL H 11  
AT 2 THR H 124 ? THR H 126 ? THR H 108 THR H 110 
AT 3 ALA H 92  ? LYS H 98  ? ALA H 88  LYS H 94  
AT 4 ILE H 34  ? GLN H 39  ? ILE H 34  GLN H 39  
AT 5 LEU H 45  ? ILE H 51  ? LEU H 45  ILE H 51  
AT 6 ASN H 59  ? TYR H 60  ? ASN H 58  TYR H 59  
AU 1 GLU H 10  ? VAL H 11  ? GLU H 10  VAL H 11  
AU 2 THR H 124 ? THR H 126 ? THR H 108 THR H 110 
AU 3 ALA H 92  ? LYS H 98  ? ALA H 88  LYS H 94  
AU 4 VAL H 118 ? TRP H 119 ? VAL H 102 TRP H 103 
AV 1 VAL H 18  ? LYS H 19  ? VAL H 18  LYS H 19  
AV 2 THR H 78  ? LEU H 83  ? THR H 77  LEU H 82  
AV 3 CYS H 22  ? LYS H 23  ? CYS H 22  LYS H 23  
AW 1 VAL H 18  ? LYS H 19  ? VAL H 18  LYS H 19  
AW 2 THR H 78  ? LEU H 83  ? THR H 77  LEU H 82  
AW 3 VAL H 68  ? ASP H 73  ? VAL H 67  ASP H 72  
AX 1 THR H 151 ? ALA H 153 ? THR H 135 ALA H 137 
AX 2 SER H 196 ? PRO H 201 ? SER H 180 PRO H 185 
AX 3 VAL H 179 ? THR H 181 ? VAL H 163 THR H 165 
AY 1 LEU I 10  ? ALA I 12  ? LEU I 11  ALA I 13  
AY 2 THR I 101 ? ILE I 105 ? THR I 102 ILE I 106 
AY 3 THR I 84  ? GLN I 89  ? THR I 85  GLN I 90  
AY 4 LEU I 32  ? LYS I 38  ? LEU I 33  LYS I 39  
AY 5 LYS I 41  ? TYR I 48  ? LYS I 42  TYR I 49  
AY 6 SER I 52  ? LEU I 53  ? SER I 53  LEU I 54  
AZ 1 SER I 113 ? VAL I 114 ? SER I 114 VAL I 115 
AZ 2 LEU I 135 ? PHE I 138 ? LEU I 136 PHE I 139 
AZ 3 TYR I 172 ? SER I 181 ? TYR I 173 SER I 182 
AZ 4 THR I 128 ? VAL I 132 ? THR I 129 VAL I 133 
BA 1 SER I 113 ? VAL I 114 ? SER I 114 VAL I 115 
BA 2 LEU I 135 ? PHE I 138 ? LEU I 136 PHE I 139 
BA 3 TYR I 172 ? SER I 181 ? TYR I 173 SER I 182 
BA 4 GLU I 160 ? VAL I 162 ? GLU I 161 VAL I 163 
BB 1 GLN I 146 ? VAL I 149 ? GLN I 147 VAL I 150 
BB 2 VAL I 190 ? GLU I 194 ? VAL I 191 GLU I 195 
BB 3 PHE I 208 ? ASN I 209 ? PHE I 209 ASN I 210 
BC 1 LEU J 5   ? GLN J 6   ? LEU J 5   GLN J 6   
BC 2 LYS J 19  ? LYS J 23  ? LYS J 19  LYS J 23  
BC 3 THR J 79  ? GLU J 82  ? THR J 78  GLU J 81  
BC 4 ILE J 70  ? THR J 71  ? ILE J 69  THR J 70  
BD 1 ASN J 59  ? TYR J 60  ? ASN J 58  TYR J 59  
BD 2 LEU J 45  ? ILE J 51  ? LEU J 45  ILE J 51  
BD 3 ILE J 34  ? GLN J 39  ? ILE J 34  GLN J 39  
BD 4 VAL J 93  ? LYS J 98  ? VAL J 89  LYS J 94  
BD 5 VAL J 118 ? TRP J 119 ? VAL J 102 TRP J 103 
BE 1 SER J 136 ? LEU J 140 ? SER J 120 LEU J 124 
BE 2 THR J 151 ? TYR J 161 ? THR J 135 TYR J 145 
BE 3 TYR J 192 ? PRO J 201 ? TYR J 176 PRO J 185 
BE 4 VAL J 179 ? THR J 181 ? VAL J 163 THR J 165 
BF 1 SER J 169 ? TRP J 170 ? SER J 153 TRP J 154 
BF 2 TYR J 210 ? ASN J 213 ? TYR J 194 ASN J 197 
BF 3 LYS J 226 ? VAL J 227 ? LYS J 210 VAL J 211 
BG 1 MET K 4   ? THR K 5   ? MET K 4   THR K 5   
BG 2 ARG K 23  ? ALA K 24  ? ARG K 24  ALA K 25  
BH 1 SER K 9   ? ALA K 12  ? SER K 10  ALA K 13  
BH 2 THR K 101 ? ILE K 105 ? THR K 102 ILE K 106 
BH 3 THR K 84  ? GLN K 89  ? THR K 85  GLN K 90  
BH 4 LEU K 32  ? GLN K 37  ? LEU K 33  GLN K 38  
BH 5 LYS K 44  ? ILE K 47  ? LYS K 45  ILE K 48  
BI 1 PHE K 115 ? PHE K 117 ? PHE K 116 PHE K 118 
BI 2 ALA K 129 ? LEU K 134 ? ALA K 130 LEU K 135 
BI 3 LEU K 174 ? LEU K 180 ? LEU K 175 LEU K 181 
BI 4 SER K 158 ? VAL K 162 ? SER K 159 VAL K 163 
BJ 1 ALA K 143 ? LYS K 144 ? ALA K 144 LYS K 145 
BJ 2 VAL K 195 ? HIS K 197 ? VAL K 196 HIS K 198 
BJ 3 LEU K 200 ? VAL K 204 ? LEU K 201 VAL K 205 
BK 1 TRP K 147 ? VAL K 149 ? TRP K 148 VAL K 150 
BK 2 VAL K 190 ? CYS K 193 ? VAL K 191 CYS K 194 
BK 3 SER K 207 ? ASN K 209 ? SER K 208 ASN K 210 
BL 1 LEU L 5   ? GLN L 6   ? LEU L 5   GLN L 6   
BL 2 SER L 17  ? LYS L 23  ? SER L 17  LYS L 23  
BL 3 THR L 78  ? SER L 84  A THR L 77  SER L 82  
BL 4 THR L 69  ? THR L 71  ? THR L 68  THR L 70  
BM 1 GLU L 10  ? LYS L 12  ? GLU L 10  LYS L 12  
BM 2 THR L 123 ? VAL L 127 ? THR L 107 VAL L 111 
BM 3 ALA L 92  ? LYS L 98  ? ALA L 88  LYS L 94  
BM 4 ILE L 34  ? GLN L 39  ? ILE L 34  GLN L 39  
BM 5 LEU L 45  ? ILE L 51  ? LEU L 45  ILE L 51  
BN 1 SER L 136 ? LEU L 140 ? SER L 120 LEU L 124 
BN 2 THR L 151 ? TYR L 161 ? THR L 135 TYR L 145 
BN 3 TYR L 192 ? PRO L 201 ? TYR L 176 PRO L 185 
BN 4 VAL L 179 ? THR L 181 ? VAL L 163 THR L 165 
BO 1 ILE L 211 ? ASN L 215 ? ILE L 195 ASN L 199 
BO 2 LYS L 222 ? LYS L 226 ? LYS L 206 LYS L 210 
BP 1 MET M 4   ? THR M 5   ? MET M 4   THR M 5   
BP 2 ILE M 20  ? ALA M 24  ? ILE M 21  ALA M 25  
BP 3 ASP M 69  ? ILE M 74  ? ASP M 70  ILE M 75  
BP 4 PHE M 61  ? SER M 62  ? PHE M 62  SER M 63  
BQ 1 SER M 9   ? ALA M 12  ? SER M 10  ALA M 13  
BQ 2 THR M 101 ? ILE M 105 ? THR M 102 ILE M 106 
BQ 3 THR M 84  ? GLN M 89  ? THR M 85  GLN M 90  
BQ 4 LEU M 32  ? GLN M 37  ? LEU M 33  GLN M 38  
BQ 5 LYS M 44  ? TYR M 48  ? LYS M 45  TYR M 49  
BQ 6 SER M 52  ? LEU M 53  ? SER M 53  LEU M 54  
BR 1 SER M 113 ? PHE M 117 ? SER M 114 PHE M 118 
BR 2 ALA M 129 ? ASN M 136 ? ALA M 130 ASN M 137 
BR 3 LEU M 174 ? LEU M 180 ? LEU M 175 LEU M 181 
BR 4 SER M 161 ? VAL M 162 ? SER M 162 VAL M 163 
BS 1 LYS M 144 ? VAL M 149 ? LYS M 145 VAL M 150 
BS 2 VAL M 190 ? HIS M 197 ? VAL M 191 HIS M 198 
BS 3 LEU M 200 ? ASN M 209 ? LEU M 201 ASN M 210 
BT 1 GLU N 10  ? LYS N 12  ? GLU N 10  LYS N 12  
BT 2 THR N 123 ? VAL N 127 ? THR N 107 VAL N 111 
BT 3 ALA N 92  ? ALA N 97  ? ALA N 88  ALA N 93  
BT 4 ILE N 34  ? GLN N 39  ? ILE N 34  GLN N 39  
BT 5 LEU N 45  ? ILE N 51  ? LEU N 45  ILE N 51  
BT 6 ALA N 58  ? TYR N 60  ? ALA N 57  TYR N 59  
BU 1 VAL N 18  ? VAL N 20  ? VAL N 18  VAL N 20  
BU 2 MET N 81  ? LEU N 83  ? MET N 80  LEU N 82  
BU 3 VAL N 68  ? ILE N 70  ? VAL N 67  ILE N 69  
BV 1 SER N 136 ? LEU N 140 ? SER N 120 LEU N 124 
BV 2 THR N 151 ? TYR N 161 ? THR N 135 TYR N 145 
BV 3 SER N 196 ? PRO N 201 ? SER N 180 PRO N 185 
BV 4 VAL N 179 ? THR N 181 ? VAL N 163 THR N 165 
BW 1 THR N 147 ? SER N 148 ? THR N 131 SER N 132 
BW 2 THR N 151 ? TYR N 161 ? THR N 135 TYR N 145 
BW 3 TYR N 192 ? LEU N 194 ? TYR N 176 LEU N 178 
BW 4 VAL N 185 ? LEU N 186 ? VAL N 169 LEU N 170 
BX 1 THR N 167 ? TRP N 170 ? THR N 151 TRP N 154 
BX 2 ILE N 211 ? HIS N 216 ? ILE N 195 HIS N 200 
BX 3 THR N 221 ? LYS N 226 ? THR N 205 LYS N 210 
BY 1 SER O 9   ? ALA O 12  ? SER O 10  ALA O 13  
BY 2 THR O 101 ? ILE O 105 ? THR O 102 ILE O 106 
BY 3 THR O 84  ? GLN O 89  ? THR O 85  GLN O 90  
BY 4 LEU O 32  ? GLN O 36  ? LEU O 33  GLN O 37  
BY 5 LYS O 44  ? TYR O 48  ? LYS O 45  TYR O 49  
BY 6 SER O 52  ? LEU O 53  ? SER O 53  LEU O 54  
BZ 1 SER O 113 ? PHE O 117 ? SER O 114 PHE O 118 
BZ 2 VAL O 132 ? PHE O 138 ? VAL O 133 PHE O 139 
BZ 3 TYR O 172 ? LEU O 178 ? TYR O 173 LEU O 179 
BZ 4 SER O 158 ? VAL O 162 ? SER O 159 VAL O 163 
CA 1 VAL O 190 ? TYR O 191 ? VAL O 191 TYR O 192 
CA 2 PHE O 208 ? ASN O 209 ? PHE O 209 ASN O 210 
CB 1 LEU P 4   ? GLN P 6   ? LEU P 4   GLN P 6   
CB 2 CYS P 22  ? ALA P 24  ? CYS P 22  ALA P 24  
CC 1 GLU P 10  ? LYS P 12  ? GLU P 10  LYS P 12  
CC 2 THR P 123 ? VAL P 127 ? THR P 107 VAL P 111 
CC 3 ALA P 92  ? ALA P 97  ? ALA P 88  ALA P 93  
CC 4 ILE P 34  ? ARG P 38  ? ILE P 34  ARG P 38  
CC 5 GLU P 46  ? ILE P 51  ? GLU P 46  ILE P 51  
CC 6 ASN P 59  ? TYR P 60  ? ASN P 58  TYR P 59  
CD 1 LYS P 19  ? VAL P 20  ? LYS P 19  VAL P 20  
CD 2 THR P 78  ? LEU P 83  ? THR P 77  LEU P 82  
CD 3 VAL P 68  ? ASP P 73  ? VAL P 67  ASP P 72  
CE 1 SER P 136 ? PRO P 139 ? SER P 120 PRO P 123 
CE 2 THR P 151 ? TYR P 161 ? THR P 135 TYR P 145 
CE 3 TYR P 192 ? PRO P 201 ? TYR P 176 PRO P 185 
CE 4 VAL P 179 ? THR P 181 ? VAL P 163 THR P 165 
CF 1 THR P 167 ? TRP P 170 ? THR P 151 TRP P 154 
CF 2 TYR P 210 ? HIS P 216 ? TYR P 194 HIS P 200 
CF 3 THR P 221 ? VAL P 227 ? THR P 205 VAL P 211 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 N THR A 5   ? N THR A 5   O ARG A 23  ? O ARG A 24  
A  2 3 N CYS A 22  ? N CYS A 23  O PHE A 70  ? O PHE A 71  
A  3 4 O THR A 73  ? O THR A 74  N SER A 62  ? N SER A 63  
B  1 2 N THR A 5   ? N THR A 5   O ARG A 23  ? O ARG A 24  
B  2 3 N ARG A 17  ? N ARG A 18  O LEU M 153 ? O LEU M 154 
C  1 2 N ALA A 12  ? N ALA A 13  O GLU A 104 ? O GLU A 105 
D  1 2 O SER A 52  ? O SER A 53  N TYR A 48  ? N TYR A 49  
D  2 3 O LYS A 44  ? O LYS A 45  N GLN A 36  ? N GLN A 37  
D  3 4 N ASN A 33  ? N ASN A 34  O GLN A 88  ? O GLN A 89  
D  4 5 N GLN A 89  ? N GLN A 90  O THR A 96  ? O THR A 97  
E  1 2 O SER A 52  ? O SER A 53  N TYR A 48  ? N TYR A 49  
E  2 3 O LYS A 44  ? O LYS A 45  N GLN A 36  ? N GLN A 37  
E  3 4 N ASN A 33  ? N ASN A 34  O GLN A 88  ? O GLN A 89  
E  4 5 N TYR A 85  ? N TYR A 86  O THR A 101 ? O THR A 102 
F  1 2 N PHE A 117 ? N PHE A 118 O VAL A 132 ? O VAL A 133 
F  2 3 N VAL A 131 ? N VAL A 132 O LEU A 178 ? O LEU A 179 
F  3 4 O THR A 177 ? O THR A 178 N GLN A 159 ? N GLN A 160 
G  1 2 O ALA A 152 ? O ALA A 153 N VAL A 149 ? N VAL A 150 
G  2 3 N GLN A 146 ? N GLN A 147 O GLU A 194 ? O GLU A 195 
G  3 4 N HIS A 197 ? N HIS A 198 O LEU A 200 ? O LEU A 201 
H  1 2 N LEU B 5   ? N LEU B 5   O LYS B 23  ? O LYS B 23  
I  1 2 N GLU B 10  ? N GLU B 10  O THR B 126 ? O THR B 110 
I  2 3 O VAL B 125 ? O VAL B 109 N ALA B 92  ? N ALA B 88  
I  3 4 O PHE B 95  ? O PHE B 91  N VAL B 37  ? N VAL B 37  
I  4 5 N TRP B 36  ? N TRP B 36  O MET B 48  ? O MET B 48  
I  5 6 N GLY B 50  ? N GLY B 50  O ASN B 59  ? O ASN B 58  
J  1 2 N VAL B 20  ? N VAL B 20  O MET B 81  ? O MET B 80  
J  2 3 O TYR B 80  ? O TYR B 79  N THR B 71  ? N THR B 70  
K  1 2 N SER B 136 ? N SER B 120 O LYS B 159 ? O LYS B 143 
K  2 3 N CYS B 156 ? N CYS B 140 O SER B 196 ? O SER B 180 
K  3 4 O VAL B 197 ? O VAL B 181 N HIS B 180 ? N HIS B 164 
L  1 2 N SER B 148 ? N SER B 132 O THR B 151 ? O THR B 135 
L  2 3 N CYS B 156 ? N CYS B 140 O SER B 196 ? O SER B 180 
L  3 4 O SER B 193 ? O SER B 177 N VAL B 185 ? N VAL B 169 
M  1 2 N SER B 169 ? N SER B 153 O ASN B 213 ? O ASN B 197 
N  1 2 N THR C 5   ? N THR C 5   O ARG C 23  ? O ARG C 24  
N  2 3 N ILE C 20  ? N ILE C 21  O LEU C 72  ? O LEU C 73  
N  3 4 O THR C 71  ? O THR C 72  N SER C 64  ? N SER C 65  
O  1 2 N THR C 5   ? N THR C 5   O ARG C 23  ? O ARG C 24  
O  2 3 N ARG C 17  ? N ARG C 18  O LEU O 153 ? O LEU O 154 
O  3 4 O ALA O 152 ? O ALA O 153 N VAL O 149 ? N VAL O 150 
O  4 5 N GLN O 146 ? N GLN O 147 O GLU O 194 ? O GLU O 195 
P  1 2 N ALA C 12  ? N ALA C 13  O GLU C 104 ? O GLU C 105 
P  2 3 O THR C 101 ? O THR C 102 N TYR C 85  ? N TYR C 86  
P  3 4 O GLN C 88  ? O GLN C 89  N ASN C 33  ? N ASN C 34  
P  4 5 N GLN C 36  ? N GLN C 37  O LYS C 44  ? O LYS C 45  
P  5 6 N TYR C 48  ? N TYR C 49  O SER C 52  ? O SER C 53  
Q  1 2 N PHE C 117 ? N PHE C 118 O VAL C 132 ? O VAL C 133 
Q  2 3 N ALA C 129 ? N ALA C 130 O LEU C 180 ? O LEU C 181 
Q  3 4 O SER C 175 ? O SER C 176 N SER C 161 ? N SER C 162 
R  1 2 O LYS C 206 ? O LYS C 207 N CYS C 193 ? N CYS C 194 
R  2 3 O GLU C 194 ? O GLU C 195 N GLN C 146 ? N GLN C 147 
R  3 4 N VAL C 149 ? N VAL C 150 O ALA C 152 ? O ALA C 153 
R  4 5 N LEU C 153 ? N LEU C 154 O ARG O 17  ? O ARG O 18  
R  5 6 N VAL O 18  ? N VAL O 19  O ILE O 74  ? O ILE O 75  
R  6 7 O THR O 73  ? O THR O 74  N SER O 62  ? N SER O 63  
S  1 2 N LEU D 5   ? N LEU D 5   O LYS D 23  ? O LYS D 23  
S  2 3 N VAL D 20  ? N VAL D 20  O MET D 81  ? O MET D 80  
S  3 4 O GLU D 82  ? O GLU D 81  N THR D 69  ? N THR D 68  
T  1 2 O GLU D 46  ? O GLU D 46  N ARG D 38  ? N ARG D 38  
T  2 3 N GLN D 39  ? N GLN D 39  O VAL D 93  ? O VAL D 89  
T  3 4 N TYR D 94  ? N TYR D 90  O THR D 123 ? O THR D 107 
U  1 2 N GLY D 50  ? N GLY D 50  O ASN D 59  ? O ASN D 58  
V  1 2 N LYS D 98  ? N LYS D 94  O VAL D 118 ? O VAL D 102 
W  1 2 N PHE D 138 ? N PHE D 122 O LEU D 157 ? O LEU D 141 
W  2 3 N ALA D 152 ? N ALA D 136 O VAL D 200 ? O VAL D 184 
W  3 4 O VAL D 197 ? O VAL D 181 N HIS D 180 ? N HIS D 164 
X  1 2 N PHE D 138 ? N PHE D 122 O LEU D 157 ? O LEU D 141 
X  2 3 N ALA D 152 ? N ALA D 136 O VAL D 200 ? O VAL D 184 
X  3 4 O SER D 193 ? O SER D 177 N VAL D 185 ? N VAL D 169 
Y  1 2 N HIS D 216 ? N HIS D 200 O THR D 221 ? O THR D 205 
Z  1 2 N ALA E 12  ? N ALA E 13  O GLU E 104 ? O GLU E 105 
Z  2 3 O THR E 101 ? O THR E 102 N TYR E 85  ? N TYR E 86  
Z  3 4 O GLN E 88  ? O GLN E 89  N ASN E 33  ? N ASN E 34  
Z  4 5 N TRP E 34  ? N TRP E 35  O ILE E 47  ? O ILE E 48  
Z  5 6 N TYR E 48  ? N TYR E 49  O SER E 52  ? O SER E 53  
AA 1 2 N ALA E 12  ? N ALA E 13  O GLU E 104 ? O GLU E 105 
AA 2 3 O THR E 101 ? O THR E 102 N TYR E 85  ? N TYR E 86  
AA 3 4 N GLN E 89  ? N GLN E 90  O THR E 96  ? O THR E 97  
AB 1 2 N SER E 62  ? N SER E 63  O THR E 73  ? O THR E 74  
AB 2 3 O ASP E 69  ? O ASP E 70  N SER E 66  ? N SER E 67  
AC 1 2 N SER E 62  ? N SER E 63  O THR E 73  ? O THR E 74  
AC 2 3 O ILE E 74  ? O ILE E 75  N VAL E 18  ? N VAL E 19  
AC 3 4 N THR E 19  ? N THR E 20  O LEU I 153 ? O LEU I 154 
AD 1 2 N SER E 113 ? N SER E 114 O ASN E 136 ? O ASN E 137 
AD 2 3 N ALA E 129 ? N ALA E 130 O LEU E 180 ? O LEU E 181 
AD 3 4 O THR E 177 ? O THR E 178 N GLN E 159 ? N GLN E 160 
AE 1 2 O PHE E 208 ? O PHE E 209 N TYR E 191 ? N TYR E 192 
AE 2 3 O GLU E 194 ? O GLU E 195 N GLN E 146 ? N GLN E 147 
AE 3 4 N VAL E 149 ? N VAL E 150 O ALA E 152 ? O ALA E 153 
AE 4 5 N LEU E 153 ? N LEU E 154 O THR I 19  ? O THR I 20  
AE 5 6 O ARG I 23  ? O ARG I 24  N THR I 5   ? N THR I 5   
AF 1 2 O PHE E 208 ? O PHE E 209 N TYR E 191 ? N TYR E 192 
AF 2 3 O GLU E 194 ? O GLU E 195 N GLN E 146 ? N GLN E 147 
AF 3 4 N VAL E 149 ? N VAL E 150 O ALA E 152 ? O ALA E 153 
AF 4 5 N LEU E 153 ? N LEU E 154 O THR I 19  ? O THR I 20  
AF 5 6 N VAL I 18  ? N VAL I 19  O ILE I 74  ? O ILE I 75  
AF 6 7 O THR I 71  ? O THR I 72  N SER I 64  ? N SER I 65  
AG 1 2 O ASN F 59  ? O ASN F 58  N GLY F 50  ? N GLY F 50  
AG 2 3 O MET F 48  ? O MET F 48  N TRP F 36  ? N TRP F 36  
AG 3 4 N SER F 35  ? N SER F 35  O ALA F 97  ? O ALA F 93  
AG 4 5 N LYS F 98  ? N LYS F 94  O VAL F 118 ? O VAL F 102 
AH 1 2 N THR F 69  ? N THR F 68  O GLU F 82  ? O GLU F 81  
AI 1 2 N PHE F 138 ? N PHE F 122 O LEU F 157 ? O LEU F 141 
AI 2 3 N VAL F 158 ? N VAL F 142 O LEU F 194 ? O LEU F 178 
AI 3 4 O VAL F 197 ? O VAL F 181 N HIS F 180 ? N HIS F 164 
AJ 1 2 N PHE F 138 ? N PHE F 122 O LEU F 157 ? O LEU F 141 
AJ 2 3 N VAL F 158 ? N VAL F 142 O LEU F 194 ? O LEU F 178 
AJ 3 4 O SER F 193 ? O SER F 177 N VAL F 185 ? N VAL F 169 
AK 1 2 N ALA F 152 ? N ALA F 136 O VAL F 200 ? O VAL F 184 
AL 1 2 N THR F 167 ? N THR F 151 O ASN F 215 ? O ASN F 199 
AM 1 2 N CYS F 212 ? N CYS F 196 O LYS F 225 ? O LYS F 209 
AN 1 2 N THR G 5   ? N THR G 5   O ARG G 23  ? O ARG G 24  
AO 1 2 N LEU G 10  ? N LEU G 11  O GLU G 104 ? O GLU G 105 
AO 2 3 O THR G 101 ? O THR G 102 N TYR G 85  ? N TYR G 86  
AO 3 4 O GLN G 88  ? O GLN G 89  N ASN G 33  ? N ASN G 34  
AO 4 5 N TRP G 34  ? N TRP G 35  O LEU G 46  ? O LEU G 47  
AO 5 6 N TYR G 48  ? N TYR G 49  O SER G 52  ? O SER G 53  
AP 1 2 N LEU G 10  ? N LEU G 11  O GLU G 104 ? O GLU G 105 
AP 2 3 O THR G 101 ? O THR G 102 N TYR G 85  ? N TYR G 86  
AP 3 4 N GLN G 89  ? N GLN G 90  O THR G 96  ? O THR G 97  
AQ 1 2 N SER G 64  ? N SER G 65  O THR G 71  ? O THR G 72  
AQ 2 3 O LEU G 72  ? O LEU G 73  N ILE G 20  ? N ILE G 21  
AQ 3 4 N ARG G 17  ? N ARG G 18  O LEU K 153 ? O LEU K 154 
AR 1 2 N VAL G 131 ? N VAL G 132 O LEU G 178 ? O LEU G 179 
AR 2 3 O THR G 177 ? O THR G 178 N GLN G 159 ? N GLN G 160 
AS 1 2 O ALA G 192 ? O ALA G 193 N LYS G 148 ? N LYS G 149 
AS 2 3 N VAL G 149 ? N VAL G 150 O ALA G 152 ? O ALA G 153 
AS 3 4 N SER G 155 ? N SER G 156 O THR K 19  ? O THR K 20  
AS 4 5 N ILE K 20  ? N ILE K 21  O LEU K 72  ? O LEU K 73  
AS 5 6 O THR K 73  ? O THR K 74  N SER K 62  ? N SER K 63  
AT 1 2 N GLU H 10  ? N GLU H 10  O THR H 126 ? O THR H 110 
AT 2 3 O VAL H 125 ? O VAL H 109 N ALA H 92  ? N ALA H 88  
AT 3 4 O PHE H 95  ? O PHE H 91  N VAL H 37  ? N VAL H 37  
AT 4 5 N TRP H 36  ? N TRP H 36  O GLY H 49  ? O GLY H 49  
AT 5 6 N GLY H 50  ? N GLY H 50  O ASN H 59  ? O ASN H 58  
AU 1 2 N GLU H 10  ? N GLU H 10  O THR H 126 ? O THR H 110 
AU 2 3 O VAL H 125 ? O VAL H 109 N ALA H 92  ? N ALA H 88  
AU 3 4 N LYS H 98  ? N LYS H 94  O VAL H 118 ? O VAL H 102 
AV 1 2 N VAL H 18  ? N VAL H 18  O LEU H 83  ? O LEU H 82  
AV 2 3 O THR H 79  ? O THR H 78  N CYS H 22  ? N CYS H 22  
AW 1 2 N VAL H 18  ? N VAL H 18  O LEU H 83  ? O LEU H 82  
AW 2 3 O GLU H 82  ? O GLU H 81  N THR H 69  ? N THR H 68  
AX 1 2 N ALA H 152 ? N ALA H 136 O VAL H 200 ? O VAL H 184 
AX 2 3 O VAL H 197 ? O VAL H 181 N HIS H 180 ? N HIS H 164 
AY 1 2 N LEU I 10  ? N LEU I 11  O LYS I 102 ? O LYS I 103 
AY 2 3 O THR I 101 ? O THR I 102 N TYR I 85  ? N TYR I 86  
AY 3 4 O TYR I 86  ? O TYR I 87  N TYR I 35  ? N TYR I 36  
AY 4 5 N GLN I 36  ? N GLN I 37  O LYS I 44  ? O LYS I 45  
AY 5 6 N TYR I 48  ? N TYR I 49  O SER I 52  ? O SER I 53  
AZ 1 2 N SER I 113 ? N SER I 114 O ASN I 136 ? O ASN I 137 
AZ 2 3 N PHE I 138 ? N PHE I 139 O TYR I 172 ? O TYR I 173 
AZ 3 4 O LEU I 180 ? O LEU I 181 N ALA I 129 ? N ALA I 130 
BA 1 2 N SER I 113 ? N SER I 114 O ASN I 136 ? O ASN I 137 
BA 2 3 N PHE I 138 ? N PHE I 139 O TYR I 172 ? O TYR I 173 
BA 3 4 O SER I 175 ? O SER I 176 N SER I 161 ? N SER I 162 
BB 1 2 N LYS I 148 ? N LYS I 149 O ALA I 192 ? O ALA I 193 
BB 2 3 N TYR I 191 ? N TYR I 192 O PHE I 208 ? O PHE I 209 
BC 1 2 N LEU J 5   ? N LEU J 5   O LYS J 23  ? O LYS J 23  
BC 2 3 N CYS J 22  ? N CYS J 22  O THR J 79  ? O THR J 78  
BC 3 4 O TYR J 80  ? O TYR J 79  N THR J 71  ? N THR J 70  
BD 1 2 O ASN J 59  ? O ASN J 58  N GLY J 50  ? N GLY J 50  
BD 2 3 O GLU J 46  ? O GLU J 46  N ARG J 38  ? N ARG J 38  
BD 3 4 N VAL J 37  ? N VAL J 37  O PHE J 95  ? O PHE J 91  
BD 4 5 N LYS J 98  ? N LYS J 94  O VAL J 118 ? O VAL J 102 
BE 1 2 N LEU J 140 ? N LEU J 124 O GLY J 155 ? O GLY J 139 
BE 2 3 N TYR J 161 ? N TYR J 145 O TYR J 192 ? O TYR J 176 
BE 3 4 O VAL J 197 ? O VAL J 181 N HIS J 180 ? N HIS J 164 
BF 1 2 N SER J 169 ? N SER J 153 O ASN J 213 ? O ASN J 197 
BF 2 3 N TYR J 210 ? N TYR J 194 O VAL J 227 ? O VAL J 211 
BG 1 2 N THR K 5   ? N THR K 5   O ARG K 23  ? O ARG K 24  
BH 1 2 N LEU K 10  ? N LEU K 11  O GLU K 104 ? O GLU K 105 
BH 2 3 O THR K 101 ? O THR K 102 N TYR K 85  ? N TYR K 86  
BH 3 4 O GLN K 88  ? O GLN K 89  N ASN K 33  ? N ASN K 34  
BH 4 5 N GLN K 36  ? N GLN K 37  O LYS K 44  ? O LYS K 45  
BI 1 2 N PHE K 117 ? N PHE K 118 O VAL K 132 ? O VAL K 133 
BI 2 3 N ALA K 129 ? N ALA K 130 O LEU K 180 ? O LEU K 181 
BI 3 4 O THR K 177 ? O THR K 178 N GLN K 159 ? N GLN K 160 
BJ 1 2 N LYS K 144 ? N LYS K 145 O THR K 196 ? O THR K 197 
BJ 2 3 N VAL K 195 ? N VAL K 196 O VAL K 204 ? O VAL K 205 
BK 1 2 N LYS K 148 ? N LYS K 149 O ALA K 192 ? O ALA K 193 
BK 2 3 N TYR K 191 ? N TYR K 192 O PHE K 208 ? O PHE K 209 
BL 1 2 N LEU L 5   ? N LEU L 5   O LYS L 23  ? O LYS L 23  
BL 2 3 N VAL L 20  ? N VAL L 20  O MET L 81  ? O MET L 80  
BL 3 4 O GLU L 82  ? O GLU L 81  N THR L 69  ? N THR L 68  
BM 1 2 N LYS L 12  ? N LYS L 12  O THR L 126 ? O THR L 110 
BM 2 3 O VAL L 125 ? O VAL L 109 N ALA L 92  ? N ALA L 88  
BM 3 4 O PHE L 95  ? O PHE L 91  N VAL L 37  ? N VAL L 37  
BM 4 5 N TRP L 36  ? N TRP L 36  O MET L 48  ? O MET L 48  
BN 1 2 N LEU L 140 ? N LEU L 124 O GLY L 155 ? O GLY L 139 
BN 2 3 N ALA L 152 ? N ALA L 136 O VAL L 200 ? O VAL L 184 
BN 3 4 O VAL L 197 ? O VAL L 181 N HIS L 180 ? N HIS L 164 
BO 1 2 N VAL L 214 ? N VAL L 198 O VAL L 223 ? O VAL L 207 
BP 1 2 N THR M 5   ? N THR M 5   O ARG M 23  ? O ARG M 24  
BP 2 3 N ILE M 20  ? N ILE M 21  O LEU M 72  ? O LEU M 73  
BP 3 4 O THR M 73  ? O THR M 74  N SER M 62  ? N SER M 63  
BQ 1 2 N LEU M 10  ? N LEU M 11  O GLU M 104 ? O GLU M 105 
BQ 2 3 O THR M 101 ? O THR M 102 N TYR M 85  ? N TYR M 86  
BQ 3 4 O THR M 84  ? O THR M 85  N GLN M 37  ? N GLN M 38  
BQ 4 5 N TRP M 34  ? N TRP M 35  O LEU M 46  ? O LEU M 47  
BQ 5 6 N TYR M 48  ? N TYR M 49  O SER M 52  ? O SER M 53  
BR 1 2 N PHE M 117 ? N PHE M 118 O VAL M 132 ? O VAL M 133 
BR 2 3 N VAL M 131 ? N VAL M 132 O LEU M 178 ? O LEU M 179 
BR 3 4 O SER M 175 ? O SER M 176 N SER M 161 ? N SER M 162 
BS 1 2 N GLN M 146 ? N GLN M 147 O GLU M 194 ? O GLU M 195 
BS 2 3 N TYR M 191 ? N TYR M 192 O PHE M 208 ? O PHE M 209 
BT 1 2 N LYS N 12  ? N LYS N 12  O THR N 126 ? O THR N 110 
BT 2 3 O THR N 123 ? O THR N 107 N TYR N 94  ? N TYR N 90  
BT 3 4 O PHE N 95  ? O PHE N 91  N VAL N 37  ? N VAL N 37  
BT 4 5 N ILE N 34  ? N ILE N 34  O ILE N 51  ? O ILE N 51  
BT 5 6 N GLY N 50  ? N GLY N 50  O ASN N 59  ? O ASN N 58  
BU 1 2 N VAL N 20  ? N VAL N 20  O MET N 81  ? O MET N 80  
BU 2 3 O GLU N 82  ? O GLU N 81  N THR N 69  ? N THR N 68  
BV 1 2 N LEU N 140 ? N LEU N 124 O GLY N 155 ? O GLY N 139 
BV 2 3 N LEU N 154 ? N LEU N 138 O VAL N 198 ? O VAL N 182 
BV 3 4 O VAL N 197 ? O VAL N 181 N HIS N 180 ? N HIS N 164 
BW 1 2 N SER N 148 ? N SER N 132 O THR N 151 ? O THR N 135 
BW 2 3 N VAL N 158 ? N VAL N 142 O LEU N 194 ? O LEU N 178 
BW 3 4 O SER N 193 ? O SER N 177 N VAL N 185 ? N VAL N 169 
BX 1 2 N SER N 169 ? N SER N 153 O ASN N 213 ? O ASN N 197 
BX 2 3 N VAL N 214 ? N VAL N 198 O VAL N 223 ? O VAL N 207 
BY 1 2 N ALA O 12  ? N ALA O 13  O GLU O 104 ? O GLU O 105 
BY 2 3 O THR O 101 ? O THR O 102 N TYR O 85  ? N TYR O 86  
BY 3 4 O TYR O 86  ? O TYR O 87  N TYR O 35  ? N TYR O 36  
BY 4 5 N TRP O 34  ? N TRP O 35  O LEU O 46  ? O LEU O 47  
BY 5 6 N TYR O 48  ? N TYR O 49  O SER O 52  ? O SER O 53  
BZ 1 2 N SER O 113 ? N SER O 114 O ASN O 136 ? O ASN O 137 
BZ 2 3 N PHE O 138 ? N PHE O 139 O TYR O 172 ? O TYR O 173 
BZ 3 4 O SER O 175 ? O SER O 176 N SER O 161 ? N SER O 162 
CA 1 2 N TYR O 191 ? N TYR O 192 O PHE O 208 ? O PHE O 209 
CB 1 2 N LEU P 5   ? N LEU P 5   O LYS P 23  ? O LYS P 23  
CC 1 2 N GLU P 10  ? N GLU P 10  O THR P 124 ? O THR P 108 
CC 2 3 O THR P 123 ? O THR P 107 N TYR P 94  ? N TYR P 90  
CC 3 4 O PHE P 95  ? O PHE P 91  N VAL P 37  ? N VAL P 37  
CC 4 5 N ARG P 38  ? N ARG P 38  O GLU P 46  ? O GLU P 46  
CC 5 6 N GLY P 50  ? N GLY P 50  O ASN P 59  ? O ASN P 58  
CD 1 2 N VAL P 20  ? N VAL P 20  O MET P 81  ? O MET P 80  
CD 2 3 O THR P 78  ? O THR P 77  N ASP P 73  ? N ASP P 72  
CE 1 2 N PHE P 138 ? N PHE P 122 O LEU P 157 ? O LEU P 141 
CE 2 3 N CYS P 156 ? N CYS P 140 O SER P 196 ? O SER P 180 
CE 3 4 O VAL P 197 ? O VAL P 181 N HIS P 180 ? N HIS P 164 
CF 1 2 N SER P 169 ? N SER P 153 O ASN P 213 ? O ASN P 197 
CF 2 3 N TYR P 210 ? N TYR P 194 O VAL P 227 ? O VAL P 211 
# 
_atom_sites.entry_id                    1RZI 
_atom_sites.fract_transf_matrix[1][1]   0.013618 
_atom_sites.fract_transf_matrix[1][2]   -0.000069 
_atom_sites.fract_transf_matrix[1][3]   0.000005 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008957 
_atom_sites.fract_transf_matrix[2][3]   -0.000708 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007525 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . ILE A  1 2   ? 14.627  33.542  137.527 1.00 52.34  ? 2   ILE A N   1 
ATOM   2     C CA  . ILE A  1 2   ? 13.242  33.332  137.103 1.00 50.16  ? 2   ILE A CA  1 
ATOM   3     C C   . ILE A  1 2   ? 13.018  31.885  136.765 1.00 49.74  ? 2   ILE A C   1 
ATOM   4     O O   . ILE A  1 2   ? 11.987  31.303  137.091 1.00 49.78  ? 2   ILE A O   1 
ATOM   5     C CB  . ILE A  1 2   ? 12.914  34.119  135.837 1.00 50.03  ? 2   ILE A CB  1 
ATOM   6     C CG1 . ILE A  1 2   ? 13.884  35.288  135.680 1.00 49.50  ? 2   ILE A CG1 1 
ATOM   7     C CG2 . ILE A  1 2   ? 11.464  34.599  135.880 1.00 48.33  ? 2   ILE A CG2 1 
ATOM   8     C CD1 . ILE A  1 2   ? 13.505  36.241  134.565 1.00 48.45  ? 2   ILE A CD1 1 
ATOM   9     N N   . GLN A  1 3   ? 13.987  31.285  136.102 1.00 48.93  ? 3   GLN A N   1 
ATOM   10    C CA  . GLN A  1 3   ? 13.750  29.946  135.674 1.00 48.41  ? 3   GLN A CA  1 
ATOM   11    C C   . GLN A  1 3   ? 14.437  29.037  136.529 1.00 47.95  ? 3   GLN A C   1 
ATOM   12    O O   . GLN A  1 3   ? 15.096  29.314  137.507 1.00 48.37  ? 3   GLN A O   1 
ATOM   13    C CB  . GLN A  1 3   ? 14.196  29.728  134.243 1.00 47.62  ? 3   GLN A CB  1 
ATOM   14    C CG  . GLN A  1 3   ? 13.994  30.919  133.375 1.00 50.88  ? 3   GLN A CG  1 
ATOM   15    C CD  . GLN A  1 3   ? 14.943  30.950  132.116 1.00 52.07  ? 3   GLN A CD  1 
ATOM   16    O OE1 . GLN A  1 3   ? 14.964  31.925  131.449 1.00 53.15  ? 3   GLN A OE1 1 
ATOM   17    N NE2 . GLN A  1 3   ? 15.682  29.911  131.831 1.00 51.88  ? 3   GLN A NE2 1 
ATOM   18    N N   . MET A  1 4   ? 14.225  27.831  136.180 1.00 47.89  ? 4   MET A N   1 
ATOM   19    C CA  . MET A  1 4   ? 14.875  26.873  137.019 1.00 46.84  ? 4   MET A CA  1 
ATOM   20    C C   . MET A  1 4   ? 15.269  25.726  136.176 1.00 47.38  ? 4   MET A C   1 
ATOM   21    O O   . MET A  1 4   ? 14.508  25.323  135.311 1.00 49.16  ? 4   MET A O   1 
ATOM   22    C CB  . MET A  1 4   ? 13.932  26.430  138.133 1.00 45.93  ? 4   MET A CB  1 
ATOM   23    C CG  . MET A  1 4   ? 13.512  27.545  139.082 1.00 45.93  ? 4   MET A CG  1 
ATOM   24    S SD  . MET A  1 4   ? 14.913  28.307  139.924 1.00 47.85  ? 4   MET A SD  1 
ATOM   25    C CE  . MET A  1 4   ? 15.400  27.003  141.034 1.00 40.21  ? 4   MET A CE  1 
ATOM   26    N N   . THR A  1 5   ? 16.490  25.262  136.357 1.00 47.98  ? 5   THR A N   1 
ATOM   27    C CA  . THR A  1 5   ? 16.944  24.204  135.497 1.00 49.64  ? 5   THR A CA  1 
ATOM   28    C C   . THR A  1 5   ? 17.129  22.811  136.139 1.00 49.45  ? 5   THR A C   1 
ATOM   29    O O   . THR A  1 5   ? 17.946  22.675  137.057 1.00 50.54  ? 5   THR A O   1 
ATOM   30    C CB  . THR A  1 5   ? 18.274  24.642  134.847 1.00 51.57  ? 5   THR A CB  1 
ATOM   31    O OG1 . THR A  1 5   ? 18.001  25.574  133.793 1.00 53.53  ? 5   THR A OG1 1 
ATOM   32    C CG2 . THR A  1 5   ? 19.025  23.434  134.312 1.00 51.63  ? 5   THR A CG2 1 
ATOM   33    N N   . GLN A  1 6   ? 16.398  21.795  135.645 1.00 48.92  ? 6   GLN A N   1 
ATOM   34    C CA  . GLN A  1 6   ? 16.478  20.375  136.107 1.00 48.55  ? 6   GLN A CA  1 
ATOM   35    C C   . GLN A  1 6   ? 16.538  19.392  134.891 1.00 49.05  ? 6   GLN A C   1 
ATOM   36    O O   . GLN A  1 6   ? 15.776  19.601  133.958 1.00 49.27  ? 6   GLN A O   1 
ATOM   37    C CB  . GLN A  1 6   ? 15.194  19.932  136.885 1.00 49.55  ? 6   GLN A CB  1 
ATOM   38    C CG  . GLN A  1 6   ? 14.898  20.466  138.292 1.00 48.92  ? 6   GLN A CG  1 
ATOM   39    C CD  . GLN A  1 6   ? 13.679  19.736  139.031 1.00 48.24  ? 6   GLN A CD  1 
ATOM   40    O OE1 . GLN A  1 6   ? 13.075  20.333  139.853 1.00 50.48  ? 6   GLN A OE1 1 
ATOM   41    N NE2 . GLN A  1 6   ? 13.377  18.500  138.733 1.00 49.58  ? 6   GLN A NE2 1 
ATOM   42    N N   . SER A  1 7   ? 17.414  18.372  134.842 1.00 50.03  ? 7   SER A N   1 
ATOM   43    C CA  . SER A  1 7   ? 17.277  17.335  133.769 1.00 50.12  ? 7   SER A CA  1 
ATOM   44    C C   . SER A  1 7   ? 16.110  16.497  134.496 1.00 48.14  ? 7   SER A C   1 
ATOM   45    O O   . SER A  1 7   ? 16.152  16.530  135.712 1.00 50.13  ? 7   SER A O   1 
ATOM   46    C CB  . SER A  1 7   ? 18.619  16.571  133.576 1.00 51.54  ? 7   SER A CB  1 
ATOM   47    O OG  . SER A  1 7   ? 19.701  17.493  133.454 1.00 54.22  ? 7   SER A OG  1 
ATOM   48    N N   . PRO A  1 8   ? 15.043  15.764  133.815 1.00 46.25  ? 8   PRO A N   1 
ATOM   49    C CA  . PRO A  1 8   ? 13.917  14.986  133.227 1.00 47.02  ? 8   PRO A CA  1 
ATOM   50    C C   . PRO A  1 8   ? 13.676  13.638  133.861 1.00 47.99  ? 8   PRO A C   1 
ATOM   51    O O   . PRO A  1 8   ? 12.580  13.422  134.421 1.00 47.51  ? 8   PRO A O   1 
ATOM   52    C CB  . PRO A  1 8   ? 14.121  14.956  131.644 1.00 45.73  ? 8   PRO A CB  1 
ATOM   53    C CG  . PRO A  1 8   ? 14.510  16.285  131.438 1.00 44.88  ? 8   PRO A CG  1 
ATOM   54    C CD  . PRO A  1 8   ? 15.446  16.480  132.637 1.00 45.07  ? 8   PRO A CD  1 
ATOM   55    N N   . SER A  1 9   ? 14.715  12.799  133.842 1.00 48.41  ? 10  SER A N   1 
ATOM   56    C CA  . SER A  1 9   ? 14.834  11.418  134.320 1.00 49.63  ? 10  SER A CA  1 
ATOM   57    C C   . SER A  1 9   ? 16.109  11.166  135.186 1.00 49.94  ? 10  SER A C   1 
ATOM   58    O O   . SER A  1 9   ? 16.631  12.059  135.841 1.00 50.17  ? 10  SER A O   1 
ATOM   59    C CB  . SER A  1 9   ? 14.920  10.502  133.111 1.00 50.28  ? 10  SER A CB  1 
ATOM   60    O OG  . SER A  1 9   ? 16.015  10.880  132.286 1.00 52.26  ? 10  SER A OG  1 
ATOM   61    N N   . LEU A  1 10  ? 16.568  9.911   135.156 1.00 51.48  ? 11  LEU A N   1 
ATOM   62    C CA  . LEU A  1 10  ? 17.673  9.289   135.937 1.00 52.45  ? 11  LEU A CA  1 
ATOM   63    C C   . LEU A  1 10  ? 17.098  7.888   136.251 1.00 54.30  ? 11  LEU A C   1 
ATOM   64    O O   . LEU A  1 10  ? 15.920  7.743   136.531 1.00 56.61  ? 11  LEU A O   1 
ATOM   65    C CB  . LEU A  1 10  ? 17.958  10.003  137.306 1.00 49.94  ? 11  LEU A CB  1 
ATOM   66    C CG  . LEU A  1 10  ? 18.537  9.266   138.548 1.00 49.67  ? 11  LEU A CG  1 
ATOM   67    C CD1 . LEU A  1 10  ? 19.948  9.744   138.862 1.00 50.44  ? 11  LEU A CD1 1 
ATOM   68    C CD2 . LEU A  1 10  ? 17.643  9.464   139.737 1.00 49.63  ? 11  LEU A CD2 1 
ATOM   69    N N   . SER A  1 11  ? 17.937  6.865   136.200 1.00 54.55  ? 12  SER A N   1 
ATOM   70    C CA  . SER A  1 11  ? 17.552  5.509   136.552 1.00 53.00  ? 12  SER A CA  1 
ATOM   71    C C   . SER A  1 11  ? 18.622  5.049   137.513 1.00 53.81  ? 12  SER A C   1 
ATOM   72    O O   . SER A  1 11  ? 19.805  5.142   137.227 1.00 53.64  ? 12  SER A O   1 
ATOM   73    C CB  . SER A  1 11  ? 17.484  4.607   135.317 1.00 51.65  ? 12  SER A CB  1 
ATOM   74    O OG  . SER A  1 11  ? 16.728  5.222   134.288 1.00 47.78  ? 12  SER A OG  1 
ATOM   75    N N   . ALA A  1 12  ? 18.204  4.562   138.674 1.00 54.30  ? 13  ALA A N   1 
ATOM   76    C CA  . ALA A  1 12  ? 19.134  4.080   139.701 1.00 53.56  ? 13  ALA A CA  1 
ATOM   77    C C   . ALA A  1 12  ? 18.649  2.732   140.236 1.00 53.59  ? 13  ALA A C   1 
ATOM   78    O O   . ALA A  1 12  ? 17.584  2.252   139.841 1.00 53.93  ? 13  ALA A O   1 
ATOM   79    C CB  . ALA A  1 12  ? 19.238  5.083   140.831 1.00 53.17  ? 13  ALA A CB  1 
ATOM   80    N N   . SER A  1 13  ? 19.438  2.112   141.113 1.00 53.33  ? 14  SER A N   1 
ATOM   81    C CA  . SER A  1 13  ? 19.080  0.819   141.702 1.00 52.31  ? 14  SER A CA  1 
ATOM   82    C C   . SER A  1 13  ? 18.596  1.078   143.139 1.00 52.32  ? 14  SER A C   1 
ATOM   83    O O   . SER A  1 13  ? 18.415  2.230   143.538 1.00 52.21  ? 14  SER A O   1 
ATOM   84    C CB  . SER A  1 13  ? 20.303  -0.115  141.714 1.00 51.26  ? 14  SER A CB  1 
ATOM   85    O OG  . SER A  1 13  ? 21.061  -0.023  140.517 1.00 48.44  ? 14  SER A OG  1 
ATOM   86    N N   . VAL A  1 14  ? 18.355  0.024   143.909 1.00 52.15  ? 15  VAL A N   1 
ATOM   87    C CA  . VAL A  1 14  ? 17.937  0.222   145.290 1.00 52.35  ? 15  VAL A CA  1 
ATOM   88    C C   . VAL A  1 14  ? 19.216  0.249   146.115 1.00 53.07  ? 15  VAL A C   1 
ATOM   89    O O   . VAL A  1 14  ? 20.079  -0.619  145.961 1.00 54.30  ? 15  VAL A O   1 
ATOM   90    C CB  . VAL A  1 14  ? 17.042  -0.909  145.779 1.00 51.85  ? 15  VAL A CB  1 
ATOM   91    C CG1 . VAL A  1 14  ? 16.730  -0.736  147.258 1.00 50.57  ? 15  VAL A CG1 1 
ATOM   92    C CG2 . VAL A  1 14  ? 15.778  -0.920  144.968 1.00 52.89  ? 15  VAL A CG2 1 
ATOM   93    N N   . GLY A  1 15  ? 19.337  1.256   146.975 1.00 52.35  ? 16  GLY A N   1 
ATOM   94    C CA  . GLY A  1 15  ? 20.524  1.404   147.794 1.00 51.76  ? 16  GLY A CA  1 
ATOM   95    C C   . GLY A  1 15  ? 21.458  2.466   147.228 1.00 51.39  ? 16  GLY A C   1 
ATOM   96    O O   . GLY A  1 15  ? 22.154  3.174   147.971 1.00 51.87  ? 16  GLY A O   1 
ATOM   97    N N   . ASP A  1 16  ? 21.466  2.580   145.903 1.00 49.50  ? 17  ASP A N   1 
ATOM   98    C CA  . ASP A  1 16  ? 22.318  3.538   145.208 1.00 49.18  ? 17  ASP A CA  1 
ATOM   99    C C   . ASP A  1 16  ? 22.183  4.894   145.859 1.00 47.45  ? 17  ASP A C   1 
ATOM   100   O O   . ASP A  1 16  ? 21.160  5.172   146.487 1.00 46.78  ? 17  ASP A O   1 
ATOM   101   C CB  . ASP A  1 16  ? 21.893  3.664   143.734 1.00 52.49  ? 17  ASP A CB  1 
ATOM   102   C CG  . ASP A  1 16  ? 22.028  2.357   142.947 1.00 54.37  ? 17  ASP A CG  1 
ATOM   103   O OD1 . ASP A  1 16  ? 21.931  1.266   143.556 1.00 57.48  ? 17  ASP A OD1 1 
ATOM   104   O OD2 . ASP A  1 16  ? 22.206  2.422   141.706 1.00 54.56  ? 17  ASP A OD2 1 
ATOM   105   N N   . ARG A  1 17  ? 23.210  5.733   145.718 1.00 46.65  ? 18  ARG A N   1 
ATOM   106   C CA  . ARG A  1 17  ? 23.162  7.098   146.256 1.00 46.20  ? 18  ARG A CA  1 
ATOM   107   C C   . ARG A  1 17  ? 22.977  8.059   145.090 1.00 45.48  ? 18  ARG A C   1 
ATOM   108   O O   . ARG A  1 17  ? 23.528  7.843   144.013 1.00 44.43  ? 18  ARG A O   1 
ATOM   109   C CB  . ARG A  1 17  ? 24.446  7.477   147.005 1.00 46.49  ? 18  ARG A CB  1 
ATOM   110   C CG  . ARG A  1 17  ? 24.630  8.996   147.130 1.00 46.96  ? 18  ARG A CG  1 
ATOM   111   C CD  . ARG A  1 17  ? 25.781  9.412   148.051 1.00 48.83  ? 18  ARG A CD  1 
ATOM   112   N NE  . ARG A  1 17  ? 25.342  9.655   149.423 1.00 48.90  ? 18  ARG A NE  1 
ATOM   113   C CZ  . ARG A  1 17  ? 25.032  8.699   150.294 1.00 50.53  ? 18  ARG A CZ  1 
ATOM   114   N NH1 . ARG A  1 17  ? 25.122  7.422   149.943 1.00 51.47  ? 18  ARG A NH1 1 
ATOM   115   N NH2 . ARG A  1 17  ? 24.606  9.016   151.511 1.00 50.32  ? 18  ARG A NH2 1 
ATOM   116   N N   . VAL A  1 18  ? 22.212  9.123   145.302 1.00 44.78  ? 19  VAL A N   1 
ATOM   117   C CA  . VAL A  1 18  ? 21.982  10.071  144.235 1.00 45.11  ? 19  VAL A CA  1 
ATOM   118   C C   . VAL A  1 18  ? 21.993  11.504  144.675 1.00 45.54  ? 19  VAL A C   1 
ATOM   119   O O   . VAL A  1 18  ? 22.056  11.807  145.860 1.00 46.15  ? 19  VAL A O   1 
ATOM   120   C CB  . VAL A  1 18  ? 20.638  9.851   143.575 1.00 44.88  ? 19  VAL A CB  1 
ATOM   121   C CG1 . VAL A  1 18  ? 20.823  9.697   142.082 1.00 47.65  ? 19  VAL A CG1 1 
ATOM   122   C CG2 . VAL A  1 18  ? 19.928  8.646   144.169 1.00 45.07  ? 19  VAL A CG2 1 
ATOM   123   N N   . THR A  1 19  ? 21.956  12.382  143.681 1.00 45.94  ? 20  THR A N   1 
ATOM   124   C CA  . THR A  1 19  ? 21.889  13.806  143.919 1.00 46.17  ? 20  THR A CA  1 
ATOM   125   C C   . THR A  1 19  ? 21.220  14.414  142.694 1.00 45.77  ? 20  THR A C   1 
ATOM   126   O O   . THR A  1 19  ? 21.714  14.310  141.574 1.00 46.82  ? 20  THR A O   1 
ATOM   127   C CB  . THR A  1 19  ? 23.284  14.408  144.182 1.00 46.80  ? 20  THR A CB  1 
ATOM   128   O OG1 . THR A  1 19  ? 24.100  13.421  144.834 1.00 49.32  ? 20  THR A OG1 1 
ATOM   129   C CG2 . THR A  1 19  ? 23.163  15.631  145.075 1.00 46.72  ? 20  THR A CG2 1 
ATOM   130   N N   . ILE A  1 20  ? 20.068  15.021  142.927 1.00 45.53  ? 21  ILE A N   1 
ATOM   131   C CA  . ILE A  1 20  ? 19.313  15.697  141.918 1.00 43.43  ? 21  ILE A CA  1 
ATOM   132   C C   . ILE A  1 20  ? 19.762  17.173  142.020 1.00 43.04  ? 21  ILE A C   1 
ATOM   133   O O   . ILE A  1 20  ? 19.512  17.838  143.018 1.00 45.51  ? 21  ILE A O   1 
ATOM   134   C CB  . ILE A  1 20  ? 17.811  15.481  142.220 1.00 42.56  ? 21  ILE A CB  1 
ATOM   135   C CG1 . ILE A  1 20  ? 17.456  14.015  141.951 1.00 41.60  ? 21  ILE A CG1 1 
ATOM   136   C CG2 . ILE A  1 20  ? 16.943  16.399  141.380 1.00 42.56  ? 21  ILE A CG2 1 
ATOM   137   C CD1 . ILE A  1 20  ? 16.593  13.383  143.028 1.00 42.00  ? 21  ILE A CD1 1 
ATOM   138   N N   . THR A  1 21  ? 20.433  17.674  140.991 1.00 41.62  ? 22  THR A N   1 
ATOM   139   C CA  . THR A  1 21  ? 20.861  19.052  141.001 1.00 40.14  ? 22  THR A CA  1 
ATOM   140   C C   . THR A  1 21  ? 19.804  19.953  140.335 1.00 40.13  ? 22  THR A C   1 
ATOM   141   O O   . THR A  1 21  ? 19.327  19.642  139.259 1.00 39.11  ? 22  THR A O   1 
ATOM   142   C CB  . THR A  1 21  ? 22.206  19.197  140.266 1.00 39.48  ? 22  THR A CB  1 
ATOM   143   O OG1 . THR A  1 21  ? 23.017  18.049  140.553 1.00 39.73  ? 22  THR A OG1 1 
ATOM   144   C CG2 . THR A  1 21  ? 22.934  20.452  140.737 1.00 40.02  ? 22  THR A CG2 1 
ATOM   145   N N   . CYS A  1 22  ? 19.412  21.051  140.985 1.00 40.70  ? 23  CYS A N   1 
ATOM   146   C CA  . CYS A  1 22  ? 18.491  22.037  140.410 1.00 41.88  ? 23  CYS A CA  1 
ATOM   147   C C   . CYS A  1 22  ? 19.241  23.345  140.488 1.00 41.87  ? 23  CYS A C   1 
ATOM   148   O O   . CYS A  1 22  ? 19.553  23.822  141.573 1.00 43.00  ? 23  CYS A O   1 
ATOM   149   C CB  . CYS A  1 22  ? 17.164  22.160  141.180 1.00 43.63  ? 23  CYS A CB  1 
ATOM   150   S SG  . CYS A  1 22  ? 16.123  23.506  140.588 1.00 53.62  ? 23  CYS A SG  1 
ATOM   151   N N   . ARG A  1 23  ? 19.555  23.904  139.324 1.00 42.39  ? 24  ARG A N   1 
ATOM   152   C CA  . ARG A  1 23  ? 20.247  25.182  139.237 1.00 40.75  ? 24  ARG A CA  1 
ATOM   153   C C   . ARG A  1 23  ? 19.246  26.274  138.950 1.00 40.35  ? 24  ARG A C   1 
ATOM   154   O O   . ARG A  1 23  ? 18.129  26.002  138.524 1.00 39.38  ? 24  ARG A O   1 
ATOM   155   C CB  . ARG A  1 23  ? 21.286  25.154  138.124 1.00 41.34  ? 24  ARG A CB  1 
ATOM   156   C CG  . ARG A  1 23  ? 22.607  24.545  138.553 1.00 43.75  ? 24  ARG A CG  1 
ATOM   157   C CD  . ARG A  1 23  ? 23.629  24.556  137.426 1.00 44.65  ? 24  ARG A CD  1 
ATOM   158   N NE  . ARG A  1 23  ? 24.686  23.575  137.662 1.00 47.73  ? 24  ARG A NE  1 
ATOM   159   C CZ  . ARG A  1 23  ? 25.159  22.748  136.735 1.00 49.24  ? 24  ARG A CZ  1 
ATOM   160   N NH1 . ARG A  1 23  ? 24.670  22.778  135.498 1.00 51.73  ? 24  ARG A NH1 1 
ATOM   161   N NH2 . ARG A  1 23  ? 26.126  21.898  137.046 1.00 49.64  ? 24  ARG A NH2 1 
ATOM   162   N N   . ALA A  1 24  ? 19.657  27.512  139.191 1.00 41.00  ? 25  ALA A N   1 
ATOM   163   C CA  . ALA A  1 24  ? 18.795  28.657  138.947 1.00 42.54  ? 25  ALA A CA  1 
ATOM   164   C C   . ALA A  1 24  ? 19.450  29.722  138.067 1.00 44.01  ? 25  ALA A C   1 
ATOM   165   O O   . ALA A  1 24  ? 20.660  29.929  138.144 1.00 43.71  ? 25  ALA A O   1 
ATOM   166   C CB  . ALA A  1 24  ? 18.349  29.258  140.272 1.00 40.93  ? 25  ALA A CB  1 
ATOM   167   N N   . SER A  1 25  ? 18.638  30.400  137.248 1.00 46.51  ? 26  SER A N   1 
ATOM   168   C CA  . SER A  1 25  ? 19.104  31.459  136.317 1.00 47.96  ? 26  SER A CA  1 
ATOM   169   C C   . SER A  1 25  ? 19.847  32.656  136.981 1.00 48.61  ? 26  SER A C   1 
ATOM   170   O O   . SER A  1 25  ? 20.997  32.984  136.669 1.00 47.92  ? 26  SER A O   1 
ATOM   171   C CB  . SER A  1 25  ? 17.901  31.954  135.485 1.00 48.44  ? 26  SER A CB  1 
ATOM   172   O OG  . SER A  1 25  ? 16.685  31.853  136.217 1.00 47.89  ? 26  SER A OG  1 
ATOM   173   N N   . GLN A  1 26  ? 19.087  33.330  137.836 1.00 48.55  ? 27  GLN A N   1 
ATOM   174   C CA  . GLN A  1 26  ? 19.502  34.446  138.700 1.00 49.13  ? 27  GLN A CA  1 
ATOM   175   C C   . GLN A  1 26  ? 19.547  33.920  140.116 1.00 49.44  ? 27  GLN A C   1 
ATOM   176   O O   . GLN A  1 26  ? 18.982  32.875  140.341 1.00 50.60  ? 27  GLN A O   1 
ATOM   177   C CB  . GLN A  1 26  ? 18.533  35.606  138.569 1.00 48.88  ? 27  GLN A CB  1 
ATOM   178   C CG  . GLN A  1 26  ? 18.040  35.837  137.160 1.00 52.43  ? 27  GLN A CG  1 
ATOM   179   C CD  . GLN A  1 26  ? 18.069  37.349  136.707 1.00 53.74  ? 27  GLN A CD  1 
ATOM   180   O OE1 . GLN A  1 26  ? 17.565  37.633  135.676 1.00 54.86  ? 27  GLN A OE1 1 
ATOM   181   N NE2 . GLN A  1 26  ? 18.649  38.255  137.465 1.00 54.18  ? 27  GLN A NE2 1 
ATOM   182   N N   . SER A  1 27  ? 20.204  34.589  141.059 1.00 49.16  ? 28  SER A N   1 
ATOM   183   C CA  . SER A  1 27  ? 20.357  33.991  142.369 1.00 47.54  ? 28  SER A CA  1 
ATOM   184   C C   . SER A  1 27  ? 19.169  34.056  143.314 1.00 46.58  ? 28  SER A C   1 
ATOM   185   O O   . SER A  1 27  ? 18.469  35.071  143.392 1.00 45.45  ? 28  SER A O   1 
ATOM   186   C CB  . SER A  1 27  ? 21.567  34.627  143.017 1.00 48.57  ? 28  SER A CB  1 
ATOM   187   O OG  . SER A  1 27  ? 22.208  33.716  143.888 1.00 52.50  ? 28  SER A OG  1 
ATOM   188   N N   . ILE A  1 28  ? 18.938  32.981  144.048 1.00 46.70  ? 29  ILE A N   1 
ATOM   189   C CA  . ILE A  1 28  ? 17.796  32.972  144.931 1.00 48.19  ? 29  ILE A CA  1 
ATOM   190   C C   . ILE A  1 28  ? 18.145  32.853  146.394 1.00 49.69  ? 29  ILE A C   1 
ATOM   191   O O   . ILE A  1 28  ? 17.270  32.968  147.264 1.00 48.81  ? 29  ILE A O   1 
ATOM   192   C CB  . ILE A  1 28  ? 16.849  31.838  144.544 1.00 48.82  ? 29  ILE A CB  1 
ATOM   193   C CG1 . ILE A  1 28  ? 17.657  30.559  144.288 1.00 48.65  ? 29  ILE A CG1 1 
ATOM   194   C CG2 . ILE A  1 28  ? 16.054  32.233  143.312 1.00 46.99  ? 29  ILE A CG2 1 
ATOM   195   C CD1 . ILE A  1 28  ? 16.817  29.372  143.877 1.00 48.05  ? 29  ILE A CD1 1 
ATOM   196   N N   . SER A  1 29  ? 19.426  32.629  146.671 1.00 51.37  ? 30  SER A N   1 
ATOM   197   C CA  . SER A  1 29  ? 19.871  32.503  148.050 1.00 51.40  ? 30  SER A CA  1 
ATOM   198   C C   . SER A  1 29  ? 19.503  31.115  148.559 1.00 51.99  ? 30  SER A C   1 
ATOM   199   O O   . SER A  1 29  ? 20.126  30.119  148.175 1.00 51.38  ? 30  SER A O   1 
ATOM   200   C CB  . SER A  1 29  ? 19.198  33.588  148.907 1.00 50.52  ? 30  SER A CB  1 
ATOM   201   O OG  . SER A  1 29  ? 19.445  33.395  150.284 1.00 51.49  ? 30  SER A OG  1 
ATOM   202   N N   . SER A  1 30  ? 18.478  31.060  149.408 1.00 52.69  ? 31  SER A N   1 
ATOM   203   C CA  . SER A  1 30  ? 18.015  29.808  149.999 1.00 53.24  ? 31  SER A CA  1 
ATOM   204   C C   . SER A  1 30  ? 16.500  29.753  150.010 1.00 52.70  ? 31  SER A C   1 
ATOM   205   O O   . SER A  1 30  ? 15.896  29.342  150.995 1.00 54.08  ? 31  SER A O   1 
ATOM   206   C CB  . SER A  1 30  ? 18.521  29.679  151.437 1.00 53.87  ? 31  SER A CB  1 
ATOM   207   O OG  . SER A  1 30  ? 19.934  29.746  151.494 1.00 55.03  ? 31  SER A OG  1 
ATOM   208   N N   . TYR A  1 31  ? 15.885  30.183  148.921 1.00 51.60  ? 32  TYR A N   1 
ATOM   209   C CA  . TYR A  1 31  ? 14.442  30.164  148.825 1.00 50.32  ? 32  TYR A CA  1 
ATOM   210   C C   . TYR A  1 31  ? 14.059  29.204  147.743 1.00 48.44  ? 32  TYR A C   1 
ATOM   211   O O   . TYR A  1 31  ? 13.315  29.545  146.827 1.00 49.01  ? 32  TYR A O   1 
ATOM   212   C CB  . TYR A  1 31  ? 13.920  31.540  148.487 1.00 53.32  ? 32  TYR A CB  1 
ATOM   213   C CG  . TYR A  1 31  ? 14.064  32.497  149.623 1.00 55.90  ? 32  TYR A CG  1 
ATOM   214   C CD1 . TYR A  1 31  ? 15.308  33.004  149.986 1.00 56.90  ? 32  TYR A CD1 1 
ATOM   215   C CD2 . TYR A  1 31  ? 12.953  32.890  150.347 1.00 58.71  ? 32  TYR A CD2 1 
ATOM   216   C CE1 . TYR A  1 31  ? 15.437  33.890  151.052 1.00 59.25  ? 32  TYR A CE1 1 
ATOM   217   C CE2 . TYR A  1 31  ? 13.063  33.772  151.413 1.00 61.68  ? 32  TYR A CE2 1 
ATOM   218   C CZ  . TYR A  1 31  ? 14.303  34.274  151.764 1.00 60.75  ? 32  TYR A CZ  1 
ATOM   219   O OH  . TYR A  1 31  ? 14.373  35.169  152.814 1.00 61.58  ? 32  TYR A OH  1 
ATOM   220   N N   . LEU A  1 32  ? 14.602  27.999  147.861 1.00 45.59  ? 33  LEU A N   1 
ATOM   221   C CA  . LEU A  1 32  ? 14.376  26.904  146.926 1.00 40.89  ? 33  LEU A CA  1 
ATOM   222   C C   . LEU A  1 32  ? 13.676  25.872  147.764 1.00 37.43  ? 33  LEU A C   1 
ATOM   223   O O   . LEU A  1 32  ? 13.944  25.775  148.948 1.00 38.41  ? 33  LEU A O   1 
ATOM   224   C CB  . LEU A  1 32  ? 15.729  26.368  146.434 1.00 39.84  ? 33  LEU A CB  1 
ATOM   225   C CG  . LEU A  1 32  ? 15.866  24.966  145.840 1.00 39.95  ? 33  LEU A CG  1 
ATOM   226   C CD1 . LEU A  1 32  ? 15.569  23.939  146.898 1.00 40.06  ? 33  LEU A CD1 1 
ATOM   227   C CD2 . LEU A  1 32  ? 14.951  24.794  144.656 1.00 39.84  ? 33  LEU A CD2 1 
ATOM   228   N N   . ASN A  1 33  ? 12.778  25.106  147.179 1.00 34.25  ? 34  ASN A N   1 
ATOM   229   C CA  . ASN A  1 33  ? 12.106  24.092  147.959 1.00 32.71  ? 34  ASN A CA  1 
ATOM   230   C C   . ASN A  1 33  ? 12.042  22.855  147.129 1.00 31.02  ? 34  ASN A C   1 
ATOM   231   O O   . ASN A  1 33  ? 12.185  22.926  145.929 1.00 30.44  ? 34  ASN A O   1 
ATOM   232   C CB  . ASN A  1 33  ? 10.696  24.549  148.320 1.00 35.56  ? 34  ASN A CB  1 
ATOM   233   C CG  . ASN A  1 33  ? 10.686  25.862  149.080 1.00 36.82  ? 34  ASN A CG  1 
ATOM   234   O OD1 . ASN A  1 33  ? 10.900  25.901  150.298 1.00 38.37  ? 34  ASN A OD1 1 
ATOM   235   N ND2 . ASN A  1 33  ? 10.457  26.951  148.360 1.00 37.69  ? 34  ASN A ND2 1 
ATOM   236   N N   . TRP A  1 34  ? 11.842  21.719  147.773 1.00 31.54  ? 35  TRP A N   1 
ATOM   237   C CA  . TRP A  1 34  ? 11.737  20.451  147.074 1.00 33.58  ? 35  TRP A CA  1 
ATOM   238   C C   . TRP A  1 34  ? 10.439  19.750  147.445 1.00 34.70  ? 35  TRP A C   1 
ATOM   239   O O   . TRP A  1 34  ? 10.001  19.814  148.597 1.00 37.20  ? 35  TRP A O   1 
ATOM   240   C CB  . TRP A  1 34  ? 12.912  19.532  147.412 1.00 34.35  ? 35  TRP A CB  1 
ATOM   241   C CG  . TRP A  1 34  ? 14.256  20.087  147.046 1.00 37.21  ? 35  TRP A CG  1 
ATOM   242   C CD1 . TRP A  1 34  ? 14.999  20.954  147.779 1.00 39.20  ? 35  TRP A CD1 1 
ATOM   243   C CD2 . TRP A  1 34  ? 15.000  19.832  145.851 1.00 37.13  ? 35  TRP A CD2 1 
ATOM   244   N NE1 . TRP A  1 34  ? 16.161  21.259  147.122 1.00 40.52  ? 35  TRP A NE1 1 
ATOM   245   C CE2 . TRP A  1 34  ? 16.187  20.583  145.932 1.00 39.12  ? 35  TRP A CE2 1 
ATOM   246   C CE3 . TRP A  1 34  ? 14.776  19.050  144.718 1.00 38.55  ? 35  TRP A CE3 1 
ATOM   247   C CZ2 . TRP A  1 34  ? 17.157  20.578  144.921 1.00 41.07  ? 35  TRP A CZ2 1 
ATOM   248   C CZ3 . TRP A  1 34  ? 15.739  19.046  143.704 1.00 41.76  ? 35  TRP A CZ3 1 
ATOM   249   C CH2 . TRP A  1 34  ? 16.916  19.807  143.816 1.00 42.00  ? 35  TRP A CH2 1 
ATOM   250   N N   . TYR A  1 35  ? 9.821   19.094  146.466 1.00 33.79  ? 36  TYR A N   1 
ATOM   251   C CA  . TYR A  1 35  ? 8.586   18.359  146.695 1.00 34.28  ? 36  TYR A CA  1 
ATOM   252   C C   . TYR A  1 35  ? 8.688   16.978  146.077 1.00 35.84  ? 36  TYR A C   1 
ATOM   253   O O   . TYR A  1 35  ? 9.375   16.781  145.080 1.00 36.83  ? 36  TYR A O   1 
ATOM   254   C CB  . TYR A  1 35  ? 7.387   19.062  146.069 1.00 32.44  ? 36  TYR A CB  1 
ATOM   255   C CG  . TYR A  1 35  ? 7.167   20.464  146.529 1.00 29.03  ? 36  TYR A CG  1 
ATOM   256   C CD1 . TYR A  1 35  ? 7.967   21.485  146.060 1.00 28.22  ? 36  TYR A CD1 1 
ATOM   257   C CD2 . TYR A  1 35  ? 6.134   20.773  147.395 1.00 28.75  ? 36  TYR A CD2 1 
ATOM   258   C CE1 . TYR A  1 35  ? 7.756   22.791  146.424 1.00 29.89  ? 36  TYR A CE1 1 
ATOM   259   C CE2 . TYR A  1 35  ? 5.902   22.084  147.780 1.00 32.25  ? 36  TYR A CE2 1 
ATOM   260   C CZ  . TYR A  1 35  ? 6.726   23.103  147.287 1.00 32.37  ? 36  TYR A CZ  1 
ATOM   261   O OH  . TYR A  1 35  ? 6.547   24.426  147.672 1.00 30.29  ? 36  TYR A OH  1 
ATOM   262   N N   . GLN A  1 36  ? 7.989   16.019  146.667 1.00 37.00  ? 37  GLN A N   1 
ATOM   263   C CA  . GLN A  1 36  ? 8.003   14.668  146.147 1.00 37.83  ? 37  GLN A CA  1 
ATOM   264   C C   . GLN A  1 36  ? 6.579   14.319  145.746 1.00 39.07  ? 37  GLN A C   1 
ATOM   265   O O   . GLN A  1 36  ? 5.646   14.555  146.512 1.00 40.06  ? 37  GLN A O   1 
ATOM   266   C CB  . GLN A  1 36  ? 8.481   13.685  147.214 1.00 37.36  ? 37  GLN A CB  1 
ATOM   267   C CG  . GLN A  1 36  ? 8.597   12.260  146.711 1.00 38.99  ? 37  GLN A CG  1 
ATOM   268   C CD  . GLN A  1 36  ? 8.582   11.229  147.818 1.00 39.60  ? 37  GLN A CD  1 
ATOM   269   O OE1 . GLN A  1 36  ? 7.664   11.195  148.640 1.00 39.58  ? 37  GLN A OE1 1 
ATOM   270   N NE2 . GLN A  1 36  ? 9.595   10.369  147.836 1.00 39.42  ? 37  GLN A NE2 1 
ATOM   271   N N   . GLN A  1 37  ? 6.413   13.769  144.546 1.00 38.59  ? 38  GLN A N   1 
ATOM   272   C CA  . GLN A  1 37  ? 5.101   13.355  144.074 1.00 38.42  ? 38  GLN A CA  1 
ATOM   273   C C   . GLN A  1 37  ? 5.139   12.095  143.215 1.00 38.11  ? 38  GLN A C   1 
ATOM   274   O O   . GLN A  1 37  ? 5.883   12.028  142.265 1.00 37.23  ? 38  GLN A O   1 
ATOM   275   C CB  . GLN A  1 37  ? 4.451   14.471  143.270 1.00 39.18  ? 38  GLN A CB  1 
ATOM   276   C CG  . GLN A  1 37  ? 3.354   13.987  142.344 1.00 38.03  ? 38  GLN A CG  1 
ATOM   277   C CD  . GLN A  1 37  ? 2.783   15.097  141.508 1.00 38.81  ? 38  GLN A CD  1 
ATOM   278   O OE1 . GLN A  1 37  ? 3.505   15.975  141.048 1.00 40.50  ? 38  GLN A OE1 1 
ATOM   279   N NE2 . GLN A  1 37  ? 1.480   15.063  141.293 1.00 38.98  ? 38  GLN A NE2 1 
ATOM   280   N N   . LYS A  1 38  ? 4.343   11.097  143.579 1.00 39.82  ? 39  LYS A N   1 
ATOM   281   C CA  . LYS A  1 38  ? 4.225   9.863   142.815 1.00 40.57  ? 39  LYS A CA  1 
ATOM   282   C C   . LYS A  1 38  ? 2.877   10.009  142.080 1.00 42.06  ? 39  LYS A C   1 
ATOM   283   O O   . LYS A  1 38  ? 2.008   10.755  142.517 1.00 41.24  ? 39  LYS A O   1 
ATOM   284   C CB  . LYS A  1 38  ? 4.178   8.640   143.740 1.00 41.68  ? 39  LYS A CB  1 
ATOM   285   C CG  . LYS A  1 38  ? 5.426   8.362   144.578 1.00 42.39  ? 39  LYS A CG  1 
ATOM   286   C CD  . LYS A  1 38  ? 5.366   6.936   145.170 1.00 41.52  ? 39  LYS A CD  1 
ATOM   287   C CE  . LYS A  1 38  ? 6.521   6.615   146.116 1.00 39.69  ? 39  LYS A CE  1 
ATOM   288   N NZ  . LYS A  1 38  ? 6.487   7.430   147.366 1.00 38.52  ? 39  LYS A NZ  1 
ATOM   289   N N   . PRO A  1 39  ? 2.680   9.284   140.971 1.00 43.94  ? 40  PRO A N   1 
ATOM   290   C CA  . PRO A  1 39  ? 1.460   9.310   140.145 1.00 46.45  ? 40  PRO A CA  1 
ATOM   291   C C   . PRO A  1 39  ? 0.124   9.415   140.880 1.00 48.28  ? 40  PRO A C   1 
ATOM   292   O O   . PRO A  1 39  ? 0.033   9.114   142.074 1.00 50.83  ? 40  PRO A O   1 
ATOM   293   C CB  . PRO A  1 39  ? 1.555   8.013   139.351 1.00 46.80  ? 40  PRO A CB  1 
ATOM   294   C CG  . PRO A  1 39  ? 3.020   7.855   139.170 1.00 47.57  ? 40  PRO A CG  1 
ATOM   295   C CD  . PRO A  1 39  ? 3.567   8.191   140.543 1.00 45.68  ? 40  PRO A CD  1 
ATOM   296   N N   . GLY A  1 40  ? -0.910  9.836   140.156 1.00 47.46  ? 41  GLY A N   1 
ATOM   297   C CA  . GLY A  1 40  ? -2.238  9.969   140.734 1.00 47.93  ? 41  GLY A CA  1 
ATOM   298   C C   . GLY A  1 40  ? -2.327  10.483  142.164 1.00 48.69  ? 41  GLY A C   1 
ATOM   299   O O   . GLY A  1 40  ? -3.409  10.459  142.765 1.00 49.51  ? 41  GLY A O   1 
ATOM   300   N N   . LYS A  1 41  ? -1.202  10.949  142.707 1.00 48.46  ? 42  LYS A N   1 
ATOM   301   C CA  . LYS A  1 41  ? -1.142  11.467  144.071 1.00 48.59  ? 42  LYS A CA  1 
ATOM   302   C C   . LYS A  1 41  ? -0.773  12.954  144.121 1.00 47.33  ? 42  LYS A C   1 
ATOM   303   O O   . LYS A  1 41  ? -0.403  13.539  143.104 1.00 48.75  ? 42  LYS A O   1 
ATOM   304   C CB  . LYS A  1 41  ? -0.165  10.631  144.886 1.00 49.58  ? 42  LYS A CB  1 
ATOM   305   C CG  . LYS A  1 41  ? -0.630  9.190   145.043 1.00 52.53  ? 42  LYS A CG  1 
ATOM   306   C CD  . LYS A  1 41  ? -2.019  9.158   145.675 1.00 55.65  ? 42  LYS A CD  1 
ATOM   307   C CE  . LYS A  1 41  ? -2.357  7.812   146.315 1.00 56.53  ? 42  LYS A CE  1 
ATOM   308   N NZ  . LYS A  1 41  ? -3.550  7.952   147.217 1.00 55.59  ? 42  LYS A NZ  1 
ATOM   309   N N   . VAL A  1 42  ? -0.880  13.561  145.296 1.00 43.89  ? 43  VAL A N   1 
ATOM   310   C CA  . VAL A  1 42  ? -0.601  14.981  145.444 1.00 42.49  ? 43  VAL A CA  1 
ATOM   311   C C   . VAL A  1 42  ? 0.803   15.267  145.940 1.00 43.41  ? 43  VAL A C   1 
ATOM   312   O O   . VAL A  1 42  ? 1.391   14.465  146.648 1.00 44.47  ? 43  VAL A O   1 
ATOM   313   C CB  . VAL A  1 42  ? -1.624  15.611  146.419 1.00 42.21  ? 43  VAL A CB  1 
ATOM   314   C CG1 . VAL A  1 42  ? -1.288  17.078  146.732 1.00 38.58  ? 43  VAL A CG1 1 
ATOM   315   C CG2 . VAL A  1 42  ? -3.022  15.482  145.815 1.00 43.49  ? 43  VAL A CG2 1 
ATOM   316   N N   . PRO A  1 43  ? 1.373   16.416  145.550 1.00 43.70  ? 44  PRO A N   1 
ATOM   317   C CA  . PRO A  1 43  ? 2.727   16.767  146.000 1.00 42.77  ? 44  PRO A CA  1 
ATOM   318   C C   . PRO A  1 43  ? 2.892   16.796  147.534 1.00 42.22  ? 44  PRO A C   1 
ATOM   319   O O   . PRO A  1 43  ? 2.101   17.423  148.252 1.00 43.07  ? 44  PRO A O   1 
ATOM   320   C CB  . PRO A  1 43  ? 2.939   18.146  145.373 1.00 42.79  ? 44  PRO A CB  1 
ATOM   321   C CG  . PRO A  1 43  ? 2.204   18.029  144.080 1.00 42.34  ? 44  PRO A CG  1 
ATOM   322   C CD  . PRO A  1 43  ? 0.919   17.326  144.476 1.00 42.45  ? 44  PRO A CD  1 
ATOM   323   N N   . LYS A  1 44  ? 3.916   16.103  148.030 1.00 41.88  ? 45  LYS A N   1 
ATOM   324   C CA  . LYS A  1 44  ? 4.219   16.063  149.468 1.00 40.93  ? 45  LYS A CA  1 
ATOM   325   C C   . LYS A  1 44  ? 5.508   16.870  149.644 1.00 39.85  ? 45  LYS A C   1 
ATOM   326   O O   . LYS A  1 44  ? 6.523   16.528  149.042 1.00 39.90  ? 45  LYS A O   1 
ATOM   327   C CB  . LYS A  1 44  ? 4.430   14.611  149.936 1.00 39.90  ? 45  LYS A CB  1 
ATOM   328   C CG  . LYS A  1 44  ? 4.935   14.494  151.373 1.00 43.58  ? 45  LYS A CG  1 
ATOM   329   C CD  . LYS A  1 44  ? 5.183   13.057  151.834 1.00 45.59  ? 45  LYS A CD  1 
ATOM   330   C CE  . LYS A  1 44  ? 5.637   13.019  153.318 1.00 48.47  ? 45  LYS A CE  1 
ATOM   331   N NZ  . LYS A  1 44  ? 5.840   11.631  153.946 1.00 49.14  ? 45  LYS A NZ  1 
ATOM   332   N N   . LEU A  1 45  ? 5.478   17.943  150.437 1.00 38.02  ? 46  LEU A N   1 
ATOM   333   C CA  . LEU A  1 45  ? 6.692   18.745  150.608 1.00 36.14  ? 46  LEU A CA  1 
ATOM   334   C C   . LEU A  1 45  ? 7.763   17.977  151.364 1.00 36.37  ? 46  LEU A C   1 
ATOM   335   O O   . LEU A  1 45  ? 7.541   17.486  152.478 1.00 34.36  ? 46  LEU A O   1 
ATOM   336   C CB  . LEU A  1 45  ? 6.422   20.077  151.339 1.00 34.08  ? 46  LEU A CB  1 
ATOM   337   C CG  . LEU A  1 45  ? 7.661   20.960  151.640 1.00 31.64  ? 46  LEU A CG  1 
ATOM   338   C CD1 . LEU A  1 45  ? 8.178   21.641  150.393 1.00 27.54  ? 46  LEU A CD1 1 
ATOM   339   C CD2 . LEU A  1 45  ? 7.305   22.003  152.668 1.00 29.06  ? 46  LEU A CD2 1 
ATOM   340   N N   . LEU A  1 46  ? 8.936   17.893  150.744 1.00 36.81  ? 47  LEU A N   1 
ATOM   341   C CA  . LEU A  1 46  ? 10.076  17.191  151.326 1.00 38.35  ? 47  LEU A CA  1 
ATOM   342   C C   . LEU A  1 46  ? 10.999  18.197  151.999 1.00 39.35  ? 47  LEU A C   1 
ATOM   343   O O   . LEU A  1 46  ? 11.149  18.181  153.222 1.00 39.25  ? 47  LEU A O   1 
ATOM   344   C CB  . LEU A  1 46  ? 10.905  16.460  150.258 1.00 37.77  ? 47  LEU A CB  1 
ATOM   345   C CG  . LEU A  1 46  ? 10.441  15.123  149.667 1.00 34.87  ? 47  LEU A CG  1 
ATOM   346   C CD1 . LEU A  1 46  ? 11.532  14.543  148.777 1.00 36.73  ? 47  LEU A CD1 1 
ATOM   347   C CD2 . LEU A  1 46  ? 10.076  14.136  150.774 1.00 34.85  ? 47  LEU A CD2 1 
ATOM   348   N N   . ILE A  1 47  ? 11.639  19.046  151.190 1.00 40.16  ? 48  ILE A N   1 
ATOM   349   C CA  . ILE A  1 47  ? 12.545  20.055  151.748 1.00 41.52  ? 48  ILE A CA  1 
ATOM   350   C C   . ILE A  1 47  ? 12.135  21.488  151.396 1.00 42.22  ? 48  ILE A C   1 
ATOM   351   O O   . ILE A  1 47  ? 11.382  21.738  150.456 1.00 44.84  ? 48  ILE A O   1 
ATOM   352   C CB  . ILE A  1 47  ? 14.003  19.900  151.273 1.00 40.33  ? 48  ILE A CB  1 
ATOM   353   C CG1 . ILE A  1 47  ? 14.462  18.457  151.427 1.00 40.77  ? 48  ILE A CG1 1 
ATOM   354   C CG2 . ILE A  1 47  ? 14.914  20.850  152.044 1.00 38.53  ? 48  ILE A CG2 1 
ATOM   355   C CD1 . ILE A  1 47  ? 15.868  18.218  150.936 1.00 40.24  ? 48  ILE A CD1 1 
ATOM   356   N N   . TYR A  1 48  ? 12.656  22.413  152.192 1.00 41.39  ? 49  TYR A N   1 
ATOM   357   C CA  . TYR A  1 48  ? 12.408  23.843  152.094 1.00 41.97  ? 49  TYR A CA  1 
ATOM   358   C C   . TYR A  1 48  ? 13.557  24.496  152.832 1.00 44.93  ? 49  TYR A C   1 
ATOM   359   O O   . TYR A  1 48  ? 14.283  23.819  153.560 1.00 46.24  ? 49  TYR A O   1 
ATOM   360   C CB  . TYR A  1 48  ? 11.103  24.209  152.788 1.00 39.71  ? 49  TYR A CB  1 
ATOM   361   C CG  . TYR A  1 48  ? 11.143  24.035  154.290 1.00 40.05  ? 49  TYR A CG  1 
ATOM   362   C CD1 . TYR A  1 48  ? 11.684  25.025  155.101 1.00 40.03  ? 49  TYR A CD1 1 
ATOM   363   C CD2 . TYR A  1 48  ? 10.663  22.882  154.901 1.00 39.63  ? 49  TYR A CD2 1 
ATOM   364   C CE1 . TYR A  1 48  ? 11.747  24.879  156.470 1.00 39.02  ? 49  TYR A CE1 1 
ATOM   365   C CE2 . TYR A  1 48  ? 10.726  22.725  156.268 1.00 38.08  ? 49  TYR A CE2 1 
ATOM   366   C CZ  . TYR A  1 48  ? 11.270  23.728  157.048 1.00 39.53  ? 49  TYR A CZ  1 
ATOM   367   O OH  . TYR A  1 48  ? 11.347  23.579  158.413 1.00 41.29  ? 49  TYR A OH  1 
ATOM   368   N N   . ALA A  1 49  ? 13.723  25.805  152.644 1.00 45.84  ? 50  ALA A N   1 
ATOM   369   C CA  . ALA A  1 49  ? 14.810  26.542  153.284 1.00 44.22  ? 50  ALA A CA  1 
ATOM   370   C C   . ALA A  1 49  ? 16.136  26.047  152.691 1.00 44.33  ? 50  ALA A C   1 
ATOM   371   O O   . ALA A  1 49  ? 17.163  26.005  153.382 1.00 44.91  ? 50  ALA A O   1 
ATOM   372   C CB  . ALA A  1 49  ? 14.778  26.312  154.791 1.00 42.17  ? 50  ALA A CB  1 
ATOM   373   N N   . ALA A  1 50  ? 16.105  25.655  151.417 1.00 43.77  ? 51  ALA A N   1 
ATOM   374   C CA  . ALA A  1 50  ? 17.301  25.130  150.763 1.00 44.53  ? 51  ALA A CA  1 
ATOM   375   C C   . ALA A  1 50  ? 17.748  23.764  151.366 1.00 45.14  ? 51  ALA A C   1 
ATOM   376   O O   . ALA A  1 50  ? 17.959  22.810  150.599 1.00 45.52  ? 51  ALA A O   1 
ATOM   377   C CB  . ALA A  1 50  ? 18.436  26.136  150.884 1.00 43.54  ? 51  ALA A CB  1 
ATOM   378   N N   . SER A  1 51  ? 17.869  23.670  152.708 1.00 46.04  ? 52  SER A N   1 
ATOM   379   C CA  . SER A  1 51  ? 18.342  22.438  153.397 1.00 47.23  ? 52  SER A CA  1 
ATOM   380   C C   . SER A  1 51  ? 17.500  21.916  154.582 1.00 46.50  ? 52  SER A C   1 
ATOM   381   O O   . SER A  1 51  ? 18.016  21.083  155.330 1.00 46.12  ? 52  SER A O   1 
ATOM   382   C CB  . SER A  1 51  ? 19.760  22.670  153.946 1.00 47.85  ? 52  SER A CB  1 
ATOM   383   O OG  . SER A  1 51  ? 19.730  23.442  155.136 1.00 50.96  ? 52  SER A OG  1 
ATOM   384   N N   . SER A  1 52  ? 16.234  22.324  154.770 1.00 45.32  ? 53  SER A N   1 
ATOM   385   C CA  . SER A  1 52  ? 15.487  21.917  156.001 1.00 44.43  ? 53  SER A CA  1 
ATOM   386   C C   . SER A  1 52  ? 14.327  20.898  155.873 1.00 43.32  ? 53  SER A C   1 
ATOM   387   O O   . SER A  1 52  ? 13.207  21.252  155.501 1.00 44.77  ? 53  SER A O   1 
ATOM   388   C CB  . SER A  1 52  ? 14.973  23.179  156.702 1.00 44.13  ? 53  SER A CB  1 
ATOM   389   O OG  . SER A  1 52  ? 15.971  24.191  156.740 1.00 44.86  ? 53  SER A OG  1 
ATOM   390   N N   . LEU A  1 53  ? 14.620  19.631  156.183 1.00 41.22  ? 54  LEU A N   1 
ATOM   391   C CA  . LEU A  1 53  ? 13.655  18.525  156.117 1.00 39.70  ? 54  LEU A CA  1 
ATOM   392   C C   . LEU A  1 53  ? 12.262  18.745  156.716 1.00 40.19  ? 54  LEU A C   1 
ATOM   393   O O   . LEU A  1 53  ? 12.103  19.052  157.902 1.00 40.42  ? 54  LEU A O   1 
ATOM   394   C CB  . LEU A  1 53  ? 14.238  17.283  156.765 1.00 38.87  ? 54  LEU A CB  1 
ATOM   395   C CG  . LEU A  1 53  ? 15.421  16.657  156.070 1.00 40.39  ? 54  LEU A CG  1 
ATOM   396   C CD1 . LEU A  1 53  ? 16.569  17.631  156.090 1.00 42.32  ? 54  LEU A CD1 1 
ATOM   397   C CD2 . LEU A  1 53  ? 15.801  15.361  156.775 1.00 42.92  ? 54  LEU A CD2 1 
ATOM   398   N N   . GLN A  1 54  ? 11.242  18.546  155.893 1.00 39.81  ? 55  GLN A N   1 
ATOM   399   C CA  . GLN A  1 54  ? 9.881   18.710  156.353 1.00 40.15  ? 55  GLN A CA  1 
ATOM   400   C C   . GLN A  1 54  ? 9.648   17.697  157.448 1.00 40.61  ? 55  GLN A C   1 
ATOM   401   O O   . GLN A  1 54  ? 10.464  16.812  157.660 1.00 41.12  ? 55  GLN A O   1 
ATOM   402   C CB  . GLN A  1 54  ? 8.894   18.472  155.216 1.00 40.72  ? 55  GLN A CB  1 
ATOM   403   C CG  . GLN A  1 54  ? 7.578   19.139  155.479 1.00 43.11  ? 55  GLN A CG  1 
ATOM   404   C CD  . GLN A  1 54  ? 7.785   20.473  156.174 1.00 44.42  ? 55  GLN A CD  1 
ATOM   405   O OE1 . GLN A  1 54  ? 7.962   20.520  157.397 1.00 47.46  ? 55  GLN A OE1 1 
ATOM   406   N NE2 . GLN A  1 54  ? 7.798   21.560  155.401 1.00 43.21  ? 55  GLN A NE2 1 
ATOM   407   N N   . SER A  1 55  ? 8.542   17.822  158.155 1.00 41.76  ? 56  SER A N   1 
ATOM   408   C CA  . SER A  1 55  ? 8.271   16.868  159.210 1.00 43.80  ? 56  SER A CA  1 
ATOM   409   C C   . SER A  1 55  ? 7.864   15.524  158.621 1.00 42.73  ? 56  SER A C   1 
ATOM   410   O O   . SER A  1 55  ? 7.120   15.461  157.655 1.00 42.07  ? 56  SER A O   1 
ATOM   411   C CB  . SER A  1 55  ? 7.184   17.399  160.165 1.00 46.53  ? 56  SER A CB  1 
ATOM   412   O OG  . SER A  1 55  ? 7.748   18.033  161.315 1.00 46.98  ? 56  SER A OG  1 
ATOM   413   N N   . GLY A  1 56  ? 8.385   14.455  159.215 1.00 42.91  ? 57  GLY A N   1 
ATOM   414   C CA  . GLY A  1 56  ? 8.094   13.103  158.771 1.00 41.87  ? 57  GLY A CA  1 
ATOM   415   C C   . GLY A  1 56  ? 9.022   12.580  157.689 1.00 41.23  ? 57  GLY A C   1 
ATOM   416   O O   . GLY A  1 56  ? 8.790   11.496  157.157 1.00 41.03  ? 57  GLY A O   1 
ATOM   417   N N   . VAL A  1 57  ? 10.084  13.318  157.372 1.00 40.84  ? 58  VAL A N   1 
ATOM   418   C CA  . VAL A  1 57  ? 10.984  12.895  156.303 1.00 41.28  ? 58  VAL A CA  1 
ATOM   419   C C   . VAL A  1 57  ? 12.190  12.067  156.737 1.00 42.26  ? 58  VAL A C   1 
ATOM   420   O O   . VAL A  1 57  ? 12.995  12.508  157.560 1.00 43.81  ? 58  VAL A O   1 
ATOM   421   C CB  . VAL A  1 57  ? 11.477  14.113  155.485 1.00 40.15  ? 58  VAL A CB  1 
ATOM   422   C CG1 . VAL A  1 57  ? 12.053  13.651  154.167 1.00 38.89  ? 58  VAL A CG1 1 
ATOM   423   C CG2 . VAL A  1 57  ? 10.334  15.058  155.224 1.00 39.63  ? 58  VAL A CG2 1 
ATOM   424   N N   . PRO A  1 58  ? 12.333  10.855  156.174 1.00 41.41  ? 59  PRO A N   1 
ATOM   425   C CA  . PRO A  1 58  ? 13.414  9.912   156.452 1.00 42.56  ? 59  PRO A CA  1 
ATOM   426   C C   . PRO A  1 58  ? 14.774  10.581  156.356 1.00 43.28  ? 59  PRO A C   1 
ATOM   427   O O   . PRO A  1 58  ? 14.969  11.448  155.516 1.00 44.24  ? 59  PRO A O   1 
ATOM   428   C CB  . PRO A  1 58  ? 13.208  8.849   155.381 1.00 42.91  ? 59  PRO A CB  1 
ATOM   429   C CG  . PRO A  1 58  ? 11.745  8.822   155.237 1.00 41.90  ? 59  PRO A CG  1 
ATOM   430   C CD  . PRO A  1 58  ? 11.417  10.290  155.175 1.00 41.30  ? 59  PRO A CD  1 
ATOM   431   N N   . SER A  1 59  ? 15.716  10.154  157.197 1.00 44.16  ? 60  SER A N   1 
ATOM   432   C CA  . SER A  1 59  ? 17.061  10.755  157.251 1.00 43.71  ? 60  SER A CA  1 
ATOM   433   C C   . SER A  1 59  ? 17.946  10.550  156.034 1.00 42.55  ? 60  SER A C   1 
ATOM   434   O O   . SER A  1 59  ? 19.075  11.049  155.993 1.00 40.31  ? 60  SER A O   1 
ATOM   435   C CB  . SER A  1 59  ? 17.819  10.271  158.501 1.00 44.09  ? 60  SER A CB  1 
ATOM   436   O OG  . SER A  1 59  ? 18.237  8.919   158.374 1.00 44.75  ? 60  SER A OG  1 
ATOM   437   N N   . ARG A  1 60  ? 17.449  9.807   155.051 1.00 42.58  ? 61  ARG A N   1 
ATOM   438   C CA  . ARG A  1 60  ? 18.241  9.597   153.856 1.00 43.26  ? 61  ARG A CA  1 
ATOM   439   C C   . ARG A  1 60  ? 18.143  10.845  153.004 1.00 44.03  ? 61  ARG A C   1 
ATOM   440   O O   . ARG A  1 60  ? 19.043  11.147  152.193 1.00 45.03  ? 61  ARG A O   1 
ATOM   441   C CB  . ARG A  1 60  ? 17.789  8.350   153.084 1.00 42.12  ? 61  ARG A CB  1 
ATOM   442   C CG  . ARG A  1 60  ? 16.324  8.097   152.898 1.00 40.07  ? 61  ARG A CG  1 
ATOM   443   C CD  . ARG A  1 60  ? 16.224  6.624   152.510 1.00 41.20  ? 61  ARG A CD  1 
ATOM   444   N NE  . ARG A  1 60  ? 14.987  6.235   151.842 1.00 41.45  ? 61  ARG A NE  1 
ATOM   445   C CZ  . ARG A  1 60  ? 13.819  6.068   152.448 1.00 39.73  ? 61  ARG A CZ  1 
ATOM   446   N NH1 . ARG A  1 60  ? 13.698  6.251   153.751 1.00 38.91  ? 61  ARG A NH1 1 
ATOM   447   N NH2 . ARG A  1 60  ? 12.767  5.711   151.742 1.00 40.48  ? 61  ARG A NH2 1 
ATOM   448   N N   . PHE A  1 61  ? 17.063  11.590  153.233 1.00 42.21  ? 62  PHE A N   1 
ATOM   449   C CA  . PHE A  1 61  ? 16.825  12.828  152.518 1.00 40.38  ? 62  PHE A CA  1 
ATOM   450   C C   . PHE A  1 61  ? 17.557  13.997  153.163 1.00 40.39  ? 62  PHE A C   1 
ATOM   451   O O   . PHE A  1 61  ? 17.517  14.188  154.378 1.00 39.14  ? 62  PHE A O   1 
ATOM   452   C CB  . PHE A  1 61  ? 15.327  13.116  152.454 1.00 38.75  ? 62  PHE A CB  1 
ATOM   453   C CG  . PHE A  1 61  ? 14.562  12.139  151.629 1.00 35.76  ? 62  PHE A CG  1 
ATOM   454   C CD1 . PHE A  1 61  ? 14.441  10.816  152.033 1.00 35.51  ? 62  PHE A CD1 1 
ATOM   455   C CD2 . PHE A  1 61  ? 13.988  12.533  150.430 1.00 35.58  ? 62  PHE A CD2 1 
ATOM   456   C CE1 . PHE A  1 61  ? 13.759  9.896   151.250 1.00 36.32  ? 62  PHE A CE1 1 
ATOM   457   C CE2 . PHE A  1 61  ? 13.302  11.620  149.632 1.00 36.04  ? 62  PHE A CE2 1 
ATOM   458   C CZ  . PHE A  1 61  ? 13.187  10.300  150.043 1.00 36.68  ? 62  PHE A CZ  1 
ATOM   459   N N   . SER A  1 62  ? 18.252  14.757  152.323 1.00 42.13  ? 63  SER A N   1 
ATOM   460   C CA  . SER A  1 62  ? 18.994  15.930  152.752 1.00 44.32  ? 63  SER A CA  1 
ATOM   461   C C   . SER A  1 62  ? 19.117  16.914  151.589 1.00 45.31  ? 63  SER A C   1 
ATOM   462   O O   . SER A  1 62  ? 19.425  16.522  150.470 1.00 45.23  ? 63  SER A O   1 
ATOM   463   C CB  . SER A  1 62  ? 20.396  15.546  153.265 1.00 43.98  ? 63  SER A CB  1 
ATOM   464   O OG  . SER A  1 62  ? 21.161  14.858  152.295 1.00 44.77  ? 63  SER A OG  1 
ATOM   465   N N   . GLY A  1 63  ? 18.806  18.180  151.877 1.00 46.98  ? 64  GLY A N   1 
ATOM   466   C CA  . GLY A  1 63  ? 18.944  19.305  150.951 1.00 47.54  ? 64  GLY A CA  1 
ATOM   467   C C   . GLY A  1 63  ? 20.287  19.993  151.330 1.00 49.00  ? 64  GLY A C   1 
ATOM   468   O O   . GLY A  1 63  ? 20.781  19.747  152.445 1.00 49.92  ? 64  GLY A O   1 
ATOM   469   N N   . SER A  1 64  ? 20.846  20.856  150.455 1.00 50.92  ? 65  SER A N   1 
ATOM   470   C CA  . SER A  1 64  ? 22.198  21.479  150.580 1.00 52.68  ? 65  SER A CA  1 
ATOM   471   C C   . SER A  1 64  ? 22.380  22.537  149.483 1.00 52.85  ? 65  SER A C   1 
ATOM   472   O O   . SER A  1 64  ? 21.785  22.379  148.416 1.00 51.36  ? 65  SER A O   1 
ATOM   473   C CB  . SER A  1 64  ? 23.249  20.423  150.252 1.00 54.01  ? 65  SER A CB  1 
ATOM   474   O OG  . SER A  1 64  ? 24.107  20.184  151.342 1.00 58.40  ? 65  SER A OG  1 
ATOM   475   N N   . GLY A  1 65  ? 23.145  23.614  149.697 1.00 53.38  ? 66  GLY A N   1 
ATOM   476   C CA  . GLY A  1 65  ? 23.348  24.561  148.592 1.00 54.03  ? 66  GLY A CA  1 
ATOM   477   C C   . GLY A  1 65  ? 22.672  25.931  148.682 1.00 54.50  ? 66  GLY A C   1 
ATOM   478   O O   . GLY A  1 65  ? 21.564  26.091  149.197 1.00 53.59  ? 66  GLY A O   1 
ATOM   479   N N   . SER A  1 66  ? 23.380  26.901  148.109 1.00 55.85  ? 67  SER A N   1 
ATOM   480   C CA  . SER A  1 66  ? 23.011  28.296  148.037 1.00 56.00  ? 67  SER A CA  1 
ATOM   481   C C   . SER A  1 66  ? 23.043  28.881  146.641 1.00 55.96  ? 67  SER A C   1 
ATOM   482   O O   . SER A  1 66  ? 23.087  28.212  145.598 1.00 55.92  ? 67  SER A O   1 
ATOM   483   C CB  . SER A  1 66  ? 23.975  29.128  148.888 1.00 55.71  ? 67  SER A CB  1 
ATOM   484   O OG  . SER A  1 66  ? 25.227  29.298  148.231 1.00 57.55  ? 67  SER A OG  1 
ATOM   485   N N   . GLY A  1 67  ? 23.013  30.204  146.743 1.00 54.68  ? 68  GLY A N   1 
ATOM   486   C CA  . GLY A  1 67  ? 23.042  31.154  145.662 1.00 52.42  ? 68  GLY A CA  1 
ATOM   487   C C   . GLY A  1 67  ? 22.113  30.796  144.532 1.00 50.69  ? 68  GLY A C   1 
ATOM   488   O O   . GLY A  1 67  ? 20.898  31.047  144.565 1.00 49.48  ? 68  GLY A O   1 
ATOM   489   N N   . THR A  1 68  ? 22.704  30.173  143.528 1.00 49.09  ? 69  THR A N   1 
ATOM   490   C CA  . THR A  1 68  ? 21.965  29.820  142.336 1.00 49.35  ? 69  THR A CA  1 
ATOM   491   C C   . THR A  1 68  ? 21.844  28.329  142.066 1.00 48.98  ? 69  THR A C   1 
ATOM   492   O O   . THR A  1 68  ? 21.076  27.914  141.196 1.00 50.19  ? 69  THR A O   1 
ATOM   493   C CB  . THR A  1 68  ? 22.613  30.477  141.091 1.00 49.05  ? 69  THR A CB  1 
ATOM   494   O OG1 . THR A  1 68  ? 24.022  30.221  141.087 1.00 49.01  ? 69  THR A OG1 1 
ATOM   495   C CG2 . THR A  1 68  ? 22.367  31.981  141.102 1.00 48.73  ? 69  THR A CG2 1 
ATOM   496   N N   . ASP A  1 69  ? 22.597  27.517  142.792 1.00 47.24  ? 70  ASP A N   1 
ATOM   497   C CA  . ASP A  1 69  ? 22.578  26.089  142.526 1.00 45.77  ? 70  ASP A CA  1 
ATOM   498   C C   . ASP A  1 69  ? 22.274  25.269  143.775 1.00 43.97  ? 70  ASP A C   1 
ATOM   499   O O   . ASP A  1 69  ? 22.843  25.516  144.829 1.00 45.88  ? 70  ASP A O   1 
ATOM   500   C CB  . ASP A  1 69  ? 23.933  25.703  141.895 1.00 48.03  ? 70  ASP A CB  1 
ATOM   501   C CG  . ASP A  1 69  ? 24.288  26.566  140.674 1.00 49.78  ? 70  ASP A CG  1 
ATOM   502   O OD1 . ASP A  1 69  ? 25.462  26.546  140.263 1.00 49.53  ? 70  ASP A OD1 1 
ATOM   503   O OD2 . ASP A  1 69  ? 23.404  27.254  140.124 1.00 49.54  ? 70  ASP A OD2 1 
ATOM   504   N N   . PHE A  1 70  ? 21.374  24.295  143.660 1.00 40.95  ? 71  PHE A N   1 
ATOM   505   C CA  . PHE A  1 70  ? 20.995  23.487  144.817 1.00 39.45  ? 71  PHE A CA  1 
ATOM   506   C C   . PHE A  1 70  ? 20.971  21.974  144.613 1.00 37.23  ? 71  PHE A C   1 
ATOM   507   O O   . PHE A  1 70  ? 20.872  21.486  143.494 1.00 37.18  ? 71  PHE A O   1 
ATOM   508   C CB  . PHE A  1 70  ? 19.648  23.978  145.330 1.00 41.09  ? 71  PHE A CB  1 
ATOM   509   C CG  . PHE A  1 70  ? 19.607  25.461  145.537 1.00 43.98  ? 71  PHE A CG  1 
ATOM   510   C CD1 . PHE A  1 70  ? 19.653  26.329  144.445 1.00 45.20  ? 71  PHE A CD1 1 
ATOM   511   C CD2 . PHE A  1 70  ? 19.580  25.999  146.824 1.00 45.09  ? 71  PHE A CD2 1 
ATOM   512   C CE1 . PHE A  1 70  ? 19.678  27.716  144.625 1.00 47.68  ? 71  PHE A CE1 1 
ATOM   513   C CE2 . PHE A  1 70  ? 19.603  27.382  147.025 1.00 46.38  ? 71  PHE A CE2 1 
ATOM   514   C CZ  . PHE A  1 70  ? 19.654  28.246  145.923 1.00 48.51  ? 71  PHE A CZ  1 
ATOM   515   N N   . THR A  1 71  ? 21.020  21.233  145.713 1.00 35.57  ? 72  THR A N   1 
ATOM   516   C CA  . THR A  1 71  ? 21.065  19.773  145.653 1.00 33.95  ? 72  THR A CA  1 
ATOM   517   C C   . THR A  1 71  ? 20.163  18.918  146.568 1.00 33.57  ? 72  THR A C   1 
ATOM   518   O O   . THR A  1 71  ? 20.161  19.085  147.789 1.00 34.43  ? 72  THR A O   1 
ATOM   519   C CB  . THR A  1 71  ? 22.523  19.312  145.897 1.00 33.79  ? 72  THR A CB  1 
ATOM   520   O OG1 . THR A  1 71  ? 23.095  18.867  144.667 1.00 34.43  ? 72  THR A OG1 1 
ATOM   521   C CG2 . THR A  1 71  ? 22.592  18.197  146.953 1.00 32.15  ? 72  THR A CG2 1 
ATOM   522   N N   . LEU A  1 72  ? 19.403  17.999  145.982 1.00 31.89  ? 73  LEU A N   1 
ATOM   523   C CA  . LEU A  1 72  ? 18.612  17.087  146.790 1.00 32.66  ? 73  LEU A CA  1 
ATOM   524   C C   . LEU A  1 72  ? 19.426  15.823  146.789 1.00 33.23  ? 73  LEU A C   1 
ATOM   525   O O   . LEU A  1 72  ? 19.600  15.190  145.761 1.00 31.61  ? 73  LEU A O   1 
ATOM   526   C CB  . LEU A  1 72  ? 17.253  16.773  146.192 1.00 33.97  ? 73  LEU A CB  1 
ATOM   527   C CG  . LEU A  1 72  ? 16.597  15.607  146.951 1.00 32.73  ? 73  LEU A CG  1 
ATOM   528   C CD1 . LEU A  1 72  ? 16.478  16.009  148.401 1.00 35.30  ? 73  LEU A CD1 1 
ATOM   529   C CD2 . LEU A  1 72  ? 15.228  15.260  146.395 1.00 33.30  ? 73  LEU A CD2 1 
ATOM   530   N N   . THR A  1 73  ? 19.933  15.446  147.950 1.00 34.51  ? 74  THR A N   1 
ATOM   531   C CA  . THR A  1 73  ? 20.778  14.275  147.978 1.00 35.40  ? 74  THR A CA  1 
ATOM   532   C C   . THR A  1 73  ? 20.170  13.122  148.708 1.00 36.34  ? 74  THR A C   1 
ATOM   533   O O   . THR A  1 73  ? 19.831  13.229  149.886 1.00 35.66  ? 74  THR A O   1 
ATOM   534   C CB  . THR A  1 73  ? 22.136  14.604  148.648 1.00 35.84  ? 74  THR A CB  1 
ATOM   535   O OG1 . THR A  1 73  ? 22.302  16.033  148.716 1.00 36.16  ? 74  THR A OG1 1 
ATOM   536   C CG2 . THR A  1 73  ? 23.278  13.983  147.867 1.00 34.65  ? 74  THR A CG2 1 
ATOM   537   N N   . ILE A  1 74  ? 19.994  11.992  148.060 1.00 38.41  ? 75  ILE A N   1 
ATOM   538   C CA  . ILE A  1 74  ? 19.545  10.973  148.962 1.00 41.59  ? 75  ILE A CA  1 
ATOM   539   C C   . ILE A  1 74  ? 20.588  9.874   149.165 1.00 44.53  ? 75  ILE A C   1 
ATOM   540   O O   . ILE A  1 74  ? 21.196  9.342   148.214 1.00 46.44  ? 75  ILE A O   1 
ATOM   541   C CB  . ILE A  1 74  ? 18.141  10.424  148.648 1.00 40.30  ? 75  ILE A CB  1 
ATOM   542   C CG1 . ILE A  1 74  ? 18.116  8.919   148.888 1.00 40.03  ? 75  ILE A CG1 1 
ATOM   543   C CG2 . ILE A  1 74  ? 17.749  10.746  147.227 1.00 40.96  ? 75  ILE A CG2 1 
ATOM   544   C CD1 . ILE A  1 74  ? 16.717  8.359   149.044 1.00 40.76  ? 75  ILE A CD1 1 
ATOM   545   N N   . SER A  1 75  ? 20.726  9.600   150.476 1.00 46.87  ? 76  SER A N   1 
ATOM   546   C CA  . SER A  1 75  ? 21.592  8.654   151.248 1.00 48.23  ? 76  SER A CA  1 
ATOM   547   C C   . SER A  1 75  ? 21.732  7.230   150.757 1.00 49.74  ? 76  SER A C   1 
ATOM   548   O O   . SER A  1 75  ? 22.801  6.831   150.306 1.00 50.72  ? 76  SER A O   1 
ATOM   549   C CB  . SER A  1 75  ? 21.113  8.600   152.702 1.00 48.41  ? 76  SER A CB  1 
ATOM   550   O OG  . SER A  1 75  ? 20.225  7.511   152.909 1.00 48.26  ? 76  SER A OG  1 
ATOM   551   N N   . SER A  1 76  ? 20.648  6.465   150.847 1.00 50.97  ? 77  SER A N   1 
ATOM   552   C CA  . SER A  1 76  ? 20.613  5.096   150.329 1.00 50.77  ? 77  SER A CA  1 
ATOM   553   C C   . SER A  1 76  ? 19.251  5.147   149.708 1.00 50.68  ? 77  SER A C   1 
ATOM   554   O O   . SER A  1 76  ? 18.469  6.021   150.042 1.00 51.96  ? 77  SER A O   1 
ATOM   555   C CB  . SER A  1 76  ? 20.714  4.031   151.407 1.00 51.43  ? 77  SER A CB  1 
ATOM   556   O OG  . SER A  1 76  ? 20.780  2.735   150.829 1.00 50.95  ? 77  SER A OG  1 
ATOM   557   N N   . LEU A  1 77  ? 18.910  4.258   148.810 1.00 50.89  ? 78  LEU A N   1 
ATOM   558   C CA  . LEU A  1 77  ? 17.656  4.450   148.077 1.00 52.04  ? 78  LEU A CA  1 
ATOM   559   C C   . LEU A  1 77  ? 16.543  3.477   148.290 1.00 52.20  ? 78  LEU A C   1 
ATOM   560   O O   . LEU A  1 77  ? 16.824  2.308   148.310 1.00 52.33  ? 78  LEU A O   1 
ATOM   561   C CB  . LEU A  1 77  ? 17.958  4.331   146.621 1.00 50.26  ? 78  LEU A CB  1 
ATOM   562   C CG  . LEU A  1 77  ? 18.087  5.623   145.850 1.00 50.21  ? 78  LEU A CG  1 
ATOM   563   C CD1 . LEU A  1 77  ? 18.106  5.353   144.363 1.00 46.94  ? 78  LEU A CD1 1 
ATOM   564   C CD2 . LEU A  1 77  ? 16.945  6.558   146.214 1.00 48.83  ? 78  LEU A CD2 1 
ATOM   565   N N   . GLN A  1 78  ? 15.266  3.822   148.374 1.00 53.24  ? 79  GLN A N   1 
ATOM   566   C CA  . GLN A  1 78  ? 14.295  2.722   148.637 1.00 53.47  ? 79  GLN A CA  1 
ATOM   567   C C   . GLN A  1 78  ? 13.109  2.598   147.676 1.00 53.85  ? 79  GLN A C   1 
ATOM   568   O O   . GLN A  1 78  ? 12.810  3.528   146.933 1.00 53.85  ? 79  GLN A O   1 
ATOM   569   C CB  . GLN A  1 78  ? 13.850  2.806   150.064 1.00 53.22  ? 79  GLN A CB  1 
ATOM   570   C CG  . GLN A  1 78  ? 14.976  2.717   151.082 1.00 52.20  ? 79  GLN A CG  1 
ATOM   571   C CD  . GLN A  1 78  ? 14.366  2.388   152.475 1.00 52.12  ? 79  GLN A CD  1 
ATOM   572   O OE1 . GLN A  1 78  ? 13.207  2.115   152.525 1.00 53.37  ? 79  GLN A OE1 1 
ATOM   573   N NE2 . GLN A  1 78  ? 15.125  2.407   153.550 1.00 51.81  ? 79  GLN A NE2 1 
ATOM   574   N N   . PRO A  1 79  ? 12.404  1.474   147.712 1.00 54.47  ? 80  PRO A N   1 
ATOM   575   C CA  . PRO A  1 79  ? 11.308  1.289   146.765 1.00 53.78  ? 80  PRO A CA  1 
ATOM   576   C C   . PRO A  1 79  ? 10.339  2.452   146.475 1.00 52.03  ? 80  PRO A C   1 
ATOM   577   O O   . PRO A  1 79  ? 9.814   2.647   145.382 1.00 52.87  ? 80  PRO A O   1 
ATOM   578   C CB  . PRO A  1 79  ? 10.704  -0.030  147.256 1.00 53.67  ? 80  PRO A CB  1 
ATOM   579   C CG  . PRO A  1 79  ? 11.959  -0.781  147.689 1.00 54.70  ? 80  PRO A CG  1 
ATOM   580   C CD  . PRO A  1 79  ? 13.014  0.201   148.098 1.00 54.69  ? 80  PRO A CD  1 
ATOM   581   N N   . GLU A  1 80  ? 10.259  3.248   147.525 1.00 50.46  ? 81  GLU A N   1 
ATOM   582   C CA  . GLU A  1 80  ? 9.359   4.344   147.817 1.00 51.16  ? 81  GLU A CA  1 
ATOM   583   C C   . GLU A  1 80  ? 9.809   5.700   147.290 1.00 50.69  ? 81  GLU A C   1 
ATOM   584   O O   . GLU A  1 80  ? 8.955   6.581   147.005 1.00 50.57  ? 81  GLU A O   1 
ATOM   585   C CB  . GLU A  1 80  ? 9.196   4.427   149.361 1.00 52.11  ? 81  GLU A CB  1 
ATOM   586   C CG  . GLU A  1 80  ? 9.017   3.082   150.046 1.00 53.99  ? 81  GLU A CG  1 
ATOM   587   C CD  . GLU A  1 80  ? 9.823   2.967   151.323 1.00 57.07  ? 81  GLU A CD  1 
ATOM   588   O OE1 . GLU A  1 80  ? 11.043  2.710   151.235 1.00 59.28  ? 81  GLU A OE1 1 
ATOM   589   O OE2 . GLU A  1 80  ? 9.238   3.138   152.416 1.00 59.24  ? 81  GLU A OE2 1 
ATOM   590   N N   . ASP A  1 81  ? 11.139  5.897   147.256 1.00 49.73  ? 82  ASP A N   1 
ATOM   591   C CA  . ASP A  1 81  ? 11.859  7.110   146.843 1.00 49.39  ? 82  ASP A CA  1 
ATOM   592   C C   . ASP A  1 81  ? 11.869  7.309   145.340 1.00 49.22  ? 82  ASP A C   1 
ATOM   593   O O   . ASP A  1 81  ? 12.223  8.378   144.827 1.00 49.16  ? 82  ASP A O   1 
ATOM   594   C CB  . ASP A  1 81  ? 13.273  7.021   147.410 1.00 48.68  ? 82  ASP A CB  1 
ATOM   595   C CG  . ASP A  1 81  ? 13.254  6.839   148.918 1.00 48.57  ? 82  ASP A CG  1 
ATOM   596   O OD1 . ASP A  1 81  ? 12.224  7.210   149.532 1.00 48.92  ? 82  ASP A OD1 1 
ATOM   597   O OD2 . ASP A  1 81  ? 14.242  6.327   149.484 1.00 49.11  ? 82  ASP A OD2 1 
ATOM   598   N N   . PHE A  1 82  ? 11.465  6.261   144.637 1.00 48.87  ? 83  PHE A N   1 
ATOM   599   C CA  . PHE A  1 82  ? 11.348  6.313   143.190 1.00 49.52  ? 83  PHE A CA  1 
ATOM   600   C C   . PHE A  1 82  ? 10.022  6.994   142.874 1.00 47.92  ? 83  PHE A C   1 
ATOM   601   O O   . PHE A  1 82  ? 8.962   6.355   142.736 1.00 48.23  ? 83  PHE A O   1 
ATOM   602   C CB  . PHE A  1 82  ? 11.388  4.915   142.602 1.00 53.01  ? 83  PHE A CB  1 
ATOM   603   C CG  . PHE A  1 82  ? 12.729  4.291   142.686 1.00 57.70  ? 83  PHE A CG  1 
ATOM   604   C CD1 . PHE A  1 82  ? 13.867  5.081   142.756 1.00 59.15  ? 83  PHE A CD1 1 
ATOM   605   C CD2 . PHE A  1 82  ? 12.869  2.958   142.626 1.00 59.57  ? 83  PHE A CD2 1 
ATOM   606   C CE1 . PHE A  1 82  ? 15.127  4.508   142.741 1.00 60.06  ? 83  PHE A CE1 1 
ATOM   607   C CE2 . PHE A  1 82  ? 14.156  2.373   142.609 1.00 60.60  ? 83  PHE A CE2 1 
ATOM   608   C CZ  . PHE A  1 82  ? 15.255  3.142   142.660 1.00 60.55  ? 83  PHE A CZ  1 
ATOM   609   N N   . ALA A  1 83  ? 10.106  8.318   142.809 1.00 43.20  ? 84  ALA A N   1 
ATOM   610   C CA  . ALA A  1 83  ? 8.979   9.171   142.539 1.00 36.01  ? 84  ALA A CA  1 
ATOM   611   C C   . ALA A  1 83  ? 9.534   10.198  141.591 1.00 32.89  ? 84  ALA A C   1 
ATOM   612   O O   . ALA A  1 83  ? 10.505  9.934   140.878 1.00 30.58  ? 84  ALA A O   1 
ATOM   613   C CB  . ALA A  1 83  ? 8.527   9.828   143.816 1.00 34.09  ? 84  ALA A CB  1 
ATOM   614   N N   . THR A  1 84  ? 8.909   11.370  141.586 1.00 30.64  ? 85  THR A N   1 
ATOM   615   C CA  . THR A  1 84  ? 9.351   12.479  140.753 1.00 28.91  ? 85  THR A CA  1 
ATOM   616   C C   . THR A  1 84  ? 9.597   13.614  141.705 1.00 26.37  ? 85  THR A C   1 
ATOM   617   O O   . THR A  1 84  ? 8.743   13.944  142.493 1.00 25.30  ? 85  THR A O   1 
ATOM   618   C CB  . THR A  1 84  ? 8.292   12.924  139.717 1.00 27.56  ? 85  THR A CB  1 
ATOM   619   O OG1 . THR A  1 84  ? 7.993   11.849  138.813 1.00 26.37  ? 85  THR A OG1 1 
ATOM   620   C CG2 . THR A  1 84  ? 8.818   14.083  138.932 1.00 25.85  ? 85  THR A CG2 1 
ATOM   621   N N   . TYR A  1 85  ? 10.783  14.188  141.650 1.00 26.79  ? 86  TYR A N   1 
ATOM   622   C CA  . TYR A  1 85  ? 11.104  15.282  142.538 1.00 28.86  ? 86  TYR A CA  1 
ATOM   623   C C   . TYR A  1 85  ? 11.145  16.566  141.713 1.00 30.13  ? 86  TYR A C   1 
ATOM   624   O O   . TYR A  1 85  ? 11.751  16.604  140.644 1.00 30.58  ? 86  TYR A O   1 
ATOM   625   C CB  . TYR A  1 85  ? 12.441  15.006  143.269 1.00 28.40  ? 86  TYR A CB  1 
ATOM   626   C CG  . TYR A  1 85  ? 12.411  13.754  144.138 1.00 26.41  ? 86  TYR A CG  1 
ATOM   627   C CD1 . TYR A  1 85  ? 12.530  12.490  143.575 1.00 27.27  ? 86  TYR A CD1 1 
ATOM   628   C CD2 . TYR A  1 85  ? 12.128  13.829  145.492 1.00 27.84  ? 86  TYR A CD2 1 
ATOM   629   C CE1 . TYR A  1 85  ? 12.353  11.324  144.328 1.00 26.56  ? 86  TYR A CE1 1 
ATOM   630   C CE2 . TYR A  1 85  ? 11.941  12.665  146.258 1.00 28.89  ? 86  TYR A CE2 1 
ATOM   631   C CZ  . TYR A  1 85  ? 12.049  11.417  145.660 1.00 28.41  ? 86  TYR A CZ  1 
ATOM   632   O OH  . TYR A  1 85  ? 11.792  10.276  146.375 1.00 27.80  ? 86  TYR A OH  1 
ATOM   633   N N   . TYR A  1 86  ? 10.456  17.593  142.210 1.00 31.00  ? 87  TYR A N   1 
ATOM   634   C CA  . TYR A  1 86  ? 10.353  18.907  141.561 1.00 31.39  ? 87  TYR A CA  1 
ATOM   635   C C   . TYR A  1 86  ? 10.950  19.970  142.466 1.00 33.13  ? 87  TYR A C   1 
ATOM   636   O O   . TYR A  1 86  ? 10.658  19.998  143.665 1.00 32.95  ? 87  TYR A O   1 
ATOM   637   C CB  . TYR A  1 86  ? 8.877   19.302  141.334 1.00 27.82  ? 87  TYR A CB  1 
ATOM   638   C CG  . TYR A  1 86  ? 8.096   18.448  140.364 1.00 26.37  ? 87  TYR A CG  1 
ATOM   639   C CD1 . TYR A  1 86  ? 7.361   17.346  140.791 1.00 25.60  ? 87  TYR A CD1 1 
ATOM   640   C CD2 . TYR A  1 86  ? 8.085   18.747  139.007 1.00 25.36  ? 87  TYR A CD2 1 
ATOM   641   C CE1 . TYR A  1 86  ? 6.633   16.573  139.881 1.00 23.48  ? 87  TYR A CE1 1 
ATOM   642   C CE2 . TYR A  1 86  ? 7.373   17.984  138.104 1.00 22.27  ? 87  TYR A CE2 1 
ATOM   643   C CZ  . TYR A  1 86  ? 6.653   16.911  138.542 1.00 22.31  ? 87  TYR A CZ  1 
ATOM   644   O OH  . TYR A  1 86  ? 5.953   16.190  137.620 1.00 23.18  ? 87  TYR A OH  1 
ATOM   645   N N   . CYS A  1 87  ? 11.771  20.857  141.926 1.00 34.25  ? 88  CYS A N   1 
ATOM   646   C CA  . CYS A  1 87  ? 12.289  21.904  142.792 1.00 36.13  ? 88  CYS A CA  1 
ATOM   647   C C   . CYS A  1 87  ? 11.491  23.130  142.488 1.00 33.75  ? 88  CYS A C   1 
ATOM   648   O O   . CYS A  1 87  ? 10.919  23.245  141.416 1.00 32.14  ? 88  CYS A O   1 
ATOM   649   C CB  . CYS A  1 87  ? 13.809  22.181  142.607 1.00 41.00  ? 88  CYS A CB  1 
ATOM   650   S SG  . CYS A  1 87  ? 14.287  22.872  141.011 1.00 47.71  ? 88  CYS A SG  1 
ATOM   651   N N   . GLN A  1 88  ? 11.441  24.035  143.449 1.00 33.00  ? 89  GLN A N   1 
ATOM   652   C CA  . GLN A  1 88  ? 10.684  25.242  143.276 1.00 34.34  ? 89  GLN A CA  1 
ATOM   653   C C   . GLN A  1 88  ? 11.359  26.438  143.897 1.00 35.26  ? 89  GLN A C   1 
ATOM   654   O O   . GLN A  1 88  ? 11.740  26.417  145.064 1.00 35.17  ? 89  GLN A O   1 
ATOM   655   C CB  . GLN A  1 88  ? 9.302   25.068  143.883 1.00 34.21  ? 89  GLN A CB  1 
ATOM   656   C CG  . GLN A  1 88  ? 8.497   26.340  143.945 1.00 37.90  ? 89  GLN A CG  1 
ATOM   657   C CD  . GLN A  1 88  ? 7.491   26.320  145.069 1.00 39.88  ? 89  GLN A CD  1 
ATOM   658   O OE1 . GLN A  1 88  ? 6.534   25.555  145.042 1.00 40.91  ? 89  GLN A OE1 1 
ATOM   659   N NE2 . GLN A  1 88  ? 7.708   27.157  146.074 1.00 40.88  ? 89  GLN A NE2 1 
ATOM   660   N N   . GLN A  1 89  ? 11.503  27.479  143.089 1.00 37.61  ? 90  GLN A N   1 
ATOM   661   C CA  . GLN A  1 89  ? 12.079  28.741  143.510 1.00 40.86  ? 90  GLN A CA  1 
ATOM   662   C C   . GLN A  1 89  ? 10.939  29.472  144.233 1.00 44.84  ? 90  GLN A C   1 
ATOM   663   O O   . GLN A  1 89  ? 9.850   29.673  143.666 1.00 44.16  ? 90  GLN A O   1 
ATOM   664   C CB  . GLN A  1 89  ? 12.535  29.532  142.279 1.00 41.48  ? 90  GLN A CB  1 
ATOM   665   C CG  . GLN A  1 89  ? 11.552  30.583  141.781 1.00 41.87  ? 90  GLN A CG  1 
ATOM   666   C CD  . GLN A  1 89  ? 11.538  31.795  142.694 1.00 43.65  ? 90  GLN A CD  1 
ATOM   667   O OE1 . GLN A  1 89  ? 11.986  31.724  143.834 1.00 40.43  ? 90  GLN A OE1 1 
ATOM   668   N NE2 . GLN A  1 89  ? 11.021  32.911  142.200 1.00 44.88  ? 90  GLN A NE2 1 
ATOM   669   N N   . SER A  1 90  ? 11.186  29.857  145.483 1.00 48.89  ? 91  SER A N   1 
ATOM   670   C CA  . SER A  1 90  ? 10.187  30.548  146.308 1.00 52.91  ? 91  SER A CA  1 
ATOM   671   C C   . SER A  1 90  ? 10.771  31.867  146.822 1.00 54.55  ? 91  SER A C   1 
ATOM   672   O O   . SER A  1 90  ? 10.470  32.321  147.931 1.00 53.75  ? 91  SER A O   1 
ATOM   673   C CB  . SER A  1 90  ? 9.791   29.652  147.492 1.00 53.78  ? 91  SER A CB  1 
ATOM   674   O OG  . SER A  1 90  ? 8.473   29.922  147.948 1.00 54.90  ? 91  SER A OG  1 
ATOM   675   N N   . TYR A  1 91  ? 11.595  32.474  145.975 1.00 57.07  ? 92  TYR A N   1 
ATOM   676   C CA  . TYR A  1 91  ? 12.299  33.717  146.271 1.00 59.12  ? 92  TYR A CA  1 
ATOM   677   C C   . TYR A  1 91  ? 11.667  34.949  145.636 1.00 59.90  ? 92  TYR A C   1 
ATOM   678   O O   . TYR A  1 91  ? 11.392  35.930  146.319 1.00 59.90  ? 92  TYR A O   1 
ATOM   679   C CB  . TYR A  1 91  ? 13.746  33.576  145.792 1.00 59.23  ? 92  TYR A CB  1 
ATOM   680   C CG  . TYR A  1 91  ? 14.633  34.775  146.013 1.00 59.18  ? 92  TYR A CG  1 
ATOM   681   C CD1 . TYR A  1 91  ? 14.898  35.249  147.302 1.00 58.99  ? 92  TYR A CD1 1 
ATOM   682   C CD2 . TYR A  1 91  ? 15.266  35.396  144.933 1.00 59.23  ? 92  TYR A CD2 1 
ATOM   683   C CE1 . TYR A  1 91  ? 15.773  36.304  147.509 1.00 58.67  ? 92  TYR A CE1 1 
ATOM   684   C CE2 . TYR A  1 91  ? 16.143  36.449  145.126 1.00 58.97  ? 92  TYR A CE2 1 
ATOM   685   C CZ  . TYR A  1 91  ? 16.391  36.896  146.414 1.00 59.44  ? 92  TYR A CZ  1 
ATOM   686   O OH  . TYR A  1 91  ? 17.263  37.933  146.599 1.00 59.18  ? 92  TYR A OH  1 
ATOM   687   N N   . SER A  1 92  ? 11.439  34.892  144.329 1.00 60.83  ? 93  SER A N   1 
ATOM   688   C CA  . SER A  1 92  ? 10.864  36.017  143.609 1.00 61.97  ? 93  SER A CA  1 
ATOM   689   C C   . SER A  1 92  ? 9.410   36.243  143.995 1.00 62.29  ? 93  SER A C   1 
ATOM   690   O O   . SER A  1 92  ? 8.950   35.772  145.030 1.00 62.99  ? 93  SER A O   1 
ATOM   691   C CB  . SER A  1 92  ? 10.971  35.769  142.101 1.00 62.72  ? 93  SER A CB  1 
ATOM   692   O OG  . SER A  1 92  ? 10.517  36.886  141.355 1.00 65.42  ? 93  SER A OG  1 
ATOM   693   N N   . THR A  1 93  ? 8.699   36.988  143.159 1.00 62.94  ? 94  THR A N   1 
ATOM   694   C CA  . THR A  1 93  ? 7.283   37.277  143.363 1.00 62.21  ? 94  THR A CA  1 
ATOM   695   C C   . THR A  1 93  ? 6.493   36.084  142.860 1.00 61.13  ? 94  THR A C   1 
ATOM   696   O O   . THR A  1 93  ? 5.475   35.703  143.447 1.00 61.24  ? 94  THR A O   1 
ATOM   697   C CB  . THR A  1 93  ? 6.843   38.508  142.548 1.00 62.95  ? 94  THR A CB  1 
ATOM   698   O OG1 . THR A  1 93  ? 5.435   38.441  142.295 1.00 63.14  ? 94  THR A OG1 1 
ATOM   699   C CG2 . THR A  1 93  ? 7.580   38.553  141.219 1.00 62.92  ? 94  THR A CG2 1 
ATOM   700   N N   . SER A  1 94  ? 6.988   35.510  141.765 1.00 59.72  ? 95  SER A N   1 
ATOM   701   C CA  . SER A  1 94  ? 6.386   34.352  141.107 1.00 59.24  ? 95  SER A CA  1 
ATOM   702   C C   . SER A  1 94  ? 7.174   33.064  141.311 1.00 57.39  ? 95  SER A C   1 
ATOM   703   O O   . SER A  1 94  ? 8.166   32.844  140.626 1.00 57.82  ? 95  SER A O   1 
ATOM   704   C CB  . SER A  1 94  ? 6.265   34.617  139.602 1.00 60.89  ? 95  SER A CB  1 
ATOM   705   O OG  . SER A  1 94  ? 5.966   33.426  138.880 1.00 62.88  ? 95  SER A OG  1 
ATOM   706   N N   . HIS A  1 95  ? 6.729   32.212  142.232 1.00 55.55  ? 96  HIS A N   1 
ATOM   707   C CA  . HIS A  1 95  ? 7.420   30.955  142.488 1.00 54.69  ? 96  HIS A CA  1 
ATOM   708   C C   . HIS A  1 95  ? 7.564   30.229  141.168 1.00 52.92  ? 96  HIS A C   1 
ATOM   709   O O   . HIS A  1 95  ? 6.670   30.279  140.330 1.00 52.43  ? 96  HIS A O   1 
ATOM   710   C CB  . HIS A  1 95  ? 6.632   30.097  143.473 1.00 56.27  ? 96  HIS A CB  1 
ATOM   711   C CG  . HIS A  1 95  ? 6.447   30.736  144.813 1.00 58.60  ? 96  HIS A CG  1 
ATOM   712   N ND1 . HIS A  1 95  ? 5.692   30.162  145.816 1.00 59.91  ? 96  HIS A ND1 1 
ATOM   713   C CD2 . HIS A  1 95  ? 6.921   31.900  145.320 1.00 58.09  ? 96  HIS A CD2 1 
ATOM   714   C CE1 . HIS A  1 95  ? 5.709   30.944  146.881 1.00 59.46  ? 96  HIS A CE1 1 
ATOM   715   N NE2 . HIS A  1 95  ? 6.448   32.005  146.605 1.00 59.23  ? 96  HIS A NE2 1 
ATOM   716   N N   . THR A  1 96  ? 8.696   29.567  140.974 1.00 50.52  ? 97  THR A N   1 
ATOM   717   C CA  . THR A  1 96  ? 8.934   28.860  139.727 1.00 48.00  ? 97  THR A CA  1 
ATOM   718   C C   . THR A  1 96  ? 9.348   27.440  139.980 1.00 45.65  ? 97  THR A C   1 
ATOM   719   O O   . THR A  1 96  ? 10.078  27.164  140.914 1.00 47.71  ? 97  THR A O   1 
ATOM   720   C CB  . THR A  1 96  ? 10.062  29.502  138.933 1.00 48.65  ? 97  THR A CB  1 
ATOM   721   O OG1 . THR A  1 96  ? 9.619   30.742  138.377 1.00 49.94  ? 97  THR A OG1 1 
ATOM   722   C CG2 . THR A  1 96  ? 10.499  28.585  137.819 1.00 49.58  ? 97  THR A CG2 1 
ATOM   723   N N   . PHE A  1 97  ? 8.904   26.535  139.131 1.00 42.51  ? 98  PHE A N   1 
ATOM   724   C CA  . PHE A  1 97  ? 9.274   25.137  139.282 1.00 39.11  ? 98  PHE A CA  1 
ATOM   725   C C   . PHE A  1 97  ? 10.274  24.693  138.223 1.00 36.54  ? 98  PHE A C   1 
ATOM   726   O O   . PHE A  1 97  ? 10.383  25.310  137.157 1.00 36.33  ? 98  PHE A O   1 
ATOM   727   C CB  . PHE A  1 97  ? 8.040   24.240  139.170 1.00 38.02  ? 98  PHE A CB  1 
ATOM   728   C CG  . PHE A  1 97  ? 7.302   24.039  140.456 1.00 36.49  ? 98  PHE A CG  1 
ATOM   729   C CD1 . PHE A  1 97  ? 5.965   24.398  140.569 1.00 37.04  ? 98  PHE A CD1 1 
ATOM   730   C CD2 . PHE A  1 97  ? 7.913   23.422  141.530 1.00 37.79  ? 98  PHE A CD2 1 
ATOM   731   C CE1 . PHE A  1 97  ? 5.238   24.144  141.723 1.00 35.02  ? 98  PHE A CE1 1 
ATOM   732   C CE2 . PHE A  1 97  ? 7.197   23.165  142.688 1.00 39.07  ? 98  PHE A CE2 1 
ATOM   733   C CZ  . PHE A  1 97  ? 5.846   23.530  142.779 1.00 36.92  ? 98  PHE A CZ  1 
ATOM   734   N N   . GLY A  1 98  ? 11.003  23.625  138.537 1.00 34.11  ? 99  GLY A N   1 
ATOM   735   C CA  . GLY A  1 98  ? 11.938  23.040  137.596 1.00 32.11  ? 99  GLY A CA  1 
ATOM   736   C C   . GLY A  1 98  ? 11.080  22.020  136.870 1.00 29.83  ? 99  GLY A C   1 
ATOM   737   O O   . GLY A  1 98  ? 10.002  21.719  137.340 1.00 29.44  ? 99  GLY A O   1 
ATOM   738   N N   . GLN A  1 99  ? 11.513  21.484  135.742 1.00 30.65  ? 100 GLN A N   1 
ATOM   739   C CA  . GLN A  1 99  ? 10.673  20.520  135.029 1.00 31.75  ? 100 GLN A CA  1 
ATOM   740   C C   . GLN A  1 99  ? 10.421  19.162  135.714 1.00 31.97  ? 100 GLN A C   1 
ATOM   741   O O   . GLN A  1 99  ? 9.539   18.407  135.286 1.00 30.98  ? 100 GLN A O   1 
ATOM   742   C CB  . GLN A  1 99  ? 11.241  20.281  133.640 1.00 32.73  ? 100 GLN A CB  1 
ATOM   743   C CG  . GLN A  1 99  ? 12.727  20.031  133.657 1.00 37.62  ? 100 GLN A CG  1 
ATOM   744   C CD  . GLN A  1 99  ? 13.154  19.150  132.512 1.00 40.77  ? 100 GLN A CD  1 
ATOM   745   O OE1 . GLN A  1 99  ? 12.485  18.156  132.208 1.00 42.60  ? 100 GLN A OE1 1 
ATOM   746   N NE2 . GLN A  1 99  ? 14.271  19.494  131.870 1.00 41.39  ? 100 GLN A NE2 1 
ATOM   747   N N   . GLY A  1 100 ? 11.196  18.845  136.757 1.00 31.28  ? 101 GLY A N   1 
ATOM   748   C CA  . GLY A  1 100 ? 11.016  17.585  137.472 1.00 30.56  ? 101 GLY A CA  1 
ATOM   749   C C   . GLY A  1 100 ? 11.954  16.438  137.097 1.00 30.93  ? 101 GLY A C   1 
ATOM   750   O O   . GLY A  1 100 ? 12.333  16.294  135.936 1.00 31.30  ? 101 GLY A O   1 
ATOM   751   N N   . THR A  1 101 ? 12.307  15.596  138.071 1.00 30.28  ? 102 THR A N   1 
ATOM   752   C CA  . THR A  1 101 ? 13.205  14.471  137.822 1.00 29.76  ? 102 THR A CA  1 
ATOM   753   C C   . THR A  1 101 ? 12.651  13.134  138.270 1.00 30.47  ? 102 THR A C   1 
ATOM   754   O O   . THR A  1 101 ? 12.665  12.811  139.450 1.00 29.87  ? 102 THR A O   1 
ATOM   755   C CB  . THR A  1 101 ? 14.533  14.673  138.541 1.00 30.59  ? 102 THR A CB  1 
ATOM   756   O OG1 . THR A  1 101 ? 14.807  16.077  138.626 1.00 28.99  ? 102 THR A OG1 1 
ATOM   757   C CG2 . THR A  1 101 ? 15.671  13.957  137.786 1.00 29.12  ? 102 THR A CG2 1 
ATOM   758   N N   . LYS A  1 102 ? 12.179  12.343  137.322 1.00 32.75  ? 103 LYS A N   1 
ATOM   759   C CA  . LYS A  1 102 ? 11.621  11.030  137.644 1.00 35.44  ? 103 LYS A CA  1 
ATOM   760   C C   . LYS A  1 102 ? 12.705  9.985   137.882 1.00 35.10  ? 103 LYS A C   1 
ATOM   761   O O   . LYS A  1 102 ? 13.434  9.630   136.966 1.00 35.40  ? 103 LYS A O   1 
ATOM   762   C CB  . LYS A  1 102 ? 10.718  10.527  136.509 1.00 37.30  ? 103 LYS A CB  1 
ATOM   763   C CG  . LYS A  1 102 ? 9.278   10.271  136.915 1.00 40.09  ? 103 LYS A CG  1 
ATOM   764   C CD  . LYS A  1 102 ? 8.546   9.342   135.936 1.00 43.87  ? 103 LYS A CD  1 
ATOM   765   C CE  . LYS A  1 102 ? 9.236   7.968   135.835 1.00 47.39  ? 103 LYS A CE  1 
ATOM   766   N NZ  . LYS A  1 102 ? 8.395   6.897   135.187 1.00 49.13  ? 103 LYS A NZ  1 
ATOM   767   N N   . LEU A  1 103 ? 12.811  9.495   139.108 1.00 34.30  ? 104 LEU A N   1 
ATOM   768   C CA  . LEU A  1 103 ? 13.783  8.467   139.406 1.00 34.52  ? 104 LEU A CA  1 
ATOM   769   C C   . LEU A  1 103 ? 13.051  7.176   139.156 1.00 35.27  ? 104 LEU A C   1 
ATOM   770   O O   . LEU A  1 103 ? 12.011  6.956   139.747 1.00 36.78  ? 104 LEU A O   1 
ATOM   771   C CB  . LEU A  1 103 ? 14.174  8.468   140.875 1.00 36.70  ? 104 LEU A CB  1 
ATOM   772   C CG  . LEU A  1 103 ? 14.705  9.696   141.597 1.00 38.69  ? 104 LEU A CG  1 
ATOM   773   C CD1 . LEU A  1 103 ? 15.011  9.331   143.050 1.00 39.79  ? 104 LEU A CD1 1 
ATOM   774   C CD2 . LEU A  1 103 ? 15.931  10.202  140.909 1.00 40.57  ? 104 LEU A CD2 1 
ATOM   775   N N   . GLU A  1 104 ? 13.573  6.319   138.290 1.00 36.85  ? 105 GLU A N   1 
ATOM   776   C CA  . GLU A  1 104 ? 12.936  5.037   138.041 1.00 38.72  ? 105 GLU A CA  1 
ATOM   777   C C   . GLU A  1 104 ? 13.940  3.971   138.420 1.00 39.15  ? 105 GLU A C   1 
ATOM   778   O O   . GLU A  1 104 ? 15.135  4.246   138.469 1.00 39.67  ? 105 GLU A O   1 
ATOM   779   C CB  . GLU A  1 104 ? 12.519  4.892   136.572 1.00 40.66  ? 105 GLU A CB  1 
ATOM   780   C CG  . GLU A  1 104 ? 13.578  5.282   135.557 1.00 44.62  ? 105 GLU A CG  1 
ATOM   781   C CD  . GLU A  1 104 ? 14.116  4.107   134.747 1.00 46.06  ? 105 GLU A CD  1 
ATOM   782   O OE1 . GLU A  1 104 ? 14.867  3.289   135.319 1.00 47.32  ? 105 GLU A OE1 1 
ATOM   783   O OE2 . GLU A  1 104 ? 13.791  4.007   133.537 1.00 46.34  ? 105 GLU A OE2 1 
ATOM   784   N N   . ILE A  1 105 ? 13.454  2.761   138.692 1.00 39.21  ? 106 ILE A N   1 
ATOM   785   C CA  . ILE A  1 105 ? 14.307  1.646   139.088 1.00 37.33  ? 106 ILE A CA  1 
ATOM   786   C C   . ILE A  1 105 ? 15.095  0.994   137.959 1.00 34.93  ? 106 ILE A C   1 
ATOM   787   O O   . ILE A  1 105 ? 14.524  0.559   136.960 1.00 32.95  ? 106 ILE A O   1 
ATOM   788   C CB  . ILE A  1 105 ? 13.485  0.553   139.757 1.00 39.21  ? 106 ILE A CB  1 
ATOM   789   C CG1 . ILE A  1 105 ? 12.479  1.160   140.726 1.00 40.06  ? 106 ILE A CG1 1 
ATOM   790   C CG2 . ILE A  1 105 ? 14.422  -0.381  140.519 1.00 41.15  ? 106 ILE A CG2 1 
ATOM   791   C CD1 . ILE A  1 105 ? 13.001  1.289   142.105 1.00 41.90  ? 106 ILE A CD1 1 
ATOM   792   N N   . LYS A  1 106 ? 16.409  0.927   138.138 1.00 33.92  ? 107 LYS A N   1 
ATOM   793   C CA  . LYS A  1 106 ? 17.301  0.312   137.164 1.00 36.19  ? 107 LYS A CA  1 
ATOM   794   C C   . LYS A  1 106 ? 17.147  -1.205  137.327 1.00 36.53  ? 107 LYS A C   1 
ATOM   795   O O   . LYS A  1 106 ? 16.678  -1.661  138.363 1.00 38.19  ? 107 LYS A O   1 
ATOM   796   C CB  . LYS A  1 106 ? 18.746  0.726   137.452 1.00 37.17  ? 107 LYS A CB  1 
ATOM   797   C CG  . LYS A  1 106 ? 19.744  0.430   136.337 1.00 42.05  ? 107 LYS A CG  1 
ATOM   798   C CD  . LYS A  1 106 ? 21.181  0.743   136.777 1.00 46.43  ? 107 LYS A CD  1 
ATOM   799   C CE  . LYS A  1 106 ? 21.260  2.095   137.517 1.00 51.65  ? 107 LYS A CE  1 
ATOM   800   N NZ  . LYS A  1 106 ? 22.638  2.542   137.963 1.00 54.23  ? 107 LYS A NZ  1 
ATOM   801   N N   . ARG A  1 107 ? 17.533  -1.983  136.324 1.00 35.43  ? 108 ARG A N   1 
ATOM   802   C CA  . ARG A  1 107 ? 17.420  -3.433  136.402 1.00 35.60  ? 108 ARG A CA  1 
ATOM   803   C C   . ARG A  1 107 ? 17.982  -4.030  135.135 1.00 37.51  ? 108 ARG A C   1 
ATOM   804   O O   . ARG A  1 107 ? 18.482  -3.285  134.304 1.00 39.01  ? 108 ARG A O   1 
ATOM   805   C CB  . ARG A  1 107 ? 15.969  -3.848  136.569 1.00 34.40  ? 108 ARG A CB  1 
ATOM   806   C CG  . ARG A  1 107 ? 15.025  -3.271  135.573 1.00 34.15  ? 108 ARG A CG  1 
ATOM   807   C CD  . ARG A  1 107 ? 13.891  -4.241  135.348 1.00 36.85  ? 108 ARG A CD  1 
ATOM   808   N NE  . ARG A  1 107 ? 14.303  -5.332  134.469 1.00 38.97  ? 108 ARG A NE  1 
ATOM   809   C CZ  . ARG A  1 107 ? 13.552  -6.390  134.180 1.00 42.17  ? 108 ARG A CZ  1 
ATOM   810   N NH1 . ARG A  1 107 ? 12.336  -6.507  134.709 1.00 42.94  ? 108 ARG A NH1 1 
ATOM   811   N NH2 . ARG A  1 107 ? 14.017  -7.330  133.361 1.00 43.88  ? 108 ARG A NH2 1 
ATOM   812   N N   . THR A  1 108 ? 17.901  -5.349  134.957 1.00 37.90  ? 109 THR A N   1 
ATOM   813   C CA  . THR A  1 108 ? 18.474  -5.945  133.744 1.00 39.61  ? 109 THR A CA  1 
ATOM   814   C C   . THR A  1 108 ? 17.578  -5.990  132.518 1.00 39.59  ? 109 THR A C   1 
ATOM   815   O O   . THR A  1 108 ? 16.390  -6.282  132.606 1.00 39.44  ? 109 THR A O   1 
ATOM   816   C CB  . THR A  1 108 ? 18.995  -7.383  133.957 1.00 40.29  ? 109 THR A CB  1 
ATOM   817   O OG1 . THR A  1 108 ? 17.888  -8.278  134.073 1.00 41.84  ? 109 THR A OG1 1 
ATOM   818   C CG2 . THR A  1 108 ? 19.880  -7.466  135.197 1.00 41.47  ? 109 THR A CG2 1 
ATOM   819   N N   . VAL A  1 109 ? 18.196  -5.732  131.369 1.00 40.32  ? 110 VAL A N   1 
ATOM   820   C CA  . VAL A  1 109 ? 17.519  -5.702  130.086 1.00 40.33  ? 110 VAL A CA  1 
ATOM   821   C C   . VAL A  1 109 ? 16.491  -6.798  129.986 1.00 42.21  ? 110 VAL A C   1 
ATOM   822   O O   . VAL A  1 109 ? 16.679  -7.900  130.492 1.00 41.52  ? 110 VAL A O   1 
ATOM   823   C CB  . VAL A  1 109 ? 18.508  -5.845  128.894 1.00 38.75  ? 110 VAL A CB  1 
ATOM   824   C CG1 . VAL A  1 109 ? 17.778  -5.643  127.587 1.00 34.96  ? 110 VAL A CG1 1 
ATOM   825   C CG2 . VAL A  1 109 ? 19.633  -4.843  129.013 1.00 35.81  ? 110 VAL A CG2 1 
ATOM   826   N N   . ALA A  1 110 ? 15.391  -6.450  129.329 1.00 45.80  ? 111 ALA A N   1 
ATOM   827   C CA  . ALA A  1 110 ? 14.261  -7.332  129.093 1.00 47.54  ? 111 ALA A CA  1 
ATOM   828   C C   . ALA A  1 110 ? 13.695  -6.982  127.716 1.00 49.47  ? 111 ALA A C   1 
ATOM   829   O O   . ALA A  1 110 ? 12.970  -5.990  127.562 1.00 49.09  ? 111 ALA A O   1 
ATOM   830   C CB  . ALA A  1 110 ? 13.197  -7.126  130.169 1.00 45.83  ? 111 ALA A CB  1 
ATOM   831   N N   . ALA A  1 111 ? 14.060  -7.783  126.716 1.00 51.93  ? 112 ALA A N   1 
ATOM   832   C CA  . ALA A  1 111 ? 13.580  -7.589  125.354 1.00 54.65  ? 112 ALA A CA  1 
ATOM   833   C C   . ALA A  1 111 ? 12.064  -7.786  125.346 1.00 56.61  ? 112 ALA A C   1 
ATOM   834   O O   . ALA A  1 111 ? 11.560  -8.782  125.863 1.00 56.81  ? 112 ALA A O   1 
ATOM   835   C CB  . ALA A  1 111 ? 14.238  -8.586  124.433 1.00 55.64  ? 112 ALA A CB  1 
ATOM   836   N N   . PRO A  1 112 ? 11.319  -6.846  124.743 1.00 58.58  ? 113 PRO A N   1 
ATOM   837   C CA  . PRO A  1 112 ? 9.858   -6.949  124.698 1.00 59.50  ? 113 PRO A CA  1 
ATOM   838   C C   . PRO A  1 112 ? 9.347   -8.116  123.872 1.00 59.61  ? 113 PRO A C   1 
ATOM   839   O O   . PRO A  1 112 ? 10.024  -8.590  122.962 1.00 60.76  ? 113 PRO A O   1 
ATOM   840   C CB  . PRO A  1 112 ? 9.441   -5.603  124.118 1.00 59.94  ? 113 PRO A CB  1 
ATOM   841   C CG  . PRO A  1 112 ? 10.551  -5.326  123.147 1.00 59.67  ? 113 PRO A CG  1 
ATOM   842   C CD  . PRO A  1 112 ? 11.790  -5.709  123.928 1.00 59.21  ? 113 PRO A CD  1 
ATOM   843   N N   . SER A  1 113 ? 8.153   -8.584  124.216 1.00 59.64  ? 114 SER A N   1 
ATOM   844   C CA  . SER A  1 113 ? 7.515   -9.680  123.503 1.00 59.07  ? 114 SER A CA  1 
ATOM   845   C C   . SER A  1 113 ? 6.317   -9.064  122.792 1.00 58.86  ? 114 SER A C   1 
ATOM   846   O O   . SER A  1 113 ? 5.324   -8.698  123.413 1.00 58.26  ? 114 SER A O   1 
ATOM   847   C CB  . SER A  1 113 ? 7.085   -10.775 124.482 1.00 59.12  ? 114 SER A CB  1 
ATOM   848   O OG  . SER A  1 113 ? 8.208   -11.526 124.922 1.00 58.21  ? 114 SER A OG  1 
ATOM   849   N N   . VAL A  1 114 ? 6.448   -8.946  121.477 1.00 59.15  ? 115 VAL A N   1 
ATOM   850   C CA  . VAL A  1 114 ? 5.444   -8.338  120.610 1.00 59.07  ? 115 VAL A CA  1 
ATOM   851   C C   . VAL A  1 114 ? 4.123   -9.069  120.428 1.00 58.91  ? 115 VAL A C   1 
ATOM   852   O O   . VAL A  1 114 ? 4.033   -10.279 120.600 1.00 58.90  ? 115 VAL A O   1 
ATOM   853   C CB  . VAL A  1 114 ? 6.039   -8.076  119.214 1.00 58.70  ? 115 VAL A CB  1 
ATOM   854   C CG1 . VAL A  1 114 ? 5.036   -7.346  118.349 1.00 59.12  ? 115 VAL A CG1 1 
ATOM   855   C CG2 . VAL A  1 114 ? 7.325   -7.266  119.343 1.00 58.47  ? 115 VAL A CG2 1 
ATOM   856   N N   . PHE A  1 115 ? 3.104   -8.293  120.073 1.00 59.44  ? 116 PHE A N   1 
ATOM   857   C CA  . PHE A  1 115 ? 1.758   -8.784  119.832 1.00 59.92  ? 116 PHE A CA  1 
ATOM   858   C C   . PHE A  1 115 ? 1.087   -7.860  118.836 1.00 60.67  ? 116 PHE A C   1 
ATOM   859   O O   . PHE A  1 115 ? 1.206   -6.639  118.947 1.00 60.51  ? 116 PHE A O   1 
ATOM   860   C CB  . PHE A  1 115 ? 0.979   -8.823  121.131 1.00 58.56  ? 116 PHE A CB  1 
ATOM   861   C CG  . PHE A  1 115 ? 1.590   -9.714  122.137 1.00 58.62  ? 116 PHE A CG  1 
ATOM   862   C CD1 . PHE A  1 115 ? 2.440   -9.211  123.100 1.00 58.67  ? 116 PHE A CD1 1 
ATOM   863   C CD2 . PHE A  1 115 ? 1.369   -11.081 122.081 1.00 59.31  ? 116 PHE A CD2 1 
ATOM   864   C CE1 . PHE A  1 115 ? 3.067   -10.057 123.995 1.00 60.09  ? 116 PHE A CE1 1 
ATOM   865   C CE2 . PHE A  1 115 ? 1.989   -11.940 122.970 1.00 59.90  ? 116 PHE A CE2 1 
ATOM   866   C CZ  . PHE A  1 115 ? 2.842   -11.429 123.930 1.00 60.66  ? 116 PHE A CZ  1 
ATOM   867   N N   . ILE A  1 116 ? 0.380   -8.447  117.871 1.00 61.75  ? 117 ILE A N   1 
ATOM   868   C CA  . ILE A  1 116 ? -0.277  -7.677  116.826 1.00 62.41  ? 117 ILE A CA  1 
ATOM   869   C C   . ILE A  1 116 ? -1.742  -8.083  116.599 1.00 63.19  ? 117 ILE A C   1 
ATOM   870   O O   . ILE A  1 116 ? -2.051  -8.932  115.770 1.00 62.47  ? 117 ILE A O   1 
ATOM   871   C CB  . ILE A  1 116 ? 0.559   -7.796  115.519 1.00 62.48  ? 117 ILE A CB  1 
ATOM   872   C CG1 . ILE A  1 116 ? 0.227   -6.652  114.572 1.00 63.46  ? 117 ILE A CG1 1 
ATOM   873   C CG2 . ILE A  1 116 ? 0.346   -9.148  114.863 1.00 60.65  ? 117 ILE A CG2 1 
ATOM   874   C CD1 . ILE A  1 116 ? 1.266   -6.475  113.479 1.00 63.66  ? 117 ILE A CD1 1 
ATOM   875   N N   . PHE A  1 117 ? -2.638  -7.461  117.358 1.00 64.71  ? 118 PHE A N   1 
ATOM   876   C CA  . PHE A  1 117 ? -4.067  -7.736  117.265 1.00 66.84  ? 118 PHE A CA  1 
ATOM   877   C C   . PHE A  1 117 ? -4.742  -7.089  116.055 1.00 67.37  ? 118 PHE A C   1 
ATOM   878   O O   . PHE A  1 117 ? -5.055  -5.895  116.083 1.00 68.12  ? 118 PHE A O   1 
ATOM   879   C CB  . PHE A  1 117 ? -4.806  -7.216  118.502 1.00 68.76  ? 118 PHE A CB  1 
ATOM   880   C CG  . PHE A  1 117 ? -4.427  -7.888  119.789 1.00 70.83  ? 118 PHE A CG  1 
ATOM   881   C CD1 . PHE A  1 117 ? -4.133  -9.241  119.830 1.00 71.45  ? 118 PHE A CD1 1 
ATOM   882   C CD2 . PHE A  1 117 ? -4.448  -7.173  120.984 1.00 71.15  ? 118 PHE A CD2 1 
ATOM   883   C CE1 . PHE A  1 117 ? -3.874  -9.869  121.041 1.00 71.44  ? 118 PHE A CE1 1 
ATOM   884   C CE2 . PHE A  1 117 ? -4.192  -7.795  122.194 1.00 69.90  ? 118 PHE A CE2 1 
ATOM   885   C CZ  . PHE A  1 117 ? -3.907  -9.143  122.222 1.00 70.33  ? 118 PHE A CZ  1 
ATOM   886   N N   . PRO A  1 118 ? -4.981  -7.851  114.977 1.00 67.33  ? 119 PRO A N   1 
ATOM   887   C CA  . PRO A  1 118 ? -5.644  -7.182  113.853 1.00 67.10  ? 119 PRO A CA  1 
ATOM   888   C C   . PRO A  1 118 ? -6.998  -6.609  114.322 1.00 66.91  ? 119 PRO A C   1 
ATOM   889   O O   . PRO A  1 118 ? -7.495  -6.995  115.381 1.00 65.93  ? 119 PRO A O   1 
ATOM   890   C CB  . PRO A  1 118 ? -5.765  -8.300  112.808 1.00 66.12  ? 119 PRO A CB  1 
ATOM   891   C CG  . PRO A  1 118 ? -5.612  -9.568  113.591 1.00 66.47  ? 119 PRO A CG  1 
ATOM   892   C CD  . PRO A  1 118 ? -4.589  -9.224  114.621 1.00 66.79  ? 119 PRO A CD  1 
ATOM   893   N N   . PRO A  1 119 ? -7.602  -5.677  113.550 1.00 67.39  ? 120 PRO A N   1 
ATOM   894   C CA  . PRO A  1 119 ? -8.888  -5.078  113.930 1.00 67.32  ? 120 PRO A CA  1 
ATOM   895   C C   . PRO A  1 119 ? -9.966  -6.062  114.284 1.00 68.03  ? 120 PRO A C   1 
ATOM   896   O O   . PRO A  1 119 ? -9.956  -7.212  113.862 1.00 68.05  ? 120 PRO A O   1 
ATOM   897   C CB  . PRO A  1 119 ? -9.276  -4.260  112.710 1.00 66.21  ? 120 PRO A CB  1 
ATOM   898   C CG  . PRO A  1 119 ? -7.969  -3.844  112.165 1.00 67.49  ? 120 PRO A CG  1 
ATOM   899   C CD  . PRO A  1 119 ? -7.132  -5.107  112.273 1.00 67.65  ? 120 PRO A CD  1 
ATOM   900   N N   . SER A  1 120 ? -10.908 -5.581  115.074 1.00 69.96  ? 121 SER A N   1 
ATOM   901   C CA  . SER A  1 120 ? -12.039 -6.381  115.490 1.00 71.46  ? 121 SER A CA  1 
ATOM   902   C C   . SER A  1 120 ? -12.959 -6.535  114.282 1.00 71.99  ? 121 SER A C   1 
ATOM   903   O O   . SER A  1 120 ? -12.494 -6.714  113.152 1.00 71.35  ? 121 SER A O   1 
ATOM   904   C CB  . SER A  1 120 ? -12.776 -5.679  116.641 1.00 72.46  ? 121 SER A CB  1 
ATOM   905   O OG  . SER A  1 120 ? -12.912 -4.277  116.413 1.00 72.96  ? 121 SER A OG  1 
ATOM   906   N N   . ASP A  1 121 ? -14.260 -6.455  114.528 1.00 72.70  ? 122 ASP A N   1 
ATOM   907   C CA  . ASP A  1 121 ? -15.255 -6.569  113.475 1.00 73.46  ? 122 ASP A CA  1 
ATOM   908   C C   . ASP A  1 121 ? -16.238 -5.430  113.677 1.00 72.43  ? 122 ASP A C   1 
ATOM   909   O O   . ASP A  1 121 ? -16.602 -4.740  112.724 1.00 72.20  ? 122 ASP A O   1 
ATOM   910   C CB  . ASP A  1 121 ? -15.987 -7.922  113.564 1.00 75.92  ? 122 ASP A CB  1 
ATOM   911   C CG  . ASP A  1 121 ? -15.077 -9.119  113.237 1.00 77.36  ? 122 ASP A CG  1 
ATOM   912   O OD1 . ASP A  1 121 ? -14.765 -9.323  112.041 1.00 77.09  ? 122 ASP A OD1 1 
ATOM   913   O OD2 . ASP A  1 121 ? -14.673 -9.852  114.175 1.00 76.33  ? 122 ASP A OD2 1 
ATOM   914   N N   . GLU A  1 122 ? -16.643 -5.230  114.932 1.00 71.63  ? 123 GLU A N   1 
ATOM   915   C CA  . GLU A  1 122 ? -17.598 -4.176  115.300 1.00 71.11  ? 123 GLU A CA  1 
ATOM   916   C C   . GLU A  1 122 ? -17.036 -2.797  114.997 1.00 68.90  ? 123 GLU A C   1 
ATOM   917   O O   . GLU A  1 122 ? -17.778 -1.834  114.747 1.00 68.28  ? 123 GLU A O   1 
ATOM   918   C CB  . GLU A  1 122 ? -17.966 -4.268  116.789 1.00 71.78  ? 123 GLU A CB  1 
ATOM   919   C CG  . GLU A  1 122 ? -19.126 -5.216  117.093 1.00 74.36  ? 123 GLU A CG  1 
ATOM   920   C CD  . GLU A  1 122 ? -18.855 -6.665  116.685 1.00 75.96  ? 123 GLU A CD  1 
ATOM   921   O OE1 . GLU A  1 122 ? -19.711 -7.535  116.969 1.00 76.09  ? 123 GLU A OE1 1 
ATOM   922   O OE2 . GLU A  1 122 ? -17.789 -6.939  116.085 1.00 76.61  ? 123 GLU A OE2 1 
ATOM   923   N N   . GLN A  1 123 ? -15.715 -2.706  115.026 1.00 65.55  ? 124 GLN A N   1 
ATOM   924   C CA  . GLN A  1 123 ? -15.087 -1.452  114.728 1.00 62.67  ? 124 GLN A CA  1 
ATOM   925   C C   . GLN A  1 123 ? -15.179 -1.275  113.226 1.00 62.16  ? 124 GLN A C   1 
ATOM   926   O O   . GLN A  1 123 ? -15.719 -0.282  112.750 1.00 63.34  ? 124 GLN A O   1 
ATOM   927   C CB  . GLN A  1 123 ? -13.627 -1.456  115.160 1.00 60.91  ? 124 GLN A CB  1 
ATOM   928   C CG  . GLN A  1 123 ? -12.856 -0.310  114.555 1.00 57.30  ? 124 GLN A CG  1 
ATOM   929   C CD  . GLN A  1 123 ? -11.386 -0.457  114.723 1.00 53.90  ? 124 GLN A CD  1 
ATOM   930   O OE1 . GLN A  1 123 ? -10.800 -1.461  114.323 1.00 50.47  ? 124 GLN A OE1 1 
ATOM   931   N NE2 . GLN A  1 123 ? -10.766 0.551   115.313 1.00 53.85  ? 124 GLN A NE2 1 
ATOM   932   N N   . LEU A  1 124 ? -14.656 -2.247  112.483 1.00 61.17  ? 125 LEU A N   1 
ATOM   933   C CA  . LEU A  1 124 ? -14.661 -2.198  111.020 1.00 59.23  ? 125 LEU A CA  1 
ATOM   934   C C   . LEU A  1 124 ? -16.022 -1.821  110.486 1.00 59.25  ? 125 LEU A C   1 
ATOM   935   O O   . LEU A  1 124 ? -16.138 -1.043  109.542 1.00 59.41  ? 125 LEU A O   1 
ATOM   936   C CB  . LEU A  1 124 ? -14.251 -3.547  110.435 1.00 57.75  ? 125 LEU A CB  1 
ATOM   937   C CG  . LEU A  1 124 ? -12.770 -3.895  110.552 1.00 56.63  ? 125 LEU A CG  1 
ATOM   938   C CD1 . LEU A  1 124 ? -12.483 -5.221  109.872 1.00 56.00  ? 125 LEU A CD1 1 
ATOM   939   C CD2 . LEU A  1 124 ? -11.961 -2.781  109.921 1.00 56.31  ? 125 LEU A CD2 1 
ATOM   940   N N   . LYS A  1 125 ? -17.056 -2.377  111.098 1.00 58.90  ? 126 LYS A N   1 
ATOM   941   C CA  . LYS A  1 125 ? -18.405 -2.085  110.677 1.00 59.29  ? 126 LYS A CA  1 
ATOM   942   C C   . LYS A  1 125 ? -18.869 -0.730  111.183 1.00 59.27  ? 126 LYS A C   1 
ATOM   943   O O   . LYS A  1 125 ? -19.839 -0.176  110.672 1.00 60.38  ? 126 LYS A O   1 
ATOM   944   C CB  . LYS A  1 125 ? -19.340 -3.200  111.141 1.00 60.41  ? 126 LYS A CB  1 
ATOM   945   C CG  . LYS A  1 125 ? -19.592 -4.255  110.062 1.00 61.46  ? 126 LYS A CG  1 
ATOM   946   C CD  . LYS A  1 125 ? -18.324 -4.571  109.260 1.00 62.05  ? 126 LYS A CD  1 
ATOM   947   C CE  . LYS A  1 125 ? -18.602 -5.561  108.124 1.00 62.45  ? 126 LYS A CE  1 
ATOM   948   N NZ  . LYS A  1 125 ? -17.380 -5.927  107.338 1.00 62.10  ? 126 LYS A NZ  1 
ATOM   949   N N   . SER A  1 126 ? -18.169 -0.187  112.173 1.00 58.82  ? 127 SER A N   1 
ATOM   950   C CA  . SER A  1 126 ? -18.526 1.118   112.718 1.00 58.56  ? 127 SER A CA  1 
ATOM   951   C C   . SER A  1 126 ? -18.058 2.229   111.779 1.00 57.19  ? 127 SER A C   1 
ATOM   952   O O   . SER A  1 126 ? -18.584 3.338   111.806 1.00 57.62  ? 127 SER A O   1 
ATOM   953   C CB  . SER A  1 126 ? -17.910 1.317   114.112 1.00 59.76  ? 127 SER A CB  1 
ATOM   954   O OG  . SER A  1 126 ? -16.537 1.655   114.030 1.00 62.68  ? 127 SER A OG  1 
ATOM   955   N N   . GLY A  1 127 ? -17.069 1.932   110.950 1.00 56.14  ? 128 GLY A N   1 
ATOM   956   C CA  . GLY A  1 127 ? -16.584 2.932   110.018 1.00 56.30  ? 128 GLY A CA  1 
ATOM   957   C C   . GLY A  1 127 ? -15.079 3.115   110.010 1.00 56.54  ? 128 GLY A C   1 
ATOM   958   O O   . GLY A  1 127 ? -14.537 3.726   109.083 1.00 56.28  ? 128 GLY A O   1 
ATOM   959   N N   . THR A  1 128 ? -14.398 2.584   111.029 1.00 56.08  ? 129 THR A N   1 
ATOM   960   C CA  . THR A  1 128 ? -12.939 2.713   111.124 1.00 55.10  ? 129 THR A CA  1 
ATOM   961   C C   . THR A  1 128 ? -12.205 1.408   111.472 1.00 53.23  ? 129 THR A C   1 
ATOM   962   O O   . THR A  1 128 ? -12.812 0.339   111.511 1.00 52.42  ? 129 THR A O   1 
ATOM   963   C CB  . THR A  1 128 ? -12.555 3.765   112.176 1.00 55.31  ? 129 THR A CB  1 
ATOM   964   O OG1 . THR A  1 128 ? -12.453 3.134   113.460 1.00 57.39  ? 129 THR A OG1 1 
ATOM   965   C CG2 . THR A  1 128 ? -13.618 4.864   112.234 1.00 54.93  ? 129 THR A CG2 1 
ATOM   966   N N   . ALA A  1 129 ? -10.897 1.513   111.722 1.00 51.66  ? 130 ALA A N   1 
ATOM   967   C CA  . ALA A  1 129 ? -10.065 0.355   112.066 1.00 49.95  ? 130 ALA A CA  1 
ATOM   968   C C   . ALA A  1 129 ? -8.728  0.682   112.763 1.00 48.82  ? 130 ALA A C   1 
ATOM   969   O O   . ALA A  1 129 ? -7.815  1.252   112.162 1.00 47.62  ? 130 ALA A O   1 
ATOM   970   C CB  . ALA A  1 129 ? -9.798  -0.487  110.812 1.00 49.05  ? 130 ALA A CB  1 
ATOM   971   N N   . SER A  1 130 ? -8.624  0.301   114.033 1.00 47.39  ? 131 SER A N   1 
ATOM   972   C CA  . SER A  1 130 ? -7.414  0.511   114.815 1.00 45.81  ? 131 SER A CA  1 
ATOM   973   C C   . SER A  1 130 ? -6.677  -0.810  114.745 1.00 44.89  ? 131 SER A C   1 
ATOM   974   O O   . SER A  1 130 ? -7.298  -1.869  114.734 1.00 44.40  ? 131 SER A O   1 
ATOM   975   C CB  . SER A  1 130 ? -7.754  0.798   116.276 1.00 46.06  ? 131 SER A CB  1 
ATOM   976   O OG  . SER A  1 130 ? -8.846  1.693   116.391 1.00 48.68  ? 131 SER A OG  1 
ATOM   977   N N   . VAL A  1 131 ? -5.357  -0.754  114.687 1.00 43.60  ? 132 VAL A N   1 
ATOM   978   C CA  . VAL A  1 131 ? -4.560  -1.969  114.636 1.00 41.40  ? 132 VAL A CA  1 
ATOM   979   C C   . VAL A  1 131 ? -3.621  -1.897  115.814 1.00 40.13  ? 132 VAL A C   1 
ATOM   980   O O   . VAL A  1 131 ? -2.741  -1.047  115.840 1.00 41.27  ? 132 VAL A O   1 
ATOM   981   C CB  . VAL A  1 131 ? -3.767  -2.052  113.327 1.00 41.39  ? 132 VAL A CB  1 
ATOM   982   C CG1 . VAL A  1 131 ? -2.442  -2.749  113.557 1.00 41.24  ? 132 VAL A CG1 1 
ATOM   983   C CG2 . VAL A  1 131 ? -4.573  -2.814  112.302 1.00 38.39  ? 132 VAL A CG2 1 
ATOM   984   N N   . VAL A  1 132 ? -3.816  -2.788  116.786 1.00 38.90  ? 133 VAL A N   1 
ATOM   985   C CA  . VAL A  1 132 ? -3.014  -2.797  118.012 1.00 37.29  ? 133 VAL A CA  1 
ATOM   986   C C   . VAL A  1 132 ? -1.785  -3.698  118.030 1.00 37.09  ? 133 VAL A C   1 
ATOM   987   O O   . VAL A  1 132 ? -1.899  -4.908  117.938 1.00 37.76  ? 133 VAL A O   1 
ATOM   988   C CB  . VAL A  1 132 ? -3.889  -3.163  119.213 1.00 35.42  ? 133 VAL A CB  1 
ATOM   989   C CG1 . VAL A  1 132 ? -3.041  -3.303  120.433 1.00 34.79  ? 133 VAL A CG1 1 
ATOM   990   C CG2 . VAL A  1 132 ? -4.943  -2.111  119.427 1.00 32.49  ? 133 VAL A CG2 1 
ATOM   991   N N   . CYS A  1 133 ? -0.619  -3.083  118.181 1.00 37.17  ? 134 CYS A N   1 
ATOM   992   C CA  . CYS A  1 133 ? 0.667   -3.770  118.233 1.00 39.22  ? 134 CYS A CA  1 
ATOM   993   C C   . CYS A  1 133 ? 1.199   -3.592  119.662 1.00 37.98  ? 134 CYS A C   1 
ATOM   994   O O   . CYS A  1 133 ? 1.777   -2.564  119.960 1.00 38.57  ? 134 CYS A O   1 
ATOM   995   C CB  . CYS A  1 133 ? 1.620   -3.115  117.204 1.00 42.26  ? 134 CYS A CB  1 
ATOM   996   S SG  . CYS A  1 133 ? 3.377   -3.654  117.117 1.00 49.20  ? 134 CYS A SG  1 
ATOM   997   N N   . LEU A  1 134 ? 1.002   -4.581  120.536 1.00 38.07  ? 135 LEU A N   1 
ATOM   998   C CA  . LEU A  1 134 ? 1.450   -4.502  121.941 1.00 39.48  ? 135 LEU A CA  1 
ATOM   999   C C   . LEU A  1 134 ? 2.882   -4.950  122.220 1.00 40.85  ? 135 LEU A C   1 
ATOM   1000  O O   . LEU A  1 134 ? 3.437   -5.753  121.480 1.00 43.65  ? 135 LEU A O   1 
ATOM   1001  C CB  . LEU A  1 134 ? 0.546   -5.334  122.842 1.00 39.86  ? 135 LEU A CB  1 
ATOM   1002  C CG  . LEU A  1 134 ? 1.032   -5.433  124.297 1.00 42.71  ? 135 LEU A CG  1 
ATOM   1003  C CD1 . LEU A  1 134 ? 0.137   -4.600  125.211 1.00 42.85  ? 135 LEU A CD1 1 
ATOM   1004  C CD2 . LEU A  1 134 ? 1.007   -6.880  124.758 1.00 44.84  ? 135 LEU A CD2 1 
ATOM   1005  N N   . LEU A  1 135 ? 3.473   -4.423  123.291 1.00 40.12  ? 136 LEU A N   1 
ATOM   1006  C CA  . LEU A  1 135 ? 4.830   -4.781  123.715 1.00 40.17  ? 136 LEU A CA  1 
ATOM   1007  C C   . LEU A  1 135 ? 4.780   -5.022  125.218 1.00 42.36  ? 136 LEU A C   1 
ATOM   1008  O O   . LEU A  1 135 ? 4.634   -4.090  126.015 1.00 42.01  ? 136 LEU A O   1 
ATOM   1009  C CB  . LEU A  1 135 ? 5.822   -3.669  123.404 1.00 37.42  ? 136 LEU A CB  1 
ATOM   1010  C CG  . LEU A  1 135 ? 6.473   -3.727  122.023 1.00 36.79  ? 136 LEU A CG  1 
ATOM   1011  C CD1 . LEU A  1 135 ? 5.495   -3.337  120.928 1.00 34.31  ? 136 LEU A CD1 1 
ATOM   1012  C CD2 . LEU A  1 135 ? 7.663   -2.804  122.022 1.00 34.89  ? 136 LEU A CD2 1 
ATOM   1013  N N   . ASN A  1 136 ? 4.916   -6.286  125.598 1.00 44.98  ? 137 ASN A N   1 
ATOM   1014  C CA  . ASN A  1 136 ? 4.825   -6.691  126.993 1.00 45.89  ? 137 ASN A CA  1 
ATOM   1015  C C   . ASN A  1 136 ? 6.131   -6.901  127.767 1.00 44.58  ? 137 ASN A C   1 
ATOM   1016  O O   . ASN A  1 136 ? 7.036   -7.615  127.333 1.00 42.21  ? 137 ASN A O   1 
ATOM   1017  C CB  . ASN A  1 136 ? 3.977   -7.960  127.070 1.00 49.48  ? 137 ASN A CB  1 
ATOM   1018  C CG  . ASN A  1 136 ? 3.282   -8.120  128.405 1.00 54.45  ? 137 ASN A CG  1 
ATOM   1019  O OD1 . ASN A  1 136 ? 2.483   -7.273  128.815 1.00 57.03  ? 137 ASN A OD1 1 
ATOM   1020  N ND2 . ASN A  1 136 ? 3.577   -9.219  129.093 1.00 57.02  ? 137 ASN A ND2 1 
ATOM   1021  N N   . ASN A  1 137 ? 6.190   -6.241  128.920 1.00 43.78  ? 138 ASN A N   1 
ATOM   1022  C CA  . ASN A  1 137 ? 7.295   -6.301  129.874 1.00 43.67  ? 138 ASN A CA  1 
ATOM   1023  C C   . ASN A  1 137 ? 8.724   -6.239  129.373 1.00 43.75  ? 138 ASN A C   1 
ATOM   1024  O O   . ASN A  1 137 ? 9.388   -7.262  129.212 1.00 44.75  ? 138 ASN A O   1 
ATOM   1025  C CB  . ASN A  1 137 ? 7.101   -7.532  130.725 1.00 43.24  ? 138 ASN A CB  1 
ATOM   1026  C CG  . ASN A  1 137 ? 5.726   -7.580  131.307 1.00 44.88  ? 138 ASN A CG  1 
ATOM   1027  O OD1 . ASN A  1 137 ? 5.173   -8.649  131.533 1.00 47.46  ? 138 ASN A OD1 1 
ATOM   1028  N ND2 . ASN A  1 137 ? 5.153   -6.408  131.557 1.00 43.71  ? 138 ASN A ND2 1 
ATOM   1029  N N   . PHE A  1 138 ? 9.206   -5.021  129.167 1.00 42.60  ? 139 PHE A N   1 
ATOM   1030  C CA  . PHE A  1 138 ? 10.555  -4.808  128.679 1.00 41.16  ? 139 PHE A CA  1 
ATOM   1031  C C   . PHE A  1 138 ? 11.200  -3.702  129.499 1.00 41.53  ? 139 PHE A C   1 
ATOM   1032  O O   . PHE A  1 138 ? 10.517  -2.966  130.223 1.00 39.26  ? 139 PHE A O   1 
ATOM   1033  C CB  . PHE A  1 138 ? 10.531  -4.401  127.196 1.00 39.11  ? 139 PHE A CB  1 
ATOM   1034  C CG  . PHE A  1 138 ? 9.841   -3.081  126.939 1.00 39.34  ? 139 PHE A CG  1 
ATOM   1035  C CD1 . PHE A  1 138 ? 8.451   -2.976  126.992 1.00 39.63  ? 139 PHE A CD1 1 
ATOM   1036  C CD2 . PHE A  1 138 ? 10.582  -1.919  126.720 1.00 38.34  ? 139 PHE A CD2 1 
ATOM   1037  C CE1 . PHE A  1 138 ? 7.812   -1.730  126.838 1.00 36.82  ? 139 PHE A CE1 1 
ATOM   1038  C CE2 . PHE A  1 138 ? 9.950   -0.680  126.568 1.00 35.94  ? 139 PHE A CE2 1 
ATOM   1039  C CZ  . PHE A  1 138 ? 8.564   -0.591  126.629 1.00 34.86  ? 139 PHE A CZ  1 
ATOM   1040  N N   . TYR A  1 139 ? 12.523  -3.610  129.387 1.00 42.86  ? 140 TYR A N   1 
ATOM   1041  C CA  . TYR A  1 139 ? 13.308  -2.585  130.069 1.00 44.32  ? 140 TYR A CA  1 
ATOM   1042  C C   . TYR A  1 139 ? 14.624  -2.508  129.332 1.00 44.01  ? 140 TYR A C   1 
ATOM   1043  O O   . TYR A  1 139 ? 15.153  -3.525  128.913 1.00 44.35  ? 140 TYR A O   1 
ATOM   1044  C CB  . TYR A  1 139 ? 13.563  -2.923  131.551 1.00 45.69  ? 140 TYR A CB  1 
ATOM   1045  C CG  . TYR A  1 139 ? 14.247  -1.788  132.302 1.00 47.92  ? 140 TYR A CG  1 
ATOM   1046  C CD1 . TYR A  1 139 ? 15.621  -1.582  132.179 1.00 49.22  ? 140 TYR A CD1 1 
ATOM   1047  C CD2 . TYR A  1 139 ? 13.511  -0.856  133.050 1.00 47.83  ? 140 TYR A CD2 1 
ATOM   1048  C CE1 . TYR A  1 139 ? 16.252  -0.473  132.770 1.00 49.19  ? 140 TYR A CE1 1 
ATOM   1049  C CE2 . TYR A  1 139 ? 14.135  0.260   133.647 1.00 47.50  ? 140 TYR A CE2 1 
ATOM   1050  C CZ  . TYR A  1 139 ? 15.511  0.440   133.497 1.00 48.65  ? 140 TYR A CZ  1 
ATOM   1051  O OH  . TYR A  1 139 ? 16.174  1.514   134.058 1.00 47.26  ? 140 TYR A OH  1 
ATOM   1052  N N   . PRO A  1 140 ? 15.166  -1.295  129.152 1.00 43.89  ? 141 PRO A N   1 
ATOM   1053  C CA  . PRO A  1 140 ? 14.641  0.001   129.587 1.00 44.13  ? 141 PRO A CA  1 
ATOM   1054  C C   . PRO A  1 140 ? 13.326  0.406   128.936 1.00 45.78  ? 141 PRO A C   1 
ATOM   1055  O O   . PRO A  1 140 ? 12.702  -0.396  128.235 1.00 46.91  ? 141 PRO A O   1 
ATOM   1056  C CB  . PRO A  1 140 ? 15.780  0.949   129.253 1.00 44.21  ? 141 PRO A CB  1 
ATOM   1057  C CG  . PRO A  1 140 ? 16.429  0.291   128.076 1.00 43.40  ? 141 PRO A CG  1 
ATOM   1058  C CD  . PRO A  1 140 ? 16.478  -1.129  128.512 1.00 42.98  ? 141 PRO A CD  1 
ATOM   1059  N N   . ARG A  1 141 ? 12.922  1.658   129.165 1.00 46.29  ? 142 ARG A N   1 
ATOM   1060  C CA  . ARG A  1 141 ? 11.670  2.215   128.638 1.00 46.37  ? 142 ARG A CA  1 
ATOM   1061  C C   . ARG A  1 141 ? 11.661  2.820   127.214 1.00 46.75  ? 142 ARG A C   1 
ATOM   1062  O O   . ARG A  1 141 ? 10.608  3.225   126.712 1.00 46.70  ? 142 ARG A O   1 
ATOM   1063  C CB  . ARG A  1 141 ? 11.153  3.256   129.631 1.00 46.10  ? 142 ARG A CB  1 
ATOM   1064  C CG  . ARG A  1 141 ? 10.400  4.414   129.017 1.00 46.66  ? 142 ARG A CG  1 
ATOM   1065  C CD  . ARG A  1 141 ? 9.644   5.176   130.065 1.00 48.67  ? 142 ARG A CD  1 
ATOM   1066  N NE  . ARG A  1 141 ? 9.074   6.394   129.518 1.00 52.08  ? 142 ARG A NE  1 
ATOM   1067  C CZ  . ARG A  1 141 ? 8.584   7.373   130.265 1.00 54.17  ? 142 ARG A CZ  1 
ATOM   1068  N NH1 . ARG A  1 141 ? 8.595   7.257   131.589 1.00 55.22  ? 142 ARG A NH1 1 
ATOM   1069  N NH2 . ARG A  1 141 ? 8.119   8.480   129.696 1.00 54.30  ? 142 ARG A NH2 1 
ATOM   1070  N N   . GLU A  1 142 ? 12.808  2.873   126.552 1.00 46.60  ? 143 GLU A N   1 
ATOM   1071  C CA  . GLU A  1 142 ? 12.859  3.466   125.233 1.00 47.52  ? 143 GLU A CA  1 
ATOM   1072  C C   . GLU A  1 142 ? 12.871  2.457   124.108 1.00 48.73  ? 143 GLU A C   1 
ATOM   1073  O O   . GLU A  1 142 ? 13.895  2.249   123.463 1.00 51.62  ? 143 GLU A O   1 
ATOM   1074  C CB  . GLU A  1 142 ? 14.082  4.372   125.112 1.00 48.25  ? 143 GLU A CB  1 
ATOM   1075  C CG  . GLU A  1 142 ? 14.312  5.253   126.319 1.00 52.45  ? 143 GLU A CG  1 
ATOM   1076  C CD  . GLU A  1 142 ? 14.829  4.466   127.523 1.00 54.85  ? 143 GLU A CD  1 
ATOM   1077  O OE1 . GLU A  1 142 ? 15.034  5.058   128.609 1.00 56.97  ? 143 GLU A OE1 1 
ATOM   1078  O OE2 . GLU A  1 142 ? 15.038  3.248   127.380 1.00 55.88  ? 143 GLU A OE2 1 
ATOM   1079  N N   . ALA A  1 143 ? 11.731  1.832   123.855 1.00 49.05  ? 144 ALA A N   1 
ATOM   1080  C CA  . ALA A  1 143 ? 11.620  0.862   122.767 1.00 49.14  ? 144 ALA A CA  1 
ATOM   1081  C C   . ALA A  1 143 ? 10.945  1.541   121.581 1.00 48.85  ? 144 ALA A C   1 
ATOM   1082  O O   . ALA A  1 143 ? 9.845   2.065   121.708 1.00 49.78  ? 144 ALA A O   1 
ATOM   1083  C CB  . ALA A  1 143 ? 10.800  -0.331  123.215 1.00 49.44  ? 144 ALA A CB  1 
ATOM   1084  N N   . LYS A  1 144 ? 11.599  1.531   120.429 1.00 49.03  ? 145 LYS A N   1 
ATOM   1085  C CA  . LYS A  1 144 ? 11.059  2.165   119.230 1.00 48.60  ? 145 LYS A CA  1 
ATOM   1086  C C   . LYS A  1 144 ? 10.174  1.238   118.367 1.00 48.56  ? 145 LYS A C   1 
ATOM   1087  O O   . LYS A  1 144 ? 10.469  0.047   118.187 1.00 49.29  ? 145 LYS A O   1 
ATOM   1088  C CB  . LYS A  1 144 ? 12.229  2.729   118.427 1.00 47.98  ? 145 LYS A CB  1 
ATOM   1089  C CG  . LYS A  1 144 ? 11.954  2.961   116.969 1.00 50.63  ? 145 LYS A CG  1 
ATOM   1090  C CD  . LYS A  1 144 ? 13.127  3.699   116.352 1.00 53.00  ? 145 LYS A CD  1 
ATOM   1091  C CE  . LYS A  1 144 ? 13.065  3.689   114.848 1.00 52.70  ? 145 LYS A CE  1 
ATOM   1092  N NZ  . LYS A  1 144 ? 13.212  2.296   114.338 1.00 55.95  ? 145 LYS A NZ  1 
ATOM   1093  N N   . VAL A  1 145 ? 9.090   1.791   117.833 1.00 46.83  ? 146 VAL A N   1 
ATOM   1094  C CA  . VAL A  1 145 ? 8.161   1.020   117.011 1.00 45.30  ? 146 VAL A CA  1 
ATOM   1095  C C   . VAL A  1 145 ? 7.887   1.619   115.634 1.00 46.08  ? 146 VAL A C   1 
ATOM   1096  O O   . VAL A  1 145 ? 7.287   2.683   115.514 1.00 47.17  ? 146 VAL A O   1 
ATOM   1097  C CB  . VAL A  1 145 ? 6.831   0.902   117.704 1.00 43.65  ? 146 VAL A CB  1 
ATOM   1098  C CG1 . VAL A  1 145 ? 5.896   0.048   116.890 1.00 43.80  ? 146 VAL A CG1 1 
ATOM   1099  C CG2 . VAL A  1 145 ? 7.035   0.342   119.057 1.00 44.64  ? 146 VAL A CG2 1 
ATOM   1100  N N   . GLN A  1 146 ? 8.293   0.929   114.584 1.00 46.63  ? 147 GLN A N   1 
ATOM   1101  C CA  . GLN A  1 146 ? 8.059   1.444   113.244 1.00 47.28  ? 147 GLN A CA  1 
ATOM   1102  C C   . GLN A  1 146 ? 6.804   0.819   112.679 1.00 47.34  ? 147 GLN A C   1 
ATOM   1103  O O   . GLN A  1 146 ? 6.604   -0.382  112.799 1.00 48.09  ? 147 GLN A O   1 
ATOM   1104  C CB  . GLN A  1 146 ? 9.244   1.107   112.345 1.00 48.61  ? 147 GLN A CB  1 
ATOM   1105  C CG  . GLN A  1 146 ? 9.397   2.017   111.172 1.00 51.12  ? 147 GLN A CG  1 
ATOM   1106  C CD  . GLN A  1 146 ? 9.180   3.466   111.553 1.00 53.94  ? 147 GLN A CD  1 
ATOM   1107  O OE1 . GLN A  1 146 ? 8.049   3.879   111.843 1.00 55.01  ? 147 GLN A OE1 1 
ATOM   1108  N NE2 . GLN A  1 146 ? 10.266  4.251   111.566 1.00 54.47  ? 147 GLN A NE2 1 
ATOM   1109  N N   . TRP A  1 147 ? 5.939   1.626   112.083 1.00 47.94  ? 148 TRP A N   1 
ATOM   1110  C CA  . TRP A  1 147 ? 4.728   1.077   111.486 1.00 47.86  ? 148 TRP A CA  1 
ATOM   1111  C C   . TRP A  1 147 ? 4.885   1.107   109.977 1.00 47.74  ? 148 TRP A C   1 
ATOM   1112  O O   . TRP A  1 147 ? 5.221   2.141   109.400 1.00 46.80  ? 148 TRP A O   1 
ATOM   1113  C CB  . TRP A  1 147 ? 3.492   1.869   111.892 1.00 47.88  ? 148 TRP A CB  1 
ATOM   1114  C CG  . TRP A  1 147 ? 2.770   1.302   113.063 1.00 47.74  ? 148 TRP A CG  1 
ATOM   1115  C CD1 . TRP A  1 147 ? 2.599   1.888   114.279 1.00 48.71  ? 148 TRP A CD1 1 
ATOM   1116  C CD2 . TRP A  1 147 ? 2.084   0.053   113.123 1.00 48.26  ? 148 TRP A CD2 1 
ATOM   1117  N NE1 . TRP A  1 147 ? 1.845   1.087   115.095 1.00 47.87  ? 148 TRP A NE1 1 
ATOM   1118  C CE2 . TRP A  1 147 ? 1.514   -0.048  114.411 1.00 47.62  ? 148 TRP A CE2 1 
ATOM   1119  C CE3 . TRP A  1 147 ? 1.893   -0.992  112.213 1.00 49.50  ? 148 TRP A CE3 1 
ATOM   1120  C CZ2 . TRP A  1 147 ? 0.768   -1.148  114.816 1.00 47.38  ? 148 TRP A CZ2 1 
ATOM   1121  C CZ3 . TRP A  1 147 ? 1.147   -2.094  112.619 1.00 50.09  ? 148 TRP A CZ3 1 
ATOM   1122  C CH2 . TRP A  1 147 ? 0.594   -2.159  113.913 1.00 48.71  ? 148 TRP A CH2 1 
ATOM   1123  N N   . LYS A  1 148 ? 4.658   -0.051  109.362 1.00 48.37  ? 149 LYS A N   1 
ATOM   1124  C CA  . LYS A  1 148 ? 4.770   -0.237  107.921 1.00 48.59  ? 149 LYS A CA  1 
ATOM   1125  C C   . LYS A  1 148 ? 3.475   -0.778  107.351 1.00 48.61  ? 149 LYS A C   1 
ATOM   1126  O O   . LYS A  1 148 ? 2.847   -1.650  107.939 1.00 49.54  ? 149 LYS A O   1 
ATOM   1127  C CB  . LYS A  1 148 ? 5.892   -1.223  107.612 1.00 49.28  ? 149 LYS A CB  1 
ATOM   1128  C CG  . LYS A  1 148 ? 7.018   -0.639  106.779 1.00 52.09  ? 149 LYS A CG  1 
ATOM   1129  C CD  . LYS A  1 148 ? 8.283   -1.494  106.835 1.00 52.32  ? 149 LYS A CD  1 
ATOM   1130  C CE  . LYS A  1 148 ? 8.895   -1.509  108.231 1.00 51.64  ? 149 LYS A CE  1 
ATOM   1131  N NZ  . LYS A  1 148 ? 10.180  -2.261  108.257 1.00 52.14  ? 149 LYS A NZ  1 
ATOM   1132  N N   . VAL A  1 149 ? 3.073   -0.260  106.204 1.00 48.34  ? 150 VAL A N   1 
ATOM   1133  C CA  . VAL A  1 149 ? 1.860   -0.727  105.569 1.00 49.34  ? 150 VAL A CA  1 
ATOM   1134  C C   . VAL A  1 149 ? 2.187   -0.982  104.112 1.00 51.93  ? 150 VAL A C   1 
ATOM   1135  O O   . VAL A  1 149 ? 2.738   -0.116  103.437 1.00 51.77  ? 150 VAL A O   1 
ATOM   1136  C CB  . VAL A  1 149 ? 0.775   0.311   105.672 1.00 48.06  ? 150 VAL A CB  1 
ATOM   1137  C CG1 . VAL A  1 149 ? -0.545  -0.279  105.212 1.00 49.19  ? 150 VAL A CG1 1 
ATOM   1138  C CG2 . VAL A  1 149 ? 0.685   0.791   107.088 1.00 46.78  ? 150 VAL A CG2 1 
ATOM   1139  N N   . ASP A  1 150 ? 1.857   -2.175  103.629 1.00 54.73  ? 151 ASP A N   1 
ATOM   1140  C CA  . ASP A  1 150 ? 2.165   -2.531  102.248 1.00 57.88  ? 151 ASP A CA  1 
ATOM   1141  C C   . ASP A  1 150 ? 3.613   -2.136  101.942 1.00 58.78  ? 151 ASP A C   1 
ATOM   1142  O O   . ASP A  1 150 ? 3.919   -1.618  100.870 1.00 58.62  ? 151 ASP A O   1 
ATOM   1143  C CB  . ASP A  1 150 ? 1.214   -1.819  101.275 1.00 59.63  ? 151 ASP A CB  1 
ATOM   1144  C CG  . ASP A  1 150 ? -0.095  -2.575  101.061 1.00 61.20  ? 151 ASP A CG  1 
ATOM   1145  O OD1 . ASP A  1 150 ? -0.036  -3.791  100.777 1.00 61.82  ? 151 ASP A OD1 1 
ATOM   1146  O OD2 . ASP A  1 150 ? -1.177  -1.956  101.156 1.00 60.90  ? 151 ASP A OD2 1 
ATOM   1147  N N   . ASN A  1 151 ? 4.495   -2.375  102.905 1.00 60.43  ? 152 ASN A N   1 
ATOM   1148  C CA  . ASN A  1 151 ? 5.913   -2.059  102.764 1.00 62.42  ? 152 ASN A CA  1 
ATOM   1149  C C   . ASN A  1 151 ? 6.223   -0.560  102.802 1.00 61.98  ? 152 ASN A C   1 
ATOM   1150  O O   . ASN A  1 151 ? 7.372   -0.149  102.584 1.00 62.46  ? 152 ASN A O   1 
ATOM   1151  C CB  . ASN A  1 151 ? 6.466   -2.674  101.471 1.00 65.17  ? 152 ASN A CB  1 
ATOM   1152  C CG  . ASN A  1 151 ? 6.429   -4.199  101.486 1.00 68.45  ? 152 ASN A CG  1 
ATOM   1153  O OD1 . ASN A  1 151 ? 6.878   -4.840  102.447 1.00 68.99  ? 152 ASN A OD1 1 
ATOM   1154  N ND2 . ASN A  1 151 ? 5.900   -4.790  100.415 1.00 69.26  ? 152 ASN A ND2 1 
ATOM   1155  N N   . ALA A  1 152 ? 5.203   0.251   103.087 1.00 59.78  ? 153 ALA A N   1 
ATOM   1156  C CA  . ALA A  1 152 ? 5.373   1.701   103.163 1.00 57.09  ? 153 ALA A CA  1 
ATOM   1157  C C   . ALA A  1 152 ? 5.573   2.153   104.603 1.00 55.42  ? 153 ALA A C   1 
ATOM   1158  O O   . ALA A  1 152 ? 4.953   1.609   105.516 1.00 55.53  ? 153 ALA A O   1 
ATOM   1159  C CB  . ALA A  1 152 ? 4.166   2.393   102.580 1.00 56.75  ? 153 ALA A CB  1 
ATOM   1160  N N   . LEU A  1 153 ? 6.438   3.146   104.805 1.00 52.67  ? 154 LEU A N   1 
ATOM   1161  C CA  . LEU A  1 153 ? 6.694   3.672   106.145 1.00 49.13  ? 154 LEU A CA  1 
ATOM   1162  C C   . LEU A  1 153 ? 5.675   4.728   106.578 1.00 47.38  ? 154 LEU A C   1 
ATOM   1163  O O   . LEU A  1 153 ? 5.553   5.784   105.964 1.00 46.93  ? 154 LEU A O   1 
ATOM   1164  C CB  . LEU A  1 153 ? 8.107   4.259   106.238 1.00 47.87  ? 154 LEU A CB  1 
ATOM   1165  C CG  . LEU A  1 153 ? 9.117   3.373   106.961 1.00 45.69  ? 154 LEU A CG  1 
ATOM   1166  C CD1 . LEU A  1 153 ? 8.392   2.666   108.080 1.00 45.91  ? 154 LEU A CD1 1 
ATOM   1167  C CD2 . LEU A  1 153 ? 9.700   2.347   106.034 1.00 44.40  ? 154 LEU A CD2 1 
ATOM   1168  N N   . GLN A  1 154 ? 4.970   4.432   107.663 1.00 45.62  ? 155 GLN A N   1 
ATOM   1169  C CA  . GLN A  1 154 ? 3.946   5.308   108.212 1.00 44.40  ? 155 GLN A CA  1 
ATOM   1170  C C   . GLN A  1 154 ? 4.492   6.348   109.195 1.00 43.51  ? 155 GLN A C   1 
ATOM   1171  O O   . GLN A  1 154 ? 5.656   6.279   109.594 1.00 44.17  ? 155 GLN A O   1 
ATOM   1172  C CB  . GLN A  1 154 ? 2.895   4.456   108.918 1.00 44.06  ? 155 GLN A CB  1 
ATOM   1173  C CG  . GLN A  1 154 ? 2.454   3.260   108.116 1.00 42.55  ? 155 GLN A CG  1 
ATOM   1174  C CD  . GLN A  1 154 ? 1.962   3.647   106.748 1.00 44.19  ? 155 GLN A CD  1 
ATOM   1175  O OE1 . GLN A  1 154 ? 0.841   4.117   106.588 1.00 44.03  ? 155 GLN A OE1 1 
ATOM   1176  N NE2 . GLN A  1 154 ? 2.806   3.462   105.748 1.00 44.91  ? 155 GLN A NE2 1 
ATOM   1177  N N   . SER A  1 155 ? 3.622   7.292   109.579 1.00 41.68  ? 156 SER A N   1 
ATOM   1178  C CA  . SER A  1 155 ? 3.923   8.377   110.530 1.00 38.20  ? 156 SER A CA  1 
ATOM   1179  C C   . SER A  1 155 ? 2.771   9.388   110.648 1.00 37.88  ? 156 SER A C   1 
ATOM   1180  O O   . SER A  1 155 ? 2.514   10.147  109.708 1.00 38.78  ? 156 SER A O   1 
ATOM   1181  C CB  . SER A  1 155 ? 5.185   9.130   110.111 1.00 36.02  ? 156 SER A CB  1 
ATOM   1182  O OG  . SER A  1 155 ? 5.369   10.283  110.909 1.00 30.83  ? 156 SER A OG  1 
ATOM   1183  N N   . GLY A  1 156 ? 2.085   9.392   111.792 1.00 36.43  ? 157 GLY A N   1 
ATOM   1184  C CA  . GLY A  1 156 ? 0.986   10.321  112.028 1.00 35.92  ? 157 GLY A CA  1 
ATOM   1185  C C   . GLY A  1 156 ? -0.340  9.666   112.372 1.00 36.99  ? 157 GLY A C   1 
ATOM   1186  O O   . GLY A  1 156 ? -1.175  10.213  113.088 1.00 35.16  ? 157 GLY A O   1 
ATOM   1187  N N   . ASN A  1 157 ? -0.506  8.457   111.860 1.00 39.19  ? 158 ASN A N   1 
ATOM   1188  C CA  . ASN A  1 157 ? -1.709  7.643   112.026 1.00 41.10  ? 158 ASN A CA  1 
ATOM   1189  C C   . ASN A  1 157 ? -1.673  6.669   113.191 1.00 41.18  ? 158 ASN A C   1 
ATOM   1190  O O   . ASN A  1 157 ? -2.686  6.056   113.529 1.00 40.65  ? 158 ASN A O   1 
ATOM   1191  C CB  . ASN A  1 157 ? -1.915  6.847   110.741 1.00 42.26  ? 158 ASN A CB  1 
ATOM   1192  C CG  . ASN A  1 157 ? -0.612  6.247   110.215 1.00 43.26  ? 158 ASN A CG  1 
ATOM   1193  O OD1 . ASN A  1 157 ? -0.614  5.544   109.211 1.00 45.16  ? 158 ASN A OD1 1 
ATOM   1194  N ND2 . ASN A  1 157 ? 0.503   6.523   110.893 1.00 40.98  ? 158 ASN A ND2 1 
ATOM   1195  N N   . SER A  1 158 ? -0.487  6.533   113.774 1.00 43.60  ? 159 SER A N   1 
ATOM   1196  C CA  . SER A  1 158 ? -0.202  5.620   114.883 1.00 44.56  ? 159 SER A CA  1 
ATOM   1197  C C   . SER A  1 158 ? 0.035   6.313   116.223 1.00 45.87  ? 159 SER A C   1 
ATOM   1198  O O   . SER A  1 158 ? 0.861   7.232   116.326 1.00 47.80  ? 159 SER A O   1 
ATOM   1199  C CB  . SER A  1 158 ? 1.041   4.796   114.534 1.00 43.78  ? 159 SER A CB  1 
ATOM   1200  O OG  . SER A  1 158 ? 2.144   5.652   114.237 1.00 40.37  ? 159 SER A OG  1 
ATOM   1201  N N   . GLN A  1 159 ? -0.676  5.874   117.254 1.00 46.10  ? 160 GLN A N   1 
ATOM   1202  C CA  . GLN A  1 159 ? -0.481  6.460   118.565 1.00 46.58  ? 160 GLN A CA  1 
ATOM   1203  C C   . GLN A  1 159 ? -0.026  5.400   119.562 1.00 45.84  ? 160 GLN A C   1 
ATOM   1204  O O   . GLN A  1 159 ? -0.539  4.279   119.579 1.00 44.80  ? 160 GLN A O   1 
ATOM   1205  C CB  . GLN A  1 159 ? -1.749  7.171   119.016 1.00 48.45  ? 160 GLN A CB  1 
ATOM   1206  C CG  . GLN A  1 159 ? -2.034  8.413   118.174 1.00 51.85  ? 160 GLN A CG  1 
ATOM   1207  C CD  . GLN A  1 159 ? -3.189  9.247   118.705 1.00 53.92  ? 160 GLN A CD  1 
ATOM   1208  O OE1 . GLN A  1 159 ? -4.306  8.745   118.880 1.00 55.67  ? 160 GLN A OE1 1 
ATOM   1209  N NE2 . GLN A  1 159 ? -2.927  10.528  118.961 1.00 53.66  ? 160 GLN A NE2 1 
ATOM   1210  N N   . GLU A  1 160 ? 0.966   5.778   120.369 1.00 45.14  ? 161 GLU A N   1 
ATOM   1211  C CA  . GLU A  1 160 ? 1.586   4.905   121.361 1.00 43.45  ? 161 GLU A CA  1 
ATOM   1212  C C   . GLU A  1 160 ? 1.271   5.338   122.773 1.00 39.88  ? 161 GLU A C   1 
ATOM   1213  O O   . GLU A  1 160 ? 0.857   6.467   123.005 1.00 40.31  ? 161 GLU A O   1 
ATOM   1214  C CB  . GLU A  1 160 ? 3.114   4.907   121.177 1.00 47.58  ? 161 GLU A CB  1 
ATOM   1215  C CG  . GLU A  1 160 ? 3.592   5.185   119.727 1.00 53.00  ? 161 GLU A CG  1 
ATOM   1216  C CD  . GLU A  1 160 ? 5.021   4.700   119.459 1.00 56.10  ? 161 GLU A CD  1 
ATOM   1217  O OE1 . GLU A  1 160 ? 5.870   4.815   120.369 1.00 58.53  ? 161 GLU A OE1 1 
ATOM   1218  O OE2 . GLU A  1 160 ? 5.299   4.216   118.335 1.00 56.20  ? 161 GLU A OE2 1 
ATOM   1219  N N   . SER A  1 161 ? 1.477   4.426   123.712 1.00 37.05  ? 162 SER A N   1 
ATOM   1220  C CA  . SER A  1 161 ? 1.237   4.678   125.122 1.00 34.29  ? 162 SER A CA  1 
ATOM   1221  C C   . SER A  1 161 ? 2.059   3.733   125.958 1.00 34.23  ? 162 SER A C   1 
ATOM   1222  O O   . SER A  1 161 ? 2.357   2.619   125.538 1.00 35.33  ? 162 SER A O   1 
ATOM   1223  C CB  . SER A  1 161 ? -0.214  4.483   125.476 1.00 32.78  ? 162 SER A CB  1 
ATOM   1224  O OG  . SER A  1 161 ? -0.330  4.407   126.881 1.00 35.55  ? 162 SER A OG  1 
ATOM   1225  N N   . VAL A  1 162 ? 2.402   4.169   127.162 1.00 35.14  ? 163 VAL A N   1 
ATOM   1226  C CA  . VAL A  1 162 ? 3.237   3.362   128.040 1.00 36.04  ? 163 VAL A CA  1 
ATOM   1227  C C   . VAL A  1 162 ? 2.801   3.264   129.502 1.00 37.66  ? 163 VAL A C   1 
ATOM   1228  O O   . VAL A  1 162 ? 2.604   4.263   130.201 1.00 37.09  ? 163 VAL A O   1 
ATOM   1229  C CB  . VAL A  1 162 ? 4.667   3.865   128.006 1.00 34.84  ? 163 VAL A CB  1 
ATOM   1230  C CG1 . VAL A  1 162 ? 5.569   2.866   128.658 1.00 36.22  ? 163 VAL A CG1 1 
ATOM   1231  C CG2 . VAL A  1 162 ? 5.085   4.109   126.581 1.00 34.34  ? 163 VAL A CG2 1 
ATOM   1232  N N   . THR A  1 163 ? 2.673   2.024   129.952 1.00 39.54  ? 164 THR A N   1 
ATOM   1233  C CA  . THR A  1 163 ? 2.259   1.712   131.305 1.00 40.33  ? 164 THR A CA  1 
ATOM   1234  C C   . THR A  1 163 ? 3.319   2.244   132.267 1.00 40.13  ? 164 THR A C   1 
ATOM   1235  O O   . THR A  1 163 ? 4.501   2.256   131.939 1.00 40.54  ? 164 THR A O   1 
ATOM   1236  C CB  . THR A  1 163 ? 2.083   0.155   131.445 1.00 41.23  ? 164 THR A CB  1 
ATOM   1237  O OG1 . THR A  1 163 ? 1.132   -0.146  132.479 1.00 43.21  ? 164 THR A OG1 1 
ATOM   1238  C CG2 . THR A  1 163 ? 3.428   -0.520  131.754 1.00 41.32  ? 164 THR A CG2 1 
ATOM   1239  N N   . GLU A  1 164 ? 2.904   2.711   133.440 1.00 41.46  ? 165 GLU A N   1 
ATOM   1240  C CA  . GLU A  1 164 ? 3.876   3.201   134.414 1.00 42.61  ? 165 GLU A CA  1 
ATOM   1241  C C   . GLU A  1 164 ? 4.630   1.999   134.981 1.00 42.65  ? 165 GLU A C   1 
ATOM   1242  O O   . GLU A  1 164 ? 4.054   0.938   135.191 1.00 42.47  ? 165 GLU A O   1 
ATOM   1243  C CB  . GLU A  1 164 ? 3.190   3.990   135.539 1.00 42.36  ? 165 GLU A CB  1 
ATOM   1244  C CG  . GLU A  1 164 ? 3.562   5.477   135.534 1.00 42.31  ? 165 GLU A CG  1 
ATOM   1245  C CD  . GLU A  1 164 ? 5.046   5.736   135.855 1.00 43.37  ? 165 GLU A CD  1 
ATOM   1246  O OE1 . GLU A  1 164 ? 5.576   6.789   135.413 1.00 42.58  ? 165 GLU A OE1 1 
ATOM   1247  O OE2 . GLU A  1 164 ? 5.674   4.902   136.559 1.00 40.60  ? 165 GLU A OE2 1 
ATOM   1248  N N   . GLN A  1 165 ? 5.924   2.171   135.220 1.00 43.28  ? 166 GLN A N   1 
ATOM   1249  C CA  . GLN A  1 165 ? 6.758   1.091   135.724 1.00 43.12  ? 166 GLN A CA  1 
ATOM   1250  C C   . GLN A  1 165 ? 6.144   0.322   136.875 1.00 45.64  ? 166 GLN A C   1 
ATOM   1251  O O   . GLN A  1 165 ? 5.599   0.903   137.818 1.00 46.09  ? 166 GLN A O   1 
ATOM   1252  C CB  . GLN A  1 165 ? 8.123   1.624   136.126 1.00 39.67  ? 166 GLN A CB  1 
ATOM   1253  C CG  . GLN A  1 165 ? 9.087   0.553   136.516 1.00 34.24  ? 166 GLN A CG  1 
ATOM   1254  C CD  . GLN A  1 165 ? 10.447  1.108   136.745 1.00 32.60  ? 166 GLN A CD  1 
ATOM   1255  O OE1 . GLN A  1 165 ? 10.618  2.031   137.532 1.00 33.70  ? 166 GLN A OE1 1 
ATOM   1256  N NE2 . GLN A  1 165 ? 11.433  0.556   136.066 1.00 31.18  ? 166 GLN A NE2 1 
ATOM   1257  N N   . ASP A  1 166 ? 6.263   -0.999  136.779 1.00 48.86  ? 167 ASP A N   1 
ATOM   1258  C CA  . ASP A  1 166 ? 5.719   -1.939  137.747 1.00 51.91  ? 167 ASP A CA  1 
ATOM   1259  C C   . ASP A  1 166 ? 6.586   -2.220  138.977 1.00 53.47  ? 167 ASP A C   1 
ATOM   1260  O O   . ASP A  1 166 ? 7.776   -2.529  138.872 1.00 52.42  ? 167 ASP A O   1 
ATOM   1261  C CB  . ASP A  1 166 ? 5.405   -3.241  137.030 1.00 54.55  ? 167 ASP A CB  1 
ATOM   1262  C CG  . ASP A  1 166 ? 4.757   -4.258  137.932 1.00 57.87  ? 167 ASP A CG  1 
ATOM   1263  O OD1 . ASP A  1 166 ? 4.311   -3.869  139.039 1.00 60.09  ? 167 ASP A OD1 1 
ATOM   1264  O OD2 . ASP A  1 166 ? 4.685   -5.442  137.522 1.00 58.12  ? 167 ASP A OD2 1 
ATOM   1265  N N   . SER A  1 167 ? 5.949   -2.128  140.143 1.00 55.68  ? 168 SER A N   1 
ATOM   1266  C CA  . SER A  1 167 ? 6.594   -2.337  141.437 1.00 57.48  ? 168 SER A CA  1 
ATOM   1267  C C   . SER A  1 167 ? 7.262   -3.694  141.615 1.00 59.56  ? 168 SER A C   1 
ATOM   1268  O O   . SER A  1 167 ? 8.364   -3.772  142.163 1.00 60.64  ? 168 SER A O   1 
ATOM   1269  C CB  . SER A  1 167 ? 5.580   -2.172  142.568 1.00 55.85  ? 168 SER A CB  1 
ATOM   1270  O OG  . SER A  1 167 ? 4.918   -3.400  142.819 1.00 52.09  ? 168 SER A OG  1 
ATOM   1271  N N   . LYS A  1 168 ? 6.594   -4.758  141.171 1.00 60.94  ? 169 LYS A N   1 
ATOM   1272  C CA  . LYS A  1 168 ? 7.127   -6.110  141.327 1.00 62.09  ? 169 LYS A CA  1 
ATOM   1273  C C   . LYS A  1 168 ? 8.391   -6.438  140.522 1.00 61.95  ? 169 LYS A C   1 
ATOM   1274  O O   . LYS A  1 168 ? 9.456   -6.629  141.116 1.00 61.94  ? 169 LYS A O   1 
ATOM   1275  C CB  . LYS A  1 168 ? 6.027   -7.156  141.049 1.00 63.61  ? 169 LYS A CB  1 
ATOM   1276  C CG  . LYS A  1 168 ? 5.304   -7.020  139.721 1.00 65.69  ? 169 LYS A CG  1 
ATOM   1277  C CD  . LYS A  1 168 ? 4.390   -8.220  139.449 1.00 67.88  ? 169 LYS A CD  1 
ATOM   1278  C CE  . LYS A  1 168 ? 3.473   -7.978  138.239 1.00 68.05  ? 169 LYS A CE  1 
ATOM   1279  N NZ  . LYS A  1 168 ? 2.231   -7.216  138.574 1.00 67.03  ? 169 LYS A NZ  1 
ATOM   1280  N N   . ASP A  1 169 ? 8.281   -6.499  139.191 1.00 61.92  ? 170 ASP A N   1 
ATOM   1281  C CA  . ASP A  1 169 ? 9.425   -6.823  138.319 1.00 60.86  ? 170 ASP A CA  1 
ATOM   1282  C C   . ASP A  1 169 ? 10.036  -5.616  137.634 1.00 59.22  ? 170 ASP A C   1 
ATOM   1283  O O   . ASP A  1 169 ? 11.041  -5.735  136.922 1.00 58.70  ? 170 ASP A O   1 
ATOM   1284  C CB  . ASP A  1 169 ? 9.028   -7.853  137.252 1.00 62.98  ? 170 ASP A CB  1 
ATOM   1285  C CG  . ASP A  1 169 ? 7.702   -7.524  136.566 1.00 65.13  ? 170 ASP A CG  1 
ATOM   1286  O OD1 . ASP A  1 169 ? 6.651   -7.484  137.250 1.00 65.44  ? 170 ASP A OD1 1 
ATOM   1287  O OD2 . ASP A  1 169 ? 7.709   -7.319  135.333 1.00 66.66  ? 170 ASP A OD2 1 
ATOM   1288  N N   . SER A  1 170 ? 9.418   -4.459  137.847 1.00 57.19  ? 171 SER A N   1 
ATOM   1289  C CA  . SER A  1 170 ? 9.903   -3.219  137.274 1.00 55.31  ? 171 SER A CA  1 
ATOM   1290  C C   . SER A  1 170 ? 10.184  -3.329  135.787 1.00 53.91  ? 171 SER A C   1 
ATOM   1291  O O   . SER A  1 170 ? 11.325  -3.217  135.357 1.00 54.72  ? 171 SER A O   1 
ATOM   1292  C CB  . SER A  1 170 ? 11.169  -2.779  138.006 1.00 55.36  ? 171 SER A CB  1 
ATOM   1293  O OG  . SER A  1 170 ? 10.918  -2.667  139.395 1.00 54.87  ? 171 SER A OG  1 
ATOM   1294  N N   . THR A  1 171 ? 9.144   -3.572  135.002 1.00 52.26  ? 172 THR A N   1 
ATOM   1295  C CA  . THR A  1 171 ? 9.300   -3.655  133.556 1.00 50.82  ? 172 THR A CA  1 
ATOM   1296  C C   . THR A  1 171 ? 8.368   -2.624  132.967 1.00 49.60  ? 172 THR A C   1 
ATOM   1297  O O   . THR A  1 171 ? 7.741   -1.859  133.697 1.00 47.75  ? 172 THR A O   1 
ATOM   1298  C CB  . THR A  1 171 ? 8.908   -5.054  132.947 1.00 50.89  ? 172 THR A CB  1 
ATOM   1299  O OG1 . THR A  1 171 ? 7.587   -5.429  133.377 1.00 48.90  ? 172 THR A OG1 1 
ATOM   1300  C CG2 . THR A  1 171 ? 9.936   -6.120  133.315 1.00 48.34  ? 172 THR A CG2 1 
ATOM   1301  N N   . TYR A  1 172 ? 8.281   -2.618  131.641 1.00 48.90  ? 173 TYR A N   1 
ATOM   1302  C CA  . TYR A  1 172 ? 7.406   -1.697  130.937 1.00 47.25  ? 173 TYR A CA  1 
ATOM   1303  C C   . TYR A  1 172 ? 6.608   -2.448  129.902 1.00 46.01  ? 173 TYR A C   1 
ATOM   1304  O O   . TYR A  1 172 ? 7.013   -3.512  129.441 1.00 44.72  ? 173 TYR A O   1 
ATOM   1305  C CB  . TYR A  1 172 ? 8.223   -0.600  130.243 1.00 47.32  ? 173 TYR A CB  1 
ATOM   1306  C CG  . TYR A  1 172 ? 8.779   0.451   131.185 1.00 46.65  ? 173 TYR A CG  1 
ATOM   1307  C CD1 . TYR A  1 172 ? 7.948   1.428   131.733 1.00 44.88  ? 173 TYR A CD1 1 
ATOM   1308  C CD2 . TYR A  1 172 ? 10.121  0.433   131.571 1.00 44.57  ? 173 TYR A CD2 1 
ATOM   1309  C CE1 . TYR A  1 172 ? 8.435   2.340   132.635 1.00 43.37  ? 173 TYR A CE1 1 
ATOM   1310  C CE2 . TYR A  1 172 ? 10.607  1.347   132.474 1.00 42.82  ? 173 TYR A CE2 1 
ATOM   1311  C CZ  . TYR A  1 172 ? 9.758   2.289   132.999 1.00 42.21  ? 173 TYR A CZ  1 
ATOM   1312  O OH  . TYR A  1 172 ? 10.229  3.182   133.913 1.00 44.88  ? 173 TYR A OH  1 
ATOM   1313  N N   . SER A  1 173 ? 5.455   -1.892  129.560 1.00 45.57  ? 174 SER A N   1 
ATOM   1314  C CA  . SER A  1 173 ? 4.603   -2.457  128.532 1.00 44.19  ? 174 SER A CA  1 
ATOM   1315  C C   . SER A  1 173 ? 4.076   -1.286  127.726 1.00 43.25  ? 174 SER A C   1 
ATOM   1316  O O   . SER A  1 173 ? 3.443   -0.388  128.258 1.00 41.16  ? 174 SER A O   1 
ATOM   1317  C CB  . SER A  1 173 ? 3.480   -3.261  129.158 1.00 43.80  ? 174 SER A CB  1 
ATOM   1318  O OG  . SER A  1 173 ? 3.992   -4.502  129.607 1.00 43.77  ? 174 SER A OG  1 
ATOM   1319  N N   . LEU A  1 174 ? 4.395   -1.289  126.442 1.00 44.08  ? 175 LEU A N   1 
ATOM   1320  C CA  . LEU A  1 174 ? 3.985   -0.229  125.524 1.00 46.14  ? 175 LEU A CA  1 
ATOM   1321  C C   . LEU A  1 174 ? 2.789   -0.681  124.687 1.00 46.83  ? 175 LEU A C   1 
ATOM   1322  O O   . LEU A  1 174 ? 2.360   -1.826  124.796 1.00 47.12  ? 175 LEU A O   1 
ATOM   1323  C CB  . LEU A  1 174 ? 5.175   0.134   124.633 1.00 44.93  ? 175 LEU A CB  1 
ATOM   1324  C CG  . LEU A  1 174 ? 5.021   0.802   123.276 1.00 44.17  ? 175 LEU A CG  1 
ATOM   1325  C CD1 . LEU A  1 174 ? 6.333   1.467   122.928 1.00 44.47  ? 175 LEU A CD1 1 
ATOM   1326  C CD2 . LEU A  1 174 ? 4.669   -0.226  122.221 1.00 45.07  ? 175 LEU A CD2 1 
ATOM   1327  N N   . SER A  1 175 ? 2.248   0.208   123.859 1.00 46.98  ? 176 SER A N   1 
ATOM   1328  C CA  . SER A  1 175 ? 1.101   -0.159  123.031 1.00 47.32  ? 176 SER A CA  1 
ATOM   1329  C C   . SER A  1 175 ? 0.811   0.841   121.932 1.00 46.02  ? 176 SER A C   1 
ATOM   1330  O O   . SER A  1 175 ? 0.195   1.871   122.169 1.00 45.65  ? 176 SER A O   1 
ATOM   1331  C CB  . SER A  1 175 ? -0.120  -0.296  123.911 1.00 49.15  ? 176 SER A CB  1 
ATOM   1332  O OG  . SER A  1 175 ? -0.076  0.715   124.902 1.00 52.42  ? 176 SER A OG  1 
ATOM   1333  N N   . SER A  1 176 ? 1.257   0.519   120.726 1.00 46.12  ? 177 SER A N   1 
ATOM   1334  C CA  . SER A  1 176 ? 1.067   1.367   119.556 1.00 46.37  ? 177 SER A CA  1 
ATOM   1335  C C   . SER A  1 176 ? -0.289  1.004   118.967 1.00 47.49  ? 177 SER A C   1 
ATOM   1336  O O   . SER A  1 176 ? -0.644  -0.171  118.878 1.00 48.90  ? 177 SER A O   1 
ATOM   1337  C CB  . SER A  1 176 ? 2.180   1.092   118.542 1.00 46.21  ? 177 SER A CB  1 
ATOM   1338  O OG  . SER A  1 176 ? 2.128   1.987   117.453 1.00 47.03  ? 177 SER A OG  1 
ATOM   1339  N N   . THR A  1 177 ? -1.066  1.998   118.570 1.00 47.09  ? 178 THR A N   1 
ATOM   1340  C CA  . THR A  1 177 ? -2.369  1.691   118.025 1.00 46.07  ? 178 THR A CA  1 
ATOM   1341  C C   . THR A  1 177 ? -2.568  2.487   116.752 1.00 47.19  ? 178 THR A C   1 
ATOM   1342  O O   . THR A  1 177 ? -2.799  3.692   116.792 1.00 48.76  ? 178 THR A O   1 
ATOM   1343  C CB  . THR A  1 177 ? -3.445  2.016   119.054 1.00 45.04  ? 178 THR A CB  1 
ATOM   1344  O OG1 . THR A  1 177 ? -2.976  1.638   120.347 1.00 42.70  ? 178 THR A OG1 1 
ATOM   1345  C CG2 . THR A  1 177 ? -4.702  1.231   118.780 1.00 46.64  ? 178 THR A CG2 1 
ATOM   1346  N N   . LEU A  1 178 ? -2.459  1.801   115.623 1.00 47.15  ? 179 LEU A N   1 
ATOM   1347  C CA  . LEU A  1 178 ? -2.599  2.427   114.316 1.00 48.10  ? 179 LEU A CA  1 
ATOM   1348  C C   . LEU A  1 178 ? -4.025  2.384   113.791 1.00 49.76  ? 179 LEU A C   1 
ATOM   1349  O O   . LEU A  1 178 ? -4.522  1.332   113.380 1.00 48.29  ? 179 LEU A O   1 
ATOM   1350  C CB  . LEU A  1 178 ? -1.649  1.750   113.323 1.00 46.98  ? 179 LEU A CB  1 
ATOM   1351  C CG  . LEU A  1 178 ? -1.732  2.086   111.836 1.00 44.88  ? 179 LEU A CG  1 
ATOM   1352  C CD1 . LEU A  1 178 ? -1.855  3.569   111.598 1.00 45.14  ? 179 LEU A CD1 1 
ATOM   1353  C CD2 . LEU A  1 178 ? -0.491  1.569   111.185 1.00 44.72  ? 179 LEU A CD2 1 
ATOM   1354  N N   . THR A  1 179 ? -4.664  3.549   113.796 1.00 52.09  ? 180 THR A N   1 
ATOM   1355  C CA  . THR A  1 179 ? -6.045  3.686   113.342 1.00 55.52  ? 180 THR A CA  1 
ATOM   1356  C C   . THR A  1 179 ? -6.160  4.232   111.912 1.00 57.44  ? 180 THR A C   1 
ATOM   1357  O O   . THR A  1 179 ? -5.430  5.154   111.533 1.00 58.76  ? 180 THR A O   1 
ATOM   1358  C CB  . THR A  1 179 ? -6.828  4.632   114.266 1.00 55.91  ? 180 THR A CB  1 
ATOM   1359  O OG1 . THR A  1 179 ? -6.056  4.892   115.451 1.00 55.96  ? 180 THR A OG1 1 
ATOM   1360  C CG2 . THR A  1 179 ? -8.180  4.016   114.631 1.00 54.63  ? 180 THR A CG2 1 
ATOM   1361  N N   . LEU A  1 180 ? -7.088  3.659   111.138 1.00 58.56  ? 181 LEU A N   1 
ATOM   1362  C CA  . LEU A  1 180 ? -7.363  4.055   109.752 1.00 58.22  ? 181 LEU A CA  1 
ATOM   1363  C C   . LEU A  1 180 ? -8.874  4.092   109.507 1.00 59.73  ? 181 LEU A C   1 
ATOM   1364  O O   . LEU A  1 180 ? -9.673  3.803   110.405 1.00 59.27  ? 181 LEU A O   1 
ATOM   1365  C CB  . LEU A  1 180 ? -6.724  3.066   108.784 1.00 56.58  ? 181 LEU A CB  1 
ATOM   1366  C CG  . LEU A  1 180 ? -5.420  3.486   108.106 1.00 56.05  ? 181 LEU A CG  1 
ATOM   1367  C CD1 . LEU A  1 180 ? -4.600  4.387   109.005 1.00 56.13  ? 181 LEU A CD1 1 
ATOM   1368  C CD2 . LEU A  1 180 ? -4.635  2.246   107.742 1.00 54.64  ? 181 LEU A CD2 1 
ATOM   1369  N N   . SER A  1 181 ? -9.266  4.453   108.291 1.00 61.39  ? 182 SER A N   1 
ATOM   1370  C CA  . SER A  1 181 ? -10.685 4.522   107.939 1.00 62.81  ? 182 SER A CA  1 
ATOM   1371  C C   . SER A  1 181 ? -11.060 3.278   107.144 1.00 63.19  ? 182 SER A C   1 
ATOM   1372  O O   . SER A  1 181 ? -10.278 2.815   106.305 1.00 63.78  ? 182 SER A O   1 
ATOM   1373  C CB  . SER A  1 181 ? -10.958 5.782   107.117 1.00 63.74  ? 182 SER A CB  1 
ATOM   1374  O OG  . SER A  1 181 ? -9.933  5.991   106.162 1.00 63.88  ? 182 SER A OG  1 
ATOM   1375  N N   . LYS A  1 182 ? -12.249 2.742   107.404 1.00 62.04  ? 183 LYS A N   1 
ATOM   1376  C CA  . LYS A  1 182 ? -12.688 1.528   106.732 1.00 61.60  ? 183 LYS A CA  1 
ATOM   1377  C C   . LYS A  1 182 ? -12.099 1.368   105.337 1.00 61.34  ? 183 LYS A C   1 
ATOM   1378  O O   . LYS A  1 182 ? -11.339 0.436   105.087 1.00 60.22  ? 183 LYS A O   1 
ATOM   1379  C CB  . LYS A  1 182 ? -14.207 1.477   106.660 1.00 62.10  ? 183 LYS A CB  1 
ATOM   1380  C CG  . LYS A  1 182 ? -14.718 0.058   106.592 1.00 63.27  ? 183 LYS A CG  1 
ATOM   1381  C CD  . LYS A  1 182 ? -16.225 -0.013  106.439 1.00 64.72  ? 183 LYS A CD  1 
ATOM   1382  C CE  . LYS A  1 182 ? -16.706 -1.457  106.554 1.00 64.44  ? 183 LYS A CE  1 
ATOM   1383  N NZ  . LYS A  1 182 ? -16.094 -2.341  105.526 1.00 63.58  ? 183 LYS A NZ  1 
ATOM   1384  N N   . ALA A  1 183 ? -12.439 2.285   104.436 1.00 61.93  ? 184 ALA A N   1 
ATOM   1385  C CA  . ALA A  1 183 ? -11.929 2.240   103.062 1.00 62.43  ? 184 ALA A CA  1 
ATOM   1386  C C   . ALA A  1 183 ? -10.422 2.109   103.094 1.00 62.76  ? 184 ALA A C   1 
ATOM   1387  O O   . ALA A  1 183 ? -9.863  1.090   102.698 1.00 61.87  ? 184 ALA A O   1 
ATOM   1388  C CB  . ALA A  1 183 ? -12.309 3.510   102.315 1.00 62.17  ? 184 ALA A CB  1 
ATOM   1389  N N   . ASP A  1 184 ? -9.784  3.175   103.566 1.00 63.86  ? 185 ASP A N   1 
ATOM   1390  C CA  . ASP A  1 184 ? -8.340  3.255   103.704 1.00 64.05  ? 185 ASP A CA  1 
ATOM   1391  C C   . ASP A  1 184 ? -7.760  1.901   104.064 1.00 65.63  ? 185 ASP A C   1 
ATOM   1392  O O   . ASP A  1 184 ? -6.869  1.395   103.377 1.00 66.04  ? 185 ASP A O   1 
ATOM   1393  C CB  . ASP A  1 184 ? -7.985  4.255   104.804 1.00 62.56  ? 185 ASP A CB  1 
ATOM   1394  C CG  . ASP A  1 184 ? -7.888  5.677   104.297 1.00 61.61  ? 185 ASP A CG  1 
ATOM   1395  O OD1 . ASP A  1 184 ? -8.808  6.128   103.587 1.00 61.01  ? 185 ASP A OD1 1 
ATOM   1396  O OD2 . ASP A  1 184 ? -6.888  6.349   104.620 1.00 61.83  ? 185 ASP A OD2 1 
ATOM   1397  N N   . TYR A  1 185 ? -8.282  1.325   105.147 1.00 66.75  ? 186 TYR A N   1 
ATOM   1398  C CA  . TYR A  1 185 ? -7.840  0.031   105.654 1.00 67.27  ? 186 TYR A CA  1 
ATOM   1399  C C   . TYR A  1 185 ? -8.013  -1.153  104.710 1.00 68.43  ? 186 TYR A C   1 
ATOM   1400  O O   . TYR A  1 185 ? -7.111  -1.981  104.584 1.00 68.08  ? 186 TYR A O   1 
ATOM   1401  C CB  . TYR A  1 185 ? -8.562  -0.292  106.951 1.00 66.65  ? 186 TYR A CB  1 
ATOM   1402  C CG  . TYR A  1 185 ? -8.199  -1.649  107.498 1.00 66.47  ? 186 TYR A CG  1 
ATOM   1403  C CD1 . TYR A  1 185 ? -6.876  -2.078  107.512 1.00 66.00  ? 186 TYR A CD1 1 
ATOM   1404  C CD2 . TYR A  1 185 ? -9.160  -2.475  108.068 1.00 66.58  ? 186 TYR A CD2 1 
ATOM   1405  C CE1 . TYR A  1 185 ? -6.516  -3.289  108.086 1.00 65.40  ? 186 TYR A CE1 1 
ATOM   1406  C CE2 . TYR A  1 185 ? -8.804  -3.694  108.649 1.00 66.26  ? 186 TYR A CE2 1 
ATOM   1407  C CZ  . TYR A  1 185 ? -7.477  -4.088  108.657 1.00 65.44  ? 186 TYR A CZ  1 
ATOM   1408  O OH  . TYR A  1 185 ? -7.091  -5.255  109.274 1.00 64.18  ? 186 TYR A OH  1 
ATOM   1409  N N   . GLU A  1 186 ? -9.173  -1.239  104.061 1.00 69.54  ? 187 GLU A N   1 
ATOM   1410  C CA  . GLU A  1 186 ? -9.462  -2.340  103.143 1.00 70.08  ? 187 GLU A CA  1 
ATOM   1411  C C   . GLU A  1 186 ? -8.635  -2.254  101.866 1.00 69.95  ? 187 GLU A C   1 
ATOM   1412  O O   . GLU A  1 186 ? -8.612  -3.187  101.074 1.00 70.09  ? 187 GLU A O   1 
ATOM   1413  C CB  . GLU A  1 186 ? -10.951 -2.346  102.788 1.00 71.18  ? 187 GLU A CB  1 
ATOM   1414  C CG  . GLU A  1 186 ? -11.873 -2.122  103.982 1.00 73.34  ? 187 GLU A CG  1 
ATOM   1415  C CD  . GLU A  1 186 ? -13.347 -2.131  103.611 1.00 74.51  ? 187 GLU A CD  1 
ATOM   1416  O OE1 . GLU A  1 186 ? -13.765 -1.322  102.751 1.00 75.14  ? 187 GLU A OE1 1 
ATOM   1417  O OE2 . GLU A  1 186 ? -14.093 -2.949  104.191 1.00 75.51  ? 187 GLU A OE2 1 
ATOM   1418  N N   . LYS A  1 187 ? -7.944  -1.137  101.679 1.00 70.69  ? 188 LYS A N   1 
ATOM   1419  C CA  . LYS A  1 187 ? -7.130  -0.936  100.491 1.00 72.16  ? 188 LYS A CA  1 
ATOM   1420  C C   . LYS A  1 187 ? -5.618  -1.042  100.750 1.00 73.16  ? 188 LYS A C   1 
ATOM   1421  O O   . LYS A  1 187 ? -4.855  -0.144  100.390 1.00 73.30  ? 188 LYS A O   1 
ATOM   1422  C CB  . LYS A  1 187 ? -7.462  0.426   99.888  1.00 73.48  ? 188 LYS A CB  1 
ATOM   1423  C CG  . LYS A  1 187 ? -8.961  0.663   99.724  1.00 75.63  ? 188 LYS A CG  1 
ATOM   1424  C CD  . LYS A  1 187 ? -9.276  2.090   99.272  1.00 77.18  ? 188 LYS A CD  1 
ATOM   1425  C CE  . LYS A  1 187 ? -10.783 2.339   99.239  1.00 77.65  ? 188 LYS A CE  1 
ATOM   1426  N NZ  . LYS A  1 187 ? -11.113 3.665   98.643  1.00 78.60  ? 188 LYS A NZ  1 
ATOM   1427  N N   . HIS A  1 188 ? -5.202  -2.151  101.367 1.00 73.87  ? 189 HIS A N   1 
ATOM   1428  C CA  . HIS A  1 188 ? -3.797  -2.444  101.689 1.00 72.62  ? 189 HIS A CA  1 
ATOM   1429  C C   . HIS A  1 188 ? -3.688  -3.926  102.114 1.00 72.06  ? 189 HIS A C   1 
ATOM   1430  O O   . HIS A  1 188 ? -4.616  -4.472  102.709 1.00 72.39  ? 189 HIS A O   1 
ATOM   1431  C CB  . HIS A  1 188 ? -3.311  -1.522  102.815 1.00 73.59  ? 189 HIS A CB  1 
ATOM   1432  C CG  . HIS A  1 188 ? -3.135  -0.092  102.397 1.00 73.84  ? 189 HIS A CG  1 
ATOM   1433  N ND1 . HIS A  1 188 ? -2.179  0.305   101.486 1.00 73.70  ? 189 HIS A ND1 1 
ATOM   1434  C CD2 . HIS A  1 188 ? -3.801  1.032   102.756 1.00 73.71  ? 189 HIS A CD2 1 
ATOM   1435  C CE1 . HIS A  1 188 ? -2.262  1.611   101.304 1.00 74.07  ? 189 HIS A CE1 1 
ATOM   1436  N NE2 . HIS A  1 188 ? -3.239  2.077   102.063 1.00 74.31  ? 189 HIS A NE2 1 
ATOM   1437  N N   . LYS A  1 189 ? -2.565  -4.578  101.825 1.00 70.75  ? 190 LYS A N   1 
ATOM   1438  C CA  . LYS A  1 189 ? -2.413  -6.000  102.163 1.00 69.83  ? 190 LYS A CA  1 
ATOM   1439  C C   . LYS A  1 189 ? -1.735  -6.327  103.513 1.00 68.75  ? 190 LYS A C   1 
ATOM   1440  O O   . LYS A  1 189 ? -2.402  -6.767  104.449 1.00 67.97  ? 190 LYS A O   1 
ATOM   1441  C CB  . LYS A  1 189 ? -1.679  -6.712  101.017 1.00 71.08  ? 190 LYS A CB  1 
ATOM   1442  C CG  . LYS A  1 189 ? -1.825  -8.231  100.998 1.00 72.93  ? 190 LYS A CG  1 
ATOM   1443  C CD  . LYS A  1 189 ? -1.322  -8.814  99.680  1.00 74.01  ? 190 LYS A CD  1 
ATOM   1444  C CE  . LYS A  1 189 ? -1.529  -10.329 99.621  1.00 75.66  ? 190 LYS A CE  1 
ATOM   1445  N NZ  . LYS A  1 189 ? -1.174  -10.926 98.282  1.00 75.79  ? 190 LYS A NZ  1 
ATOM   1446  N N   . VAL A  1 190 ? -0.419  -6.127  103.611 1.00 67.48  ? 191 VAL A N   1 
ATOM   1447  C CA  . VAL A  1 190 ? 0.327   -6.419  104.845 1.00 65.10  ? 191 VAL A CA  1 
ATOM   1448  C C   . VAL A  1 190 ? 0.188   -5.336  105.922 1.00 65.63  ? 191 VAL A C   1 
ATOM   1449  O O   . VAL A  1 190 ? -0.088  -4.166  105.631 1.00 66.00  ? 191 VAL A O   1 
ATOM   1450  C CB  . VAL A  1 190 ? 1.836   -6.606  104.573 1.00 62.69  ? 191 VAL A CB  1 
ATOM   1451  C CG1 . VAL A  1 190 ? 2.567   -6.858  105.870 1.00 60.85  ? 191 VAL A CG1 1 
ATOM   1452  C CG2 . VAL A  1 190 ? 2.054   -7.756  103.628 1.00 62.38  ? 191 VAL A CG2 1 
ATOM   1453  N N   . TYR A  1 191 ? 0.394   -5.742  107.171 1.00 64.57  ? 192 TYR A N   1 
ATOM   1454  C CA  . TYR A  1 191 ? 0.303   -4.837  108.304 1.00 63.28  ? 192 TYR A CA  1 
ATOM   1455  C C   . TYR A  1 191 ? 1.255   -5.248  109.411 1.00 62.99  ? 192 TYR A C   1 
ATOM   1456  O O   . TYR A  1 191 ? 0.900   -6.032  110.293 1.00 63.06  ? 192 TYR A O   1 
ATOM   1457  C CB  . TYR A  1 191 ? -1.121  -4.813  108.820 1.00 63.41  ? 192 TYR A CB  1 
ATOM   1458  C CG  . TYR A  1 191 ? -1.937  -3.746  108.152 1.00 65.47  ? 192 TYR A CG  1 
ATOM   1459  C CD1 . TYR A  1 191 ? -1.675  -2.397  108.396 1.00 66.16  ? 192 TYR A CD1 1 
ATOM   1460  C CD2 . TYR A  1 191 ? -2.972  -4.071  107.275 1.00 65.53  ? 192 TYR A CD2 1 
ATOM   1461  C CE1 . TYR A  1 191 ? -2.426  -1.400  107.791 1.00 65.85  ? 192 TYR A CE1 1 
ATOM   1462  C CE2 . TYR A  1 191 ? -3.722  -3.078  106.663 1.00 65.15  ? 192 TYR A CE2 1 
ATOM   1463  C CZ  . TYR A  1 191 ? -3.445  -1.749  106.932 1.00 64.84  ? 192 TYR A CZ  1 
ATOM   1464  O OH  . TYR A  1 191 ? -4.212  -0.767  106.381 1.00 64.50  ? 192 TYR A OH  1 
ATOM   1465  N N   . ALA A  1 192 ? 2.466   -4.703  109.364 1.00 61.51  ? 193 ALA A N   1 
ATOM   1466  C CA  . ALA A  1 192 ? 3.483   -5.029  110.346 1.00 60.60  ? 193 ALA A CA  1 
ATOM   1467  C C   . ALA A  1 192 ? 4.000   -3.832  111.136 1.00 60.19  ? 193 ALA A C   1 
ATOM   1468  O O   . ALA A  1 192 ? 3.852   -2.674  110.729 1.00 60.98  ? 193 ALA A O   1 
ATOM   1469  C CB  . ALA A  1 192 ? 4.648   -5.722  109.664 1.00 61.00  ? 193 ALA A CB  1 
ATOM   1470  N N   . CYS A  1 193 ? 4.614   -4.135  112.273 1.00 56.71  ? 194 CYS A N   1 
ATOM   1471  C CA  . CYS A  1 193 ? 5.176   -3.124  113.120 1.00 53.15  ? 194 CYS A CA  1 
ATOM   1472  C C   . CYS A  1 193 ? 6.517   -3.634  113.628 1.00 52.14  ? 194 CYS A C   1 
ATOM   1473  O O   . CYS A  1 193 ? 6.586   -4.410  114.561 1.00 51.06  ? 194 CYS A O   1 
ATOM   1474  C CB  . CYS A  1 193 ? 4.207   -2.824  114.261 1.00 52.53  ? 194 CYS A CB  1 
ATOM   1475  S SG  . CYS A  1 193 ? 3.634   -4.286  115.186 1.00 52.63  ? 194 CYS A SG  1 
ATOM   1476  N N   . GLU A  1 194 ? 7.588   -3.212  112.973 1.00 51.94  ? 195 GLU A N   1 
ATOM   1477  C CA  . GLU A  1 194 ? 8.930   -3.609  113.362 1.00 52.75  ? 195 GLU A CA  1 
ATOM   1478  C C   . GLU A  1 194 ? 9.366   -2.860  114.622 1.00 54.01  ? 195 GLU A C   1 
ATOM   1479  O O   . GLU A  1 194 ? 9.247   -1.633  114.710 1.00 54.10  ? 195 GLU A O   1 
ATOM   1480  C CB  . GLU A  1 194 ? 9.909   -3.319  112.229 1.00 52.75  ? 195 GLU A CB  1 
ATOM   1481  C CG  . GLU A  1 194 ? 11.348  -3.175  112.672 1.00 55.56  ? 195 GLU A CG  1 
ATOM   1482  C CD  . GLU A  1 194 ? 11.925  -1.799  112.354 1.00 58.64  ? 195 GLU A CD  1 
ATOM   1483  O OE1 . GLU A  1 194 ? 12.645  -1.670  111.337 1.00 59.54  ? 195 GLU A OE1 1 
ATOM   1484  O OE2 . GLU A  1 194 ? 11.654  -0.840  113.117 1.00 59.98  ? 195 GLU A OE2 1 
ATOM   1485  N N   . VAL A  1 195 ? 9.891   -3.601  115.592 1.00 54.61  ? 196 VAL A N   1 
ATOM   1486  C CA  . VAL A  1 195 ? 10.330  -3.009  116.848 1.00 54.39  ? 196 VAL A CA  1 
ATOM   1487  C C   . VAL A  1 195 ? 11.836  -3.111  117.098 1.00 54.45  ? 196 VAL A C   1 
ATOM   1488  O O   . VAL A  1 195 ? 12.388  -4.206  117.158 1.00 54.40  ? 196 VAL A O   1 
ATOM   1489  C CB  . VAL A  1 195 ? 9.628   -3.674  118.017 1.00 53.98  ? 196 VAL A CB  1 
ATOM   1490  C CG1 . VAL A  1 195 ? 9.733   -2.792  119.225 1.00 55.93  ? 196 VAL A CG1 1 
ATOM   1491  C CG2 . VAL A  1 195 ? 8.184   -3.952  117.669 1.00 54.84  ? 196 VAL A CG2 1 
ATOM   1492  N N   . THR A  1 196 ? 12.505  -1.971  117.228 1.00 53.95  ? 197 THR A N   1 
ATOM   1493  C CA  . THR A  1 196 ? 13.931  -1.986  117.503 1.00 54.23  ? 197 THR A CA  1 
ATOM   1494  C C   . THR A  1 196 ? 13.976  -1.734  118.993 1.00 54.08  ? 197 THR A C   1 
ATOM   1495  O O   . THR A  1 196 ? 13.224  -0.912  119.505 1.00 53.43  ? 197 THR A O   1 
ATOM   1496  C CB  . THR A  1 196 ? 14.692  -0.885  116.741 1.00 54.67  ? 197 THR A CB  1 
ATOM   1497  O OG1 . THR A  1 196 ? 16.076  -0.913  117.108 1.00 53.91  ? 197 THR A OG1 1 
ATOM   1498  C CG2 . THR A  1 196 ? 14.124  0.470   117.064 1.00 57.21  ? 197 THR A CG2 1 
ATOM   1499  N N   . HIS A  1 197 ? 14.836  -2.460  119.696 1.00 54.05  ? 198 HIS A N   1 
ATOM   1500  C CA  . HIS A  1 197 ? 14.896  -2.329  121.137 1.00 53.06  ? 198 HIS A CA  1 
ATOM   1501  C C   . HIS A  1 197 ? 16.260  -2.604  121.750 1.00 53.74  ? 198 HIS A C   1 
ATOM   1502  O O   . HIS A  1 197 ? 16.990  -3.481  121.301 1.00 53.93  ? 198 HIS A O   1 
ATOM   1503  C CB  . HIS A  1 197 ? 13.876  -3.258  121.776 1.00 50.94  ? 198 HIS A CB  1 
ATOM   1504  C CG  . HIS A  1 197 ? 13.895  -3.202  123.261 1.00 50.76  ? 198 HIS A CG  1 
ATOM   1505  N ND1 . HIS A  1 197 ? 14.975  -3.626  123.997 1.00 49.48  ? 198 HIS A ND1 1 
ATOM   1506  C CD2 . HIS A  1 197 ? 13.017  -2.680  124.147 1.00 51.86  ? 198 HIS A CD2 1 
ATOM   1507  C CE1 . HIS A  1 197 ? 14.765  -3.363  125.272 1.00 51.59  ? 198 HIS A CE1 1 
ATOM   1508  N NE2 . HIS A  1 197 ? 13.583  -2.788  125.392 1.00 51.96  ? 198 HIS A NE2 1 
ATOM   1509  N N   . GLN A  1 198 ? 16.577  -1.855  122.803 1.00 53.75  ? 199 GLN A N   1 
ATOM   1510  C CA  . GLN A  1 198 ? 17.846  -1.983  123.497 1.00 52.92  ? 199 GLN A CA  1 
ATOM   1511  C C   . GLN A  1 198 ? 18.138  -3.420  123.840 1.00 54.42  ? 199 GLN A C   1 
ATOM   1512  O O   . GLN A  1 198 ? 19.251  -3.754  124.203 1.00 54.87  ? 199 GLN A O   1 
ATOM   1513  C CB  . GLN A  1 198 ? 17.835  -1.160  124.779 1.00 50.53  ? 199 GLN A CB  1 
ATOM   1514  C CG  . GLN A  1 198 ? 19.109  -1.268  125.576 1.00 46.72  ? 199 GLN A CG  1 
ATOM   1515  C CD  . GLN A  1 198 ? 20.326  -1.023  124.725 1.00 45.91  ? 199 GLN A CD  1 
ATOM   1516  O OE1 . GLN A  1 198 ? 20.432  0.004   124.072 1.00 47.65  ? 199 GLN A OE1 1 
ATOM   1517  N NE2 . GLN A  1 198 ? 21.254  -1.962  124.728 1.00 44.65  ? 199 GLN A NE2 1 
ATOM   1518  N N   . GLY A  1 199 ? 17.131  -4.273  123.711 1.00 56.70  ? 200 GLY A N   1 
ATOM   1519  C CA  . GLY A  1 199 ? 17.304  -5.676  124.034 1.00 59.27  ? 200 GLY A CA  1 
ATOM   1520  C C   . GLY A  1 199 ? 17.328  -6.622  122.850 1.00 60.49  ? 200 GLY A C   1 
ATOM   1521  O O   . GLY A  1 199 ? 17.624  -7.801  123.006 1.00 61.13  ? 200 GLY A O   1 
ATOM   1522  N N   . LEU A  1 200 ? 17.039  -6.112  121.662 1.00 61.69  ? 201 LEU A N   1 
ATOM   1523  C CA  . LEU A  1 200 ? 17.027  -6.951  120.478 1.00 63.13  ? 201 LEU A CA  1 
ATOM   1524  C C   . LEU A  1 200 ? 18.102  -6.597  119.470 1.00 63.68  ? 201 LEU A C   1 
ATOM   1525  O O   . LEU A  1 200 ? 18.103  -5.507  118.884 1.00 63.95  ? 201 LEU A O   1 
ATOM   1526  C CB  . LEU A  1 200 ? 15.661  -6.863  119.807 1.00 64.91  ? 201 LEU A CB  1 
ATOM   1527  C CG  . LEU A  1 200 ? 14.500  -7.317  120.685 1.00 65.47  ? 201 LEU A CG  1 
ATOM   1528  C CD1 . LEU A  1 200 ? 13.187  -6.935  120.045 1.00 67.08  ? 201 LEU A CD1 1 
ATOM   1529  C CD2 . LEU A  1 200 ? 14.586  -8.813  120.887 1.00 67.02  ? 201 LEU A CD2 1 
ATOM   1530  N N   . SER A  1 201 ? 19.016  -7.534  119.268 1.00 64.37  ? 202 SER A N   1 
ATOM   1531  C CA  . SER A  1 201 ? 20.101  -7.358  118.310 1.00 65.58  ? 202 SER A CA  1 
ATOM   1532  C C   . SER A  1 201 ? 19.509  -7.267  116.899 1.00 66.12  ? 202 SER A C   1 
ATOM   1533  O O   . SER A  1 201 ? 20.173  -6.858  115.944 1.00 65.34  ? 202 SER A O   1 
ATOM   1534  C CB  . SER A  1 201 ? 21.033  -8.556  118.405 1.00 65.50  ? 202 SER A CB  1 
ATOM   1535  O OG  . SER A  1 201 ? 20.276  -9.732  118.657 1.00 65.93  ? 202 SER A OG  1 
ATOM   1536  N N   . SER A  1 202 ? 18.244  -7.662  116.788 1.00 67.08  ? 203 SER A N   1 
ATOM   1537  C CA  . SER A  1 202 ? 17.529  -7.650  115.519 1.00 67.40  ? 203 SER A CA  1 
ATOM   1538  C C   . SER A  1 202 ? 16.057  -7.282  115.723 1.00 66.53  ? 203 SER A C   1 
ATOM   1539  O O   . SER A  1 202 ? 15.322  -7.961  116.447 1.00 66.30  ? 203 SER A O   1 
ATOM   1540  C CB  . SER A  1 202 ? 17.630  -9.028  114.843 1.00 68.79  ? 203 SER A CB  1 
ATOM   1541  O OG  . SER A  1 202 ? 16.803  -9.114  113.687 1.00 69.79  ? 203 SER A OG  1 
ATOM   1542  N N   . PRO A  1 203 ? 15.613  -6.191  115.080 1.00 65.40  ? 204 PRO A N   1 
ATOM   1543  C CA  . PRO A  1 203 ? 14.234  -5.700  115.161 1.00 64.49  ? 204 PRO A CA  1 
ATOM   1544  C C   . PRO A  1 203 ? 13.207  -6.794  114.850 1.00 63.96  ? 204 PRO A C   1 
ATOM   1545  O O   . PRO A  1 203 ? 13.203  -7.378  113.764 1.00 64.54  ? 204 PRO A O   1 
ATOM   1546  C CB  . PRO A  1 203 ? 14.218  -4.580  114.130 1.00 64.50  ? 204 PRO A CB  1 
ATOM   1547  C CG  . PRO A  1 203 ? 15.623  -4.060  114.188 1.00 64.55  ? 204 PRO A CG  1 
ATOM   1548  C CD  . PRO A  1 203 ? 16.437  -5.314  114.229 1.00 64.36  ? 204 PRO A CD  1 
ATOM   1549  N N   . VAL A  1 204 ? 12.332  -7.070  115.805 1.00 63.46  ? 205 VAL A N   1 
ATOM   1550  C CA  . VAL A  1 204 ? 11.315  -8.097  115.621 1.00 63.47  ? 205 VAL A CA  1 
ATOM   1551  C C   . VAL A  1 204 ? 10.099  -7.552  114.865 1.00 64.43  ? 205 VAL A C   1 
ATOM   1552  O O   . VAL A  1 204 ? 9.674   -6.421  115.096 1.00 64.50  ? 205 VAL A O   1 
ATOM   1553  C CB  . VAL A  1 204 ? 10.867  -8.656  116.981 1.00 62.38  ? 205 VAL A CB  1 
ATOM   1554  C CG1 . VAL A  1 204 ? 9.957   -9.861  116.775 1.00 62.17  ? 205 VAL A CG1 1 
ATOM   1555  C CG2 . VAL A  1 204 ? 12.088  -9.021  117.811 1.00 60.68  ? 205 VAL A CG2 1 
ATOM   1556  N N   . THR A  1 205 ? 9.541   -8.358  113.964 1.00 65.98  ? 206 THR A N   1 
ATOM   1557  C CA  . THR A  1 205 ? 8.384   -7.935  113.174 1.00 67.02  ? 206 THR A CA  1 
ATOM   1558  C C   . THR A  1 205 ? 7.150   -8.805  113.370 1.00 68.22  ? 206 THR A C   1 
ATOM   1559  O O   . THR A  1 205 ? 7.225   -10.033 113.349 1.00 68.60  ? 206 THR A O   1 
ATOM   1560  C CB  . THR A  1 205 ? 8.707   -7.901  111.666 1.00 66.31  ? 206 THR A CB  1 
ATOM   1561  O OG1 . THR A  1 205 ? 9.580   -6.802  111.381 1.00 65.17  ? 206 THR A OG1 1 
ATOM   1562  C CG2 . THR A  1 205 ? 7.436   -7.740  110.860 1.00 66.32  ? 206 THR A CG2 1 
ATOM   1563  N N   . LYS A  1 206 ? 6.013   -8.137  113.534 1.00 69.47  ? 207 LYS A N   1 
ATOM   1564  C CA  . LYS A  1 206 ? 4.720   -8.779  113.754 1.00 70.88  ? 207 LYS A CA  1 
ATOM   1565  C C   . LYS A  1 206 ? 3.765   -8.231  112.681 1.00 71.33  ? 207 LYS A C   1 
ATOM   1566  O O   . LYS A  1 206 ? 3.758   -7.029  112.426 1.00 71.03  ? 207 LYS A O   1 
ATOM   1567  C CB  . LYS A  1 206 ? 4.217   -8.400  115.153 1.00 71.19  ? 207 LYS A CB  1 
ATOM   1568  C CG  . LYS A  1 206 ? 3.383   -9.449  115.883 1.00 72.14  ? 207 LYS A CG  1 
ATOM   1569  C CD  . LYS A  1 206 ? 4.236   -10.538 116.546 1.00 72.76  ? 207 LYS A CD  1 
ATOM   1570  C CE  . LYS A  1 206 ? 3.360   -11.508 117.358 1.00 72.69  ? 207 LYS A CE  1 
ATOM   1571  N NZ  . LYS A  1 206 ? 4.108   -12.677 117.921 1.00 71.69  ? 207 LYS A NZ  1 
ATOM   1572  N N   . SER A  1 207 ? 2.961   -9.097  112.061 1.00 72.35  ? 208 SER A N   1 
ATOM   1573  C CA  . SER A  1 207 ? 2.033   -8.654  111.009 1.00 73.06  ? 208 SER A CA  1 
ATOM   1574  C C   . SER A  1 207 ? 0.890   -9.612  110.679 1.00 73.27  ? 208 SER A C   1 
ATOM   1575  O O   . SER A  1 207 ? 0.781   -10.688 111.253 1.00 73.94  ? 208 SER A O   1 
ATOM   1576  C CB  . SER A  1 207 ? 2.801   -8.395  109.716 1.00 73.13  ? 208 SER A CB  1 
ATOM   1577  O OG  . SER A  1 207 ? 3.209   -9.615  109.127 1.00 72.21  ? 208 SER A OG  1 
ATOM   1578  N N   . PHE A  1 208 ? 0.045   -9.204  109.737 1.00 73.63  ? 209 PHE A N   1 
ATOM   1579  C CA  . PHE A  1 208 ? -1.082  -10.014 109.281 1.00 74.75  ? 209 PHE A CA  1 
ATOM   1580  C C   . PHE A  1 208 ? -1.656  -9.355  108.035 1.00 75.59  ? 209 PHE A C   1 
ATOM   1581  O O   . PHE A  1 208 ? -1.878  -8.144  108.017 1.00 76.72  ? 209 PHE A O   1 
ATOM   1582  C CB  . PHE A  1 208 ? -2.179  -10.095 110.339 1.00 75.23  ? 209 PHE A CB  1 
ATOM   1583  C CG  . PHE A  1 208 ? -2.968  -8.825  110.488 1.00 76.29  ? 209 PHE A CG  1 
ATOM   1584  C CD1 . PHE A  1 208 ? -2.483  -7.771  111.258 1.00 76.15  ? 209 PHE A CD1 1 
ATOM   1585  C CD2 . PHE A  1 208 ? -4.171  -8.659  109.810 1.00 75.83  ? 209 PHE A CD2 1 
ATOM   1586  C CE1 . PHE A  1 208 ? -3.184  -6.573  111.345 1.00 76.59  ? 209 PHE A CE1 1 
ATOM   1587  C CE2 . PHE A  1 208 ? -4.875  -7.463  109.890 1.00 76.01  ? 209 PHE A CE2 1 
ATOM   1588  C CZ  . PHE A  1 208 ? -4.382  -6.419  110.657 1.00 76.08  ? 209 PHE A CZ  1 
ATOM   1589  N N   . ASN A  1 209 ? -1.902  -10.153 107.000 1.00 75.78  ? 210 ASN A N   1 
ATOM   1590  C CA  . ASN A  1 209 ? -2.445  -9.647  105.739 1.00 74.30  ? 210 ASN A CA  1 
ATOM   1591  C C   . ASN A  1 209 ? -3.963  -9.577  105.834 1.00 73.82  ? 210 ASN A C   1 
ATOM   1592  O O   . ASN A  1 209 ? -4.632  -10.580 105.640 1.00 73.70  ? 210 ASN A O   1 
ATOM   1593  C CB  . ASN A  1 209 ? -2.041  -10.581 104.595 1.00 73.02  ? 210 ASN A CB  1 
ATOM   1594  C CG  . ASN A  1 209 ? -0.557  -10.910 104.603 1.00 72.01  ? 210 ASN A CG  1 
ATOM   1595  O OD1 . ASN A  1 209 ? 0.211   -10.379 103.807 1.00 72.49  ? 210 ASN A OD1 1 
ATOM   1596  N ND2 . ASN A  1 209 ? -0.150  -11.790 105.508 1.00 70.44  ? 210 ASN A ND2 1 
ATOM   1597  N N   . ARG A  1 210 ? -4.500  -8.395  106.125 1.00 73.98  ? 211 ARG A N   1 
ATOM   1598  C CA  . ARG A  1 210 ? -5.948  -8.210  106.260 1.00 74.52  ? 211 ARG A CA  1 
ATOM   1599  C C   . ARG A  1 210 ? -6.743  -9.143  105.374 1.00 74.74  ? 211 ARG A C   1 
ATOM   1600  O O   . ARG A  1 210 ? -6.258  -9.587  104.336 1.00 74.55  ? 211 ARG A O   1 
ATOM   1601  C CB  . ARG A  1 210 ? -6.354  -6.765  105.950 1.00 74.04  ? 211 ARG A CB  1 
ATOM   1602  C CG  . ARG A  1 210 ? -5.999  -6.287  104.561 1.00 73.11  ? 211 ARG A CG  1 
ATOM   1603  C CD  . ARG A  1 210 ? -6.632  -4.941  104.289 1.00 72.96  ? 211 ARG A CD  1 
ATOM   1604  N NE  . ARG A  1 210 ? -7.786  -5.047  103.403 1.00 73.24  ? 211 ARG A NE  1 
ATOM   1605  C CZ  . ARG A  1 210 ? -8.886  -5.736  103.686 1.00 73.44  ? 211 ARG A CZ  1 
ATOM   1606  N NH1 . ARG A  1 210 ? -8.983  -6.386  104.838 1.00 72.44  ? 211 ARG A NH1 1 
ATOM   1607  N NH2 . ARG A  1 210 ? -9.887  -5.778  102.812 1.00 74.17  ? 211 ARG A NH2 1 
ATOM   1608  N N   . GLY A  1 211 ? -7.976  -9.427  105.776 1.00 75.54  ? 212 GLY A N   1 
ATOM   1609  C CA  . GLY A  1 211 ? -8.794  -10.336 104.997 1.00 77.28  ? 212 GLY A CA  1 
ATOM   1610  C C   . GLY A  1 211 ? -8.142  -11.710 105.022 1.00 78.29  ? 212 GLY A C   1 
ATOM   1611  O O   . GLY A  1 211 ? -7.591  -12.174 104.016 1.00 78.23  ? 212 GLY A O   1 
ATOM   1612  N N   . GLU A  1 212 ? -8.194  -12.350 106.189 1.00 78.41  ? 213 GLU A N   1 
ATOM   1613  C CA  . GLU A  1 212 ? -7.619  -13.676 106.394 1.00 78.10  ? 213 GLU A CA  1 
ATOM   1614  C C   . GLU A  1 212 ? -8.194  -14.316 107.653 1.00 77.42  ? 213 GLU A C   1 
ATOM   1615  O O   . GLU A  1 212 ? -8.026  -15.513 107.886 1.00 76.58  ? 213 GLU A O   1 
ATOM   1616  C CB  . GLU A  1 212 ? -6.093  -13.581 106.504 1.00 78.90  ? 213 GLU A CB  1 
ATOM   1617  C CG  . GLU A  1 212 ? -5.600  -12.385 107.305 1.00 80.39  ? 213 GLU A CG  1 
ATOM   1618  C CD  . GLU A  1 212 ? -5.970  -12.442 108.771 1.00 81.21  ? 213 GLU A CD  1 
ATOM   1619  O OE1 . GLU A  1 212 ? -6.140  -11.360 109.378 1.00 81.16  ? 213 GLU A OE1 1 
ATOM   1620  O OE2 . GLU A  1 212 ? -6.075  -13.562 109.318 1.00 81.97  ? 213 GLU A OE2 1 
ATOM   1621  N N   . GLN B  2 1   ? -5.970  17.644  159.830 1.00 75.61  ? 1   GLN B N   1 
ATOM   1622  C CA  . GLN B  2 1   ? -5.991  18.980  160.423 1.00 76.51  ? 1   GLN B CA  1 
ATOM   1623  C C   . GLN B  2 1   ? -6.566  20.014  159.445 1.00 76.60  ? 1   GLN B C   1 
ATOM   1624  O O   . GLN B  2 1   ? -7.762  19.972  159.129 1.00 77.51  ? 1   GLN B O   1 
ATOM   1625  C CB  . GLN B  2 1   ? -4.574  19.379  160.850 1.00 76.36  ? 1   GLN B CB  1 
ATOM   1626  C CG  . GLN B  2 1   ? -3.873  18.327  161.704 1.00 75.92  ? 1   GLN B CG  1 
ATOM   1627  C CD  . GLN B  2 1   ? -4.655  17.971  162.960 1.00 74.95  ? 1   GLN B CD  1 
ATOM   1628  O OE1 . GLN B  2 1   ? -5.850  17.668  162.895 1.00 74.24  ? 1   GLN B OE1 1 
ATOM   1629  N NE2 . GLN B  2 1   ? -3.981  17.999  164.108 1.00 73.47  ? 1   GLN B NE2 1 
ATOM   1630  N N   . VAL B  2 2   ? -5.732  20.952  158.983 1.00 75.94  ? 2   VAL B N   1 
ATOM   1631  C CA  . VAL B  2 2   ? -6.189  21.956  158.016 1.00 74.06  ? 2   VAL B CA  1 
ATOM   1632  C C   . VAL B  2 2   ? -6.368  21.206  156.698 1.00 73.34  ? 2   VAL B C   1 
ATOM   1633  O O   . VAL B  2 2   ? -5.544  20.369  156.323 1.00 72.75  ? 2   VAL B O   1 
ATOM   1634  C CB  . VAL B  2 2   ? -5.174  23.123  157.838 1.00 73.05  ? 2   VAL B CB  1 
ATOM   1635  C CG1 . VAL B  2 2   ? -4.007  22.680  156.996 1.00 72.22  ? 2   VAL B CG1 1 
ATOM   1636  C CG2 . VAL B  2 2   ? -5.862  24.323  157.208 1.00 71.73  ? 2   VAL B CG2 1 
ATOM   1637  N N   . GLN B  2 3   ? -7.451  21.500  155.999 1.00 72.91  ? 3   GLN B N   1 
ATOM   1638  C CA  . GLN B  2 3   ? -7.743  20.795  154.768 1.00 71.93  ? 3   GLN B CA  1 
ATOM   1639  C C   . GLN B  2 3   ? -8.144  21.732  153.635 1.00 69.95  ? 3   GLN B C   1 
ATOM   1640  O O   . GLN B  2 3   ? -8.812  22.741  153.855 1.00 69.50  ? 3   GLN B O   1 
ATOM   1641  C CB  . GLN B  2 3   ? -8.856  19.784  155.067 1.00 73.17  ? 3   GLN B CB  1 
ATOM   1642  C CG  . GLN B  2 3   ? -9.523  19.155  153.869 1.00 75.89  ? 3   GLN B CG  1 
ATOM   1643  C CD  . GLN B  2 3   ? -10.745 18.340  154.261 1.00 76.98  ? 3   GLN B CD  1 
ATOM   1644  O OE1 . GLN B  2 3   ? -11.721 18.876  154.791 1.00 77.11  ? 3   GLN B OE1 1 
ATOM   1645  N NE2 . GLN B  2 3   ? -10.694 17.036  154.005 1.00 77.68  ? 3   GLN B NE2 1 
ATOM   1646  N N   . LEU B  2 4   ? -7.716  21.393  152.424 1.00 68.47  ? 4   LEU B N   1 
ATOM   1647  C CA  . LEU B  2 4   ? -8.043  22.168  151.239 1.00 67.34  ? 4   LEU B CA  1 
ATOM   1648  C C   . LEU B  2 4   ? -9.050  21.435  150.423 1.00 65.99  ? 4   LEU B C   1 
ATOM   1649  O O   . LEU B  2 4   ? -8.750  20.360  149.825 1.00 65.13  ? 4   LEU B O   1 
ATOM   1650  C CB  . LEU B  2 4   ? -6.794  22.429  150.403 1.00 67.38  ? 4   LEU B CB  1 
ATOM   1651  C CG  . LEU B  2 4   ? -5.668  23.132  151.165 1.00 67.39  ? 4   LEU B CG  1 
ATOM   1652  C CD1 . LEU B  2 4   ? -4.490  23.401  150.229 1.00 67.94  ? 4   LEU B CD1 1 
ATOM   1653  C CD2 . LEU B  2 4   ? -6.189  24.426  151.748 1.00 66.34  ? 4   LEU B CD2 1 
ATOM   1654  N N   . LEU B  2 5   ? -10.115 22.212  150.229 1.00 64.49  ? 5   LEU B N   1 
ATOM   1655  C CA  . LEU B  2 5   ? -11.184 21.614  149.485 1.00 64.01  ? 5   LEU B CA  1 
ATOM   1656  C C   . LEU B  2 5   ? -11.497 22.328  148.233 1.00 63.84  ? 5   LEU B C   1 
ATOM   1657  O O   . LEU B  2 5   ? -12.203 23.377  148.217 1.00 65.23  ? 5   LEU B O   1 
ATOM   1658  C CB  . LEU B  2 5   ? -12.436 21.444  150.335 1.00 63.04  ? 5   LEU B CB  1 
ATOM   1659  C CG  . LEU B  2 5   ? -12.669 20.065  150.960 1.00 62.45  ? 5   LEU B CG  1 
ATOM   1660  C CD1 . LEU B  2 5   ? -12.988 20.201  152.443 1.00 61.80  ? 5   LEU B CD1 1 
ATOM   1661  C CD2 . LEU B  2 5   ? -13.793 19.332  150.234 1.00 61.22  ? 5   LEU B CD2 1 
ATOM   1662  N N   . GLN B  2 6   ? -11.156 21.545  147.217 1.00 62.52  ? 6   GLN B N   1 
ATOM   1663  C CA  . GLN B  2 6   ? -11.290 22.125  145.922 1.00 60.06  ? 6   GLN B CA  1 
ATOM   1664  C C   . GLN B  2 6   ? -12.628 21.844  145.267 1.00 59.21  ? 6   GLN B C   1 
ATOM   1665  O O   . GLN B  2 6   ? -13.384 21.026  145.764 1.00 59.82  ? 6   GLN B O   1 
ATOM   1666  C CB  . GLN B  2 6   ? -10.138 21.677  145.038 1.00 59.95  ? 6   GLN B CB  1 
ATOM   1667  C CG  . GLN B  2 6   ? -8.787  21.733  145.763 1.00 58.33  ? 6   GLN B CG  1 
ATOM   1668  C CD  . GLN B  2 6   ? -7.617  22.106  144.864 1.00 58.07  ? 6   GLN B CD  1 
ATOM   1669  O OE1 . GLN B  2 6   ? -6.497  22.302  145.348 1.00 57.77  ? 6   GLN B OE1 1 
ATOM   1670  N NE2 . GLN B  2 6   ? -7.866  22.208  143.560 1.00 55.47  ? 6   GLN B NE2 1 
ATOM   1671  N N   . SER B  2 7   ? -12.906 22.519  144.150 1.00 58.32  ? 7   SER B N   1 
ATOM   1672  C CA  . SER B  2 7   ? -14.161 22.362  143.400 1.00 57.00  ? 7   SER B CA  1 
ATOM   1673  C C   . SER B  2 7   ? -14.241 21.082  142.560 1.00 56.77  ? 7   SER B C   1 
ATOM   1674  O O   . SER B  2 7   ? -13.286 20.299  142.491 1.00 56.67  ? 7   SER B O   1 
ATOM   1675  C CB  . SER B  2 7   ? -14.375 23.558  142.471 1.00 56.29  ? 7   SER B CB  1 
ATOM   1676  O OG  . SER B  2 7   ? -14.267 24.779  143.174 1.00 55.57  ? 7   SER B OG  1 
ATOM   1677  N N   . GLY B  2 8   ? -15.385 20.892  141.905 1.00 56.11  ? 8   GLY B N   1 
ATOM   1678  C CA  . GLY B  2 8   ? -15.600 19.709  141.090 1.00 55.03  ? 8   GLY B CA  1 
ATOM   1679  C C   . GLY B  2 8   ? -14.980 19.798  139.715 1.00 55.13  ? 8   GLY B C   1 
ATOM   1680  O O   . GLY B  2 8   ? -14.739 20.894  139.212 1.00 54.83  ? 8   GLY B O   1 
ATOM   1681  N N   . ALA B  2 9   ? -14.724 18.639  139.110 1.00 55.69  ? 9   ALA B N   1 
ATOM   1682  C CA  . ALA B  2 9   ? -14.119 18.552  137.781 1.00 56.13  ? 9   ALA B CA  1 
ATOM   1683  C C   . ALA B  2 9   ? -14.950 19.316  136.759 1.00 57.08  ? 9   ALA B C   1 
ATOM   1684  O O   . ALA B  2 9   ? -16.179 19.180  136.732 1.00 57.44  ? 9   ALA B O   1 
ATOM   1685  C CB  . ALA B  2 9   ? -13.996 17.103  137.370 1.00 55.69  ? 9   ALA B CB  1 
ATOM   1686  N N   . GLU B  2 10  ? -14.278 20.096  135.910 1.00 57.18  ? 10  GLU B N   1 
ATOM   1687  C CA  . GLU B  2 10  ? -14.961 20.913  134.913 1.00 57.82  ? 10  GLU B CA  1 
ATOM   1688  C C   . GLU B  2 10  ? -14.585 20.682  133.452 1.00 57.78  ? 10  GLU B C   1 
ATOM   1689  O O   . GLU B  2 10  ? -13.405 20.611  133.113 1.00 59.52  ? 10  GLU B O   1 
ATOM   1690  C CB  . GLU B  2 10  ? -14.756 22.397  135.234 1.00 58.28  ? 10  GLU B CB  1 
ATOM   1691  C CG  . GLU B  2 10  ? -15.309 22.820  136.579 1.00 60.63  ? 10  GLU B CG  1 
ATOM   1692  C CD  . GLU B  2 10  ? -16.296 23.970  136.470 1.00 63.34  ? 10  GLU B CD  1 
ATOM   1693  O OE1 . GLU B  2 10  ? -17.360 23.782  135.836 1.00 63.18  ? 10  GLU B OE1 1 
ATOM   1694  O OE2 . GLU B  2 10  ? -16.009 25.062  137.021 1.00 65.36  ? 10  GLU B OE2 1 
ATOM   1695  N N   . VAL B  2 11  ? -15.602 20.591  132.590 1.00 56.97  ? 11  VAL B N   1 
ATOM   1696  C CA  . VAL B  2 11  ? -15.423 20.402  131.146 1.00 55.59  ? 11  VAL B CA  1 
ATOM   1697  C C   . VAL B  2 11  ? -15.928 21.650  130.405 1.00 55.93  ? 11  VAL B C   1 
ATOM   1698  O O   . VAL B  2 11  ? -17.083 21.706  129.985 1.00 56.58  ? 11  VAL B O   1 
ATOM   1699  C CB  . VAL B  2 11  ? -16.214 19.183  130.629 1.00 53.96  ? 11  VAL B CB  1 
ATOM   1700  C CG1 . VAL B  2 11  ? -15.942 18.981  129.155 1.00 51.51  ? 11  VAL B CG1 1 
ATOM   1701  C CG2 . VAL B  2 11  ? -15.843 17.948  131.418 1.00 52.14  ? 11  VAL B CG2 1 
ATOM   1702  N N   . LYS B  2 12  ? -15.049 22.638  130.254 1.00 55.61  ? 12  LYS B N   1 
ATOM   1703  C CA  . LYS B  2 12  ? -15.362 23.901  129.596 1.00 55.43  ? 12  LYS B CA  1 
ATOM   1704  C C   . LYS B  2 12  ? -14.994 23.869  128.119 1.00 56.13  ? 12  LYS B C   1 
ATOM   1705  O O   . LYS B  2 12  ? -14.001 23.258  127.741 1.00 57.34  ? 12  LYS B O   1 
ATOM   1706  C CB  . LYS B  2 12  ? -14.591 25.026  130.272 1.00 54.84  ? 12  LYS B CB  1 
ATOM   1707  C CG  . LYS B  2 12  ? -14.904 25.204  131.748 1.00 55.63  ? 12  LYS B CG  1 
ATOM   1708  C CD  . LYS B  2 12  ? -16.204 25.958  131.926 1.00 56.08  ? 12  LYS B CD  1 
ATOM   1709  C CE  . LYS B  2 12  ? -16.414 26.397  133.368 1.00 56.30  ? 12  LYS B CE  1 
ATOM   1710  N NZ  . LYS B  2 12  ? -17.539 27.382  133.467 1.00 55.63  ? 12  LYS B NZ  1 
ATOM   1711  N N   . LYS B  2 13  ? -15.792 24.533  127.284 1.00 56.23  ? 13  LYS B N   1 
ATOM   1712  C CA  . LYS B  2 13  ? -15.528 24.578  125.843 1.00 55.45  ? 13  LYS B CA  1 
ATOM   1713  C C   . LYS B  2 13  ? -14.328 25.476  125.604 1.00 54.49  ? 13  LYS B C   1 
ATOM   1714  O O   . LYS B  2 13  ? -14.123 26.446  126.331 1.00 53.58  ? 13  LYS B O   1 
ATOM   1715  C CB  . LYS B  2 13  ? -16.742 25.144  125.066 1.00 56.36  ? 13  LYS B CB  1 
ATOM   1716  C CG  . LYS B  2 13  ? -17.980 24.235  124.964 1.00 55.50  ? 13  LYS B CG  1 
ATOM   1717  C CD  . LYS B  2 13  ? -17.761 23.109  123.975 1.00 55.14  ? 13  LYS B CD  1 
ATOM   1718  C CE  . LYS B  2 13  ? -18.922 22.133  123.974 1.00 55.29  ? 13  LYS B CE  1 
ATOM   1719  N NZ  . LYS B  2 13  ? -18.660 21.007  123.032 1.00 54.53  ? 13  LYS B NZ  1 
ATOM   1720  N N   . PRO B  2 14  ? -13.530 25.167  124.572 1.00 54.68  ? 14  PRO B N   1 
ATOM   1721  C CA  . PRO B  2 14  ? -12.328 25.907  124.176 1.00 55.53  ? 14  PRO B CA  1 
ATOM   1722  C C   . PRO B  2 14  ? -12.628 27.369  123.913 1.00 55.54  ? 14  PRO B C   1 
ATOM   1723  O O   . PRO B  2 14  ? -12.666 27.784  122.755 1.00 57.01  ? 14  PRO B O   1 
ATOM   1724  C CB  . PRO B  2 14  ? -11.901 25.213  122.884 1.00 55.87  ? 14  PRO B CB  1 
ATOM   1725  C CG  . PRO B  2 14  ? -12.383 23.850  123.057 1.00 55.93  ? 14  PRO B CG  1 
ATOM   1726  C CD  . PRO B  2 14  ? -13.760 24.054  123.641 1.00 55.62  ? 14  PRO B CD  1 
ATOM   1727  N N   . GLY B  2 15  ? -12.832 28.141  124.976 1.00 54.81  ? 15  GLY B N   1 
ATOM   1728  C CA  . GLY B  2 15  ? -13.138 29.553  124.835 1.00 53.06  ? 15  GLY B CA  1 
ATOM   1729  C C   . GLY B  2 15  ? -13.873 30.069  126.057 1.00 52.42  ? 15  GLY B C   1 
ATOM   1730  O O   . GLY B  2 15  ? -13.836 31.256  126.358 1.00 51.62  ? 15  GLY B O   1 
ATOM   1731  N N   . SER B  2 16  ? -14.548 29.183  126.772 1.00 51.60  ? 16  SER B N   1 
ATOM   1732  C CA  . SER B  2 16  ? -15.246 29.619  127.961 1.00 53.34  ? 16  SER B CA  1 
ATOM   1733  C C   . SER B  2 16  ? -14.253 30.163  128.985 1.00 53.85  ? 16  SER B C   1 
ATOM   1734  O O   . SER B  2 16  ? -13.125 30.529  128.650 1.00 53.37  ? 16  SER B O   1 
ATOM   1735  C CB  . SER B  2 16  ? -16.024 28.457  128.565 1.00 54.14  ? 16  SER B CB  1 
ATOM   1736  O OG  . SER B  2 16  ? -16.980 27.982  127.643 1.00 55.86  ? 16  SER B OG  1 
ATOM   1737  N N   . SER B  2 17  ? -14.690 30.225  130.236 1.00 54.38  ? 17  SER B N   1 
ATOM   1738  C CA  . SER B  2 17  ? -13.852 30.699  131.329 1.00 55.70  ? 17  SER B CA  1 
ATOM   1739  C C   . SER B  2 17  ? -14.050 29.707  132.454 1.00 55.98  ? 17  SER B C   1 
ATOM   1740  O O   . SER B  2 17  ? -14.725 28.697  132.274 1.00 56.63  ? 17  SER B O   1 
ATOM   1741  C CB  . SER B  2 17  ? -14.301 32.089  131.791 1.00 57.51  ? 17  SER B CB  1 
ATOM   1742  O OG  . SER B  2 17  ? -14.590 32.115  133.188 1.00 58.37  ? 17  SER B OG  1 
ATOM   1743  N N   . VAL B  2 18  ? -13.485 29.988  133.618 1.00 55.57  ? 18  VAL B N   1 
ATOM   1744  C CA  . VAL B  2 18  ? -13.661 29.081  134.730 1.00 56.24  ? 18  VAL B CA  1 
ATOM   1745  C C   . VAL B  2 18  ? -13.157 29.645  136.057 1.00 57.59  ? 18  VAL B C   1 
ATOM   1746  O O   . VAL B  2 18  ? -12.095 30.265  136.121 1.00 58.13  ? 18  VAL B O   1 
ATOM   1747  C CB  . VAL B  2 18  ? -12.974 27.731  134.425 1.00 55.99  ? 18  VAL B CB  1 
ATOM   1748  C CG1 . VAL B  2 18  ? -11.491 27.938  134.162 1.00 53.40  ? 18  VAL B CG1 1 
ATOM   1749  C CG2 . VAL B  2 18  ? -13.216 26.766  135.564 1.00 56.47  ? 18  VAL B CG2 1 
ATOM   1750  N N   . LYS B  2 19  ? -13.944 29.449  137.111 1.00 57.94  ? 19  LYS B N   1 
ATOM   1751  C CA  . LYS B  2 19  ? -13.580 29.906  138.442 1.00 58.66  ? 19  LYS B CA  1 
ATOM   1752  C C   . LYS B  2 19  ? -13.521 28.633  139.263 1.00 59.43  ? 19  LYS B C   1 
ATOM   1753  O O   . LYS B  2 19  ? -14.326 27.721  139.037 1.00 60.28  ? 19  LYS B O   1 
ATOM   1754  C CB  . LYS B  2 19  ? -14.646 30.839  139.001 1.00 59.37  ? 19  LYS B CB  1 
ATOM   1755  C CG  . LYS B  2 19  ? -14.355 31.323  140.401 1.00 63.17  ? 19  LYS B CG  1 
ATOM   1756  C CD  . LYS B  2 19  ? -15.399 32.336  140.894 1.00 66.23  ? 19  LYS B CD  1 
ATOM   1757  C CE  . LYS B  2 19  ? -14.825 33.216  142.024 1.00 68.12  ? 19  LYS B CE  1 
ATOM   1758  N NZ  . LYS B  2 19  ? -15.805 34.097  142.733 1.00 68.17  ? 19  LYS B NZ  1 
ATOM   1759  N N   . VAL B  2 20  ? -12.574 28.559  140.198 1.00 59.00  ? 20  VAL B N   1 
ATOM   1760  C CA  . VAL B  2 20  ? -12.406 27.366  141.027 1.00 58.76  ? 20  VAL B CA  1 
ATOM   1761  C C   . VAL B  2 20  ? -12.293 27.686  142.524 1.00 59.91  ? 20  VAL B C   1 
ATOM   1762  O O   . VAL B  2 20  ? -11.571 28.615  142.914 1.00 60.57  ? 20  VAL B O   1 
ATOM   1763  C CB  . VAL B  2 20  ? -11.123 26.588  140.608 1.00 57.50  ? 20  VAL B CB  1 
ATOM   1764  C CG1 . VAL B  2 20  ? -11.251 25.122  140.973 1.00 57.47  ? 20  VAL B CG1 1 
ATOM   1765  C CG2 . VAL B  2 20  ? -10.877 26.736  139.138 1.00 54.98  ? 20  VAL B CG2 1 
ATOM   1766  N N   . SER B  2 21  ? -12.991 26.904  143.353 1.00 59.63  ? 21  SER B N   1 
ATOM   1767  C CA  . SER B  2 21  ? -12.956 27.071  144.808 1.00 59.29  ? 21  SER B CA  1 
ATOM   1768  C C   . SER B  2 21  ? -11.742 26.367  145.399 1.00 59.03  ? 21  SER B C   1 
ATOM   1769  O O   . SER B  2 21  ? -10.869 25.926  144.681 1.00 59.87  ? 21  SER B O   1 
ATOM   1770  C CB  . SER B  2 21  ? -14.223 26.505  145.448 1.00 59.45  ? 21  SER B CB  1 
ATOM   1771  O OG  . SER B  2 21  ? -15.374 27.140  144.928 1.00 60.95  ? 21  SER B OG  1 
ATOM   1772  N N   . CYS B  2 22  ? -11.703 26.244  146.713 1.00 59.79  ? 22  CYS B N   1 
ATOM   1773  C CA  . CYS B  2 22  ? -10.578 25.627  147.394 1.00 61.17  ? 22  CYS B CA  1 
ATOM   1774  C C   . CYS B  2 22  ? -10.747 26.028  148.852 1.00 63.14  ? 22  CYS B C   1 
ATOM   1775  O O   . CYS B  2 22  ? -9.918  26.730  149.430 1.00 63.57  ? 22  CYS B O   1 
ATOM   1776  C CB  . CYS B  2 22  ? -9.264  26.179  146.810 1.00 61.25  ? 22  CYS B CB  1 
ATOM   1777  S SG  . CYS B  2 22  ? -7.738  26.157  147.840 1.00 61.42  ? 22  CYS B SG  1 
ATOM   1778  N N   . LYS B  2 23  ? -11.854 25.589  149.434 1.00 65.16  ? 23  LYS B N   1 
ATOM   1779  C CA  . LYS B  2 23  ? -12.177 25.890  150.821 1.00 67.71  ? 23  LYS B CA  1 
ATOM   1780  C C   . LYS B  2 23  ? -11.042 25.400  151.709 1.00 70.06  ? 23  LYS B C   1 
ATOM   1781  O O   . LYS B  2 23  ? -10.373 24.425  151.366 1.00 70.87  ? 23  LYS B O   1 
ATOM   1782  C CB  . LYS B  2 23  ? -13.477 25.184  151.192 1.00 67.69  ? 23  LYS B CB  1 
ATOM   1783  C CG  . LYS B  2 23  ? -14.208 25.756  152.379 1.00 68.56  ? 23  LYS B CG  1 
ATOM   1784  C CD  . LYS B  2 23  ? -13.541 25.461  153.702 1.00 68.53  ? 23  LYS B CD  1 
ATOM   1785  C CE  . LYS B  2 23  ? -14.338 26.116  154.814 1.00 68.80  ? 23  LYS B CE  1 
ATOM   1786  N NZ  . LYS B  2 23  ? -14.481 27.583  154.583 1.00 68.60  ? 23  LYS B NZ  1 
ATOM   1787  N N   . ALA B  2 24  ? -10.828 26.074  152.841 1.00 72.25  ? 24  ALA B N   1 
ATOM   1788  C CA  . ALA B  2 24  ? -9.769  25.717  153.794 1.00 73.97  ? 24  ALA B CA  1 
ATOM   1789  C C   . ALA B  2 24  ? -10.336 25.512  155.202 1.00 75.61  ? 24  ALA B C   1 
ATOM   1790  O O   . ALA B  2 24  ? -10.558 26.480  155.933 1.00 75.90  ? 24  ALA B O   1 
ATOM   1791  C CB  . ALA B  2 24  ? -8.704  26.814  153.818 1.00 73.42  ? 24  ALA B CB  1 
ATOM   1792  N N   . SER B  2 25  ? -10.538 24.251  155.583 1.00 77.35  ? 25  SER B N   1 
ATOM   1793  C CA  . SER B  2 25  ? -11.110 23.904  156.885 1.00 78.98  ? 25  SER B CA  1 
ATOM   1794  C C   . SER B  2 25  ? -10.140 23.311  157.893 1.00 80.53  ? 25  SER B C   1 
ATOM   1795  O O   . SER B  2 25  ? -10.135 22.098  158.122 1.00 80.40  ? 25  SER B O   1 
ATOM   1796  C CB  . SER B  2 25  ? -12.251 22.910  156.696 1.00 79.04  ? 25  SER B CB  1 
ATOM   1797  O OG  . SER B  2 25  ? -11.759 21.693  156.162 1.00 80.50  ? 25  SER B OG  1 
ATOM   1798  N N   . GLY B  2 26  ? -9.334  24.164  158.509 1.00 82.28  ? 26  GLY B N   1 
ATOM   1799  C CA  . GLY B  2 26  ? -8.394  23.677  159.498 1.00 84.44  ? 26  GLY B CA  1 
ATOM   1800  C C   . GLY B  2 26  ? -8.298  24.603  160.691 1.00 85.78  ? 26  GLY B C   1 
ATOM   1801  O O   . GLY B  2 26  ? -9.004  24.424  161.689 1.00 86.03  ? 26  GLY B O   1 
ATOM   1802  N N   . GLY B  2 27  ? -7.425  25.601  160.579 1.00 86.80  ? 27  GLY B N   1 
ATOM   1803  C CA  . GLY B  2 27  ? -7.238  26.550  161.658 1.00 87.27  ? 27  GLY B CA  1 
ATOM   1804  C C   . GLY B  2 27  ? -7.551  27.959  161.213 1.00 87.52  ? 27  GLY B C   1 
ATOM   1805  O O   . GLY B  2 27  ? -8.719  28.348  161.105 1.00 87.55  ? 27  GLY B O   1 
ATOM   1806  N N   . THR B  2 28  ? -6.505  28.730  160.951 1.00 87.64  ? 28  THR B N   1 
ATOM   1807  C CA  . THR B  2 28  ? -6.683  30.108  160.512 1.00 87.71  ? 28  THR B CA  1 
ATOM   1808  C C   . THR B  2 28  ? -6.883  30.147  158.998 1.00 88.60  ? 28  THR B C   1 
ATOM   1809  O O   . THR B  2 28  ? -7.142  29.121  158.359 1.00 89.61  ? 28  THR B O   1 
ATOM   1810  C CB  . THR B  2 28  ? -5.453  30.961  160.857 1.00 86.17  ? 28  THR B CB  1 
ATOM   1811  O OG1 . THR B  2 28  ? -4.505  30.159  161.561 1.00 84.96  ? 28  THR B OG1 1 
ATOM   1812  C CG2 . THR B  2 28  ? -5.846  32.127  161.739 1.00 85.15  ? 28  THR B CG2 1 
ATOM   1813  N N   . PHE B  2 29  ? -6.776  31.345  158.438 1.00 88.24  ? 29  PHE B N   1 
ATOM   1814  C CA  . PHE B  2 29  ? -6.887  31.561  157.004 1.00 87.62  ? 29  PHE B CA  1 
ATOM   1815  C C   . PHE B  2 29  ? -5.985  32.766  156.834 1.00 86.93  ? 29  PHE B C   1 
ATOM   1816  O O   . PHE B  2 29  ? -4.804  32.620  156.550 1.00 86.72  ? 29  PHE B O   1 
ATOM   1817  C CB  . PHE B  2 29  ? -8.324  31.908  156.593 1.00 88.61  ? 29  PHE B CB  1 
ATOM   1818  C CG  . PHE B  2 29  ? -8.538  31.932  155.100 1.00 89.69  ? 29  PHE B CG  1 
ATOM   1819  C CD1 . PHE B  2 29  ? -8.394  30.769  154.340 1.00 90.35  ? 29  PHE B CD1 1 
ATOM   1820  C CD2 . PHE B  2 29  ? -8.867  33.117  154.448 1.00 90.69  ? 29  PHE B CD2 1 
ATOM   1821  C CE1 . PHE B  2 29  ? -8.570  30.790  152.952 1.00 90.64  ? 29  PHE B CE1 1 
ATOM   1822  C CE2 . PHE B  2 29  ? -9.046  33.147  153.057 1.00 91.66  ? 29  PHE B CE2 1 
ATOM   1823  C CZ  . PHE B  2 29  ? -8.897  31.981  152.311 1.00 91.01  ? 29  PHE B CZ  1 
ATOM   1824  N N   . SER B  2 30  ? -6.557  33.946  157.052 1.00 85.93  ? 30  SER B N   1 
ATOM   1825  C CA  . SER B  2 30  ? -5.853  35.223  156.974 1.00 84.44  ? 30  SER B CA  1 
ATOM   1826  C C   . SER B  2 30  ? -4.359  35.207  156.604 1.00 83.40  ? 30  SER B C   1 
ATOM   1827  O O   . SER B  2 30  ? -3.931  35.940  155.706 1.00 83.05  ? 30  SER B O   1 
ATOM   1828  C CB  . SER B  2 30  ? -6.052  35.965  158.301 1.00 84.82  ? 30  SER B CB  1 
ATOM   1829  O OG  . SER B  2 30  ? -6.196  35.060  159.387 1.00 83.53  ? 30  SER B OG  1 
ATOM   1830  N N   . SER B  2 31  ? -3.566  34.389  157.294 1.00 81.71  ? 31  SER B N   1 
ATOM   1831  C CA  . SER B  2 31  ? -2.130  34.319  157.018 1.00 79.86  ? 31  SER B CA  1 
ATOM   1832  C C   . SER B  2 31  ? -1.716  33.215  156.031 1.00 77.54  ? 31  SER B C   1 
ATOM   1833  O O   . SER B  2 31  ? -0.755  33.391  155.280 1.00 77.31  ? 31  SER B O   1 
ATOM   1834  C CB  . SER B  2 31  ? -1.339  34.174  158.334 1.00 81.00  ? 31  SER B CB  1 
ATOM   1835  O OG  . SER B  2 31  ? -1.683  35.176  159.284 1.00 80.81  ? 31  SER B OG  1 
ATOM   1836  N N   . TYR B  2 32  ? -2.426  32.085  156.039 1.00 74.78  ? 32  TYR B N   1 
ATOM   1837  C CA  . TYR B  2 32  ? -2.130  30.981  155.121 1.00 71.64  ? 32  TYR B CA  1 
ATOM   1838  C C   . TYR B  2 32  ? -1.991  31.565  153.707 1.00 69.69  ? 32  TYR B C   1 
ATOM   1839  O O   . TYR B  2 32  ? -2.935  32.151  153.183 1.00 70.03  ? 32  TYR B O   1 
ATOM   1840  C CB  . TYR B  2 32  ? -3.268  29.947  155.120 1.00 70.87  ? 32  TYR B CB  1 
ATOM   1841  C CG  . TYR B  2 32  ? -3.430  29.098  156.375 1.00 70.30  ? 32  TYR B CG  1 
ATOM   1842  C CD1 . TYR B  2 32  ? -4.498  28.202  156.492 1.00 70.49  ? 32  TYR B CD1 1 
ATOM   1843  C CD2 . TYR B  2 32  ? -2.517  29.161  157.423 1.00 70.38  ? 32  TYR B CD2 1 
ATOM   1844  C CE1 . TYR B  2 32  ? -4.652  27.387  157.619 1.00 70.16  ? 32  TYR B CE1 1 
ATOM   1845  C CE2 . TYR B  2 32  ? -2.662  28.348  158.559 1.00 70.51  ? 32  TYR B CE2 1 
ATOM   1846  C CZ  . TYR B  2 32  ? -3.730  27.462  158.650 1.00 70.37  ? 32  TYR B CZ  1 
ATOM   1847  O OH  . TYR B  2 32  ? -3.870  26.648  159.760 1.00 69.56  ? 32  TYR B OH  1 
ATOM   1848  N N   . ALA B  2 33  ? -0.818  31.405  153.097 1.00 66.81  ? 33  ALA B N   1 
ATOM   1849  C CA  . ALA B  2 33  ? -0.564  31.929  151.753 1.00 62.67  ? 33  ALA B CA  1 
ATOM   1850  C C   . ALA B  2 33  ? -1.020  30.960  150.667 1.00 59.38  ? 33  ALA B C   1 
ATOM   1851  O O   . ALA B  2 33  ? -0.293  30.031  150.327 1.00 59.54  ? 33  ALA B O   1 
ATOM   1852  C CB  . ALA B  2 33  ? 0.924   32.226  151.592 1.00 62.37  ? 33  ALA B CB  1 
ATOM   1853  N N   . ILE B  2 34  ? -2.218  31.170  150.122 1.00 55.80  ? 34  ILE B N   1 
ATOM   1854  C CA  . ILE B  2 34  ? -2.726  30.284  149.074 1.00 52.67  ? 34  ILE B CA  1 
ATOM   1855  C C   . ILE B  2 34  ? -1.952  30.479  147.780 1.00 51.03  ? 34  ILE B C   1 
ATOM   1856  O O   . ILE B  2 34  ? -1.521  31.583  147.454 1.00 49.95  ? 34  ILE B O   1 
ATOM   1857  C CB  . ILE B  2 34  ? -4.231  30.515  148.757 1.00 52.28  ? 34  ILE B CB  1 
ATOM   1858  C CG1 . ILE B  2 34  ? -5.106  30.073  149.925 1.00 50.85  ? 34  ILE B CG1 1 
ATOM   1859  C CG2 . ILE B  2 34  ? -4.636  29.712  147.528 1.00 51.89  ? 34  ILE B CG2 1 
ATOM   1860  C CD1 . ILE B  2 34  ? -5.228  31.095  151.026 1.00 51.79  ? 34  ILE B CD1 1 
ATOM   1861  N N   . SER B  2 35  ? -1.787  29.393  147.041 1.00 49.10  ? 35  SER B N   1 
ATOM   1862  C CA  . SER B  2 35  ? -1.071  29.445  145.785 1.00 47.66  ? 35  SER B CA  1 
ATOM   1863  C C   . SER B  2 35  ? -1.760  28.495  144.804 1.00 46.10  ? 35  SER B C   1 
ATOM   1864  O O   . SER B  2 35  ? -2.321  27.492  145.218 1.00 46.36  ? 35  SER B O   1 
ATOM   1865  C CB  . SER B  2 35  ? 0.374   29.040  146.027 1.00 47.97  ? 35  SER B CB  1 
ATOM   1866  O OG  . SER B  2 35  ? 1.200   29.545  145.008 1.00 50.49  ? 35  SER B OG  1 
ATOM   1867  N N   . TRP B  2 36  ? -1.746  28.818  143.516 1.00 44.55  ? 36  TRP B N   1 
ATOM   1868  C CA  . TRP B  2 36  ? -2.393  27.963  142.531 1.00 43.75  ? 36  TRP B CA  1 
ATOM   1869  C C   . TRP B  2 36  ? -1.453  27.402  141.491 1.00 43.24  ? 36  TRP B C   1 
ATOM   1870  O O   . TRP B  2 36  ? -0.909  28.143  140.670 1.00 43.31  ? 36  TRP B O   1 
ATOM   1871  C CB  . TRP B  2 36  ? -3.512  28.707  141.823 1.00 45.00  ? 36  TRP B CB  1 
ATOM   1872  C CG  . TRP B  2 36  ? -4.720  28.853  142.654 1.00 47.45  ? 36  TRP B CG  1 
ATOM   1873  C CD1 . TRP B  2 36  ? -4.976  29.835  143.547 1.00 48.45  ? 36  TRP B CD1 1 
ATOM   1874  C CD2 . TRP B  2 36  ? -5.834  27.954  142.710 1.00 49.33  ? 36  TRP B CD2 1 
ATOM   1875  N NE1 . TRP B  2 36  ? -6.185  29.615  144.166 1.00 49.35  ? 36  TRP B NE1 1 
ATOM   1876  C CE2 . TRP B  2 36  ? -6.734  28.465  143.672 1.00 49.14  ? 36  TRP B CE2 1 
ATOM   1877  C CE3 . TRP B  2 36  ? -6.159  26.763  142.044 1.00 50.61  ? 36  TRP B CE3 1 
ATOM   1878  C CZ2 . TRP B  2 36  ? -7.938  27.830  143.988 1.00 49.10  ? 36  TRP B CZ2 1 
ATOM   1879  C CZ3 . TRP B  2 36  ? -7.364  26.127  142.359 1.00 51.62  ? 36  TRP B CZ3 1 
ATOM   1880  C CH2 . TRP B  2 36  ? -8.236  26.667  143.326 1.00 50.44  ? 36  TRP B CH2 1 
ATOM   1881  N N   . VAL B  2 37  ? -1.281  26.083  141.520 1.00 41.73  ? 37  VAL B N   1 
ATOM   1882  C CA  . VAL B  2 37  ? -0.402  25.389  140.582 1.00 39.60  ? 37  VAL B CA  1 
ATOM   1883  C C   . VAL B  2 37  ? -1.215  24.397  139.748 1.00 40.21  ? 37  VAL B C   1 
ATOM   1884  O O   . VAL B  2 37  ? -2.071  23.679  140.281 1.00 39.71  ? 37  VAL B O   1 
ATOM   1885  C CB  . VAL B  2 37  ? 0.717   24.616  141.332 1.00 37.57  ? 37  VAL B CB  1 
ATOM   1886  C CG1 . VAL B  2 37  ? 1.775   24.131  140.360 1.00 34.82  ? 37  VAL B CG1 1 
ATOM   1887  C CG2 . VAL B  2 37  ? 1.330   25.500  142.384 1.00 35.57  ? 37  VAL B CG2 1 
ATOM   1888  N N   . ARG B  2 38  ? -0.960  24.367  138.439 1.00 40.16  ? 38  ARG B N   1 
ATOM   1889  C CA  . ARG B  2 38  ? -1.667  23.443  137.560 1.00 39.71  ? 38  ARG B CA  1 
ATOM   1890  C C   . ARG B  2 38  ? -0.676  22.467  136.956 1.00 39.91  ? 38  ARG B C   1 
ATOM   1891  O O   . ARG B  2 38  ? 0.508   22.759  136.855 1.00 38.95  ? 38  ARG B O   1 
ATOM   1892  C CB  . ARG B  2 38  ? -2.400  24.198  136.455 1.00 40.09  ? 38  ARG B CB  1 
ATOM   1893  C CG  . ARG B  2 38  ? -1.509  24.899  135.457 1.00 41.05  ? 38  ARG B CG  1 
ATOM   1894  C CD  . ARG B  2 38  ? -2.331  25.382  134.269 1.00 41.39  ? 38  ARG B CD  1 
ATOM   1895  N NE  . ARG B  2 38  ? -1.509  25.520  133.072 1.00 42.98  ? 38  ARG B NE  1 
ATOM   1896  C CZ  . ARG B  2 38  ? -1.934  26.015  131.912 1.00 44.79  ? 38  ARG B CZ  1 
ATOM   1897  N NH1 . ARG B  2 38  ? -3.184  26.430  131.765 1.00 46.18  ? 38  ARG B NH1 1 
ATOM   1898  N NH2 . ARG B  2 38  ? -1.098  26.111  130.892 1.00 46.96  ? 38  ARG B NH2 1 
ATOM   1899  N N   . GLN B  2 39  ? -1.165  21.306  136.550 1.00 40.74  ? 39  GLN B N   1 
ATOM   1900  C CA  . GLN B  2 39  ? -0.301  20.288  135.980 1.00 41.51  ? 39  GLN B CA  1 
ATOM   1901  C C   . GLN B  2 39  ? -0.959  19.519  134.848 1.00 42.08  ? 39  GLN B C   1 
ATOM   1902  O O   . GLN B  2 39  ? -1.783  18.630  135.090 1.00 40.80  ? 39  GLN B O   1 
ATOM   1903  C CB  . GLN B  2 39  ? 0.094   19.304  137.068 1.00 43.06  ? 39  GLN B CB  1 
ATOM   1904  C CG  . GLN B  2 39  ? 0.901   18.092  136.602 1.00 44.00  ? 39  GLN B CG  1 
ATOM   1905  C CD  . GLN B  2 39  ? 0.893   16.985  137.646 1.00 44.11  ? 39  GLN B CD  1 
ATOM   1906  O OE1 . GLN B  2 39  ? -0.129  16.322  137.849 1.00 44.50  ? 39  GLN B OE1 1 
ATOM   1907  N NE2 . GLN B  2 39  ? 2.022   16.800  138.330 1.00 41.04  ? 39  GLN B NE2 1 
ATOM   1908  N N   . ALA B  2 40  ? -0.576  19.852  133.614 1.00 43.16  ? 40  ALA B N   1 
ATOM   1909  C CA  . ALA B  2 40  ? -1.104  19.180  132.426 1.00 42.91  ? 40  ALA B CA  1 
ATOM   1910  C C   . ALA B  2 40  ? -0.818  17.682  132.532 1.00 43.59  ? 40  ALA B C   1 
ATOM   1911  O O   . ALA B  2 40  ? -0.248  17.212  133.517 1.00 43.31  ? 40  ALA B O   1 
ATOM   1912  C CB  . ALA B  2 40  ? -0.451  19.748  131.182 1.00 40.13  ? 40  ALA B CB  1 
ATOM   1913  N N   . PRO B  2 41  ? -1.246  16.905  131.534 1.00 44.12  ? 41  PRO B N   1 
ATOM   1914  C CA  . PRO B  2 41  ? -0.993  15.462  131.570 1.00 46.01  ? 41  PRO B CA  1 
ATOM   1915  C C   . PRO B  2 41  ? 0.515   15.100  131.591 1.00 47.25  ? 41  PRO B C   1 
ATOM   1916  O O   . PRO B  2 41  ? 1.265   15.401  130.649 1.00 47.22  ? 41  PRO B O   1 
ATOM   1917  C CB  . PRO B  2 41  ? -1.702  14.974  130.312 1.00 43.88  ? 41  PRO B CB  1 
ATOM   1918  C CG  . PRO B  2 41  ? -2.886  15.843  130.284 1.00 43.24  ? 41  PRO B CG  1 
ATOM   1919  C CD  . PRO B  2 41  ? -2.315  17.212  130.575 1.00 43.43  ? 41  PRO B CD  1 
ATOM   1920  N N   . GLY B  2 42  ? 0.958   14.445  132.662 1.00 47.04  ? 42  GLY B N   1 
ATOM   1921  C CA  . GLY B  2 42  ? 2.361   14.095  132.736 1.00 46.95  ? 42  GLY B CA  1 
ATOM   1922  C C   . GLY B  2 42  ? 3.226   15.300  132.409 1.00 46.28  ? 42  GLY B C   1 
ATOM   1923  O O   . GLY B  2 42  ? 4.002   15.283  131.451 1.00 45.67  ? 42  GLY B O   1 
ATOM   1924  N N   . GLN B  2 43  ? 3.057   16.358  133.201 1.00 45.93  ? 43  GLN B N   1 
ATOM   1925  C CA  . GLN B  2 43  ? 3.825   17.595  133.053 1.00 45.60  ? 43  GLN B CA  1 
ATOM   1926  C C   . GLN B  2 43  ? 4.166   18.133  134.431 1.00 43.75  ? 43  GLN B C   1 
ATOM   1927  O O   . GLN B  2 43  ? 3.484   17.843  135.421 1.00 41.99  ? 43  GLN B O   1 
ATOM   1928  C CB  . GLN B  2 43  ? 3.042   18.687  132.298 1.00 47.38  ? 43  GLN B CB  1 
ATOM   1929  C CG  . GLN B  2 43  ? 3.016   18.557  130.785 1.00 50.84  ? 43  GLN B CG  1 
ATOM   1930  C CD  . GLN B  2 43  ? 3.122   19.906  130.080 1.00 52.63  ? 43  GLN B CD  1 
ATOM   1931  O OE1 . GLN B  2 43  ? 4.208   20.328  129.678 1.00 51.43  ? 43  GLN B OE1 1 
ATOM   1932  N NE2 . GLN B  2 43  ? 1.989   20.595  129.939 1.00 54.57  ? 43  GLN B NE2 1 
ATOM   1933  N N   . GLY B  2 44  ? 5.226   18.926  134.484 1.00 42.06  ? 44  GLY B N   1 
ATOM   1934  C CA  . GLY B  2 44  ? 5.628   19.510  135.742 1.00 40.69  ? 44  GLY B CA  1 
ATOM   1935  C C   . GLY B  2 44  ? 4.555   20.432  136.288 1.00 38.74  ? 44  GLY B C   1 
ATOM   1936  O O   . GLY B  2 44  ? 3.635   20.828  135.567 1.00 36.97  ? 44  GLY B O   1 
ATOM   1937  N N   . LEU B  2 45  ? 4.670   20.756  137.571 1.00 38.13  ? 45  LEU B N   1 
ATOM   1938  C CA  . LEU B  2 45  ? 3.726   21.642  138.214 1.00 37.83  ? 45  LEU B CA  1 
ATOM   1939  C C   . LEU B  2 45  ? 3.989   22.984  137.585 1.00 37.12  ? 45  LEU B C   1 
ATOM   1940  O O   . LEU B  2 45  ? 5.051   23.214  137.036 1.00 34.24  ? 45  LEU B O   1 
ATOM   1941  C CB  . LEU B  2 45  ? 3.965   21.688  139.717 1.00 39.25  ? 45  LEU B CB  1 
ATOM   1942  C CG  . LEU B  2 45  ? 3.948   20.328  140.442 1.00 41.24  ? 45  LEU B CG  1 
ATOM   1943  C CD1 . LEU B  2 45  ? 4.324   20.530  141.928 1.00 40.57  ? 45  LEU B CD1 1 
ATOM   1944  C CD2 . LEU B  2 45  ? 2.569   19.670  140.313 1.00 38.01  ? 45  LEU B CD2 1 
ATOM   1945  N N   . GLU B  2 46  ? 3.013   23.868  137.661 1.00 39.14  ? 46  GLU B N   1 
ATOM   1946  C CA  . GLU B  2 46  ? 3.133   25.167  137.034 1.00 40.91  ? 46  GLU B CA  1 
ATOM   1947  C C   . GLU B  2 46  ? 2.400   26.168  137.886 1.00 40.64  ? 46  GLU B C   1 
ATOM   1948  O O   . GLU B  2 46  ? 1.176   26.184  137.917 1.00 41.37  ? 46  GLU B O   1 
ATOM   1949  C CB  . GLU B  2 46  ? 2.510   25.090  135.645 1.00 42.62  ? 46  GLU B CB  1 
ATOM   1950  C CG  . GLU B  2 46  ? 2.567   26.358  134.851 1.00 47.02  ? 46  GLU B CG  1 
ATOM   1951  C CD  . GLU B  2 46  ? 2.224   26.142  133.382 1.00 49.29  ? 46  GLU B CD  1 
ATOM   1952  O OE1 . GLU B  2 46  ? 1.092   25.700  133.078 1.00 49.82  ? 46  GLU B OE1 1 
ATOM   1953  O OE2 . GLU B  2 46  ? 3.096   26.417  132.530 1.00 51.91  ? 46  GLU B OE2 1 
ATOM   1954  N N   . TRP B  2 47  ? 3.155   27.004  138.575 1.00 40.59  ? 47  TRP B N   1 
ATOM   1955  C CA  . TRP B  2 47  ? 2.567   27.988  139.461 1.00 42.67  ? 47  TRP B CA  1 
ATOM   1956  C C   . TRP B  2 47  ? 1.864   29.111  138.720 1.00 43.79  ? 47  TRP B C   1 
ATOM   1957  O O   . TRP B  2 47  ? 2.497   29.990  138.145 1.00 43.75  ? 47  TRP B O   1 
ATOM   1958  C CB  . TRP B  2 47  ? 3.648   28.557  140.352 1.00 43.23  ? 47  TRP B CB  1 
ATOM   1959  C CG  . TRP B  2 47  ? 3.170   29.533  141.358 1.00 45.20  ? 47  TRP B CG  1 
ATOM   1960  C CD1 . TRP B  2 47  ? 2.717   29.263  142.619 1.00 45.13  ? 47  TRP B CD1 1 
ATOM   1961  C CD2 . TRP B  2 47  ? 3.187   30.959  141.232 1.00 45.92  ? 47  TRP B CD2 1 
ATOM   1962  N NE1 . TRP B  2 47  ? 2.465   30.437  143.293 1.00 45.04  ? 47  TRP B NE1 1 
ATOM   1963  C CE2 . TRP B  2 47  ? 2.743   31.493  142.465 1.00 45.90  ? 47  TRP B CE2 1 
ATOM   1964  C CE3 . TRP B  2 47  ? 3.537   31.839  140.198 1.00 44.63  ? 47  TRP B CE3 1 
ATOM   1965  C CZ2 . TRP B  2 47  ? 2.643   32.869  142.691 1.00 45.04  ? 47  TRP B CZ2 1 
ATOM   1966  C CZ3 . TRP B  2 47  ? 3.436   33.205  140.425 1.00 44.26  ? 47  TRP B CZ3 1 
ATOM   1967  C CH2 . TRP B  2 47  ? 2.995   33.707  141.661 1.00 44.26  ? 47  TRP B CH2 1 
ATOM   1968  N N   . MET B  2 48  ? 0.542   29.082  138.757 1.00 45.61  ? 48  MET B N   1 
ATOM   1969  C CA  . MET B  2 48  ? -0.261  30.091  138.086 1.00 48.35  ? 48  MET B CA  1 
ATOM   1970  C C   . MET B  2 48  ? -0.315  31.419  138.843 1.00 49.12  ? 48  MET B C   1 
ATOM   1971  O O   . MET B  2 48  ? -0.420  32.483  138.230 1.00 47.29  ? 48  MET B O   1 
ATOM   1972  C CB  . MET B  2 48  ? -1.675  29.564  137.887 1.00 50.48  ? 48  MET B CB  1 
ATOM   1973  C CG  . MET B  2 48  ? -1.769  28.352  136.986 1.00 52.00  ? 48  MET B CG  1 
ATOM   1974  S SD  . MET B  2 48  ? -3.490  27.934  136.801 1.00 55.57  ? 48  MET B SD  1 
ATOM   1975  C CE  . MET B  2 48  ? -4.052  29.387  135.874 1.00 53.14  ? 48  MET B CE  1 
ATOM   1976  N N   . GLY B  2 49  ? -0.258  31.346  140.174 1.00 50.29  ? 49  GLY B N   1 
ATOM   1977  C CA  . GLY B  2 49  ? -0.299  32.546  140.993 1.00 51.15  ? 49  GLY B CA  1 
ATOM   1978  C C   . GLY B  2 49  ? -0.823  32.324  142.398 1.00 52.11  ? 49  GLY B C   1 
ATOM   1979  O O   . GLY B  2 49  ? -1.579  31.394  142.643 1.00 52.41  ? 49  GLY B O   1 
ATOM   1980  N N   . GLY B  2 50  ? -0.423  33.189  143.320 1.00 53.21  ? 50  GLY B N   1 
ATOM   1981  C CA  . GLY B  2 50  ? -0.868  33.072  144.698 1.00 56.81  ? 50  GLY B CA  1 
ATOM   1982  C C   . GLY B  2 50  ? -1.376  34.385  145.281 1.00 59.10  ? 50  GLY B C   1 
ATOM   1983  O O   . GLY B  2 50  ? -1.572  35.355  144.551 1.00 59.65  ? 50  GLY B O   1 
ATOM   1984  N N   . ILE B  2 51  ? -1.564  34.434  146.596 1.00 60.60  ? 51  ILE B N   1 
ATOM   1985  C CA  . ILE B  2 51  ? -2.074  35.635  147.228 1.00 62.98  ? 51  ILE B CA  1 
ATOM   1986  C C   . ILE B  2 51  ? -2.037  35.513  148.754 1.00 65.45  ? 51  ILE B C   1 
ATOM   1987  O O   . ILE B  2 51  ? -1.608  34.499  149.296 1.00 66.53  ? 51  ILE B O   1 
ATOM   1988  C CB  . ILE B  2 51  ? -3.520  35.840  146.779 1.00 64.20  ? 51  ILE B CB  1 
ATOM   1989  C CG1 . ILE B  2 51  ? -4.080  37.153  147.321 1.00 65.15  ? 51  ILE B CG1 1 
ATOM   1990  C CG2 . ILE B  2 51  ? -4.360  34.649  147.229 1.00 64.09  ? 51  ILE B CG2 1 
ATOM   1991  C CD1 . ILE B  2 51  ? -5.460  37.481  146.777 1.00 63.62  ? 51  ILE B CD1 1 
ATOM   1992  N N   . ILE B  2 52  ? -2.482  36.558  149.442 1.00 67.85  ? 52  ILE B N   1 
ATOM   1993  C CA  . ILE B  2 52  ? -2.535  36.566  150.900 1.00 69.73  ? 52  ILE B CA  1 
ATOM   1994  C C   . ILE B  2 52  ? -3.683  37.458  151.328 1.00 71.72  ? 52  ILE B C   1 
ATOM   1995  O O   . ILE B  2 52  ? -3.633  38.668  151.132 1.00 71.85  ? 52  ILE B O   1 
ATOM   1996  C CB  . ILE B  2 52  ? -1.259  37.112  151.511 1.00 69.62  ? 52  ILE B CB  1 
ATOM   1997  C CG1 . ILE B  2 52  ? -0.122  36.118  151.294 1.00 70.20  ? 52  ILE B CG1 1 
ATOM   1998  C CG2 . ILE B  2 52  ? -1.472  37.367  152.986 1.00 69.48  ? 52  ILE B CG2 1 
ATOM   1999  C CD1 . ILE B  2 52  ? 1.193   36.589  151.850 1.00 72.15  ? 52  ILE B CD1 1 
ATOM   2000  N N   . PRO B  2 53  A -4.734  36.866  151.926 1.00 74.50  ? 52  PRO B N   1 
ATOM   2001  C CA  . PRO B  2 53  A -5.947  37.546  152.408 1.00 75.74  ? 52  PRO B CA  1 
ATOM   2002  C C   . PRO B  2 53  A -5.687  38.913  153.028 1.00 75.67  ? 52  PRO B C   1 
ATOM   2003  O O   . PRO B  2 53  A -5.945  39.960  152.419 1.00 74.61  ? 52  PRO B O   1 
ATOM   2004  C CB  . PRO B  2 53  A -6.516  36.552  153.426 1.00 76.33  ? 52  PRO B CB  1 
ATOM   2005  C CG  . PRO B  2 53  A -6.187  35.241  152.798 1.00 76.37  ? 52  PRO B CG  1 
ATOM   2006  C CD  . PRO B  2 53  A -4.737  35.454  152.356 1.00 75.90  ? 52  PRO B CD  1 
ATOM   2007  N N   . VAL B  2 54  ? -5.188  38.874  154.256 1.00 75.60  ? 53  VAL B N   1 
ATOM   2008  C CA  . VAL B  2 54  ? -4.857  40.069  155.010 1.00 75.78  ? 53  VAL B CA  1 
ATOM   2009  C C   . VAL B  2 54  ? -4.225  41.154  154.136 1.00 75.84  ? 53  VAL B C   1 
ATOM   2010  O O   . VAL B  2 54  ? -4.148  42.311  154.532 1.00 76.61  ? 53  VAL B O   1 
ATOM   2011  C CB  . VAL B  2 54  ? -3.893  39.709  156.166 1.00 75.17  ? 53  VAL B CB  1 
ATOM   2012  C CG1 . VAL B  2 54  ? -4.682  39.413  157.439 1.00 74.86  ? 53  VAL B CG1 1 
ATOM   2013  C CG2 . VAL B  2 54  ? -3.080  38.478  155.789 1.00 75.15  ? 53  VAL B CG2 1 
ATOM   2014  N N   . PHE B  2 55  ? -3.784  40.779  152.944 1.00 75.69  ? 54  PHE B N   1 
ATOM   2015  C CA  . PHE B  2 55  ? -3.152  41.721  152.040 1.00 75.99  ? 54  PHE B CA  1 
ATOM   2016  C C   . PHE B  2 55  ? -3.970  41.920  150.784 1.00 77.63  ? 54  PHE B C   1 
ATOM   2017  O O   . PHE B  2 55  ? -3.662  42.793  149.967 1.00 78.45  ? 54  PHE B O   1 
ATOM   2018  C CB  . PHE B  2 55  ? -1.758  41.220  151.703 1.00 74.62  ? 54  PHE B CB  1 
ATOM   2019  C CG  . PHE B  2 55  ? -0.890  41.061  152.904 1.00 72.59  ? 54  PHE B CG  1 
ATOM   2020  C CD1 . PHE B  2 55  ? -1.428  40.618  154.103 1.00 71.32  ? 54  PHE B CD1 1 
ATOM   2021  C CD2 . PHE B  2 55  ? 0.457   41.379  152.854 1.00 72.61  ? 54  PHE B CD2 1 
ATOM   2022  C CE1 . PHE B  2 55  ? -0.652  40.496  155.237 1.00 71.85  ? 54  PHE B CE1 1 
ATOM   2023  C CE2 . PHE B  2 55  ? 1.253   41.261  153.987 1.00 72.55  ? 54  PHE B CE2 1 
ATOM   2024  C CZ  . PHE B  2 55  ? 0.695   40.818  155.185 1.00 72.81  ? 54  PHE B CZ  1 
ATOM   2025  N N   . GLY B  2 56  ? -5.008  41.097  150.644 1.00 78.38  ? 55  GLY B N   1 
ATOM   2026  C CA  . GLY B  2 56  ? -5.918  41.178  149.513 1.00 79.68  ? 55  GLY B CA  1 
ATOM   2027  C C   . GLY B  2 56  ? -5.395  41.043  148.091 1.00 80.59  ? 55  GLY B C   1 
ATOM   2028  O O   . GLY B  2 56  ? -6.002  40.347  147.276 1.00 80.41  ? 55  GLY B O   1 
ATOM   2029  N N   . SER B  2 57  ? -4.289  41.713  147.774 1.00 81.27  ? 56  SER B N   1 
ATOM   2030  C CA  . SER B  2 57  ? -3.735  41.652  146.422 1.00 80.67  ? 56  SER B CA  1 
ATOM   2031  C C   . SER B  2 57  ? -2.909  40.396  146.176 1.00 80.06  ? 56  SER B C   1 
ATOM   2032  O O   . SER B  2 57  ? -2.316  39.816  147.096 1.00 79.92  ? 56  SER B O   1 
ATOM   2033  C CB  . SER B  2 57  ? -2.870  42.889  146.124 1.00 81.15  ? 56  SER B CB  1 
ATOM   2034  O OG  . SER B  2 57  ? -1.563  42.755  146.667 1.00 81.13  ? 56  SER B OG  1 
ATOM   2035  N N   . ALA B  2 58  ? -2.878  39.998  144.909 1.00 78.81  ? 57  ALA B N   1 
ATOM   2036  C CA  . ALA B  2 58  ? -2.139  38.829  144.472 1.00 76.97  ? 57  ALA B CA  1 
ATOM   2037  C C   . ALA B  2 58  ? -1.333  39.169  143.217 1.00 75.17  ? 57  ALA B C   1 
ATOM   2038  O O   . ALA B  2 58  ? -1.516  40.231  142.605 1.00 75.15  ? 57  ALA B O   1 
ATOM   2039  C CB  . ALA B  2 58  ? -3.104  37.689  144.177 1.00 77.28  ? 57  ALA B CB  1 
ATOM   2040  N N   . ASN B  2 59  ? -0.432  38.262  142.856 1.00 72.36  ? 58  ASN B N   1 
ATOM   2041  C CA  . ASN B  2 59  ? 0.399   38.409  141.673 1.00 69.26  ? 58  ASN B CA  1 
ATOM   2042  C C   . ASN B  2 59  ? 0.352   37.088  140.927 1.00 67.66  ? 58  ASN B C   1 
ATOM   2043  O O   . ASN B  2 59  ? 0.273   36.021  141.533 1.00 66.44  ? 58  ASN B O   1 
ATOM   2044  C CB  . ASN B  2 59  ? 1.840   38.749  142.055 1.00 68.75  ? 58  ASN B CB  1 
ATOM   2045  C CG  . ASN B  2 59  ? 2.261   38.112  143.360 1.00 68.79  ? 58  ASN B CG  1 
ATOM   2046  O OD1 . ASN B  2 59  ? 1.825   38.537  144.430 1.00 69.29  ? 58  ASN B OD1 1 
ATOM   2047  N ND2 . ASN B  2 59  ? 3.108   37.087  143.284 1.00 67.98  ? 58  ASN B ND2 1 
ATOM   2048  N N   . TYR B  2 60  ? 0.379   37.163  139.607 1.00 65.81  ? 59  TYR B N   1 
ATOM   2049  C CA  . TYR B  2 60  ? 0.327   35.966  138.804 1.00 64.50  ? 59  TYR B CA  1 
ATOM   2050  C C   . TYR B  2 60  ? 1.581   35.911  137.938 1.00 63.11  ? 59  TYR B C   1 
ATOM   2051  O O   . TYR B  2 60  ? 2.188   36.939  137.660 1.00 61.79  ? 59  TYR B O   1 
ATOM   2052  C CB  . TYR B  2 60  ? -0.922  35.990  137.922 1.00 66.38  ? 59  TYR B CB  1 
ATOM   2053  C CG  . TYR B  2 60  ? -2.166  36.560  138.580 1.00 67.82  ? 59  TYR B CG  1 
ATOM   2054  C CD1 . TYR B  2 60  ? -2.337  37.939  138.730 1.00 68.73  ? 59  TYR B CD1 1 
ATOM   2055  C CD2 . TYR B  2 60  ? -3.191  35.721  139.028 1.00 68.60  ? 59  TYR B CD2 1 
ATOM   2056  C CE1 . TYR B  2 60  ? -3.511  38.471  139.311 1.00 68.66  ? 59  TYR B CE1 1 
ATOM   2057  C CE2 . TYR B  2 60  ? -4.363  36.240  139.608 1.00 68.31  ? 59  TYR B CE2 1 
ATOM   2058  C CZ  . TYR B  2 60  ? -4.516  37.612  139.746 1.00 67.95  ? 59  TYR B CZ  1 
ATOM   2059  O OH  . TYR B  2 60  ? -5.668  38.116  140.312 1.00 66.83  ? 59  TYR B OH  1 
ATOM   2060  N N   . ALA B  2 61  ? 1.969   34.711  137.520 1.00 62.01  ? 60  ALA B N   1 
ATOM   2061  C CA  . ALA B  2 61  ? 3.142   34.549  136.681 1.00 61.90  ? 60  ALA B CA  1 
ATOM   2062  C C   . ALA B  2 61  ? 2.842   35.035  135.260 1.00 62.53  ? 60  ALA B C   1 
ATOM   2063  O O   . ALA B  2 61  ? 1.722   34.886  134.759 1.00 63.20  ? 60  ALA B O   1 
ATOM   2064  C CB  . ALA B  2 61  ? 3.574   33.094  136.669 1.00 61.87  ? 60  ALA B CB  1 
ATOM   2065  N N   . GLN B  2 62  ? 3.861   35.615  134.628 1.00 62.47  ? 61  GLN B N   1 
ATOM   2066  C CA  . GLN B  2 62  ? 3.801   36.181  133.274 1.00 62.16  ? 61  GLN B CA  1 
ATOM   2067  C C   . GLN B  2 62  ? 2.754   35.622  132.299 1.00 60.86  ? 61  GLN B C   1 
ATOM   2068  O O   . GLN B  2 62  ? 1.642   36.137  132.211 1.00 60.41  ? 61  GLN B O   1 
ATOM   2069  C CB  . GLN B  2 62  ? 5.186   36.084  132.625 1.00 64.42  ? 61  GLN B CB  1 
ATOM   2070  C CG  . GLN B  2 62  ? 5.748   37.395  132.094 1.00 68.22  ? 61  GLN B CG  1 
ATOM   2071  C CD  . GLN B  2 62  ? 7.119   37.215  131.440 1.00 71.71  ? 61  GLN B CD  1 
ATOM   2072  O OE1 . GLN B  2 62  ? 7.225   36.707  130.320 1.00 73.90  ? 61  GLN B OE1 1 
ATOM   2073  N NE2 . GLN B  2 62  ? 8.177   37.619  132.147 1.00 72.63  ? 61  GLN B NE2 1 
ATOM   2074  N N   . LYS B  2 63  ? 3.109   34.575  131.558 1.00 59.00  ? 62  LYS B N   1 
ATOM   2075  C CA  . LYS B  2 63  ? 2.188   34.019  130.581 1.00 56.65  ? 62  LYS B CA  1 
ATOM   2076  C C   . LYS B  2 63  ? 0.757   33.920  131.084 1.00 55.49  ? 62  LYS B C   1 
ATOM   2077  O O   . LYS B  2 63  ? -0.178  33.861  130.284 1.00 56.89  ? 62  LYS B O   1 
ATOM   2078  C CB  . LYS B  2 63  ? 2.664   32.646  130.084 1.00 55.96  ? 62  LYS B CB  1 
ATOM   2079  C CG  . LYS B  2 63  ? 2.539   31.505  131.068 1.00 55.92  ? 62  LYS B CG  1 
ATOM   2080  C CD  . LYS B  2 63  ? 2.353   30.167  130.347 1.00 56.79  ? 62  LYS B CD  1 
ATOM   2081  C CE  . LYS B  2 63  ? 0.905   29.985  129.834 1.00 57.72  ? 62  LYS B CE  1 
ATOM   2082  N NZ  . LYS B  2 63  ? 0.670   28.755  128.991 1.00 56.01  ? 62  LYS B NZ  1 
ATOM   2083  N N   . PHE B  2 64  ? 0.567   33.927  132.396 1.00 52.51  ? 63  PHE B N   1 
ATOM   2084  C CA  . PHE B  2 64  ? -0.782  33.825  132.906 1.00 51.51  ? 63  PHE B CA  1 
ATOM   2085  C C   . PHE B  2 64  ? -1.413  35.139  133.249 1.00 51.17  ? 63  PHE B C   1 
ATOM   2086  O O   . PHE B  2 64  ? -2.490  35.177  133.808 1.00 50.05  ? 63  PHE B O   1 
ATOM   2087  C CB  . PHE B  2 64  ? -0.829  32.895  134.114 1.00 51.83  ? 63  PHE B CB  1 
ATOM   2088  C CG  . PHE B  2 64  ? -0.855  31.443  133.740 1.00 51.49  ? 63  PHE B CG  1 
ATOM   2089  C CD1 . PHE B  2 64  ? 0.306   30.685  133.757 1.00 51.63  ? 63  PHE B CD1 1 
ATOM   2090  C CD2 . PHE B  2 64  ? -2.021  30.867  133.265 1.00 50.06  ? 63  PHE B CD2 1 
ATOM   2091  C CE1 . PHE B  2 64  ? 0.307   29.386  133.300 1.00 50.61  ? 63  PHE B CE1 1 
ATOM   2092  C CE2 . PHE B  2 64  ? -2.025  29.576  132.808 1.00 50.90  ? 63  PHE B CE2 1 
ATOM   2093  C CZ  . PHE B  2 64  ? -0.856  28.831  132.823 1.00 51.19  ? 63  PHE B CZ  1 
ATOM   2094  N N   . GLN B  2 65  ? -0.751  36.222  132.877 1.00 52.76  ? 64  GLN B N   1 
ATOM   2095  C CA  . GLN B  2 65  ? -1.240  37.569  133.173 1.00 53.48  ? 64  GLN B CA  1 
ATOM   2096  C C   . GLN B  2 65  ? -2.323  38.098  132.220 1.00 52.44  ? 64  GLN B C   1 
ATOM   2097  O O   . GLN B  2 65  ? -2.194  38.022  130.999 1.00 51.65  ? 64  GLN B O   1 
ATOM   2098  C CB  . GLN B  2 65  ? -0.058  38.548  133.187 1.00 54.77  ? 64  GLN B CB  1 
ATOM   2099  C CG  . GLN B  2 65  ? -0.272  39.781  134.036 1.00 54.78  ? 64  GLN B CG  1 
ATOM   2100  C CD  . GLN B  2 65  ? -0.112  39.481  135.498 1.00 54.95  ? 64  GLN B CD  1 
ATOM   2101  O OE1 . GLN B  2 65  ? 0.976   39.106  135.943 1.00 56.34  ? 64  GLN B OE1 1 
ATOM   2102  N NE2 . GLN B  2 65  ? -1.192  39.633  136.263 1.00 53.85  ? 64  GLN B NE2 1 
ATOM   2103  N N   . GLY B  2 66  ? -3.387  38.642  132.799 1.00 51.06  ? 65  GLY B N   1 
ATOM   2104  C CA  . GLY B  2 66  ? -4.453  39.178  131.989 1.00 51.88  ? 65  GLY B CA  1 
ATOM   2105  C C   . GLY B  2 66  ? -5.600  38.216  131.807 1.00 52.55  ? 65  GLY B C   1 
ATOM   2106  O O   . GLY B  2 66  ? -6.748  38.640  131.665 1.00 53.60  ? 65  GLY B O   1 
ATOM   2107  N N   . ARG B  2 67  ? -5.297  36.923  131.800 1.00 52.61  ? 66  ARG B N   1 
ATOM   2108  C CA  . ARG B  2 67  ? -6.323  35.903  131.629 1.00 52.16  ? 66  ARG B CA  1 
ATOM   2109  C C   . ARG B  2 67  ? -6.603  35.118  132.908 1.00 52.44  ? 66  ARG B C   1 
ATOM   2110  O O   . ARG B  2 67  ? -7.492  34.271  132.934 1.00 52.36  ? 66  ARG B O   1 
ATOM   2111  C CB  . ARG B  2 67  ? -5.935  34.942  130.500 1.00 52.03  ? 66  ARG B CB  1 
ATOM   2112  C CG  . ARG B  2 67  ? -4.499  35.082  129.972 1.00 51.76  ? 66  ARG B CG  1 
ATOM   2113  C CD  . ARG B  2 67  ? -4.300  34.353  128.617 1.00 51.72  ? 66  ARG B CD  1 
ATOM   2114  N NE  . ARG B  2 67  ? -4.057  32.907  128.724 1.00 52.52  ? 66  ARG B NE  1 
ATOM   2115  C CZ  . ARG B  2 67  ? -4.992  31.967  128.884 1.00 52.42  ? 66  ARG B CZ  1 
ATOM   2116  N NH1 . ARG B  2 67  ? -6.272  32.289  128.961 1.00 53.31  ? 66  ARG B NH1 1 
ATOM   2117  N NH2 . ARG B  2 67  ? -4.648  30.688  128.952 1.00 51.98  ? 66  ARG B NH2 1 
ATOM   2118  N N   . VAL B  2 68  ? -5.861  35.421  133.970 1.00 52.77  ? 67  VAL B N   1 
ATOM   2119  C CA  . VAL B  2 68  ? -6.017  34.732  135.248 1.00 54.08  ? 67  VAL B CA  1 
ATOM   2120  C C   . VAL B  2 68  ? -6.402  35.691  136.369 1.00 54.84  ? 67  VAL B C   1 
ATOM   2121  O O   . VAL B  2 68  ? -6.035  36.862  136.343 1.00 54.90  ? 67  VAL B O   1 
ATOM   2122  C CB  . VAL B  2 68  ? -4.708  34.035  135.666 1.00 54.65  ? 67  VAL B CB  1 
ATOM   2123  C CG1 . VAL B  2 68  ? -3.707  35.068  136.129 1.00 54.44  ? 67  VAL B CG1 1 
ATOM   2124  C CG2 . VAL B  2 68  ? -4.970  33.033  136.780 1.00 55.45  ? 67  VAL B CG2 1 
ATOM   2125  N N   . THR B  2 69  ? -7.128  35.181  137.359 1.00 55.96  ? 68  THR B N   1 
ATOM   2126  C CA  . THR B  2 69  ? -7.552  35.997  138.485 1.00 57.93  ? 68  THR B CA  1 
ATOM   2127  C C   . THR B  2 69  ? -7.928  35.160  139.710 1.00 59.92  ? 68  THR B C   1 
ATOM   2128  O O   . THR B  2 69  ? -9.027  34.597  139.791 1.00 60.20  ? 68  THR B O   1 
ATOM   2129  C CB  . THR B  2 69  ? -8.740  36.880  138.097 1.00 57.42  ? 68  THR B CB  1 
ATOM   2130  O OG1 . THR B  2 69  ? -8.418  37.616  136.911 1.00 56.12  ? 68  THR B OG1 1 
ATOM   2131  C CG2 . THR B  2 69  ? -9.052  37.858  139.221 1.00 57.51  ? 68  THR B CG2 1 
ATOM   2132  N N   . ILE B  2 70  ? -7.005  35.100  140.669 1.00 61.45  ? 69  ILE B N   1 
ATOM   2133  C CA  . ILE B  2 70  ? -7.192  34.335  141.898 1.00 63.03  ? 69  ILE B CA  1 
ATOM   2134  C C   . ILE B  2 70  ? -7.588  35.238  143.052 1.00 64.81  ? 69  ILE B C   1 
ATOM   2135  O O   . ILE B  2 70  ? -6.850  36.168  143.375 1.00 65.12  ? 69  ILE B O   1 
ATOM   2136  C CB  . ILE B  2 70  ? -5.886  33.627  142.334 1.00 62.55  ? 69  ILE B CB  1 
ATOM   2137  C CG1 . ILE B  2 70  ? -5.384  32.682  141.244 1.00 61.93  ? 69  ILE B CG1 1 
ATOM   2138  C CG2 . ILE B  2 70  ? -6.127  32.857  143.612 1.00 63.44  ? 69  ILE B CG2 1 
ATOM   2139  C CD1 . ILE B  2 70  ? -3.969  32.214  141.465 1.00 59.85  ? 69  ILE B CD1 1 
ATOM   2140  N N   . THR B  2 71  ? -8.730  34.956  143.682 1.00 67.28  ? 70  THR B N   1 
ATOM   2141  C CA  . THR B  2 71  ? -9.197  35.742  144.834 1.00 68.85  ? 70  THR B CA  1 
ATOM   2142  C C   . THR B  2 71  ? -9.325  34.908  146.105 1.00 70.34  ? 70  THR B C   1 
ATOM   2143  O O   . THR B  2 71  ? -9.105  33.697  146.108 1.00 70.53  ? 70  THR B O   1 
ATOM   2144  C CB  . THR B  2 71  ? -10.576 36.379  144.600 1.00 68.39  ? 70  THR B CB  1 
ATOM   2145  O OG1 . THR B  2 71  ? -11.526 35.352  144.282 1.00 67.51  ? 70  THR B OG1 1 
ATOM   2146  C CG2 . THR B  2 71  ? -10.511 37.419  143.494 1.00 69.19  ? 70  THR B CG2 1 
ATOM   2147  N N   . ALA B  2 72  ? -9.696  35.578  147.188 1.00 72.29  ? 71  ALA B N   1 
ATOM   2148  C CA  . ALA B  2 72  ? -9.878  34.921  148.470 1.00 74.53  ? 71  ALA B CA  1 
ATOM   2149  C C   . ALA B  2 72  ? -10.927 35.663  149.283 1.00 75.98  ? 71  ALA B C   1 
ATOM   2150  O O   . ALA B  2 72  ? -10.824 36.875  149.489 1.00 76.56  ? 71  ALA B O   1 
ATOM   2151  C CB  . ALA B  2 72  ? -8.562  34.885  149.235 1.00 75.72  ? 71  ALA B CB  1 
ATOM   2152  N N   . ASP B  2 73  ? -11.941 34.933  149.735 1.00 77.13  ? 72  ASP B N   1 
ATOM   2153  C CA  . ASP B  2 73  ? -13.001 35.518  150.542 1.00 77.55  ? 72  ASP B CA  1 
ATOM   2154  C C   . ASP B  2 73  ? -12.924 34.936  151.944 1.00 78.41  ? 72  ASP B C   1 
ATOM   2155  O O   . ASP B  2 73  ? -13.686 34.043  152.301 1.00 77.89  ? 72  ASP B O   1 
ATOM   2156  C CB  . ASP B  2 73  ? -14.361 35.219  149.923 1.00 77.33  ? 72  ASP B CB  1 
ATOM   2157  C CG  . ASP B  2 73  ? -15.497 35.731  150.762 1.00 77.32  ? 72  ASP B CG  1 
ATOM   2158  O OD1 . ASP B  2 73  ? -16.637 35.773  150.254 1.00 77.52  ? 72  ASP B OD1 1 
ATOM   2159  O OD2 . ASP B  2 73  ? -15.248 36.088  151.932 1.00 77.63  ? 72  ASP B OD2 1 
ATOM   2160  N N   . GLU B  2 74  ? -11.977 35.450  152.723 1.00 80.03  ? 73  GLU B N   1 
ATOM   2161  C CA  . GLU B  2 74  ? -11.749 35.015  154.100 1.00 81.50  ? 73  GLU B CA  1 
ATOM   2162  C C   . GLU B  2 74  ? -13.039 34.843  154.897 1.00 80.86  ? 73  GLU B C   1 
ATOM   2163  O O   . GLU B  2 74  ? -13.150 33.942  155.739 1.00 79.67  ? 73  GLU B O   1 
ATOM   2164  C CB  . GLU B  2 74  ? -10.820 36.010  154.818 1.00 83.85  ? 73  GLU B CB  1 
ATOM   2165  C CG  . GLU B  2 74  ? -10.750 37.419  154.207 1.00 86.35  ? 73  GLU B CG  1 
ATOM   2166  C CD  . GLU B  2 74  ? -12.108 38.103  154.087 1.00 88.63  ? 73  GLU B CD  1 
ATOM   2167  O OE1 . GLU B  2 74  ? -12.941 37.642  153.270 1.00 89.85  ? 73  GLU B OE1 1 
ATOM   2168  O OE2 . GLU B  2 74  ? -12.340 39.103  154.809 1.00 88.71  ? 73  GLU B OE2 1 
ATOM   2169  N N   . ALA B  2 75  ? -14.009 35.712  154.630 1.00 80.29  ? 74  ALA B N   1 
ATOM   2170  C CA  . ALA B  2 75  ? -15.293 35.643  155.305 1.00 79.99  ? 74  ALA B CA  1 
ATOM   2171  C C   . ALA B  2 75  ? -15.855 34.231  155.093 1.00 79.92  ? 74  ALA B C   1 
ATOM   2172  O O   . ALA B  2 75  ? -16.880 33.856  155.667 1.00 80.41  ? 74  ALA B O   1 
ATOM   2173  C CB  . ALA B  2 75  ? -16.233 36.695  154.734 1.00 79.04  ? 74  ALA B CB  1 
ATOM   2174  N N   . THR B  2 76  ? -15.165 33.456  154.258 1.00 79.12  ? 75  THR B N   1 
ATOM   2175  C CA  . THR B  2 76  ? -15.540 32.080  153.968 1.00 77.54  ? 75  THR B CA  1 
ATOM   2176  C C   . THR B  2 76  ? -14.301 31.197  154.017 1.00 76.36  ? 75  THR B C   1 
ATOM   2177  O O   . THR B  2 76  ? -14.395 29.979  153.879 1.00 75.70  ? 75  THR B O   1 
ATOM   2178  C CB  . THR B  2 76  ? -16.193 31.941  152.582 1.00 77.87  ? 75  THR B CB  1 
ATOM   2179  O OG1 . THR B  2 76  ? -15.330 32.488  151.580 1.00 78.88  ? 75  THR B OG1 1 
ATOM   2180  C CG2 . THR B  2 76  ? -17.518 32.661  152.555 1.00 78.54  ? 75  THR B CG2 1 
ATOM   2181  N N   . SER B  2 77  ? -13.141 31.820  154.208 1.00 74.99  ? 76  SER B N   1 
ATOM   2182  C CA  . SER B  2 77  ? -11.883 31.087  154.291 1.00 74.09  ? 76  SER B CA  1 
ATOM   2183  C C   . SER B  2 77  ? -11.607 30.282  153.014 1.00 73.24  ? 76  SER B C   1 
ATOM   2184  O O   . SER B  2 77  ? -10.999 29.210  153.052 1.00 72.90  ? 76  SER B O   1 
ATOM   2185  C CB  . SER B  2 77  ? -11.928 30.151  155.501 1.00 74.09  ? 76  SER B CB  1 
ATOM   2186  O OG  . SER B  2 77  ? -12.278 30.865  156.676 1.00 74.22  ? 76  SER B OG  1 
ATOM   2187  N N   . THR B  2 78  ? -12.038 30.822  151.882 1.00 71.74  ? 77  THR B N   1 
ATOM   2188  C CA  . THR B  2 78  ? -11.870 30.149  150.606 1.00 70.51  ? 77  THR B CA  1 
ATOM   2189  C C   . THR B  2 78  ? -11.104 30.986  149.595 1.00 69.38  ? 77  THR B C   1 
ATOM   2190  O O   . THR B  2 78  ? -10.969 32.199  149.756 1.00 69.64  ? 77  THR B O   1 
ATOM   2191  C CB  . THR B  2 78  ? -13.236 29.799  150.015 1.00 71.05  ? 77  THR B CB  1 
ATOM   2192  O OG1 . THR B  2 78  ? -13.900 28.894  150.901 1.00 71.00  ? 77  THR B OG1 1 
ATOM   2193  C CG2 . THR B  2 78  ? -13.090 29.152  148.646 1.00 70.33  ? 77  THR B CG2 1 
ATOM   2194  N N   . THR B  2 79  ? -10.615 30.322  148.551 1.00 66.64  ? 78  THR B N   1 
ATOM   2195  C CA  . THR B  2 79  ? -9.859  30.972  147.502 1.00 63.82  ? 78  THR B CA  1 
ATOM   2196  C C   . THR B  2 79  ? -10.486 30.668  146.165 1.00 63.28  ? 78  THR B C   1 
ATOM   2197  O O   . THR B  2 79  ? -11.025 29.585  145.968 1.00 64.10  ? 78  THR B O   1 
ATOM   2198  C CB  . THR B  2 79  ? -8.446  30.459  147.474 1.00 63.24  ? 78  THR B CB  1 
ATOM   2199  O OG1 . THR B  2 79  ? -7.796  30.808  148.696 1.00 63.57  ? 78  THR B OG1 1 
ATOM   2200  C CG2 . THR B  2 79  ? -7.698  31.061  146.314 1.00 64.66  ? 78  THR B CG2 1 
ATOM   2201  N N   . TYR B  2 80  ? -10.412 31.614  145.237 1.00 62.50  ? 79  TYR B N   1 
ATOM   2202  C CA  . TYR B  2 80  ? -10.990 31.399  143.919 1.00 61.68  ? 79  TYR B CA  1 
ATOM   2203  C C   . TYR B  2 80  ? -10.021 31.659  142.783 1.00 60.85  ? 79  TYR B C   1 
ATOM   2204  O O   . TYR B  2 80  ? -9.339  32.682  142.734 1.00 60.42  ? 79  TYR B O   1 
ATOM   2205  C CB  . TYR B  2 80  ? -12.251 32.249  143.747 1.00 62.05  ? 79  TYR B CB  1 
ATOM   2206  C CG  . TYR B  2 80  ? -13.350 31.835  144.695 1.00 63.18  ? 79  TYR B CG  1 
ATOM   2207  C CD1 . TYR B  2 80  ? -13.328 32.221  146.034 1.00 64.15  ? 79  TYR B CD1 1 
ATOM   2208  C CD2 . TYR B  2 80  ? -14.367 30.987  144.276 1.00 63.07  ? 79  TYR B CD2 1 
ATOM   2209  C CE1 . TYR B  2 80  ? -14.291 31.766  146.933 1.00 64.90  ? 79  TYR B CE1 1 
ATOM   2210  C CE2 . TYR B  2 80  ? -15.333 30.528  145.162 1.00 64.23  ? 79  TYR B CE2 1 
ATOM   2211  C CZ  . TYR B  2 80  ? -15.292 30.918  146.488 1.00 65.11  ? 79  TYR B CZ  1 
ATOM   2212  O OH  . TYR B  2 80  ? -16.256 30.456  147.361 1.00 65.62  ? 79  TYR B OH  1 
ATOM   2213  N N   . MET B  2 81  ? -9.961  30.710  141.865 1.00 59.95  ? 80  MET B N   1 
ATOM   2214  C CA  . MET B  2 81  ? -9.079  30.840  140.731 1.00 59.65  ? 80  MET B CA  1 
ATOM   2215  C C   . MET B  2 81  ? -9.921  31.093  139.482 1.00 59.40  ? 80  MET B C   1 
ATOM   2216  O O   . MET B  2 81  ? -10.742 30.267  139.097 1.00 59.16  ? 80  MET B O   1 
ATOM   2217  C CB  . MET B  2 81  ? -8.255  29.568  140.601 1.00 60.24  ? 80  MET B CB  1 
ATOM   2218  C CG  . MET B  2 81  ? -6.877  29.789  140.021 1.00 60.42  ? 80  MET B CG  1 
ATOM   2219  S SD  . MET B  2 81  ? -6.900  30.147  138.256 1.00 61.94  ? 80  MET B SD  1 
ATOM   2220  C CE  . MET B  2 81  ? -6.606  28.501  137.590 1.00 60.41  ? 80  MET B CE  1 
ATOM   2221  N N   . GLU B  2 82  ? -9.719  32.252  138.866 1.00 59.75  ? 81  GLU B N   1 
ATOM   2222  C CA  . GLU B  2 82  ? -10.461 32.652  137.668 1.00 60.82  ? 81  GLU B CA  1 
ATOM   2223  C C   . GLU B  2 82  ? -9.606  32.592  136.384 1.00 60.43  ? 81  GLU B C   1 
ATOM   2224  O O   . GLU B  2 82  ? -8.685  33.399  136.219 1.00 61.53  ? 81  GLU B O   1 
ATOM   2225  C CB  . GLU B  2 82  ? -10.993 34.077  137.880 1.00 62.10  ? 81  GLU B CB  1 
ATOM   2226  C CG  . GLU B  2 82  ? -11.661 34.716  136.674 1.00 65.14  ? 81  GLU B CG  1 
ATOM   2227  C CD  . GLU B  2 82  ? -12.864 33.926  136.192 1.00 67.98  ? 81  GLU B CD  1 
ATOM   2228  O OE1 . GLU B  2 82  ? -13.392 33.109  136.982 1.00 69.14  ? 81  GLU B OE1 1 
ATOM   2229  O OE2 . GLU B  2 82  ? -13.291 34.133  135.031 1.00 68.58  ? 81  GLU B OE2 1 
ATOM   2230  N N   . LEU B  2 83  ? -9.899  31.648  135.481 1.00 58.52  ? 82  LEU B N   1 
ATOM   2231  C CA  . LEU B  2 83  ? -9.135  31.523  134.229 1.00 55.91  ? 82  LEU B CA  1 
ATOM   2232  C C   . LEU B  2 83  ? -9.993  31.667  132.960 1.00 55.46  ? 82  LEU B C   1 
ATOM   2233  O O   . LEU B  2 83  ? -10.714 30.741  132.566 1.00 54.48  ? 82  LEU B O   1 
ATOM   2234  C CB  . LEU B  2 83  ? -8.380  30.194  134.185 1.00 53.75  ? 82  LEU B CB  1 
ATOM   2235  C CG  . LEU B  2 83  ? -7.297  30.185  133.099 1.00 53.04  ? 82  LEU B CG  1 
ATOM   2236  C CD1 . LEU B  2 83  ? -6.368  31.343  133.336 1.00 52.84  ? 82  LEU B CD1 1 
ATOM   2237  C CD2 . LEU B  2 83  ? -6.514  28.893  133.097 1.00 53.06  ? 82  LEU B CD2 1 
ATOM   2238  N N   . SER B  2 84  A -9.873  32.831  132.318 1.00 54.89  ? 82  SER B N   1 
ATOM   2239  C CA  . SER B  2 84  A -10.623 33.193  131.110 1.00 55.18  ? 82  SER B CA  1 
ATOM   2240  C C   . SER B  2 84  A -10.197 32.559  129.769 1.00 54.96  ? 82  SER B C   1 
ATOM   2241  O O   . SER B  2 84  A -9.805  31.399  129.718 1.00 55.45  ? 82  SER B O   1 
ATOM   2242  C CB  . SER B  2 84  A -10.602 34.714  130.982 1.00 55.29  ? 82  SER B CB  1 
ATOM   2243  O OG  . SER B  2 84  A -9.287  35.203  131.184 1.00 55.06  ? 82  SER B OG  1 
ATOM   2244  N N   . SER B  2 85  B -10.306 33.336  128.692 1.00 54.30  ? 82  SER B N   1 
ATOM   2245  C CA  . SER B  2 85  B -9.939  32.918  127.336 1.00 54.35  ? 82  SER B CA  1 
ATOM   2246  C C   . SER B  2 85  B -9.359  31.523  127.266 1.00 53.85  ? 82  SER B C   1 
ATOM   2247  O O   . SER B  2 85  B -8.172  31.355  127.005 1.00 54.39  ? 82  SER B O   1 
ATOM   2248  C CB  . SER B  2 85  B -8.911  33.886  126.751 1.00 55.21  ? 82  SER B CB  1 
ATOM   2249  O OG  . SER B  2 85  B -9.350  35.228  126.851 1.00 58.86  ? 82  SER B OG  1 
ATOM   2250  N N   . LEU B  2 86  C -10.189 30.515  127.468 1.00 53.57  ? 82  LEU B N   1 
ATOM   2251  C CA  . LEU B  2 86  C -9.675  29.153  127.460 1.00 53.86  ? 82  LEU B CA  1 
ATOM   2252  C C   . LEU B  2 86  C -9.269  28.549  126.125 1.00 54.07  ? 82  LEU B C   1 
ATOM   2253  O O   . LEU B  2 86  C -9.871  28.810  125.084 1.00 53.82  ? 82  LEU B O   1 
ATOM   2254  C CB  . LEU B  2 86  C -10.652 28.211  128.180 1.00 52.52  ? 82  LEU B CB  1 
ATOM   2255  C CG  . LEU B  2 86  C -10.595 28.302  129.707 1.00 51.00  ? 82  LEU B CG  1 
ATOM   2256  C CD1 . LEU B  2 86  C -11.588 27.331  130.309 1.00 49.96  ? 82  LEU B CD1 1 
ATOM   2257  C CD2 . LEU B  2 86  C -9.174  28.008  130.190 1.00 48.42  ? 82  LEU B CD2 1 
ATOM   2258  N N   . ARG B  2 87  ? -8.227  27.725  126.198 1.00 54.75  ? 83  ARG B N   1 
ATOM   2259  C CA  . ARG B  2 87  ? -7.667  27.025  125.055 1.00 55.57  ? 83  ARG B CA  1 
ATOM   2260  C C   . ARG B  2 87  ? -7.637  25.534  125.379 1.00 55.19  ? 83  ARG B C   1 
ATOM   2261  O O   . ARG B  2 87  ? -8.251  25.081  126.344 1.00 55.60  ? 83  ARG B O   1 
ATOM   2262  C CB  . ARG B  2 87  ? -6.239  27.489  124.799 1.00 57.27  ? 83  ARG B CB  1 
ATOM   2263  C CG  . ARG B  2 87  ? -5.986  28.962  125.024 1.00 61.14  ? 83  ARG B CG  1 
ATOM   2264  C CD  . ARG B  2 87  ? -4.506  29.233  124.821 1.00 64.49  ? 83  ARG B CD  1 
ATOM   2265  N NE  . ARG B  2 87  ? -4.053  30.500  125.392 1.00 66.83  ? 83  ARG B NE  1 
ATOM   2266  C CZ  . ARG B  2 87  ? -2.781  30.897  125.399 1.00 67.92  ? 83  ARG B CZ  1 
ATOM   2267  N NH1 . ARG B  2 87  ? -1.831  30.125  124.865 1.00 68.43  ? 83  ARG B NH1 1 
ATOM   2268  N NH2 . ARG B  2 87  ? -2.454  32.065  125.943 1.00 67.79  ? 83  ARG B NH2 1 
ATOM   2269  N N   . SER B  2 88  ? -6.894  24.772  124.587 1.00 54.02  ? 84  SER B N   1 
ATOM   2270  C CA  . SER B  2 88  ? -6.803  23.341  124.809 1.00 53.85  ? 84  SER B CA  1 
ATOM   2271  C C   . SER B  2 88  ? -5.638  22.955  125.729 1.00 53.24  ? 84  SER B C   1 
ATOM   2272  O O   . SER B  2 88  ? -5.680  21.913  126.381 1.00 53.56  ? 84  SER B O   1 
ATOM   2273  C CB  . SER B  2 88  ? -6.683  22.618  123.468 1.00 54.77  ? 84  SER B CB  1 
ATOM   2274  O OG  . SER B  2 88  ? -6.783  21.213  123.628 1.00 56.74  ? 84  SER B OG  1 
ATOM   2275  N N   . GLU B  2 89  ? -4.599  23.781  125.793 1.00 51.45  ? 85  GLU B N   1 
ATOM   2276  C CA  . GLU B  2 89  ? -3.478  23.460  126.665 1.00 49.72  ? 85  GLU B CA  1 
ATOM   2277  C C   . GLU B  2 89  ? -3.708  23.954  128.074 1.00 47.00  ? 85  GLU B C   1 
ATOM   2278  O O   . GLU B  2 89  ? -2.811  23.900  128.907 1.00 46.44  ? 85  GLU B O   1 
ATOM   2279  C CB  . GLU B  2 89  ? -2.163  24.046  126.146 1.00 53.14  ? 85  GLU B CB  1 
ATOM   2280  C CG  . GLU B  2 89  ? -2.304  25.130  125.102 1.00 57.23  ? 85  GLU B CG  1 
ATOM   2281  C CD  . GLU B  2 89  ? -2.040  26.507  125.678 1.00 60.18  ? 85  GLU B CD  1 
ATOM   2282  O OE1 . GLU B  2 89  ? -2.099  27.505  124.912 1.00 60.05  ? 85  GLU B OE1 1 
ATOM   2283  O OE2 . GLU B  2 89  ? -1.766  26.577  126.903 1.00 60.65  ? 85  GLU B OE2 1 
ATOM   2284  N N   . ASP B  2 90  ? -4.897  24.461  128.354 1.00 44.92  ? 86  ASP B N   1 
ATOM   2285  C CA  . ASP B  2 90  ? -5.159  24.919  129.706 1.00 42.95  ? 86  ASP B CA  1 
ATOM   2286  C C   . ASP B  2 90  ? -5.744  23.735  130.475 1.00 41.15  ? 86  ASP B C   1 
ATOM   2287  O O   . ASP B  2 90  ? -5.982  23.826  131.673 1.00 40.63  ? 86  ASP B O   1 
ATOM   2288  C CB  . ASP B  2 90  ? -6.121  26.130  129.723 1.00 43.76  ? 86  ASP B CB  1 
ATOM   2289  C CG  . ASP B  2 90  ? -5.537  27.387  129.035 1.00 43.20  ? 86  ASP B CG  1 
ATOM   2290  O OD1 . ASP B  2 90  ? -4.375  27.758  129.300 1.00 41.58  ? 86  ASP B OD1 1 
ATOM   2291  O OD2 . ASP B  2 90  ? -6.258  28.017  128.235 1.00 42.09  ? 86  ASP B OD2 1 
ATOM   2292  N N   . THR B  2 91  ? -5.950  22.617  129.776 1.00 40.68  ? 87  THR B N   1 
ATOM   2293  C CA  . THR B  2 91  ? -6.485  21.382  130.371 1.00 40.66  ? 87  THR B CA  1 
ATOM   2294  C C   . THR B  2 91  ? -5.500  20.746  131.343 1.00 41.16  ? 87  THR B C   1 
ATOM   2295  O O   . THR B  2 91  ? -4.365  20.428  130.972 1.00 41.39  ? 87  THR B O   1 
ATOM   2296  C CB  . THR B  2 91  ? -6.781  20.315  129.305 1.00 41.29  ? 87  THR B CB  1 
ATOM   2297  O OG1 . THR B  2 91  ? -7.760  20.806  128.390 1.00 44.94  ? 87  THR B OG1 1 
ATOM   2298  C CG2 . THR B  2 91  ? -7.301  19.057  129.946 1.00 40.84  ? 87  THR B CG2 1 
ATOM   2299  N N   . ALA B  2 92  ? -5.932  20.533  132.581 1.00 41.14  ? 88  ALA B N   1 
ATOM   2300  C CA  . ALA B  2 92  ? -5.045  19.928  133.562 1.00 41.60  ? 88  ALA B CA  1 
ATOM   2301  C C   . ALA B  2 92  ? -5.635  19.828  134.951 1.00 41.63  ? 88  ALA B C   1 
ATOM   2302  O O   . ALA B  2 92  ? -6.756  20.250  135.192 1.00 43.03  ? 88  ALA B O   1 
ATOM   2303  C CB  . ALA B  2 92  ? -3.751  20.708  133.621 1.00 41.69  ? 88  ALA B CB  1 
ATOM   2304  N N   . VAL B  2 93  ? -4.858  19.261  135.865 1.00 41.69  ? 89  VAL B N   1 
ATOM   2305  C CA  . VAL B  2 93  ? -5.265  19.117  137.259 1.00 41.17  ? 89  VAL B CA  1 
ATOM   2306  C C   . VAL B  2 93  ? -4.818  20.364  138.025 1.00 41.31  ? 89  VAL B C   1 
ATOM   2307  O O   . VAL B  2 93  ? -3.630  20.555  138.293 1.00 42.80  ? 89  VAL B O   1 
ATOM   2308  C CB  . VAL B  2 93  ? -4.617  17.889  137.898 1.00 40.63  ? 89  VAL B CB  1 
ATOM   2309  C CG1 . VAL B  2 93  ? -4.858  17.915  139.379 1.00 40.33  ? 89  VAL B CG1 1 
ATOM   2310  C CG2 . VAL B  2 93  ? -5.177  16.624  137.284 1.00 39.43  ? 89  VAL B CG2 1 
ATOM   2311  N N   . TYR B  2 94  ? -5.773  21.209  138.384 1.00 39.96  ? 90  TYR B N   1 
ATOM   2312  C CA  . TYR B  2 94  ? -5.454  22.441  139.075 1.00 38.26  ? 90  TYR B CA  1 
ATOM   2313  C C   . TYR B  2 94  ? -5.430  22.315  140.571 1.00 38.23  ? 90  TYR B C   1 
ATOM   2314  O O   . TYR B  2 94  ? -6.438  21.975  141.172 1.00 40.37  ? 90  TYR B O   1 
ATOM   2315  C CB  . TYR B  2 94  ? -6.446  23.527  138.676 1.00 37.03  ? 90  TYR B CB  1 
ATOM   2316  C CG  . TYR B  2 94  ? -6.264  24.029  137.251 1.00 35.00  ? 90  TYR B CG  1 
ATOM   2317  C CD1 . TYR B  2 94  ? -6.409  23.166  136.166 1.00 34.84  ? 90  TYR B CD1 1 
ATOM   2318  C CD2 . TYR B  2 94  ? -5.954  25.364  136.993 1.00 32.56  ? 90  TYR B CD2 1 
ATOM   2319  C CE1 . TYR B  2 94  ? -6.254  23.621  134.856 1.00 33.90  ? 90  TYR B CE1 1 
ATOM   2320  C CE2 . TYR B  2 94  ? -5.793  25.821  135.699 1.00 32.83  ? 90  TYR B CE2 1 
ATOM   2321  C CZ  . TYR B  2 94  ? -5.947  24.945  134.641 1.00 33.19  ? 90  TYR B CZ  1 
ATOM   2322  O OH  . TYR B  2 94  ? -5.804  25.395  133.369 1.00 33.30  ? 90  TYR B OH  1 
ATOM   2323  N N   . PHE B  2 95  ? -4.271  22.600  141.166 1.00 37.60  ? 91  PHE B N   1 
ATOM   2324  C CA  . PHE B  2 95  ? -4.091  22.549  142.619 1.00 36.00  ? 91  PHE B CA  1 
ATOM   2325  C C   . PHE B  2 95  ? -3.998  23.951  143.207 1.00 37.35  ? 91  PHE B C   1 
ATOM   2326  O O   . PHE B  2 95  ? -3.629  24.908  142.514 1.00 37.12  ? 91  PHE B O   1 
ATOM   2327  C CB  . PHE B  2 95  ? -2.797  21.843  143.002 1.00 34.30  ? 91  PHE B CB  1 
ATOM   2328  C CG  . PHE B  2 95  ? -2.682  20.437  142.504 1.00 33.75  ? 91  PHE B CG  1 
ATOM   2329  C CD1 . PHE B  2 95  ? -1.842  20.127  141.451 1.00 32.64  ? 91  PHE B CD1 1 
ATOM   2330  C CD2 . PHE B  2 95  ? -3.370  19.406  143.123 1.00 32.92  ? 91  PHE B CD2 1 
ATOM   2331  C CE1 . PHE B  2 95  ? -1.694  18.814  141.037 1.00 31.03  ? 91  PHE B CE1 1 
ATOM   2332  C CE2 . PHE B  2 95  ? -3.216  18.095  142.704 1.00 29.15  ? 91  PHE B CE2 1 
ATOM   2333  C CZ  . PHE B  2 95  ? -2.383  17.805  141.671 1.00 28.44  ? 91  PHE B CZ  1 
ATOM   2334  N N   . CYS B  2 96  ? -4.323  24.044  144.496 1.00 39.33  ? 92  CYS B N   1 
ATOM   2335  C CA  . CYS B  2 96  ? -4.249  25.286  145.269 1.00 41.34  ? 92  CYS B CA  1 
ATOM   2336  C C   . CYS B  2 96  ? -3.606  24.880  146.586 1.00 39.56  ? 92  CYS B C   1 
ATOM   2337  O O   . CYS B  2 96  ? -4.205  24.158  147.371 1.00 38.80  ? 92  CYS B O   1 
ATOM   2338  C CB  . CYS B  2 96  ? -5.632  25.850  145.562 1.00 46.84  ? 92  CYS B CB  1 
ATOM   2339  S SG  . CYS B  2 96  ? -6.520  24.882  146.814 1.00 55.66  ? 92  CYS B SG  1 
ATOM   2340  N N   . ALA B  2 97  ? -2.377  25.324  146.817 1.00 37.74  ? 93  ALA B N   1 
ATOM   2341  C CA  . ALA B  2 97  ? -1.671  24.969  148.035 1.00 36.47  ? 93  ALA B CA  1 
ATOM   2342  C C   . ALA B  2 97  ? -1.723  26.068  149.092 1.00 36.00  ? 93  ALA B C   1 
ATOM   2343  O O   . ALA B  2 97  ? -2.252  27.156  148.868 1.00 33.82  ? 93  ALA B O   1 
ATOM   2344  C CB  . ALA B  2 97  ? -0.219  24.613  147.704 1.00 34.70  ? 93  ALA B CB  1 
ATOM   2345  N N   . LYS B  2 98  ? -1.140  25.765  150.240 1.00 36.72  ? 94  LYS B N   1 
ATOM   2346  C CA  . LYS B  2 98  ? -1.103  26.678  151.357 1.00 39.03  ? 94  LYS B CA  1 
ATOM   2347  C C   . LYS B  2 98  ? 0.282   26.567  151.986 1.00 40.99  ? 94  LYS B C   1 
ATOM   2348  O O   . LYS B  2 98  ? 0.951   25.556  151.814 1.00 41.24  ? 94  LYS B O   1 
ATOM   2349  C CB  . LYS B  2 98  ? -2.219  26.277  152.333 1.00 40.20  ? 94  LYS B CB  1 
ATOM   2350  C CG  . LYS B  2 98  ? -2.091  26.790  153.739 1.00 41.40  ? 94  LYS B CG  1 
ATOM   2351  C CD  . LYS B  2 98  ? -1.176  25.901  154.543 1.00 43.45  ? 94  LYS B CD  1 
ATOM   2352  C CE  . LYS B  2 98  ? -0.888  26.512  155.894 1.00 45.48  ? 94  LYS B CE  1 
ATOM   2353  N NZ  . LYS B  2 98  ? 0.076   25.694  156.674 1.00 46.81  ? 94  LYS B NZ  1 
ATOM   2354  N N   . GLY B  2 99  ? 0.721   27.603  152.698 1.00 43.26  ? 95  GLY B N   1 
ATOM   2355  C CA  . GLY B  2 99  ? 2.038   27.568  153.320 1.00 46.21  ? 95  GLY B CA  1 
ATOM   2356  C C   . GLY B  2 99  ? 2.152   28.206  154.709 1.00 49.36  ? 95  GLY B C   1 
ATOM   2357  O O   . GLY B  2 99  ? 3.232   28.183  155.324 1.00 49.46  ? 95  GLY B O   1 
ATOM   2358  N N   . GLY B  2 100 ? 1.052   28.768  155.213 1.00 49.31  ? 96  GLY B N   1 
ATOM   2359  C CA  . GLY B  2 100 ? 1.065   29.401  156.524 1.00 50.10  ? 96  GLY B CA  1 
ATOM   2360  C C   . GLY B  2 100 ? 1.717   28.582  157.628 1.00 50.57  ? 96  GLY B C   1 
ATOM   2361  O O   . GLY B  2 100 ? 1.777   29.000  158.795 1.00 51.23  ? 96  GLY B O   1 
ATOM   2362  N N   . HIS B  2 114 J 9.959   30.049  152.684 1.00 64.97  ? 100 HIS B N   1 
ATOM   2363  C CA  . HIS B  2 114 J 8.632   29.506  152.402 1.00 66.06  ? 100 HIS B CA  1 
ATOM   2364  C C   . HIS B  2 114 J 8.571   27.998  152.614 1.00 65.30  ? 100 HIS B C   1 
ATOM   2365  O O   . HIS B  2 114 J 9.113   27.473  153.591 1.00 66.14  ? 100 HIS B O   1 
ATOM   2366  C CB  . HIS B  2 114 J 8.231   29.820  150.966 1.00 67.89  ? 100 HIS B CB  1 
ATOM   2367  C CG  . HIS B  2 114 J 7.078   30.772  150.852 1.00 71.60  ? 100 HIS B CG  1 
ATOM   2368  N ND1 . HIS B  2 114 J 5.953   30.682  151.646 1.00 72.75  ? 100 HIS B ND1 1 
ATOM   2369  C CD2 . HIS B  2 114 J 6.845   31.789  149.985 1.00 72.06  ? 100 HIS B CD2 1 
ATOM   2370  C CE1 . HIS B  2 114 J 5.075   31.595  151.269 1.00 73.28  ? 100 HIS B CE1 1 
ATOM   2371  N NE2 . HIS B  2 114 J 5.591   32.279  150.262 1.00 72.76  ? 100 HIS B NE2 1 
ATOM   2372  N N   . GLY B  2 115 K 7.899   27.303  151.701 1.00 63.33  ? 100 GLY B N   1 
ATOM   2373  C CA  . GLY B  2 115 K 7.805   25.863  151.816 1.00 61.26  ? 100 GLY B CA  1 
ATOM   2374  C C   . GLY B  2 115 K 6.636   25.257  151.083 1.00 60.41  ? 100 GLY B C   1 
ATOM   2375  O O   . GLY B  2 115 K 6.826   24.481  150.149 1.00 59.86  ? 100 GLY B O   1 
ATOM   2376  N N   . MET B  2 116 L 5.434   25.627  151.521 1.00 60.50  ? 100 MET B N   1 
ATOM   2377  C CA  . MET B  2 116 L 4.152   25.148  150.984 1.00 60.69  ? 100 MET B CA  1 
ATOM   2378  C C   . MET B  2 116 L 3.754   23.740  151.445 1.00 59.54  ? 100 MET B C   1 
ATOM   2379  O O   . MET B  2 116 L 3.840   22.744  150.716 1.00 57.58  ? 100 MET B O   1 
ATOM   2380  C CB  . MET B  2 116 L 4.124   25.245  149.468 1.00 62.28  ? 100 MET B CB  1 
ATOM   2381  C CG  . MET B  2 116 L 3.238   26.369  149.002 1.00 64.03  ? 100 MET B CG  1 
ATOM   2382  S SD  . MET B  2 116 L 3.214   26.492  147.221 1.00 70.77  ? 100 MET B SD  1 
ATOM   2383  C CE  . MET B  2 116 L 4.429   27.819  146.933 1.00 68.57  ? 100 MET B CE  1 
ATOM   2384  N N   . ASP B  2 117 ? 3.306   23.722  152.695 1.00 58.90  ? 101 ASP B N   1 
ATOM   2385  C CA  . ASP B  2 117 ? 2.859   22.562  153.443 1.00 57.09  ? 101 ASP B CA  1 
ATOM   2386  C C   . ASP B  2 117 ? 1.856   21.687  152.740 1.00 54.65  ? 101 ASP B C   1 
ATOM   2387  O O   . ASP B  2 117 ? 2.203   20.805  151.979 1.00 55.91  ? 101 ASP B O   1 
ATOM   2388  C CB  . ASP B  2 117 ? 2.212   23.027  154.751 1.00 60.33  ? 101 ASP B CB  1 
ATOM   2389  C CG  . ASP B  2 117 ? 2.831   24.298  155.301 1.00 63.84  ? 101 ASP B CG  1 
ATOM   2390  O OD1 . ASP B  2 117 ? 2.803   24.463  156.542 1.00 65.01  ? 101 ASP B OD1 1 
ATOM   2391  O OD2 . ASP B  2 117 ? 3.335   25.132  154.508 1.00 65.24  ? 101 ASP B OD2 1 
ATOM   2392  N N   . VAL B  2 118 ? 0.597   21.970  153.059 1.00 52.83  ? 102 VAL B N   1 
ATOM   2393  C CA  . VAL B  2 118 ? -0.604  21.282  152.601 1.00 49.70  ? 102 VAL B CA  1 
ATOM   2394  C C   . VAL B  2 118 ? -1.085  21.722  151.234 1.00 48.75  ? 102 VAL B C   1 
ATOM   2395  O O   . VAL B  2 118 ? -0.946  22.884  150.851 1.00 48.79  ? 102 VAL B O   1 
ATOM   2396  C CB  . VAL B  2 118 ? -1.745  21.530  153.613 1.00 48.00  ? 102 VAL B CB  1 
ATOM   2397  C CG1 . VAL B  2 118 ? -1.886  23.005  153.845 1.00 47.72  ? 102 VAL B CG1 1 
ATOM   2398  C CG2 . VAL B  2 118 ? -3.053  21.003  153.099 1.00 47.73  ? 102 VAL B CG2 1 
ATOM   2399  N N   . TRP B  2 119 ? -1.674  20.776  150.515 1.00 46.75  ? 103 TRP B N   1 
ATOM   2400  C CA  . TRP B  2 119 ? -2.215  21.035  149.188 1.00 46.26  ? 103 TRP B CA  1 
ATOM   2401  C C   . TRP B  2 119 ? -3.670  20.550  149.113 1.00 47.34  ? 103 TRP B C   1 
ATOM   2402  O O   . TRP B  2 119 ? -4.213  20.043  150.087 1.00 48.65  ? 103 TRP B O   1 
ATOM   2403  C CB  . TRP B  2 119 ? -1.401  20.287  148.129 1.00 43.88  ? 103 TRP B CB  1 
ATOM   2404  C CG  . TRP B  2 119 ? 0.040   20.687  147.997 1.00 39.16  ? 103 TRP B CG  1 
ATOM   2405  C CD1 . TRP B  2 119 ? 0.977   20.720  148.975 1.00 36.32  ? 103 TRP B CD1 1 
ATOM   2406  C CD2 . TRP B  2 119 ? 0.705   21.056  146.788 1.00 37.52  ? 103 TRP B CD2 1 
ATOM   2407  N NE1 . TRP B  2 119 ? 2.188   21.089  148.453 1.00 36.29  ? 103 TRP B NE1 1 
ATOM   2408  C CE2 . TRP B  2 119 ? 2.045   21.300  147.109 1.00 36.54  ? 103 TRP B CE2 1 
ATOM   2409  C CE3 . TRP B  2 119 ? 0.291   21.202  145.460 1.00 36.07  ? 103 TRP B CE3 1 
ATOM   2410  C CZ2 . TRP B  2 119 ? 2.979   21.683  146.154 1.00 38.77  ? 103 TRP B CZ2 1 
ATOM   2411  C CZ3 . TRP B  2 119 ? 1.220   21.585  144.512 1.00 36.88  ? 103 TRP B CZ3 1 
ATOM   2412  C CH2 . TRP B  2 119 ? 2.546   21.820  144.859 1.00 37.43  ? 103 TRP B CH2 1 
ATOM   2413  N N   . GLY B  2 120 ? -4.292  20.703  147.946 1.00 48.05  ? 104 GLY B N   1 
ATOM   2414  C CA  . GLY B  2 120 ? -5.661  20.254  147.766 1.00 46.82  ? 104 GLY B CA  1 
ATOM   2415  C C   . GLY B  2 120 ? -5.700  18.875  147.127 1.00 45.84  ? 104 GLY B C   1 
ATOM   2416  O O   . GLY B  2 120 ? -4.670  18.230  146.968 1.00 45.24  ? 104 GLY B O   1 
ATOM   2417  N N   . GLN B  2 121 ? -6.894  18.422  146.770 1.00 45.39  ? 105 GLN B N   1 
ATOM   2418  C CA  . GLN B  2 121 ? -7.065  17.123  146.134 1.00 44.81  ? 105 GLN B CA  1 
ATOM   2419  C C   . GLN B  2 121 ? -6.849  17.296  144.656 1.00 43.36  ? 105 GLN B C   1 
ATOM   2420  O O   . GLN B  2 121 ? -6.669  16.330  143.933 1.00 42.46  ? 105 GLN B O   1 
ATOM   2421  C CB  . GLN B  2 121 ? -8.484  16.594  146.352 1.00 46.74  ? 105 GLN B CB  1 
ATOM   2422  C CG  . GLN B  2 121 ? -9.577  17.432  145.676 1.00 47.35  ? 105 GLN B CG  1 
ATOM   2423  C CD  . GLN B  2 121 ? -10.413 18.213  146.669 1.00 47.61  ? 105 GLN B CD  1 
ATOM   2424  O OE1 . GLN B  2 121 ? -10.085 18.282  147.860 1.00 48.13  ? 105 GLN B OE1 1 
ATOM   2425  N NE2 . GLN B  2 121 ? -11.496 18.812  146.186 1.00 46.20  ? 105 GLN B NE2 1 
ATOM   2426  N N   . GLY B  2 122 ? -6.912  18.549  144.226 1.00 43.42  ? 106 GLY B N   1 
ATOM   2427  C CA  . GLY B  2 122 ? -6.730  18.898  142.833 1.00 43.80  ? 106 GLY B CA  1 
ATOM   2428  C C   . GLY B  2 122 ? -8.044  19.235  142.168 1.00 44.38  ? 106 GLY B C   1 
ATOM   2429  O O   . GLY B  2 122 ? -9.065  19.241  142.833 1.00 46.74  ? 106 GLY B O   1 
ATOM   2430  N N   . THR B  2 123 ? -8.013  19.510  140.861 1.00 44.37  ? 107 THR B N   1 
ATOM   2431  C CA  . THR B  2 123 ? -9.196  19.841  140.064 1.00 42.61  ? 107 THR B CA  1 
ATOM   2432  C C   . THR B  2 123 ? -8.948  19.502  138.589 1.00 43.20  ? 107 THR B C   1 
ATOM   2433  O O   . THR B  2 123 ? -7.981  19.980  137.992 1.00 42.98  ? 107 THR B O   1 
ATOM   2434  C CB  . THR B  2 123 ? -9.536  21.344  140.146 1.00 42.63  ? 107 THR B CB  1 
ATOM   2435  O OG1 . THR B  2 123 ? -10.226 21.622  141.373 1.00 39.03  ? 107 THR B OG1 1 
ATOM   2436  C CG2 . THR B  2 123 ? -10.393 21.761  138.932 1.00 42.67  ? 107 THR B CG2 1 
ATOM   2437  N N   . THR B  2 124 ? -9.830  18.699  137.998 1.00 42.24  ? 108 THR B N   1 
ATOM   2438  C CA  . THR B  2 124 ? -9.679  18.313  136.598 1.00 40.40  ? 108 THR B CA  1 
ATOM   2439  C C   . THR B  2 124 ? -10.531 19.166  135.661 1.00 40.06  ? 108 THR B C   1 
ATOM   2440  O O   . THR B  2 124 ? -11.744 18.980  135.569 1.00 41.48  ? 108 THR B O   1 
ATOM   2441  C CB  . THR B  2 124 ? -10.055 16.816  136.364 1.00 40.14  ? 108 THR B CB  1 
ATOM   2442  O OG1 . THR B  2 124 ? -9.042  15.970  136.908 1.00 38.16  ? 108 THR B OG1 1 
ATOM   2443  C CG2 . THR B  2 124 ? -10.194 16.517  134.872 1.00 39.53  ? 108 THR B CG2 1 
ATOM   2444  N N   . VAL B  2 125 ? -9.888  20.091  134.957 1.00 38.33  ? 109 VAL B N   1 
ATOM   2445  C CA  . VAL B  2 125 ? -10.573 20.956  134.005 1.00 36.09  ? 109 VAL B CA  1 
ATOM   2446  C C   . VAL B  2 125 ? -10.151 20.604  132.576 1.00 37.50  ? 109 VAL B C   1 
ATOM   2447  O O   . VAL B  2 125 ? -9.074  20.982  132.135 1.00 37.91  ? 109 VAL B O   1 
ATOM   2448  C CB  . VAL B  2 125 ? -10.231 22.413  134.270 1.00 33.95  ? 109 VAL B CB  1 
ATOM   2449  C CG1 . VAL B  2 125 ? -10.863 23.287  133.216 1.00 31.71  ? 109 VAL B CG1 1 
ATOM   2450  C CG2 . VAL B  2 125 ? -10.671 22.797  135.685 1.00 32.75  ? 109 VAL B CG2 1 
ATOM   2451  N N   . THR B  2 126 ? -10.982 19.858  131.858 1.00 37.81  ? 110 THR B N   1 
ATOM   2452  C CA  . THR B  2 126 ? -10.634 19.507  130.495 1.00 39.54  ? 110 THR B CA  1 
ATOM   2453  C C   . THR B  2 126 ? -11.261 20.545  129.608 1.00 39.98  ? 110 THR B C   1 
ATOM   2454  O O   . THR B  2 126 ? -12.432 20.860  129.749 1.00 40.89  ? 110 THR B O   1 
ATOM   2455  C CB  . THR B  2 126 ? -11.189 18.139  130.039 1.00 41.16  ? 110 THR B CB  1 
ATOM   2456  O OG1 . THR B  2 126 ? -10.706 17.090  130.890 1.00 42.35  ? 110 THR B OG1 1 
ATOM   2457  C CG2 . THR B  2 126 ? -10.753 17.867  128.591 1.00 39.72  ? 110 THR B CG2 1 
ATOM   2458  N N   . VAL B  2 127 ? -10.476 21.069  128.687 1.00 39.72  ? 111 VAL B N   1 
ATOM   2459  C CA  . VAL B  2 127 ? -10.954 22.073  127.770 1.00 38.97  ? 111 VAL B CA  1 
ATOM   2460  C C   . VAL B  2 127 ? -10.760 21.444  126.410 1.00 41.82  ? 111 VAL B C   1 
ATOM   2461  O O   . VAL B  2 127 ? -9.679  20.936  126.122 1.00 45.29  ? 111 VAL B O   1 
ATOM   2462  C CB  . VAL B  2 127 ? -10.107 23.338  127.865 1.00 35.79  ? 111 VAL B CB  1 
ATOM   2463  C CG1 . VAL B  2 127 ? -10.804 24.468  127.185 1.00 34.84  ? 111 VAL B CG1 1 
ATOM   2464  C CG2 . VAL B  2 127 ? -9.850  23.670  129.302 1.00 34.77  ? 111 VAL B CG2 1 
ATOM   2465  N N   . ALA B  2 128 ? -11.799 21.456  125.582 1.00 42.70  ? 112 ALA B N   1 
ATOM   2466  C CA  . ALA B  2 128 ? -11.728 20.886  124.239 1.00 42.95  ? 112 ALA B CA  1 
ATOM   2467  C C   . ALA B  2 128 ? -13.109 20.967  123.614 1.00 43.59  ? 112 ALA B C   1 
ATOM   2468  O O   . ALA B  2 128 ? -14.117 20.757  124.294 1.00 44.41  ? 112 ALA B O   1 
ATOM   2469  C CB  . ALA B  2 128 ? -11.261 19.433  124.290 1.00 43.35  ? 112 ALA B CB  1 
ATOM   2470  N N   . SER B  2 129 ? -13.143 21.274  122.320 1.00 42.89  ? 113 SER B N   1 
ATOM   2471  C CA  . SER B  2 129 ? -14.386 21.417  121.581 1.00 41.77  ? 113 SER B CA  1 
ATOM   2472  C C   . SER B  2 129 ? -15.029 20.095  121.211 1.00 41.04  ? 113 SER B C   1 
ATOM   2473  O O   . SER B  2 129 ? -15.274 19.830  120.046 1.00 39.54  ? 113 SER B O   1 
ATOM   2474  C CB  . SER B  2 129 ? -14.150 22.244  120.310 1.00 43.04  ? 113 SER B CB  1 
ATOM   2475  O OG  . SER B  2 129 ? -13.447 21.520  119.312 1.00 45.26  ? 113 SER B OG  1 
ATOM   2476  N N   . ALA B  2 130 ? -15.299 19.268  122.209 1.00 41.43  ? 114 ALA B N   1 
ATOM   2477  C CA  . ALA B  2 130 ? -15.934 17.981  121.986 1.00 43.15  ? 114 ALA B CA  1 
ATOM   2478  C C   . ALA B  2 130 ? -16.898 17.772  123.139 1.00 44.54  ? 114 ALA B C   1 
ATOM   2479  O O   . ALA B  2 130 ? -16.672 18.289  124.235 1.00 44.99  ? 114 ALA B O   1 
ATOM   2480  C CB  . ALA B  2 130 ? -14.893 16.873  121.950 1.00 43.56  ? 114 ALA B CB  1 
ATOM   2481  N N   . SER B  2 131 ? -17.968 17.018  122.898 1.00 45.85  ? 115 SER B N   1 
ATOM   2482  C CA  . SER B  2 131 ? -18.983 16.770  123.933 1.00 45.85  ? 115 SER B CA  1 
ATOM   2483  C C   . SER B  2 131 ? -18.824 15.420  124.609 1.00 43.36  ? 115 SER B C   1 
ATOM   2484  O O   . SER B  2 131 ? -18.223 14.507  124.056 1.00 43.21  ? 115 SER B O   1 
ATOM   2485  C CB  . SER B  2 131 ? -20.393 16.868  123.330 1.00 48.42  ? 115 SER B CB  1 
ATOM   2486  O OG  . SER B  2 131 ? -20.705 18.201  122.940 1.00 51.23  ? 115 SER B OG  1 
ATOM   2487  N N   . THR B  2 132 ? -19.383 15.297  125.805 1.00 40.80  ? 116 THR B N   1 
ATOM   2488  C CA  . THR B  2 132 ? -19.296 14.054  126.554 1.00 39.27  ? 116 THR B CA  1 
ATOM   2489  C C   . THR B  2 132 ? -19.747 12.858  125.724 1.00 39.57  ? 116 THR B C   1 
ATOM   2490  O O   . THR B  2 132 ? -20.554 13.003  124.820 1.00 42.05  ? 116 THR B O   1 
ATOM   2491  C CB  . THR B  2 132 ? -20.125 14.155  127.813 1.00 36.75  ? 116 THR B CB  1 
ATOM   2492  O OG1 . THR B  2 132 ? -19.741 15.341  128.512 1.00 31.48  ? 116 THR B OG1 1 
ATOM   2493  C CG2 . THR B  2 132 ? -19.892 12.954  128.697 1.00 36.62  ? 116 THR B CG2 1 
ATOM   2494  N N   . LYS B  2 133 ? -19.225 11.679  126.024 1.00 38.71  ? 117 LYS B N   1 
ATOM   2495  C CA  . LYS B  2 133 ? -19.580 10.507  125.249 1.00 39.24  ? 117 LYS B CA  1 
ATOM   2496  C C   . LYS B  2 133 ? -19.024 9.197   125.825 1.00 39.66  ? 117 LYS B C   1 
ATOM   2497  O O   . LYS B  2 133 ? -17.818 9.049   126.022 1.00 40.58  ? 117 LYS B O   1 
ATOM   2498  C CB  . LYS B  2 133 ? -19.074 10.681  123.811 1.00 39.27  ? 117 LYS B CB  1 
ATOM   2499  C CG  . LYS B  2 133 ? -19.394 9.499   122.909 1.00 42.25  ? 117 LYS B CG  1 
ATOM   2500  C CD  . LYS B  2 133 ? -18.409 9.348   121.750 1.00 44.66  ? 117 LYS B CD  1 
ATOM   2501  C CE  . LYS B  2 133 ? -18.500 7.925   121.162 1.00 46.68  ? 117 LYS B CE  1 
ATOM   2502  N NZ  . LYS B  2 133 ? -17.544 7.572   120.051 1.00 44.89  ? 117 LYS B NZ  1 
ATOM   2503  N N   . GLY B  2 134 ? -19.905 8.240   126.095 1.00 38.77  ? 118 GLY B N   1 
ATOM   2504  C CA  . GLY B  2 134 ? -19.451 6.964   126.611 1.00 36.73  ? 118 GLY B CA  1 
ATOM   2505  C C   . GLY B  2 134 ? -18.605 6.361   125.515 1.00 36.15  ? 118 GLY B C   1 
ATOM   2506  O O   . GLY B  2 134 ? -18.779 6.727   124.360 1.00 34.00  ? 118 GLY B O   1 
ATOM   2507  N N   . PRO B  2 135 ? -17.668 5.457   125.836 1.00 36.65  ? 119 PRO B N   1 
ATOM   2508  C CA  . PRO B  2 135 ? -16.808 4.833   124.824 1.00 37.65  ? 119 PRO B CA  1 
ATOM   2509  C C   . PRO B  2 135 ? -17.310 3.542   124.196 1.00 38.68  ? 119 PRO B C   1 
ATOM   2510  O O   . PRO B  2 135 ? -18.137 2.837   124.764 1.00 39.71  ? 119 PRO B O   1 
ATOM   2511  C CB  . PRO B  2 135 ? -15.517 4.603   125.586 1.00 36.08  ? 119 PRO B CB  1 
ATOM   2512  C CG  . PRO B  2 135 ? -16.011 4.261   126.921 1.00 35.93  ? 119 PRO B CG  1 
ATOM   2513  C CD  . PRO B  2 135 ? -17.088 5.279   127.176 1.00 36.11  ? 119 PRO B CD  1 
ATOM   2514  N N   . SER B  2 136 ? -16.811 3.237   123.007 1.00 39.56  ? 120 SER B N   1 
ATOM   2515  C CA  . SER B  2 136 ? -17.184 1.988   122.353 1.00 40.88  ? 120 SER B CA  1 
ATOM   2516  C C   . SER B  2 136 ? -16.314 0.941   123.062 1.00 40.86  ? 120 SER B C   1 
ATOM   2517  O O   . SER B  2 136 ? -15.663 1.264   124.048 1.00 40.36  ? 120 SER B O   1 
ATOM   2518  C CB  . SER B  2 136 ? -16.850 2.056   120.868 1.00 41.33  ? 120 SER B CB  1 
ATOM   2519  O OG  . SER B  2 136 ? -17.384 3.236   120.294 1.00 42.73  ? 120 SER B OG  1 
ATOM   2520  N N   . VAL B  2 137 ? -16.295 -0.297  122.589 1.00 40.63  ? 121 VAL B N   1 
ATOM   2521  C CA  . VAL B  2 137 ? -15.487 -1.320  123.240 1.00 41.33  ? 121 VAL B CA  1 
ATOM   2522  C C   . VAL B  2 137 ? -15.248 -2.468  122.275 1.00 43.05  ? 121 VAL B C   1 
ATOM   2523  O O   . VAL B  2 137 ? -16.194 -3.066  121.772 1.00 43.07  ? 121 VAL B O   1 
ATOM   2524  C CB  . VAL B  2 137 ? -16.193 -1.875  124.503 1.00 41.29  ? 121 VAL B CB  1 
ATOM   2525  C CG1 . VAL B  2 137 ? -15.338 -2.967  125.140 1.00 42.71  ? 121 VAL B CG1 1 
ATOM   2526  C CG2 . VAL B  2 137 ? -16.457 -0.755  125.518 1.00 39.95  ? 121 VAL B CG2 1 
ATOM   2527  N N   . PHE B  2 138 ? -13.991 -2.800  122.018 1.00 45.39  ? 122 PHE B N   1 
ATOM   2528  C CA  . PHE B  2 138 ? -13.718 -3.876  121.073 1.00 48.05  ? 122 PHE B CA  1 
ATOM   2529  C C   . PHE B  2 138 ? -12.724 -4.948  121.505 1.00 49.80  ? 122 PHE B C   1 
ATOM   2530  O O   . PHE B  2 138 ? -11.594 -4.658  121.914 1.00 49.91  ? 122 PHE B O   1 
ATOM   2531  C CB  . PHE B  2 138 ? -13.259 -3.282  119.750 1.00 49.66  ? 122 PHE B CB  1 
ATOM   2532  C CG  . PHE B  2 138 ? -14.049 -2.090  119.326 1.00 51.64  ? 122 PHE B CG  1 
ATOM   2533  C CD1 . PHE B  2 138 ? -15.425 -2.181  119.146 1.00 52.30  ? 122 PHE B CD1 1 
ATOM   2534  C CD2 . PHE B  2 138 ? -13.425 -0.872  119.115 1.00 51.97  ? 122 PHE B CD2 1 
ATOM   2535  C CE1 . PHE B  2 138 ? -16.163 -1.083  118.766 1.00 51.26  ? 122 PHE B CE1 1 
ATOM   2536  C CE2 . PHE B  2 138 ? -14.158 0.232   118.734 1.00 52.66  ? 122 PHE B CE2 1 
ATOM   2537  C CZ  . PHE B  2 138 ? -15.531 0.125   118.559 1.00 51.84  ? 122 PHE B CZ  1 
ATOM   2538  N N   . PRO B  2 139 ? -13.130 -6.216  121.373 1.00 51.42  ? 123 PRO B N   1 
ATOM   2539  C CA  . PRO B  2 139 ? -12.354 -7.408  121.721 1.00 52.85  ? 123 PRO B CA  1 
ATOM   2540  C C   . PRO B  2 139 ? -11.036 -7.550  120.951 1.00 53.99  ? 123 PRO B C   1 
ATOM   2541  O O   . PRO B  2 139 ? -11.034 -7.780  119.742 1.00 53.81  ? 123 PRO B O   1 
ATOM   2542  C CB  . PRO B  2 139 ? -13.328 -8.536  121.411 1.00 53.55  ? 123 PRO B CB  1 
ATOM   2543  C CG  . PRO B  2 139 ? -14.072 -7.988  120.222 1.00 53.05  ? 123 PRO B CG  1 
ATOM   2544  C CD  . PRO B  2 139 ? -14.383 -6.597  120.701 1.00 52.23  ? 123 PRO B CD  1 
ATOM   2545  N N   . LEU B  2 140 ? -9.922  -7.425  121.665 1.00 55.28  ? 124 LEU B N   1 
ATOM   2546  C CA  . LEU B  2 140 ? -8.603  -7.536  121.070 1.00 57.66  ? 124 LEU B CA  1 
ATOM   2547  C C   . LEU B  2 140 ? -8.255  -8.999  120.924 1.00 60.03  ? 124 LEU B C   1 
ATOM   2548  O O   . LEU B  2 140 ? -7.130  -9.408  121.159 1.00 59.72  ? 124 LEU B O   1 
ATOM   2549  C CB  . LEU B  2 140 ? -7.586  -6.826  121.957 1.00 57.37  ? 124 LEU B CB  1 
ATOM   2550  C CG  . LEU B  2 140 ? -7.852  -5.320  122.118 1.00 57.79  ? 124 LEU B CG  1 
ATOM   2551  C CD1 . LEU B  2 140 ? -7.088  -4.780  123.302 1.00 57.54  ? 124 LEU B CD1 1 
ATOM   2552  C CD2 . LEU B  2 140 ? -7.457  -4.582  120.850 1.00 57.41  ? 124 LEU B CD2 1 
ATOM   2553  N N   . ALA B  2 141 ? -9.257  -9.773  120.530 1.00 64.09  ? 125 ALA B N   1 
ATOM   2554  C CA  . ALA B  2 141 ? -9.173  -11.223 120.326 1.00 68.14  ? 125 ALA B CA  1 
ATOM   2555  C C   . ALA B  2 141 ? -7.790  -11.863 120.274 1.00 71.32  ? 125 ALA B C   1 
ATOM   2556  O O   . ALA B  2 141 ? -6.874  -11.348 119.630 1.00 72.03  ? 125 ALA B O   1 
ATOM   2557  C CB  . ALA B  2 141 ? -9.933  -11.598 119.073 1.00 67.73  ? 125 ALA B CB  1 
ATOM   2558  N N   . PRO B  2 142 ? -7.635  -13.021 120.942 1.00 74.25  ? 126 PRO B N   1 
ATOM   2559  C CA  . PRO B  2 142 ? -6.392  -13.802 121.019 1.00 76.33  ? 126 PRO B CA  1 
ATOM   2560  C C   . PRO B  2 142 ? -6.263  -14.886 119.928 1.00 77.92  ? 126 PRO B C   1 
ATOM   2561  O O   . PRO B  2 142 ? -7.051  -15.839 119.887 1.00 78.20  ? 126 PRO B O   1 
ATOM   2562  C CB  . PRO B  2 142 ? -6.456  -14.429 122.421 1.00 75.62  ? 126 PRO B CB  1 
ATOM   2563  C CG  . PRO B  2 142 ? -7.641  -13.748 123.102 1.00 75.47  ? 126 PRO B CG  1 
ATOM   2564  C CD  . PRO B  2 142 ? -8.574  -13.478 121.975 1.00 74.59  ? 126 PRO B CD  1 
ATOM   2565  N N   . SER B  2 143 ? -5.275  -14.741 119.051 1.00 79.30  ? 127 SER B N   1 
ATOM   2566  C CA  . SER B  2 143 ? -5.057  -15.726 117.994 1.00 81.36  ? 127 SER B CA  1 
ATOM   2567  C C   . SER B  2 143 ? -3.558  -15.995 117.791 1.00 82.10  ? 127 SER B C   1 
ATOM   2568  O O   . SER B  2 143 ? -2.760  -15.766 118.703 1.00 82.58  ? 127 SER B O   1 
ATOM   2569  C CB  . SER B  2 143 ? -5.724  -15.269 116.683 1.00 82.30  ? 127 SER B CB  1 
ATOM   2570  O OG  . SER B  2 143 ? -5.229  -14.019 116.234 1.00 83.68  ? 127 SER B OG  1 
ATOM   2571  N N   . SER B  2 144 ? -3.174  -16.490 116.615 1.00 82.30  ? 128 SER B N   1 
ATOM   2572  C CA  . SER B  2 144 ? -1.769  -16.792 116.345 1.00 82.43  ? 128 SER B CA  1 
ATOM   2573  C C   . SER B  2 144 ? -0.862  -15.619 116.708 1.00 82.82  ? 128 SER B C   1 
ATOM   2574  O O   . SER B  2 144 ? 0.083   -15.768 117.495 1.00 82.40  ? 128 SER B O   1 
ATOM   2575  C CB  . SER B  2 144 ? -1.582  -17.163 114.869 1.00 82.67  ? 128 SER B CB  1 
ATOM   2576  O OG  . SER B  2 144 ? -1.993  -16.117 114.006 1.00 82.48  ? 128 SER B OG  1 
ATOM   2577  N N   . LYS B  2 145 ? -1.166  -14.459 116.123 1.00 83.16  ? 129 LYS B N   1 
ATOM   2578  C CA  . LYS B  2 145 ? -0.419  -13.220 116.346 1.00 82.90  ? 129 LYS B CA  1 
ATOM   2579  C C   . LYS B  2 145 ? -0.875  -12.623 117.683 1.00 83.38  ? 129 LYS B C   1 
ATOM   2580  O O   . LYS B  2 145 ? -1.434  -11.519 117.740 1.00 83.65  ? 129 LYS B O   1 
ATOM   2581  C CB  . LYS B  2 145 ? -0.711  -12.226 115.218 1.00 81.12  ? 129 LYS B CB  1 
ATOM   2582  C CG  . LYS B  2 145 ? -0.938  -12.856 113.846 1.00 78.59  ? 129 LYS B CG  1 
ATOM   2583  C CD  . LYS B  2 145 ? 0.310   -12.893 112.980 1.00 75.81  ? 129 LYS B CD  1 
ATOM   2584  C CE  . LYS B  2 145 ? 1.375   -13.809 113.518 1.00 74.00  ? 129 LYS B CE  1 
ATOM   2585  N NZ  . LYS B  2 145 ? 2.538   -13.797 112.586 1.00 72.75  ? 129 LYS B NZ  1 
ATOM   2586  N N   . SER B  2 146 ? -0.638  -13.377 118.753 1.00 82.99  ? 130 SER B N   1 
ATOM   2587  C CA  . SER B  2 146 ? -1.028  -12.966 120.092 1.00 82.37  ? 130 SER B CA  1 
ATOM   2588  C C   . SER B  2 146 ? -0.532  -13.994 121.116 1.00 83.08  ? 130 SER B C   1 
ATOM   2589  O O   . SER B  2 146 ? -1.129  -14.158 122.180 1.00 83.06  ? 130 SER B O   1 
ATOM   2590  C CB  . SER B  2 146 ? -2.552  -12.839 120.161 1.00 80.25  ? 130 SER B CB  1 
ATOM   2591  O OG  . SER B  2 146 ? -2.977  -12.550 121.473 1.00 78.24  ? 130 SER B OG  1 
ATOM   2592  N N   . THR B  2 147 ? 0.569   -14.676 120.794 1.00 83.60  ? 131 THR B N   1 
ATOM   2593  C CA  . THR B  2 147 ? 1.130   -15.697 121.683 1.00 83.63  ? 131 THR B CA  1 
ATOM   2594  C C   . THR B  2 147 ? 2.630   -15.939 121.523 1.00 83.34  ? 131 THR B C   1 
ATOM   2595  O O   . THR B  2 147 ? 3.257   -15.484 120.566 1.00 83.42  ? 131 THR B O   1 
ATOM   2596  C CB  . THR B  2 147 ? 0.460   -17.056 121.460 1.00 83.94  ? 131 THR B CB  1 
ATOM   2597  O OG1 . THR B  2 147 ? 0.655   -17.453 120.098 1.00 84.37  ? 131 THR B OG1 1 
ATOM   2598  C CG2 . THR B  2 147 ? -1.022  -16.987 121.755 1.00 84.42  ? 131 THR B CG2 1 
ATOM   2599  N N   . SER B  2 148 ? 3.183   -16.684 122.474 1.00 83.01  ? 132 SER B N   1 
ATOM   2600  C CA  . SER B  2 148 ? 4.598   -17.052 122.484 1.00 82.82  ? 132 SER B CA  1 
ATOM   2601  C C   . SER B  2 148 ? 4.845   -17.947 123.708 1.00 82.29  ? 132 SER B C   1 
ATOM   2602  O O   . SER B  2 148 ? 4.555   -17.564 124.848 1.00 82.58  ? 132 SER B O   1 
ATOM   2603  C CB  . SER B  2 148 ? 5.496   -15.803 122.537 1.00 83.30  ? 132 SER B CB  1 
ATOM   2604  O OG  . SER B  2 148 ? 6.876   -16.149 122.468 1.00 82.39  ? 132 SER B OG  1 
ATOM   2605  N N   . GLY B  2 149 ? 5.379   -19.140 123.462 1.00 80.83  ? 133 GLY B N   1 
ATOM   2606  C CA  . GLY B  2 149 ? 5.627   -20.079 124.539 1.00 78.05  ? 133 GLY B CA  1 
ATOM   2607  C C   . GLY B  2 149 ? 4.284   -20.641 124.949 1.00 76.54  ? 133 GLY B C   1 
ATOM   2608  O O   . GLY B  2 149 ? 3.505   -21.090 124.102 1.00 75.08  ? 133 GLY B O   1 
ATOM   2609  N N   . GLY B  2 150 ? 4.012   -20.615 126.248 1.00 75.37  ? 134 GLY B N   1 
ATOM   2610  C CA  . GLY B  2 150 ? 2.740   -21.099 126.743 1.00 73.95  ? 134 GLY B CA  1 
ATOM   2611  C C   . GLY B  2 150 ? 1.895   -19.919 127.179 1.00 72.95  ? 134 GLY B C   1 
ATOM   2612  O O   . GLY B  2 150 ? 0.993   -20.063 128.000 1.00 73.18  ? 134 GLY B O   1 
ATOM   2613  N N   . THR B  2 151 ? 2.190   -18.743 126.629 1.00 72.38  ? 135 THR B N   1 
ATOM   2614  C CA  . THR B  2 151 ? 1.455   -17.529 126.977 1.00 71.20  ? 135 THR B CA  1 
ATOM   2615  C C   . THR B  2 151 ? 0.829   -16.787 125.810 1.00 69.04  ? 135 THR B C   1 
ATOM   2616  O O   . THR B  2 151 ? 1.511   -16.336 124.892 1.00 67.75  ? 135 THR B O   1 
ATOM   2617  C CB  . THR B  2 151 ? 2.339   -16.516 127.745 1.00 72.43  ? 135 THR B CB  1 
ATOM   2618  O OG1 . THR B  2 151 ? 2.204   -16.726 129.159 1.00 74.09  ? 135 THR B OG1 1 
ATOM   2619  C CG2 . THR B  2 151 ? 1.923   -15.090 127.410 1.00 72.18  ? 135 THR B CG2 1 
ATOM   2620  N N   . ALA B  2 152 ? -0.489  -16.666 125.884 1.00 67.15  ? 136 ALA B N   1 
ATOM   2621  C CA  . ALA B  2 152 ? -1.284  -15.959 124.897 1.00 65.26  ? 136 ALA B CA  1 
ATOM   2622  C C   . ALA B  2 152 ? -1.805  -14.768 125.682 1.00 64.52  ? 136 ALA B C   1 
ATOM   2623  O O   . ALA B  2 152 ? -1.891  -14.843 126.910 1.00 65.55  ? 136 ALA B O   1 
ATOM   2624  C CB  . ALA B  2 152 ? -2.433  -16.824 124.446 1.00 64.28  ? 136 ALA B CB  1 
ATOM   2625  N N   . ALA B  2 153 ? -2.149  -13.677 125.001 1.00 62.87  ? 137 ALA B N   1 
ATOM   2626  C CA  . ALA B  2 153 ? -2.658  -12.490 125.692 1.00 59.85  ? 137 ALA B CA  1 
ATOM   2627  C C   . ALA B  2 153 ? -3.783  -11.782 124.962 1.00 57.75  ? 137 ALA B C   1 
ATOM   2628  O O   . ALA B  2 153 ? -3.622  -11.340 123.838 1.00 56.26  ? 137 ALA B O   1 
ATOM   2629  C CB  . ALA B  2 153 ? -1.528  -11.515 125.932 1.00 60.83  ? 137 ALA B CB  1 
ATOM   2630  N N   . LEU B  2 154 ? -4.931  -11.681 125.605 1.00 56.71  ? 138 LEU B N   1 
ATOM   2631  C CA  . LEU B  2 154 ? -6.043  -10.984 125.002 1.00 57.69  ? 138 LEU B CA  1 
ATOM   2632  C C   . LEU B  2 154 ? -5.967  -9.538  125.490 1.00 59.26  ? 138 LEU B C   1 
ATOM   2633  O O   . LEU B  2 154 ? -4.919  -9.089  125.966 1.00 59.68  ? 138 LEU B O   1 
ATOM   2634  C CB  . LEU B  2 154 ? -7.368  -11.596 125.430 1.00 56.99  ? 138 LEU B CB  1 
ATOM   2635  C CG  . LEU B  2 154 ? -7.603  -11.502 126.931 1.00 58.26  ? 138 LEU B CG  1 
ATOM   2636  C CD1 . LEU B  2 154 ? -9.081  -11.642 127.260 1.00 58.08  ? 138 LEU B CD1 1 
ATOM   2637  C CD2 . LEU B  2 154 ? -6.770  -12.572 127.610 1.00 59.66  ? 138 LEU B CD2 1 
ATOM   2638  N N   . GLY B  2 155 ? -7.080  -8.819  125.375 1.00 60.22  ? 139 GLY B N   1 
ATOM   2639  C CA  . GLY B  2 155 ? -7.129  -7.435  125.803 1.00 60.76  ? 139 GLY B CA  1 
ATOM   2640  C C   . GLY B  2 155 ? -8.389  -6.757  125.305 1.00 61.56  ? 139 GLY B C   1 
ATOM   2641  O O   . GLY B  2 155 ? -9.090  -7.300  124.452 1.00 61.41  ? 139 GLY B O   1 
ATOM   2642  N N   . CYS B  2 156 ? -8.668  -5.567  125.836 1.00 62.14  ? 140 CYS B N   1 
ATOM   2643  C CA  . CYS B  2 156 ? -9.852  -4.785  125.463 1.00 61.54  ? 140 CYS B CA  1 
ATOM   2644  C C   . CYS B  2 156 ? -9.512  -3.374  124.975 1.00 59.55  ? 140 CYS B C   1 
ATOM   2645  O O   . CYS B  2 156 ? -8.907  -2.587  125.706 1.00 59.36  ? 140 CYS B O   1 
ATOM   2646  C CB  . CYS B  2 156 ? -10.817 -4.651  126.656 1.00 63.89  ? 140 CYS B CB  1 
ATOM   2647  S SG  . CYS B  2 156 ? -12.239 -5.801  126.697 1.00 67.95  ? 140 CYS B SG  1 
ATOM   2648  N N   . LEU B  2 157 ? -9.919  -3.057  123.746 1.00 56.64  ? 141 LEU B N   1 
ATOM   2649  C CA  . LEU B  2 157 ? -9.697  -1.732  123.175 1.00 53.00  ? 141 LEU B CA  1 
ATOM   2650  C C   . LEU B  2 157 ? -10.896 -0.798  123.415 1.00 51.22  ? 141 LEU B C   1 
ATOM   2651  O O   . LEU B  2 157 ? -11.920 -0.917  122.751 1.00 50.04  ? 141 LEU B O   1 
ATOM   2652  C CB  . LEU B  2 157 ? -9.434  -1.849  121.672 1.00 51.71  ? 141 LEU B CB  1 
ATOM   2653  C CG  . LEU B  2 157 ? -9.881  -0.635  120.848 1.00 52.19  ? 141 LEU B CG  1 
ATOM   2654  C CD1 . LEU B  2 157 ? -9.283  0.641   121.422 1.00 51.74  ? 141 LEU B CD1 1 
ATOM   2655  C CD2 . LEU B  2 157 ? -9.491  -0.821  119.391 1.00 51.67  ? 141 LEU B CD2 1 
ATOM   2656  N N   . VAL B  2 158 ? -10.772 0.120   124.370 1.00 49.49  ? 142 VAL B N   1 
ATOM   2657  C CA  . VAL B  2 158 ? -11.840 1.075   124.647 1.00 48.58  ? 142 VAL B CA  1 
ATOM   2658  C C   . VAL B  2 158 ? -11.555 2.264   123.733 1.00 48.42  ? 142 VAL B C   1 
ATOM   2659  O O   . VAL B  2 158 ? -10.397 2.617   123.553 1.00 50.32  ? 142 VAL B O   1 
ATOM   2660  C CB  . VAL B  2 158 ? -11.813 1.488   126.118 1.00 48.72  ? 142 VAL B CB  1 
ATOM   2661  C CG1 . VAL B  2 158 ? -12.828 2.587   126.392 1.00 48.02  ? 142 VAL B CG1 1 
ATOM   2662  C CG2 . VAL B  2 158 ? -12.110 0.279   126.968 1.00 48.81  ? 142 VAL B CG2 1 
ATOM   2663  N N   . LYS B  2 159 ? -12.580 2.885   123.151 1.00 47.48  ? 143 LYS B N   1 
ATOM   2664  C CA  . LYS B  2 159 ? -12.322 3.981   122.210 1.00 46.53  ? 143 LYS B CA  1 
ATOM   2665  C C   . LYS B  2 159 ? -13.375 5.090   122.070 1.00 44.85  ? 143 LYS B C   1 
ATOM   2666  O O   . LYS B  2 159 ? -14.572 4.867   122.253 1.00 44.91  ? 143 LYS B O   1 
ATOM   2667  C CB  . LYS B  2 159 ? -12.044 3.384   120.814 1.00 46.86  ? 143 LYS B CB  1 
ATOM   2668  C CG  . LYS B  2 159 ? -11.452 4.360   119.806 1.00 48.95  ? 143 LYS B CG  1 
ATOM   2669  C CD  . LYS B  2 159 ? -11.484 3.800   118.388 1.00 50.24  ? 143 LYS B CD  1 
ATOM   2670  C CE  . LYS B  2 159 ? -10.637 4.639   117.411 1.00 52.27  ? 143 LYS B CE  1 
ATOM   2671  N NZ  . LYS B  2 159 ? -11.078 6.067   117.234 1.00 51.44  ? 143 LYS B NZ  1 
ATOM   2672  N N   . ASP B  2 160 ? -12.893 6.284   121.730 1.00 42.61  ? 144 ASP B N   1 
ATOM   2673  C CA  . ASP B  2 160 ? -13.710 7.471   121.514 1.00 40.52  ? 144 ASP B CA  1 
ATOM   2674  C C   . ASP B  2 160 ? -14.630 7.942   122.636 1.00 38.99  ? 144 ASP B C   1 
ATOM   2675  O O   . ASP B  2 160 ? -15.851 7.942   122.484 1.00 38.06  ? 144 ASP B O   1 
ATOM   2676  C CB  . ASP B  2 160 ? -14.539 7.308   120.241 1.00 41.95  ? 144 ASP B CB  1 
ATOM   2677  C CG  . ASP B  2 160 ? -13.724 7.527   118.974 1.00 44.77  ? 144 ASP B CG  1 
ATOM   2678  O OD1 . ASP B  2 160 ? -13.018 8.553   118.904 1.00 48.21  ? 144 ASP B OD1 1 
ATOM   2679  O OD2 . ASP B  2 160 ? -13.798 6.694   118.039 1.00 44.67  ? 144 ASP B OD2 1 
ATOM   2680  N N   . TYR B  2 161 ? -14.053 8.366   123.753 1.00 36.66  ? 145 TYR B N   1 
ATOM   2681  C CA  . TYR B  2 161 ? -14.864 8.873   124.853 1.00 35.92  ? 145 TYR B CA  1 
ATOM   2682  C C   . TYR B  2 161 ? -14.408 10.268  125.304 1.00 35.09  ? 145 TYR B C   1 
ATOM   2683  O O   . TYR B  2 161 ? -13.399 10.779  124.839 1.00 35.56  ? 145 TYR B O   1 
ATOM   2684  C CB  . TYR B  2 161 ? -14.848 7.875   126.006 1.00 36.47  ? 145 TYR B CB  1 
ATOM   2685  C CG  . TYR B  2 161 ? -13.478 7.419   126.420 1.00 39.46  ? 145 TYR B CG  1 
ATOM   2686  C CD1 . TYR B  2 161 ? -12.770 8.101   127.403 1.00 40.08  ? 145 TYR B CD1 1 
ATOM   2687  C CD2 . TYR B  2 161 ? -12.875 6.307   125.818 1.00 42.08  ? 145 TYR B CD2 1 
ATOM   2688  C CE1 . TYR B  2 161 ? -11.493 7.695   127.786 1.00 42.94  ? 145 TYR B CE1 1 
ATOM   2689  C CE2 . TYR B  2 161 ? -11.595 5.888   126.192 1.00 43.62  ? 145 TYR B CE2 1 
ATOM   2690  C CZ  . TYR B  2 161 ? -10.911 6.591   127.181 1.00 44.26  ? 145 TYR B CZ  1 
ATOM   2691  O OH  . TYR B  2 161 ? -9.653  6.201   127.586 1.00 45.90  ? 145 TYR B OH  1 
ATOM   2692  N N   . PHE B  2 162 ? -15.166 10.897  126.185 1.00 34.40  ? 146 PHE B N   1 
ATOM   2693  C CA  . PHE B  2 162 ? -14.836 12.230  126.672 1.00 33.92  ? 146 PHE B CA  1 
ATOM   2694  C C   . PHE B  2 162 ? -15.760 12.616  127.817 1.00 35.60  ? 146 PHE B C   1 
ATOM   2695  O O   . PHE B  2 162 ? -16.976 12.497  127.712 1.00 35.73  ? 146 PHE B O   1 
ATOM   2696  C CB  . PHE B  2 162 ? -15.004 13.247  125.555 1.00 32.75  ? 146 PHE B CB  1 
ATOM   2697  C CG  . PHE B  2 162 ? -14.763 14.674  125.987 1.00 33.04  ? 146 PHE B CG  1 
ATOM   2698  C CD1 . PHE B  2 162 ? -13.476 15.155  126.176 1.00 32.66  ? 146 PHE B CD1 1 
ATOM   2699  C CD2 . PHE B  2 162 ? -15.823 15.549  126.174 1.00 33.27  ? 146 PHE B CD2 1 
ATOM   2700  C CE1 . PHE B  2 162 ? -13.257 16.477  126.538 1.00 31.77  ? 146 PHE B CE1 1 
ATOM   2701  C CE2 . PHE B  2 162 ? -15.601 16.877  126.539 1.00 30.97  ? 146 PHE B CE2 1 
ATOM   2702  C CZ  . PHE B  2 162 ? -14.323 17.333  126.716 1.00 30.57  ? 146 PHE B CZ  1 
ATOM   2703  N N   . PRO B  2 163 ? -15.198 13.101  128.926 1.00 37.11  ? 147 PRO B N   1 
ATOM   2704  C CA  . PRO B  2 163 ? -13.770 13.296  129.147 1.00 39.57  ? 147 PRO B CA  1 
ATOM   2705  C C   . PRO B  2 163 ? -13.200 12.159  129.994 1.00 41.67  ? 147 PRO B C   1 
ATOM   2706  O O   . PRO B  2 163 ? -13.790 11.080  130.068 1.00 43.05  ? 147 PRO B O   1 
ATOM   2707  C CB  . PRO B  2 163 ? -13.739 14.623  129.880 1.00 38.49  ? 147 PRO B CB  1 
ATOM   2708  C CG  . PRO B  2 163 ? -14.900 14.476  130.789 1.00 36.50  ? 147 PRO B CG  1 
ATOM   2709  C CD  . PRO B  2 163 ? -15.975 13.838  129.936 1.00 36.06  ? 147 PRO B CD  1 
ATOM   2710  N N   . GLU B  2 164 ? -12.054 12.408  130.622 1.00 41.71  ? 148 GLU B N   1 
ATOM   2711  C CA  . GLU B  2 164 ? -11.420 11.426  131.479 1.00 41.78  ? 148 GLU B CA  1 
ATOM   2712  C C   . GLU B  2 164 ? -12.302 11.296  132.714 1.00 40.01  ? 148 GLU B C   1 
ATOM   2713  O O   . GLU B  2 164 ? -12.997 12.235  133.067 1.00 38.29  ? 148 GLU B O   1 
ATOM   2714  C CB  . GLU B  2 164 ? -10.037 11.925  131.882 1.00 45.06  ? 148 GLU B CB  1 
ATOM   2715  C CG  . GLU B  2 164 ? -9.039  11.970  130.740 1.00 50.82  ? 148 GLU B CG  1 
ATOM   2716  C CD  . GLU B  2 164 ? -8.197  10.695  130.634 1.00 54.46  ? 148 GLU B CD  1 
ATOM   2717  O OE1 . GLU B  2 164 ? -8.793  9.591   130.574 1.00 57.88  ? 148 GLU B OE1 1 
ATOM   2718  O OE2 . GLU B  2 164 ? -6.941  10.801  130.608 1.00 54.52  ? 148 GLU B OE2 1 
ATOM   2719  N N   . PRO B  2 165 ? -12.268 10.139  133.400 1.00 39.44  ? 149 PRO B N   1 
ATOM   2720  C CA  . PRO B  2 165 ? -11.482 8.935   133.132 1.00 39.49  ? 149 PRO B CA  1 
ATOM   2721  C C   . PRO B  2 165 ? -12.414 7.733   132.925 1.00 40.07  ? 149 PRO B C   1 
ATOM   2722  O O   . PRO B  2 165 ? -13.630 7.872   132.970 1.00 40.31  ? 149 PRO B O   1 
ATOM   2723  C CB  . PRO B  2 165 ? -10.694 8.798   134.412 1.00 37.45  ? 149 PRO B CB  1 
ATOM   2724  C CG  . PRO B  2 165 ? -11.777 9.035   135.429 1.00 38.20  ? 149 PRO B CG  1 
ATOM   2725  C CD  . PRO B  2 165 ? -12.698 10.118  134.808 1.00 39.11  ? 149 PRO B CD  1 
ATOM   2726  N N   . VAL B  2 166 ? -11.838 6.552   132.739 1.00 41.20  ? 150 VAL B N   1 
ATOM   2727  C CA  . VAL B  2 166 ? -12.627 5.344   132.542 1.00 41.71  ? 150 VAL B CA  1 
ATOM   2728  C C   . VAL B  2 166 ? -11.970 4.166   133.248 1.00 42.88  ? 150 VAL B C   1 
ATOM   2729  O O   . VAL B  2 166 ? -10.816 3.861   133.004 1.00 42.16  ? 150 VAL B O   1 
ATOM   2730  C CB  . VAL B  2 166 ? -12.751 5.019   131.046 1.00 40.63  ? 150 VAL B CB  1 
ATOM   2731  C CG1 . VAL B  2 166 ? -11.434 4.495   130.508 1.00 39.24  ? 150 VAL B CG1 1 
ATOM   2732  C CG2 . VAL B  2 166 ? -13.852 4.019   130.825 1.00 41.83  ? 150 VAL B CG2 1 
ATOM   2733  N N   . THR B  2 167 ? -12.695 3.493   134.125 1.00 45.51  ? 151 THR B N   1 
ATOM   2734  C CA  . THR B  2 167 ? -12.095 2.357   134.815 1.00 49.60  ? 151 THR B CA  1 
ATOM   2735  C C   . THR B  2 167 ? -12.257 1.072   134.009 1.00 51.97  ? 151 THR B C   1 
ATOM   2736  O O   . THR B  2 167 ? -13.109 0.993   133.130 1.00 52.91  ? 151 THR B O   1 
ATOM   2737  C CB  . THR B  2 167 ? -12.734 2.122   136.160 1.00 49.31  ? 151 THR B CB  1 
ATOM   2738  O OG1 . THR B  2 167 ? -13.939 1.372   135.965 1.00 50.67  ? 151 THR B OG1 1 
ATOM   2739  C CG2 . THR B  2 167 ? -13.041 3.450   136.845 1.00 47.24  ? 151 THR B CG2 1 
ATOM   2740  N N   . VAL B  2 168 ? -11.455 0.061   134.338 1.00 54.73  ? 152 VAL B N   1 
ATOM   2741  C CA  . VAL B  2 168 ? -11.488 -1.223  133.633 1.00 57.07  ? 152 VAL B CA  1 
ATOM   2742  C C   . VAL B  2 168 ? -11.095 -2.414  134.514 1.00 59.13  ? 152 VAL B C   1 
ATOM   2743  O O   . VAL B  2 168 ? -9.909  -2.645  134.769 1.00 58.81  ? 152 VAL B O   1 
ATOM   2744  C CB  . VAL B  2 168 ? -10.529 -1.207  132.408 1.00 56.45  ? 152 VAL B CB  1 
ATOM   2745  C CG1 . VAL B  2 168 ? -10.604 -2.532  131.649 1.00 55.76  ? 152 VAL B CG1 1 
ATOM   2746  C CG2 . VAL B  2 168 ? -10.871 -0.041  131.498 1.00 55.42  ? 152 VAL B CG2 1 
ATOM   2747  N N   . SER B  2 169 ? -12.089 -3.170  134.972 1.00 61.82  ? 153 SER B N   1 
ATOM   2748  C CA  . SER B  2 169 ? -11.829 -4.349  135.799 1.00 64.59  ? 153 SER B CA  1 
ATOM   2749  C C   . SER B  2 169 ? -12.202 -5.609  135.009 1.00 66.06  ? 153 SER B C   1 
ATOM   2750  O O   . SER B  2 169 ? -13.234 -5.640  134.336 1.00 66.01  ? 153 SER B O   1 
ATOM   2751  C CB  . SER B  2 169 ? -12.640 -4.293  137.112 1.00 64.32  ? 153 SER B CB  1 
ATOM   2752  O OG  . SER B  2 169 ? -14.025 -4.513  136.896 1.00 65.50  ? 153 SER B OG  1 
ATOM   2753  N N   . TRP B  2 170 ? -11.357 -6.639  135.067 1.00 67.57  ? 154 TRP B N   1 
ATOM   2754  C CA  . TRP B  2 170 ? -11.660 -7.888  134.362 1.00 68.35  ? 154 TRP B CA  1 
ATOM   2755  C C   . TRP B  2 170 ? -12.433 -8.895  135.230 1.00 67.44  ? 154 TRP B C   1 
ATOM   2756  O O   . TRP B  2 170 ? -12.348 -8.890  136.466 1.00 66.02  ? 154 TRP B O   1 
ATOM   2757  C CB  . TRP B  2 170 ? -10.386 -8.550  133.815 1.00 69.69  ? 154 TRP B CB  1 
ATOM   2758  C CG  . TRP B  2 170 ? -9.813  -7.882  132.600 1.00 71.19  ? 154 TRP B CG  1 
ATOM   2759  C CD1 . TRP B  2 170 ? -8.934  -6.836  132.577 1.00 72.72  ? 154 TRP B CD1 1 
ATOM   2760  C CD2 . TRP B  2 170 ? -10.065 -8.225  131.228 1.00 71.87  ? 154 TRP B CD2 1 
ATOM   2761  N NE1 . TRP B  2 170 ? -8.615  -6.511  131.275 1.00 73.64  ? 154 TRP B NE1 1 
ATOM   2762  C CE2 . TRP B  2 170 ? -9.295  -7.347  130.428 1.00 72.50  ? 154 TRP B CE2 1 
ATOM   2763  C CE3 . TRP B  2 170 ? -10.865 -9.188  130.597 1.00 71.68  ? 154 TRP B CE3 1 
ATOM   2764  C CZ2 . TRP B  2 170 ? -9.302  -7.405  129.027 1.00 71.61  ? 154 TRP B CZ2 1 
ATOM   2765  C CZ3 . TRP B  2 170 ? -10.870 -9.245  129.202 1.00 71.08  ? 154 TRP B CZ3 1 
ATOM   2766  C CH2 . TRP B  2 170 ? -10.091 -8.358  128.435 1.00 71.13  ? 154 TRP B CH2 1 
ATOM   2767  N N   . ASN B  2 171 ? -13.181 -9.764  134.557 1.00 66.94  ? 155 ASN B N   1 
ATOM   2768  C CA  . ASN B  2 171 ? -13.999 -10.755 135.226 1.00 66.68  ? 155 ASN B CA  1 
ATOM   2769  C C   . ASN B  2 171 ? -14.508 -10.174 136.531 1.00 66.70  ? 155 ASN B C   1 
ATOM   2770  O O   . ASN B  2 171 ? -14.497 -10.823 137.574 1.00 67.36  ? 155 ASN B O   1 
ATOM   2771  C CB  . ASN B  2 171 ? -13.208 -12.041 135.445 1.00 66.32  ? 155 ASN B CB  1 
ATOM   2772  C CG  . ASN B  2 171 ? -13.020 -12.812 134.159 1.00 66.82  ? 155 ASN B CG  1 
ATOM   2773  O OD1 . ASN B  2 171 ? -13.958 -12.953 133.377 1.00 67.01  ? 155 ASN B OD1 1 
ATOM   2774  N ND2 . ASN B  2 171 ? -11.812 -13.318 133.929 1.00 67.84  ? 155 ASN B ND2 1 
ATOM   2775  N N   . SER B  2 172 ? -14.940 -8.919  136.442 1.00 66.20  ? 156 SER B N   1 
ATOM   2776  C CA  . SER B  2 172 ? -15.499 -8.178  137.561 1.00 64.81  ? 156 SER B CA  1 
ATOM   2777  C C   . SER B  2 172 ? -14.640 -8.245  138.808 1.00 63.74  ? 156 SER B C   1 
ATOM   2778  O O   . SER B  2 172 ? -15.110 -8.623  139.874 1.00 62.83  ? 156 SER B O   1 
ATOM   2779  C CB  . SER B  2 172 ? -16.908 -8.700  137.862 1.00 65.43  ? 156 SER B CB  1 
ATOM   2780  O OG  . SER B  2 172 ? -17.598 -7.837  138.744 1.00 65.28  ? 156 SER B OG  1 
ATOM   2781  N N   . GLY B  2 173 ? -13.372 -7.888  138.671 1.00 63.88  ? 157 GLY B N   1 
ATOM   2782  C CA  . GLY B  2 173 ? -12.491 -7.901  139.825 1.00 64.06  ? 157 GLY B CA  1 
ATOM   2783  C C   . GLY B  2 173 ? -11.665 -9.152  140.024 1.00 63.74  ? 157 GLY B C   1 
ATOM   2784  O O   . GLY B  2 173 ? -10.574 -9.086  140.572 1.00 63.41  ? 157 GLY B O   1 
ATOM   2785  N N   . ALA B  2 174 ? -12.176 -10.293 139.581 1.00 64.51  ? 158 ALA B N   1 
ATOM   2786  C CA  . ALA B  2 174 ? -11.458 -11.556 139.728 1.00 64.81  ? 158 ALA B CA  1 
ATOM   2787  C C   . ALA B  2 174 ? -10.035 -11.497 139.176 1.00 65.11  ? 158 ALA B C   1 
ATOM   2788  O O   . ALA B  2 174 ? -9.066  -11.483 139.944 1.00 65.19  ? 158 ALA B O   1 
ATOM   2789  C CB  . ALA B  2 174 ? -12.226 -12.666 139.044 1.00 65.86  ? 158 ALA B CB  1 
ATOM   2790  N N   . LEU B  2 175 ? -9.913  -11.471 137.847 1.00 64.65  ? 159 LEU B N   1 
ATOM   2791  C CA  . LEU B  2 175 ? -8.604  -11.417 137.198 1.00 64.22  ? 159 LEU B CA  1 
ATOM   2792  C C   . LEU B  2 175 ? -7.803  -10.258 137.765 1.00 64.66  ? 159 LEU B C   1 
ATOM   2793  O O   . LEU B  2 175 ? -8.281  -9.126  137.819 1.00 64.41  ? 159 LEU B O   1 
ATOM   2794  C CB  . LEU B  2 175 ? -8.756  -11.252 135.692 1.00 62.93  ? 159 LEU B CB  1 
ATOM   2795  C CG  . LEU B  2 175 ? -7.452  -11.074 134.913 1.00 62.87  ? 159 LEU B CG  1 
ATOM   2796  C CD1 . LEU B  2 175 ? -6.502  -12.207 135.230 1.00 62.35  ? 159 LEU B CD1 1 
ATOM   2797  C CD2 . LEU B  2 175 ? -7.752  -11.015 133.417 1.00 63.35  ? 159 LEU B CD2 1 
ATOM   2798  N N   . THR B  2 176 ? -6.577  -10.538 138.184 1.00 65.20  ? 160 THR B N   1 
ATOM   2799  C CA  . THR B  2 176 ? -5.759  -9.501  138.783 1.00 65.43  ? 160 THR B CA  1 
ATOM   2800  C C   . THR B  2 176 ? -4.325  -9.459  138.268 1.00 64.52  ? 160 THR B C   1 
ATOM   2801  O O   . THR B  2 176 ? -3.726  -8.386  138.152 1.00 63.74  ? 160 THR B O   1 
ATOM   2802  C CB  . THR B  2 176 ? -5.745  -9.667  140.330 1.00 66.17  ? 160 THR B CB  1 
ATOM   2803  O OG1 . THR B  2 176 ? -5.438  -11.029 140.672 1.00 65.68  ? 160 THR B OG1 1 
ATOM   2804  C CG2 . THR B  2 176 ? -7.106  -9.310  140.911 1.00 65.80  ? 160 THR B CG2 1 
ATOM   2805  N N   . SER B  2 177 ? -3.787  -10.630 137.953 1.00 63.47  ? 161 SER B N   1 
ATOM   2806  C CA  . SER B  2 177 ? -2.415  -10.734 137.484 1.00 63.55  ? 161 SER B CA  1 
ATOM   2807  C C   . SER B  2 177 ? -2.251  -10.465 135.989 1.00 62.59  ? 161 SER B C   1 
ATOM   2808  O O   . SER B  2 177 ? -3.158  -10.741 135.200 1.00 62.31  ? 161 SER B O   1 
ATOM   2809  C CB  . SER B  2 177 ? -1.863  -12.127 137.826 1.00 64.98  ? 161 SER B CB  1 
ATOM   2810  O OG  . SER B  2 177 ? -0.562  -12.332 137.290 1.00 66.00  ? 161 SER B OG  1 
ATOM   2811  N N   . GLY B  2 178 ? -1.088  -9.914  135.626 1.00 61.09  ? 162 GLY B N   1 
ATOM   2812  C CA  . GLY B  2 178 ? -0.756  -9.618  134.238 1.00 59.73  ? 162 GLY B CA  1 
ATOM   2813  C C   . GLY B  2 178 ? -1.760  -8.841  133.411 1.00 58.49  ? 162 GLY B C   1 
ATOM   2814  O O   . GLY B  2 178 ? -2.033  -9.190  132.259 1.00 57.72  ? 162 GLY B O   1 
ATOM   2815  N N   . VAL B  2 179 ? -2.303  -7.780  133.997 1.00 57.35  ? 163 VAL B N   1 
ATOM   2816  C CA  . VAL B  2 179 ? -3.287  -6.944  133.329 1.00 56.14  ? 163 VAL B CA  1 
ATOM   2817  C C   . VAL B  2 179 ? -2.783  -5.520  133.295 1.00 55.59  ? 163 VAL B C   1 
ATOM   2818  O O   . VAL B  2 179 ? -2.782  -4.834  134.320 1.00 56.05  ? 163 VAL B O   1 
ATOM   2819  C CB  . VAL B  2 179 ? -4.635  -6.973  134.071 1.00 56.03  ? 163 VAL B CB  1 
ATOM   2820  C CG1 . VAL B  2 179 ? -5.571  -5.895  133.519 1.00 56.98  ? 163 VAL B CG1 1 
ATOM   2821  C CG2 . VAL B  2 179 ? -5.266  -8.338  133.913 1.00 55.36  ? 163 VAL B CG2 1 
ATOM   2822  N N   . HIS B  2 180 ? -2.367  -5.079  132.112 1.00 54.03  ? 164 HIS B N   1 
ATOM   2823  C CA  . HIS B  2 180 ? -1.845  -3.731  131.937 1.00 52.91  ? 164 HIS B CA  1 
ATOM   2824  C C   . HIS B  2 180 ? -2.859  -2.716  131.424 1.00 51.61  ? 164 HIS B C   1 
ATOM   2825  O O   . HIS B  2 180 ? -3.136  -2.676  130.220 1.00 51.58  ? 164 HIS B O   1 
ATOM   2826  C CB  . HIS B  2 180 ? -0.645  -3.770  130.989 1.00 54.06  ? 164 HIS B CB  1 
ATOM   2827  C CG  . HIS B  2 180 ? 0.641   -4.111  131.671 1.00 55.65  ? 164 HIS B CG  1 
ATOM   2828  N ND1 . HIS B  2 180 ? 0.869   -5.337  132.258 1.00 56.25  ? 164 HIS B ND1 1 
ATOM   2829  C CD2 . HIS B  2 180 ? 1.733   -3.357  131.940 1.00 56.94  ? 164 HIS B CD2 1 
ATOM   2830  C CE1 . HIS B  2 180 ? 2.043   -5.319  132.865 1.00 57.12  ? 164 HIS B CE1 1 
ATOM   2831  N NE2 . HIS B  2 180 ? 2.588   -4.129  132.689 1.00 56.58  ? 164 HIS B NE2 1 
ATOM   2832  N N   . THR B  2 181 ? -3.407  -1.886  132.316 1.00 48.58  ? 165 THR B N   1 
ATOM   2833  C CA  . THR B  2 181 ? -4.373  -0.890  131.855 1.00 45.04  ? 165 THR B CA  1 
ATOM   2834  C C   . THR B  2 181 ? -3.660  0.385   131.459 1.00 43.77  ? 165 THR B C   1 
ATOM   2835  O O   . THR B  2 181 ? -3.447  1.270   132.287 1.00 42.80  ? 165 THR B O   1 
ATOM   2836  C CB  . THR B  2 181 ? -5.389  -0.514  132.900 1.00 43.73  ? 165 THR B CB  1 
ATOM   2837  O OG1 . THR B  2 181 ? -5.812  -1.677  133.616 1.00 46.04  ? 165 THR B OG1 1 
ATOM   2838  C CG2 . THR B  2 181 ? -6.580  0.090   132.214 1.00 41.92  ? 165 THR B CG2 1 
ATOM   2839  N N   . PHE B  2 182 ? -3.311  0.473   130.178 1.00 41.31  ? 166 PHE B N   1 
ATOM   2840  C CA  . PHE B  2 182 ? -2.597  1.621   129.653 1.00 39.05  ? 166 PHE B CA  1 
ATOM   2841  C C   . PHE B  2 182 ? -3.178  3.002   129.970 1.00 38.87  ? 166 PHE B C   1 
ATOM   2842  O O   . PHE B  2 182 ? -4.359  3.160   130.315 1.00 37.48  ? 166 PHE B O   1 
ATOM   2843  C CB  . PHE B  2 182 ? -2.424  1.474   128.150 1.00 36.92  ? 166 PHE B CB  1 
ATOM   2844  C CG  . PHE B  2 182 ? -1.486  0.387   127.763 1.00 35.52  ? 166 PHE B CG  1 
ATOM   2845  C CD1 . PHE B  2 182 ? -1.954  -0.867  127.424 1.00 33.82  ? 166 PHE B CD1 1 
ATOM   2846  C CD2 . PHE B  2 182 ? -0.116  0.610   127.755 1.00 35.99  ? 166 PHE B CD2 1 
ATOM   2847  C CE1 . PHE B  2 182 ? -1.067  -1.889  127.077 1.00 33.78  ? 166 PHE B CE1 1 
ATOM   2848  C CE2 . PHE B  2 182 ? 0.777   -0.414  127.408 1.00 35.37  ? 166 PHE B CE2 1 
ATOM   2849  C CZ  . PHE B  2 182 ? 0.299   -1.660  127.070 1.00 33.17  ? 166 PHE B CZ  1 
ATOM   2850  N N   . PRO B  2 183 ? -2.330  4.033   129.867 1.00 38.29  ? 167 PRO B N   1 
ATOM   2851  C CA  . PRO B  2 183 ? -2.791  5.392   130.148 1.00 37.13  ? 167 PRO B CA  1 
ATOM   2852  C C   . PRO B  2 183 ? -3.667  5.799   128.987 1.00 35.91  ? 167 PRO B C   1 
ATOM   2853  O O   . PRO B  2 183 ? -3.590  5.192   127.925 1.00 34.73  ? 167 PRO B O   1 
ATOM   2854  C CB  . PRO B  2 183 ? -1.496  6.200   130.213 1.00 37.40  ? 167 PRO B CB  1 
ATOM   2855  C CG  . PRO B  2 183 ? -0.422  5.145   130.479 1.00 37.90  ? 167 PRO B CG  1 
ATOM   2856  C CD  . PRO B  2 183 ? -0.878  3.997   129.635 1.00 37.07  ? 167 PRO B CD  1 
ATOM   2857  N N   . ALA B  2 184 ? -4.506  6.810   129.186 1.00 36.15  ? 168 ALA B N   1 
ATOM   2858  C CA  . ALA B  2 184 ? -5.392  7.261   128.120 1.00 35.47  ? 168 ALA B CA  1 
ATOM   2859  C C   . ALA B  2 184 ? -4.589  7.965   127.039 1.00 35.11  ? 168 ALA B C   1 
ATOM   2860  O O   . ALA B  2 184 ? -3.414  8.278   127.222 1.00 35.24  ? 168 ALA B O   1 
ATOM   2861  C CB  . ALA B  2 184 ? -6.452  8.183   128.672 1.00 35.25  ? 168 ALA B CB  1 
ATOM   2862  N N   . VAL B  2 185 ? -5.223  8.200   125.903 1.00 34.39  ? 169 VAL B N   1 
ATOM   2863  C CA  . VAL B  2 185 ? -4.557  8.857   124.802 1.00 33.32  ? 169 VAL B CA  1 
ATOM   2864  C C   . VAL B  2 185 ? -5.504  9.905   124.237 1.00 33.76  ? 169 VAL B C   1 
ATOM   2865  O O   . VAL B  2 185 ? -6.671  9.633   124.006 1.00 34.20  ? 169 VAL B O   1 
ATOM   2866  C CB  . VAL B  2 185 ? -4.166  7.826   123.716 1.00 32.25  ? 169 VAL B CB  1 
ATOM   2867  C CG1 . VAL B  2 185 ? -5.051  7.959   122.500 1.00 31.35  ? 169 VAL B CG1 1 
ATOM   2868  C CG2 . VAL B  2 185 ? -2.715  8.002   123.342 1.00 33.02  ? 169 VAL B CG2 1 
ATOM   2869  N N   . LEU B  2 186 ? -4.999  11.112  124.045 1.00 33.90  ? 170 LEU B N   1 
ATOM   2870  C CA  . LEU B  2 186 ? -5.797  12.190  123.504 1.00 33.92  ? 170 LEU B CA  1 
ATOM   2871  C C   . LEU B  2 186 ? -5.738  12.092  121.986 1.00 34.77  ? 170 LEU B C   1 
ATOM   2872  O O   . LEU B  2 186 ? -4.677  11.912  121.417 1.00 36.44  ? 170 LEU B O   1 
ATOM   2873  C CB  . LEU B  2 186 ? -5.232  13.524  124.000 1.00 33.06  ? 170 LEU B CB  1 
ATOM   2874  C CG  . LEU B  2 186 ? -6.115  14.765  123.960 1.00 32.46  ? 170 LEU B CG  1 
ATOM   2875  C CD1 . LEU B  2 186 ? -7.563  14.365  124.048 1.00 34.75  ? 170 LEU B CD1 1 
ATOM   2876  C CD2 . LEU B  2 186 ? -5.768  15.667  125.126 1.00 33.48  ? 170 LEU B CD2 1 
ATOM   2877  N N   . GLN B  2 187 ? -6.878  12.191  121.319 1.00 38.23  ? 171 GLN B N   1 
ATOM   2878  C CA  . GLN B  2 187 ? -6.907  12.106  119.855 1.00 39.97  ? 171 GLN B CA  1 
ATOM   2879  C C   . GLN B  2 187 ? -7.171  13.458  119.187 1.00 40.86  ? 171 GLN B C   1 
ATOM   2880  O O   . GLN B  2 187 ? -7.690  14.396  119.798 1.00 39.33  ? 171 GLN B O   1 
ATOM   2881  C CB  . GLN B  2 187 ? -7.969  11.093  119.404 1.00 40.70  ? 171 GLN B CB  1 
ATOM   2882  C CG  . GLN B  2 187 ? -7.615  9.615   119.680 1.00 44.75  ? 171 GLN B CG  1 
ATOM   2883  C CD  . GLN B  2 187 ? -8.785  8.645   119.437 1.00 48.45  ? 171 GLN B CD  1 
ATOM   2884  O OE1 . GLN B  2 187 ? -8.921  8.039   118.361 1.00 48.95  ? 171 GLN B OE1 1 
ATOM   2885  N NE2 . GLN B  2 187 ? -9.644  8.508   120.444 1.00 50.40  ? 171 GLN B NE2 1 
ATOM   2886  N N   . SER B  2 188 ? -6.779  13.563  117.925 1.00 43.25  ? 172 SER B N   1 
ATOM   2887  C CA  . SER B  2 188 ? -7.009  14.788  117.168 1.00 45.70  ? 172 SER B CA  1 
ATOM   2888  C C   . SER B  2 188 ? -8.497  15.086  117.322 1.00 47.23  ? 172 SER B C   1 
ATOM   2889  O O   . SER B  2 188 ? -8.894  16.204  117.664 1.00 48.62  ? 172 SER B O   1 
ATOM   2890  C CB  . SER B  2 188 ? -6.690  14.552  115.701 1.00 45.16  ? 172 SER B CB  1 
ATOM   2891  O OG  . SER B  2 188 ? -7.556  13.558  115.166 1.00 46.03  ? 172 SER B OG  1 
ATOM   2892  N N   . SER B  2 189 ? -9.296  14.046  117.074 1.00 47.38  ? 173 SER B N   1 
ATOM   2893  C CA  . SER B  2 189 ? -10.753 14.068  117.162 1.00 46.08  ? 173 SER B CA  1 
ATOM   2894  C C   . SER B  2 189 ? -11.255 14.840  118.385 1.00 44.64  ? 173 SER B C   1 
ATOM   2895  O O   . SER B  2 189 ? -12.224 15.593  118.299 1.00 45.83  ? 173 SER B O   1 
ATOM   2896  C CB  . SER B  2 189 ? -11.270 12.625  117.208 1.00 47.22  ? 173 SER B CB  1 
ATOM   2897  O OG  . SER B  2 189 ? -10.613 11.812  116.240 1.00 47.82  ? 173 SER B OG  1 
ATOM   2898  N N   . GLY B  2 190 ? -10.593 14.654  119.520 1.00 42.18  ? 174 GLY B N   1 
ATOM   2899  C CA  . GLY B  2 190 ? -10.991 15.359  120.730 1.00 40.20  ? 174 GLY B CA  1 
ATOM   2900  C C   . GLY B  2 190 ? -11.151 14.400  121.886 1.00 37.66  ? 174 GLY B C   1 
ATOM   2901  O O   . GLY B  2 190 ? -10.839 14.701  123.045 1.00 35.83  ? 174 GLY B O   1 
ATOM   2902  N N   . LEU B  2 191 ? -11.623 13.213  121.531 1.00 36.15  ? 175 LEU B N   1 
ATOM   2903  C CA  . LEU B  2 191 ? -11.873 12.143  122.478 1.00 34.20  ? 175 LEU B CA  1 
ATOM   2904  C C   . LEU B  2 191 ? -10.612 11.323  122.731 1.00 33.77  ? 175 LEU B C   1 
ATOM   2905  O O   . LEU B  2 191 ? -9.729  11.244  121.879 1.00 31.69  ? 175 LEU B O   1 
ATOM   2906  C CB  . LEU B  2 191 ? -12.969 11.243  121.924 1.00 32.13  ? 175 LEU B CB  1 
ATOM   2907  C CG  . LEU B  2 191 ? -14.093 12.033  121.267 1.00 30.67  ? 175 LEU B CG  1 
ATOM   2908  C CD1 . LEU B  2 191 ? -14.740 11.218  120.163 1.00 29.30  ? 175 LEU B CD1 1 
ATOM   2909  C CD2 . LEU B  2 191 ? -15.080 12.445  122.330 1.00 30.58  ? 175 LEU B CD2 1 
ATOM   2910  N N   . TYR B  2 192 ? -10.560 10.706  123.909 1.00 33.29  ? 176 TYR B N   1 
ATOM   2911  C CA  . TYR B  2 192 ? -9.442  9.878   124.324 1.00 31.31  ? 176 TYR B CA  1 
ATOM   2912  C C   . TYR B  2 192 ? -9.697  8.429   123.979 1.00 30.69  ? 176 TYR B C   1 
ATOM   2913  O O   . TYR B  2 192 ? -10.743 8.088   123.439 1.00 32.10  ? 176 TYR B O   1 
ATOM   2914  C CB  . TYR B  2 192 ? -9.258  10.016  125.817 1.00 32.14  ? 176 TYR B CB  1 
ATOM   2915  C CG  . TYR B  2 192 ? -9.162  11.451  126.262 1.00 33.62  ? 176 TYR B CG  1 
ATOM   2916  C CD1 . TYR B  2 192 ? -7.934  12.020  126.602 1.00 33.11  ? 176 TYR B CD1 1 
ATOM   2917  C CD2 . TYR B  2 192 ? -10.298 12.245  126.341 1.00 34.02  ? 176 TYR B CD2 1 
ATOM   2918  C CE1 . TYR B  2 192 ? -7.842  13.350  127.015 1.00 33.83  ? 176 TYR B CE1 1 
ATOM   2919  C CE2 . TYR B  2 192 ? -10.216 13.574  126.751 1.00 35.79  ? 176 TYR B CE2 1 
ATOM   2920  C CZ  . TYR B  2 192 ? -8.986  14.118  127.087 1.00 34.56  ? 176 TYR B CZ  1 
ATOM   2921  O OH  . TYR B  2 192 ? -8.921  15.420  127.499 1.00 34.57  ? 176 TYR B OH  1 
ATOM   2922  N N   . SER B  2 193 ? -8.740  7.573   124.299 1.00 30.75  ? 177 SER B N   1 
ATOM   2923  C CA  . SER B  2 193 ? -8.863  6.148   124.019 1.00 32.36  ? 177 SER B CA  1 
ATOM   2924  C C   . SER B  2 193 ? -7.708  5.394   124.684 1.00 34.75  ? 177 SER B C   1 
ATOM   2925  O O   . SER B  2 193 ? -6.598  5.915   124.785 1.00 36.11  ? 177 SER B O   1 
ATOM   2926  C CB  . SER B  2 193 ? -8.826  5.922   122.502 1.00 30.12  ? 177 SER B CB  1 
ATOM   2927  O OG  . SER B  2 193 ? -9.294  4.644   122.117 1.00 27.85  ? 177 SER B OG  1 
ATOM   2928  N N   . LEU B  2 194 ? -7.979  4.188   125.174 1.00 36.26  ? 178 LEU B N   1 
ATOM   2929  C CA  . LEU B  2 194 ? -6.945  3.350   125.776 1.00 37.15  ? 178 LEU B CA  1 
ATOM   2930  C C   . LEU B  2 194 ? -7.338  1.909   125.586 1.00 38.09  ? 178 LEU B C   1 
ATOM   2931  O O   . LEU B  2 194 ? -8.271  1.610   124.849 1.00 39.34  ? 178 LEU B O   1 
ATOM   2932  C CB  . LEU B  2 194 ? -6.767  3.626   127.268 1.00 37.29  ? 178 LEU B CB  1 
ATOM   2933  C CG  . LEU B  2 194 ? -7.914  3.527   128.280 1.00 38.73  ? 178 LEU B CG  1 
ATOM   2934  C CD1 . LEU B  2 194 ? -8.615  2.183   128.264 1.00 37.79  ? 178 LEU B CD1 1 
ATOM   2935  C CD2 . LEU B  2 194 ? -7.317  3.776   129.646 1.00 37.51  ? 178 LEU B CD2 1 
ATOM   2936  N N   . SER B  2 195 ? -6.629  1.016   126.262 1.00 39.22  ? 179 SER B N   1 
ATOM   2937  C CA  . SER B  2 195 ? -6.912  -0.411  126.176 1.00 39.83  ? 179 SER B CA  1 
ATOM   2938  C C   . SER B  2 195 ? -6.266  -1.147  127.325 1.00 40.53  ? 179 SER B C   1 
ATOM   2939  O O   . SER B  2 195 ? -5.421  -0.597  128.009 1.00 41.21  ? 179 SER B O   1 
ATOM   2940  C CB  . SER B  2 195 ? -6.418  -0.975  124.834 1.00 38.46  ? 179 SER B CB  1 
ATOM   2941  O OG  . SER B  2 195 ? -5.226  -0.354  124.392 1.00 35.94  ? 179 SER B OG  1 
ATOM   2942  N N   . SER B  2 196 ? -6.681  -2.382  127.560 1.00 43.81  ? 180 SER B N   1 
ATOM   2943  C CA  . SER B  2 196 ? -6.077  -3.168  128.632 1.00 47.48  ? 180 SER B CA  1 
ATOM   2944  C C   . SER B  2 196 ? -5.819  -4.611  128.211 1.00 49.01  ? 180 SER B C   1 
ATOM   2945  O O   . SER B  2 196 ? -6.748  -5.403  128.063 1.00 49.07  ? 180 SER B O   1 
ATOM   2946  C CB  . SER B  2 196 ? -6.952  -3.151  129.897 1.00 47.66  ? 180 SER B CB  1 
ATOM   2947  O OG  . SER B  2 196 ? -6.326  -3.865  130.960 1.00 46.06  ? 180 SER B OG  1 
ATOM   2948  N N   . VAL B  2 197 ? -4.553  -4.943  128.003 1.00 51.03  ? 181 VAL B N   1 
ATOM   2949  C CA  . VAL B  2 197 ? -4.205  -6.299  127.634 1.00 55.11  ? 181 VAL B CA  1 
ATOM   2950  C C   . VAL B  2 197 ? -3.950  -7.089  128.903 1.00 57.32  ? 181 VAL B C   1 
ATOM   2951  O O   . VAL B  2 197 ? -3.563  -6.538  129.936 1.00 58.22  ? 181 VAL B O   1 
ATOM   2952  C CB  . VAL B  2 197 ? -2.926  -6.382  126.764 1.00 55.33  ? 181 VAL B CB  1 
ATOM   2953  C CG1 . VAL B  2 197 ? -3.188  -5.815  125.383 1.00 55.85  ? 181 VAL B CG1 1 
ATOM   2954  C CG2 . VAL B  2 197 ? -1.793  -5.653  127.440 1.00 55.24  ? 181 VAL B CG2 1 
ATOM   2955  N N   . VAL B  2 198 ? -4.187  -8.388  128.820 1.00 59.32  ? 182 VAL B N   1 
ATOM   2956  C CA  . VAL B  2 198 ? -3.952  -9.268  129.944 1.00 60.97  ? 182 VAL B CA  1 
ATOM   2957  C C   . VAL B  2 198 ? -3.333  -10.520 129.355 1.00 61.30  ? 182 VAL B C   1 
ATOM   2958  O O   . VAL B  2 198 ? -3.988  -11.288 128.654 1.00 61.14  ? 182 VAL B O   1 
ATOM   2959  C CB  . VAL B  2 198 ? -5.258  -9.603  130.700 1.00 61.64  ? 182 VAL B CB  1 
ATOM   2960  C CG1 . VAL B  2 198 ? -6.339  -10.040 129.726 1.00 62.32  ? 182 VAL B CG1 1 
ATOM   2961  C CG2 . VAL B  2 198 ? -4.992  -10.692 131.714 1.00 61.48  ? 182 VAL B CG2 1 
ATOM   2962  N N   . THR B  2 199 ? -2.043  -10.688 129.613 1.00 62.37  ? 183 THR B N   1 
ATOM   2963  C CA  . THR B  2 199 ? -1.298  -11.837 129.119 1.00 62.53  ? 183 THR B CA  1 
ATOM   2964  C C   . THR B  2 199 ? -1.541  -12.993 130.111 1.00 62.86  ? 183 THR B C   1 
ATOM   2965  O O   . THR B  2 199 ? -1.076  -12.972 131.257 1.00 63.80  ? 183 THR B O   1 
ATOM   2966  C CB  . THR B  2 199 ? 0.233   -11.464 128.946 1.00 61.24  ? 183 THR B CB  1 
ATOM   2967  O OG1 . THR B  2 199 ? 0.874   -12.417 128.094 1.00 60.35  ? 183 THR B OG1 1 
ATOM   2968  C CG2 . THR B  2 199 ? 0.953   -11.410 130.286 1.00 60.72  ? 183 THR B CG2 1 
ATOM   2969  N N   . VAL B  2 200 ? -2.326  -13.974 129.670 1.00 62.16  ? 184 VAL B N   1 
ATOM   2970  C CA  . VAL B  2 200 ? -2.668  -15.123 130.490 1.00 60.68  ? 184 VAL B CA  1 
ATOM   2971  C C   . VAL B  2 200 ? -2.118  -16.387 129.831 1.00 61.99  ? 184 VAL B C   1 
ATOM   2972  O O   . VAL B  2 200 ? -1.365  -16.313 128.847 1.00 61.18  ? 184 VAL B O   1 
ATOM   2973  C CB  . VAL B  2 200 ? -4.200  -15.251 130.650 1.00 58.77  ? 184 VAL B CB  1 
ATOM   2974  C CG1 . VAL B  2 200 ? -4.800  -13.907 130.969 1.00 57.37  ? 184 VAL B CG1 1 
ATOM   2975  C CG2 . VAL B  2 200 ? -4.808  -15.822 129.395 1.00 58.36  ? 184 VAL B CG2 1 
ATOM   2976  N N   . PRO B  2 201 ? -2.467  -17.564 130.383 1.00 62.63  ? 185 PRO B N   1 
ATOM   2977  C CA  . PRO B  2 201 ? -2.032  -18.875 129.881 1.00 62.53  ? 185 PRO B CA  1 
ATOM   2978  C C   . PRO B  2 201 ? -2.713  -19.299 128.592 1.00 62.21  ? 185 PRO B C   1 
ATOM   2979  O O   . PRO B  2 201 ? -3.934  -19.227 128.475 1.00 61.56  ? 185 PRO B O   1 
ATOM   2980  C CB  . PRO B  2 201 ? -2.386  -19.813 131.025 1.00 62.84  ? 185 PRO B CB  1 
ATOM   2981  C CG  . PRO B  2 201 ? -2.290  -18.922 132.228 1.00 62.99  ? 185 PRO B CG  1 
ATOM   2982  C CD  . PRO B  2 201 ? -2.992  -17.696 131.752 1.00 62.67  ? 185 PRO B CD  1 
ATOM   2983  N N   . SER B  2 202 ? -1.917  -19.750 127.630 1.00 62.75  ? 186 SER B N   1 
ATOM   2984  C CA  . SER B  2 202 ? -2.449  -20.199 126.349 1.00 63.74  ? 186 SER B CA  1 
ATOM   2985  C C   . SER B  2 202 ? -3.579  -21.185 126.610 1.00 64.15  ? 186 SER B C   1 
ATOM   2986  O O   . SER B  2 202 ? -4.728  -20.968 126.226 1.00 64.07  ? 186 SER B O   1 
ATOM   2987  C CB  . SER B  2 202 ? -1.350  -20.876 125.518 1.00 62.96  ? 186 SER B CB  1 
ATOM   2988  O OG  . SER B  2 202 ? -0.431  -19.929 125.002 1.00 62.74  ? 186 SER B OG  1 
ATOM   2989  N N   . SER B  2 203 ? -3.231  -22.274 127.274 1.00 64.76  ? 187 SER B N   1 
ATOM   2990  C CA  . SER B  2 203 ? -4.181  -23.314 127.613 1.00 65.67  ? 187 SER B CA  1 
ATOM   2991  C C   . SER B  2 203 ? -5.536  -22.781 128.125 1.00 66.60  ? 187 SER B C   1 
ATOM   2992  O O   . SER B  2 203 ? -6.601  -23.177 127.632 1.00 66.62  ? 187 SER B O   1 
ATOM   2993  C CB  . SER B  2 203 ? -3.529  -24.223 128.653 1.00 66.01  ? 187 SER B CB  1 
ATOM   2994  O OG  . SER B  2 203 ? -2.580  -23.494 129.422 1.00 66.51  ? 187 SER B OG  1 
ATOM   2995  N N   . SER B  2 204 ? -5.484  -21.875 129.102 1.00 67.06  ? 188 SER B N   1 
ATOM   2996  C CA  . SER B  2 204 ? -6.679  -21.293 129.721 1.00 66.23  ? 188 SER B CA  1 
ATOM   2997  C C   . SER B  2 204 ? -7.629  -20.510 128.812 1.00 65.81  ? 188 SER B C   1 
ATOM   2998  O O   . SER B  2 204 ? -8.384  -19.665 129.297 1.00 65.69  ? 188 SER B O   1 
ATOM   2999  C CB  . SER B  2 204 ? -6.269  -20.395 130.895 1.00 66.37  ? 188 SER B CB  1 
ATOM   3000  O OG  . SER B  2 204 ? -5.484  -19.300 130.455 1.00 66.46  ? 188 SER B OG  1 
ATOM   3001  N N   . LEU B  2 205 ? -7.614  -20.789 127.509 1.00 64.84  ? 189 LEU B N   1 
ATOM   3002  C CA  . LEU B  2 205 ? -8.499  -20.079 126.587 1.00 63.10  ? 189 LEU B CA  1 
ATOM   3003  C C   . LEU B  2 205 ? -9.826  -20.792 126.391 1.00 62.34  ? 189 LEU B C   1 
ATOM   3004  O O   . LEU B  2 205 ? -10.891 -20.189 126.546 1.00 61.47  ? 189 LEU B O   1 
ATOM   3005  C CB  . LEU B  2 205 ? -7.816  -19.866 125.230 1.00 62.23  ? 189 LEU B CB  1 
ATOM   3006  C CG  . LEU B  2 205 ? -6.629  -18.894 125.261 1.00 62.21  ? 189 LEU B CG  1 
ATOM   3007  C CD1 . LEU B  2 205 ? -6.165  -18.585 123.849 1.00 60.37  ? 189 LEU B CD1 1 
ATOM   3008  C CD2 . LEU B  2 205 ? -7.042  -17.602 125.983 1.00 63.16  ? 189 LEU B CD2 1 
ATOM   3009  N N   . GLY B  2 206 ? -9.761  -22.075 126.059 1.00 61.61  ? 190 GLY B N   1 
ATOM   3010  C CA  . GLY B  2 206 ? -10.978 -22.833 125.849 1.00 62.12  ? 190 GLY B CA  1 
ATOM   3011  C C   . GLY B  2 206 ? -11.613 -23.216 127.166 1.00 62.48  ? 190 GLY B C   1 
ATOM   3012  O O   . GLY B  2 206 ? -12.743 -23.714 127.200 1.00 62.26  ? 190 GLY B O   1 
ATOM   3013  N N   . THR B  2 207 ? -10.890 -22.964 128.254 1.00 62.56  ? 191 THR B N   1 
ATOM   3014  C CA  . THR B  2 207 ? -11.373 -23.296 129.589 1.00 62.88  ? 191 THR B CA  1 
ATOM   3015  C C   . THR B  2 207 ? -12.017 -22.186 130.411 1.00 62.59  ? 191 THR B C   1 
ATOM   3016  O O   . THR B  2 207 ? -13.073 -22.396 130.995 1.00 62.15  ? 191 THR B O   1 
ATOM   3017  C CB  . THR B  2 207 ? -10.253 -23.916 130.448 1.00 64.14  ? 191 THR B CB  1 
ATOM   3018  O OG1 . THR B  2 207 ? -10.357 -23.427 131.796 1.00 63.15  ? 191 THR B OG1 1 
ATOM   3019  C CG2 . THR B  2 207 ? -8.879  -23.592 129.858 1.00 64.06  ? 191 THR B CG2 1 
ATOM   3020  N N   . GLN B  2 208 ? -11.398 -21.014 130.470 1.00 63.57  ? 192 GLN B N   1 
ATOM   3021  C CA  . GLN B  2 208 ? -11.970 -19.931 131.274 1.00 65.80  ? 192 GLN B CA  1 
ATOM   3022  C C   . GLN B  2 208 ? -12.682 -18.845 130.467 1.00 67.04  ? 192 GLN B C   1 
ATOM   3023  O O   . GLN B  2 208 ? -12.554 -18.789 129.236 1.00 68.34  ? 192 GLN B O   1 
ATOM   3024  C CB  . GLN B  2 208 ? -10.884 -19.291 132.151 1.00 66.40  ? 192 GLN B CB  1 
ATOM   3025  C CG  . GLN B  2 208 ? -11.404 -18.183 133.050 1.00 65.81  ? 192 GLN B CG  1 
ATOM   3026  C CD  . GLN B  2 208 ? -12.478 -18.675 133.991 1.00 66.48  ? 192 GLN B CD  1 
ATOM   3027  O OE1 . GLN B  2 208 ? -12.182 -19.201 135.067 1.00 65.45  ? 192 GLN B OE1 1 
ATOM   3028  N NE2 . GLN B  2 208 ? -13.738 -18.526 133.583 1.00 65.63  ? 192 GLN B NE2 1 
ATOM   3029  N N   . THR B  2 209 ? -13.430 -17.990 131.174 1.00 66.97  ? 193 THR B N   1 
ATOM   3030  C CA  . THR B  2 209 ? -14.180 -16.887 130.564 1.00 66.42  ? 193 THR B CA  1 
ATOM   3031  C C   . THR B  2 209 ? -13.408 -15.575 130.671 1.00 65.22  ? 193 THR B C   1 
ATOM   3032  O O   . THR B  2 209 ? -12.846 -15.265 131.721 1.00 65.99  ? 193 THR B O   1 
ATOM   3033  C CB  . THR B  2 209 ? -15.531 -16.660 131.270 1.00 66.89  ? 193 THR B CB  1 
ATOM   3034  O OG1 . THR B  2 209 ? -16.031 -17.907 131.765 1.00 68.31  ? 193 THR B OG1 1 
ATOM   3035  C CG2 . THR B  2 209 ? -16.543 -16.054 130.302 1.00 66.46  ? 193 THR B CG2 1 
ATOM   3036  N N   . TYR B  2 210 ? -13.397 -14.798 129.595 1.00 63.49  ? 194 TYR B N   1 
ATOM   3037  C CA  . TYR B  2 210 ? -12.702 -13.528 129.607 1.00 61.60  ? 194 TYR B CA  1 
ATOM   3038  C C   . TYR B  2 210 ? -13.563 -12.336 129.198 1.00 61.39  ? 194 TYR B C   1 
ATOM   3039  O O   . TYR B  2 210 ? -13.876 -12.142 128.017 1.00 59.63  ? 194 TYR B O   1 
ATOM   3040  C CB  . TYR B  2 210 ? -11.456 -13.639 128.753 1.00 60.75  ? 194 TYR B CB  1 
ATOM   3041  C CG  . TYR B  2 210 ? -10.452 -14.559 129.397 1.00 62.47  ? 194 TYR B CG  1 
ATOM   3042  C CD1 . TYR B  2 210 ? -10.344 -14.620 130.789 1.00 63.19  ? 194 TYR B CD1 1 
ATOM   3043  C CD2 . TYR B  2 210 ? -9.568  -15.328 128.634 1.00 62.88  ? 194 TYR B CD2 1 
ATOM   3044  C CE1 . TYR B  2 210 ? -9.388  -15.410 131.409 1.00 62.39  ? 194 TYR B CE1 1 
ATOM   3045  C CE2 . TYR B  2 210 ? -8.599  -16.122 129.248 1.00 62.49  ? 194 TYR B CE2 1 
ATOM   3046  C CZ  . TYR B  2 210 ? -8.519  -16.150 130.639 1.00 62.15  ? 194 TYR B CZ  1 
ATOM   3047  O OH  . TYR B  2 210 ? -7.552  -16.887 131.272 1.00 63.34  ? 194 TYR B OH  1 
ATOM   3048  N N   . ILE B  2 211 ? -13.937 -11.551 130.214 1.00 61.14  ? 195 ILE B N   1 
ATOM   3049  C CA  . ILE B  2 211 ? -14.779 -10.357 130.074 1.00 60.92  ? 195 ILE B CA  1 
ATOM   3050  C C   . ILE B  2 211 ? -14.201 -9.111  130.768 1.00 61.22  ? 195 ILE B C   1 
ATOM   3051  O O   . ILE B  2 211 ? -13.886 -9.158  131.953 1.00 60.96  ? 195 ILE B O   1 
ATOM   3052  C CB  . ILE B  2 211 ? -16.206 -10.619 130.665 1.00 59.59  ? 195 ILE B CB  1 
ATOM   3053  C CG1 . ILE B  2 211 ? -17.077 -11.332 129.634 1.00 59.03  ? 195 ILE B CG1 1 
ATOM   3054  C CG2 . ILE B  2 211 ? -16.862 -9.310  131.115 1.00 57.78  ? 195 ILE B CG2 1 
ATOM   3055  C CD1 . ILE B  2 211 ? -16.751 -12.786 129.450 1.00 60.34  ? 195 ILE B CD1 1 
ATOM   3056  N N   . CYS B  2 212 ? -14.079 -7.999  130.041 1.00 61.69  ? 196 CYS B N   1 
ATOM   3057  C CA  . CYS B  2 212 ? -13.573 -6.768  130.643 1.00 63.11  ? 196 CYS B CA  1 
ATOM   3058  C C   . CYS B  2 212 ? -14.737 -5.885  131.074 1.00 63.28  ? 196 CYS B C   1 
ATOM   3059  O O   . CYS B  2 212 ? -15.807 -5.911  130.447 1.00 62.53  ? 196 CYS B O   1 
ATOM   3060  C CB  . CYS B  2 212 ? -12.657 -5.990  129.684 1.00 64.35  ? 196 CYS B CB  1 
ATOM   3061  S SG  . CYS B  2 212 ? -13.408 -5.156  128.239 1.00 66.17  ? 196 CYS B SG  1 
ATOM   3062  N N   . ASN B  2 213 ? -14.511 -5.108  132.141 1.00 63.63  ? 197 ASN B N   1 
ATOM   3063  C CA  . ASN B  2 213 ? -15.523 -4.209  132.718 1.00 63.06  ? 197 ASN B CA  1 
ATOM   3064  C C   . ASN B  2 213 ? -15.215 -2.725  132.635 1.00 60.49  ? 197 ASN B C   1 
ATOM   3065  O O   . ASN B  2 213 ? -14.843 -2.103  133.627 1.00 60.49  ? 197 ASN B O   1 
ATOM   3066  C CB  . ASN B  2 213 ? -15.778 -4.558  134.189 1.00 65.69  ? 197 ASN B CB  1 
ATOM   3067  C CG  . ASN B  2 213 ? -16.292 -5.967  134.367 1.00 68.82  ? 197 ASN B CG  1 
ATOM   3068  O OD1 . ASN B  2 213 ? -15.625 -6.938  133.991 1.00 70.45  ? 197 ASN B OD1 1 
ATOM   3069  N ND2 . ASN B  2 213 ? -17.490 -6.093  134.935 1.00 70.46  ? 197 ASN B ND2 1 
ATOM   3070  N N   . VAL B  2 214 ? -15.394 -2.158  131.456 1.00 57.83  ? 198 VAL B N   1 
ATOM   3071  C CA  . VAL B  2 214 ? -15.160 -0.743  131.269 1.00 56.99  ? 198 VAL B CA  1 
ATOM   3072  C C   . VAL B  2 214 ? -16.303 0.030   131.897 1.00 56.59  ? 198 VAL B C   1 
ATOM   3073  O O   . VAL B  2 214 ? -17.413 -0.468  132.004 1.00 55.50  ? 198 VAL B O   1 
ATOM   3074  C CB  . VAL B  2 214 ? -15.097 -0.391  129.778 1.00 56.84  ? 198 VAL B CB  1 
ATOM   3075  C CG1 . VAL B  2 214 ? -14.801 1.093   129.603 1.00 55.68  ? 198 VAL B CG1 1 
ATOM   3076  C CG2 . VAL B  2 214 ? -14.045 -1.252  129.091 1.00 56.35  ? 198 VAL B CG2 1 
ATOM   3077  N N   . ASN B  2 215 ? -16.032 1.249   132.321 1.00 57.68  ? 199 ASN B N   1 
ATOM   3078  C CA  . ASN B  2 215 ? -17.076 2.064   132.914 1.00 60.38  ? 199 ASN B CA  1 
ATOM   3079  C C   . ASN B  2 215 ? -16.709 3.540   132.861 1.00 60.72  ? 199 ASN B C   1 
ATOM   3080  O O   . ASN B  2 215 ? -15.638 3.947   133.318 1.00 60.01  ? 199 ASN B O   1 
ATOM   3081  C CB  . ASN B  2 215 ? -17.331 1.631   134.359 1.00 63.10  ? 199 ASN B CB  1 
ATOM   3082  C CG  . ASN B  2 215 ? -18.315 2.547   135.085 1.00 65.83  ? 199 ASN B CG  1 
ATOM   3083  O OD1 . ASN B  2 215 ? -18.750 2.250   136.205 1.00 67.04  ? 199 ASN B OD1 1 
ATOM   3084  N ND2 . ASN B  2 215 ? -18.663 3.670   134.454 1.00 66.62  ? 199 ASN B ND2 1 
ATOM   3085  N N   . HIS B  2 216 ? -17.604 4.338   132.291 1.00 61.30  ? 200 HIS B N   1 
ATOM   3086  C CA  . HIS B  2 216 ? -17.378 5.769   132.177 1.00 62.90  ? 200 HIS B CA  1 
ATOM   3087  C C   . HIS B  2 216 ? -18.547 6.493   132.817 1.00 61.82  ? 200 HIS B C   1 
ATOM   3088  O O   . HIS B  2 216 ? -19.582 6.698   132.186 1.00 61.45  ? 200 HIS B O   1 
ATOM   3089  C CB  . HIS B  2 216 ? -17.225 6.168   130.697 1.00 65.71  ? 200 HIS B CB  1 
ATOM   3090  C CG  . HIS B  2 216 ? -16.991 7.635   130.482 1.00 68.60  ? 200 HIS B CG  1 
ATOM   3091  N ND1 . HIS B  2 216 ? -18.020 8.547   130.375 1.00 70.25  ? 200 HIS B ND1 1 
ATOM   3092  C CD2 . HIS B  2 216 ? -15.845 8.350   130.369 1.00 68.63  ? 200 HIS B CD2 1 
ATOM   3093  C CE1 . HIS B  2 216 ? -17.517 9.757   130.201 1.00 70.47  ? 200 HIS B CE1 1 
ATOM   3094  N NE2 . HIS B  2 216 ? -16.199 9.666   130.196 1.00 68.74  ? 200 HIS B NE2 1 
ATOM   3095  N N   . LYS B  2 217 ? -18.372 6.878   134.077 1.00 61.07  ? 201 LYS B N   1 
ATOM   3096  C CA  . LYS B  2 217 ? -19.421 7.561   134.817 1.00 60.78  ? 201 LYS B CA  1 
ATOM   3097  C C   . LYS B  2 217 ? -19.738 8.988   134.368 1.00 60.05  ? 201 LYS B C   1 
ATOM   3098  O O   . LYS B  2 217 ? -20.854 9.465   134.572 1.00 57.86  ? 201 LYS B O   1 
ATOM   3099  C CB  . LYS B  2 217 ? -19.102 7.543   136.309 1.00 62.15  ? 201 LYS B CB  1 
ATOM   3100  C CG  . LYS B  2 217 ? -19.233 6.160   136.945 1.00 63.98  ? 201 LYS B CG  1 
ATOM   3101  C CD  . LYS B  2 217 ? -18.991 6.207   138.454 1.00 64.56  ? 201 LYS B CD  1 
ATOM   3102  C CE  . LYS B  2 217 ? -19.050 4.814   139.077 1.00 65.49  ? 201 LYS B CE  1 
ATOM   3103  N NZ  . LYS B  2 217 ? -18.864 4.843   140.562 1.00 66.22  ? 201 LYS B NZ  1 
ATOM   3104  N N   . PRO B  2 218 ? -18.769 9.691   133.746 1.00 60.58  ? 202 PRO B N   1 
ATOM   3105  C CA  . PRO B  2 218 ? -19.069 11.063  133.308 1.00 60.07  ? 202 PRO B CA  1 
ATOM   3106  C C   . PRO B  2 218 ? -20.249 11.044  132.344 1.00 60.13  ? 202 PRO B C   1 
ATOM   3107  O O   . PRO B  2 218 ? -20.855 12.076  132.062 1.00 60.35  ? 202 PRO B O   1 
ATOM   3108  C CB  . PRO B  2 218 ? -17.781 11.506  132.624 1.00 59.16  ? 202 PRO B CB  1 
ATOM   3109  C CG  . PRO B  2 218 ? -16.731 10.688  133.308 1.00 60.23  ? 202 PRO B CG  1 
ATOM   3110  C CD  . PRO B  2 218 ? -17.367 9.339   133.456 1.00 59.99  ? 202 PRO B CD  1 
ATOM   3111  N N   . SER B  2 219 ? -20.566 9.852   131.847 1.00 60.00  ? 203 SER B N   1 
ATOM   3112  C CA  . SER B  2 219 ? -21.675 9.663   130.928 1.00 59.65  ? 203 SER B CA  1 
ATOM   3113  C C   . SER B  2 219 ? -22.469 8.434   131.315 1.00 61.31  ? 203 SER B C   1 
ATOM   3114  O O   . SER B  2 219 ? -22.995 7.760   130.437 1.00 60.56  ? 203 SER B O   1 
ATOM   3115  C CB  . SER B  2 219 ? -21.171 9.418   129.533 1.00 57.82  ? 203 SER B CB  1 
ATOM   3116  O OG  . SER B  2 219 ? -20.792 8.064   129.435 1.00 56.48  ? 203 SER B OG  1 
ATOM   3117  N N   . ASN B  2 220 ? -22.543 8.135   132.611 1.00 63.79  ? 204 ASN B N   1 
ATOM   3118  C CA  . ASN B  2 220 ? -23.268 6.960   133.104 1.00 66.27  ? 204 ASN B CA  1 
ATOM   3119  C C   . ASN B  2 220 ? -23.208 5.828   132.098 1.00 66.73  ? 204 ASN B C   1 
ATOM   3120  O O   . ASN B  2 220 ? -24.049 5.739   131.205 1.00 66.74  ? 204 ASN B O   1 
ATOM   3121  C CB  . ASN B  2 220 ? -24.732 7.284   133.359 1.00 68.49  ? 204 ASN B CB  1 
ATOM   3122  C CG  . ASN B  2 220 ? -24.916 8.611   134.020 1.00 72.67  ? 204 ASN B CG  1 
ATOM   3123  O OD1 . ASN B  2 220 ? -24.464 8.830   135.150 1.00 74.70  ? 204 ASN B OD1 1 
ATOM   3124  N ND2 . ASN B  2 220 ? -25.579 9.527   133.317 1.00 74.77  ? 204 ASN B ND2 1 
ATOM   3125  N N   . THR B  2 221 ? -22.222 4.957   132.242 1.00 67.01  ? 205 THR B N   1 
ATOM   3126  C CA  . THR B  2 221 ? -22.083 3.854   131.317 1.00 67.15  ? 205 THR B CA  1 
ATOM   3127  C C   . THR B  2 221 ? -21.270 2.769   131.968 1.00 67.43  ? 205 THR B C   1 
ATOM   3128  O O   . THR B  2 221 ? -20.388 3.053   132.774 1.00 68.32  ? 205 THR B O   1 
ATOM   3129  C CB  . THR B  2 221 ? -21.359 4.291   130.058 1.00 67.41  ? 205 THR B CB  1 
ATOM   3130  O OG1 . THR B  2 221 ? -22.030 5.423   129.493 1.00 68.29  ? 205 THR B OG1 1 
ATOM   3131  C CG2 . THR B  2 221 ? -21.333 3.159   129.055 1.00 68.31  ? 205 THR B CG2 1 
ATOM   3132  N N   . LYS B  2 222 ? -21.566 1.525   131.614 1.00 66.85  ? 206 LYS B N   1 
ATOM   3133  C CA  . LYS B  2 222 ? -20.856 0.383   132.173 1.00 66.34  ? 206 LYS B CA  1 
ATOM   3134  C C   . LYS B  2 222 ? -20.871 -0.767  131.168 1.00 64.89  ? 206 LYS B C   1 
ATOM   3135  O O   . LYS B  2 222 ? -21.328 -1.866  131.463 1.00 64.39  ? 206 LYS B O   1 
ATOM   3136  C CB  . LYS B  2 222 ? -21.508 -0.053  133.493 1.00 67.18  ? 206 LYS B CB  1 
ATOM   3137  C CG  . LYS B  2 222 ? -21.379 0.948   134.632 1.00 67.86  ? 206 LYS B CG  1 
ATOM   3138  C CD  . LYS B  2 222 ? -22.487 0.757   135.675 1.00 70.75  ? 206 LYS B CD  1 
ATOM   3139  C CE  . LYS B  2 222 ? -23.885 1.016   135.086 1.00 70.74  ? 206 LYS B CE  1 
ATOM   3140  N NZ  . LYS B  2 222 ? -24.981 0.777   136.075 1.00 71.20  ? 206 LYS B NZ  1 
ATOM   3141  N N   . VAL B  2 223 ? -20.371 -0.499  129.973 1.00 63.58  ? 207 VAL B N   1 
ATOM   3142  C CA  . VAL B  2 223 ? -20.324 -1.511  128.937 1.00 63.03  ? 207 VAL B CA  1 
ATOM   3143  C C   . VAL B  2 223 ? -19.526 -2.721  129.400 1.00 62.71  ? 207 VAL B C   1 
ATOM   3144  O O   . VAL B  2 223 ? -18.642 -2.606  130.240 1.00 61.88  ? 207 VAL B O   1 
ATOM   3145  C CB  . VAL B  2 223 ? -19.680 -0.942  127.656 1.00 63.29  ? 207 VAL B CB  1 
ATOM   3146  C CG1 . VAL B  2 223 ? -19.334 -2.067  126.690 1.00 63.21  ? 207 VAL B CG1 1 
ATOM   3147  C CG2 . VAL B  2 223 ? -20.635 0.050   127.003 1.00 63.82  ? 207 VAL B CG2 1 
ATOM   3148  N N   . ASP B  2 224 ? -19.863 -3.882  128.847 1.00 63.35  ? 208 ASP B N   1 
ATOM   3149  C CA  . ASP B  2 224 ? -19.182 -5.139  129.146 1.00 63.58  ? 208 ASP B CA  1 
ATOM   3150  C C   . ASP B  2 224 ? -19.088 -5.955  127.858 1.00 63.60  ? 208 ASP B C   1 
ATOM   3151  O O   . ASP B  2 224 ? -20.087 -6.189  127.179 1.00 62.84  ? 208 ASP B O   1 
ATOM   3152  C CB  . ASP B  2 224 ? -19.939 -5.926  130.216 1.00 63.79  ? 208 ASP B CB  1 
ATOM   3153  C CG  . ASP B  2 224 ? -19.307 -5.796  131.583 1.00 64.06  ? 208 ASP B CG  1 
ATOM   3154  O OD1 . ASP B  2 224 ? -19.992 -5.345  132.528 1.00 63.52  ? 208 ASP B OD1 1 
ATOM   3155  O OD2 . ASP B  2 224 ? -18.117 -6.152  131.704 1.00 64.06  ? 208 ASP B OD2 1 
ATOM   3156  N N   . LYS B  2 225 ? -17.876 -6.368  127.520 1.00 63.85  ? 209 LYS B N   1 
ATOM   3157  C CA  . LYS B  2 225 ? -17.654 -7.137  126.312 1.00 63.91  ? 209 LYS B CA  1 
ATOM   3158  C C   . LYS B  2 225 ? -17.038 -8.467  126.721 1.00 63.93  ? 209 LYS B C   1 
ATOM   3159  O O   . LYS B  2 225 ? -16.997 -8.793  127.896 1.00 63.53  ? 209 LYS B O   1 
ATOM   3160  C CB  . LYS B  2 225 ? -16.713 -6.364  125.387 1.00 63.79  ? 209 LYS B CB  1 
ATOM   3161  C CG  . LYS B  2 225 ? -16.680 -6.844  123.937 1.00 65.15  ? 209 LYS B CG  1 
ATOM   3162  C CD  . LYS B  2 225 ? -17.777 -6.212  123.082 1.00 64.73  ? 209 LYS B CD  1 
ATOM   3163  C CE  . LYS B  2 225 ? -17.545 -6.513  121.600 1.00 64.52  ? 209 LYS B CE  1 
ATOM   3164  N NZ  . LYS B  2 225 ? -18.386 -5.692  120.682 1.00 63.50  ? 209 LYS B NZ  1 
ATOM   3165  N N   . LYS B  2 226 ? -16.574 -9.234  125.745 1.00 65.73  ? 210 LYS B N   1 
ATOM   3166  C CA  . LYS B  2 226 ? -15.946 -10.527 125.993 1.00 67.36  ? 210 LYS B CA  1 
ATOM   3167  C C   . LYS B  2 226 ? -14.952 -10.831 124.878 1.00 66.92  ? 210 LYS B C   1 
ATOM   3168  O O   . LYS B  2 226 ? -15.332 -10.974 123.720 1.00 66.39  ? 210 LYS B O   1 
ATOM   3169  C CB  . LYS B  2 226 ? -17.002 -11.637 126.050 1.00 69.83  ? 210 LYS B CB  1 
ATOM   3170  C CG  . LYS B  2 226 ? -16.406 -13.057 126.073 1.00 73.41  ? 210 LYS B CG  1 
ATOM   3171  C CD  . LYS B  2 226 ? -17.472 -14.152 126.265 1.00 75.07  ? 210 LYS B CD  1 
ATOM   3172  C CE  . LYS B  2 226 ? -16.845 -15.541 126.467 1.00 74.38  ? 210 LYS B CE  1 
ATOM   3173  N NZ  . LYS B  2 226 ? -17.864 -16.633 126.419 1.00 72.67  ? 210 LYS B NZ  1 
ATOM   3174  N N   . VAL B  2 227 ? -13.678 -10.931 125.219 1.00 66.65  ? 211 VAL B N   1 
ATOM   3175  C CA  . VAL B  2 227 ? -12.679 -11.217 124.201 1.00 67.85  ? 211 VAL B CA  1 
ATOM   3176  C C   . VAL B  2 227 ? -12.621 -12.727 123.919 1.00 67.93  ? 211 VAL B C   1 
ATOM   3177  O O   . VAL B  2 227 ? -12.685 -13.540 124.843 1.00 67.10  ? 211 VAL B O   1 
ATOM   3178  C CB  . VAL B  2 227 ? -11.282 -10.701 124.643 1.00 67.91  ? 211 VAL B CB  1 
ATOM   3179  C CG1 . VAL B  2 227 ? -10.324 -10.670 123.445 1.00 67.79  ? 211 VAL B CG1 1 
ATOM   3180  C CG2 . VAL B  2 227 ? -11.417 -9.312  125.270 1.00 66.75  ? 211 VAL B CG2 1 
ATOM   3181  N N   . GLU B  2 228 ? -12.512 -13.095 122.643 1.00 68.09  ? 212 GLU B N   1 
ATOM   3182  C CA  . GLU B  2 228 ? -12.446 -14.505 122.251 1.00 68.96  ? 212 GLU B CA  1 
ATOM   3183  C C   . GLU B  2 228 ? -11.680 -14.685 120.938 1.00 68.82  ? 212 GLU B C   1 
ATOM   3184  O O   . GLU B  2 228 ? -11.513 -13.724 120.192 1.00 69.75  ? 212 GLU B O   1 
ATOM   3185  C CB  . GLU B  2 228 ? -13.859 -15.075 122.097 1.00 69.80  ? 212 GLU B CB  1 
ATOM   3186  C CG  . GLU B  2 228 ? -14.733 -14.888 123.321 1.00 71.17  ? 212 GLU B CG  1 
ATOM   3187  C CD  . GLU B  2 228 ? -15.871 -15.882 123.386 1.00 71.24  ? 212 GLU B CD  1 
ATOM   3188  O OE1 . GLU B  2 228 ? -15.595 -17.093 123.574 1.00 70.62  ? 212 GLU B OE1 1 
ATOM   3189  O OE2 . GLU B  2 228 ? -17.035 -15.445 123.250 1.00 70.31  ? 212 GLU B OE2 1 
ATOM   3190  N N   . PRO B  2 229 ? -11.198 -15.916 120.645 1.00 67.95  ? 213 PRO B N   1 
ATOM   3191  C CA  . PRO B  2 229 ? -10.444 -16.224 119.419 1.00 66.92  ? 213 PRO B CA  1 
ATOM   3192  C C   . PRO B  2 229 ? -11.272 -16.270 118.139 1.00 66.36  ? 213 PRO B C   1 
ATOM   3193  O O   . PRO B  2 229 ? -10.716 -15.943 117.068 1.00 65.23  ? 213 PRO B O   1 
ATOM   3194  C CB  . PRO B  2 229 ? -9.800  -17.572 119.736 1.00 66.31  ? 213 PRO B CB  1 
ATOM   3195  C CG  . PRO B  2 229 ? -9.661  -17.547 121.214 1.00 66.15  ? 213 PRO B CG  1 
ATOM   3196  C CD  . PRO B  2 229 ? -10.998 -16.990 121.633 1.00 67.52  ? 213 PRO B CD  1 
ATOM   3197  N N   . ASP C  1 1   ? 28.275  56.144  128.619 1.00 73.30  ? 1   ASP C N   1 
ATOM   3198  C CA  . ASP C  1 1   ? 28.839  56.201  130.006 1.00 73.43  ? 1   ASP C CA  1 
ATOM   3199  C C   . ASP C  1 1   ? 28.901  57.657  130.508 1.00 72.65  ? 1   ASP C C   1 
ATOM   3200  O O   . ASP C  1 1   ? 28.426  58.583  129.833 1.00 73.48  ? 1   ASP C O   1 
ATOM   3201  C CB  . ASP C  1 1   ? 30.246  55.583  130.018 1.00 73.42  ? 1   ASP C CB  1 
ATOM   3202  C CG  . ASP C  1 1   ? 30.556  54.855  131.318 1.00 73.91  ? 1   ASP C CG  1 
ATOM   3203  O OD1 . ASP C  1 1   ? 30.512  55.488  132.397 1.00 74.45  ? 1   ASP C OD1 1 
ATOM   3204  O OD2 . ASP C  1 1   ? 30.843  53.642  131.259 1.00 73.84  ? 1   ASP C OD2 1 
ATOM   3205  N N   . ILE C  1 2   ? 29.465  57.857  131.697 1.00 70.23  ? 2   ILE C N   1 
ATOM   3206  C CA  . ILE C  1 2   ? 29.599  59.199  132.241 1.00 68.07  ? 2   ILE C CA  1 
ATOM   3207  C C   . ILE C  1 2   ? 30.952  59.760  131.837 1.00 67.51  ? 2   ILE C C   1 
ATOM   3208  O O   . ILE C  1 2   ? 31.898  59.016  131.584 1.00 68.14  ? 2   ILE C O   1 
ATOM   3209  C CB  . ILE C  1 2   ? 29.520  59.209  133.755 1.00 67.51  ? 2   ILE C CB  1 
ATOM   3210  C CG1 . ILE C  1 2   ? 28.179  58.635  134.210 1.00 67.13  ? 2   ILE C CG1 1 
ATOM   3211  C CG2 . ILE C  1 2   ? 29.698  60.636  134.252 1.00 67.95  ? 2   ILE C CG2 1 
ATOM   3212  C CD1 . ILE C  1 2   ? 28.027  58.545  135.711 1.00 65.10  ? 2   ILE C CD1 1 
ATOM   3213  N N   . GLN C  1 3   ? 31.046  61.079  131.778 1.00 66.52  ? 3   GLN C N   1 
ATOM   3214  C CA  . GLN C  1 3   ? 32.289  61.720  131.378 1.00 65.13  ? 3   GLN C CA  1 
ATOM   3215  C C   . GLN C  1 3   ? 32.762  62.687  132.450 1.00 63.27  ? 3   GLN C C   1 
ATOM   3216  O O   . GLN C  1 3   ? 32.065  63.655  132.777 1.00 62.92  ? 3   GLN C O   1 
ATOM   3217  C CB  . GLN C  1 3   ? 32.084  62.491  130.066 1.00 66.21  ? 3   GLN C CB  1 
ATOM   3218  C CG  . GLN C  1 3   ? 31.561  61.671  128.888 1.00 66.60  ? 3   GLN C CG  1 
ATOM   3219  C CD  . GLN C  1 3   ? 32.648  61.298  127.893 1.00 67.59  ? 3   GLN C CD  1 
ATOM   3220  O OE1 . GLN C  1 3   ? 32.360  60.970  126.737 1.00 67.62  ? 3   GLN C OE1 1 
ATOM   3221  N NE2 . GLN C  1 3   ? 33.904  61.342  128.335 1.00 67.21  ? 3   GLN C NE2 1 
ATOM   3222  N N   . MET C  1 4   ? 33.938  62.421  133.008 1.00 59.72  ? 4   MET C N   1 
ATOM   3223  C CA  . MET C  1 4   ? 34.466  63.320  134.005 1.00 56.62  ? 4   MET C CA  1 
ATOM   3224  C C   . MET C  1 4   ? 35.378  64.266  133.270 1.00 54.28  ? 4   MET C C   1 
ATOM   3225  O O   . MET C  1 4   ? 36.436  63.879  132.777 1.00 52.88  ? 4   MET C O   1 
ATOM   3226  C CB  . MET C  1 4   ? 35.212  62.562  135.100 1.00 56.71  ? 4   MET C CB  1 
ATOM   3227  C CG  . MET C  1 4   ? 34.308  61.652  135.925 1.00 56.33  ? 4   MET C CG  1 
ATOM   3228  S SD  . MET C  1 4   ? 32.863  62.456  136.757 1.00 57.05  ? 4   MET C SD  1 
ATOM   3229  C CE  . MET C  1 4   ? 33.568  62.886  138.323 1.00 55.03  ? 4   MET C CE  1 
ATOM   3230  N N   . THR C  1 5   ? 34.920  65.510  133.184 1.00 52.79  ? 5   THR C N   1 
ATOM   3231  C CA  . THR C  1 5   ? 35.640  66.566  132.502 1.00 51.84  ? 5   THR C CA  1 
ATOM   3232  C C   . THR C  1 5   ? 36.326  67.459  133.506 1.00 51.59  ? 5   THR C C   1 
ATOM   3233  O O   . THR C  1 5   ? 35.726  67.902  134.483 1.00 50.96  ? 5   THR C O   1 
ATOM   3234  C CB  . THR C  1 5   ? 34.702  67.401  131.652 1.00 51.55  ? 5   THR C CB  1 
ATOM   3235  O OG1 . THR C  1 5   ? 33.408  66.785  131.633 1.00 52.16  ? 5   THR C OG1 1 
ATOM   3236  C CG2 . THR C  1 5   ? 35.234  67.491  130.242 1.00 49.85  ? 5   THR C CG2 1 
ATOM   3237  N N   . GLN C  1 6   ? 37.588  67.746  133.229 1.00 52.35  ? 6   GLN C N   1 
ATOM   3238  C CA  . GLN C  1 6   ? 38.393  68.536  134.132 1.00 54.78  ? 6   GLN C CA  1 
ATOM   3239  C C   . GLN C  1 6   ? 39.645  69.155  133.454 1.00 56.03  ? 6   GLN C C   1 
ATOM   3240  O O   . GLN C  1 6   ? 40.189  68.534  132.560 1.00 56.61  ? 6   GLN C O   1 
ATOM   3241  C CB  . GLN C  1 6   ? 38.822  67.592  135.267 1.00 56.12  ? 6   GLN C CB  1 
ATOM   3242  C CG  . GLN C  1 6   ? 40.301  67.465  135.576 1.00 56.74  ? 6   GLN C CG  1 
ATOM   3243  C CD  . GLN C  1 6   ? 40.579  66.172  136.342 1.00 56.89  ? 6   GLN C CD  1 
ATOM   3244  O OE1 . GLN C  1 6   ? 40.396  65.074  135.808 1.00 55.04  ? 6   GLN C OE1 1 
ATOM   3245  N NE2 . GLN C  1 6   ? 41.005  66.297  137.601 1.00 57.89  ? 6   GLN C NE2 1 
ATOM   3246  N N   . SER C  1 7   ? 40.152  70.320  133.932 1.00 57.13  ? 7   SER C N   1 
ATOM   3247  C CA  . SER C  1 7   ? 41.447  71.071  133.474 1.00 57.54  ? 7   SER C CA  1 
ATOM   3248  C C   . SER C  1 7   ? 42.181  70.353  132.286 1.00 56.05  ? 7   SER C C   1 
ATOM   3249  O O   . SER C  1 7   ? 41.396  69.960  131.582 1.00 57.36  ? 7   SER C O   1 
ATOM   3250  C CB  . SER C  1 7   ? 42.305  71.455  134.649 1.00 61.12  ? 7   SER C CB  1 
ATOM   3251  O OG  . SER C  1 7   ? 41.501  71.896  135.737 1.00 62.38  ? 7   SER C OG  1 
ATOM   3252  N N   . PRO C  1 8   ? 43.487  70.049  131.910 1.00 55.03  ? 8   PRO C N   1 
ATOM   3253  C CA  . PRO C  1 8   ? 44.938  69.813  131.694 1.00 52.91  ? 8   PRO C CA  1 
ATOM   3254  C C   . PRO C  1 8   ? 46.144  69.913  132.610 1.00 50.52  ? 8   PRO C C   1 
ATOM   3255  O O   . PRO C  1 8   ? 46.711  68.931  133.150 1.00 51.02  ? 8   PRO C O   1 
ATOM   3256  C CB  . PRO C  1 8   ? 45.222  70.574  130.377 1.00 53.70  ? 8   PRO C CB  1 
ATOM   3257  C CG  . PRO C  1 8   ? 44.007  70.302  129.582 1.00 54.13  ? 8   PRO C CG  1 
ATOM   3258  C CD  . PRO C  1 8   ? 42.913  70.483  130.579 1.00 56.56  ? 8   PRO C CD  1 
ATOM   3259  N N   . SER C  1 9   ? 46.426  71.205  132.673 1.00 47.53  ? 10  SER C N   1 
ATOM   3260  C CA  . SER C  1 9   ? 47.472  72.024  133.251 1.00 46.28  ? 10  SER C CA  1 
ATOM   3261  C C   . SER C  1 9   ? 47.037  73.248  134.065 1.00 44.66  ? 10  SER C C   1 
ATOM   3262  O O   . SER C  1 9   ? 46.076  73.943  133.740 1.00 44.70  ? 10  SER C O   1 
ATOM   3263  C CB  . SER C  1 9   ? 48.306  72.531  132.076 1.00 47.00  ? 10  SER C CB  1 
ATOM   3264  O OG  . SER C  1 9   ? 49.690  72.292  132.274 1.00 49.30  ? 10  SER C OG  1 
ATOM   3265  N N   . LEU C  1 10  ? 47.793  73.496  135.125 1.00 42.48  ? 11  LEU C N   1 
ATOM   3266  C CA  . LEU C  1 10  ? 47.572  74.636  135.983 1.00 39.75  ? 11  LEU C CA  1 
ATOM   3267  C C   . LEU C  1 10  ? 48.933  75.072  136.521 1.00 39.28  ? 11  LEU C C   1 
ATOM   3268  O O   . LEU C  1 10  ? 49.548  74.399  137.344 1.00 39.13  ? 11  LEU C O   1 
ATOM   3269  C CB  . LEU C  1 10  ? 46.618  74.272  137.130 1.00 39.51  ? 11  LEU C CB  1 
ATOM   3270  C CG  . LEU C  1 10  ? 46.152  75.415  138.037 1.00 36.86  ? 11  LEU C CG  1 
ATOM   3271  C CD1 . LEU C  1 10  ? 46.572  75.161  139.447 1.00 34.31  ? 11  LEU C CD1 1 
ATOM   3272  C CD2 . LEU C  1 10  ? 46.739  76.728  137.550 1.00 37.67  ? 11  LEU C CD2 1 
ATOM   3273  N N   . SER C  1 11  ? 49.424  76.190  136.016 1.00 39.09  ? 12  SER C N   1 
ATOM   3274  C CA  . SER C  1 11  ? 50.691  76.704  136.479 1.00 38.86  ? 12  SER C CA  1 
ATOM   3275  C C   . SER C  1 11  ? 50.317  77.555  137.655 1.00 39.58  ? 12  SER C C   1 
ATOM   3276  O O   . SER C  1 11  ? 49.484  78.453  137.532 1.00 39.91  ? 12  SER C O   1 
ATOM   3277  C CB  . SER C  1 11  ? 51.343  77.574  135.421 1.00 38.64  ? 12  SER C CB  1 
ATOM   3278  O OG  . SER C  1 11  ? 51.662  76.817  134.279 1.00 39.36  ? 12  SER C OG  1 
ATOM   3279  N N   . ALA C  1 12  ? 50.912  77.266  138.798 1.00 40.75  ? 13  ALA C N   1 
ATOM   3280  C CA  . ALA C  1 12  ? 50.618  78.022  140.009 1.00 43.35  ? 13  ALA C CA  1 
ATOM   3281  C C   . ALA C  1 12  ? 51.923  78.359  140.696 1.00 43.70  ? 13  ALA C C   1 
ATOM   3282  O O   . ALA C  1 12  ? 52.987  78.066  140.166 1.00 44.58  ? 13  ALA C O   1 
ATOM   3283  C CB  . ALA C  1 12  ? 49.722  77.195  140.947 1.00 43.53  ? 13  ALA C CB  1 
ATOM   3284  N N   . SER C  1 13  ? 51.840  78.981  141.867 1.00 43.33  ? 14  SER C N   1 
ATOM   3285  C CA  . SER C  1 13  ? 53.034  79.329  142.621 1.00 44.11  ? 14  SER C CA  1 
ATOM   3286  C C   . SER C  1 13  ? 52.878  78.747  144.014 1.00 45.52  ? 14  SER C C   1 
ATOM   3287  O O   . SER C  1 13  ? 51.851  78.152  144.334 1.00 46.60  ? 14  SER C O   1 
ATOM   3288  C CB  . SER C  1 13  ? 53.186  80.846  142.702 1.00 42.13  ? 14  SER C CB  1 
ATOM   3289  O OG  . SER C  1 13  ? 52.839  81.437  141.466 1.00 42.96  ? 14  SER C OG  1 
ATOM   3290  N N   . VAL C  1 14  ? 53.898  78.895  144.842 1.00 47.54  ? 15  VAL C N   1 
ATOM   3291  C CA  . VAL C  1 14  ? 53.816  78.400  146.206 1.00 49.11  ? 15  VAL C CA  1 
ATOM   3292  C C   . VAL C  1 14  ? 53.151  79.499  147.043 1.00 50.16  ? 15  VAL C C   1 
ATOM   3293  O O   . VAL C  1 14  ? 53.508  80.678  146.931 1.00 50.15  ? 15  VAL C O   1 
ATOM   3294  C CB  . VAL C  1 14  ? 55.223  78.067  146.758 1.00 49.59  ? 15  VAL C CB  1 
ATOM   3295  C CG1 . VAL C  1 14  ? 55.147  77.753  148.250 1.00 48.78  ? 15  VAL C CG1 1 
ATOM   3296  C CG2 . VAL C  1 14  ? 55.803  76.878  145.997 1.00 47.27  ? 15  VAL C CG2 1 
ATOM   3297  N N   . GLY C  1 15  ? 52.176  79.110  147.858 1.00 50.39  ? 16  GLY C N   1 
ATOM   3298  C CA  . GLY C  1 15  ? 51.473  80.078  148.677 1.00 52.59  ? 16  GLY C CA  1 
ATOM   3299  C C   . GLY C  1 15  ? 50.168  80.477  148.010 1.00 54.87  ? 16  GLY C C   1 
ATOM   3300  O O   . GLY C  1 15  ? 49.263  81.058  148.641 1.00 55.87  ? 16  GLY C O   1 
ATOM   3301  N N   . ASP C  1 16  ? 50.081  80.149  146.721 1.00 54.99  ? 17  ASP C N   1 
ATOM   3302  C CA  . ASP C  1 16  ? 48.912  80.431  145.887 1.00 55.25  ? 17  ASP C CA  1 
ATOM   3303  C C   . ASP C  1 16  ? 47.658  79.691  146.378 1.00 53.03  ? 17  ASP C C   1 
ATOM   3304  O O   . ASP C  1 16  ? 47.730  78.856  147.269 1.00 53.71  ? 17  ASP C O   1 
ATOM   3305  C CB  . ASP C  1 16  ? 49.204  80.000  144.435 1.00 59.16  ? 17  ASP C CB  1 
ATOM   3306  C CG  . ASP C  1 16  ? 50.186  80.939  143.709 1.00 63.50  ? 17  ASP C CG  1 
ATOM   3307  O OD1 . ASP C  1 16  ? 51.028  81.575  144.398 1.00 66.32  ? 17  ASP C OD1 1 
ATOM   3308  O OD2 . ASP C  1 16  ? 50.125  81.025  142.448 1.00 62.77  ? 17  ASP C OD2 1 
ATOM   3309  N N   . ARG C  1 17  ? 46.504  80.018  145.810 1.00 49.74  ? 18  ARG C N   1 
ATOM   3310  C CA  . ARG C  1 17  ? 45.285  79.320  146.163 1.00 45.35  ? 18  ARG C CA  1 
ATOM   3311  C C   . ARG C  1 17  ? 44.760  78.719  144.853 1.00 43.94  ? 18  ARG C C   1 
ATOM   3312  O O   . ARG C  1 17  ? 44.658  79.407  143.837 1.00 41.72  ? 18  ARG C O   1 
ATOM   3313  C CB  . ARG C  1 17  ? 44.272  80.273  146.770 1.00 44.39  ? 18  ARG C CB  1 
ATOM   3314  C CG  . ARG C  1 17  ? 43.279  79.564  147.664 1.00 45.71  ? 18  ARG C CG  1 
ATOM   3315  C CD  . ARG C  1 17  ? 42.282  80.520  148.274 1.00 49.21  ? 18  ARG C CD  1 
ATOM   3316  N NE  . ARG C  1 17  ? 41.752  80.052  149.559 1.00 54.70  ? 18  ARG C NE  1 
ATOM   3317  C CZ  . ARG C  1 17  ? 42.470  79.933  150.683 1.00 56.60  ? 18  ARG C CZ  1 
ATOM   3318  N NH1 . ARG C  1 17  ? 43.766  80.241  150.702 1.00 56.05  ? 18  ARG C NH1 1 
ATOM   3319  N NH2 . ARG C  1 17  ? 41.883  79.525  151.806 1.00 57.29  ? 18  ARG C NH2 1 
ATOM   3320  N N   . VAL C  1 18  ? 44.438  77.430  144.877 1.00 42.89  ? 19  VAL C N   1 
ATOM   3321  C CA  . VAL C  1 18  ? 43.970  76.736  143.676 1.00 41.92  ? 19  VAL C CA  1 
ATOM   3322  C C   . VAL C  1 18  ? 42.660  75.950  143.780 1.00 39.97  ? 19  VAL C C   1 
ATOM   3323  O O   . VAL C  1 18  ? 42.475  75.147  144.686 1.00 38.77  ? 19  VAL C O   1 
ATOM   3324  C CB  . VAL C  1 18  ? 45.035  75.737  143.168 1.00 41.70  ? 19  VAL C CB  1 
ATOM   3325  C CG1 . VAL C  1 18  ? 44.432  74.869  142.073 1.00 41.64  ? 19  VAL C CG1 1 
ATOM   3326  C CG2 . VAL C  1 18  ? 46.267  76.474  142.678 1.00 40.90  ? 19  VAL C CG2 1 
ATOM   3327  N N   . THR C  1 19  ? 41.768  76.160  142.821 1.00 38.40  ? 20  THR C N   1 
ATOM   3328  C CA  . THR C  1 19  ? 40.513  75.435  142.820 1.00 37.08  ? 20  THR C CA  1 
ATOM   3329  C C   . THR C  1 19  ? 40.356  74.690  141.505 1.00 37.00  ? 20  THR C C   1 
ATOM   3330  O O   . THR C  1 19  ? 40.064  75.284  140.463 1.00 38.60  ? 20  THR C O   1 
ATOM   3331  C CB  . THR C  1 19  ? 39.292  76.358  143.022 1.00 36.32  ? 20  THR C CB  1 
ATOM   3332  O OG1 . THR C  1 19  ? 39.341  76.969  144.320 1.00 32.45  ? 20  THR C OG1 1 
ATOM   3333  C CG2 . THR C  1 19  ? 38.015  75.550  142.899 1.00 34.80  ? 20  THR C CG2 1 
ATOM   3334  N N   . ILE C  1 20  ? 40.563  73.378  141.576 1.00 35.65  ? 21  ILE C N   1 
ATOM   3335  C CA  . ILE C  1 20  ? 40.460  72.486  140.431 1.00 33.72  ? 21  ILE C CA  1 
ATOM   3336  C C   . ILE C  1 20  ? 39.048  71.925  140.388 1.00 33.60  ? 21  ILE C C   1 
ATOM   3337  O O   . ILE C  1 20  ? 38.637  71.234  141.292 1.00 34.61  ? 21  ILE C O   1 
ATOM   3338  C CB  . ILE C  1 20  ? 41.464  71.326  140.563 1.00 32.03  ? 21  ILE C CB  1 
ATOM   3339  C CG1 . ILE C  1 20  ? 42.903  71.866  140.602 1.00 31.02  ? 21  ILE C CG1 1 
ATOM   3340  C CG2 . ILE C  1 20  ? 41.291  70.377  139.421 1.00 33.64  ? 21  ILE C CG2 1 
ATOM   3341  C CD1 . ILE C  1 20  ? 43.989  70.808  140.802 1.00 25.66  ? 21  ILE C CD1 1 
ATOM   3342  N N   . THR C  1 21  ? 38.292  72.238  139.350 1.00 35.59  ? 22  THR C N   1 
ATOM   3343  C CA  . THR C  1 21  ? 36.924  71.739  139.261 1.00 39.10  ? 22  THR C CA  1 
ATOM   3344  C C   . THR C  1 21  ? 36.874  70.586  138.279 1.00 40.84  ? 22  THR C C   1 
ATOM   3345  O O   . THR C  1 21  ? 37.639  70.551  137.329 1.00 42.05  ? 22  THR C O   1 
ATOM   3346  C CB  . THR C  1 21  ? 35.932  72.818  138.743 1.00 39.91  ? 22  THR C CB  1 
ATOM   3347  O OG1 . THR C  1 21  ? 36.154  73.012  137.343 1.00 41.36  ? 22  THR C OG1 1 
ATOM   3348  C CG2 . THR C  1 21  ? 36.115  74.166  139.468 1.00 37.96  ? 22  THR C CG2 1 
ATOM   3349  N N   . CYS C  1 22  ? 35.970  69.645  138.495 1.00 43.10  ? 23  CYS C N   1 
ATOM   3350  C CA  . CYS C  1 22  ? 35.837  68.508  137.593 1.00 46.27  ? 23  CYS C CA  1 
ATOM   3351  C C   . CYS C  1 22  ? 34.363  68.268  137.414 1.00 47.57  ? 23  CYS C C   1 
ATOM   3352  O O   . CYS C  1 22  ? 33.704  67.774  138.326 1.00 49.52  ? 23  CYS C O   1 
ATOM   3353  C CB  . CYS C  1 22  ? 36.497  67.283  138.205 1.00 48.56  ? 23  CYS C CB  1 
ATOM   3354  S SG  . CYS C  1 22  ? 35.896  65.616  137.731 1.00 53.28  ? 23  CYS C SG  1 
ATOM   3355  N N   . ARG C  1 23  ? 33.845  68.615  136.242 1.00 48.17  ? 24  ARG C N   1 
ATOM   3356  C CA  . ARG C  1 23  ? 32.424  68.463  135.972 1.00 48.52  ? 24  ARG C CA  1 
ATOM   3357  C C   . ARG C  1 23  ? 31.992  67.112  135.373 1.00 48.25  ? 24  ARG C C   1 
ATOM   3358  O O   . ARG C  1 23  ? 32.686  66.508  134.547 1.00 44.89  ? 24  ARG C O   1 
ATOM   3359  C CB  . ARG C  1 23  ? 31.962  69.640  135.105 1.00 49.04  ? 24  ARG C CB  1 
ATOM   3360  C CG  . ARG C  1 23  ? 32.118  70.980  135.826 1.00 48.87  ? 24  ARG C CG  1 
ATOM   3361  C CD  . ARG C  1 23  ? 32.055  72.187  134.880 1.00 50.00  ? 24  ARG C CD  1 
ATOM   3362  N NE  . ARG C  1 23  ? 32.075  73.455  135.623 1.00 50.70  ? 24  ARG C NE  1 
ATOM   3363  C CZ  . ARG C  1 23  ? 32.101  74.663  135.060 1.00 50.94  ? 24  ARG C CZ  1 
ATOM   3364  N NH1 . ARG C  1 23  ? 32.112  74.771  133.733 1.00 51.28  ? 24  ARG C NH1 1 
ATOM   3365  N NH2 . ARG C  1 23  ? 32.113  75.760  135.820 1.00 47.73  ? 24  ARG C NH2 1 
ATOM   3366  N N   . ALA C  1 24  ? 30.832  66.652  135.836 1.00 48.92  ? 25  ALA C N   1 
ATOM   3367  C CA  . ALA C  1 24  ? 30.255  65.392  135.412 1.00 50.41  ? 25  ALA C CA  1 
ATOM   3368  C C   . ALA C  1 24  ? 29.239  65.576  134.277 1.00 52.38  ? 25  ALA C C   1 
ATOM   3369  O O   . ALA C  1 24  ? 28.660  66.664  134.111 1.00 51.90  ? 25  ALA C O   1 
ATOM   3370  C CB  . ALA C  1 24  ? 29.597  64.729  136.598 1.00 49.19  ? 25  ALA C CB  1 
ATOM   3371  N N   . SER C  1 25  ? 29.024  64.512  133.498 1.00 54.02  ? 26  SER C N   1 
ATOM   3372  C CA  . SER C  1 25  ? 28.074  64.565  132.387 1.00 56.40  ? 26  SER C CA  1 
ATOM   3373  C C   . SER C  1 25  ? 26.652  64.319  132.869 1.00 57.26  ? 26  SER C C   1 
ATOM   3374  O O   . SER C  1 25  ? 25.696  64.758  132.240 1.00 56.92  ? 26  SER C O   1 
ATOM   3375  C CB  . SER C  1 25  ? 28.438  63.541  131.307 1.00 56.44  ? 26  SER C CB  1 
ATOM   3376  O OG  . SER C  1 25  ? 28.560  62.242  131.848 1.00 59.24  ? 26  SER C OG  1 
ATOM   3377  N N   . GLN C  1 26  ? 26.528  63.619  133.991 1.00 59.09  ? 27  GLN C N   1 
ATOM   3378  C CA  . GLN C  1 26  ? 25.233  63.311  134.591 1.00 61.07  ? 27  GLN C CA  1 
ATOM   3379  C C   . GLN C  1 26  ? 25.374  63.108  136.113 1.00 61.26  ? 27  GLN C C   1 
ATOM   3380  O O   . GLN C  1 26  ? 26.316  62.458  136.581 1.00 60.38  ? 27  GLN C O   1 
ATOM   3381  C CB  . GLN C  1 26  ? 24.625  62.061  133.935 1.00 62.90  ? 27  GLN C CB  1 
ATOM   3382  C CG  . GLN C  1 26  ? 23.574  62.342  132.849 1.00 66.90  ? 27  GLN C CG  1 
ATOM   3383  C CD  . GLN C  1 26  ? 24.149  62.468  131.438 1.00 69.58  ? 27  GLN C CD  1 
ATOM   3384  O OE1 . GLN C  1 26  ? 24.696  61.506  130.892 1.00 72.21  ? 27  GLN C OE1 1 
ATOM   3385  N NE2 . GLN C  1 26  ? 24.011  63.651  130.836 1.00 69.46  ? 27  GLN C NE2 1 
ATOM   3386  N N   . SER C  1 27  ? 24.425  63.667  136.867 1.00 61.49  ? 28  SER C N   1 
ATOM   3387  C CA  . SER C  1 27  ? 24.395  63.613  138.338 1.00 61.76  ? 28  SER C CA  1 
ATOM   3388  C C   . SER C  1 27  ? 25.146  62.510  139.072 1.00 61.71  ? 28  SER C C   1 
ATOM   3389  O O   . SER C  1 27  ? 24.686  61.377  139.109 1.00 61.11  ? 28  SER C O   1 
ATOM   3390  C CB  . SER C  1 27  ? 22.952  63.573  138.829 1.00 62.04  ? 28  SER C CB  1 
ATOM   3391  O OG  . SER C  1 27  ? 22.904  63.391  140.234 1.00 60.60  ? 28  SER C OG  1 
ATOM   3392  N N   . ILE C  1 28  ? 26.280  62.847  139.681 1.00 62.09  ? 29  ILE C N   1 
ATOM   3393  C CA  . ILE C  1 28  ? 27.046  61.860  140.440 1.00 62.70  ? 29  ILE C CA  1 
ATOM   3394  C C   . ILE C  1 28  ? 26.888  62.149  141.940 1.00 63.31  ? 29  ILE C C   1 
ATOM   3395  O O   . ILE C  1 28  ? 27.791  61.930  142.746 1.00 62.80  ? 29  ILE C O   1 
ATOM   3396  C CB  . ILE C  1 28  ? 28.565  61.853  140.038 1.00 61.69  ? 29  ILE C CB  1 
ATOM   3397  C CG1 . ILE C  1 28  ? 29.368  62.869  140.855 1.00 61.28  ? 29  ILE C CG1 1 
ATOM   3398  C CG2 . ILE C  1 28  ? 28.697  62.195  138.579 1.00 61.29  ? 29  ILE C CG2 1 
ATOM   3399  C CD1 . ILE C  1 28  ? 30.878  62.722  140.725 1.00 59.01  ? 29  ILE C CD1 1 
ATOM   3400  N N   . SER C  1 29  ? 25.709  62.638  142.301 1.00 64.77  ? 30  SER C N   1 
ATOM   3401  C CA  . SER C  1 29  ? 25.395  62.959  143.685 1.00 66.10  ? 30  SER C CA  1 
ATOM   3402  C C   . SER C  1 29  ? 26.594  63.521  144.413 1.00 66.89  ? 30  SER C C   1 
ATOM   3403  O O   . SER C  1 29  ? 26.837  64.729  144.384 1.00 67.25  ? 30  SER C O   1 
ATOM   3404  C CB  . SER C  1 29  ? 24.890  61.716  144.425 1.00 66.43  ? 30  SER C CB  1 
ATOM   3405  O OG  . SER C  1 29  ? 23.559  61.396  144.048 1.00 66.73  ? 30  SER C OG  1 
ATOM   3406  N N   . SER C  1 30  ? 27.349  62.636  145.058 1.00 67.30  ? 31  SER C N   1 
ATOM   3407  C CA  . SER C  1 30  ? 28.524  63.056  145.806 1.00 68.00  ? 31  SER C CA  1 
ATOM   3408  C C   . SER C  1 30  ? 29.718  62.101  145.685 1.00 67.33  ? 31  SER C C   1 
ATOM   3409  O O   . SER C  1 30  ? 30.831  62.428  146.108 1.00 67.69  ? 31  SER C O   1 
ATOM   3410  C CB  . SER C  1 30  ? 28.152  63.235  147.286 1.00 68.76  ? 31  SER C CB  1 
ATOM   3411  O OG  . SER C  1 30  ? 27.262  64.323  147.469 1.00 69.53  ? 31  SER C OG  1 
ATOM   3412  N N   . TYR C  1 31  ? 29.495  60.934  145.096 1.00 65.74  ? 32  TYR C N   1 
ATOM   3413  C CA  . TYR C  1 31  ? 30.559  59.946  144.966 1.00 64.59  ? 32  TYR C CA  1 
ATOM   3414  C C   . TYR C  1 31  ? 31.774  60.382  144.137 1.00 61.66  ? 32  TYR C C   1 
ATOM   3415  O O   . TYR C  1 31  ? 32.369  59.569  143.424 1.00 62.56  ? 32  TYR C O   1 
ATOM   3416  C CB  . TYR C  1 31  ? 29.995  58.651  144.383 1.00 67.81  ? 32  TYR C CB  1 
ATOM   3417  C CG  . TYR C  1 31  ? 28.838  58.055  145.158 1.00 70.33  ? 32  TYR C CG  1 
ATOM   3418  C CD1 . TYR C  1 31  ? 27.558  58.607  145.080 1.00 71.58  ? 32  TYR C CD1 1 
ATOM   3419  C CD2 . TYR C  1 31  ? 29.014  56.900  145.923 1.00 71.64  ? 32  TYR C CD2 1 
ATOM   3420  C CE1 . TYR C  1 31  ? 26.479  58.019  145.734 1.00 73.07  ? 32  TYR C CE1 1 
ATOM   3421  C CE2 . TYR C  1 31  ? 27.947  56.305  146.583 1.00 73.18  ? 32  TYR C CE2 1 
ATOM   3422  C CZ  . TYR C  1 31  ? 26.683  56.866  146.483 1.00 74.32  ? 32  TYR C CZ  1 
ATOM   3423  O OH  . TYR C  1 31  ? 25.623  56.269  147.132 1.00 76.12  ? 32  TYR C OH  1 
ATOM   3424  N N   . LEU C  1 32  ? 32.145  61.650  144.222 1.00 55.82  ? 33  LEU C N   1 
ATOM   3425  C CA  . LEU C  1 32  ? 33.294  62.126  143.486 1.00 51.76  ? 33  LEU C CA  1 
ATOM   3426  C C   . LEU C  1 32  ? 34.523  61.980  144.390 1.00 50.66  ? 33  LEU C C   1 
ATOM   3427  O O   . LEU C  1 32  ? 34.475  62.331  145.570 1.00 50.35  ? 33  LEU C O   1 
ATOM   3428  C CB  . LEU C  1 32  ? 33.062  63.585  143.079 1.00 50.82  ? 33  LEU C CB  1 
ATOM   3429  C CG  . LEU C  1 32  ? 34.164  64.379  142.365 1.00 50.74  ? 33  LEU C CG  1 
ATOM   3430  C CD1 . LEU C  1 32  ? 35.197  64.928  143.350 1.00 49.60  ? 33  LEU C CD1 1 
ATOM   3431  C CD2 . LEU C  1 32  ? 34.819  63.478  141.346 1.00 51.68  ? 33  LEU C CD2 1 
ATOM   3432  N N   . ASN C  1 33  ? 35.618  61.450  143.850 1.00 48.79  ? 34  ASN C N   1 
ATOM   3433  C CA  . ASN C  1 33  ? 36.842  61.268  144.636 1.00 47.13  ? 34  ASN C CA  1 
ATOM   3434  C C   . ASN C  1 33  ? 38.036  61.879  143.931 1.00 45.11  ? 34  ASN C C   1 
ATOM   3435  O O   . ASN C  1 33  ? 38.201  61.715  142.732 1.00 44.83  ? 34  ASN C O   1 
ATOM   3436  C CB  . ASN C  1 33  ? 37.128  59.786  144.855 1.00 50.60  ? 34  ASN C CB  1 
ATOM   3437  C CG  . ASN C  1 33  ? 35.877  58.987  145.159 1.00 53.99  ? 34  ASN C CG  1 
ATOM   3438  O OD1 . ASN C  1 33  ? 35.228  59.188  146.190 1.00 56.19  ? 34  ASN C OD1 1 
ATOM   3439  N ND2 . ASN C  1 33  ? 35.527  58.073  144.256 1.00 54.41  ? 34  ASN C ND2 1 
ATOM   3440  N N   . TRP C  1 34  ? 38.878  62.571  144.682 1.00 42.80  ? 35  TRP C N   1 
ATOM   3441  C CA  . TRP C  1 34  ? 40.052  63.205  144.108 1.00 41.20  ? 35  TRP C CA  1 
ATOM   3442  C C   . TRP C  1 34  ? 41.297  62.426  144.456 1.00 40.84  ? 35  TRP C C   1 
ATOM   3443  O O   . TRP C  1 34  ? 41.596  62.226  145.625 1.00 41.38  ? 35  TRP C O   1 
ATOM   3444  C CB  . TRP C  1 34  ? 40.220  64.628  144.636 1.00 39.78  ? 35  TRP C CB  1 
ATOM   3445  C CG  . TRP C  1 34  ? 39.149  65.582  144.249 1.00 39.53  ? 35  TRP C CG  1 
ATOM   3446  C CD1 . TRP C  1 34  ? 38.156  66.069  145.048 1.00 40.69  ? 35  TRP C CD1 1 
ATOM   3447  C CD2 . TRP C  1 34  ? 39.000  66.233  142.984 1.00 37.90  ? 35  TRP C CD2 1 
ATOM   3448  N NE1 . TRP C  1 34  ? 37.398  66.992  144.357 1.00 40.58  ? 35  TRP C NE1 1 
ATOM   3449  C CE2 . TRP C  1 34  ? 37.900  67.109  143.089 1.00 37.71  ? 35  TRP C CE2 1 
ATOM   3450  C CE3 . TRP C  1 34  ? 39.695  66.167  141.776 1.00 36.29  ? 35  TRP C CE3 1 
ATOM   3451  C CZ2 . TRP C  1 34  ? 37.486  67.906  142.039 1.00 36.15  ? 35  TRP C CZ2 1 
ATOM   3452  C CZ3 . TRP C  1 34  ? 39.284  66.962  140.732 1.00 35.46  ? 35  TRP C CZ3 1 
ATOM   3453  C CH2 . TRP C  1 34  ? 38.191  67.821  140.869 1.00 36.18  ? 35  TRP C CH2 1 
ATOM   3454  N N   . TYR C  1 35  ? 42.029  61.991  143.445 1.00 40.60  ? 36  TYR C N   1 
ATOM   3455  C CA  . TYR C  1 35  ? 43.254  61.260  143.683 1.00 41.67  ? 36  TYR C CA  1 
ATOM   3456  C C   . TYR C  1 35  ? 44.429  62.155  143.367 1.00 42.45  ? 36  TYR C C   1 
ATOM   3457  O O   . TYR C  1 35  ? 44.267  63.229  142.812 1.00 43.96  ? 36  TYR C O   1 
ATOM   3458  C CB  . TYR C  1 35  ? 43.335  60.035  142.794 1.00 42.28  ? 36  TYR C CB  1 
ATOM   3459  C CG  . TYR C  1 35  ? 42.302  58.981  143.065 1.00 44.37  ? 36  TYR C CG  1 
ATOM   3460  C CD1 . TYR C  1 35  ? 40.954  59.302  143.125 1.00 46.05  ? 36  TYR C CD1 1 
ATOM   3461  C CD2 . TYR C  1 35  ? 42.669  57.645  143.185 1.00 45.88  ? 36  TYR C CD2 1 
ATOM   3462  C CE1 . TYR C  1 35  ? 39.988  58.314  143.289 1.00 48.04  ? 36  TYR C CE1 1 
ATOM   3463  C CE2 . TYR C  1 35  ? 41.720  56.652  143.348 1.00 47.44  ? 36  TYR C CE2 1 
ATOM   3464  C CZ  . TYR C  1 35  ? 40.377  56.989  143.397 1.00 48.37  ? 36  TYR C CZ  1 
ATOM   3465  O OH  . TYR C  1 35  ? 39.425  56.002  143.528 1.00 48.56  ? 36  TYR C OH  1 
ATOM   3466  N N   . GLN C  1 36  ? 45.620  61.700  143.716 1.00 43.49  ? 37  GLN C N   1 
ATOM   3467  C CA  . GLN C  1 36  ? 46.827  62.456  143.450 1.00 44.57  ? 37  GLN C CA  1 
ATOM   3468  C C   . GLN C  1 36  ? 47.893  61.502  142.954 1.00 44.67  ? 37  GLN C C   1 
ATOM   3469  O O   . GLN C  1 36  ? 47.875  60.319  143.276 1.00 44.73  ? 37  GLN C O   1 
ATOM   3470  C CB  . GLN C  1 36  ? 47.321  63.147  144.715 1.00 44.35  ? 37  GLN C CB  1 
ATOM   3471  C CG  . GLN C  1 36  ? 48.406  64.170  144.455 1.00 46.88  ? 37  GLN C CG  1 
ATOM   3472  C CD  . GLN C  1 36  ? 49.026  64.695  145.734 1.00 49.90  ? 37  GLN C CD  1 
ATOM   3473  O OE1 . GLN C  1 36  ? 49.697  63.959  146.457 1.00 51.57  ? 37  GLN C OE1 1 
ATOM   3474  N NE2 . GLN C  1 36  ? 48.802  65.975  146.024 1.00 50.64  ? 37  GLN C NE2 1 
ATOM   3475  N N   . GLN C  1 37  ? 48.820  62.018  142.163 1.00 45.40  ? 38  GLN C N   1 
ATOM   3476  C CA  . GLN C  1 37  ? 49.899  61.200  141.639 1.00 46.94  ? 38  GLN C CA  1 
ATOM   3477  C C   . GLN C  1 37  ? 51.085  62.088  141.340 1.00 48.39  ? 38  GLN C C   1 
ATOM   3478  O O   . GLN C  1 37  ? 50.940  63.299  141.181 1.00 47.71  ? 38  GLN C O   1 
ATOM   3479  C CB  . GLN C  1 37  ? 49.460  60.481  140.371 1.00 45.95  ? 38  GLN C CB  1 
ATOM   3480  C CG  . GLN C  1 37  ? 50.435  59.455  139.857 1.00 45.54  ? 38  GLN C CG  1 
ATOM   3481  C CD  . GLN C  1 37  ? 49.946  58.801  138.560 1.00 49.14  ? 38  GLN C CD  1 
ATOM   3482  O OE1 . GLN C  1 37  ? 49.876  59.451  137.505 1.00 49.69  ? 38  GLN C OE1 1 
ATOM   3483  N NE2 . GLN C  1 37  ? 49.595  57.513  138.635 1.00 46.82  ? 38  GLN C NE2 1 
ATOM   3484  N N   . LYS C  1 38  ? 52.262  61.477  141.286 1.00 51.10  ? 39  LYS C N   1 
ATOM   3485  C CA  . LYS C  1 38  ? 53.497  62.193  141.001 1.00 52.98  ? 39  LYS C CA  1 
ATOM   3486  C C   . LYS C  1 38  ? 54.341  61.358  140.041 1.00 55.21  ? 39  LYS C C   1 
ATOM   3487  O O   . LYS C  1 38  ? 54.038  60.185  139.806 1.00 55.08  ? 39  LYS C O   1 
ATOM   3488  C CB  . LYS C  1 38  ? 54.268  62.457  142.295 1.00 51.37  ? 39  LYS C CB  1 
ATOM   3489  C CG  . LYS C  1 38  ? 53.608  63.466  143.211 1.00 51.27  ? 39  LYS C CG  1 
ATOM   3490  C CD  . LYS C  1 38  ? 54.516  63.867  144.369 1.00 50.73  ? 39  LYS C CD  1 
ATOM   3491  C CE  . LYS C  1 38  ? 53.799  64.744  145.394 1.00 51.23  ? 39  LYS C CE  1 
ATOM   3492  N NZ  . LYS C  1 38  ? 54.719  65.148  146.502 1.00 49.35  ? 39  LYS C NZ  1 
ATOM   3493  N N   . PRO C  1 39  ? 55.398  61.958  139.458 1.00 57.44  ? 40  PRO C N   1 
ATOM   3494  C CA  . PRO C  1 39  ? 56.261  61.230  138.525 1.00 58.62  ? 40  PRO C CA  1 
ATOM   3495  C C   . PRO C  1 39  ? 56.746  59.889  139.088 1.00 59.40  ? 40  PRO C C   1 
ATOM   3496  O O   . PRO C  1 39  ? 57.540  59.851  140.029 1.00 59.31  ? 40  PRO C O   1 
ATOM   3497  C CB  . PRO C  1 39  ? 57.410  62.212  138.288 1.00 58.80  ? 40  PRO C CB  1 
ATOM   3498  C CG  . PRO C  1 39  ? 56.723  63.534  138.362 1.00 58.36  ? 40  PRO C CG  1 
ATOM   3499  C CD  . PRO C  1 39  ? 55.846  63.359  139.588 1.00 58.40  ? 40  PRO C CD  1 
ATOM   3500  N N   . GLY C  1 40  ? 56.242  58.798  138.518 1.00 59.79  ? 41  GLY C N   1 
ATOM   3501  C CA  . GLY C  1 40  ? 56.648  57.475  138.951 1.00 60.85  ? 41  GLY C CA  1 
ATOM   3502  C C   . GLY C  1 40  ? 55.931  56.858  140.140 1.00 62.04  ? 41  GLY C C   1 
ATOM   3503  O O   . GLY C  1 40  ? 55.740  55.640  140.178 1.00 62.41  ? 41  GLY C O   1 
ATOM   3504  N N   . LYS C  1 41  ? 55.518  57.670  141.107 1.00 62.20  ? 42  LYS C N   1 
ATOM   3505  C CA  . LYS C  1 41  ? 54.856  57.125  142.284 1.00 62.31  ? 42  LYS C CA  1 
ATOM   3506  C C   . LYS C  1 41  ? 53.366  56.815  142.161 1.00 61.75  ? 42  LYS C C   1 
ATOM   3507  O O   . LYS C  1 41  ? 52.632  57.468  141.412 1.00 62.21  ? 42  LYS C O   1 
ATOM   3508  C CB  . LYS C  1 41  ? 55.103  58.043  143.475 1.00 63.63  ? 42  LYS C CB  1 
ATOM   3509  C CG  . LYS C  1 41  ? 56.581  58.239  143.758 1.00 67.50  ? 42  LYS C CG  1 
ATOM   3510  C CD  . LYS C  1 41  ? 57.318  56.891  143.810 1.00 70.70  ? 42  LYS C CD  1 
ATOM   3511  C CE  . LYS C  1 41  ? 58.830  57.052  144.037 1.00 71.97  ? 42  LYS C CE  1 
ATOM   3512  N NZ  . LYS C  1 41  ? 59.587  55.765  143.868 1.00 72.26  ? 42  LYS C NZ  1 
ATOM   3513  N N   . VAL C  1 42  ? 52.948  55.801  142.919 1.00 60.62  ? 43  VAL C N   1 
ATOM   3514  C CA  . VAL C  1 42  ? 51.569  55.311  142.977 1.00 58.94  ? 43  VAL C CA  1 
ATOM   3515  C C   . VAL C  1 42  ? 50.550  56.453  143.168 1.00 58.32  ? 43  VAL C C   1 
ATOM   3516  O O   . VAL C  1 42  ? 50.876  57.529  143.696 1.00 57.65  ? 43  VAL C O   1 
ATOM   3517  C CB  . VAL C  1 42  ? 51.415  54.286  144.158 1.00 58.55  ? 43  VAL C CB  1 
ATOM   3518  C CG1 . VAL C  1 42  ? 50.058  53.612  144.124 1.00 57.16  ? 43  VAL C CG1 1 
ATOM   3519  C CG2 . VAL C  1 42  ? 52.516  53.249  144.098 1.00 58.13  ? 43  VAL C CG2 1 
ATOM   3520  N N   . PRO C  1 43  ? 49.302  56.233  142.722 1.00 57.14  ? 44  PRO C N   1 
ATOM   3521  C CA  . PRO C  1 43  ? 48.236  57.232  142.848 1.00 56.57  ? 44  PRO C CA  1 
ATOM   3522  C C   . PRO C  1 43  ? 47.793  57.266  144.296 1.00 56.23  ? 44  PRO C C   1 
ATOM   3523  O O   . PRO C  1 43  ? 47.994  56.298  145.024 1.00 57.60  ? 44  PRO C O   1 
ATOM   3524  C CB  . PRO C  1 43  ? 47.132  56.676  141.960 1.00 56.93  ? 44  PRO C CB  1 
ATOM   3525  C CG  . PRO C  1 43  ? 47.868  55.814  140.979 1.00 57.08  ? 44  PRO C CG  1 
ATOM   3526  C CD  . PRO C  1 43  ? 48.883  55.137  141.835 1.00 56.70  ? 44  PRO C CD  1 
ATOM   3527  N N   . LYS C  1 44  ? 47.182  58.358  144.725 1.00 55.08  ? 45  LYS C N   1 
ATOM   3528  C CA  . LYS C  1 44  ? 46.725  58.425  146.103 1.00 54.18  ? 45  LYS C CA  1 
ATOM   3529  C C   . LYS C  1 44  ? 45.303  58.957  146.197 1.00 54.29  ? 45  LYS C C   1 
ATOM   3530  O O   . LYS C  1 44  ? 44.937  59.885  145.486 1.00 55.75  ? 45  LYS C O   1 
ATOM   3531  C CB  . LYS C  1 44  ? 47.660  59.306  146.925 1.00 53.00  ? 45  LYS C CB  1 
ATOM   3532  C CG  . LYS C  1 44  ? 47.324  59.342  148.403 1.00 51.52  ? 45  LYS C CG  1 
ATOM   3533  C CD  . LYS C  1 44  ? 48.367  60.131  149.164 1.00 50.44  ? 45  LYS C CD  1 
ATOM   3534  C CE  . LYS C  1 44  ? 48.095  60.133  150.651 1.00 48.97  ? 45  LYS C CE  1 
ATOM   3535  N NZ  . LYS C  1 44  ? 49.055  61.033  151.338 1.00 48.76  ? 45  LYS C NZ  1 
ATOM   3536  N N   . LEU C  1 45  ? 44.492  58.350  147.056 1.00 53.38  ? 46  LEU C N   1 
ATOM   3537  C CA  . LEU C  1 45  ? 43.125  58.808  147.237 1.00 52.56  ? 46  LEU C CA  1 
ATOM   3538  C C   . LEU C  1 45  ? 43.243  59.867  148.295 1.00 52.01  ? 46  LEU C C   1 
ATOM   3539  O O   . LEU C  1 45  ? 43.568  59.557  149.427 1.00 51.99  ? 46  LEU C O   1 
ATOM   3540  C CB  . LEU C  1 45  ? 42.217  57.693  147.759 1.00 52.41  ? 46  LEU C CB  1 
ATOM   3541  C CG  . LEU C  1 45  ? 40.759  58.093  148.035 1.00 50.91  ? 46  LEU C CG  1 
ATOM   3542  C CD1 . LEU C  1 45  ? 40.025  58.354  146.707 1.00 48.45  ? 46  LEU C CD1 1 
ATOM   3543  C CD2 . LEU C  1 45  ? 40.074  56.986  148.828 1.00 48.52  ? 46  LEU C CD2 1 
ATOM   3544  N N   . LEU C  1 46  ? 43.002  61.117  147.928 1.00 52.37  ? 47  LEU C N   1 
ATOM   3545  C CA  . LEU C  1 46  ? 43.102  62.194  148.890 1.00 53.32  ? 47  LEU C CA  1 
ATOM   3546  C C   . LEU C  1 46  ? 41.735  62.604  149.363 1.00 54.02  ? 47  LEU C C   1 
ATOM   3547  O O   . LEU C  1 46  ? 41.580  63.106  150.471 1.00 54.33  ? 47  LEU C O   1 
ATOM   3548  C CB  . LEU C  1 46  ? 43.805  63.406  148.283 1.00 52.51  ? 47  LEU C CB  1 
ATOM   3549  C CG  . LEU C  1 46  ? 45.235  63.201  147.794 1.00 52.12  ? 47  LEU C CG  1 
ATOM   3550  C CD1 . LEU C  1 46  ? 46.039  64.463  148.096 1.00 52.36  ? 47  LEU C CD1 1 
ATOM   3551  C CD2 . LEU C  1 46  ? 45.857  62.011  148.483 1.00 50.62  ? 47  LEU C CD2 1 
ATOM   3552  N N   . ILE C  1 47  ? 40.740  62.391  148.518 1.00 54.36  ? 48  ILE C N   1 
ATOM   3553  C CA  . ILE C  1 47  ? 39.390  62.765  148.879 1.00 55.83  ? 48  ILE C CA  1 
ATOM   3554  C C   . ILE C  1 47  ? 38.377  61.848  148.224 1.00 58.97  ? 48  ILE C C   1 
ATOM   3555  O O   . ILE C  1 47  ? 38.509  61.497  147.047 1.00 60.51  ? 48  ILE C O   1 
ATOM   3556  C CB  . ILE C  1 47  ? 39.096  64.247  148.484 1.00 53.23  ? 48  ILE C CB  1 
ATOM   3557  C CG1 . ILE C  1 47  ? 39.789  65.191  149.472 1.00 50.70  ? 48  ILE C CG1 1 
ATOM   3558  C CG2 . ILE C  1 47  ? 37.592  64.505  148.443 1.00 49.98  ? 48  ILE C CG2 1 
ATOM   3559  C CD1 . ILE C  1 47  ? 39.513  66.651  149.238 1.00 49.17  ? 48  ILE C CD1 1 
ATOM   3560  N N   . TYR C  1 48  ? 37.385  61.436  149.012 1.00 61.65  ? 49  TYR C N   1 
ATOM   3561  C CA  . TYR C  1 48  ? 36.303  60.588  148.530 1.00 63.72  ? 49  TYR C CA  1 
ATOM   3562  C C   . TYR C  1 48  ? 35.015  61.199  149.048 1.00 63.34  ? 49  TYR C C   1 
ATOM   3563  O O   . TYR C  1 48  ? 35.033  62.029  149.954 1.00 62.59  ? 49  TYR C O   1 
ATOM   3564  C CB  . TYR C  1 48  ? 36.446  59.131  149.015 1.00 66.46  ? 49  TYR C CB  1 
ATOM   3565  C CG  . TYR C  1 48  ? 36.241  58.903  150.499 1.00 70.51  ? 49  TYR C CG  1 
ATOM   3566  C CD1 . TYR C  1 48  ? 35.519  57.794  150.962 1.00 71.94  ? 49  TYR C CD1 1 
ATOM   3567  C CD2 . TYR C  1 48  ? 36.804  59.766  151.445 1.00 71.73  ? 49  TYR C CD2 1 
ATOM   3568  C CE1 . TYR C  1 48  ? 35.364  57.547  152.338 1.00 73.80  ? 49  TYR C CE1 1 
ATOM   3569  C CE2 . TYR C  1 48  ? 36.661  59.533  152.823 1.00 74.03  ? 49  TYR C CE2 1 
ATOM   3570  C CZ  . TYR C  1 48  ? 35.943  58.422  153.265 1.00 74.69  ? 49  TYR C CZ  1 
ATOM   3571  O OH  . TYR C  1 48  ? 35.835  58.182  154.623 1.00 73.63  ? 49  TYR C OH  1 
ATOM   3572  N N   . ALA C  1 49  ? 33.898  60.806  148.458 1.00 64.08  ? 50  ALA C N   1 
ATOM   3573  C CA  . ALA C  1 49  ? 32.614  61.344  148.873 1.00 64.76  ? 50  ALA C CA  1 
ATOM   3574  C C   . ALA C  1 49  ? 32.636  62.863  148.765 1.00 64.49  ? 50  ALA C C   1 
ATOM   3575  O O   . ALA C  1 49  ? 32.451  63.569  149.758 1.00 64.82  ? 50  ALA C O   1 
ATOM   3576  C CB  . ALA C  1 49  ? 32.316  60.924  150.306 1.00 65.88  ? 50  ALA C CB  1 
ATOM   3577  N N   . ALA C  1 50  ? 32.867  63.365  147.558 1.00 63.73  ? 51  ALA C N   1 
ATOM   3578  C CA  . ALA C  1 50  ? 32.911  64.802  147.350 1.00 63.23  ? 51  ALA C CA  1 
ATOM   3579  C C   . ALA C  1 50  ? 33.783  65.460  148.422 1.00 63.10  ? 51  ALA C C   1 
ATOM   3580  O O   . ALA C  1 50  ? 35.012  65.378  148.396 1.00 63.53  ? 51  ALA C O   1 
ATOM   3581  C CB  . ALA C  1 50  ? 31.498  65.372  147.405 1.00 62.60  ? 51  ALA C CB  1 
ATOM   3582  N N   . SER C  1 51  ? 33.121  66.090  149.380 1.00 62.09  ? 52  SER C N   1 
ATOM   3583  C CA  . SER C  1 51  ? 33.787  66.795  150.459 1.00 61.49  ? 52  SER C CA  1 
ATOM   3584  C C   . SER C  1 51  ? 34.376  65.944  151.582 1.00 60.44  ? 52  SER C C   1 
ATOM   3585  O O   . SER C  1 51  ? 34.968  66.487  152.513 1.00 60.20  ? 52  SER C O   1 
ATOM   3586  C CB  . SER C  1 51  ? 32.805  67.795  151.074 1.00 63.09  ? 52  SER C CB  1 
ATOM   3587  O OG  . SER C  1 51  ? 31.634  67.145  151.563 1.00 62.97  ? 52  SER C OG  1 
ATOM   3588  N N   . SER C  1 52  ? 34.234  64.625  151.510 1.00 59.57  ? 53  SER C N   1 
ATOM   3589  C CA  . SER C  1 52  ? 34.734  63.780  152.596 1.00 58.58  ? 53  SER C CA  1 
ATOM   3590  C C   . SER C  1 52  ? 36.214  63.404  152.556 1.00 57.20  ? 53  SER C C   1 
ATOM   3591  O O   . SER C  1 52  ? 36.601  62.354  152.041 1.00 55.46  ? 53  SER C O   1 
ATOM   3592  C CB  . SER C  1 52  ? 33.886  62.513  152.720 1.00 59.37  ? 53  SER C CB  1 
ATOM   3593  O OG  . SER C  1 52  ? 34.221  61.797  153.894 1.00 59.06  ? 53  SER C OG  1 
ATOM   3594  N N   . LEU C  1 53  ? 37.024  64.279  153.145 1.00 56.54  ? 54  LEU C N   1 
ATOM   3595  C CA  . LEU C  1 53  ? 38.469  64.118  153.233 1.00 55.64  ? 54  LEU C CA  1 
ATOM   3596  C C   . LEU C  1 53  ? 38.884  62.709  153.665 1.00 56.44  ? 54  LEU C C   1 
ATOM   3597  O O   . LEU C  1 53  ? 38.057  61.911  154.109 1.00 58.21  ? 54  LEU C O   1 
ATOM   3598  C CB  . LEU C  1 53  ? 39.018  65.157  154.210 1.00 52.50  ? 54  LEU C CB  1 
ATOM   3599  C CG  . LEU C  1 53  ? 40.523  65.278  154.359 1.00 49.82  ? 54  LEU C CG  1 
ATOM   3600  C CD1 . LEU C  1 53  ? 40.902  66.739  154.492 1.00 49.56  ? 54  LEU C CD1 1 
ATOM   3601  C CD2 . LEU C  1 53  ? 40.962  64.479  155.552 1.00 50.59  ? 54  LEU C CD2 1 
ATOM   3602  N N   . GLN C  1 54  ? 40.171  62.411  153.531 1.00 56.00  ? 55  GLN C N   1 
ATOM   3603  C CA  . GLN C  1 54  ? 40.700  61.105  153.887 1.00 55.45  ? 55  GLN C CA  1 
ATOM   3604  C C   . GLN C  1 54  ? 41.837  61.216  154.873 1.00 55.71  ? 55  GLN C C   1 
ATOM   3605  O O   . GLN C  1 54  ? 42.590  62.184  154.864 1.00 55.36  ? 55  GLN C O   1 
ATOM   3606  C CB  . GLN C  1 54  ? 41.204  60.388  152.644 1.00 56.58  ? 55  GLN C CB  1 
ATOM   3607  C CG  . GLN C  1 54  ? 42.011  59.139  152.931 1.00 56.59  ? 55  GLN C CG  1 
ATOM   3608  C CD  . GLN C  1 54  ? 41.187  58.052  153.568 1.00 57.72  ? 55  GLN C CD  1 
ATOM   3609  O OE1 . GLN C  1 54  ? 40.847  58.118  154.758 1.00 56.93  ? 55  GLN C OE1 1 
ATOM   3610  N NE2 . GLN C  1 54  ? 40.846  57.036  152.775 1.00 57.02  ? 55  GLN C NE2 1 
ATOM   3611  N N   . SER C  1 55  ? 41.967  60.196  155.710 1.00 56.09  ? 56  SER C N   1 
ATOM   3612  C CA  . SER C  1 55  ? 43.008  60.158  156.728 1.00 55.68  ? 56  SER C CA  1 
ATOM   3613  C C   . SER C  1 55  ? 44.423  60.265  156.178 1.00 53.58  ? 56  SER C C   1 
ATOM   3614  O O   . SER C  1 55  ? 44.762  59.657  155.166 1.00 52.55  ? 56  SER C O   1 
ATOM   3615  C CB  . SER C  1 55  ? 42.893  58.876  157.554 1.00 56.60  ? 56  SER C CB  1 
ATOM   3616  O OG  . SER C  1 55  ? 44.024  58.728  158.401 1.00 58.49  ? 56  SER C OG  1 
ATOM   3617  N N   . GLY C  1 56  ? 45.247  61.031  156.879 1.00 51.90  ? 57  GLY C N   1 
ATOM   3618  C CA  . GLY C  1 56  ? 46.614  61.205  156.462 1.00 50.87  ? 57  GLY C CA  1 
ATOM   3619  C C   . GLY C  1 56  ? 46.672  62.252  155.384 1.00 50.85  ? 57  GLY C C   1 
ATOM   3620  O O   . GLY C  1 56  ? 47.484  62.140  154.469 1.00 51.30  ? 57  GLY C O   1 
ATOM   3621  N N   . VAL C  1 57  ? 45.803  63.261  155.475 1.00 50.15  ? 58  VAL C N   1 
ATOM   3622  C CA  . VAL C  1 57  ? 45.785  64.335  154.482 1.00 48.84  ? 58  VAL C CA  1 
ATOM   3623  C C   . VAL C  1 57  ? 45.932  65.704  155.108 1.00 47.74  ? 58  VAL C C   1 
ATOM   3624  O O   . VAL C  1 57  ? 45.329  66.002  156.125 1.00 47.24  ? 58  VAL C O   1 
ATOM   3625  C CB  . VAL C  1 57  ? 44.499  64.351  153.648 1.00 48.56  ? 58  VAL C CB  1 
ATOM   3626  C CG1 . VAL C  1 57  ? 44.524  65.550  152.696 1.00 49.06  ? 58  VAL C CG1 1 
ATOM   3627  C CG2 . VAL C  1 57  ? 44.374  63.066  152.860 1.00 48.10  ? 58  VAL C CG2 1 
ATOM   3628  N N   . PRO C  1 58  ? 46.759  66.555  154.502 1.00 47.40  ? 59  PRO C N   1 
ATOM   3629  C CA  . PRO C  1 58  ? 46.937  67.893  155.060 1.00 47.33  ? 59  PRO C CA  1 
ATOM   3630  C C   . PRO C  1 58  ? 45.632  68.666  155.037 1.00 47.17  ? 59  PRO C C   1 
ATOM   3631  O O   . PRO C  1 58  ? 44.659  68.236  154.421 1.00 46.21  ? 59  PRO C O   1 
ATOM   3632  C CB  . PRO C  1 58  ? 48.008  68.493  154.159 1.00 47.22  ? 59  PRO C CB  1 
ATOM   3633  C CG  . PRO C  1 58  ? 48.862  67.272  153.832 1.00 46.80  ? 59  PRO C CG  1 
ATOM   3634  C CD  . PRO C  1 58  ? 47.795  66.258  153.497 1.00 46.92  ? 59  PRO C CD  1 
ATOM   3635  N N   . SER C  1 59  ? 45.610  69.804  155.717 1.00 47.79  ? 60  SER C N   1 
ATOM   3636  C CA  . SER C  1 59  ? 44.402  70.617  155.769 1.00 48.66  ? 60  SER C CA  1 
ATOM   3637  C C   . SER C  1 59  ? 44.459  71.752  154.758 1.00 49.74  ? 60  SER C C   1 
ATOM   3638  O O   . SER C  1 59  ? 43.723  72.730  154.882 1.00 50.58  ? 60  SER C O   1 
ATOM   3639  C CB  . SER C  1 59  ? 44.203  71.213  157.165 1.00 47.05  ? 60  SER C CB  1 
ATOM   3640  O OG  . SER C  1 59  ? 44.886  72.448  157.278 1.00 44.85  ? 60  SER C OG  1 
ATOM   3641  N N   . ARG C  1 60  ? 45.351  71.649  153.780 1.00 50.42  ? 61  ARG C N   1 
ATOM   3642  C CA  . ARG C  1 60  ? 45.434  72.691  152.769 1.00 51.68  ? 61  ARG C CA  1 
ATOM   3643  C C   . ARG C  1 60  ? 44.424  72.342  151.674 1.00 52.33  ? 61  ARG C C   1 
ATOM   3644  O O   . ARG C  1 60  ? 43.937  73.205  150.953 1.00 52.55  ? 61  ARG C O   1 
ATOM   3645  C CB  . ARG C  1 60  ? 46.868  72.816  152.209 1.00 51.47  ? 61  ARG C CB  1 
ATOM   3646  C CG  . ARG C  1 60  ? 47.757  71.581  152.379 1.00 52.45  ? 61  ARG C CG  1 
ATOM   3647  C CD  . ARG C  1 60  ? 49.071  71.721  151.606 1.00 52.48  ? 61  ARG C CD  1 
ATOM   3648  N NE  . ARG C  1 60  ? 49.846  70.475  151.541 1.00 54.15  ? 61  ARG C NE  1 
ATOM   3649  C CZ  . ARG C  1 60  ? 50.534  69.944  152.557 1.00 56.70  ? 61  ARG C CZ  1 
ATOM   3650  N NH1 . ARG C  1 60  ? 50.556  70.540  153.744 1.00 54.49  ? 61  ARG C NH1 1 
ATOM   3651  N NH2 . ARG C  1 60  ? 51.221  68.814  152.390 1.00 57.44  ? 61  ARG C NH2 1 
ATOM   3652  N N   . PHE C  1 61  ? 44.080  71.065  151.598 1.00 52.99  ? 62  PHE C N   1 
ATOM   3653  C CA  . PHE C  1 61  ? 43.135  70.563  150.614 1.00 53.56  ? 62  PHE C CA  1 
ATOM   3654  C C   . PHE C  1 61  ? 41.711  70.800  151.075 1.00 53.77  ? 62  PHE C C   1 
ATOM   3655  O O   . PHE C  1 61  ? 41.488  71.500  152.055 1.00 54.96  ? 62  PHE C O   1 
ATOM   3656  C CB  . PHE C  1 61  ? 43.381  69.071  150.402 1.00 55.13  ? 62  PHE C CB  1 
ATOM   3657  C CG  . PHE C  1 61  ? 44.789  68.757  149.980 1.00 56.90  ? 62  PHE C CG  1 
ATOM   3658  C CD1 . PHE C  1 61  ? 45.864  69.182  150.747 1.00 57.13  ? 62  PHE C CD1 1 
ATOM   3659  C CD2 . PHE C  1 61  ? 45.042  68.106  148.777 1.00 57.80  ? 62  PHE C CD2 1 
ATOM   3660  C CE1 . PHE C  1 61  ? 47.166  68.975  150.320 1.00 58.49  ? 62  PHE C CE1 1 
ATOM   3661  C CE2 . PHE C  1 61  ? 46.339  67.894  148.341 1.00 57.92  ? 62  PHE C CE2 1 
ATOM   3662  C CZ  . PHE C  1 61  ? 47.403  68.329  149.111 1.00 58.98  ? 62  PHE C CZ  1 
ATOM   3663  N N   . SER C  1 62  ? 40.753  70.226  150.356 1.00 53.48  ? 63  SER C N   1 
ATOM   3664  C CA  . SER C  1 62  ? 39.334  70.362  150.682 1.00 52.56  ? 63  SER C CA  1 
ATOM   3665  C C   . SER C  1 62  ? 38.538  70.245  149.414 1.00 53.27  ? 63  SER C C   1 
ATOM   3666  O O   . SER C  1 62  ? 38.851  70.880  148.398 1.00 52.35  ? 63  SER C O   1 
ATOM   3667  C CB  . SER C  1 62  ? 39.004  71.713  151.309 1.00 50.86  ? 63  SER C CB  1 
ATOM   3668  O OG  . SER C  1 62  ? 38.943  72.714  150.319 1.00 47.87  ? 63  SER C OG  1 
ATOM   3669  N N   . GLY C  1 63  ? 37.497  69.428  149.499 1.00 54.30  ? 64  GLY C N   1 
ATOM   3670  C CA  . GLY C  1 63  ? 36.617  69.206  148.375 1.00 55.45  ? 64  GLY C CA  1 
ATOM   3671  C C   . GLY C  1 63  ? 35.219  69.678  148.697 1.00 55.90  ? 64  GLY C C   1 
ATOM   3672  O O   . GLY C  1 63  ? 34.767  69.597  149.835 1.00 54.12  ? 64  GLY C O   1 
ATOM   3673  N N   . SER C  1 64  ? 34.540  70.190  147.679 1.00 57.66  ? 65  SER C N   1 
ATOM   3674  C CA  . SER C  1 64  ? 33.177  70.672  147.837 1.00 59.00  ? 65  SER C CA  1 
ATOM   3675  C C   . SER C  1 64  ? 32.380  70.328  146.592 1.00 57.43  ? 65  SER C C   1 
ATOM   3676  O O   . SER C  1 64  ? 32.908  69.783  145.634 1.00 57.02  ? 65  SER C O   1 
ATOM   3677  C CB  . SER C  1 64  ? 33.162  72.195  148.061 1.00 61.12  ? 65  SER C CB  1 
ATOM   3678  O OG  . SER C  1 64  ? 33.554  72.900  146.892 1.00 64.47  ? 65  SER C OG  1 
ATOM   3679  N N   . GLY C  1 65  ? 31.099  70.644  146.613 1.00 57.34  ? 66  GLY C N   1 
ATOM   3680  C CA  . GLY C  1 65  ? 30.271  70.364  145.463 1.00 58.06  ? 66  GLY C CA  1 
ATOM   3681  C C   . GLY C  1 65  ? 29.406  69.145  145.659 1.00 58.27  ? 66  GLY C C   1 
ATOM   3682  O O   . GLY C  1 65  ? 29.382  68.550  146.734 1.00 58.10  ? 66  GLY C O   1 
ATOM   3683  N N   . SER C  1 66  ? 28.690  68.784  144.600 1.00 59.49  ? 67  SER C N   1 
ATOM   3684  C CA  . SER C  1 66  ? 27.799  67.632  144.608 1.00 59.28  ? 67  SER C CA  1 
ATOM   3685  C C   . SER C  1 66  ? 26.889  67.686  143.391 1.00 57.98  ? 67  SER C C   1 
ATOM   3686  O O   . SER C  1 66  ? 26.551  68.759  142.900 1.00 56.21  ? 67  SER C O   1 
ATOM   3687  C CB  . SER C  1 66  ? 26.969  67.630  145.889 1.00 59.93  ? 67  SER C CB  1 
ATOM   3688  O OG  . SER C  1 66  ? 26.470  68.932  146.148 1.00 62.89  ? 67  SER C OG  1 
ATOM   3689  N N   . GLY C  1 67  ? 26.509  66.523  142.894 1.00 57.96  ? 68  GLY C N   1 
ATOM   3690  C CA  . GLY C  1 67  ? 25.643  66.493  141.738 1.00 59.95  ? 68  GLY C CA  1 
ATOM   3691  C C   . GLY C  1 67  ? 26.349  66.473  140.394 1.00 60.65  ? 68  GLY C C   1 
ATOM   3692  O O   . GLY C  1 67  ? 26.252  65.474  139.678 1.00 61.57  ? 68  GLY C O   1 
ATOM   3693  N N   . THR C  1 68  ? 27.059  67.552  140.046 1.00 60.42  ? 69  THR C N   1 
ATOM   3694  C CA  . THR C  1 68  ? 27.747  67.631  138.749 1.00 59.66  ? 69  THR C CA  1 
ATOM   3695  C C   . THR C  1 68  ? 28.937  68.594  138.682 1.00 59.17  ? 69  THR C C   1 
ATOM   3696  O O   . THR C  1 68  ? 29.829  68.430  137.847 1.00 57.13  ? 69  THR C O   1 
ATOM   3697  C CB  . THR C  1 68  ? 26.757  68.062  137.632 1.00 59.58  ? 69  THR C CB  1 
ATOM   3698  O OG1 . THR C  1 68  ? 26.021  69.211  138.070 1.00 58.39  ? 69  THR C OG1 1 
ATOM   3699  C CG2 . THR C  1 68  ? 25.779  66.938  137.298 1.00 58.26  ? 69  THR C CG2 1 
ATOM   3700  N N   . ASP C  1 69  ? 28.926  69.595  139.565 1.00 59.96  ? 70  ASP C N   1 
ATOM   3701  C CA  . ASP C  1 69  ? 29.954  70.646  139.618 1.00 60.18  ? 70  ASP C CA  1 
ATOM   3702  C C   . ASP C  1 69  ? 30.816  70.571  140.889 1.00 57.83  ? 70  ASP C C   1 
ATOM   3703  O O   . ASP C  1 69  ? 30.653  71.377  141.809 1.00 57.49  ? 70  ASP C O   1 
ATOM   3704  C CB  . ASP C  1 69  ? 29.282  72.035  139.550 1.00 64.15  ? 70  ASP C CB  1 
ATOM   3705  C CG  . ASP C  1 69  ? 27.950  72.029  138.753 1.00 68.11  ? 70  ASP C CG  1 
ATOM   3706  O OD1 . ASP C  1 69  ? 27.135  72.969  138.941 1.00 68.55  ? 70  ASP C OD1 1 
ATOM   3707  O OD2 . ASP C  1 69  ? 27.716  71.098  137.939 1.00 69.81  ? 70  ASP C OD2 1 
ATOM   3708  N N   . PHE C  1 70  ? 31.745  69.618  140.914 1.00 55.42  ? 71  PHE C N   1 
ATOM   3709  C CA  . PHE C  1 70  ? 32.634  69.401  142.051 1.00 52.52  ? 71  PHE C CA  1 
ATOM   3710  C C   . PHE C  1 70  ? 33.910  70.244  142.060 1.00 51.08  ? 71  PHE C C   1 
ATOM   3711  O O   . PHE C  1 70  ? 34.366  70.710  141.019 1.00 52.18  ? 71  PHE C O   1 
ATOM   3712  C CB  . PHE C  1 70  ? 32.981  67.918  142.132 1.00 51.56  ? 71  PHE C CB  1 
ATOM   3713  C CG  . PHE C  1 70  ? 31.781  67.038  142.243 1.00 51.44  ? 71  PHE C CG  1 
ATOM   3714  C CD1 . PHE C  1 70  ? 30.945  66.845  141.156 1.00 52.18  ? 71  PHE C CD1 1 
ATOM   3715  C CD2 . PHE C  1 70  ? 31.454  66.441  143.449 1.00 50.83  ? 71  PHE C CD2 1 
ATOM   3716  C CE1 . PHE C  1 70  ? 29.802  66.071  141.271 1.00 52.53  ? 71  PHE C CE1 1 
ATOM   3717  C CE2 . PHE C  1 70  ? 30.314  65.666  143.574 1.00 51.16  ? 71  PHE C CE2 1 
ATOM   3718  C CZ  . PHE C  1 70  ? 29.486  65.481  142.486 1.00 51.77  ? 71  PHE C CZ  1 
ATOM   3719  N N   . THR C  1 71  ? 34.493  70.406  143.247 1.00 48.77  ? 72  THR C N   1 
ATOM   3720  C CA  . THR C  1 71  ? 35.690  71.217  143.432 1.00 46.13  ? 72  THR C CA  1 
ATOM   3721  C C   . THR C  1 71  ? 36.705  70.745  144.490 1.00 46.06  ? 72  THR C C   1 
ATOM   3722  O O   . THR C  1 71  ? 36.343  70.457  145.641 1.00 44.89  ? 72  THR C O   1 
ATOM   3723  C CB  . THR C  1 71  ? 35.271  72.671  143.789 1.00 44.86  ? 72  THR C CB  1 
ATOM   3724  O OG1 . THR C  1 71  ? 35.398  73.491  142.632 1.00 45.03  ? 72  THR C OG1 1 
ATOM   3725  C CG2 . THR C  1 71  ? 36.109  73.246  144.922 1.00 41.75  ? 72  THR C CG2 1 
ATOM   3726  N N   . LEU C  1 72  ? 37.976  70.678  144.085 1.00 43.87  ? 73  LEU C N   1 
ATOM   3727  C CA  . LEU C  1 72  ? 39.068  70.338  144.993 1.00 42.49  ? 73  LEU C CA  1 
ATOM   3728  C C   . LEU C  1 72  ? 39.933  71.593  145.112 1.00 42.61  ? 73  LEU C C   1 
ATOM   3729  O O   . LEU C  1 72  ? 40.637  71.942  144.180 1.00 41.00  ? 73  LEU C O   1 
ATOM   3730  C CB  . LEU C  1 72  ? 39.935  69.213  144.447 1.00 40.66  ? 73  LEU C CB  1 
ATOM   3731  C CG  . LEU C  1 72  ? 41.154  68.939  145.342 1.00 39.79  ? 73  LEU C CG  1 
ATOM   3732  C CD1 . LEU C  1 72  ? 40.795  67.885  146.363 1.00 39.16  ? 73  LEU C CD1 1 
ATOM   3733  C CD2 . LEU C  1 72  ? 42.327  68.474  144.519 1.00 37.69  ? 73  LEU C CD2 1 
ATOM   3734  N N   . THR C  1 73  ? 39.883  72.281  146.245 1.00 44.03  ? 74  THR C N   1 
ATOM   3735  C CA  . THR C  1 73  ? 40.685  73.492  146.388 1.00 46.23  ? 74  THR C CA  1 
ATOM   3736  C C   . THR C  1 73  ? 41.909  73.262  147.262 1.00 48.28  ? 74  THR C C   1 
ATOM   3737  O O   . THR C  1 73  ? 41.923  72.320  148.045 1.00 50.93  ? 74  THR C O   1 
ATOM   3738  C CB  . THR C  1 73  ? 39.855  74.646  146.998 1.00 44.91  ? 74  THR C CB  1 
ATOM   3739  O OG1 . THR C  1 73  ? 38.968  75.169  146.006 1.00 45.23  ? 74  THR C OG1 1 
ATOM   3740  C CG2 . THR C  1 73  ? 40.761  75.763  147.481 1.00 41.50  ? 74  THR C CG2 1 
ATOM   3741  N N   . ILE C  1 74  ? 42.938  74.105  147.111 1.00 48.46  ? 75  ILE C N   1 
ATOM   3742  C CA  . ILE C  1 74  ? 44.150  74.001  147.925 1.00 47.79  ? 75  ILE C CA  1 
ATOM   3743  C C   . ILE C  1 74  ? 44.572  75.347  148.497 1.00 48.35  ? 75  ILE C C   1 
ATOM   3744  O O   . ILE C  1 74  ? 45.150  76.173  147.800 1.00 47.75  ? 75  ILE C O   1 
ATOM   3745  C CB  . ILE C  1 74  ? 45.342  73.402  147.155 1.00 47.05  ? 75  ILE C CB  1 
ATOM   3746  C CG1 . ILE C  1 74  ? 45.064  71.931  146.837 1.00 46.40  ? 75  ILE C CG1 1 
ATOM   3747  C CG2 . ILE C  1 74  ? 46.617  73.519  148.005 1.00 46.48  ? 75  ILE C CG2 1 
ATOM   3748  C CD1 . ILE C  1 74  ? 46.293  71.040  146.886 1.00 46.42  ? 75  ILE C CD1 1 
ATOM   3749  N N   . SER C  1 75  ? 44.276  75.518  149.787 1.00 48.92  ? 76  SER C N   1 
ATOM   3750  C CA  . SER C  1 75  ? 44.538  76.712  150.587 1.00 48.84  ? 76  SER C CA  1 
ATOM   3751  C C   . SER C  1 75  ? 45.797  77.518  150.283 1.00 49.73  ? 76  SER C C   1 
ATOM   3752  O O   . SER C  1 75  ? 45.731  78.743  150.106 1.00 50.21  ? 76  SER C O   1 
ATOM   3753  C CB  . SER C  1 75  ? 44.567  76.323  152.059 1.00 50.16  ? 76  SER C CB  1 
ATOM   3754  O OG  . SER C  1 75  ? 45.796  75.688  152.372 1.00 51.13  ? 76  SER C OG  1 
ATOM   3755  N N   . SER C  1 76  ? 46.949  76.855  150.260 1.00 48.79  ? 77  SER C N   1 
ATOM   3756  C CA  . SER C  1 76  ? 48.188  77.566  149.986 1.00 48.17  ? 77  SER C CA  1 
ATOM   3757  C C   . SER C  1 76  ? 49.326  76.633  149.620 1.00 48.02  ? 77  SER C C   1 
ATOM   3758  O O   . SER C  1 76  ? 50.247  76.417  150.410 1.00 49.01  ? 77  SER C O   1 
ATOM   3759  C CB  . SER C  1 76  ? 48.580  78.411  151.186 1.00 47.46  ? 77  SER C CB  1 
ATOM   3760  O OG  . SER C  1 76  ? 49.816  79.045  150.943 1.00 48.62  ? 77  SER C OG  1 
ATOM   3761  N N   . LEU C  1 77  ? 49.241  76.101  148.403 1.00 47.49  ? 78  LEU C N   1 
ATOM   3762  C CA  . LEU C  1 77  ? 50.205  75.166  147.824 1.00 46.14  ? 78  LEU C CA  1 
ATOM   3763  C C   . LEU C  1 77  ? 51.575  75.048  148.479 1.00 43.93  ? 78  LEU C C   1 
ATOM   3764  O O   . LEU C  1 77  ? 52.174  76.039  148.888 1.00 43.61  ? 78  LEU C O   1 
ATOM   3765  C CB  . LEU C  1 77  ? 50.393  75.481  146.335 1.00 48.34  ? 78  LEU C CB  1 
ATOM   3766  C CG  . LEU C  1 77  ? 49.559  74.703  145.309 1.00 48.99  ? 78  LEU C CG  1 
ATOM   3767  C CD1 . LEU C  1 77  ? 48.094  74.992  145.523 1.00 48.75  ? 78  LEU C CD1 1 
ATOM   3768  C CD2 . LEU C  1 77  ? 49.990  75.090  143.891 1.00 47.86  ? 78  LEU C CD2 1 
ATOM   3769  N N   . GLN C  1 78  ? 52.058  73.812  148.551 1.00 41.63  ? 79  GLN C N   1 
ATOM   3770  C CA  . GLN C  1 78  ? 53.357  73.505  149.133 1.00 40.14  ? 79  GLN C CA  1 
ATOM   3771  C C   . GLN C  1 78  ? 54.151  72.856  148.024 1.00 38.33  ? 79  GLN C C   1 
ATOM   3772  O O   . GLN C  1 78  ? 53.573  72.153  147.207 1.00 37.19  ? 79  GLN C O   1 
ATOM   3773  C CB  . GLN C  1 78  ? 53.247  72.454  150.246 1.00 41.03  ? 79  GLN C CB  1 
ATOM   3774  C CG  . GLN C  1 78  ? 52.071  72.539  151.177 1.00 40.80  ? 79  GLN C CG  1 
ATOM   3775  C CD  . GLN C  1 78  ? 52.133  73.744  152.043 1.00 42.82  ? 79  GLN C CD  1 
ATOM   3776  O OE1 . GLN C  1 78  ? 53.220  74.172  152.444 1.00 41.94  ? 79  GLN C OE1 1 
ATOM   3777  N NE2 . GLN C  1 78  ? 50.964  74.310  152.361 1.00 45.14  ? 79  GLN C NE2 1 
ATOM   3778  N N   . PRO C  1 79  ? 55.484  73.068  147.988 1.00 38.12  ? 80  PRO C N   1 
ATOM   3779  C CA  . PRO C  1 79  ? 56.352  72.474  146.965 1.00 37.26  ? 80  PRO C CA  1 
ATOM   3780  C C   . PRO C  1 79  ? 56.029  71.007  146.635 1.00 37.29  ? 80  PRO C C   1 
ATOM   3781  O O   . PRO C  1 79  ? 56.294  70.541  145.530 1.00 36.92  ? 80  PRO C O   1 
ATOM   3782  C CB  . PRO C  1 79  ? 57.741  72.658  147.566 1.00 35.36  ? 80  PRO C CB  1 
ATOM   3783  C CG  . PRO C  1 79  ? 57.634  74.028  148.144 1.00 34.63  ? 80  PRO C CG  1 
ATOM   3784  C CD  . PRO C  1 79  ? 56.251  74.032  148.807 1.00 36.62  ? 80  PRO C CD  1 
ATOM   3785  N N   . GLU C  1 80  ? 55.442  70.281  147.578 1.00 38.81  ? 81  GLU C N   1 
ATOM   3786  C CA  . GLU C  1 80  ? 55.106  68.893  147.308 1.00 40.91  ? 81  GLU C CA  1 
ATOM   3787  C C   . GLU C  1 80  ? 53.664  68.690  146.833 1.00 41.42  ? 81  GLU C C   1 
ATOM   3788  O O   . GLU C  1 80  ? 53.243  67.562  146.586 1.00 42.13  ? 81  GLU C O   1 
ATOM   3789  C CB  . GLU C  1 80  ? 55.365  68.029  148.535 1.00 42.78  ? 81  GLU C CB  1 
ATOM   3790  C CG  . GLU C  1 80  ? 54.517  68.354  149.738 1.00 46.68  ? 81  GLU C CG  1 
ATOM   3791  C CD  . GLU C  1 80  ? 55.114  69.442  150.607 1.00 50.27  ? 81  GLU C CD  1 
ATOM   3792  O OE1 . GLU C  1 80  ? 56.294  69.790  150.388 1.00 51.20  ? 81  GLU C OE1 1 
ATOM   3793  O OE2 . GLU C  1 80  ? 54.406  69.936  151.523 1.00 52.99  ? 81  GLU C OE2 1 
ATOM   3794  N N   . ASP C  1 81  ? 52.902  69.772  146.708 1.00 40.79  ? 82  ASP C N   1 
ATOM   3795  C CA  . ASP C  1 81  ? 51.537  69.650  146.229 1.00 40.36  ? 82  ASP C CA  1 
ATOM   3796  C C   . ASP C  1 81  ? 51.509  69.678  144.703 1.00 40.65  ? 82  ASP C C   1 
ATOM   3797  O O   . ASP C  1 81  ? 50.467  69.420  144.093 1.00 41.61  ? 82  ASP C O   1 
ATOM   3798  C CB  . ASP C  1 81  ? 50.651  70.768  146.776 1.00 41.06  ? 82  ASP C CB  1 
ATOM   3799  C CG  . ASP C  1 81  ? 50.465  70.681  148.270 1.00 41.67  ? 82  ASP C CG  1 
ATOM   3800  O OD1 . ASP C  1 81  ? 50.590  69.563  148.834 1.00 40.00  ? 82  ASP C OD1 1 
ATOM   3801  O OD2 . ASP C  1 81  ? 50.178  71.738  148.875 1.00 41.35  ? 82  ASP C OD2 1 
ATOM   3802  N N   . PHE C  1 82  ? 52.643  69.994  144.079 1.00 38.59  ? 83  PHE C N   1 
ATOM   3803  C CA  . PHE C  1 82  ? 52.702  70.005  142.623 1.00 36.32  ? 83  PHE C CA  1 
ATOM   3804  C C   . PHE C  1 82  ? 52.771  68.587  142.050 1.00 35.40  ? 83  PHE C C   1 
ATOM   3805  O O   . PHE C  1 82  ? 53.755  67.868  142.227 1.00 34.16  ? 83  PHE C O   1 
ATOM   3806  C CB  . PHE C  1 82  ? 53.879  70.834  142.163 1.00 33.85  ? 83  PHE C CB  1 
ATOM   3807  C CG  . PHE C  1 82  ? 53.764  72.261  142.547 1.00 35.41  ? 83  PHE C CG  1 
ATOM   3808  C CD1 . PHE C  1 82  ? 54.229  72.703  143.770 1.00 35.39  ? 83  PHE C CD1 1 
ATOM   3809  C CD2 . PHE C  1 82  ? 53.162  73.180  141.693 1.00 37.35  ? 83  PHE C CD2 1 
ATOM   3810  C CE1 . PHE C  1 82  ? 54.102  74.049  144.145 1.00 34.71  ? 83  PHE C CE1 1 
ATOM   3811  C CE2 . PHE C  1 82  ? 53.031  74.524  142.063 1.00 36.42  ? 83  PHE C CE2 1 
ATOM   3812  C CZ  . PHE C  1 82  ? 53.505  74.952  143.290 1.00 34.51  ? 83  PHE C CZ  1 
ATOM   3813  N N   . ALA C  1 83  ? 51.689  68.199  141.381 1.00 34.43  ? 84  ALA C N   1 
ATOM   3814  C CA  . ALA C  1 83  ? 51.548  66.885  140.772 1.00 34.18  ? 84  ALA C CA  1 
ATOM   3815  C C   . ALA C  1 83  ? 50.160  66.753  140.139 1.00 33.74  ? 84  ALA C C   1 
ATOM   3816  O O   . ALA C  1 83  ? 49.271  67.572  140.376 1.00 34.47  ? 84  ALA C O   1 
ATOM   3817  C CB  . ALA C  1 83  ? 51.742  65.814  141.815 1.00 33.35  ? 84  ALA C CB  1 
ATOM   3818  N N   . THR C  1 84  ? 49.970  65.717  139.335 1.00 32.00  ? 85  THR C N   1 
ATOM   3819  C CA  . THR C  1 84  ? 48.685  65.514  138.683 1.00 31.48  ? 85  THR C CA  1 
ATOM   3820  C C   . THR C  1 84  ? 47.560  65.272  139.687 1.00 30.65  ? 85  THR C C   1 
ATOM   3821  O O   . THR C  1 84  ? 47.812  64.744  140.754 1.00 30.71  ? 85  THR C O   1 
ATOM   3822  C CB  . THR C  1 84  ? 48.745  64.320  137.708 1.00 30.05  ? 85  THR C CB  1 
ATOM   3823  O OG1 . THR C  1 84  ? 49.490  64.682  136.543 1.00 29.67  ? 85  THR C OG1 1 
ATOM   3824  C CG2 . THR C  1 84  ? 47.362  63.923  137.283 1.00 31.21  ? 85  THR C CG2 1 
ATOM   3825  N N   . TYR C  1 85  ? 46.332  65.669  139.350 1.00 30.71  ? 86  TYR C N   1 
ATOM   3826  C CA  . TYR C  1 85  ? 45.186  65.443  140.233 1.00 32.32  ? 86  TYR C CA  1 
ATOM   3827  C C   . TYR C  1 85  ? 44.008  64.885  139.469 1.00 34.31  ? 86  TYR C C   1 
ATOM   3828  O O   . TYR C  1 85  ? 43.392  65.591  138.683 1.00 35.40  ? 86  TYR C O   1 
ATOM   3829  C CB  . TYR C  1 85  ? 44.732  66.723  140.907 1.00 30.33  ? 86  TYR C CB  1 
ATOM   3830  C CG  . TYR C  1 85  ? 45.615  67.180  142.028 1.00 31.58  ? 86  TYR C CG  1 
ATOM   3831  C CD1 . TYR C  1 85  ? 46.821  67.829  141.769 1.00 32.99  ? 86  TYR C CD1 1 
ATOM   3832  C CD2 . TYR C  1 85  ? 45.240  66.987  143.355 1.00 30.58  ? 86  TYR C CD2 1 
ATOM   3833  C CE1 . TYR C  1 85  ? 47.628  68.276  142.809 1.00 33.10  ? 86  TYR C CE1 1 
ATOM   3834  C CE2 . TYR C  1 85  ? 46.028  67.427  144.396 1.00 29.91  ? 86  TYR C CE2 1 
ATOM   3835  C CZ  . TYR C  1 85  ? 47.221  68.070  144.123 1.00 32.41  ? 86  TYR C CZ  1 
ATOM   3836  O OH  . TYR C  1 85  ? 48.027  68.498  145.160 1.00 35.21  ? 86  TYR C OH  1 
ATOM   3837  N N   . TYR C  1 86  ? 43.679  63.621  139.708 1.00 35.87  ? 87  TYR C N   1 
ATOM   3838  C CA  . TYR C  1 86  ? 42.563  62.997  139.009 1.00 37.12  ? 87  TYR C CA  1 
ATOM   3839  C C   . TYR C  1 86  ? 41.249  63.100  139.764 1.00 39.16  ? 87  TYR C C   1 
ATOM   3840  O O   . TYR C  1 86  ? 41.230  63.377  140.955 1.00 40.57  ? 87  TYR C O   1 
ATOM   3841  C CB  . TYR C  1 86  ? 42.861  61.520  138.741 1.00 35.47  ? 87  TYR C CB  1 
ATOM   3842  C CG  . TYR C  1 86  ? 43.988  61.258  137.762 1.00 33.45  ? 87  TYR C CG  1 
ATOM   3843  C CD1 . TYR C  1 86  ? 45.300  61.071  138.203 1.00 31.64  ? 87  TYR C CD1 1 
ATOM   3844  C CD2 . TYR C  1 86  ? 43.730  61.198  136.384 1.00 31.97  ? 87  TYR C CD2 1 
ATOM   3845  C CE1 . TYR C  1 86  ? 46.324  60.829  137.290 1.00 33.18  ? 87  TYR C CE1 1 
ATOM   3846  C CE2 . TYR C  1 86  ? 44.733  60.962  135.464 1.00 31.33  ? 87  TYR C CE2 1 
ATOM   3847  C CZ  . TYR C  1 86  ? 46.032  60.775  135.911 1.00 33.66  ? 87  TYR C CZ  1 
ATOM   3848  O OH  . TYR C  1 86  ? 47.023  60.516  134.981 1.00 32.05  ? 87  TYR C OH  1 
ATOM   3849  N N   . CYS C  1 87  ? 40.149  62.887  139.058 1.00 42.28  ? 88  CYS C N   1 
ATOM   3850  C CA  . CYS C  1 87  ? 38.824  62.913  139.661 1.00 46.05  ? 88  CYS C CA  1 
ATOM   3851  C C   . CYS C  1 87  ? 38.057  61.715  139.145 1.00 47.82  ? 88  CYS C C   1 
ATOM   3852  O O   . CYS C  1 87  ? 38.384  61.147  138.109 1.00 48.20  ? 88  CYS C O   1 
ATOM   3853  C CB  . CYS C  1 87  ? 38.068  64.200  139.330 1.00 47.15  ? 88  CYS C CB  1 
ATOM   3854  S SG  . CYS C  1 87  ? 37.625  64.547  137.589 1.00 51.71  ? 88  CYS C SG  1 
ATOM   3855  N N   . GLN C  1 88  ? 37.027  61.320  139.862 1.00 49.97  ? 89  GLN C N   1 
ATOM   3856  C CA  . GLN C  1 88  ? 36.305  60.161  139.429 1.00 52.87  ? 89  GLN C CA  1 
ATOM   3857  C C   . GLN C  1 88  ? 34.916  60.053  140.026 1.00 55.72  ? 89  GLN C C   1 
ATOM   3858  O O   . GLN C  1 88  ? 34.674  60.421  141.182 1.00 55.89  ? 89  GLN C O   1 
ATOM   3859  C CB  . GLN C  1 88  ? 37.133  58.927  139.760 1.00 51.91  ? 89  GLN C CB  1 
ATOM   3860  C CG  . GLN C  1 88  ? 36.454  57.937  140.656 1.00 53.49  ? 89  GLN C CG  1 
ATOM   3861  C CD  . GLN C  1 88  ? 37.444  57.070  141.382 1.00 54.70  ? 89  GLN C CD  1 
ATOM   3862  O OE1 . GLN C  1 88  ? 38.180  56.301  140.767 1.00 55.72  ? 89  GLN C OE1 1 
ATOM   3863  N NE2 . GLN C  1 88  ? 37.478  57.195  142.703 1.00 54.81  ? 89  GLN C NE2 1 
ATOM   3864  N N   . GLN C  1 89  ? 34.009  59.543  139.201 1.00 58.32  ? 90  GLN C N   1 
ATOM   3865  C CA  . GLN C  1 89  ? 32.633  59.348  139.580 1.00 60.97  ? 90  GLN C CA  1 
ATOM   3866  C C   . GLN C  1 89  ? 32.485  57.904  140.032 1.00 62.57  ? 90  GLN C C   1 
ATOM   3867  O O   . GLN C  1 89  ? 32.669  56.967  139.261 1.00 62.12  ? 90  GLN C O   1 
ATOM   3868  C CB  . GLN C  1 89  ? 31.709  59.679  138.398 1.00 61.10  ? 90  GLN C CB  1 
ATOM   3869  C CG  . GLN C  1 89  ? 30.644  58.648  138.089 1.00 64.08  ? 90  GLN C CG  1 
ATOM   3870  C CD  . GLN C  1 89  ? 31.154  57.530  137.201 1.00 67.39  ? 90  GLN C CD  1 
ATOM   3871  O OE1 . GLN C  1 89  ? 30.405  56.626  136.817 1.00 68.55  ? 90  GLN C OE1 1 
ATOM   3872  N NE2 . GLN C  1 89  ? 32.439  57.587  136.865 1.00 69.31  ? 90  GLN C NE2 1 
ATOM   3873  N N   . SER C  1 90  ? 32.202  57.749  141.321 1.00 64.83  ? 91  SER C N   1 
ATOM   3874  C CA  . SER C  1 90  ? 32.003  56.451  141.945 1.00 66.51  ? 91  SER C CA  1 
ATOM   3875  C C   . SER C  1 90  ? 30.499  56.405  142.116 1.00 67.55  ? 91  SER C C   1 
ATOM   3876  O O   . SER C  1 90  ? 29.995  56.081  143.180 1.00 68.80  ? 91  SER C O   1 
ATOM   3877  C CB  . SER C  1 90  ? 32.695  56.429  143.312 1.00 66.40  ? 91  SER C CB  1 
ATOM   3878  O OG  . SER C  1 90  ? 32.739  55.125  143.857 1.00 66.79  ? 91  SER C OG  1 
ATOM   3879  N N   . TYR C  1 91  ? 29.789  56.747  141.050 1.00 68.91  ? 92  TYR C N   1 
ATOM   3880  C CA  . TYR C  1 91  ? 28.334  56.802  141.072 1.00 69.87  ? 92  TYR C CA  1 
ATOM   3881  C C   . TYR C  1 91  ? 27.720  55.746  140.182 1.00 69.07  ? 92  TYR C C   1 
ATOM   3882  O O   . TYR C  1 91  ? 26.652  55.240  140.485 1.00 68.54  ? 92  TYR C O   1 
ATOM   3883  C CB  . TYR C  1 91  ? 27.872  58.182  140.598 1.00 72.92  ? 92  TYR C CB  1 
ATOM   3884  C CG  . TYR C  1 91  ? 26.408  58.489  140.809 1.00 75.35  ? 92  TYR C CG  1 
ATOM   3885  C CD1 . TYR C  1 91  ? 25.945  58.939  142.042 1.00 76.59  ? 92  TYR C CD1 1 
ATOM   3886  C CD2 . TYR C  1 91  ? 25.487  58.362  139.768 1.00 76.86  ? 92  TYR C CD2 1 
ATOM   3887  C CE1 . TYR C  1 91  ? 24.602  59.264  142.240 1.00 77.72  ? 92  TYR C CE1 1 
ATOM   3888  C CE2 . TYR C  1 91  ? 24.132  58.683  139.955 1.00 78.47  ? 92  TYR C CE2 1 
ATOM   3889  C CZ  . TYR C  1 91  ? 23.700  59.136  141.198 1.00 78.36  ? 92  TYR C CZ  1 
ATOM   3890  O OH  . TYR C  1 91  ? 22.380  59.471  141.406 1.00 78.71  ? 92  TYR C OH  1 
ATOM   3891  N N   . SER C  1 92  ? 28.393  55.422  139.080 1.00 69.41  ? 93  SER C N   1 
ATOM   3892  C CA  . SER C  1 92  ? 27.886  54.427  138.140 1.00 69.72  ? 93  SER C CA  1 
ATOM   3893  C C   . SER C  1 92  ? 28.386  53.017  138.357 1.00 70.89  ? 93  SER C C   1 
ATOM   3894  O O   . SER C  1 92  ? 29.375  52.782  139.052 1.00 71.19  ? 93  SER C O   1 
ATOM   3895  C CB  . SER C  1 92  ? 28.216  54.801  136.704 1.00 68.49  ? 93  SER C CB  1 
ATOM   3896  O OG  . SER C  1 92  ? 27.867  53.722  135.855 1.00 66.27  ? 93  SER C OG  1 
ATOM   3897  N N   . THR C  1 93  ? 27.692  52.077  137.731 1.00 71.88  ? 94  THR C N   1 
ATOM   3898  C CA  . THR C  1 93  ? 28.051  50.677  137.830 1.00 73.14  ? 94  THR C CA  1 
ATOM   3899  C C   . THR C  1 93  ? 29.338  50.422  137.036 1.00 73.83  ? 94  THR C C   1 
ATOM   3900  O O   . THR C  1 93  ? 29.628  49.291  136.639 1.00 74.08  ? 94  THR C O   1 
ATOM   3901  C CB  . THR C  1 93  ? 26.885  49.782  137.320 1.00 73.49  ? 94  THR C CB  1 
ATOM   3902  O OG1 . THR C  1 93  ? 26.171  50.452  136.268 1.00 72.39  ? 94  THR C OG1 1 
ATOM   3903  C CG2 . THR C  1 93  ? 25.923  49.478  138.460 1.00 72.99  ? 94  THR C CG2 1 
ATOM   3904  N N   . SER C  1 94  ? 30.103  51.493  136.819 1.00 74.23  ? 95  SER C N   1 
ATOM   3905  C CA  . SER C  1 94  ? 31.378  51.452  136.093 1.00 74.00  ? 95  SER C CA  1 
ATOM   3906  C C   . SER C  1 94  ? 32.096  52.789  136.293 1.00 72.94  ? 95  SER C C   1 
ATOM   3907  O O   . SER C  1 94  ? 31.885  53.743  135.545 1.00 72.84  ? 95  SER C O   1 
ATOM   3908  C CB  . SER C  1 94  ? 31.143  51.212  134.597 1.00 75.38  ? 95  SER C CB  1 
ATOM   3909  O OG  . SER C  1 94  ? 30.398  52.272  134.015 1.00 77.80  ? 95  SER C OG  1 
ATOM   3910  N N   . HIS C  1 95  ? 32.946  52.849  137.310 1.00 71.88  ? 96  HIS C N   1 
ATOM   3911  C CA  . HIS C  1 95  ? 33.667  54.067  137.639 1.00 70.58  ? 96  HIS C CA  1 
ATOM   3912  C C   . HIS C  1 95  ? 34.429  54.679  136.470 1.00 70.60  ? 96  HIS C C   1 
ATOM   3913  O O   . HIS C  1 95  ? 34.805  53.984  135.519 1.00 71.68  ? 96  HIS C O   1 
ATOM   3914  C CB  . HIS C  1 95  ? 34.578  53.778  138.820 1.00 70.26  ? 96  HIS C CB  1 
ATOM   3915  C CG  . HIS C  1 95  ? 33.853  53.158  139.976 1.00 71.03  ? 96  HIS C CG  1 
ATOM   3916  N ND1 . HIS C  1 95  ? 34.483  52.411  140.947 1.00 72.01  ? 96  HIS C ND1 1 
ATOM   3917  C CD2 . HIS C  1 95  ? 32.541  53.178  140.313 1.00 70.87  ? 96  HIS C CD2 1 
ATOM   3918  C CE1 . HIS C  1 95  ? 33.593  51.996  141.830 1.00 71.62  ? 96  HIS C CE1 1 
ATOM   3919  N NE2 . HIS C  1 95  ? 32.407  52.448  141.468 1.00 71.17  ? 96  HIS C NE2 1 
ATOM   3920  N N   . THR C  1 96  ? 34.633  55.994  136.543 1.00 69.33  ? 97  THR C N   1 
ATOM   3921  C CA  . THR C  1 96  ? 35.311  56.760  135.494 1.00 67.23  ? 97  THR C CA  1 
ATOM   3922  C C   . THR C  1 96  ? 36.184  57.825  136.136 1.00 65.42  ? 97  THR C C   1 
ATOM   3923  O O   . THR C  1 96  ? 35.840  58.331  137.198 1.00 65.81  ? 97  THR C O   1 
ATOM   3924  C CB  . THR C  1 96  ? 34.273  57.471  134.580 1.00 67.88  ? 97  THR C CB  1 
ATOM   3925  O OG1 . THR C  1 96  ? 33.613  56.504  133.751 1.00 68.23  ? 97  THR C OG1 1 
ATOM   3926  C CG2 . THR C  1 96  ? 34.941  58.527  133.704 1.00 68.85  ? 97  THR C CG2 1 
ATOM   3927  N N   . PHE C  1 97  ? 37.304  58.167  135.498 1.00 63.62  ? 98  PHE C N   1 
ATOM   3928  C CA  . PHE C  1 97  ? 38.212  59.196  136.032 1.00 61.35  ? 98  PHE C CA  1 
ATOM   3929  C C   . PHE C  1 97  ? 38.123  60.511  135.272 1.00 59.40  ? 98  PHE C C   1 
ATOM   3930  O O   . PHE C  1 97  ? 37.172  60.794  134.553 1.00 58.73  ? 98  PHE C O   1 
ATOM   3931  C CB  . PHE C  1 97  ? 39.690  58.784  135.943 1.00 61.31  ? 98  PHE C CB  1 
ATOM   3932  C CG  . PHE C  1 97  ? 40.042  57.548  136.691 1.00 61.56  ? 98  PHE C CG  1 
ATOM   3933  C CD1 . PHE C  1 97  ? 40.107  56.328  136.041 1.00 62.17  ? 98  PHE C CD1 1 
ATOM   3934  C CD2 . PHE C  1 97  ? 40.342  57.604  138.048 1.00 62.15  ? 98  PHE C CD2 1 
ATOM   3935  C CE1 . PHE C  1 97  ? 40.467  55.180  136.733 1.00 63.69  ? 98  PHE C CE1 1 
ATOM   3936  C CE2 . PHE C  1 97  ? 40.702  56.461  138.751 1.00 61.74  ? 98  PHE C CE2 1 
ATOM   3937  C CZ  . PHE C  1 97  ? 40.765  55.248  138.094 1.00 62.64  ? 98  PHE C CZ  1 
ATOM   3938  N N   . GLY C  1 98  ? 39.170  61.299  135.457 1.00 57.32  ? 99  GLY C N   1 
ATOM   3939  C CA  . GLY C  1 98  ? 39.314  62.566  134.781 1.00 55.18  ? 99  GLY C CA  1 
ATOM   3940  C C   . GLY C  1 98  ? 40.695  62.418  134.173 1.00 53.65  ? 99  GLY C C   1 
ATOM   3941  O O   . GLY C  1 98  ? 41.467  61.551  134.597 1.00 53.80  ? 99  GLY C O   1 
ATOM   3942  N N   . GLN C  1 99  ? 41.027  63.224  133.179 1.00 50.88  ? 100 GLN C N   1 
ATOM   3943  C CA  . GLN C  1 99  ? 42.336  63.097  132.577 1.00 49.09  ? 100 GLN C CA  1 
ATOM   3944  C C   . GLN C  1 99  ? 43.396  63.608  133.532 1.00 48.44  ? 100 GLN C C   1 
ATOM   3945  O O   . GLN C  1 99  ? 44.590  63.525  133.246 1.00 50.13  ? 100 GLN C O   1 
ATOM   3946  C CB  . GLN C  1 99  ? 42.391  63.889  131.295 1.00 48.98  ? 100 GLN C CB  1 
ATOM   3947  C CG  . GLN C  1 99  ? 41.936  65.300  131.473 1.00 50.66  ? 100 GLN C CG  1 
ATOM   3948  C CD  . GLN C  1 99  ? 42.201  66.111  130.249 1.00 52.46  ? 100 GLN C CD  1 
ATOM   3949  O OE1 . GLN C  1 99  ? 43.353  66.282  129.843 1.00 55.89  ? 100 GLN C OE1 1 
ATOM   3950  N NE2 . GLN C  1 99  ? 41.143  66.608  129.631 1.00 52.57  ? 100 GLN C NE2 1 
ATOM   3951  N N   . GLY C  1 100 ? 42.953  64.142  134.667 1.00 46.46  ? 101 GLY C N   1 
ATOM   3952  C CA  . GLY C  1 100 ? 43.869  64.668  135.658 1.00 43.67  ? 101 GLY C CA  1 
ATOM   3953  C C   . GLY C  1 100 ? 44.346  66.044  135.258 1.00 42.92  ? 101 GLY C C   1 
ATOM   3954  O O   . GLY C  1 100 ? 44.240  66.410  134.086 1.00 42.86  ? 101 GLY C O   1 
ATOM   3955  N N   . THR C  1 101 ? 44.859  66.804  136.231 1.00 41.93  ? 102 THR C N   1 
ATOM   3956  C CA  . THR C  1 101 ? 45.379  68.162  136.015 1.00 38.63  ? 102 THR C CA  1 
ATOM   3957  C C   . THR C  1 101 ? 46.755  68.233  136.661 1.00 38.88  ? 102 THR C C   1 
ATOM   3958  O O   . THR C  1 101 ? 46.875  68.020  137.866 1.00 40.05  ? 102 THR C O   1 
ATOM   3959  C CB  . THR C  1 101 ? 44.475  69.254  136.682 1.00 36.71  ? 102 THR C CB  1 
ATOM   3960  O OG1 . THR C  1 101 ? 43.158  69.210  136.126 1.00 33.22  ? 102 THR C OG1 1 
ATOM   3961  C CG2 . THR C  1 101 ? 45.055  70.639  136.464 1.00 33.63  ? 102 THR C CG2 1 
ATOM   3962  N N   . LYS C  1 102 ? 47.792  68.513  135.878 1.00 38.83  ? 103 LYS C N   1 
ATOM   3963  C CA  . LYS C  1 102 ? 49.140  68.619  136.438 1.00 40.30  ? 103 LYS C CA  1 
ATOM   3964  C C   . LYS C  1 102 ? 49.397  69.986  137.081 1.00 40.67  ? 103 LYS C C   1 
ATOM   3965  O O   . LYS C  1 102 ? 49.293  71.018  136.420 1.00 40.75  ? 103 LYS C O   1 
ATOM   3966  C CB  . LYS C  1 102 ? 50.202  68.373  135.357 1.00 40.04  ? 103 LYS C CB  1 
ATOM   3967  C CG  . LYS C  1 102 ? 51.615  68.683  135.841 1.00 41.39  ? 103 LYS C CG  1 
ATOM   3968  C CD  . LYS C  1 102 ? 52.651  68.749  134.719 1.00 43.76  ? 103 LYS C CD  1 
ATOM   3969  C CE  . LYS C  1 102 ? 54.018  69.296  135.217 1.00 45.83  ? 103 LYS C CE  1 
ATOM   3970  N NZ  . LYS C  1 102 ? 55.151  69.241  134.215 1.00 42.61  ? 103 LYS C NZ  1 
ATOM   3971  N N   . LEU C  1 103 ? 49.731  69.988  138.368 1.00 41.23  ? 104 LEU C N   1 
ATOM   3972  C CA  . LEU C  1 103 ? 50.033  71.231  139.088 1.00 43.68  ? 104 LEU C CA  1 
ATOM   3973  C C   . LEU C  1 103 ? 51.513  71.605  138.868 1.00 45.59  ? 104 LEU C C   1 
ATOM   3974  O O   . LEU C  1 103 ? 52.404  70.956  139.435 1.00 46.35  ? 104 LEU C O   1 
ATOM   3975  C CB  . LEU C  1 103 ? 49.800  71.029  140.585 1.00 44.09  ? 104 LEU C CB  1 
ATOM   3976  C CG  . LEU C  1 103 ? 48.934  71.983  141.409 1.00 44.82  ? 104 LEU C CG  1 
ATOM   3977  C CD1 . LEU C  1 103 ? 49.278  73.410  141.044 1.00 46.52  ? 104 LEU C CD1 1 
ATOM   3978  C CD2 . LEU C  1 103 ? 47.464  71.694  141.181 1.00 43.33  ? 104 LEU C CD2 1 
ATOM   3979  N N   . GLU C  1 104 ? 51.785  72.636  138.063 1.00 46.07  ? 105 GLU C N   1 
ATOM   3980  C CA  . GLU C  1 104 ? 53.173  73.034  137.809 1.00 46.62  ? 105 GLU C CA  1 
ATOM   3981  C C   . GLU C  1 104 ? 53.575  74.317  138.566 1.00 45.20  ? 105 GLU C C   1 
ATOM   3982  O O   . GLU C  1 104 ? 52.707  75.050  139.042 1.00 43.98  ? 105 GLU C O   1 
ATOM   3983  C CB  . GLU C  1 104 ? 53.420  73.206  136.305 1.00 48.62  ? 105 GLU C CB  1 
ATOM   3984  C CG  . GLU C  1 104 ? 52.949  74.545  135.753 1.00 52.55  ? 105 GLU C CG  1 
ATOM   3985  C CD  . GLU C  1 104 ? 54.031  75.290  134.963 1.00 53.85  ? 105 GLU C CD  1 
ATOM   3986  O OE1 . GLU C  1 104 ? 53.831  76.485  134.647 1.00 55.08  ? 105 GLU C OE1 1 
ATOM   3987  O OE2 . GLU C  1 104 ? 55.077  74.686  134.652 1.00 54.72  ? 105 GLU C OE2 1 
ATOM   3988  N N   . ILE C  1 105 ? 54.890  74.569  138.651 1.00 44.27  ? 106 ILE C N   1 
ATOM   3989  C CA  . ILE C  1 105 ? 55.472  75.715  139.380 1.00 43.60  ? 106 ILE C CA  1 
ATOM   3990  C C   . ILE C  1 105 ? 55.711  76.980  138.572 1.00 43.88  ? 106 ILE C C   1 
ATOM   3991  O O   . ILE C  1 105 ? 56.691  77.094  137.841 1.00 42.88  ? 106 ILE C O   1 
ATOM   3992  C CB  . ILE C  1 105 ? 56.845  75.366  140.022 1.00 42.29  ? 106 ILE C CB  1 
ATOM   3993  C CG1 . ILE C  1 105 ? 56.765  74.055  140.802 1.00 41.24  ? 106 ILE C CG1 1 
ATOM   3994  C CG2 . ILE C  1 105 ? 57.254  76.469  140.968 1.00 41.66  ? 106 ILE C CG2 1 
ATOM   3995  C CD1 . ILE C  1 105 ? 58.093  73.382  140.988 1.00 38.17  ? 106 ILE C CD1 1 
ATOM   3996  N N   . LYS C  1 106 ? 54.828  77.946  138.756 1.00 44.72  ? 107 LYS C N   1 
ATOM   3997  C CA  . LYS C  1 106 ? 54.902  79.218  138.061 1.00 46.04  ? 107 LYS C CA  1 
ATOM   3998  C C   . LYS C  1 106 ? 56.133  80.041  138.484 1.00 45.56  ? 107 LYS C C   1 
ATOM   3999  O O   . LYS C  1 106 ? 56.110  80.725  139.512 1.00 46.56  ? 107 LYS C O   1 
ATOM   4000  C CB  . LYS C  1 106 ? 53.602  80.003  138.334 1.00 47.45  ? 107 LYS C CB  1 
ATOM   4001  C CG  . LYS C  1 106 ? 53.503  81.355  137.653 1.00 51.11  ? 107 LYS C CG  1 
ATOM   4002  C CD  . LYS C  1 106 ? 52.261  82.148  138.089 1.00 54.29  ? 107 LYS C CD  1 
ATOM   4003  C CE  . LYS C  1 106 ? 50.941  81.421  137.799 1.00 55.27  ? 107 LYS C CE  1 
ATOM   4004  N NZ  . LYS C  1 106 ? 49.780  82.367  137.673 1.00 54.24  ? 107 LYS C NZ  1 
ATOM   4005  N N   . ARG C  1 107 ? 57.211  79.970  137.710 1.00 43.34  ? 108 ARG C N   1 
ATOM   4006  C CA  . ARG C  1 107 ? 58.403  80.762  138.026 1.00 43.17  ? 108 ARG C CA  1 
ATOM   4007  C C   . ARG C  1 107 ? 58.704  81.731  136.895 1.00 43.44  ? 108 ARG C C   1 
ATOM   4008  O O   . ARG C  1 107 ? 58.121  81.623  135.814 1.00 43.57  ? 108 ARG C O   1 
ATOM   4009  C CB  . ARG C  1 107 ? 59.623  79.878  138.268 1.00 42.76  ? 108 ARG C CB  1 
ATOM   4010  C CG  . ARG C  1 107 ? 59.890  78.862  137.195 1.00 41.97  ? 108 ARG C CG  1 
ATOM   4011  C CD  . ARG C  1 107 ? 61.348  78.719  137.054 1.00 39.53  ? 108 ARG C CD  1 
ATOM   4012  N NE  . ARG C  1 107 ? 61.879  79.985  136.586 1.00 40.64  ? 108 ARG C NE  1 
ATOM   4013  C CZ  . ARG C  1 107 ? 63.156  80.190  136.316 1.00 40.89  ? 108 ARG C CZ  1 
ATOM   4014  N NH1 . ARG C  1 107 ? 64.020  79.200  136.478 1.00 41.83  ? 108 ARG C NH1 1 
ATOM   4015  N NH2 . ARG C  1 107 ? 63.564  81.376  135.888 1.00 40.25  ? 108 ARG C NH2 1 
ATOM   4016  N N   . THR C  1 108 ? 59.617  82.670  137.136 1.00 42.68  ? 109 THR C N   1 
ATOM   4017  C CA  . THR C  1 108 ? 59.957  83.684  136.131 1.00 42.43  ? 109 THR C CA  1 
ATOM   4018  C C   . THR C  1 108 ? 60.569  83.107  134.863 1.00 42.29  ? 109 THR C C   1 
ATOM   4019  O O   . THR C  1 108 ? 61.337  82.151  134.923 1.00 43.60  ? 109 THR C O   1 
ATOM   4020  C CB  . THR C  1 108 ? 60.936  84.696  136.689 1.00 41.53  ? 109 THR C CB  1 
ATOM   4021  O OG1 . THR C  1 108 ? 62.208  84.065  136.846 1.00 42.63  ? 109 THR C OG1 1 
ATOM   4022  C CG2 . THR C  1 108 ? 60.453  85.211  138.034 1.00 39.85  ? 109 THR C CG2 1 
ATOM   4023  N N   . VAL C  1 109 ? 60.248  83.722  133.726 1.00 41.66  ? 110 VAL C N   1 
ATOM   4024  C CA  . VAL C  1 109 ? 60.730  83.278  132.414 1.00 40.90  ? 110 VAL C CA  1 
ATOM   4025  C C   . VAL C  1 109 ? 62.249  83.251  132.225 1.00 41.34  ? 110 VAL C C   1 
ATOM   4026  O O   . VAL C  1 109 ? 62.956  84.177  132.629 1.00 40.80  ? 110 VAL C O   1 
ATOM   4027  C CB  . VAL C  1 109 ? 60.135  84.141  131.294 1.00 39.26  ? 110 VAL C CB  1 
ATOM   4028  C CG1 . VAL C  1 109 ? 60.556  83.597  129.955 1.00 37.45  ? 110 VAL C CG1 1 
ATOM   4029  C CG2 . VAL C  1 109 ? 58.616  84.185  131.425 1.00 38.49  ? 110 VAL C CG2 1 
ATOM   4030  N N   . ALA C  1 110 ? 62.725  82.178  131.589 1.00 41.16  ? 111 ALA C N   1 
ATOM   4031  C CA  . ALA C  1 110 ? 64.143  81.966  131.310 1.00 41.06  ? 111 ALA C CA  1 
ATOM   4032  C C   . ALA C  1 110 ? 64.320  81.480  129.888 1.00 41.32  ? 111 ALA C C   1 
ATOM   4033  O O   . ALA C  1 110 ? 63.939  80.361  129.573 1.00 40.73  ? 111 ALA C O   1 
ATOM   4034  C CB  . ALA C  1 110 ? 64.715  80.931  132.250 1.00 40.17  ? 111 ALA C CB  1 
ATOM   4035  N N   . ALA C  1 111 ? 64.893  82.314  129.026 1.00 42.62  ? 112 ALA C N   1 
ATOM   4036  C CA  . ALA C  1 111 ? 65.126  81.909  127.642 1.00 43.81  ? 112 ALA C CA  1 
ATOM   4037  C C   . ALA C  1 111 ? 66.216  80.864  127.687 1.00 45.05  ? 112 ALA C C   1 
ATOM   4038  O O   . ALA C  1 111 ? 67.099  80.901  128.550 1.00 46.08  ? 112 ALA C O   1 
ATOM   4039  C CB  . ALA C  1 111 ? 65.581  83.086  126.802 1.00 44.60  ? 112 ALA C CB  1 
ATOM   4040  N N   . PRO C  1 112 ? 66.185  79.912  126.759 1.00 45.84  ? 113 PRO C N   1 
ATOM   4041  C CA  . PRO C  1 112 ? 67.255  78.931  126.858 1.00 45.80  ? 113 PRO C CA  1 
ATOM   4042  C C   . PRO C  1 112 ? 68.543  79.364  126.180 1.00 45.76  ? 113 PRO C C   1 
ATOM   4043  O O   . PRO C  1 112 ? 68.754  80.544  125.856 1.00 45.72  ? 113 PRO C O   1 
ATOM   4044  C CB  . PRO C  1 112 ? 66.640  77.703  126.206 1.00 45.70  ? 113 PRO C CB  1 
ATOM   4045  C CG  . PRO C  1 112 ? 65.861  78.294  125.094 1.00 45.50  ? 113 PRO C CG  1 
ATOM   4046  C CD  . PRO C  1 112 ? 65.174  79.484  125.776 1.00 46.95  ? 113 PRO C CD  1 
ATOM   4047  N N   . SER C  1 113 ? 69.398  78.367  126.000 1.00 44.17  ? 114 SER C N   1 
ATOM   4048  C CA  . SER C  1 113 ? 70.689  78.489  125.362 1.00 43.11  ? 114 SER C CA  1 
ATOM   4049  C C   . SER C  1 113 ? 70.686  77.233  124.509 1.00 42.07  ? 114 SER C C   1 
ATOM   4050  O O   . SER C  1 113 ? 70.533  76.132  125.022 1.00 43.33  ? 114 SER C O   1 
ATOM   4051  C CB  . SER C  1 113 ? 71.786  78.440  126.415 1.00 43.80  ? 114 SER C CB  1 
ATOM   4052  O OG  . SER C  1 113 ? 71.438  77.529  127.445 1.00 45.69  ? 114 SER C OG  1 
ATOM   4053  N N   . VAL C  1 114 ? 70.841  77.390  123.206 1.00 39.62  ? 115 VAL C N   1 
ATOM   4054  C CA  . VAL C  1 114 ? 70.779  76.247  122.326 1.00 38.35  ? 115 VAL C CA  1 
ATOM   4055  C C   . VAL C  1 114 ? 72.132  75.667  121.936 1.00 36.28  ? 115 VAL C C   1 
ATOM   4056  O O   . VAL C  1 114 ? 73.124  76.395  121.880 1.00 36.59  ? 115 VAL C O   1 
ATOM   4057  C CB  . VAL C  1 114 ? 69.969  76.623  121.068 1.00 40.17  ? 115 VAL C CB  1 
ATOM   4058  C CG1 . VAL C  1 114 ? 69.517  75.365  120.331 1.00 39.20  ? 115 VAL C CG1 1 
ATOM   4059  C CG2 . VAL C  1 114 ? 68.767  77.480  121.483 1.00 38.46  ? 115 VAL C CG2 1 
ATOM   4060  N N   . PHE C  1 115 ? 72.147  74.349  121.689 1.00 31.92  ? 116 PHE C N   1 
ATOM   4061  C CA  . PHE C  1 115 ? 73.342  73.599  121.305 1.00 28.45  ? 116 PHE C CA  1 
ATOM   4062  C C   . PHE C  1 115 ? 73.016  72.686  120.138 1.00 28.10  ? 116 PHE C C   1 
ATOM   4063  O O   . PHE C  1 115 ? 71.942  72.112  120.100 1.00 30.23  ? 116 PHE C O   1 
ATOM   4064  C CB  . PHE C  1 115 ? 73.831  72.743  122.466 1.00 25.88  ? 116 PHE C CB  1 
ATOM   4065  C CG  . PHE C  1 115 ? 74.131  73.522  123.699 1.00 25.04  ? 116 PHE C CG  1 
ATOM   4066  C CD1 . PHE C  1 115 ? 73.110  74.060  124.461 1.00 26.37  ? 116 PHE C CD1 1 
ATOM   4067  C CD2 . PHE C  1 115 ? 75.430  73.753  124.084 1.00 26.19  ? 116 PHE C CD2 1 
ATOM   4068  C CE1 . PHE C  1 115 ? 73.384  74.814  125.574 1.00 25.54  ? 116 PHE C CE1 1 
ATOM   4069  C CE2 . PHE C  1 115 ? 75.724  74.509  125.200 1.00 26.67  ? 116 PHE C CE2 1 
ATOM   4070  C CZ  . PHE C  1 115 ? 74.695  75.039  125.942 1.00 28.01  ? 116 PHE C CZ  1 
ATOM   4071  N N   . ILE C  1 116 ? 73.932  72.545  119.183 1.00 26.74  ? 117 ILE C N   1 
ATOM   4072  C CA  . ILE C  1 116 ? 73.681  71.684  118.033 1.00 25.43  ? 117 ILE C CA  1 
ATOM   4073  C C   . ILE C  1 116 ? 74.761  70.630  117.871 1.00 26.49  ? 117 ILE C C   1 
ATOM   4074  O O   . ILE C  1 116 ? 75.948  70.943  117.891 1.00 28.40  ? 117 ILE C O   1 
ATOM   4075  C CB  . ILE C  1 116 ? 73.584  72.479  116.733 1.00 21.95  ? 117 ILE C CB  1 
ATOM   4076  C CG1 . ILE C  1 116 ? 72.161  72.419  116.208 1.00 21.44  ? 117 ILE C CG1 1 
ATOM   4077  C CG2 . ILE C  1 116 ? 74.470  71.879  115.693 1.00 21.12  ? 117 ILE C CG2 1 
ATOM   4078  C CD1 . ILE C  1 116 ? 72.079  72.324  114.708 1.00 19.27  ? 117 ILE C CD1 1 
ATOM   4079  N N   . PHE C  1 117 ? 74.334  69.385  117.672 1.00 26.43  ? 118 PHE C N   1 
ATOM   4080  C CA  . PHE C  1 117 ? 75.240  68.252  117.539 1.00 25.21  ? 118 PHE C CA  1 
ATOM   4081  C C   . PHE C  1 117 ? 75.147  67.546  116.206 1.00 26.72  ? 118 PHE C C   1 
ATOM   4082  O O   . PHE C  1 117 ? 74.157  66.858  115.950 1.00 27.48  ? 118 PHE C O   1 
ATOM   4083  C CB  . PHE C  1 117 ? 74.932  67.215  118.608 1.00 24.33  ? 118 PHE C CB  1 
ATOM   4084  C CG  . PHE C  1 117 ? 74.954  67.747  119.997 1.00 21.77  ? 118 PHE C CG  1 
ATOM   4085  C CD1 . PHE C  1 117 ? 76.155  68.094  120.596 1.00 20.12  ? 118 PHE C CD1 1 
ATOM   4086  C CD2 . PHE C  1 117 ? 73.775  67.850  120.719 1.00 20.25  ? 118 PHE C CD2 1 
ATOM   4087  C CE1 . PHE C  1 117 ? 76.188  68.524  121.884 1.00 22.64  ? 118 PHE C CE1 1 
ATOM   4088  C CE2 . PHE C  1 117 ? 73.788  68.285  122.021 1.00 22.77  ? 118 PHE C CE2 1 
ATOM   4089  C CZ  . PHE C  1 117 ? 74.996  68.622  122.615 1.00 22.94  ? 118 PHE C CZ  1 
ATOM   4090  N N   . PRO C  1 118 ? 76.193  67.659  115.360 1.00 27.84  ? 119 PRO C N   1 
ATOM   4091  C CA  . PRO C  1 118 ? 76.237  67.026  114.037 1.00 29.27  ? 119 PRO C CA  1 
ATOM   4092  C C   . PRO C  1 118 ? 76.229  65.522  114.173 1.00 31.17  ? 119 PRO C C   1 
ATOM   4093  O O   . PRO C  1 118 ? 76.552  64.989  115.223 1.00 29.92  ? 119 PRO C O   1 
ATOM   4094  C CB  . PRO C  1 118 ? 77.549  67.521  113.465 1.00 29.26  ? 119 PRO C CB  1 
ATOM   4095  C CG  . PRO C  1 118 ? 78.408  67.561  114.676 1.00 29.88  ? 119 PRO C CG  1 
ATOM   4096  C CD  . PRO C  1 118 ? 77.501  68.243  115.687 1.00 28.06  ? 119 PRO C CD  1 
ATOM   4097  N N   . PRO C  1 119 ? 75.857  64.802  113.108 1.00 34.96  ? 120 PRO C N   1 
ATOM   4098  C CA  . PRO C  1 119 ? 75.886  63.360  113.349 1.00 36.50  ? 120 PRO C CA  1 
ATOM   4099  C C   . PRO C  1 119 ? 77.328  62.866  113.473 1.00 38.02  ? 120 PRO C C   1 
ATOM   4100  O O   . PRO C  1 119 ? 78.285  63.541  113.032 1.00 36.39  ? 120 PRO C O   1 
ATOM   4101  C CB  . PRO C  1 119 ? 75.143  62.793  112.136 1.00 35.83  ? 120 PRO C CB  1 
ATOM   4102  C CG  . PRO C  1 119 ? 75.506  63.751  111.060 1.00 35.15  ? 120 PRO C CG  1 
ATOM   4103  C CD  . PRO C  1 119 ? 75.389  65.103  111.741 1.00 35.80  ? 120 PRO C CD  1 
ATOM   4104  N N   . SER C  1 120 ? 77.455  61.694  114.095 1.00 39.25  ? 121 SER C N   1 
ATOM   4105  C CA  . SER C  1 120 ? 78.733  61.031  114.327 1.00 40.26  ? 121 SER C CA  1 
ATOM   4106  C C   . SER C  1 120 ? 79.170  60.285  113.078 1.00 41.94  ? 121 SER C C   1 
ATOM   4107  O O   . SER C  1 120 ? 78.355  59.984  112.202 1.00 41.73  ? 121 SER C O   1 
ATOM   4108  C CB  . SER C  1 120 ? 78.591  60.016  115.458 1.00 38.85  ? 121 SER C CB  1 
ATOM   4109  O OG  . SER C  1 120 ? 77.730  58.957  115.056 1.00 39.17  ? 121 SER C OG  1 
ATOM   4110  N N   . ASP C  1 121 ? 80.464  59.992  113.010 1.00 44.40  ? 122 ASP C N   1 
ATOM   4111  C CA  . ASP C  1 121 ? 81.024  59.237  111.898 1.00 46.99  ? 122 ASP C CA  1 
ATOM   4112  C C   . ASP C  1 121 ? 80.498  57.817  112.049 1.00 46.71  ? 122 ASP C C   1 
ATOM   4113  O O   . ASP C  1 121 ? 79.938  57.240  111.114 1.00 46.70  ? 122 ASP C O   1 
ATOM   4114  C CB  . ASP C  1 121 ? 82.558  59.188  111.972 1.00 49.99  ? 122 ASP C CB  1 
ATOM   4115  C CG  . ASP C  1 121 ? 83.216  60.502  111.586 1.00 53.21  ? 122 ASP C CG  1 
ATOM   4116  O OD1 . ASP C  1 121 ? 82.862  61.045  110.511 1.00 56.23  ? 122 ASP C OD1 1 
ATOM   4117  O OD2 . ASP C  1 121 ? 84.101  60.978  112.347 1.00 55.43  ? 122 ASP C OD2 1 
ATOM   4118  N N   . GLU C  1 122 ? 80.690  57.268  113.244 1.00 45.82  ? 123 GLU C N   1 
ATOM   4119  C CA  . GLU C  1 122 ? 80.263  55.918  113.548 1.00 46.73  ? 123 GLU C CA  1 
ATOM   4120  C C   . GLU C  1 122 ? 78.859  55.633  113.028 1.00 47.25  ? 123 GLU C C   1 
ATOM   4121  O O   . GLU C  1 122 ? 78.646  54.644  112.315 1.00 47.69  ? 123 GLU C O   1 
ATOM   4122  C CB  . GLU C  1 122 ? 80.311  55.675  115.062 1.00 48.03  ? 123 GLU C CB  1 
ATOM   4123  C CG  . GLU C  1 122 ? 81.649  56.016  115.714 1.00 51.32  ? 123 GLU C CG  1 
ATOM   4124  C CD  . GLU C  1 122 ? 81.690  57.414  116.352 1.00 52.77  ? 123 GLU C CD  1 
ATOM   4125  O OE1 . GLU C  1 122 ? 81.358  57.530  117.563 1.00 51.47  ? 123 GLU C OE1 1 
ATOM   4126  O OE2 . GLU C  1 122 ? 82.053  58.390  115.642 1.00 52.11  ? 123 GLU C OE2 1 
ATOM   4127  N N   . GLN C  1 123 ? 77.907  56.499  113.380 1.00 46.16  ? 124 GLN C N   1 
ATOM   4128  C CA  . GLN C  1 123 ? 76.522  56.325  112.967 1.00 44.12  ? 124 GLN C CA  1 
ATOM   4129  C C   . GLN C  1 123 ? 76.302  56.353  111.460 1.00 42.52  ? 124 GLN C C   1 
ATOM   4130  O O   . GLN C  1 123 ? 75.347  55.778  110.958 1.00 43.77  ? 124 GLN C O   1 
ATOM   4131  C CB  . GLN C  1 123 ? 75.658  57.388  113.618 1.00 44.67  ? 124 GLN C CB  1 
ATOM   4132  C CG  . GLN C  1 123 ? 74.214  57.378  113.141 1.00 47.13  ? 124 GLN C CG  1 
ATOM   4133  C CD  . GLN C  1 123 ? 73.378  58.484  113.764 1.00 48.35  ? 124 GLN C CD  1 
ATOM   4134  O OE1 . GLN C  1 123 ? 73.711  59.675  113.674 1.00 47.75  ? 124 GLN C OE1 1 
ATOM   4135  N NE2 . GLN C  1 123 ? 72.282  58.094  114.399 1.00 48.65  ? 124 GLN C NE2 1 
ATOM   4136  N N   . LEU C  1 124 ? 77.167  57.030  110.728 1.00 40.92  ? 125 LEU C N   1 
ATOM   4137  C CA  . LEU C  1 124 ? 77.000  57.092  109.292 1.00 40.69  ? 125 LEU C CA  1 
ATOM   4138  C C   . LEU C  1 124 ? 77.529  55.795  108.744 1.00 42.01  ? 125 LEU C C   1 
ATOM   4139  O O   . LEU C  1 124 ? 77.007  55.255  107.766 1.00 41.62  ? 125 LEU C O   1 
ATOM   4140  C CB  . LEU C  1 124 ? 77.756  58.291  108.739 1.00 39.20  ? 125 LEU C CB  1 
ATOM   4141  C CG  . LEU C  1 124 ? 77.175  59.574  109.348 1.00 37.86  ? 125 LEU C CG  1 
ATOM   4142  C CD1 . LEU C  1 124 ? 78.067  60.751  109.074 1.00 35.85  ? 125 LEU C CD1 1 
ATOM   4143  C CD2 . LEU C  1 124 ? 75.773  59.795  108.807 1.00 37.40  ? 125 LEU C CD2 1 
ATOM   4144  N N   . LYS C  1 125 ? 78.561  55.287  109.410 1.00 43.87  ? 126 LYS C N   1 
ATOM   4145  C CA  . LYS C  1 125 ? 79.186  54.017  109.053 1.00 45.29  ? 126 LYS C CA  1 
ATOM   4146  C C   . LYS C  1 125 ? 78.063  52.982  109.083 1.00 45.96  ? 126 LYS C C   1 
ATOM   4147  O O   . LYS C  1 125 ? 78.134  51.960  108.415 1.00 46.96  ? 126 LYS C O   1 
ATOM   4148  C CB  . LYS C  1 125 ? 80.244  53.649  110.098 1.00 45.76  ? 126 LYS C CB  1 
ATOM   4149  C CG  . LYS C  1 125 ? 81.517  53.024  109.561 1.00 47.83  ? 126 LYS C CG  1 
ATOM   4150  C CD  . LYS C  1 125 ? 82.549  52.873  110.683 1.00 48.67  ? 126 LYS C CD  1 
ATOM   4151  C CE  . LYS C  1 125 ? 83.993  52.826  110.161 1.00 49.90  ? 126 LYS C CE  1 
ATOM   4152  N NZ  . LYS C  1 125 ? 85.032  52.789  111.253 1.00 49.90  ? 126 LYS C NZ  1 
ATOM   4153  N N   . SER C  1 126 ? 77.031  53.274  109.874 1.00 46.58  ? 127 SER C N   1 
ATOM   4154  C CA  . SER C  1 126 ? 75.864  52.410  110.041 1.00 46.58  ? 127 SER C CA  1 
ATOM   4155  C C   . SER C  1 126 ? 74.820  52.618  108.957 1.00 46.68  ? 127 SER C C   1 
ATOM   4156  O O   . SER C  1 126 ? 73.874  51.833  108.840 1.00 47.34  ? 127 SER C O   1 
ATOM   4157  C CB  . SER C  1 126 ? 75.204  52.663  111.400 1.00 47.80  ? 127 SER C CB  1 
ATOM   4158  O OG  . SER C  1 126 ? 73.786  52.709  111.275 1.00 47.20  ? 127 SER C OG  1 
ATOM   4159  N N   . GLY C  1 127 ? 74.970  53.688  108.183 1.00 45.67  ? 128 GLY C N   1 
ATOM   4160  C CA  . GLY C  1 127 ? 74.016  53.938  107.115 1.00 43.44  ? 128 GLY C CA  1 
ATOM   4161  C C   . GLY C  1 127 ? 72.830  54.827  107.456 1.00 40.39  ? 128 GLY C C   1 
ATOM   4162  O O   . GLY C  1 127 ? 71.767  54.718  106.841 1.00 38.70  ? 128 GLY C O   1 
ATOM   4163  N N   . THR C  1 128 ? 73.000  55.696  108.447 1.00 37.36  ? 129 THR C N   1 
ATOM   4164  C CA  . THR C  1 128 ? 71.935  56.619  108.824 1.00 34.50  ? 129 THR C CA  1 
ATOM   4165  C C   . THR C  1 128 ? 72.468  57.736  109.729 1.00 32.28  ? 129 THR C C   1 
ATOM   4166  O O   . THR C  1 128 ? 73.410  57.517  110.481 1.00 32.08  ? 129 THR C O   1 
ATOM   4167  C CB  . THR C  1 128 ? 70.745  55.879  109.484 1.00 33.45  ? 129 THR C CB  1 
ATOM   4168  O OG1 . THR C  1 128 ? 70.363  56.579  110.668 1.00 32.37  ? 129 THR C OG1 1 
ATOM   4169  C CG2 . THR C  1 128 ? 71.096  54.422  109.794 1.00 33.03  ? 129 THR C CG2 1 
ATOM   4170  N N   . ALA C  1 129 ? 71.879  58.930  109.641 1.00 28.89  ? 130 ALA C N   1 
ATOM   4171  C CA  . ALA C  1 129 ? 72.353  60.062  110.416 1.00 26.54  ? 130 ALA C CA  1 
ATOM   4172  C C   . ALA C  1 129 ? 71.323  60.656  111.334 1.00 26.63  ? 130 ALA C C   1 
ATOM   4173  O O   . ALA C  1 129 ? 70.146  60.682  111.003 1.00 25.70  ? 130 ALA C O   1 
ATOM   4174  C CB  . ALA C  1 129 ? 72.871  61.125  109.502 1.00 24.69  ? 130 ALA C CB  1 
ATOM   4175  N N   . SER C  1 130 ? 71.806  61.147  112.482 1.00 27.08  ? 131 SER C N   1 
ATOM   4176  C CA  . SER C  1 130 ? 71.004  61.775  113.536 1.00 27.19  ? 131 SER C CA  1 
ATOM   4177  C C   . SER C  1 130 ? 71.540  63.154  113.904 1.00 27.67  ? 131 SER C C   1 
ATOM   4178  O O   . SER C  1 130 ? 72.707  63.263  114.269 1.00 29.21  ? 131 SER C O   1 
ATOM   4179  C CB  . SER C  1 130 ? 71.052  60.927  114.804 1.00 25.06  ? 131 SER C CB  1 
ATOM   4180  O OG  . SER C  1 130 ? 70.000  59.999  114.857 1.00 27.91  ? 131 SER C OG  1 
ATOM   4181  N N   . VAL C  1 131 ? 70.711  64.196  113.839 1.00 27.24  ? 132 VAL C N   1 
ATOM   4182  C CA  . VAL C  1 131 ? 71.166  65.546  114.223 1.00 27.91  ? 132 VAL C CA  1 
ATOM   4183  C C   . VAL C  1 131 ? 70.404  66.002  115.463 1.00 29.45  ? 132 VAL C C   1 
ATOM   4184  O O   . VAL C  1 131 ? 69.179  66.021  115.449 1.00 31.61  ? 132 VAL C O   1 
ATOM   4185  C CB  . VAL C  1 131 ? 70.924  66.570  113.116 1.00 26.10  ? 132 VAL C CB  1 
ATOM   4186  C CG1 . VAL C  1 131 ? 71.446  67.933  113.526 1.00 24.92  ? 132 VAL C CG1 1 
ATOM   4187  C CG2 . VAL C  1 131 ? 71.608  66.117  111.869 1.00 29.15  ? 132 VAL C CG2 1 
ATOM   4188  N N   . VAL C  1 132 ? 71.116  66.386  116.522 1.00 29.29  ? 133 VAL C N   1 
ATOM   4189  C CA  . VAL C  1 132 ? 70.451  66.789  117.755 1.00 30.60  ? 133 VAL C CA  1 
ATOM   4190  C C   . VAL C  1 132 ? 70.550  68.263  118.173 1.00 32.89  ? 133 VAL C C   1 
ATOM   4191  O O   . VAL C  1 132 ? 71.633  68.811  118.305 1.00 32.00  ? 133 VAL C O   1 
ATOM   4192  C CB  . VAL C  1 132 ? 70.940  65.920  118.940 1.00 29.12  ? 133 VAL C CB  1 
ATOM   4193  C CG1 . VAL C  1 132 ? 70.252  66.358  120.213 1.00 28.41  ? 133 VAL C CG1 1 
ATOM   4194  C CG2 . VAL C  1 132 ? 70.675  64.451  118.667 1.00 24.93  ? 133 VAL C CG2 1 
ATOM   4195  N N   . CYS C  1 133 ? 69.394  68.890  118.382 1.00 36.16  ? 134 CYS C N   1 
ATOM   4196  C CA  . CYS C  1 133 ? 69.322  70.281  118.818 1.00 38.56  ? 134 CYS C CA  1 
ATOM   4197  C C   . CYS C  1 133 ? 69.051  70.105  120.288 1.00 39.32  ? 134 CYS C C   1 
ATOM   4198  O O   . CYS C  1 133 ? 68.640  69.027  120.697 1.00 42.02  ? 134 CYS C O   1 
ATOM   4199  C CB  . CYS C  1 133 ? 68.130  70.997  118.184 1.00 41.86  ? 134 CYS C CB  1 
ATOM   4200  S SG  . CYS C  1 133 ? 68.249  72.816  118.096 1.00 43.48  ? 134 CYS C SG  1 
ATOM   4201  N N   . LEU C  1 134 ? 69.273  71.146  121.084 1.00 39.00  ? 135 LEU C N   1 
ATOM   4202  C CA  . LEU C  1 134 ? 69.044  71.076  122.526 1.00 36.46  ? 135 LEU C CA  1 
ATOM   4203  C C   . LEU C  1 134 ? 68.778  72.472  123.083 1.00 36.13  ? 135 LEU C C   1 
ATOM   4204  O O   . LEU C  1 134 ? 69.598  73.370  122.944 1.00 35.05  ? 135 LEU C O   1 
ATOM   4205  C CB  . LEU C  1 134 ? 70.259  70.440  123.210 1.00 35.64  ? 135 LEU C CB  1 
ATOM   4206  C CG  . LEU C  1 134 ? 70.292  70.411  124.741 1.00 36.85  ? 135 LEU C CG  1 
ATOM   4207  C CD1 . LEU C  1 134 ? 69.022  69.731  125.261 1.00 35.96  ? 135 LEU C CD1 1 
ATOM   4208  C CD2 . LEU C  1 134 ? 71.567  69.713  125.229 1.00 33.43  ? 135 LEU C CD2 1 
ATOM   4209  N N   . LEU C  1 135 ? 67.599  72.643  123.673 1.00 36.54  ? 136 LEU C N   1 
ATOM   4210  C CA  . LEU C  1 135 ? 67.171  73.899  124.286 1.00 36.58  ? 136 LEU C CA  1 
ATOM   4211  C C   . LEU C  1 135 ? 67.395  73.636  125.755 1.00 37.45  ? 136 LEU C C   1 
ATOM   4212  O O   . LEU C  1 135 ? 66.588  72.956  126.387 1.00 38.70  ? 136 LEU C O   1 
ATOM   4213  C CB  . LEU C  1 135 ? 65.677  74.144  124.068 1.00 36.29  ? 136 LEU C CB  1 
ATOM   4214  C CG  . LEU C  1 135 ? 65.085  74.231  122.665 1.00 36.53  ? 136 LEU C CG  1 
ATOM   4215  C CD1 . LEU C  1 135 ? 65.416  73.000  121.875 1.00 33.31  ? 136 LEU C CD1 1 
ATOM   4216  C CD2 . LEU C  1 135 ? 63.581  74.388  122.785 1.00 35.40  ? 136 LEU C CD2 1 
ATOM   4217  N N   . ASN C  1 136 ? 68.462  74.197  126.310 1.00 38.22  ? 137 ASN C N   1 
ATOM   4218  C CA  . ASN C  1 136 ? 68.811  73.936  127.702 1.00 39.55  ? 137 ASN C CA  1 
ATOM   4219  C C   . ASN C  1 136 ? 68.303  74.831  128.826 1.00 39.83  ? 137 ASN C C   1 
ATOM   4220  O O   . ASN C  1 136 ? 68.465  76.049  128.793 1.00 42.00  ? 137 ASN C O   1 
ATOM   4221  C CB  . ASN C  1 136 ? 70.328  73.836  127.800 1.00 40.29  ? 137 ASN C CB  1 
ATOM   4222  C CG  . ASN C  1 136 ? 70.768  73.211  129.080 1.00 43.22  ? 137 ASN C CG  1 
ATOM   4223  O OD1 . ASN C  1 136 ? 70.138  72.253  129.552 1.00 45.08  ? 137 ASN C OD1 1 
ATOM   4224  N ND2 . ASN C  1 136 ? 71.861  73.725  129.660 1.00 42.27  ? 137 ASN C ND2 1 
ATOM   4225  N N   . ASN C  1 137 ? 67.708  74.201  129.835 1.00 39.10  ? 138 ASN C N   1 
ATOM   4226  C CA  . ASN C  1 137 ? 67.194  74.884  131.034 1.00 38.71  ? 138 ASN C CA  1 
ATOM   4227  C C   . ASN C  1 137 ? 66.419  76.178  130.822 1.00 37.90  ? 138 ASN C C   1 
ATOM   4228  O O   . ASN C  1 137 ? 66.915  77.267  131.127 1.00 37.96  ? 138 ASN C O   1 
ATOM   4229  C CB  . ASN C  1 137 ? 68.346  75.139  132.013 1.00 38.16  ? 138 ASN C CB  1 
ATOM   4230  C CG  . ASN C  1 137 ? 68.796  73.868  132.729 1.00 38.23  ? 138 ASN C CG  1 
ATOM   4231  O OD1 . ASN C  1 137 ? 69.987  73.641  132.918 1.00 36.23  ? 138 ASN C OD1 1 
ATOM   4232  N ND2 . ASN C  1 137 ? 67.833  73.044  133.144 1.00 39.25  ? 138 ASN C ND2 1 
ATOM   4233  N N   . PHE C  1 138 ? 65.183  76.038  130.347 1.00 36.91  ? 139 PHE C N   1 
ATOM   4234  C CA  . PHE C  1 138 ? 64.316  77.176  130.064 1.00 35.50  ? 139 PHE C CA  1 
ATOM   4235  C C   . PHE C  1 138 ? 62.996  77.131  130.793 1.00 35.36  ? 139 PHE C C   1 
ATOM   4236  O O   . PHE C  1 138 ? 62.733  76.235  131.579 1.00 35.26  ? 139 PHE C O   1 
ATOM   4237  C CB  . PHE C  1 138 ? 64.012  77.245  128.569 1.00 34.94  ? 139 PHE C CB  1 
ATOM   4238  C CG  . PHE C  1 138 ? 63.361  76.002  128.031 1.00 33.20  ? 139 PHE C CG  1 
ATOM   4239  C CD1 . PHE C  1 138 ? 64.135  74.958  127.515 1.00 31.36  ? 139 PHE C CD1 1 
ATOM   4240  C CD2 . PHE C  1 138 ? 61.976  75.864  128.054 1.00 30.82  ? 139 PHE C CD2 1 
ATOM   4241  C CE1 . PHE C  1 138 ? 63.543  73.809  127.033 1.00 29.59  ? 139 PHE C CE1 1 
ATOM   4242  C CE2 . PHE C  1 138 ? 61.376  74.714  127.572 1.00 30.21  ? 139 PHE C CE2 1 
ATOM   4243  C CZ  . PHE C  1 138 ? 62.159  73.682  127.058 1.00 29.61  ? 139 PHE C CZ  1 
ATOM   4244  N N   . TYR C  1 139 ? 62.159  78.114  130.485 1.00 37.20  ? 140 TYR C N   1 
ATOM   4245  C CA  . TYR C  1 139 ? 60.833  78.251  131.078 1.00 37.70  ? 140 TYR C CA  1 
ATOM   4246  C C   . TYR C  1 139 ? 60.136  79.513  130.517 1.00 37.12  ? 140 TYR C C   1 
ATOM   4247  O O   . TYR C  1 139 ? 60.757  80.563  130.365 1.00 36.41  ? 140 TYR C O   1 
ATOM   4248  C CB  . TYR C  1 139 ? 60.950  78.317  132.608 1.00 37.89  ? 140 TYR C CB  1 
ATOM   4249  C CG  . TYR C  1 139 ? 59.614  78.264  133.292 1.00 39.89  ? 140 TYR C CG  1 
ATOM   4250  C CD1 . TYR C  1 139 ? 58.910  79.429  133.553 1.00 41.06  ? 140 TYR C CD1 1 
ATOM   4251  C CD2 . TYR C  1 139 ? 58.982  77.049  133.533 1.00 40.32  ? 140 TYR C CD2 1 
ATOM   4252  C CE1 . TYR C  1 139 ? 57.598  79.391  134.016 1.00 41.73  ? 140 TYR C CE1 1 
ATOM   4253  C CE2 . TYR C  1 139 ? 57.666  76.998  133.998 1.00 41.07  ? 140 TYR C CE2 1 
ATOM   4254  C CZ  . TYR C  1 139 ? 56.977  78.178  134.226 1.00 41.01  ? 140 TYR C CZ  1 
ATOM   4255  O OH  . TYR C  1 139 ? 55.648  78.172  134.586 1.00 40.60  ? 140 TYR C OH  1 
ATOM   4256  N N   . PRO C  1 140 ? 58.830  79.427  130.213 1.00 36.13  ? 141 PRO C N   1 
ATOM   4257  C CA  . PRO C  1 140 ? 57.855  78.334  130.303 1.00 36.38  ? 141 PRO C CA  1 
ATOM   4258  C C   . PRO C  1 140 ? 58.173  77.065  129.526 1.00 36.35  ? 141 PRO C C   1 
ATOM   4259  O O   . PRO C  1 140 ? 59.154  76.997  128.801 1.00 36.54  ? 141 PRO C O   1 
ATOM   4260  C CB  . PRO C  1 140 ? 56.571  78.989  129.823 1.00 36.02  ? 141 PRO C CB  1 
ATOM   4261  C CG  . PRO C  1 140 ? 57.060  79.933  128.825 1.00 36.52  ? 141 PRO C CG  1 
ATOM   4262  C CD  . PRO C  1 140 ? 58.219  80.576  129.539 1.00 35.91  ? 141 PRO C CD  1 
ATOM   4263  N N   . ARG C  1 141 ? 57.314  76.067  129.671 1.00 36.92  ? 142 ARG C N   1 
ATOM   4264  C CA  . ARG C  1 141 ? 57.513  74.786  129.019 1.00 38.61  ? 142 ARG C CA  1 
ATOM   4265  C C   . ARG C  1 141 ? 57.537  74.814  127.511 1.00 39.26  ? 142 ARG C C   1 
ATOM   4266  O O   . ARG C  1 141 ? 58.533  74.434  126.914 1.00 39.57  ? 142 ARG C O   1 
ATOM   4267  C CB  . ARG C  1 141 ? 56.448  73.802  129.464 1.00 41.50  ? 142 ARG C CB  1 
ATOM   4268  C CG  . ARG C  1 141 ? 56.820  72.364  129.230 1.00 43.73  ? 142 ARG C CG  1 
ATOM   4269  C CD  . ARG C  1 141 ? 55.586  71.506  129.275 1.00 46.58  ? 142 ARG C CD  1 
ATOM   4270  N NE  . ARG C  1 141 ? 55.869  70.107  128.978 1.00 50.52  ? 142 ARG C NE  1 
ATOM   4271  C CZ  . ARG C  1 141 ? 56.458  69.674  127.868 1.00 52.87  ? 142 ARG C CZ  1 
ATOM   4272  N NH1 . ARG C  1 141 ? 56.844  70.539  126.931 1.00 53.78  ? 142 ARG C NH1 1 
ATOM   4273  N NH2 . ARG C  1 141 ? 56.645  68.369  127.688 1.00 54.12  ? 142 ARG C NH2 1 
ATOM   4274  N N   . GLU C  1 142 ? 56.436  75.238  126.894 1.00 40.25  ? 143 GLU C N   1 
ATOM   4275  C CA  . GLU C  1 142 ? 56.328  75.304  125.429 1.00 41.65  ? 143 GLU C CA  1 
ATOM   4276  C C   . GLU C  1 142 ? 57.542  75.899  124.719 1.00 41.91  ? 143 GLU C C   1 
ATOM   4277  O O   . GLU C  1 142 ? 58.068  76.943  125.112 1.00 41.99  ? 143 GLU C O   1 
ATOM   4278  C CB  . GLU C  1 142 ? 55.089  76.101  125.026 1.00 42.85  ? 143 GLU C CB  1 
ATOM   4279  C CG  . GLU C  1 142 ? 53.799  75.364  125.269 1.00 46.22  ? 143 GLU C CG  1 
ATOM   4280  C CD  . GLU C  1 142 ? 53.595  75.029  126.729 1.00 48.67  ? 143 GLU C CD  1 
ATOM   4281  O OE1 . GLU C  1 142 ? 53.255  73.859  127.027 1.00 50.10  ? 143 GLU C OE1 1 
ATOM   4282  O OE2 . GLU C  1 142 ? 53.765  75.939  127.574 1.00 49.11  ? 143 GLU C OE2 1 
ATOM   4283  N N   . ALA C  1 143 ? 57.977  75.233  123.659 1.00 41.67  ? 144 ALA C N   1 
ATOM   4284  C CA  . ALA C  1 143 ? 59.126  75.700  122.892 1.00 41.91  ? 144 ALA C CA  1 
ATOM   4285  C C   . ALA C  1 143 ? 58.851  75.500  121.401 1.00 41.84  ? 144 ALA C C   1 
ATOM   4286  O O   . ALA C  1 143 ? 57.838  74.904  121.028 1.00 42.21  ? 144 ALA C O   1 
ATOM   4287  C CB  . ALA C  1 143 ? 60.393  74.940  123.320 1.00 40.80  ? 144 ALA C CB  1 
ATOM   4288  N N   . LYS C  1 144 ? 59.739  75.987  120.543 1.00 41.05  ? 145 LYS C N   1 
ATOM   4289  C CA  . LYS C  1 144 ? 59.501  75.827  119.125 1.00 40.71  ? 145 LYS C CA  1 
ATOM   4290  C C   . LYS C  1 144 ? 60.760  75.557  118.289 1.00 39.75  ? 145 LYS C C   1 
ATOM   4291  O O   . LYS C  1 144 ? 61.383  76.471  117.757 1.00 40.20  ? 145 LYS C O   1 
ATOM   4292  C CB  . LYS C  1 144 ? 58.767  77.062  118.597 1.00 41.84  ? 145 LYS C CB  1 
ATOM   4293  C CG  . LYS C  1 144 ? 57.950  76.785  117.341 1.00 46.42  ? 145 LYS C CG  1 
ATOM   4294  C CD  . LYS C  1 144 ? 57.843  77.999  116.402 1.00 47.61  ? 145 LYS C CD  1 
ATOM   4295  C CE  . LYS C  1 144 ? 57.178  77.621  115.066 1.00 45.27  ? 145 LYS C CE  1 
ATOM   4296  N NZ  . LYS C  1 144 ? 57.880  76.486  114.398 1.00 43.46  ? 145 LYS C NZ  1 
ATOM   4297  N N   . VAL C  1 145 ? 61.150  74.296  118.173 1.00 37.29  ? 146 VAL C N   1 
ATOM   4298  C CA  . VAL C  1 145 ? 62.304  74.003  117.362 1.00 35.40  ? 146 VAL C CA  1 
ATOM   4299  C C   . VAL C  1 145 ? 61.781  73.749  115.962 1.00 38.13  ? 146 VAL C C   1 
ATOM   4300  O O   . VAL C  1 145 ? 60.902  72.908  115.754 1.00 39.81  ? 146 VAL C O   1 
ATOM   4301  C CB  . VAL C  1 145 ? 63.069  72.772  117.852 1.00 31.83  ? 146 VAL C CB  1 
ATOM   4302  C CG1 . VAL C  1 145 ? 64.228  72.460  116.905 1.00 30.22  ? 146 VAL C CG1 1 
ATOM   4303  C CG2 . VAL C  1 145 ? 63.600  73.035  119.217 1.00 29.53  ? 146 VAL C CG2 1 
ATOM   4304  N N   . GLN C  1 146 ? 62.314  74.507  115.008 1.00 38.56  ? 147 GLN C N   1 
ATOM   4305  C CA  . GLN C  1 146 ? 61.946  74.394  113.611 1.00 36.25  ? 147 GLN C CA  1 
ATOM   4306  C C   . GLN C  1 146 ? 63.206  74.028  112.827 1.00 36.05  ? 147 GLN C C   1 
ATOM   4307  O O   . GLN C  1 146 ? 64.153  74.816  112.762 1.00 34.60  ? 147 GLN C O   1 
ATOM   4308  C CB  . GLN C  1 146 ? 61.401  75.727  113.134 1.00 36.24  ? 147 GLN C CB  1 
ATOM   4309  C CG  . GLN C  1 146 ? 61.123  75.776  111.678 1.00 38.52  ? 147 GLN C CG  1 
ATOM   4310  C CD  . GLN C  1 146 ? 59.875  75.020  111.305 1.00 40.77  ? 147 GLN C CD  1 
ATOM   4311  O OE1 . GLN C  1 146 ? 59.878  74.236  110.349 1.00 43.40  ? 147 GLN C OE1 1 
ATOM   4312  N NE2 . GLN C  1 146 ? 58.790  75.253  112.047 1.00 41.23  ? 147 GLN C NE2 1 
ATOM   4313  N N   . TRP C  1 147 ? 63.212  72.818  112.259 1.00 35.47  ? 148 TRP C N   1 
ATOM   4314  C CA  . TRP C  1 147 ? 64.330  72.318  111.456 1.00 32.79  ? 148 TRP C CA  1 
ATOM   4315  C C   . TRP C  1 147 ? 64.179  72.772  109.995 1.00 32.85  ? 148 TRP C C   1 
ATOM   4316  O O   . TRP C  1 147 ? 63.062  72.824  109.449 1.00 31.86  ? 148 TRP C O   1 
ATOM   4317  C CB  . TRP C  1 147 ? 64.407  70.771  111.485 1.00 32.54  ? 148 TRP C CB  1 
ATOM   4318  C CG  . TRP C  1 147 ? 64.903  70.144  112.773 1.00 31.14  ? 148 TRP C CG  1 
ATOM   4319  C CD1 . TRP C  1 147 ? 64.140  69.690  113.811 1.00 32.61  ? 148 TRP C CD1 1 
ATOM   4320  C CD2 . TRP C  1 147 ? 66.268  70.017  113.200 1.00 30.78  ? 148 TRP C CD2 1 
ATOM   4321  N NE1 . TRP C  1 147 ? 64.941  69.307  114.863 1.00 31.02  ? 148 TRP C NE1 1 
ATOM   4322  C CE2 . TRP C  1 147 ? 66.249  69.499  114.515 1.00 30.45  ? 148 TRP C CE2 1 
ATOM   4323  C CE3 . TRP C  1 147 ? 67.501  70.298  112.603 1.00 29.12  ? 148 TRP C CE3 1 
ATOM   4324  C CZ2 . TRP C  1 147 ? 67.414  69.263  115.244 1.00 30.50  ? 148 TRP C CZ2 1 
ATOM   4325  C CZ3 . TRP C  1 147 ? 68.659  70.062  113.329 1.00 31.31  ? 148 TRP C CZ3 1 
ATOM   4326  C CH2 . TRP C  1 147 ? 68.606  69.551  114.640 1.00 31.06  ? 148 TRP C CH2 1 
ATOM   4327  N N   . LYS C  1 148 ? 65.318  73.102  109.387 1.00 31.77  ? 149 LYS C N   1 
ATOM   4328  C CA  . LYS C  1 148 ? 65.406  73.538  108.004 1.00 32.12  ? 149 LYS C CA  1 
ATOM   4329  C C   . LYS C  1 148 ? 66.688  72.931  107.484 1.00 32.14  ? 149 LYS C C   1 
ATOM   4330  O O   . LYS C  1 148 ? 67.706  72.889  108.158 1.00 30.68  ? 149 LYS C O   1 
ATOM   4331  C CB  . LYS C  1 148 ? 65.528  75.059  107.887 1.00 35.63  ? 149 LYS C CB  1 
ATOM   4332  C CG  . LYS C  1 148 ? 64.994  75.870  109.066 1.00 37.91  ? 149 LYS C CG  1 
ATOM   4333  C CD  . LYS C  1 148 ? 65.288  77.353  108.866 1.00 39.40  ? 149 LYS C CD  1 
ATOM   4334  C CE  . LYS C  1 148 ? 64.797  78.167  110.059 1.00 41.90  ? 149 LYS C CE  1 
ATOM   4335  N NZ  . LYS C  1 148 ? 65.295  79.579  110.050 1.00 42.11  ? 149 LYS C NZ  1 
ATOM   4336  N N   . VAL C  1 149 ? 66.646  72.478  106.257 1.00 34.28  ? 150 VAL C N   1 
ATOM   4337  C CA  . VAL C  1 149 ? 67.797  71.858  105.652 1.00 36.60  ? 150 VAL C CA  1 
ATOM   4338  C C   . VAL C  1 149 ? 67.848  72.431  104.246 1.00 38.61  ? 150 VAL C C   1 
ATOM   4339  O O   . VAL C  1 149 ? 66.992  72.133  103.419 1.00 40.46  ? 150 VAL C O   1 
ATOM   4340  C CB  . VAL C  1 149 ? 67.607  70.316  105.632 1.00 37.38  ? 150 VAL C CB  1 
ATOM   4341  C CG1 . VAL C  1 149 ? 68.666  69.648  104.770 1.00 38.10  ? 150 VAL C CG1 1 
ATOM   4342  C CG2 . VAL C  1 149 ? 67.650  69.779  107.055 1.00 34.22  ? 150 VAL C CG2 1 
ATOM   4343  N N   . ASP C  1 150 ? 68.848  73.261  103.980 1.00 39.66  ? 151 ASP C N   1 
ATOM   4344  C CA  . ASP C  1 150 ? 68.978  73.903  102.683 1.00 40.24  ? 151 ASP C CA  1 
ATOM   4345  C C   . ASP C  1 150 ? 67.739  74.756  102.523 1.00 39.91  ? 151 ASP C C   1 
ATOM   4346  O O   . ASP C  1 150 ? 67.206  74.922  101.431 1.00 39.91  ? 151 ASP C O   1 
ATOM   4347  C CB  . ASP C  1 150 ? 69.097  72.863  101.560 1.00 41.44  ? 151 ASP C CB  1 
ATOM   4348  C CG  . ASP C  1 150 ? 70.484  72.217  101.510 1.00 44.37  ? 151 ASP C CG  1 
ATOM   4349  O OD1 . ASP C  1 150 ? 71.414  72.734  102.174 1.00 46.98  ? 151 ASP C OD1 1 
ATOM   4350  O OD2 . ASP C  1 150 ? 70.663  71.206  100.798 1.00 44.79  ? 151 ASP C OD2 1 
ATOM   4351  N N   . ASN C  1 151 ? 67.298  75.292  103.655 1.00 40.34  ? 152 ASN C N   1 
ATOM   4352  C CA  . ASN C  1 151 ? 66.123  76.150  103.740 1.00 42.04  ? 152 ASN C CA  1 
ATOM   4353  C C   . ASN C  1 151 ? 64.790  75.429  103.613 1.00 40.99  ? 152 ASN C C   1 
ATOM   4354  O O   . ASN C  1 151 ? 63.742  76.026  103.849 1.00 43.05  ? 152 ASN C O   1 
ATOM   4355  C CB  . ASN C  1 151 ? 66.212  77.307  102.731 1.00 45.34  ? 152 ASN C CB  1 
ATOM   4356  C CG  . ASN C  1 151 ? 67.010  78.490  103.279 1.00 48.52  ? 152 ASN C CG  1 
ATOM   4357  O OD1 . ASN C  1 151 ? 66.627  79.087  104.296 1.00 49.51  ? 152 ASN C OD1 1 
ATOM   4358  N ND2 . ASN C  1 151 ? 68.130  78.824  102.622 1.00 47.99  ? 152 ASN C ND2 1 
ATOM   4359  N N   . ALA C  1 152 ? 64.807  74.156  103.239 1.00 37.77  ? 153 ALA C N   1 
ATOM   4360  C CA  . ALA C  1 152 ? 63.561  73.419  103.182 1.00 34.96  ? 153 ALA C CA  1 
ATOM   4361  C C   . ALA C  1 152 ? 63.129  73.208  104.644 1.00 34.35  ? 153 ALA C C   1 
ATOM   4362  O O   . ALA C  1 152 ? 63.775  72.498  105.412 1.00 32.01  ? 153 ALA C O   1 
ATOM   4363  C CB  . ALA C  1 152 ? 63.769  72.098  102.499 1.00 35.10  ? 153 ALA C CB  1 
ATOM   4364  N N   . LEU C  1 153 ? 62.050  73.858  105.042 1.00 34.08  ? 154 LEU C N   1 
ATOM   4365  C CA  . LEU C  1 153 ? 61.582  73.718  106.405 1.00 33.65  ? 154 LEU C CA  1 
ATOM   4366  C C   . LEU C  1 153 ? 61.185  72.287  106.561 1.00 32.15  ? 154 LEU C C   1 
ATOM   4367  O O   . LEU C  1 153 ? 60.579  71.736  105.659 1.00 29.77  ? 154 LEU C O   1 
ATOM   4368  C CB  . LEU C  1 153 ? 60.361  74.599  106.648 1.00 35.03  ? 154 LEU C CB  1 
ATOM   4369  C CG  . LEU C  1 153 ? 60.592  76.103  106.594 1.00 35.17  ? 154 LEU C CG  1 
ATOM   4370  C CD1 . LEU C  1 153 ? 61.497  76.524  107.715 1.00 35.33  ? 154 LEU C CD1 1 
ATOM   4371  C CD2 . LEU C  1 153 ? 61.207  76.462  105.260 1.00 36.53  ? 154 LEU C CD2 1 
ATOM   4372  N N   . GLN C  1 154 ? 61.517  71.689  107.704 1.00 32.50  ? 155 GLN C N   1 
ATOM   4373  C CA  . GLN C  1 154 ? 61.167  70.289  107.950 1.00 31.88  ? 155 GLN C CA  1 
ATOM   4374  C C   . GLN C  1 154 ? 60.036  70.101  108.953 1.00 33.24  ? 155 GLN C C   1 
ATOM   4375  O O   . GLN C  1 154 ? 59.534  71.044  109.582 1.00 34.41  ? 155 GLN C O   1 
ATOM   4376  C CB  . GLN C  1 154 ? 62.384  69.489  108.431 1.00 28.03  ? 155 GLN C CB  1 
ATOM   4377  C CG  . GLN C  1 154 ? 63.627  69.699  107.605 1.00 28.85  ? 155 GLN C CG  1 
ATOM   4378  C CD  . GLN C  1 154 ? 63.587  68.960  106.285 1.00 28.31  ? 155 GLN C CD  1 
ATOM   4379  O OE1 . GLN C  1 154 ? 62.584  68.973  105.588 1.00 31.25  ? 155 GLN C OE1 1 
ATOM   4380  N NE2 . GLN C  1 154 ? 64.683  68.323  105.933 1.00 27.88  ? 155 GLN C NE2 1 
ATOM   4381  N N   . SER C  1 155 ? 59.660  68.842  109.098 1.00 33.90  ? 156 SER C N   1 
ATOM   4382  C CA  . SER C  1 155 ? 58.607  68.445  109.991 1.00 32.81  ? 156 SER C CA  1 
ATOM   4383  C C   . SER C  1 155 ? 58.302  66.948  109.838 1.00 32.58  ? 156 SER C C   1 
ATOM   4384  O O   . SER C  1 155 ? 58.256  66.409  108.730 1.00 29.85  ? 156 SER C O   1 
ATOM   4385  C CB  . SER C  1 155 ? 57.372  69.270  109.693 1.00 29.80  ? 156 SER C CB  1 
ATOM   4386  O OG  . SER C  1 155 ? 56.358  68.939  110.611 1.00 36.25  ? 156 SER C OG  1 
ATOM   4387  N N   . GLY C  1 156 ? 58.127  66.280  110.975 1.00 34.74  ? 157 GLY C N   1 
ATOM   4388  C CA  . GLY C  1 156 ? 57.803  64.861  110.974 1.00 33.85  ? 157 GLY C CA  1 
ATOM   4389  C C   . GLY C  1 156 ? 58.981  63.914  110.912 1.00 32.41  ? 157 GLY C C   1 
ATOM   4390  O O   . GLY C  1 156 ? 58.839  62.745  111.222 1.00 33.60  ? 157 GLY C O   1 
ATOM   4391  N N   . ASN C  1 157 ? 60.138  64.427  110.525 1.00 30.80  ? 158 ASN C N   1 
ATOM   4392  C CA  . ASN C  1 157 ? 61.352  63.641  110.426 1.00 30.11  ? 158 ASN C CA  1 
ATOM   4393  C C   . ASN C  1 157 ? 62.196  63.776  111.699 1.00 28.91  ? 158 ASN C C   1 
ATOM   4394  O O   . ASN C  1 157 ? 63.377  63.430  111.701 1.00 29.94  ? 158 ASN C O   1 
ATOM   4395  C CB  . ASN C  1 157 ? 62.147  64.155  109.235 1.00 33.90  ? 158 ASN C CB  1 
ATOM   4396  C CG  . ASN C  1 157 ? 62.271  65.687  109.235 1.00 36.23  ? 158 ASN C CG  1 
ATOM   4397  O OD1 . ASN C  1 157 ? 61.277  66.419  109.367 1.00 41.29  ? 158 ASN C OD1 1 
ATOM   4398  N ND2 . ASN C  1 157 ? 63.489  66.170  109.083 1.00 35.01  ? 158 ASN C ND2 1 
ATOM   4399  N N   . SER C  1 158 ? 61.602  64.285  112.775 1.00 27.12  ? 159 SER C N   1 
ATOM   4400  C CA  . SER C  1 158 ? 62.332  64.489  114.026 1.00 27.05  ? 159 SER C CA  1 
ATOM   4401  C C   . SER C  1 158 ? 61.466  64.389  115.265 1.00 27.63  ? 159 SER C C   1 
ATOM   4402  O O   . SER C  1 158 ? 60.351  64.884  115.285 1.00 27.68  ? 159 SER C O   1 
ATOM   4403  C CB  . SER C  1 158 ? 62.996  65.864  114.034 1.00 26.60  ? 159 SER C CB  1 
ATOM   4404  O OG  . SER C  1 158 ? 62.081  66.870  114.423 1.00 25.53  ? 159 SER C OG  1 
ATOM   4405  N N   . GLN C  1 159 ? 61.998  63.764  116.310 1.00 28.52  ? 160 GLN C N   1 
ATOM   4406  C CA  . GLN C  1 159 ? 61.255  63.612  117.550 1.00 30.84  ? 160 GLN C CA  1 
ATOM   4407  C C   . GLN C  1 159 ? 61.897  64.421  118.668 1.00 32.34  ? 160 GLN C C   1 
ATOM   4408  O O   . GLN C  1 159 ? 62.971  64.999  118.500 1.00 32.90  ? 160 GLN C O   1 
ATOM   4409  C CB  . GLN C  1 159 ? 61.151  62.128  117.942 1.00 32.83  ? 160 GLN C CB  1 
ATOM   4410  C CG  . GLN C  1 159 ? 60.273  61.277  116.983 1.00 35.93  ? 160 GLN C CG  1 
ATOM   4411  C CD  . GLN C  1 159 ? 59.520  60.147  117.689 1.00 38.53  ? 160 GLN C CD  1 
ATOM   4412  O OE1 . GLN C  1 159 ? 60.094  59.103  118.026 1.00 38.50  ? 160 GLN C OE1 1 
ATOM   4413  N NE2 . GLN C  1 159 ? 58.222  60.365  117.931 1.00 39.00  ? 160 GLN C NE2 1 
ATOM   4414  N N   . GLU C  1 160 ? 61.242  64.477  119.815 1.00 32.81  ? 161 GLU C N   1 
ATOM   4415  C CA  . GLU C  1 160 ? 61.797  65.251  120.908 1.00 33.16  ? 161 GLU C CA  1 
ATOM   4416  C C   . GLU C  1 160 ? 61.218  64.899  122.262 1.00 32.24  ? 161 GLU C C   1 
ATOM   4417  O O   . GLU C  1 160 ? 60.038  64.592  122.391 1.00 32.31  ? 161 GLU C O   1 
ATOM   4418  C CB  . GLU C  1 160 ? 61.560  66.723  120.655 1.00 35.59  ? 161 GLU C CB  1 
ATOM   4419  C CG  . GLU C  1 160 ? 60.296  67.205  121.286 1.00 37.75  ? 161 GLU C CG  1 
ATOM   4420  C CD  . GLU C  1 160 ? 59.877  68.512  120.718 1.00 39.85  ? 161 GLU C CD  1 
ATOM   4421  O OE1 . GLU C  1 160 ? 60.248  68.766  119.548 1.00 39.48  ? 161 GLU C OE1 1 
ATOM   4422  O OE2 . GLU C  1 160 ? 59.179  69.268  121.426 1.00 41.43  ? 161 GLU C OE2 1 
ATOM   4423  N N   . SER C  1 161 ? 62.053  64.978  123.280 1.00 30.70  ? 162 SER C N   1 
ATOM   4424  C CA  . SER C  1 161 ? 61.606  64.651  124.603 1.00 30.59  ? 162 SER C CA  1 
ATOM   4425  C C   . SER C  1 161 ? 61.905  65.806  125.551 1.00 31.53  ? 162 SER C C   1 
ATOM   4426  O O   . SER C  1 161 ? 62.796  66.620  125.321 1.00 31.44  ? 162 SER C O   1 
ATOM   4427  C CB  . SER C  1 161 ? 62.273  63.364  125.054 1.00 30.65  ? 162 SER C CB  1 
ATOM   4428  O OG  . SER C  1 161 ? 61.772  62.973  126.308 1.00 35.94  ? 162 SER C OG  1 
ATOM   4429  N N   . VAL C  1 162 ? 61.139  65.891  126.619 1.00 32.25  ? 163 VAL C N   1 
ATOM   4430  C CA  . VAL C  1 162 ? 61.342  66.974  127.525 1.00 34.09  ? 163 VAL C CA  1 
ATOM   4431  C C   . VAL C  1 162 ? 61.723  66.435  128.870 1.00 36.91  ? 163 VAL C C   1 
ATOM   4432  O O   . VAL C  1 162 ? 61.658  65.239  129.101 1.00 38.62  ? 163 VAL C O   1 
ATOM   4433  C CB  . VAL C  1 162 ? 60.088  67.821  127.653 1.00 34.10  ? 163 VAL C CB  1 
ATOM   4434  C CG1 . VAL C  1 162 ? 60.490  69.252  127.975 1.00 35.43  ? 163 VAL C CG1 1 
ATOM   4435  C CG2 . VAL C  1 162 ? 59.270  67.758  126.364 1.00 32.61  ? 163 VAL C CG2 1 
ATOM   4436  N N   . THR C  1 163 ? 62.111  67.345  129.753 1.00 39.12  ? 164 THR C N   1 
ATOM   4437  C CA  . THR C  1 163 ? 62.564  67.039  131.098 1.00 39.16  ? 164 THR C CA  1 
ATOM   4438  C C   . THR C  1 163 ? 61.513  67.464  132.127 1.00 41.20  ? 164 THR C C   1 
ATOM   4439  O O   . THR C  1 163 ? 61.112  68.630  132.160 1.00 42.10  ? 164 THR C O   1 
ATOM   4440  C CB  . THR C  1 163 ? 63.913  67.779  131.330 1.00 38.13  ? 164 THR C CB  1 
ATOM   4441  O OG1 . THR C  1 163 ? 64.949  66.819  131.540 1.00 38.56  ? 164 THR C OG1 1 
ATOM   4442  C CG2 . THR C  1 163 ? 63.840  68.759  132.504 1.00 38.86  ? 164 THR C CG2 1 
ATOM   4443  N N   . GLU C  1 164 ? 61.057  66.529  132.962 1.00 42.64  ? 165 GLU C N   1 
ATOM   4444  C CA  . GLU C  1 164 ? 60.057  66.874  133.980 1.00 43.11  ? 165 GLU C CA  1 
ATOM   4445  C C   . GLU C  1 164 ? 60.560  68.033  134.826 1.00 40.87  ? 165 GLU C C   1 
ATOM   4446  O O   . GLU C  1 164 ? 61.676  68.008  135.329 1.00 40.36  ? 165 GLU C O   1 
ATOM   4447  C CB  . GLU C  1 164 ? 59.726  65.674  134.873 1.00 44.82  ? 165 GLU C CB  1 
ATOM   4448  C CG  . GLU C  1 164 ? 58.338  65.061  134.601 1.00 49.58  ? 165 GLU C CG  1 
ATOM   4449  C CD  . GLU C  1 164 ? 57.168  65.922  135.113 1.00 53.92  ? 165 GLU C CD  1 
ATOM   4450  O OE1 . GLU C  1 164 ? 55.998  65.540  134.876 1.00 55.50  ? 165 GLU C OE1 1 
ATOM   4451  O OE2 . GLU C  1 164 ? 57.406  66.973  135.756 1.00 56.04  ? 165 GLU C OE2 1 
ATOM   4452  N N   . GLN C  1 165 ? 59.713  69.045  134.960 1.00 39.88  ? 166 GLN C N   1 
ATOM   4453  C CA  . GLN C  1 165 ? 60.021  70.255  135.692 1.00 39.80  ? 166 GLN C CA  1 
ATOM   4454  C C   . GLN C  1 165 ? 61.029  70.056  136.797 1.00 42.21  ? 166 GLN C C   1 
ATOM   4455  O O   . GLN C  1 165 ? 60.728  69.429  137.810 1.00 43.20  ? 166 GLN C O   1 
ATOM   4456  C CB  . GLN C  1 165 ? 58.748  70.854  136.260 1.00 37.29  ? 166 GLN C CB  1 
ATOM   4457  C CG  . GLN C  1 165 ? 58.951  72.190  136.919 1.00 34.57  ? 166 GLN C CG  1 
ATOM   4458  C CD  . GLN C  1 165 ? 57.651  72.954  137.080 1.00 35.74  ? 166 GLN C CD  1 
ATOM   4459  O OE1 . GLN C  1 165 ? 56.684  72.472  137.694 1.00 33.41  ? 166 GLN C OE1 1 
ATOM   4460  N NE2 . GLN C  1 165 ? 57.619  74.162  136.531 1.00 35.69  ? 166 GLN C NE2 1 
ATOM   4461  N N   . ASP C  1 166 ? 62.230  70.599  136.587 1.00 43.26  ? 167 ASP C N   1 
ATOM   4462  C CA  . ASP C  1 166 ? 63.324  70.503  137.543 1.00 44.09  ? 167 ASP C CA  1 
ATOM   4463  C C   . ASP C  1 166 ? 62.891  70.925  138.956 1.00 45.98  ? 167 ASP C C   1 
ATOM   4464  O O   . ASP C  1 166 ? 62.057  71.815  139.134 1.00 46.25  ? 167 ASP C O   1 
ATOM   4465  C CB  . ASP C  1 166 ? 64.503  71.362  137.055 1.00 43.91  ? 167 ASP C CB  1 
ATOM   4466  C CG  . ASP C  1 166 ? 65.734  71.251  137.954 1.00 43.46  ? 167 ASP C CG  1 
ATOM   4467  O OD1 . ASP C  1 166 ? 65.586  71.485  139.170 1.00 45.45  ? 167 ASP C OD1 1 
ATOM   4468  O OD2 . ASP C  1 166 ? 66.841  70.938  137.455 1.00 39.13  ? 167 ASP C OD2 1 
ATOM   4469  N N   . SER C  1 167 ? 63.463  70.269  139.960 1.00 48.09  ? 168 SER C N   1 
ATOM   4470  C CA  . SER C  1 167 ? 63.144  70.546  141.362 1.00 49.09  ? 168 SER C CA  1 
ATOM   4471  C C   . SER C  1 167 ? 63.771  71.848  141.794 1.00 48.25  ? 168 SER C C   1 
ATOM   4472  O O   . SER C  1 167 ? 63.081  72.779  142.227 1.00 50.37  ? 168 SER C O   1 
ATOM   4473  C CB  . SER C  1 167 ? 63.716  69.461  142.259 1.00 49.77  ? 168 SER C CB  1 
ATOM   4474  O OG  . SER C  1 167 ? 65.138  69.578  142.267 1.00 51.84  ? 168 SER C OG  1 
ATOM   4475  N N   . LYS C  1 168 ? 65.094  71.883  141.679 1.00 45.49  ? 169 LYS C N   1 
ATOM   4476  C CA  . LYS C  1 168 ? 65.894  73.021  142.078 1.00 44.81  ? 169 LYS C CA  1 
ATOM   4477  C C   . LYS C  1 168 ? 65.624  74.387  141.427 1.00 44.25  ? 169 LYS C C   1 
ATOM   4478  O O   . LYS C  1 168 ? 65.734  75.410  142.102 1.00 43.15  ? 169 LYS C O   1 
ATOM   4479  C CB  . LYS C  1 168 ? 67.364  72.660  141.911 1.00 46.00  ? 169 LYS C CB  1 
ATOM   4480  C CG  . LYS C  1 168 ? 67.709  72.186  140.521 1.00 48.30  ? 169 LYS C CG  1 
ATOM   4481  C CD  . LYS C  1 168 ? 69.203  72.102  140.295 1.00 50.14  ? 169 LYS C CD  1 
ATOM   4482  C CE  . LYS C  1 168 ? 69.508  71.767  138.843 1.00 49.98  ? 169 LYS C CE  1 
ATOM   4483  N NZ  . LYS C  1 168 ? 70.978  71.587  138.602 1.00 52.66  ? 169 LYS C NZ  1 
ATOM   4484  N N   . ASP C  1 169 ? 65.271  74.415  140.138 1.00 42.97  ? 170 ASP C N   1 
ATOM   4485  C CA  . ASP C  1 169 ? 65.032  75.677  139.435 1.00 41.67  ? 170 ASP C CA  1 
ATOM   4486  C C   . ASP C  1 169 ? 63.736  75.733  138.660 1.00 40.70  ? 170 ASP C C   1 
ATOM   4487  O O   . ASP C  1 169 ? 63.408  76.747  138.052 1.00 40.57  ? 170 ASP C O   1 
ATOM   4488  C CB  . ASP C  1 169 ? 66.180  75.974  138.474 1.00 43.76  ? 170 ASP C CB  1 
ATOM   4489  C CG  . ASP C  1 169 ? 66.415  74.852  137.488 1.00 46.97  ? 170 ASP C CG  1 
ATOM   4490  O OD1 . ASP C  1 169 ? 67.142  73.889  137.827 1.00 48.79  ? 170 ASP C OD1 1 
ATOM   4491  O OD2 . ASP C  1 169 ? 65.861  74.920  136.373 1.00 48.10  ? 170 ASP C OD2 1 
ATOM   4492  N N   . SER C  1 170 ? 63.011  74.631  138.667 1.00 40.93  ? 171 SER C N   1 
ATOM   4493  C CA  . SER C  1 170 ? 61.730  74.540  137.978 1.00 41.62  ? 171 SER C CA  1 
ATOM   4494  C C   . SER C  1 170 ? 61.761  74.615  136.451 1.00 40.54  ? 171 SER C C   1 
ATOM   4495  O O   . SER C  1 170 ? 60.705  74.646  135.817 1.00 42.73  ? 171 SER C O   1 
ATOM   4496  C CB  . SER C  1 170 ? 60.785  75.609  138.524 1.00 42.89  ? 171 SER C CB  1 
ATOM   4497  O OG  . SER C  1 170 ? 60.512  75.377  139.895 1.00 45.12  ? 171 SER C OG  1 
ATOM   4498  N N   . THR C  1 171 ? 62.952  74.629  135.863 1.00 38.20  ? 172 THR C N   1 
ATOM   4499  C CA  . THR C  1 171 ? 63.090  74.691  134.409 1.00 36.48  ? 172 THR C CA  1 
ATOM   4500  C C   . THR C  1 171 ? 63.059  73.319  133.756 1.00 35.73  ? 172 THR C C   1 
ATOM   4501  O O   . THR C  1 171 ? 63.134  72.289  134.434 1.00 35.80  ? 172 THR C O   1 
ATOM   4502  C CB  . THR C  1 171 ? 64.420  75.330  133.996 1.00 37.08  ? 172 THR C CB  1 
ATOM   4503  O OG1 . THR C  1 171 ? 65.495  74.403  134.226 1.00 35.79  ? 172 THR C OG1 1 
ATOM   4504  C CG2 . THR C  1 171 ? 64.659  76.598  134.791 1.00 36.43  ? 172 THR C CG2 1 
ATOM   4505  N N   . TYR C  1 172 ? 62.967  73.323  132.429 1.00 35.28  ? 173 TYR C N   1 
ATOM   4506  C CA  . TYR C  1 172 ? 62.961  72.087  131.635 1.00 34.89  ? 173 TYR C CA  1 
ATOM   4507  C C   . TYR C  1 172 ? 64.107  72.165  130.667 1.00 34.44  ? 173 TYR C C   1 
ATOM   4508  O O   . TYR C  1 172 ? 64.756  73.203  130.532 1.00 34.22  ? 173 TYR C O   1 
ATOM   4509  C CB  . TYR C  1 172 ? 61.686  71.934  130.820 1.00 31.87  ? 173 TYR C CB  1 
ATOM   4510  C CG  . TYR C  1 172 ? 60.487  72.310  131.599 1.00 32.91  ? 173 TYR C CG  1 
ATOM   4511  C CD1 . TYR C  1 172 ? 59.697  71.348  132.209 1.00 33.71  ? 173 TYR C CD1 1 
ATOM   4512  C CD2 . TYR C  1 172 ? 60.183  73.648  131.814 1.00 34.79  ? 173 TYR C CD2 1 
ATOM   4513  C CE1 . TYR C  1 172 ? 58.627  71.717  133.028 1.00 34.02  ? 173 TYR C CE1 1 
ATOM   4514  C CE2 . TYR C  1 172 ? 59.126  74.021  132.628 1.00 34.97  ? 173 TYR C CE2 1 
ATOM   4515  C CZ  . TYR C  1 172 ? 58.362  73.051  133.226 1.00 32.64  ? 173 TYR C CZ  1 
ATOM   4516  O OH  . TYR C  1 172 ? 57.356  73.435  134.035 1.00 32.36  ? 173 TYR C OH  1 
ATOM   4517  N N   . SER C  1 173 ? 64.341  71.056  129.988 1.00 34.12  ? 174 SER C N   1 
ATOM   4518  C CA  . SER C  1 173 ? 65.400  70.981  129.000 1.00 34.43  ? 174 SER C CA  1 
ATOM   4519  C C   . SER C  1 173 ? 64.768  70.179  127.876 1.00 32.73  ? 174 SER C C   1 
ATOM   4520  O O   . SER C  1 173 ? 64.036  69.230  128.160 1.00 32.80  ? 174 SER C O   1 
ATOM   4521  C CB  . SER C  1 173 ? 66.635  70.266  129.581 1.00 36.75  ? 174 SER C CB  1 
ATOM   4522  O OG  . SER C  1 173 ? 67.302  71.048  130.573 1.00 37.74  ? 174 SER C OG  1 
ATOM   4523  N N   . LEU C  1 174 ? 65.017  70.565  126.617 1.00 30.51  ? 175 LEU C N   1 
ATOM   4524  C CA  . LEU C  1 174 ? 64.421  69.857  125.483 1.00 28.08  ? 175 LEU C CA  1 
ATOM   4525  C C   . LEU C  1 174 ? 65.405  69.291  124.475 1.00 28.25  ? 175 LEU C C   1 
ATOM   4526  O O   . LEU C  1 174 ? 66.374  69.938  124.071 1.00 27.88  ? 175 LEU C O   1 
ATOM   4527  C CB  . LEU C  1 174 ? 63.399  70.747  124.766 1.00 24.92  ? 175 LEU C CB  1 
ATOM   4528  C CG  . LEU C  1 174 ? 62.348  70.032  123.911 1.00 22.12  ? 175 LEU C CG  1 
ATOM   4529  C CD1 . LEU C  1 174 ? 61.095  70.835  123.874 1.00 17.03  ? 175 LEU C CD1 1 
ATOM   4530  C CD2 . LEU C  1 174 ? 62.880  69.810  122.516 1.00 19.85  ? 175 LEU C CD2 1 
ATOM   4531  N N   . SER C  1 175 ? 65.136  68.047  124.101 1.00 28.52  ? 176 SER C N   1 
ATOM   4532  C CA  . SER C  1 175 ? 65.944  67.311  123.150 1.00 29.58  ? 176 SER C CA  1 
ATOM   4533  C C   . SER C  1 175 ? 65.109  67.150  121.919 1.00 29.93  ? 176 SER C C   1 
ATOM   4534  O O   . SER C  1 175 ? 63.930  66.865  122.029 1.00 31.77  ? 176 SER C O   1 
ATOM   4535  C CB  . SER C  1 175 ? 66.273  65.918  123.679 1.00 30.84  ? 176 SER C CB  1 
ATOM   4536  O OG  . SER C  1 175 ? 65.598  64.927  122.923 1.00 29.63  ? 176 SER C OG  1 
ATOM   4537  N N   . SER C  1 176 ? 65.723  67.331  120.756 1.00 29.47  ? 177 SER C N   1 
ATOM   4538  C CA  . SER C  1 176 ? 65.049  67.191  119.476 1.00 29.04  ? 177 SER C CA  1 
ATOM   4539  C C   . SER C  1 176 ? 66.020  66.531  118.525 1.00 28.11  ? 177 SER C C   1 
ATOM   4540  O O   . SER C  1 176 ? 67.043  67.118  118.191 1.00 26.72  ? 177 SER C O   1 
ATOM   4541  C CB  . SER C  1 176 ? 64.670  68.549  118.912 1.00 29.48  ? 177 SER C CB  1 
ATOM   4542  O OG  . SER C  1 176 ? 64.535  68.453  117.503 1.00 31.37  ? 177 SER C OG  1 
ATOM   4543  N N   . THR C  1 177 ? 65.702  65.319  118.088 1.00 26.64  ? 178 THR C N   1 
ATOM   4544  C CA  . THR C  1 177 ? 66.590  64.620  117.179 1.00 26.47  ? 178 THR C CA  1 
ATOM   4545  C C   . THR C  1 177 ? 66.063  64.510  115.747 1.00 26.95  ? 178 THR C C   1 
ATOM   4546  O O   . THR C  1 177 ? 65.035  63.877  115.487 1.00 27.52  ? 178 THR C O   1 
ATOM   4547  C CB  . THR C  1 177 ? 66.908  63.194  117.690 1.00 26.09  ? 178 THR C CB  1 
ATOM   4548  O OG1 . THR C  1 177 ? 67.087  63.223  119.106 1.00 25.91  ? 178 THR C OG1 1 
ATOM   4549  C CG2 . THR C  1 177 ? 68.203  62.663  117.045 1.00 23.85  ? 178 THR C CG2 1 
ATOM   4550  N N   . LEU C  1 178 ? 66.771  65.139  114.817 1.00 26.26  ? 179 LEU C N   1 
ATOM   4551  C CA  . LEU C  1 178 ? 66.395  65.061  113.428 1.00 26.80  ? 179 LEU C CA  1 
ATOM   4552  C C   . LEU C  1 178 ? 67.115  63.820  112.910 1.00 27.87  ? 179 LEU C C   1 
ATOM   4553  O O   . LEU C  1 178 ? 68.334  63.680  113.077 1.00 27.08  ? 179 LEU C O   1 
ATOM   4554  C CB  . LEU C  1 178 ? 66.849  66.310  112.680 1.00 26.63  ? 179 LEU C CB  1 
ATOM   4555  C CG  . LEU C  1 178 ? 66.293  66.363  111.250 1.00 28.78  ? 179 LEU C CG  1 
ATOM   4556  C CD1 . LEU C  1 178 ? 65.882  67.781  110.900 1.00 30.16  ? 179 LEU C CD1 1 
ATOM   4557  C CD2 . LEU C  1 178 ? 67.320  65.842  110.272 1.00 28.57  ? 179 LEU C CD2 1 
ATOM   4558  N N   . THR C  1 179 ? 66.369  62.904  112.302 1.00 27.83  ? 180 THR C N   1 
ATOM   4559  C CA  . THR C  1 179 ? 66.986  61.685  111.805 1.00 29.05  ? 180 THR C CA  1 
ATOM   4560  C C   . THR C  1 179 ? 66.865  61.519  110.310 1.00 29.66  ? 180 THR C C   1 
ATOM   4561  O O   . THR C  1 179 ? 65.793  61.726  109.747 1.00 31.36  ? 180 THR C O   1 
ATOM   4562  C CB  . THR C  1 179 ? 66.402  60.448  112.503 1.00 29.30  ? 180 THR C CB  1 
ATOM   4563  O OG1 . THR C  1 179 ? 67.410  59.879  113.354 1.00 26.66  ? 180 THR C OG1 1 
ATOM   4564  C CG2 . THR C  1 179 ? 65.910  59.406  111.467 1.00 29.06  ? 180 THR C CG2 1 
ATOM   4565  N N   . LEU C  1 180 ? 67.970  61.111  109.691 1.00 29.17  ? 181 LEU C N   1 
ATOM   4566  C CA  . LEU C  1 180 ? 68.055  60.930  108.246 1.00 30.02  ? 181 LEU C CA  1 
ATOM   4567  C C   . LEU C  1 180 ? 68.935  59.735  107.909 1.00 32.32  ? 181 LEU C C   1 
ATOM   4568  O O   . LEU C  1 180 ? 69.823  59.393  108.705 1.00 34.12  ? 181 LEU C O   1 
ATOM   4569  C CB  . LEU C  1 180 ? 68.704  62.160  107.626 1.00 26.04  ? 181 LEU C CB  1 
ATOM   4570  C CG  . LEU C  1 180 ? 68.173  63.539  107.942 1.00 22.04  ? 181 LEU C CG  1 
ATOM   4571  C CD1 . LEU C  1 180 ? 69.271  64.548  107.744 1.00 20.97  ? 181 LEU C CD1 1 
ATOM   4572  C CD2 . LEU C  1 180 ? 66.985  63.829  107.054 1.00 20.89  ? 181 LEU C CD2 1 
ATOM   4573  N N   . SER C  1 181 ? 68.711  59.123  106.742 1.00 31.97  ? 182 SER C N   1 
ATOM   4574  C CA  . SER C  1 181 ? 69.538  57.998  106.300 1.00 34.46  ? 182 SER C CA  1 
ATOM   4575  C C   . SER C  1 181 ? 70.787  58.684  105.773 1.00 37.57  ? 182 SER C C   1 
ATOM   4576  O O   . SER C  1 181 ? 70.728  59.869  105.444 1.00 37.14  ? 182 SER C O   1 
ATOM   4577  C CB  . SER C  1 181 ? 68.873  57.218  105.172 1.00 34.20  ? 182 SER C CB  1 
ATOM   4578  O OG  . SER C  1 181 ? 69.010  57.893  103.932 1.00 33.64  ? 182 SER C OG  1 
ATOM   4579  N N   . LYS C  1 182 ? 71.907  57.962  105.673 1.00 41.17  ? 183 LYS C N   1 
ATOM   4580  C CA  . LYS C  1 182 ? 73.163  58.585  105.234 1.00 43.69  ? 183 LYS C CA  1 
ATOM   4581  C C   . LYS C  1 182 ? 73.020  59.433  103.985 1.00 45.85  ? 183 LYS C C   1 
ATOM   4582  O O   . LYS C  1 182 ? 73.603  60.522  103.885 1.00 46.28  ? 183 LYS C O   1 
ATOM   4583  C CB  . LYS C  1 182 ? 74.254  57.546  105.000 1.00 42.29  ? 183 LYS C CB  1 
ATOM   4584  C CG  . LYS C  1 182 ? 75.651  58.145  104.852 1.00 40.11  ? 183 LYS C CG  1 
ATOM   4585  C CD  . LYS C  1 182 ? 76.640  57.060  104.486 1.00 41.13  ? 183 LYS C CD  1 
ATOM   4586  C CE  . LYS C  1 182 ? 78.081  57.431  104.820 1.00 42.69  ? 183 LYS C CE  1 
ATOM   4587  N NZ  . LYS C  1 182 ? 78.760  58.249  103.777 1.00 43.13  ? 183 LYS C NZ  1 
ATOM   4588  N N   . ALA C  1 183 ? 72.249  58.939  103.029 1.00 47.69  ? 184 ALA C N   1 
ATOM   4589  C CA  . ALA C  1 183 ? 72.050  59.688  101.801 1.00 50.67  ? 184 ALA C CA  1 
ATOM   4590  C C   . ALA C  1 183 ? 71.431  61.041  102.139 1.00 52.11  ? 184 ALA C C   1 
ATOM   4591  O O   . ALA C  1 183 ? 72.143  62.022  102.390 1.00 51.65  ? 184 ALA C O   1 
ATOM   4592  C CB  . ALA C  1 183 ? 71.147  58.917  100.863 1.00 51.16  ? 184 ALA C CB  1 
ATOM   4593  N N   . ASP C  1 184 ? 70.099  61.074  102.148 1.00 53.75  ? 185 ASP C N   1 
ATOM   4594  C CA  . ASP C  1 184 ? 69.342  62.284  102.458 1.00 54.21  ? 185 ASP C CA  1 
ATOM   4595  C C   . ASP C  1 184 ? 70.291  63.262  103.141 1.00 52.76  ? 185 ASP C C   1 
ATOM   4596  O O   . ASP C  1 184 ? 70.570  64.341  102.622 1.00 52.28  ? 185 ASP C O   1 
ATOM   4597  C CB  . ASP C  1 184 ? 68.167  61.950  103.394 1.00 56.05  ? 185 ASP C CB  1 
ATOM   4598  C CG  . ASP C  1 184 ? 67.327  60.769  102.898 1.00 58.29  ? 185 ASP C CG  1 
ATOM   4599  O OD1 . ASP C  1 184 ? 67.920  59.754  102.460 1.00 59.03  ? 185 ASP C OD1 1 
ATOM   4600  O OD2 . ASP C  1 184 ? 66.075  60.848  102.962 1.00 58.50  ? 185 ASP C OD2 1 
ATOM   4601  N N   . TYR C  1 185 ? 70.810  62.853  104.294 1.00 50.53  ? 186 TYR C N   1 
ATOM   4602  C CA  . TYR C  1 185 ? 71.719  63.690  105.042 1.00 48.56  ? 186 TYR C CA  1 
ATOM   4603  C C   . TYR C  1 185 ? 72.787  64.194  104.112 1.00 49.92  ? 186 TYR C C   1 
ATOM   4604  O O   . TYR C  1 185 ? 72.771  65.350  103.701 1.00 49.48  ? 186 TYR C O   1 
ATOM   4605  C CB  . TYR C  1 185 ? 72.370  62.908  106.160 1.00 44.59  ? 186 TYR C CB  1 
ATOM   4606  C CG  . TYR C  1 185 ? 73.394  63.719  106.897 1.00 41.73  ? 186 TYR C CG  1 
ATOM   4607  C CD1 . TYR C  1 185 ? 73.020  64.806  107.689 1.00 40.67  ? 186 TYR C CD1 1 
ATOM   4608  C CD2 . TYR C  1 185 ? 74.745  63.406  106.803 1.00 40.79  ? 186 TYR C CD2 1 
ATOM   4609  C CE1 . TYR C  1 185 ? 73.977  65.557  108.371 1.00 39.48  ? 186 TYR C CE1 1 
ATOM   4610  C CE2 . TYR C  1 185 ? 75.710  64.147  107.482 1.00 38.62  ? 186 TYR C CE2 1 
ATOM   4611  C CZ  . TYR C  1 185 ? 75.322  65.213  108.258 1.00 38.37  ? 186 TYR C CZ  1 
ATOM   4612  O OH  . TYR C  1 185 ? 76.283  65.923  108.916 1.00 36.56  ? 186 TYR C OH  1 
ATOM   4613  N N   . GLU C  1 186 ? 73.720  63.317  103.770 1.00 51.87  ? 187 GLU C N   1 
ATOM   4614  C CA  . GLU C  1 186 ? 74.795  63.696  102.869 1.00 54.19  ? 187 GLU C CA  1 
ATOM   4615  C C   . GLU C  1 186 ? 74.287  64.528  101.692 1.00 54.36  ? 187 GLU C C   1 
ATOM   4616  O O   . GLU C  1 186 ? 74.981  65.427  101.221 1.00 54.27  ? 187 GLU C O   1 
ATOM   4617  C CB  . GLU C  1 186 ? 75.496  62.455  102.343 1.00 56.15  ? 187 GLU C CB  1 
ATOM   4618  C CG  . GLU C  1 186 ? 75.995  61.542  103.424 1.00 59.89  ? 187 GLU C CG  1 
ATOM   4619  C CD  . GLU C  1 186 ? 77.172  60.713  102.960 1.00 63.18  ? 187 GLU C CD  1 
ATOM   4620  O OE1 . GLU C  1 186 ? 77.046  60.016  101.922 1.00 64.66  ? 187 GLU C OE1 1 
ATOM   4621  O OE2 . GLU C  1 186 ? 78.225  60.767  103.632 1.00 64.03  ? 187 GLU C OE2 1 
ATOM   4622  N N   . LYS C  1 187 ? 73.078  64.227  101.225 1.00 54.19  ? 188 LYS C N   1 
ATOM   4623  C CA  . LYS C  1 187 ? 72.475  64.955  100.111 1.00 53.95  ? 188 LYS C CA  1 
ATOM   4624  C C   . LYS C  1 187 ? 72.527  66.479  100.234 1.00 51.72  ? 188 LYS C C   1 
ATOM   4625  O O   . LYS C  1 187 ? 72.756  67.166  99.250  1.00 50.63  ? 188 LYS C O   1 
ATOM   4626  C CB  . LYS C  1 187 ? 71.000  64.572  99.939  1.00 57.31  ? 188 LYS C CB  1 
ATOM   4627  C CG  . LYS C  1 187 ? 70.710  63.198  99.339  1.00 61.29  ? 188 LYS C CG  1 
ATOM   4628  C CD  . LYS C  1 187 ? 69.218  63.076  98.980  1.00 62.81  ? 188 LYS C CD  1 
ATOM   4629  C CE  . LYS C  1 187 ? 68.851  61.714  98.408  1.00 63.63  ? 188 LYS C CE  1 
ATOM   4630  N NZ  . LYS C  1 187 ? 67.423  61.698  97.989  1.00 65.78  ? 188 LYS C NZ  1 
ATOM   4631  N N   . HIS C  1 188 ? 72.306  67.002  101.435 1.00 49.04  ? 189 HIS C N   1 
ATOM   4632  C CA  . HIS C  1 188 ? 72.276  68.442  101.635 1.00 46.28  ? 189 HIS C CA  1 
ATOM   4633  C C   . HIS C  1 188 ? 73.498  68.997  102.334 1.00 46.49  ? 189 HIS C C   1 
ATOM   4634  O O   . HIS C  1 188 ? 74.312  68.235  102.838 1.00 48.32  ? 189 HIS C O   1 
ATOM   4635  C CB  . HIS C  1 188 ? 71.025  68.777  102.410 1.00 44.61  ? 189 HIS C CB  1 
ATOM   4636  C CG  . HIS C  1 188 ? 69.829  68.023  101.940 1.00 42.51  ? 189 HIS C CG  1 
ATOM   4637  N ND1 . HIS C  1 188 ? 69.404  68.053  100.633 1.00 41.58  ? 189 HIS C ND1 1 
ATOM   4638  C CD2 . HIS C  1 188 ? 68.968  67.218  102.598 1.00 43.82  ? 189 HIS C CD2 1 
ATOM   4639  C CE1 . HIS C  1 188 ? 68.329  67.301  100.505 1.00 42.87  ? 189 HIS C CE1 1 
ATOM   4640  N NE2 . HIS C  1 188 ? 68.042  66.781  101.683 1.00 44.13  ? 189 HIS C NE2 1 
ATOM   4641  N N   . LYS C  1 189 ? 73.615  70.323  102.388 1.00 44.74  ? 190 LYS C N   1 
ATOM   4642  C CA  . LYS C  1 189 ? 74.781  70.967  102.993 1.00 43.59  ? 190 LYS C CA  1 
ATOM   4643  C C   . LYS C  1 189 ? 74.540  71.824  104.230 1.00 43.52  ? 190 LYS C C   1 
ATOM   4644  O O   . LYS C  1 189 ? 75.476  72.131  104.958 1.00 44.90  ? 190 LYS C O   1 
ATOM   4645  C CB  . LYS C  1 189 ? 75.483  71.814  101.925 1.00 43.71  ? 190 LYS C CB  1 
ATOM   4646  C CG  . LYS C  1 189 ? 76.524  72.815  102.412 1.00 45.21  ? 190 LYS C CG  1 
ATOM   4647  C CD  . LYS C  1 189 ? 76.954  73.748  101.260 1.00 46.58  ? 190 LYS C CD  1 
ATOM   4648  C CE  . LYS C  1 189 ? 78.285  74.474  101.543 1.00 48.84  ? 190 LYS C CE  1 
ATOM   4649  N NZ  . LYS C  1 189 ? 78.782  75.334  100.411 1.00 46.92  ? 190 LYS C NZ  1 
ATOM   4650  N N   . VAL C  1 190 ? 73.304  72.224  104.487 1.00 42.62  ? 191 VAL C N   1 
ATOM   4651  C CA  . VAL C  1 190 ? 73.054  73.069  105.652 1.00 41.03  ? 191 VAL C CA  1 
ATOM   4652  C C   . VAL C  1 190 ? 71.920  72.540  106.507 1.00 38.40  ? 191 VAL C C   1 
ATOM   4653  O O   . VAL C  1 190 ? 70.852  72.213  106.002 1.00 38.67  ? 191 VAL C O   1 
ATOM   4654  C CB  . VAL C  1 190 ? 72.718  74.523  105.225 1.00 42.73  ? 191 VAL C CB  1 
ATOM   4655  C CG1 . VAL C  1 190 ? 72.908  75.479  106.413 1.00 42.11  ? 191 VAL C CG1 1 
ATOM   4656  C CG2 . VAL C  1 190 ? 73.584  74.930  104.031 1.00 42.62  ? 191 VAL C CG2 1 
ATOM   4657  N N   . TYR C  1 191 ? 72.157  72.473  107.808 1.00 34.72  ? 192 TYR C N   1 
ATOM   4658  C CA  . TYR C  1 191 ? 71.156  71.967  108.741 1.00 32.35  ? 192 TYR C CA  1 
ATOM   4659  C C   . TYR C  1 191 ? 71.031  72.976  109.845 1.00 31.75  ? 192 TYR C C   1 
ATOM   4660  O O   . TYR C  1 191 ? 72.040  73.395  110.412 1.00 31.32  ? 192 TYR C O   1 
ATOM   4661  C CB  . TYR C  1 191 ? 71.604  70.607  109.306 1.00 29.74  ? 192 TYR C CB  1 
ATOM   4662  C CG  . TYR C  1 191 ? 71.733  69.537  108.235 1.00 25.28  ? 192 TYR C CG  1 
ATOM   4663  C CD1 . TYR C  1 191 ? 70.606  68.913  107.726 1.00 24.94  ? 192 TYR C CD1 1 
ATOM   4664  C CD2 . TYR C  1 191 ? 72.964  69.200  107.690 1.00 20.71  ? 192 TYR C CD2 1 
ATOM   4665  C CE1 . TYR C  1 191 ? 70.692  67.991  106.711 1.00 22.16  ? 192 TYR C CE1 1 
ATOM   4666  C CE2 . TYR C  1 191 ? 73.054  68.282  106.674 1.00 19.60  ? 192 TYR C CE2 1 
ATOM   4667  C CZ  . TYR C  1 191 ? 71.912  67.679  106.187 1.00 20.17  ? 192 TYR C CZ  1 
ATOM   4668  O OH  . TYR C  1 191 ? 71.953  66.762  105.164 1.00 19.63  ? 192 TYR C OH  1 
ATOM   4669  N N   . ALA C  1 192 ? 69.801  73.369  110.156 1.00 31.05  ? 193 ALA C N   1 
ATOM   4670  C CA  . ALA C  1 192 ? 69.597  74.373  111.192 1.00 32.64  ? 193 ALA C CA  1 
ATOM   4671  C C   . ALA C  1 192 ? 68.375  74.219  112.074 1.00 33.74  ? 193 ALA C C   1 
ATOM   4672  O O   . ALA C  1 192 ? 67.317  73.790  111.625 1.00 34.11  ? 193 ALA C O   1 
ATOM   4673  C CB  . ALA C  1 192 ? 69.560  75.747  110.557 1.00 31.46  ? 193 ALA C CB  1 
ATOM   4674  N N   . CYS C  1 193 ? 68.521  74.561  113.345 1.00 33.45  ? 194 CYS C N   1 
ATOM   4675  C CA  . CYS C  1 193 ? 67.364  74.518  114.190 1.00 36.45  ? 194 CYS C CA  1 
ATOM   4676  C C   . CYS C  1 193 ? 67.199  75.871  114.875 1.00 35.51  ? 194 CYS C C   1 
ATOM   4677  O O   . CYS C  1 193 ? 68.049  76.321  115.642 1.00 33.46  ? 194 CYS C O   1 
ATOM   4678  C CB  . CYS C  1 193 ? 67.389  73.326  115.185 1.00 39.40  ? 194 CYS C CB  1 
ATOM   4679  S SG  . CYS C  1 193 ? 68.886  73.065  116.179 1.00 48.26  ? 194 CYS C SG  1 
ATOM   4680  N N   . GLU C  1 194 ? 66.087  76.520  114.522 1.00 35.91  ? 195 GLU C N   1 
ATOM   4681  C CA  . GLU C  1 194 ? 65.682  77.818  115.043 1.00 35.16  ? 195 GLU C CA  1 
ATOM   4682  C C   . GLU C  1 194 ? 64.652  77.555  116.126 1.00 34.36  ? 195 GLU C C   1 
ATOM   4683  O O   . GLU C  1 194 ? 63.728  76.751  115.952 1.00 32.85  ? 195 GLU C O   1 
ATOM   4684  C CB  . GLU C  1 194 ? 65.092  78.660  113.905 1.00 37.56  ? 195 GLU C CB  1 
ATOM   4685  C CG  . GLU C  1 194 ? 63.949  79.588  114.253 1.00 41.94  ? 195 GLU C CG  1 
ATOM   4686  C CD  . GLU C  1 194 ? 62.874  79.582  113.165 1.00 45.75  ? 195 GLU C CD  1 
ATOM   4687  O OE1 . GLU C  1 194 ? 63.242  79.797  111.992 1.00 48.55  ? 195 GLU C OE1 1 
ATOM   4688  O OE2 . GLU C  1 194 ? 61.674  79.353  113.466 1.00 46.63  ? 195 GLU C OE2 1 
ATOM   4689  N N   . VAL C  1 195 ? 64.834  78.244  117.247 1.00 33.83  ? 196 VAL C N   1 
ATOM   4690  C CA  . VAL C  1 195 ? 63.974  78.128  118.425 1.00 32.16  ? 196 VAL C CA  1 
ATOM   4691  C C   . VAL C  1 195 ? 63.249  79.432  118.744 1.00 29.78  ? 196 VAL C C   1 
ATOM   4692  O O   . VAL C  1 195 ? 63.883  80.442  118.977 1.00 29.03  ? 196 VAL C O   1 
ATOM   4693  C CB  . VAL C  1 195 ? 64.832  77.705  119.646 1.00 31.97  ? 196 VAL C CB  1 
ATOM   4694  C CG1 . VAL C  1 195 ? 64.147  78.053  120.945 1.00 28.43  ? 196 VAL C CG1 1 
ATOM   4695  C CG2 . VAL C  1 195 ? 65.106  76.224  119.564 1.00 32.23  ? 196 VAL C CG2 1 
ATOM   4696  N N   . THR C  1 196 ? 61.924  79.393  118.743 1.00 28.44  ? 197 THR C N   1 
ATOM   4697  C CA  . THR C  1 196 ? 61.112  80.566  119.042 1.00 27.95  ? 197 THR C CA  1 
ATOM   4698  C C   . THR C  1 196 ? 60.529  80.328  120.424 1.00 29.04  ? 197 THR C C   1 
ATOM   4699  O O   . THR C  1 196 ? 59.700  79.438  120.618 1.00 30.31  ? 197 THR C O   1 
ATOM   4700  C CB  . THR C  1 196 ? 59.953  80.766  117.990 1.00 26.75  ? 197 THR C CB  1 
ATOM   4701  O OG1 . THR C  1 196 ? 58.705  80.258  118.495 1.00 20.58  ? 197 THR C OG1 1 
ATOM   4702  C CG2 . THR C  1 196 ? 60.295  80.050  116.683 1.00 23.13  ? 197 THR C CG2 1 
ATOM   4703  N N   . HIS C  1 197 ? 60.974  81.119  121.391 1.00 29.44  ? 198 HIS C N   1 
ATOM   4704  C CA  . HIS C  1 197 ? 60.504  80.959  122.760 1.00 29.20  ? 198 HIS C CA  1 
ATOM   4705  C C   . HIS C  1 197 ? 60.211  82.257  123.505 1.00 30.69  ? 198 HIS C C   1 
ATOM   4706  O O   . HIS C  1 197 ? 60.889  83.273  123.332 1.00 28.70  ? 198 HIS C O   1 
ATOM   4707  C CB  . HIS C  1 197 ? 61.509  80.114  123.567 1.00 25.98  ? 198 HIS C CB  1 
ATOM   4708  C CG  . HIS C  1 197 ? 61.187  80.023  125.025 1.00 24.27  ? 198 HIS C CG  1 
ATOM   4709  N ND1 . HIS C  1 197 ? 61.853  80.757  125.981 1.00 21.97  ? 198 HIS C ND1 1 
ATOM   4710  C CD2 . HIS C  1 197 ? 60.233  79.324  125.686 1.00 24.98  ? 198 HIS C CD2 1 
ATOM   4711  C CE1 . HIS C  1 197 ? 61.326  80.514  127.167 1.00 22.71  ? 198 HIS C CE1 1 
ATOM   4712  N NE2 . HIS C  1 197 ? 60.342  79.647  127.019 1.00 24.56  ? 198 HIS C NE2 1 
ATOM   4713  N N   . GLN C  1 198 ? 59.176  82.185  124.337 1.00 34.60  ? 199 GLN C N   1 
ATOM   4714  C CA  . GLN C  1 198 ? 58.711  83.289  125.167 1.00 37.79  ? 199 GLN C CA  1 
ATOM   4715  C C   . GLN C  1 198 ? 59.903  84.127  125.608 1.00 39.07  ? 199 GLN C C   1 
ATOM   4716  O O   . GLN C  1 198 ? 60.067  85.261  125.161 1.00 39.09  ? 199 GLN C O   1 
ATOM   4717  C CB  . GLN C  1 198 ? 57.991  82.728  126.396 1.00 39.24  ? 199 GLN C CB  1 
ATOM   4718  C CG  . GLN C  1 198 ? 57.205  83.727  127.180 1.00 43.41  ? 199 GLN C CG  1 
ATOM   4719  C CD  . GLN C  1 198 ? 55.891  84.060  126.510 1.00 48.59  ? 199 GLN C CD  1 
ATOM   4720  O OE1 . GLN C  1 198 ? 54.954  83.254  126.507 1.00 51.33  ? 199 GLN C OE1 1 
ATOM   4721  N NE2 . GLN C  1 198 ? 55.810  85.252  125.931 1.00 51.23  ? 199 GLN C NE2 1 
ATOM   4722  N N   . GLY C  1 199 ? 60.735  83.546  126.471 1.00 39.61  ? 200 GLY C N   1 
ATOM   4723  C CA  . GLY C  1 199 ? 61.904  84.238  126.984 1.00 42.36  ? 200 GLY C CA  1 
ATOM   4724  C C   . GLY C  1 199 ? 62.842  84.933  126.006 1.00 44.53  ? 200 GLY C C   1 
ATOM   4725  O O   . GLY C  1 199 ? 63.708  85.692  126.434 1.00 44.79  ? 200 GLY C O   1 
ATOM   4726  N N   . LEU C  1 200 ? 62.703  84.686  124.707 1.00 46.20  ? 201 LEU C N   1 
ATOM   4727  C CA  . LEU C  1 200 ? 63.574  85.341  123.729 1.00 49.09  ? 201 LEU C CA  1 
ATOM   4728  C C   . LEU C  1 200 ? 62.775  86.308  122.879 1.00 50.81  ? 201 LEU C C   1 
ATOM   4729  O O   . LEU C  1 200 ? 61.622  86.044  122.554 1.00 52.33  ? 201 LEU C O   1 
ATOM   4730  C CB  . LEU C  1 200 ? 64.265  84.306  122.831 1.00 49.26  ? 201 LEU C CB  1 
ATOM   4731  C CG  . LEU C  1 200 ? 65.408  83.535  123.508 1.00 49.71  ? 201 LEU C CG  1 
ATOM   4732  C CD1 . LEU C  1 200 ? 65.877  82.413  122.605 1.00 46.99  ? 201 LEU C CD1 1 
ATOM   4733  C CD2 . LEU C  1 200 ? 66.552  84.503  123.851 1.00 48.80  ? 201 LEU C CD2 1 
ATOM   4734  N N   . SER C  1 201 ? 63.382  87.431  122.515 1.00 52.24  ? 202 SER C N   1 
ATOM   4735  C CA  . SER C  1 201 ? 62.675  88.424  121.721 1.00 53.32  ? 202 SER C CA  1 
ATOM   4736  C C   . SER C  1 201 ? 62.807  88.132  120.240 1.00 53.64  ? 202 SER C C   1 
ATOM   4737  O O   . SER C  1 201 ? 62.012  88.624  119.426 1.00 54.38  ? 202 SER C O   1 
ATOM   4738  C CB  . SER C  1 201 ? 63.192  89.839  122.032 1.00 54.33  ? 202 SER C CB  1 
ATOM   4739  O OG  . SER C  1 201 ? 64.589  89.959  121.824 1.00 53.89  ? 202 SER C OG  1 
ATOM   4740  N N   . SER C  1 202 ? 63.802  87.322  119.886 1.00 53.26  ? 203 SER C N   1 
ATOM   4741  C CA  . SER C  1 202 ? 64.008  86.976  118.484 1.00 52.27  ? 203 SER C CA  1 
ATOM   4742  C C   . SER C  1 202 ? 64.524  85.558  118.287 1.00 50.41  ? 203 SER C C   1 
ATOM   4743  O O   . SER C  1 202 ? 65.541  85.187  118.871 1.00 51.45  ? 203 SER C O   1 
ATOM   4744  C CB  . SER C  1 202 ? 64.988  87.960  117.854 1.00 53.42  ? 203 SER C CB  1 
ATOM   4745  O OG  . SER C  1 202 ? 65.081  87.730  116.466 1.00 55.01  ? 203 SER C OG  1 
ATOM   4746  N N   . PRO C  1 203 ? 63.826  84.750  117.459 1.00 48.59  ? 204 PRO C N   1 
ATOM   4747  C CA  . PRO C  1 203 ? 64.127  83.350  117.105 1.00 47.95  ? 204 PRO C CA  1 
ATOM   4748  C C   . PRO C  1 203 ? 65.621  82.961  116.980 1.00 46.75  ? 204 PRO C C   1 
ATOM   4749  O O   . PRO C  1 203 ? 66.297  83.325  116.012 1.00 47.53  ? 204 PRO C O   1 
ATOM   4750  C CB  . PRO C  1 203 ? 63.364  83.174  115.796 1.00 46.31  ? 204 PRO C CB  1 
ATOM   4751  C CG  . PRO C  1 203 ? 62.113  83.899  116.089 1.00 46.05  ? 204 PRO C CG  1 
ATOM   4752  C CD  . PRO C  1 203 ? 62.572  85.172  116.811 1.00 47.56  ? 204 PRO C CD  1 
ATOM   4753  N N   . VAL C  1 204 ? 66.117  82.206  117.959 1.00 44.93  ? 205 VAL C N   1 
ATOM   4754  C CA  . VAL C  1 204 ? 67.513  81.766  117.996 1.00 44.30  ? 205 VAL C CA  1 
ATOM   4755  C C   . VAL C  1 204 ? 67.844  80.746  116.908 1.00 43.09  ? 205 VAL C C   1 
ATOM   4756  O O   . VAL C  1 204 ? 66.964  80.015  116.441 1.00 43.03  ? 205 VAL C O   1 
ATOM   4757  C CB  . VAL C  1 204 ? 67.854  81.172  119.398 1.00 45.76  ? 205 VAL C CB  1 
ATOM   4758  C CG1 . VAL C  1 204 ? 68.909  80.067  119.290 1.00 44.18  ? 205 VAL C CG1 1 
ATOM   4759  C CG2 . VAL C  1 204 ? 68.345  82.292  120.324 1.00 45.10  ? 205 VAL C CG2 1 
ATOM   4760  N N   . THR C  1 205 ? 69.108  80.689  116.500 1.00 40.78  ? 206 THR C N   1 
ATOM   4761  C CA  . THR C  1 205 ? 69.466  79.740  115.459 1.00 38.81  ? 206 THR C CA  1 
ATOM   4762  C C   . THR C  1 205 ? 70.886  79.201  115.364 1.00 38.92  ? 206 THR C C   1 
ATOM   4763  O O   . THR C  1 205 ? 71.806  79.886  114.919 1.00 37.98  ? 206 THR C O   1 
ATOM   4764  C CB  . THR C  1 205 ? 69.077  80.286  114.080 1.00 36.58  ? 206 THR C CB  1 
ATOM   4765  O OG1 . THR C  1 205 ? 67.649  80.300  113.969 1.00 32.36  ? 206 THR C OG1 1 
ATOM   4766  C CG2 . THR C  1 205 ? 69.675  79.435  112.977 1.00 34.28  ? 206 THR C CG2 1 
ATOM   4767  N N   . LYS C  1 206 ? 71.018  77.941  115.769 1.00 39.49  ? 207 LYS C N   1 
ATOM   4768  C CA  . LYS C  1 206 ? 72.260  77.193  115.707 1.00 40.80  ? 207 LYS C CA  1 
ATOM   4769  C C   . LYS C  1 206 ? 72.118  76.261  114.484 1.00 41.44  ? 207 LYS C C   1 
ATOM   4770  O O   . LYS C  1 206 ? 71.081  75.618  114.289 1.00 40.07  ? 207 LYS C O   1 
ATOM   4771  C CB  . LYS C  1 206 ? 72.441  76.362  116.976 1.00 41.42  ? 207 LYS C CB  1 
ATOM   4772  C CG  . LYS C  1 206 ? 73.622  76.755  117.844 1.00 42.89  ? 207 LYS C CG  1 
ATOM   4773  C CD  . LYS C  1 206 ? 73.464  78.145  118.455 1.00 43.30  ? 207 LYS C CD  1 
ATOM   4774  C CE  . LYS C  1 206 ? 74.710  78.521  119.264 1.00 43.96  ? 207 LYS C CE  1 
ATOM   4775  N NZ  . LYS C  1 206 ? 74.723  79.936  119.752 1.00 43.19  ? 207 LYS C NZ  1 
ATOM   4776  N N   . SER C  1 207 ? 73.155  76.212  113.654 1.00 43.01  ? 208 SER C N   1 
ATOM   4777  C CA  . SER C  1 207 ? 73.156  75.381  112.452 1.00 43.83  ? 208 SER C CA  1 
ATOM   4778  C C   . SER C  1 207 ? 74.585  75.045  112.066 1.00 45.49  ? 208 SER C C   1 
ATOM   4779  O O   . SER C  1 207 ? 75.540  75.410  112.765 1.00 45.87  ? 208 SER C O   1 
ATOM   4780  C CB  . SER C  1 207 ? 72.523  76.119  111.273 1.00 43.19  ? 208 SER C CB  1 
ATOM   4781  O OG  . SER C  1 207 ? 73.394  77.115  110.760 1.00 41.46  ? 208 SER C OG  1 
ATOM   4782  N N   . PHE C  1 208 ? 74.733  74.354  110.940 1.00 45.91  ? 209 PHE C N   1 
ATOM   4783  C CA  . PHE C  1 208 ? 76.054  74.006  110.475 1.00 45.29  ? 209 PHE C CA  1 
ATOM   4784  C C   . PHE C  1 208 ? 76.030  73.461  109.074 1.00 46.66  ? 209 PHE C C   1 
ATOM   4785  O O   . PHE C  1 208 ? 74.984  73.040  108.579 1.00 46.37  ? 209 PHE C O   1 
ATOM   4786  C CB  . PHE C  1 208 ? 76.704  72.998  111.413 1.00 43.64  ? 209 PHE C CB  1 
ATOM   4787  C CG  . PHE C  1 208 ? 76.090  71.638  111.371 1.00 40.65  ? 209 PHE C CG  1 
ATOM   4788  C CD1 . PHE C  1 208 ? 75.218  71.235  112.355 1.00 38.83  ? 209 PHE C CD1 1 
ATOM   4789  C CD2 . PHE C  1 208 ? 76.417  70.746  110.358 1.00 40.68  ? 209 PHE C CD2 1 
ATOM   4790  C CE1 . PHE C  1 208 ? 74.677  69.965  112.338 1.00 39.36  ? 209 PHE C CE1 1 
ATOM   4791  C CE2 . PHE C  1 208 ? 75.880  69.471  110.332 1.00 40.70  ? 209 PHE C CE2 1 
ATOM   4792  C CZ  . PHE C  1 208 ? 75.006  69.078  111.327 1.00 39.88  ? 209 PHE C CZ  1 
ATOM   4793  N N   . ASN C  1 209 ? 77.203  73.493  108.444 1.00 48.85  ? 210 ASN C N   1 
ATOM   4794  C CA  . ASN C  1 209 ? 77.389  73.019  107.086 1.00 50.08  ? 210 ASN C CA  1 
ATOM   4795  C C   . ASN C  1 209 ? 78.016  71.644  107.140 1.00 51.92  ? 210 ASN C C   1 
ATOM   4796  O O   . ASN C  1 209 ? 79.180  71.509  107.496 1.00 52.71  ? 210 ASN C O   1 
ATOM   4797  C CB  . ASN C  1 209 ? 78.294  73.975  106.318 1.00 50.00  ? 210 ASN C CB  1 
ATOM   4798  C CG  . ASN C  1 209 ? 77.676  75.350  106.155 1.00 52.26  ? 210 ASN C CG  1 
ATOM   4799  O OD1 . ASN C  1 209 ? 78.121  76.158  105.342 1.00 53.89  ? 210 ASN C OD1 1 
ATOM   4800  N ND2 . ASN C  1 209 ? 76.641  75.625  106.934 1.00 53.18  ? 210 ASN C ND2 1 
ATOM   4801  N N   . ARG C  1 210 ? 77.219  70.630  106.807 1.00 54.11  ? 211 ARG C N   1 
ATOM   4802  C CA  . ARG C  1 210 ? 77.648  69.237  106.794 1.00 55.08  ? 211 ARG C CA  1 
ATOM   4803  C C   . ARG C  1 210 ? 78.991  69.082  106.153 1.00 57.14  ? 211 ARG C C   1 
ATOM   4804  O O   . ARG C  1 210 ? 79.179  69.470  105.001 1.00 57.19  ? 211 ARG C O   1 
ATOM   4805  C CB  . ARG C  1 210 ? 76.679  68.379  106.011 1.00 55.14  ? 211 ARG C CB  1 
ATOM   4806  C CG  . ARG C  1 210 ? 77.277  67.051  105.619 1.00 56.94  ? 211 ARG C CG  1 
ATOM   4807  C CD  . ARG C  1 210 ? 76.373  66.306  104.674 1.00 59.17  ? 211 ARG C CD  1 
ATOM   4808  N NE  . ARG C  1 210 ? 76.405  66.875  103.335 1.00 62.00  ? 211 ARG C NE  1 
ATOM   4809  C CZ  . ARG C  1 210 ? 77.392  66.682  102.471 1.00 63.20  ? 211 ARG C CZ  1 
ATOM   4810  N NH1 . ARG C  1 210 ? 78.437  65.930  102.803 1.00 64.39  ? 211 ARG C NH1 1 
ATOM   4811  N NH2 . ARG C  1 210 ? 77.328  67.232  101.270 1.00 64.93  ? 211 ARG C NH2 1 
ATOM   4812  N N   . GLY C  1 211 ? 79.906  68.469  106.898 1.00 60.16  ? 212 GLY C N   1 
ATOM   4813  C CA  . GLY C  1 211 ? 81.261  68.253  106.424 1.00 62.58  ? 212 GLY C CA  1 
ATOM   4814  C C   . GLY C  1 211 ? 82.233  69.222  107.080 1.00 64.60  ? 212 GLY C C   1 
ATOM   4815  O O   . GLY C  1 211 ? 82.321  70.375  106.665 1.00 64.71  ? 212 GLY C O   1 
ATOM   4816  N N   . GLU C  1 212 ? 82.943  68.755  108.108 1.00 66.23  ? 213 GLU C N   1 
ATOM   4817  C CA  . GLU C  1 212 ? 83.932  69.551  108.839 1.00 67.82  ? 213 GLU C CA  1 
ATOM   4818  C C   . GLU C  1 212 ? 84.375  68.817  110.101 1.00 67.96  ? 213 GLU C C   1 
ATOM   4819  O O   . GLU C  1 212 ? 83.582  68.607  111.022 1.00 68.15  ? 213 GLU C O   1 
ATOM   4820  C CB  . GLU C  1 212 ? 83.371  70.930  109.223 1.00 70.11  ? 213 GLU C CB  1 
ATOM   4821  C CG  . GLU C  1 212 ? 83.563  72.013  108.159 1.00 72.74  ? 213 GLU C CG  1 
ATOM   4822  C CD  . GLU C  1 212 ? 83.302  73.423  108.669 1.00 74.61  ? 213 GLU C CD  1 
ATOM   4823  O OE1 . GLU C  1 212 ? 82.297  73.631  109.390 1.00 76.03  ? 213 GLU C OE1 1 
ATOM   4824  O OE2 . GLU C  1 212 ? 84.106  74.324  108.336 1.00 75.09  ? 213 GLU C OE2 1 
ATOM   4825  N N   . GLN D  2 1   ? 47.516  48.896  155.341 1.00 84.33  ? 1   GLN D N   1 
ATOM   4826  C CA  . GLN D  2 1   ? 48.018  47.529  155.315 1.00 84.52  ? 1   GLN D CA  1 
ATOM   4827  C C   . GLN D  2 1   ? 47.552  46.776  154.066 1.00 85.02  ? 1   GLN D C   1 
ATOM   4828  O O   . GLN D  2 1   ? 47.273  47.388  153.029 1.00 85.13  ? 1   GLN D O   1 
ATOM   4829  C CB  . GLN D  2 1   ? 47.567  46.778  156.570 1.00 83.78  ? 1   GLN D CB  1 
ATOM   4830  C CG  . GLN D  2 1   ? 48.319  47.159  157.824 1.00 84.94  ? 1   GLN D CG  1 
ATOM   4831  C CD  . GLN D  2 1   ? 47.877  46.360  159.040 1.00 85.91  ? 1   GLN D CD  1 
ATOM   4832  O OE1 . GLN D  2 1   ? 47.867  45.132  159.016 1.00 85.95  ? 1   GLN D OE1 1 
ATOM   4833  N NE2 . GLN D  2 1   ? 47.514  47.059  160.116 1.00 86.30  ? 1   GLN D NE2 1 
ATOM   4834  N N   . VAL D  2 2   ? 47.471  45.449  154.192 1.00 84.74  ? 2   VAL D N   1 
ATOM   4835  C CA  . VAL D  2 2   ? 47.064  44.526  153.123 1.00 83.40  ? 2   VAL D CA  1 
ATOM   4836  C C   . VAL D  2 2   ? 47.496  44.930  151.720 1.00 82.53  ? 2   VAL D C   1 
ATOM   4837  O O   . VAL D  2 2   ? 46.687  44.954  150.799 1.00 81.69  ? 2   VAL D O   1 
ATOM   4838  C CB  . VAL D  2 2   ? 45.526  44.278  153.118 1.00 83.51  ? 2   VAL D CB  1 
ATOM   4839  C CG1 . VAL D  2 2   ? 44.772  45.553  152.776 1.00 83.46  ? 2   VAL D CG1 1 
ATOM   4840  C CG2 . VAL D  2 2   ? 45.188  43.175  152.125 1.00 82.82  ? 2   VAL D CG2 1 
ATOM   4841  N N   . GLN D  2 3   ? 48.779  45.238  151.561 1.00 82.59  ? 3   GLN D N   1 
ATOM   4842  C CA  . GLN D  2 3   ? 49.318  45.623  150.262 1.00 83.37  ? 3   GLN D CA  1 
ATOM   4843  C C   . GLN D  2 3   ? 48.813  44.646  149.194 1.00 83.22  ? 3   GLN D C   1 
ATOM   4844  O O   . GLN D  2 3   ? 48.325  43.561  149.530 1.00 84.85  ? 3   GLN D O   1 
ATOM   4845  C CB  . GLN D  2 3   ? 50.850  45.600  150.315 1.00 83.60  ? 3   GLN D CB  1 
ATOM   4846  C CG  . GLN D  2 3   ? 51.537  45.648  148.954 1.00 84.15  ? 3   GLN D CG  1 
ATOM   4847  C CD  . GLN D  2 3   ? 53.032  45.382  149.039 1.00 84.94  ? 3   GLN D CD  1 
ATOM   4848  O OE1 . GLN D  2 3   ? 53.481  44.521  149.801 1.00 84.45  ? 3   GLN D OE1 1 
ATOM   4849  N NE2 . GLN D  2 3   ? 53.810  46.111  148.242 1.00 85.17  ? 3   GLN D NE2 1 
ATOM   4850  N N   . LEU D  2 4   ? 48.917  45.029  147.916 1.00 81.10  ? 4   LEU D N   1 
ATOM   4851  C CA  . LEU D  2 4   ? 48.481  44.166  146.811 1.00 78.06  ? 4   LEU D CA  1 
ATOM   4852  C C   . LEU D  2 4   ? 49.695  43.624  146.064 1.00 76.52  ? 4   LEU D C   1 
ATOM   4853  O O   . LEU D  2 4   ? 50.765  44.230  146.088 1.00 76.02  ? 4   LEU D O   1 
ATOM   4854  C CB  . LEU D  2 4   ? 47.579  44.943  145.846 1.00 78.41  ? 4   LEU D CB  1 
ATOM   4855  C CG  . LEU D  2 4   ? 46.189  45.373  146.347 1.00 78.15  ? 4   LEU D CG  1 
ATOM   4856  C CD1 . LEU D  2 4   ? 45.563  46.375  145.372 1.00 79.24  ? 4   LEU D CD1 1 
ATOM   4857  C CD2 . LEU D  2 4   ? 45.297  44.153  146.510 1.00 77.56  ? 4   LEU D CD2 1 
ATOM   4858  N N   . LEU D  2 5   ? 49.540  42.481  145.408 1.00 75.00  ? 5   LEU D N   1 
ATOM   4859  C CA  . LEU D  2 5   ? 50.663  41.900  144.674 1.00 75.38  ? 5   LEU D CA  1 
ATOM   4860  C C   . LEU D  2 5   ? 50.258  41.453  143.272 1.00 73.70  ? 5   LEU D C   1 
ATOM   4861  O O   . LEU D  2 5   ? 49.330  40.664  143.102 1.00 73.57  ? 5   LEU D O   1 
ATOM   4862  C CB  . LEU D  2 5   ? 51.255  40.715  145.442 1.00 78.16  ? 5   LEU D CB  1 
ATOM   4863  C CG  . LEU D  2 5   ? 51.799  41.017  146.845 1.00 82.23  ? 5   LEU D CG  1 
ATOM   4864  C CD1 . LEU D  2 5   ? 52.349  39.744  147.492 1.00 81.06  ? 5   LEU D CD1 1 
ATOM   4865  C CD2 . LEU D  2 5   ? 52.882  42.093  146.778 1.00 80.25  ? 5   LEU D CD2 1 
ATOM   4866  N N   . GLN D  2 6   ? 50.980  41.956  142.275 1.00 71.95  ? 6   GLN D N   1 
ATOM   4867  C CA  . GLN D  2 6   ? 50.702  41.643  140.886 1.00 70.18  ? 6   GLN D CA  1 
ATOM   4868  C C   . GLN D  2 6   ? 51.840  40.902  140.242 1.00 69.58  ? 6   GLN D C   1 
ATOM   4869  O O   . GLN D  2 6   ? 52.920  40.771  140.812 1.00 67.96  ? 6   GLN D O   1 
ATOM   4870  C CB  . GLN D  2 6   ? 50.456  42.919  140.077 1.00 70.69  ? 6   GLN D CB  1 
ATOM   4871  C CG  . GLN D  2 6   ? 49.795  44.048  140.841 1.00 69.17  ? 6   GLN D CG  1 
ATOM   4872  C CD  . GLN D  2 6   ? 49.197  45.079  139.921 1.00 68.80  ? 6   GLN D CD  1 
ATOM   4873  O OE1 . GLN D  2 6   ? 48.971  46.220  140.314 1.00 69.84  ? 6   GLN D OE1 1 
ATOM   4874  N NE2 . GLN D  2 6   ? 48.923  44.679  138.687 1.00 69.02  ? 6   GLN D NE2 1 
ATOM   4875  N N   . SER D  2 7   ? 51.585  40.437  139.027 1.00 70.24  ? 7   SER D N   1 
ATOM   4876  C CA  . SER D  2 7   ? 52.581  39.714  138.255 1.00 71.57  ? 7   SER D CA  1 
ATOM   4877  C C   . SER D  2 7   ? 53.730  40.648  137.891 1.00 71.71  ? 7   SER D C   1 
ATOM   4878  O O   . SER D  2 7   ? 53.786  41.785  138.366 1.00 72.80  ? 7   SER D O   1 
ATOM   4879  C CB  . SER D  2 7   ? 51.943  39.139  136.982 1.00 72.07  ? 7   SER D CB  1 
ATOM   4880  O OG  . SER D  2 7   ? 51.122  40.093  136.331 1.00 71.99  ? 7   SER D OG  1 
ATOM   4881  N N   . GLY D  2 8   ? 54.641  40.170  137.047 1.00 71.29  ? 8   GLY D N   1 
ATOM   4882  C CA  . GLY D  2 8   ? 55.781  40.981  136.646 1.00 70.83  ? 8   GLY D CA  1 
ATOM   4883  C C   . GLY D  2 8   ? 55.697  41.531  135.230 1.00 69.88  ? 8   GLY D C   1 
ATOM   4884  O O   . GLY D  2 8   ? 54.756  41.229  134.496 1.00 69.56  ? 8   GLY D O   1 
ATOM   4885  N N   . ALA D  2 9   ? 56.682  42.343  134.851 1.00 68.84  ? 9   ALA D N   1 
ATOM   4886  C CA  . ALA D  2 9   ? 56.714  42.931  133.523 1.00 67.59  ? 9   ALA D CA  1 
ATOM   4887  C C   . ALA D  2 9   ? 56.587  41.859  132.467 1.00 67.57  ? 9   ALA D C   1 
ATOM   4888  O O   . ALA D  2 9   ? 57.420  40.951  132.383 1.00 67.04  ? 9   ALA D O   1 
ATOM   4889  C CB  . ALA D  2 9   ? 57.997  43.692  133.317 1.00 68.86  ? 9   ALA D CB  1 
ATOM   4890  N N   . GLU D  2 10  ? 55.529  41.973  131.670 1.00 67.46  ? 10  GLU D N   1 
ATOM   4891  C CA  . GLU D  2 10  ? 55.256  41.044  130.589 1.00 67.05  ? 10  GLU D CA  1 
ATOM   4892  C C   . GLU D  2 10  ? 55.385  41.798  129.263 1.00 67.26  ? 10  GLU D C   1 
ATOM   4893  O O   . GLU D  2 10  ? 55.138  43.004  129.193 1.00 67.02  ? 10  GLU D O   1 
ATOM   4894  C CB  . GLU D  2 10  ? 53.848  40.449  130.735 1.00 66.81  ? 10  GLU D CB  1 
ATOM   4895  C CG  . GLU D  2 10  ? 53.610  39.711  132.058 1.00 69.44  ? 10  GLU D CG  1 
ATOM   4896  C CD  . GLU D  2 10  ? 52.480  38.669  132.004 1.00 71.27  ? 10  GLU D CD  1 
ATOM   4897  O OE1 . GLU D  2 10  ? 52.597  37.707  131.211 1.00 73.56  ? 10  GLU D OE1 1 
ATOM   4898  O OE2 . GLU D  2 10  ? 51.480  38.796  132.753 1.00 70.32  ? 10  GLU D OE2 1 
ATOM   4899  N N   . VAL D  2 11  ? 55.813  41.080  128.228 1.00 66.99  ? 11  VAL D N   1 
ATOM   4900  C CA  . VAL D  2 11  ? 55.977  41.637  126.890 1.00 66.15  ? 11  VAL D CA  1 
ATOM   4901  C C   . VAL D  2 11  ? 55.264  40.668  125.968 1.00 65.31  ? 11  VAL D C   1 
ATOM   4902  O O   . VAL D  2 11  ? 55.701  39.534  125.787 1.00 65.15  ? 11  VAL D O   1 
ATOM   4903  C CB  . VAL D  2 11  ? 57.465  41.715  126.464 1.00 66.73  ? 11  VAL D CB  1 
ATOM   4904  C CG1 . VAL D  2 11  ? 57.575  42.356  125.083 1.00 66.20  ? 11  VAL D CG1 1 
ATOM   4905  C CG2 . VAL D  2 11  ? 58.273  42.505  127.496 1.00 66.82  ? 11  VAL D CG2 1 
ATOM   4906  N N   . LYS D  2 12  ? 54.166  41.114  125.379 1.00 64.76  ? 12  LYS D N   1 
ATOM   4907  C CA  . LYS D  2 12  ? 53.400  40.242  124.515 1.00 63.92  ? 12  LYS D CA  1 
ATOM   4908  C C   . LYS D  2 12  ? 53.327  40.657  123.064 1.00 64.08  ? 12  LYS D C   1 
ATOM   4909  O O   . LYS D  2 12  ? 52.641  41.615  122.714 1.00 64.38  ? 12  LYS D O   1 
ATOM   4910  C CB  . LYS D  2 12  ? 51.988  40.078  125.082 1.00 62.64  ? 12  LYS D CB  1 
ATOM   4911  C CG  . LYS D  2 12  ? 51.949  39.273  126.384 1.00 61.59  ? 12  LYS D CG  1 
ATOM   4912  C CD  . LYS D  2 12  ? 52.179  37.784  126.130 1.00 59.55  ? 12  LYS D CD  1 
ATOM   4913  C CE  . LYS D  2 12  ? 52.297  37.020  127.421 1.00 57.56  ? 12  LYS D CE  1 
ATOM   4914  N NZ  . LYS D  2 12  ? 53.560  37.347  128.112 1.00 57.36  ? 12  LYS D NZ  1 
ATOM   4915  N N   . LYS D  2 13  ? 54.044  39.916  122.225 1.00 64.60  ? 13  LYS D N   1 
ATOM   4916  C CA  . LYS D  2 13  ? 54.056  40.156  120.794 1.00 64.63  ? 13  LYS D CA  1 
ATOM   4917  C C   . LYS D  2 13  ? 52.592  40.365  120.442 1.00 65.67  ? 13  LYS D C   1 
ATOM   4918  O O   . LYS D  2 13  ? 51.725  39.650  120.937 1.00 65.19  ? 13  LYS D O   1 
ATOM   4919  C CB  . LYS D  2 13  ? 54.594  38.923  120.067 1.00 64.59  ? 13  LYS D CB  1 
ATOM   4920  C CG  . LYS D  2 13  ? 55.868  38.336  120.675 1.00 65.97  ? 13  LYS D CG  1 
ATOM   4921  C CD  . LYS D  2 13  ? 57.137  39.093  120.244 1.00 66.00  ? 13  LYS D CD  1 
ATOM   4922  C CE  . LYS D  2 13  ? 58.372  38.592  121.003 1.00 65.53  ? 13  LYS D CE  1 
ATOM   4923  N NZ  . LYS D  2 13  ? 59.669  38.957  120.361 1.00 64.17  ? 13  LYS D NZ  1 
ATOM   4924  N N   . PRO D  2 14  ? 52.288  41.359  119.601 1.00 66.83  ? 14  PRO D N   1 
ATOM   4925  C CA  . PRO D  2 14  ? 50.898  41.609  119.228 1.00 68.03  ? 14  PRO D CA  1 
ATOM   4926  C C   . PRO D  2 14  ? 50.140  40.359  118.777 1.00 69.79  ? 14  PRO D C   1 
ATOM   4927  O O   . PRO D  2 14  ? 50.712  39.417  118.220 1.00 69.49  ? 14  PRO D O   1 
ATOM   4928  C CB  . PRO D  2 14  ? 51.029  42.650  118.129 1.00 67.09  ? 14  PRO D CB  1 
ATOM   4929  C CG  . PRO D  2 14  ? 52.187  43.442  118.589 1.00 67.29  ? 14  PRO D CG  1 
ATOM   4930  C CD  . PRO D  2 14  ? 53.172  42.358  118.983 1.00 67.36  ? 14  PRO D CD  1 
ATOM   4931  N N   . GLY D  2 15  ? 48.836  40.371  119.025 1.00 71.45  ? 15  GLY D N   1 
ATOM   4932  C CA  . GLY D  2 15  ? 48.001  39.244  118.673 1.00 72.39  ? 15  GLY D CA  1 
ATOM   4933  C C   . GLY D  2 15  ? 47.770  38.440  119.930 1.00 73.12  ? 15  GLY D C   1 
ATOM   4934  O O   . GLY D  2 15  ? 46.644  38.056  120.234 1.00 73.38  ? 15  GLY D O   1 
ATOM   4935  N N   . SER D  2 16  ? 48.848  38.205  120.671 1.00 73.83  ? 16  SER D N   1 
ATOM   4936  C CA  . SER D  2 16  ? 48.785  37.441  121.906 1.00 74.84  ? 16  SER D CA  1 
ATOM   4937  C C   . SER D  2 16  ? 47.815  38.058  122.908 1.00 75.10  ? 16  SER D C   1 
ATOM   4938  O O   . SER D  2 16  ? 47.226  39.111  122.661 1.00 75.60  ? 16  SER D O   1 
ATOM   4939  C CB  . SER D  2 16  ? 50.173  37.353  122.540 1.00 75.92  ? 16  SER D CB  1 
ATOM   4940  O OG  . SER D  2 16  ? 50.658  38.641  122.881 1.00 77.25  ? 16  SER D OG  1 
ATOM   4941  N N   . SER D  2 17  ? 47.659  37.386  124.042 1.00 74.70  ? 17  SER D N   1 
ATOM   4942  C CA  . SER D  2 17  ? 46.776  37.842  125.101 1.00 74.00  ? 17  SER D CA  1 
ATOM   4943  C C   . SER D  2 17  ? 47.443  37.498  126.420 1.00 73.79  ? 17  SER D C   1 
ATOM   4944  O O   . SER D  2 17  ? 47.584  36.327  126.767 1.00 73.77  ? 17  SER D O   1 
ATOM   4945  C CB  . SER D  2 17  ? 45.428  37.135  125.002 1.00 73.96  ? 17  SER D CB  1 
ATOM   4946  O OG  . SER D  2 17  ? 45.577  35.728  125.013 1.00 75.20  ? 17  SER D OG  1 
ATOM   4947  N N   . VAL D  2 18  ? 47.876  38.518  127.146 1.00 73.83  ? 18  VAL D N   1 
ATOM   4948  C CA  . VAL D  2 18  ? 48.534  38.288  128.419 1.00 74.36  ? 18  VAL D CA  1 
ATOM   4949  C C   . VAL D  2 18  ? 47.524  38.359  129.545 1.00 74.99  ? 18  VAL D C   1 
ATOM   4950  O O   . VAL D  2 18  ? 46.397  38.820  129.355 1.00 74.92  ? 18  VAL D O   1 
ATOM   4951  C CB  . VAL D  2 18  ? 49.655  39.314  128.685 1.00 73.79  ? 18  VAL D CB  1 
ATOM   4952  C CG1 . VAL D  2 18  ? 49.126  40.718  128.503 1.00 74.55  ? 18  VAL D CG1 1 
ATOM   4953  C CG2 . VAL D  2 18  ? 50.195  39.143  130.086 1.00 72.31  ? 18  VAL D CG2 1 
ATOM   4954  N N   . LYS D  2 19  ? 47.945  37.888  130.715 1.00 75.78  ? 19  LYS D N   1 
ATOM   4955  C CA  . LYS D  2 19  ? 47.113  37.863  131.907 1.00 75.71  ? 19  LYS D CA  1 
ATOM   4956  C C   . LYS D  2 19  ? 47.940  38.434  133.047 1.00 75.35  ? 19  LYS D C   1 
ATOM   4957  O O   . LYS D  2 19  ? 49.105  38.075  133.220 1.00 75.13  ? 19  LYS D O   1 
ATOM   4958  C CB  . LYS D  2 19  ? 46.694  36.416  132.227 1.00 75.97  ? 19  LYS D CB  1 
ATOM   4959  C CG  . LYS D  2 19  ? 46.119  35.631  131.030 1.00 75.11  ? 19  LYS D CG  1 
ATOM   4960  C CD  . LYS D  2 19  ? 45.849  34.170  131.377 1.00 74.63  ? 19  LYS D CD  1 
ATOM   4961  C CE  . LYS D  2 19  ? 44.813  34.038  132.487 1.00 74.42  ? 19  LYS D CE  1 
ATOM   4962  N NZ  . LYS D  2 19  ? 44.556  32.619  132.865 1.00 74.45  ? 19  LYS D NZ  1 
ATOM   4963  N N   . VAL D  2 20  ? 47.335  39.336  133.809 1.00 75.45  ? 20  VAL D N   1 
ATOM   4964  C CA  . VAL D  2 20  ? 48.013  39.962  134.933 1.00 76.38  ? 20  VAL D CA  1 
ATOM   4965  C C   . VAL D  2 20  ? 47.339  39.471  136.209 1.00 76.64  ? 20  VAL D C   1 
ATOM   4966  O O   . VAL D  2 20  ? 46.149  39.150  136.196 1.00 76.10  ? 20  VAL D O   1 
ATOM   4967  C CB  . VAL D  2 20  ? 47.911  41.518  134.866 1.00 76.98  ? 20  VAL D CB  1 
ATOM   4968  C CG1 . VAL D  2 20  ? 48.895  42.151  135.843 1.00 76.99  ? 20  VAL D CG1 1 
ATOM   4969  C CG2 . VAL D  2 20  ? 48.179  42.008  133.454 1.00 76.23  ? 20  VAL D CG2 1 
ATOM   4970  N N   . SER D  2 21  ? 48.094  39.419  137.306 1.00 76.97  ? 21  SER D N   1 
ATOM   4971  C CA  . SER D  2 21  ? 47.561  38.953  138.587 1.00 77.07  ? 21  SER D CA  1 
ATOM   4972  C C   . SER D  2 21  ? 47.673  39.957  139.737 1.00 77.50  ? 21  SER D C   1 
ATOM   4973  O O   . SER D  2 21  ? 48.562  40.803  139.746 1.00 77.61  ? 21  SER D O   1 
ATOM   4974  C CB  . SER D  2 21  ? 48.243  37.636  138.979 1.00 76.68  ? 21  SER D CB  1 
ATOM   4975  O OG  . SER D  2 21  ? 49.575  37.581  138.506 1.00 74.74  ? 21  SER D OG  1 
ATOM   4976  N N   . CYS D  2 22  ? 46.754  39.842  140.698 1.00 78.24  ? 22  CYS D N   1 
ATOM   4977  C CA  . CYS D  2 22  ? 46.700  40.709  141.881 1.00 78.19  ? 22  CYS D CA  1 
ATOM   4978  C C   . CYS D  2 22  ? 46.374  39.816  143.084 1.00 79.21  ? 22  CYS D C   1 
ATOM   4979  O O   . CYS D  2 22  ? 45.231  39.383  143.245 1.00 78.50  ? 22  CYS D O   1 
ATOM   4980  C CB  . CYS D  2 22  ? 45.601  41.765  141.703 1.00 77.01  ? 22  CYS D CB  1 
ATOM   4981  S SG  . CYS D  2 22  ? 45.732  43.276  142.727 1.00 72.81  ? 22  CYS D SG  1 
ATOM   4982  N N   . LYS D  2 23  ? 47.379  39.553  143.920 1.00 81.25  ? 23  LYS D N   1 
ATOM   4983  C CA  . LYS D  2 23  ? 47.234  38.682  145.093 1.00 83.52  ? 23  LYS D CA  1 
ATOM   4984  C C   . LYS D  2 23  ? 47.090  39.407  146.433 1.00 84.00  ? 23  LYS D C   1 
ATOM   4985  O O   . LYS D  2 23  ? 47.947  40.195  146.844 1.00 82.65  ? 23  LYS D O   1 
ATOM   4986  C CB  . LYS D  2 23  ? 48.419  37.711  145.155 1.00 84.98  ? 23  LYS D CB  1 
ATOM   4987  C CG  . LYS D  2 23  ? 48.250  36.525  146.107 1.00 87.15  ? 23  LYS D CG  1 
ATOM   4988  C CD  . LYS D  2 23  ? 48.668  36.847  147.538 1.00 88.49  ? 23  LYS D CD  1 
ATOM   4989  C CE  . LYS D  2 23  ? 48.499  35.631  148.445 1.00 89.01  ? 23  LYS D CE  1 
ATOM   4990  N NZ  . LYS D  2 23  ? 48.696  35.958  149.891 1.00 89.96  ? 23  LYS D NZ  1 
ATOM   4991  N N   . ALA D  2 24  ? 45.996  39.099  147.117 1.00 85.65  ? 24  ALA D N   1 
ATOM   4992  C CA  . ALA D  2 24  ? 45.677  39.698  148.406 1.00 88.39  ? 24  ALA D CA  1 
ATOM   4993  C C   . ALA D  2 24  ? 46.444  39.068  149.567 1.00 89.87  ? 24  ALA D C   1 
ATOM   4994  O O   . ALA D  2 24  ? 46.739  37.870  149.553 1.00 90.92  ? 24  ALA D O   1 
ATOM   4995  C CB  . ALA D  2 24  ? 44.166  39.594  148.660 1.00 87.71  ? 24  ALA D CB  1 
ATOM   4996  N N   . SER D  2 25  ? 46.757  39.879  150.575 1.00 90.79  ? 25  SER D N   1 
ATOM   4997  C CA  . SER D  2 25  ? 47.476  39.403  151.751 1.00 91.50  ? 25  SER D CA  1 
ATOM   4998  C C   . SER D  2 25  ? 47.227  40.343  152.918 1.00 92.68  ? 25  SER D C   1 
ATOM   4999  O O   . SER D  2 25  ? 47.951  41.324  153.084 1.00 92.77  ? 25  SER D O   1 
ATOM   5000  C CB  . SER D  2 25  ? 48.986  39.342  151.485 1.00 90.88  ? 25  SER D CB  1 
ATOM   5001  O OG  . SER D  2 25  ? 49.314  38.390  150.490 1.00 90.64  ? 25  SER D OG  1 
ATOM   5002  N N   . GLY D  2 26  ? 46.205  40.064  153.721 1.00 93.45  ? 26  GLY D N   1 
ATOM   5003  C CA  . GLY D  2 26  ? 45.955  40.923  154.865 1.00 95.07  ? 26  GLY D CA  1 
ATOM   5004  C C   . GLY D  2 26  ? 44.569  41.518  155.019 1.00 96.33  ? 26  GLY D C   1 
ATOM   5005  O O   . GLY D  2 26  ? 44.180  41.920  156.121 1.00 96.61  ? 26  GLY D O   1 
ATOM   5006  N N   . GLY D  2 27  ? 43.821  41.590  153.925 1.00 96.95  ? 27  GLY D N   1 
ATOM   5007  C CA  . GLY D  2 27  ? 42.483  42.148  153.993 1.00 97.59  ? 27  GLY D CA  1 
ATOM   5008  C C   . GLY D  2 27  ? 41.516  41.260  153.240 1.00 98.49  ? 27  GLY D C   1 
ATOM   5009  O O   . GLY D  2 27  ? 41.666  41.060  152.030 1.00 98.79  ? 27  GLY D O   1 
ATOM   5010  N N   . THR D  2 28  ? 40.533  40.712  153.950 1.00 98.58  ? 28  THR D N   1 
ATOM   5011  C CA  . THR D  2 28  ? 39.543  39.839  153.328 1.00 98.31  ? 28  THR D CA  1 
ATOM   5012  C C   . THR D  2 28  ? 39.134  40.379  151.956 1.00 97.18  ? 28  THR D C   1 
ATOM   5013  O O   . THR D  2 28  ? 38.230  41.205  151.831 1.00 96.51  ? 28  THR D O   1 
ATOM   5014  C CB  . THR D  2 28  ? 38.316  39.677  154.246 1.00 99.52  ? 28  THR D CB  1 
ATOM   5015  O OG1 . THR D  2 28  ? 37.963  40.949  154.817 1.00 100.06 ? 28  THR D OG1 1 
ATOM   5016  C CG2 . THR D  2 28  ? 38.627  38.671  155.358 1.00 99.53  ? 28  THR D CG2 1 
ATOM   5017  N N   . PHE D  2 29  ? 39.820  39.886  150.930 1.00 96.49  ? 29  PHE D N   1 
ATOM   5018  C CA  . PHE D  2 29  ? 39.605  40.312  149.554 1.00 96.10  ? 29  PHE D CA  1 
ATOM   5019  C C   . PHE D  2 29  ? 38.245  39.978  148.955 1.00 96.31  ? 29  PHE D C   1 
ATOM   5020  O O   . PHE D  2 29  ? 37.706  40.763  148.169 1.00 96.64  ? 29  PHE D O   1 
ATOM   5021  C CB  . PHE D  2 29  ? 40.739  39.751  148.669 1.00 95.31  ? 29  PHE D CB  1 
ATOM   5022  C CG  . PHE D  2 29  ? 40.314  38.663  147.716 1.00 94.24  ? 29  PHE D CG  1 
ATOM   5023  C CD1 . PHE D  2 29  ? 39.791  37.458  148.182 1.00 94.59  ? 29  PHE D CD1 1 
ATOM   5024  C CD2 . PHE D  2 29  ? 40.453  38.842  146.347 1.00 93.48  ? 29  PHE D CD2 1 
ATOM   5025  C CE1 . PHE D  2 29  ? 39.412  36.450  147.295 1.00 94.21  ? 29  PHE D CE1 1 
ATOM   5026  C CE2 . PHE D  2 29  ? 40.079  37.844  145.456 1.00 93.65  ? 29  PHE D CE2 1 
ATOM   5027  C CZ  . PHE D  2 29  ? 39.557  36.645  145.931 1.00 93.66  ? 29  PHE D CZ  1 
ATOM   5028  N N   . SER D  2 30  ? 37.689  38.827  149.331 1.00 96.10  ? 30  SER D N   1 
ATOM   5029  C CA  . SER D  2 30  ? 36.404  38.389  148.793 1.00 96.05  ? 30  SER D CA  1 
ATOM   5030  C C   . SER D  2 30  ? 35.230  39.275  149.194 1.00 96.23  ? 30  SER D C   1 
ATOM   5031  O O   . SER D  2 30  ? 34.107  38.793  149.310 1.00 96.61  ? 30  SER D O   1 
ATOM   5032  C CB  . SER D  2 30  ? 36.113  36.943  149.213 1.00 95.36  ? 30  SER D CB  1 
ATOM   5033  O OG  . SER D  2 30  ? 35.859  36.853  150.602 1.00 94.44  ? 30  SER D OG  1 
ATOM   5034  N N   . SER D  2 31  ? 35.490  40.566  149.393 1.00 96.30  ? 31  SER D N   1 
ATOM   5035  C CA  . SER D  2 31  ? 34.448  41.516  149.779 1.00 95.75  ? 31  SER D CA  1 
ATOM   5036  C C   . SER D  2 31  ? 34.910  42.952  149.535 1.00 94.83  ? 31  SER D C   1 
ATOM   5037  O O   . SER D  2 31  ? 34.442  43.885  150.189 1.00 95.10  ? 31  SER D O   1 
ATOM   5038  C CB  . SER D  2 31  ? 34.112  41.358  151.260 1.00 96.29  ? 31  SER D CB  1 
ATOM   5039  O OG  . SER D  2 31  ? 35.217  41.763  152.055 1.00 97.50  ? 31  SER D OG  1 
ATOM   5040  N N   . TYR D  2 32  ? 35.835  43.127  148.600 1.00 93.37  ? 32  TYR D N   1 
ATOM   5041  C CA  . TYR D  2 32  ? 36.349  44.453  148.294 1.00 91.85  ? 32  TYR D CA  1 
ATOM   5042  C C   . TYR D  2 32  ? 35.925  44.903  146.903 1.00 89.71  ? 32  TYR D C   1 
ATOM   5043  O O   . TYR D  2 32  ? 35.393  44.113  146.116 1.00 90.09  ? 32  TYR D O   1 
ATOM   5044  C CB  . TYR D  2 32  ? 37.876  44.455  148.419 1.00 93.90  ? 32  TYR D CB  1 
ATOM   5045  C CG  . TYR D  2 32  ? 38.375  44.311  149.844 1.00 96.06  ? 32  TYR D CG  1 
ATOM   5046  C CD1 . TYR D  2 32  ? 39.727  44.116  150.110 1.00 96.41  ? 32  TYR D CD1 1 
ATOM   5047  C CD2 . TYR D  2 32  ? 37.491  44.380  150.929 1.00 97.67  ? 32  TYR D CD2 1 
ATOM   5048  C CE1 . TYR D  2 32  ? 40.196  43.990  151.418 1.00 98.52  ? 32  TYR D CE1 1 
ATOM   5049  C CE2 . TYR D  2 32  ? 37.946  44.256  152.244 1.00 98.99  ? 32  TYR D CE2 1 
ATOM   5050  C CZ  . TYR D  2 32  ? 39.303  44.059  152.483 1.00 99.72  ? 32  TYR D CZ  1 
ATOM   5051  O OH  . TYR D  2 32  ? 39.766  43.913  153.781 1.00 101.29 ? 32  TYR D OH  1 
ATOM   5052  N N   . ALA D  2 33  ? 36.147  46.179  146.608 1.00 86.30  ? 33  ALA D N   1 
ATOM   5053  C CA  . ALA D  2 33  ? 35.787  46.723  145.308 1.00 82.74  ? 33  ALA D CA  1 
ATOM   5054  C C   . ALA D  2 33  ? 36.972  46.631  144.351 1.00 80.65  ? 33  ALA D C   1 
ATOM   5055  O O   . ALA D  2 33  ? 37.392  47.638  143.775 1.00 81.38  ? 33  ALA D O   1 
ATOM   5056  C CB  . ALA D  2 33  ? 35.333  48.174  145.450 1.00 81.76  ? 33  ALA D CB  1 
ATOM   5057  N N   . ILE D  2 34  ? 37.508  45.421  144.186 1.00 77.42  ? 34  ILE D N   1 
ATOM   5058  C CA  . ILE D  2 34  ? 38.638  45.206  143.288 1.00 74.02  ? 34  ILE D CA  1 
ATOM   5059  C C   . ILE D  2 34  ? 38.288  45.664  141.877 1.00 71.78  ? 34  ILE D C   1 
ATOM   5060  O O   . ILE D  2 34  ? 37.155  45.528  141.426 1.00 70.35  ? 34  ILE D O   1 
ATOM   5061  C CB  . ILE D  2 34  ? 39.064  43.714  143.220 1.00 74.03  ? 34  ILE D CB  1 
ATOM   5062  C CG1 . ILE D  2 34  ? 39.742  43.284  144.524 1.00 74.13  ? 34  ILE D CG1 1 
ATOM   5063  C CG2 . ILE D  2 34  ? 40.033  43.503  142.065 1.00 74.58  ? 34  ILE D CG2 1 
ATOM   5064  C CD1 . ILE D  2 34  ? 38.795  43.072  145.675 1.00 76.01  ? 34  ILE D CD1 1 
ATOM   5065  N N   . SER D  2 35  ? 39.276  46.203  141.181 1.00 69.96  ? 35  SER D N   1 
ATOM   5066  C CA  . SER D  2 35  ? 39.075  46.684  139.830 1.00 68.07  ? 35  SER D CA  1 
ATOM   5067  C C   . SER D  2 35  ? 40.422  46.991  139.213 1.00 67.07  ? 35  SER D C   1 
ATOM   5068  O O   . SER D  2 35  ? 41.307  47.527  139.871 1.00 67.01  ? 35  SER D O   1 
ATOM   5069  C CB  . SER D  2 35  ? 38.206  47.930  139.865 1.00 68.18  ? 35  SER D CB  1 
ATOM   5070  O OG  . SER D  2 35  ? 38.576  48.741  140.963 1.00 69.64  ? 35  SER D OG  1 
ATOM   5071  N N   . TRP D  2 36  ? 40.579  46.641  137.945 1.00 66.62  ? 36  TRP D N   1 
ATOM   5072  C CA  . TRP D  2 36  ? 41.831  46.873  137.248 1.00 65.81  ? 36  TRP D CA  1 
ATOM   5073  C C   . TRP D  2 36  ? 41.883  48.252  136.606 1.00 63.68  ? 36  TRP D C   1 
ATOM   5074  O O   . TRP D  2 36  ? 40.892  48.716  136.032 1.00 62.87  ? 36  TRP D O   1 
ATOM   5075  C CB  . TRP D  2 36  ? 42.031  45.783  136.199 1.00 69.52  ? 36  TRP D CB  1 
ATOM   5076  C CG  . TRP D  2 36  ? 42.237  44.425  136.811 1.00 73.13  ? 36  TRP D CG  1 
ATOM   5077  C CD1 . TRP D  2 36  ? 41.297  43.647  137.430 1.00 74.09  ? 36  TRP D CD1 1 
ATOM   5078  C CD2 . TRP D  2 36  ? 43.485  43.731  136.946 1.00 74.79  ? 36  TRP D CD2 1 
ATOM   5079  N NE1 . TRP D  2 36  ? 41.885  42.515  137.947 1.00 75.09  ? 36  TRP D NE1 1 
ATOM   5080  C CE2 . TRP D  2 36  ? 43.226  42.542  137.666 1.00 75.20  ? 36  TRP D CE2 1 
ATOM   5081  C CE3 . TRP D  2 36  ? 44.799  44.002  136.529 1.00 75.31  ? 36  TRP D CE3 1 
ATOM   5082  C CZ2 . TRP D  2 36  ? 44.233  41.627  137.982 1.00 75.72  ? 36  TRP D CZ2 1 
ATOM   5083  C CZ3 . TRP D  2 36  ? 45.798  43.097  136.840 1.00 75.32  ? 36  TRP D CZ3 1 
ATOM   5084  C CH2 . TRP D  2 36  ? 45.510  41.921  137.562 1.00 76.86  ? 36  TRP D CH2 1 
ATOM   5085  N N   . VAL D  2 37  ? 43.040  48.905  136.701 1.00 60.82  ? 37  VAL D N   1 
ATOM   5086  C CA  . VAL D  2 37  ? 43.199  50.242  136.141 1.00 59.28  ? 37  VAL D CA  1 
ATOM   5087  C C   . VAL D  2 37  ? 44.553  50.531  135.490 1.00 58.93  ? 37  VAL D C   1 
ATOM   5088  O O   . VAL D  2 37  ? 45.573  50.631  136.181 1.00 59.51  ? 37  VAL D O   1 
ATOM   5089  C CB  . VAL D  2 37  ? 43.008  51.292  137.214 1.00 59.07  ? 37  VAL D CB  1 
ATOM   5090  C CG1 . VAL D  2 37  ? 42.615  52.604  136.564 1.00 59.10  ? 37  VAL D CG1 1 
ATOM   5091  C CG2 . VAL D  2 37  ? 41.988  50.826  138.218 1.00 57.68  ? 37  VAL D CG2 1 
ATOM   5092  N N   . ARG D  2 38  ? 44.564  50.720  134.171 1.00 57.33  ? 38  ARG D N   1 
ATOM   5093  C CA  . ARG D  2 38  ? 45.823  50.993  133.476 1.00 54.56  ? 38  ARG D CA  1 
ATOM   5094  C C   . ARG D  2 38  ? 46.201  52.458  133.262 1.00 52.25  ? 38  ARG D C   1 
ATOM   5095  O O   . ARG D  2 38  ? 45.364  53.370  133.209 1.00 49.50  ? 38  ARG D O   1 
ATOM   5096  C CB  . ARG D  2 38  ? 45.875  50.262  132.122 1.00 54.97  ? 38  ARG D CB  1 
ATOM   5097  C CG  . ARG D  2 38  ? 44.884  50.737  131.071 1.00 53.56  ? 38  ARG D CG  1 
ATOM   5098  C CD  . ARG D  2 38  ? 45.022  49.906  129.792 1.00 52.97  ? 38  ARG D CD  1 
ATOM   5099  N NE  . ARG D  2 38  ? 44.156  50.389  128.719 1.00 52.81  ? 38  ARG D NE  1 
ATOM   5100  C CZ  . ARG D  2 38  ? 43.824  49.689  127.638 1.00 52.25  ? 38  ARG D CZ  1 
ATOM   5101  N NH1 . ARG D  2 38  ? 44.278  48.456  127.463 1.00 51.92  ? 38  ARG D NH1 1 
ATOM   5102  N NH2 . ARG D  2 38  ? 43.027  50.226  126.728 1.00 52.68  ? 38  ARG D NH2 1 
ATOM   5103  N N   . GLN D  2 39  ? 47.504  52.647  133.125 1.00 49.84  ? 39  GLN D N   1 
ATOM   5104  C CA  . GLN D  2 39  ? 48.079  53.951  132.922 1.00 47.44  ? 39  GLN D CA  1 
ATOM   5105  C C   . GLN D  2 39  ? 49.040  53.851  131.762 1.00 47.03  ? 39  GLN D C   1 
ATOM   5106  O O   . GLN D  2 39  ? 50.159  53.377  131.925 1.00 47.93  ? 39  GLN D O   1 
ATOM   5107  C CB  . GLN D  2 39  ? 48.840  54.375  134.170 1.00 46.22  ? 39  GLN D CB  1 
ATOM   5108  C CG  . GLN D  2 39  ? 49.551  55.679  134.015 1.00 45.12  ? 39  GLN D CG  1 
ATOM   5109  C CD  . GLN D  2 39  ? 48.956  56.760  134.868 1.00 45.68  ? 39  GLN D CD  1 
ATOM   5110  O OE1 . GLN D  2 39  ? 49.180  56.797  136.077 1.00 46.86  ? 39  GLN D OE1 1 
ATOM   5111  N NE2 . GLN D  2 39  ? 48.184  57.648  134.253 1.00 45.01  ? 39  GLN D NE2 1 
ATOM   5112  N N   . ALA D  2 40  ? 48.610  54.289  130.586 1.00 46.54  ? 40  ALA D N   1 
ATOM   5113  C CA  . ALA D  2 40  ? 49.476  54.243  129.415 1.00 46.88  ? 40  ALA D CA  1 
ATOM   5114  C C   . ALA D  2 40  ? 50.465  55.381  129.530 1.00 47.21  ? 40  ALA D C   1 
ATOM   5115  O O   . ALA D  2 40  ? 50.107  56.464  129.984 1.00 47.58  ? 40  ALA D O   1 
ATOM   5116  C CB  . ALA D  2 40  ? 48.660  54.393  128.161 1.00 46.75  ? 40  ALA D CB  1 
ATOM   5117  N N   . PRO D  2 41  ? 51.719  55.163  129.098 1.00 48.01  ? 41  PRO D N   1 
ATOM   5118  C CA  . PRO D  2 41  ? 52.763  56.200  129.170 1.00 48.58  ? 41  PRO D CA  1 
ATOM   5119  C C   . PRO D  2 41  ? 52.287  57.622  128.854 1.00 49.03  ? 41  PRO D C   1 
ATOM   5120  O O   . PRO D  2 41  ? 51.792  57.898  127.759 1.00 47.90  ? 41  PRO D O   1 
ATOM   5121  C CB  . PRO D  2 41  ? 53.814  55.702  128.181 1.00 47.51  ? 41  PRO D CB  1 
ATOM   5122  C CG  . PRO D  2 41  ? 53.677  54.214  128.283 1.00 47.49  ? 41  PRO D CG  1 
ATOM   5123  C CD  . PRO D  2 41  ? 52.176  54.014  128.294 1.00 46.93  ? 41  PRO D CD  1 
ATOM   5124  N N   . GLY D  2 42  ? 52.433  58.514  129.831 1.00 50.43  ? 42  GLY D N   1 
ATOM   5125  C CA  . GLY D  2 42  ? 52.025  59.901  129.657 1.00 53.05  ? 42  GLY D CA  1 
ATOM   5126  C C   . GLY D  2 42  ? 50.525  60.145  129.713 1.00 54.67  ? 42  GLY D C   1 
ATOM   5127  O O   . GLY D  2 42  ? 50.053  61.290  129.649 1.00 54.63  ? 42  GLY D O   1 
ATOM   5128  N N   . GLN D  2 43  ? 49.771  59.060  129.831 1.00 55.87  ? 43  GLN D N   1 
ATOM   5129  C CA  . GLN D  2 43  ? 48.329  59.147  129.887 1.00 56.75  ? 43  GLN D CA  1 
ATOM   5130  C C   . GLN D  2 43  ? 47.871  58.955  131.315 1.00 57.70  ? 43  GLN D C   1 
ATOM   5131  O O   . GLN D  2 43  ? 48.672  58.607  132.184 1.00 57.09  ? 43  GLN D O   1 
ATOM   5132  C CB  . GLN D  2 43  ? 47.716  58.076  128.992 1.00 57.46  ? 43  GLN D CB  1 
ATOM   5133  C CG  . GLN D  2 43  ? 48.297  58.056  127.595 1.00 59.09  ? 43  GLN D CG  1 
ATOM   5134  C CD  . GLN D  2 43  ? 48.499  59.451  127.028 1.00 61.02  ? 43  GLN D CD  1 
ATOM   5135  O OE1 . GLN D  2 43  ? 49.415  60.178  127.424 1.00 61.43  ? 43  GLN D OE1 1 
ATOM   5136  N NE2 . GLN D  2 43  ? 47.636  59.834  126.097 1.00 62.34  ? 43  GLN D NE2 1 
ATOM   5137  N N   . GLY D  2 44  ? 46.581  59.186  131.549 1.00 58.91  ? 44  GLY D N   1 
ATOM   5138  C CA  . GLY D  2 44  ? 46.022  59.037  132.880 1.00 60.24  ? 44  GLY D CA  1 
ATOM   5139  C C   . GLY D  2 44  ? 45.336  57.702  133.114 1.00 61.65  ? 44  GLY D C   1 
ATOM   5140  O O   . GLY D  2 44  ? 45.367  56.804  132.265 1.00 62.25  ? 44  GLY D O   1 
ATOM   5141  N N   . LEU D  2 45  ? 44.703  57.578  134.274 1.00 62.23  ? 45  LEU D N   1 
ATOM   5142  C CA  . LEU D  2 45  ? 44.002  56.357  134.661 1.00 62.39  ? 45  LEU D CA  1 
ATOM   5143  C C   . LEU D  2 45  ? 42.828  56.040  133.740 1.00 62.34  ? 45  LEU D C   1 
ATOM   5144  O O   . LEU D  2 45  ? 42.179  56.941  133.218 1.00 61.76  ? 45  LEU D O   1 
ATOM   5145  C CB  . LEU D  2 45  ? 43.498  56.499  136.098 1.00 60.78  ? 45  LEU D CB  1 
ATOM   5146  C CG  . LEU D  2 45  ? 44.473  57.256  137.002 1.00 59.77  ? 45  LEU D CG  1 
ATOM   5147  C CD1 . LEU D  2 45  ? 43.846  57.523  138.372 1.00 58.82  ? 45  LEU D CD1 1 
ATOM   5148  C CD2 . LEU D  2 45  ? 45.756  56.456  137.121 1.00 58.49  ? 45  LEU D CD2 1 
ATOM   5149  N N   . GLU D  2 46  ? 42.564  54.753  133.546 1.00 63.03  ? 46  GLU D N   1 
ATOM   5150  C CA  . GLU D  2 46  ? 41.454  54.327  132.704 1.00 63.85  ? 46  GLU D CA  1 
ATOM   5151  C C   . GLU D  2 46  ? 40.814  53.037  133.235 1.00 63.43  ? 46  GLU D C   1 
ATOM   5152  O O   . GLU D  2 46  ? 41.020  51.945  132.695 1.00 63.50  ? 46  GLU D O   1 
ATOM   5153  C CB  . GLU D  2 46  ? 41.936  54.144  131.262 1.00 65.79  ? 46  GLU D CB  1 
ATOM   5154  C CG  . GLU D  2 46  ? 40.848  53.812  130.237 1.00 67.23  ? 46  GLU D CG  1 
ATOM   5155  C CD  . GLU D  2 46  ? 41.399  53.713  128.806 1.00 69.16  ? 46  GLU D CD  1 
ATOM   5156  O OE1 . GLU D  2 46  ? 42.434  53.039  128.594 1.00 69.04  ? 46  GLU D OE1 1 
ATOM   5157  O OE2 . GLU D  2 46  ? 40.793  54.310  127.890 1.00 70.59  ? 46  GLU D OE2 1 
ATOM   5158  N N   . TRP D  2 47  ? 40.043  53.190  134.308 1.00 62.16  ? 47  TRP D N   1 
ATOM   5159  C CA  . TRP D  2 47  ? 39.327  52.099  134.953 1.00 61.17  ? 47  TRP D CA  1 
ATOM   5160  C C   . TRP D  2 47  ? 38.844  51.170  133.854 1.00 62.04  ? 47  TRP D C   1 
ATOM   5161  O O   . TRP D  2 47  ? 38.287  51.630  132.861 1.00 62.91  ? 47  TRP D O   1 
ATOM   5162  C CB  . TRP D  2 47  ? 38.127  52.676  135.701 1.00 60.09  ? 47  TRP D CB  1 
ATOM   5163  C CG  . TRP D  2 47  ? 37.481  51.760  136.693 1.00 59.59  ? 47  TRP D CG  1 
ATOM   5164  C CD1 . TRP D  2 47  ? 37.907  51.489  137.964 1.00 59.77  ? 47  TRP D CD1 1 
ATOM   5165  C CD2 . TRP D  2 47  ? 36.278  51.012  136.507 1.00 58.47  ? 47  TRP D CD2 1 
ATOM   5166  N NE1 . TRP D  2 47  ? 37.039  50.621  138.579 1.00 58.63  ? 47  TRP D NE1 1 
ATOM   5167  C CE2 . TRP D  2 47  ? 36.031  50.313  137.705 1.00 58.28  ? 47  TRP D CE2 1 
ATOM   5168  C CE3 . TRP D  2 47  ? 35.385  50.865  135.441 1.00 58.86  ? 47  TRP D CE3 1 
ATOM   5169  C CZ2 . TRP D  2 47  ? 34.929  49.483  137.867 1.00 58.46  ? 47  TRP D CZ2 1 
ATOM   5170  C CZ3 . TRP D  2 47  ? 34.293  50.041  135.602 1.00 58.41  ? 47  TRP D CZ3 1 
ATOM   5171  C CH2 . TRP D  2 47  ? 34.073  49.359  136.808 1.00 58.69  ? 47  TRP D CH2 1 
ATOM   5172  N N   . MET D  2 48  ? 39.053  49.870  134.010 1.00 62.91  ? 48  MET D N   1 
ATOM   5173  C CA  . MET D  2 48  ? 38.604  48.929  132.981 1.00 63.78  ? 48  MET D CA  1 
ATOM   5174  C C   . MET D  2 48  ? 37.370  48.160  133.447 1.00 64.36  ? 48  MET D C   1 
ATOM   5175  O O   . MET D  2 48  ? 36.520  47.778  132.638 1.00 63.22  ? 48  MET D O   1 
ATOM   5176  C CB  . MET D  2 48  ? 39.734  47.948  132.616 1.00 63.07  ? 48  MET D CB  1 
ATOM   5177  C CG  . MET D  2 48  ? 40.912  48.579  131.851 1.00 61.43  ? 48  MET D CG  1 
ATOM   5178  S SD  . MET D  2 48  ? 42.382  47.508  131.735 1.00 61.18  ? 48  MET D SD  1 
ATOM   5179  C CE  . MET D  2 48  ? 42.125  46.761  130.161 1.00 58.05  ? 48  MET D CE  1 
ATOM   5180  N N   . GLY D  2 49  ? 37.282  47.957  134.762 1.00 65.81  ? 49  GLY D N   1 
ATOM   5181  C CA  . GLY D  2 49  ? 36.167  47.229  135.348 1.00 66.55  ? 49  GLY D CA  1 
ATOM   5182  C C   . GLY D  2 49  ? 36.383  46.831  136.804 1.00 66.61  ? 49  GLY D C   1 
ATOM   5183  O O   . GLY D  2 49  ? 37.330  47.293  137.451 1.00 65.35  ? 49  GLY D O   1 
ATOM   5184  N N   . GLY D  2 50  ? 35.501  45.974  137.321 1.00 66.77  ? 50  GLY D N   1 
ATOM   5185  C CA  . GLY D  2 50  ? 35.616  45.536  138.704 1.00 67.11  ? 50  GLY D CA  1 
ATOM   5186  C C   . GLY D  2 50  ? 34.950  44.203  139.003 1.00 66.95  ? 50  GLY D C   1 
ATOM   5187  O O   . GLY D  2 50  ? 34.158  43.701  138.210 1.00 67.35  ? 50  GLY D O   1 
ATOM   5188  N N   . ILE D  2 51  ? 35.274  43.624  140.154 1.00 66.62  ? 51  ILE D N   1 
ATOM   5189  C CA  . ILE D  2 51  ? 34.695  42.349  140.559 1.00 66.86  ? 51  ILE D CA  1 
ATOM   5190  C C   . ILE D  2 51  ? 34.565  42.247  142.082 1.00 68.73  ? 51  ILE D C   1 
ATOM   5191  O O   . ILE D  2 51  ? 35.023  43.108  142.832 1.00 69.29  ? 51  ILE D O   1 
ATOM   5192  C CB  . ILE D  2 51  ? 35.551  41.169  140.068 1.00 65.07  ? 51  ILE D CB  1 
ATOM   5193  C CG1 . ILE D  2 51  ? 34.815  39.854  140.293 1.00 64.68  ? 51  ILE D CG1 1 
ATOM   5194  C CG2 . ILE D  2 51  ? 36.854  41.117  140.831 1.00 64.86  ? 51  ILE D CG2 1 
ATOM   5195  C CD1 . ILE D  2 51  ? 35.650  38.638  139.986 1.00 63.79  ? 51  ILE D CD1 1 
ATOM   5196  N N   . ILE D  2 52  ? 33.917  41.193  142.541 1.00 70.53  ? 52  ILE D N   1 
ATOM   5197  C CA  . ILE D  2 52  ? 33.772  40.979  143.961 1.00 72.09  ? 52  ILE D CA  1 
ATOM   5198  C C   . ILE D  2 52  ? 33.553  39.493  144.156 1.00 73.40  ? 52  ILE D C   1 
ATOM   5199  O O   . ILE D  2 52  ? 32.431  39.002  144.080 1.00 72.45  ? 52  ILE D O   1 
ATOM   5200  C CB  . ILE D  2 52  ? 32.600  41.767  144.529 1.00 71.80  ? 52  ILE D CB  1 
ATOM   5201  C CG1 . ILE D  2 52  ? 32.799  43.252  144.254 1.00 71.51  ? 52  ILE D CG1 1 
ATOM   5202  C CG2 . ILE D  2 52  ? 32.525  41.557  146.021 1.00 72.22  ? 52  ILE D CG2 1 
ATOM   5203  C CD1 . ILE D  2 52  ? 31.789  44.135  144.939 1.00 72.13  ? 52  ILE D CD1 1 
ATOM   5204  N N   . PRO D  2 53  A 34.644  38.759  144.399 1.00 75.49  ? 52  PRO D N   1 
ATOM   5205  C CA  . PRO D  2 53  A 34.664  37.315  144.612 1.00 78.37  ? 52  PRO D CA  1 
ATOM   5206  C C   . PRO D  2 53  A 33.328  36.813  145.112 1.00 80.70  ? 52  PRO D C   1 
ATOM   5207  O O   . PRO D  2 53  A 32.861  35.752  144.697 1.00 81.80  ? 52  PRO D O   1 
ATOM   5208  C CB  . PRO D  2 53  A 35.782  37.148  145.626 1.00 78.35  ? 52  PRO D CB  1 
ATOM   5209  C CG  . PRO D  2 53  A 36.774  38.136  145.129 1.00 77.01  ? 52  PRO D CG  1 
ATOM   5210  C CD  . PRO D  2 53  A 35.922  39.355  144.825 1.00 76.16  ? 52  PRO D CD  1 
ATOM   5211  N N   . VAL D  2 54  ? 32.723  37.582  146.009 1.00 82.60  ? 53  VAL D N   1 
ATOM   5212  C CA  . VAL D  2 54  ? 31.411  37.247  146.541 1.00 84.84  ? 53  VAL D CA  1 
ATOM   5213  C C   . VAL D  2 54  ? 30.608  36.547  145.448 1.00 85.39  ? 53  VAL D C   1 
ATOM   5214  O O   . VAL D  2 54  ? 30.647  35.317  145.318 1.00 84.95  ? 53  VAL D O   1 
ATOM   5215  C CB  . VAL D  2 54  ? 30.654  38.526  146.963 1.00 85.62  ? 53  VAL D CB  1 
ATOM   5216  C CG1 . VAL D  2 54  ? 29.233  38.185  147.399 1.00 85.60  ? 53  VAL D CG1 1 
ATOM   5217  C CG2 . VAL D  2 54  ? 31.406  39.216  148.090 1.00 87.01  ? 53  VAL D CG2 1 
ATOM   5218  N N   . PHE D  2 55  ? 29.892  37.343  144.658 1.00 86.03  ? 54  PHE D N   1 
ATOM   5219  C CA  . PHE D  2 55  ? 29.091  36.802  143.569 1.00 86.79  ? 54  PHE D CA  1 
ATOM   5220  C C   . PHE D  2 55  ? 29.849  36.862  142.245 1.00 86.72  ? 54  PHE D C   1 
ATOM   5221  O O   . PHE D  2 55  ? 29.650  37.773  141.437 1.00 86.99  ? 54  PHE D O   1 
ATOM   5222  C CB  . PHE D  2 55  ? 27.753  37.546  143.471 1.00 86.83  ? 54  PHE D CB  1 
ATOM   5223  C CG  . PHE D  2 55  ? 27.824  38.998  143.861 1.00 87.47  ? 54  PHE D CG  1 
ATOM   5224  C CD1 . PHE D  2 55  ? 28.412  39.937  143.019 1.00 88.13  ? 54  PHE D CD1 1 
ATOM   5225  C CD2 . PHE D  2 55  ? 27.265  39.430  145.063 1.00 87.73  ? 54  PHE D CD2 1 
ATOM   5226  C CE1 . PHE D  2 55  ? 28.440  41.291  143.368 1.00 88.63  ? 54  PHE D CE1 1 
ATOM   5227  C CE2 . PHE D  2 55  ? 27.286  40.777  145.423 1.00 88.11  ? 54  PHE D CE2 1 
ATOM   5228  C CZ  . PHE D  2 55  ? 27.874  41.710  144.573 1.00 88.77  ? 54  PHE D CZ  1 
ATOM   5229  N N   . GLY D  2 56  ? 30.722  35.877  142.043 1.00 86.05  ? 55  GLY D N   1 
ATOM   5230  C CA  . GLY D  2 56  ? 31.524  35.807  140.833 1.00 85.20  ? 55  GLY D CA  1 
ATOM   5231  C C   . GLY D  2 56  ? 30.857  36.343  139.581 1.00 84.54  ? 55  GLY D C   1 
ATOM   5232  O O   . GLY D  2 56  ? 30.019  35.676  138.976 1.00 84.74  ? 55  GLY D O   1 
ATOM   5233  N N   . SER D  2 57  ? 31.232  37.558  139.199 1.00 83.99  ? 56  SER D N   1 
ATOM   5234  C CA  . SER D  2 57  ? 30.700  38.217  138.009 1.00 83.92  ? 56  SER D CA  1 
ATOM   5235  C C   . SER D  2 57  ? 31.490  39.502  137.779 1.00 83.51  ? 56  SER D C   1 
ATOM   5236  O O   . SER D  2 57  ? 31.530  40.376  138.647 1.00 84.76  ? 56  SER D O   1 
ATOM   5237  C CB  . SER D  2 57  ? 29.213  38.524  138.192 1.00 84.44  ? 56  SER D CB  1 
ATOM   5238  O OG  . SER D  2 57  ? 28.952  39.024  139.492 1.00 85.90  ? 56  SER D OG  1 
ATOM   5239  N N   . ALA D  2 58  ? 32.124  39.611  136.616 1.00 82.15  ? 57  ALA D N   1 
ATOM   5240  C CA  . ALA D  2 58  ? 32.933  40.781  136.301 1.00 80.97  ? 57  ALA D CA  1 
ATOM   5241  C C   . ALA D  2 58  ? 32.139  41.917  135.665 1.00 80.34  ? 57  ALA D C   1 
ATOM   5242  O O   . ALA D  2 58  ? 31.109  41.687  135.038 1.00 80.04  ? 57  ALA D O   1 
ATOM   5243  C CB  . ALA D  2 58  ? 34.079  40.375  135.398 1.00 81.05  ? 57  ALA D CB  1 
ATOM   5244  N N   . ASN D  2 59  ? 32.636  43.144  135.833 1.00 80.35  ? 58  ASN D N   1 
ATOM   5245  C CA  . ASN D  2 59  ? 31.993  44.348  135.297 1.00 79.73  ? 58  ASN D CA  1 
ATOM   5246  C C   . ASN D  2 59  ? 32.966  45.282  134.599 1.00 78.88  ? 58  ASN D C   1 
ATOM   5247  O O   . ASN D  2 59  ? 33.527  46.176  135.229 1.00 77.78  ? 58  ASN D O   1 
ATOM   5248  C CB  . ASN D  2 59  ? 31.297  45.119  136.416 1.00 80.22  ? 58  ASN D CB  1 
ATOM   5249  C CG  . ASN D  2 59  ? 30.113  44.373  136.976 1.00 81.28  ? 58  ASN D CG  1 
ATOM   5250  O OD1 . ASN D  2 59  ? 29.080  44.243  136.314 1.00 80.94  ? 58  ASN D OD1 1 
ATOM   5251  N ND2 . ASN D  2 59  ? 30.256  43.861  138.199 1.00 82.03  ? 58  ASN D ND2 1 
ATOM   5252  N N   . TYR D  2 60  ? 33.147  45.066  133.298 1.00 78.09  ? 59  TYR D N   1 
ATOM   5253  C CA  . TYR D  2 60  ? 34.034  45.878  132.479 1.00 76.94  ? 59  TYR D CA  1 
ATOM   5254  C C   . TYR D  2 60  ? 33.181  47.038  132.009 1.00 77.09  ? 59  TYR D C   1 
ATOM   5255  O O   . TYR D  2 60  ? 31.972  47.022  132.201 1.00 77.20  ? 59  TYR D O   1 
ATOM   5256  C CB  . TYR D  2 60  ? 34.523  45.056  131.297 1.00 76.14  ? 59  TYR D CB  1 
ATOM   5257  C CG  . TYR D  2 60  ? 34.537  43.580  131.594 1.00 75.77  ? 59  TYR D CG  1 
ATOM   5258  C CD1 . TYR D  2 60  ? 33.427  42.781  131.320 1.00 75.83  ? 59  TYR D CD1 1 
ATOM   5259  C CD2 . TYR D  2 60  ? 35.640  42.986  132.194 1.00 76.60  ? 59  TYR D CD2 1 
ATOM   5260  C CE1 . TYR D  2 60  ? 33.417  41.416  131.641 1.00 76.27  ? 59  TYR D CE1 1 
ATOM   5261  C CE2 . TYR D  2 60  ? 35.646  41.625  132.521 1.00 77.10  ? 59  TYR D CE2 1 
ATOM   5262  C CZ  . TYR D  2 60  ? 34.534  40.845  132.244 1.00 76.67  ? 59  TYR D CZ  1 
ATOM   5263  O OH  . TYR D  2 60  ? 34.554  39.506  132.582 1.00 75.10  ? 59  TYR D OH  1 
ATOM   5264  N N   . ALA D  2 61  ? 33.787  48.039  131.389 1.00 77.69  ? 60  ALA D N   1 
ATOM   5265  C CA  . ALA D  2 61  ? 33.011  49.192  130.951 1.00 78.70  ? 60  ALA D CA  1 
ATOM   5266  C C   . ALA D  2 61  ? 32.316  49.067  129.601 1.00 79.37  ? 60  ALA D C   1 
ATOM   5267  O O   . ALA D  2 61  ? 31.337  48.333  129.446 1.00 79.20  ? 60  ALA D O   1 
ATOM   5268  C CB  . ALA D  2 61  ? 33.884  50.428  130.955 1.00 79.14  ? 60  ALA D CB  1 
ATOM   5269  N N   . GLN D  2 62  ? 32.835  49.801  128.626 1.00 79.86  ? 61  GLN D N   1 
ATOM   5270  C CA  . GLN D  2 62  ? 32.257  49.828  127.291 1.00 80.73  ? 61  GLN D CA  1 
ATOM   5271  C C   . GLN D  2 62  ? 33.112  49.198  126.182 1.00 80.94  ? 61  GLN D C   1 
ATOM   5272  O O   . GLN D  2 62  ? 32.844  48.083  125.722 1.00 80.30  ? 61  GLN D O   1 
ATOM   5273  C CB  . GLN D  2 62  ? 31.926  51.288  126.930 1.00 81.63  ? 61  GLN D CB  1 
ATOM   5274  C CG  . GLN D  2 62  ? 32.854  52.349  127.561 1.00 80.33  ? 61  GLN D CG  1 
ATOM   5275  C CD  . GLN D  2 62  ? 32.842  53.686  126.816 1.00 79.39  ? 61  GLN D CD  1 
ATOM   5276  O OE1 . GLN D  2 62  ? 31.812  54.118  126.288 1.00 78.15  ? 61  GLN D OE1 1 
ATOM   5277  N NE2 . GLN D  2 62  ? 33.994  54.349  126.784 1.00 78.63  ? 61  GLN D NE2 1 
ATOM   5278  N N   . LYS D  2 63  ? 34.118  49.950  125.743 1.00 80.79  ? 62  LYS D N   1 
ATOM   5279  C CA  . LYS D  2 63  ? 35.042  49.526  124.699 1.00 80.29  ? 62  LYS D CA  1 
ATOM   5280  C C   . LYS D  2 63  ? 35.622  48.133  124.982 1.00 81.83  ? 62  LYS D C   1 
ATOM   5281  O O   . LYS D  2 63  ? 35.825  47.334  124.065 1.00 81.16  ? 62  LYS D O   1 
ATOM   5282  C CB  . LYS D  2 63  ? 36.163  50.565  124.584 1.00 78.23  ? 62  LYS D CB  1 
ATOM   5283  C CG  . LYS D  2 63  ? 36.323  51.447  125.832 1.00 74.96  ? 62  LYS D CG  1 
ATOM   5284  C CD  . LYS D  2 63  ? 37.500  52.416  125.731 1.00 73.73  ? 62  LYS D CD  1 
ATOM   5285  C CE  . LYS D  2 63  ? 38.800  51.690  125.374 1.00 73.47  ? 62  LYS D CE  1 
ATOM   5286  N NZ  . LYS D  2 63  ? 40.015  52.544  125.495 1.00 71.58  ? 62  LYS D NZ  1 
ATOM   5287  N N   . PHE D  2 64  ? 35.879  47.851  126.258 1.00 83.32  ? 63  PHE D N   1 
ATOM   5288  C CA  . PHE D  2 64  ? 36.423  46.561  126.668 1.00 83.92  ? 63  PHE D CA  1 
ATOM   5289  C C   . PHE D  2 64  ? 35.282  45.548  126.765 1.00 84.52  ? 63  PHE D C   1 
ATOM   5290  O O   . PHE D  2 64  ? 35.156  44.803  127.743 1.00 83.62  ? 63  PHE D O   1 
ATOM   5291  C CB  . PHE D  2 64  ? 37.118  46.680  128.023 1.00 83.60  ? 63  PHE D CB  1 
ATOM   5292  C CG  . PHE D  2 64  ? 38.118  47.791  128.099 1.00 82.04  ? 63  PHE D CG  1 
ATOM   5293  C CD1 . PHE D  2 64  ? 37.702  49.109  128.182 1.00 81.70  ? 63  PHE D CD1 1 
ATOM   5294  C CD2 . PHE D  2 64  ? 39.477  47.517  128.092 1.00 81.99  ? 63  PHE D CD2 1 
ATOM   5295  C CE1 . PHE D  2 64  ? 38.626  50.141  128.258 1.00 81.75  ? 63  PHE D CE1 1 
ATOM   5296  C CE2 . PHE D  2 64  ? 40.409  48.543  128.167 1.00 81.85  ? 63  PHE D CE2 1 
ATOM   5297  C CZ  . PHE D  2 64  ? 39.984  49.857  128.250 1.00 81.65  ? 63  PHE D CZ  1 
ATOM   5298  N N   . GLN D  2 65  ? 34.446  45.542  125.736 1.00 85.42  ? 64  GLN D N   1 
ATOM   5299  C CA  . GLN D  2 65  ? 33.314  44.634  125.666 1.00 86.26  ? 64  GLN D CA  1 
ATOM   5300  C C   . GLN D  2 65  ? 33.792  43.354  124.969 1.00 85.41  ? 64  GLN D C   1 
ATOM   5301  O O   . GLN D  2 65  ? 34.239  43.389  123.822 1.00 85.74  ? 64  GLN D O   1 
ATOM   5302  C CB  . GLN D  2 65  ? 32.178  45.303  124.879 1.00 87.54  ? 64  GLN D CB  1 
ATOM   5303  C CG  . GLN D  2 65  ? 30.776  44.984  125.388 1.00 88.63  ? 64  GLN D CG  1 
ATOM   5304  C CD  . GLN D  2 65  ? 30.694  44.972  126.904 1.00 88.39  ? 64  GLN D CD  1 
ATOM   5305  O OE1 . GLN D  2 65  ? 31.077  45.936  127.571 1.00 88.99  ? 64  GLN D OE1 1 
ATOM   5306  N NE2 . GLN D  2 65  ? 30.191  43.876  127.454 1.00 87.74  ? 64  GLN D NE2 1 
ATOM   5307  N N   . GLY D  2 66  ? 33.710  42.232  125.675 1.00 84.15  ? 65  GLY D N   1 
ATOM   5308  C CA  . GLY D  2 66  ? 34.159  40.976  125.113 1.00 82.40  ? 65  GLY D CA  1 
ATOM   5309  C C   . GLY D  2 66  ? 35.670  40.885  125.196 1.00 81.73  ? 65  GLY D C   1 
ATOM   5310  O O   . GLY D  2 66  ? 36.218  39.801  125.373 1.00 82.80  ? 65  GLY D O   1 
ATOM   5311  N N   . ARG D  2 67  ? 36.347  42.025  125.085 1.00 80.46  ? 66  ARG D N   1 
ATOM   5312  C CA  . ARG D  2 67  ? 37.810  42.075  125.133 1.00 79.17  ? 66  ARG D CA  1 
ATOM   5313  C C   . ARG D  2 67  ? 38.458  41.673  126.456 1.00 78.40  ? 66  ARG D C   1 
ATOM   5314  O O   . ARG D  2 67  ? 39.273  40.751  126.491 1.00 78.30  ? 66  ARG D O   1 
ATOM   5315  C CB  . ARG D  2 67  ? 38.311  43.480  124.774 1.00 79.37  ? 66  ARG D CB  1 
ATOM   5316  C CG  . ARG D  2 67  ? 38.568  43.732  123.294 1.00 78.01  ? 66  ARG D CG  1 
ATOM   5317  C CD  . ARG D  2 67  ? 40.056  43.991  123.018 1.00 76.88  ? 66  ARG D CD  1 
ATOM   5318  N NE  . ARG D  2 67  ? 40.576  45.142  123.754 1.00 75.45  ? 66  ARG D NE  1 
ATOM   5319  C CZ  . ARG D  2 67  ? 41.831  45.575  123.679 1.00 74.73  ? 66  ARG D CZ  1 
ATOM   5320  N NH1 . ARG D  2 67  ? 42.703  44.954  122.894 1.00 74.53  ? 66  ARG D NH1 1 
ATOM   5321  N NH2 . ARG D  2 67  ? 42.218  46.621  124.399 1.00 73.21  ? 66  ARG D NH2 1 
ATOM   5322  N N   . VAL D  2 68  ? 38.104  42.371  127.535 1.00 77.57  ? 67  VAL D N   1 
ATOM   5323  C CA  . VAL D  2 68  ? 38.687  42.121  128.863 1.00 76.36  ? 67  VAL D CA  1 
ATOM   5324  C C   . VAL D  2 68  ? 38.034  41.012  129.704 1.00 75.58  ? 67  VAL D C   1 
ATOM   5325  O O   . VAL D  2 68  ? 36.843  40.739  129.578 1.00 75.85  ? 67  VAL D O   1 
ATOM   5326  C CB  . VAL D  2 68  ? 38.714  43.441  129.693 1.00 74.72  ? 67  VAL D CB  1 
ATOM   5327  C CG1 . VAL D  2 68  ? 37.327  44.013  129.776 1.00 74.18  ? 67  VAL D CG1 1 
ATOM   5328  C CG2 . VAL D  2 68  ? 39.276  43.193  131.080 1.00 73.36  ? 67  VAL D CG2 1 
ATOM   5329  N N   . THR D  2 69  ? 38.836  40.386  130.563 1.00 75.06  ? 68  THR D N   1 
ATOM   5330  C CA  . THR D  2 69  ? 38.386  39.304  131.443 1.00 74.58  ? 68  THR D CA  1 
ATOM   5331  C C   . THR D  2 69  ? 38.934  39.457  132.877 1.00 74.32  ? 68  THR D C   1 
ATOM   5332  O O   . THR D  2 69  ? 40.151  39.455  133.099 1.00 72.73  ? 68  THR D O   1 
ATOM   5333  C CB  . THR D  2 69  ? 38.817  37.925  130.872 1.00 74.38  ? 68  THR D CB  1 
ATOM   5334  O OG1 . THR D  2 69  ? 38.060  37.646  129.690 1.00 73.95  ? 68  THR D OG1 1 
ATOM   5335  C CG2 . THR D  2 69  ? 38.586  36.812  131.884 1.00 74.35  ? 68  THR D CG2 1 
ATOM   5336  N N   . ILE D  2 70  ? 38.019  39.589  133.838 1.00 74.20  ? 69  ILE D N   1 
ATOM   5337  C CA  . ILE D  2 70  ? 38.372  39.745  135.250 1.00 74.34  ? 69  ILE D CA  1 
ATOM   5338  C C   . ILE D  2 70  ? 37.840  38.596  136.109 1.00 76.12  ? 69  ILE D C   1 
ATOM   5339  O O   . ILE D  2 70  ? 36.626  38.489  136.316 1.00 76.64  ? 69  ILE D O   1 
ATOM   5340  C CB  . ILE D  2 70  ? 37.791  41.043  135.836 1.00 72.21  ? 69  ILE D CB  1 
ATOM   5341  C CG1 . ILE D  2 70  ? 38.460  42.259  135.203 1.00 71.42  ? 69  ILE D CG1 1 
ATOM   5342  C CG2 . ILE D  2 70  ? 37.972  41.051  137.337 1.00 71.62  ? 69  ILE D CG2 1 
ATOM   5343  C CD1 . ILE D  2 70  ? 37.854  43.573  135.646 1.00 70.61  ? 69  ILE D CD1 1 
ATOM   5344  N N   . THR D  2 71  ? 38.741  37.746  136.610 1.00 77.46  ? 70  THR D N   1 
ATOM   5345  C CA  . THR D  2 71  ? 38.350  36.618  137.463 1.00 78.33  ? 70  THR D CA  1 
ATOM   5346  C C   . THR D  2 71  ? 39.076  36.700  138.807 1.00 78.89  ? 70  THR D C   1 
ATOM   5347  O O   . THR D  2 71  ? 39.887  37.604  139.032 1.00 78.72  ? 70  THR D O   1 
ATOM   5348  C CB  . THR D  2 71  ? 38.672  35.239  136.814 1.00 78.10  ? 70  THR D CB  1 
ATOM   5349  O OG1 . THR D  2 71  ? 40.089  35.087  136.690 1.00 79.05  ? 70  THR D OG1 1 
ATOM   5350  C CG2 . THR D  2 71  ? 38.033  35.120  135.437 1.00 77.05  ? 70  THR D CG2 1 
ATOM   5351  N N   . ALA D  2 72  ? 38.775  35.755  139.696 1.00 79.81  ? 71  ALA D N   1 
ATOM   5352  C CA  . ALA D  2 72  ? 39.388  35.710  141.024 1.00 80.73  ? 71  ALA D CA  1 
ATOM   5353  C C   . ALA D  2 72  ? 39.021  34.437  141.782 1.00 81.16  ? 71  ALA D C   1 
ATOM   5354  O O   . ALA D  2 72  ? 37.887  33.971  141.718 1.00 81.26  ? 71  ALA D O   1 
ATOM   5355  C CB  . ALA D  2 72  ? 38.964  36.931  141.841 1.00 79.67  ? 71  ALA D CB  1 
ATOM   5356  N N   . ASP D  2 73  ? 39.989  33.877  142.501 1.00 81.97  ? 72  ASP D N   1 
ATOM   5357  C CA  . ASP D  2 73  ? 39.761  32.668  143.291 1.00 81.99  ? 72  ASP D CA  1 
ATOM   5358  C C   . ASP D  2 73  ? 40.215  32.921  144.730 1.00 82.77  ? 72  ASP D C   1 
ATOM   5359  O O   . ASP D  2 73  ? 41.404  33.152  144.978 1.00 82.63  ? 72  ASP D O   1 
ATOM   5360  C CB  . ASP D  2 73  ? 40.546  31.492  142.714 1.00 80.85  ? 72  ASP D CB  1 
ATOM   5361  C CG  . ASP D  2 73  ? 40.226  30.183  143.411 1.00 80.26  ? 72  ASP D CG  1 
ATOM   5362  O OD1 . ASP D  2 73  ? 41.146  29.348  143.561 1.00 79.67  ? 72  ASP D OD1 1 
ATOM   5363  O OD2 . ASP D  2 73  ? 39.052  29.985  143.798 1.00 79.12  ? 72  ASP D OD2 1 
ATOM   5364  N N   . GLU D  2 74  ? 39.271  32.883  145.673 1.00 83.41  ? 73  GLU D N   1 
ATOM   5365  C CA  . GLU D  2 74  ? 39.588  33.109  147.086 1.00 83.47  ? 73  GLU D CA  1 
ATOM   5366  C C   . GLU D  2 74  ? 40.529  32.017  147.596 1.00 83.06  ? 73  GLU D C   1 
ATOM   5367  O O   . GLU D  2 74  ? 41.185  32.191  148.620 1.00 83.50  ? 73  GLU D O   1 
ATOM   5368  C CB  . GLU D  2 74  ? 38.319  33.112  147.954 1.00 84.01  ? 73  GLU D CB  1 
ATOM   5369  C CG  . GLU D  2 74  ? 37.099  33.819  147.365 1.00 84.25  ? 73  GLU D CG  1 
ATOM   5370  C CD  . GLU D  2 74  ? 36.402  33.004  146.281 1.00 84.27  ? 73  GLU D CD  1 
ATOM   5371  O OE1 . GLU D  2 74  ? 35.398  33.495  145.726 1.00 83.97  ? 73  GLU D OE1 1 
ATOM   5372  O OE2 . GLU D  2 74  ? 36.850  31.878  145.978 1.00 84.02  ? 73  GLU D OE2 1 
ATOM   5373  N N   . ALA D  2 75  ? 40.579  30.891  146.885 1.00 82.26  ? 74  ALA D N   1 
ATOM   5374  C CA  . ALA D  2 75  ? 41.448  29.778  147.255 1.00 81.05  ? 74  ALA D CA  1 
ATOM   5375  C C   . ALA D  2 75  ? 42.893  30.259  147.202 1.00 80.55  ? 74  ALA D C   1 
ATOM   5376  O O   . ALA D  2 75  ? 43.821  29.553  147.596 1.00 80.72  ? 74  ALA D O   1 
ATOM   5377  C CB  . ALA D  2 75  ? 41.240  28.603  146.295 1.00 80.68  ? 74  ALA D CB  1 
ATOM   5378  N N   . THR D  2 76  ? 43.068  31.479  146.709 1.00 80.34  ? 75  THR D N   1 
ATOM   5379  C CA  . THR D  2 76  ? 44.379  32.102  146.602 1.00 80.15  ? 75  THR D CA  1 
ATOM   5380  C C   . THR D  2 76  ? 44.252  33.577  146.976 1.00 78.71  ? 75  THR D C   1 
ATOM   5381  O O   . THR D  2 76  ? 45.243  34.219  147.338 1.00 77.65  ? 75  THR D O   1 
ATOM   5382  C CB  . THR D  2 76  ? 44.945  31.980  145.158 1.00 81.08  ? 75  THR D CB  1 
ATOM   5383  O OG1 . THR D  2 76  ? 44.014  32.538  144.219 1.00 81.67  ? 75  THR D OG1 1 
ATOM   5384  C CG2 . THR D  2 76  ? 45.190  30.516  144.804 1.00 81.54  ? 75  THR D CG2 1 
ATOM   5385  N N   . SER D  2 77  ? 43.017  34.081  146.898 1.00 77.36  ? 76  SER D N   1 
ATOM   5386  C CA  . SER D  2 77  ? 42.674  35.474  147.192 1.00 76.70  ? 76  SER D CA  1 
ATOM   5387  C C   . SER D  2 77  ? 43.130  36.341  146.020 1.00 76.10  ? 76  SER D C   1 
ATOM   5388  O O   . SER D  2 77  ? 43.398  37.534  146.171 1.00 76.63  ? 76  SER D O   1 
ATOM   5389  C CB  . SER D  2 77  ? 43.358  35.955  148.483 1.00 77.31  ? 76  SER D CB  1 
ATOM   5390  O OG  . SER D  2 77  ? 42.985  35.183  149.613 1.00 77.27  ? 76  SER D OG  1 
ATOM   5391  N N   . THR D  2 78  ? 43.190  35.729  144.845 1.00 74.74  ? 77  THR D N   1 
ATOM   5392  C CA  . THR D  2 78  ? 43.652  36.403  143.642 1.00 73.37  ? 77  THR D CA  1 
ATOM   5393  C C   . THR D  2 78  ? 42.572  36.788  142.634 1.00 71.90  ? 77  THR D C   1 
ATOM   5394  O O   . THR D  2 78  ? 41.513  36.167  142.573 1.00 69.48  ? 77  THR D O   1 
ATOM   5395  C CB  . THR D  2 78  ? 44.717  35.512  142.933 1.00 74.55  ? 77  THR D CB  1 
ATOM   5396  O OG1 . THR D  2 78  ? 45.942  35.561  143.678 1.00 75.19  ? 77  THR D OG1 1 
ATOM   5397  C CG2 . THR D  2 78  ? 44.966  35.962  141.485 1.00 73.38  ? 77  THR D CG2 1 
ATOM   5398  N N   . THR D  2 79  ? 42.870  37.841  141.865 1.00 71.58  ? 78  THR D N   1 
ATOM   5399  C CA  . THR D  2 79  ? 42.014  38.357  140.790 1.00 70.12  ? 78  THR D CA  1 
ATOM   5400  C C   . THR D  2 79  ? 42.885  38.407  139.559 1.00 69.85  ? 78  THR D C   1 
ATOM   5401  O O   . THR D  2 79  ? 43.876  39.136  139.533 1.00 69.59  ? 78  THR D O   1 
ATOM   5402  C CB  . THR D  2 79  ? 41.556  39.810  141.002 1.00 68.98  ? 78  THR D CB  1 
ATOM   5403  O OG1 . THR D  2 79  ? 42.612  40.547  141.626 1.00 66.92  ? 78  THR D OG1 1 
ATOM   5404  C CG2 . THR D  2 79  ? 40.279  39.874  141.808 1.00 68.49  ? 78  THR D CG2 1 
ATOM   5405  N N   . TYR D  2 80  ? 42.524  37.642  138.542 1.00 69.76  ? 79  TYR D N   1 
ATOM   5406  C CA  . TYR D  2 80  ? 43.298  37.657  137.317 1.00 70.53  ? 79  TYR D CA  1 
ATOM   5407  C C   . TYR D  2 80  ? 42.653  38.629  136.332 1.00 70.85  ? 79  TYR D C   1 
ATOM   5408  O O   . TYR D  2 80  ? 41.456  38.919  136.417 1.00 70.48  ? 79  TYR D O   1 
ATOM   5409  C CB  . TYR D  2 80  ? 43.374  36.255  136.702 1.00 70.96  ? 79  TYR D CB  1 
ATOM   5410  C CG  . TYR D  2 80  ? 43.988  35.215  137.608 1.00 72.11  ? 79  TYR D CG  1 
ATOM   5411  C CD1 . TYR D  2 80  ? 43.195  34.438  138.452 1.00 73.18  ? 79  TYR D CD1 1 
ATOM   5412  C CD2 . TYR D  2 80  ? 45.367  35.024  137.645 1.00 72.30  ? 79  TYR D CD2 1 
ATOM   5413  C CE1 . TYR D  2 80  ? 43.764  33.494  139.316 1.00 73.97  ? 79  TYR D CE1 1 
ATOM   5414  C CE2 . TYR D  2 80  ? 45.946  34.086  138.503 1.00 73.71  ? 79  TYR D CE2 1 
ATOM   5415  C CZ  . TYR D  2 80  ? 45.139  33.324  139.337 1.00 73.89  ? 79  TYR D CZ  1 
ATOM   5416  O OH  . TYR D  2 80  ? 45.708  32.397  140.187 1.00 73.89  ? 79  TYR D OH  1 
ATOM   5417  N N   . MET D  2 81  ? 43.464  39.139  135.409 1.00 70.77  ? 80  MET D N   1 
ATOM   5418  C CA  . MET D  2 81  ? 43.012  40.071  134.388 1.00 70.19  ? 80  MET D CA  1 
ATOM   5419  C C   . MET D  2 81  ? 43.564  39.548  133.078 1.00 70.01  ? 80  MET D C   1 
ATOM   5420  O O   . MET D  2 81  ? 44.762  39.612  132.838 1.00 68.85  ? 80  MET D O   1 
ATOM   5421  C CB  . MET D  2 81  ? 43.558  41.463  134.686 1.00 70.86  ? 80  MET D CB  1 
ATOM   5422  C CG  . MET D  2 81  ? 42.990  42.575  133.835 1.00 71.65  ? 80  MET D CG  1 
ATOM   5423  S SD  . MET D  2 81  ? 43.774  42.649  132.230 1.00 72.97  ? 80  MET D SD  1 
ATOM   5424  C CE  . MET D  2 81  ? 45.288  43.519  132.654 1.00 72.38  ? 80  MET D CE  1 
ATOM   5425  N N   . GLU D  2 82  ? 42.680  39.009  132.247 1.00 71.52  ? 81  GLU D N   1 
ATOM   5426  C CA  . GLU D  2 82  ? 43.060  38.437  130.958 1.00 73.59  ? 81  GLU D CA  1 
ATOM   5427  C C   . GLU D  2 82  ? 42.611  39.292  129.791 1.00 74.37  ? 81  GLU D C   1 
ATOM   5428  O O   . GLU D  2 82  ? 41.447  39.685  129.712 1.00 75.26  ? 81  GLU D O   1 
ATOM   5429  C CB  . GLU D  2 82  ? 42.454  37.036  130.808 1.00 74.86  ? 81  GLU D CB  1 
ATOM   5430  C CG  . GLU D  2 82  ? 42.226  36.580  129.364 1.00 77.35  ? 81  GLU D CG  1 
ATOM   5431  C CD  . GLU D  2 82  ? 41.670  35.159  129.266 1.00 78.80  ? 81  GLU D CD  1 
ATOM   5432  O OE1 . GLU D  2 82  ? 40.691  34.845  129.984 1.00 78.60  ? 81  GLU D OE1 1 
ATOM   5433  O OE2 . GLU D  2 82  ? 42.210  34.360  128.464 1.00 78.92  ? 81  GLU D OE2 1 
ATOM   5434  N N   . LEU D  2 83  ? 43.534  39.577  128.881 1.00 74.65  ? 82  LEU D N   1 
ATOM   5435  C CA  . LEU D  2 83  ? 43.203  40.370  127.706 1.00 75.56  ? 82  LEU D CA  1 
ATOM   5436  C C   . LEU D  2 83  ? 43.738  39.678  126.452 1.00 76.39  ? 82  LEU D C   1 
ATOM   5437  O O   . LEU D  2 83  ? 44.926  39.358  126.354 1.00 76.88  ? 82  LEU D O   1 
ATOM   5438  C CB  . LEU D  2 83  ? 43.767  41.794  127.833 1.00 74.43  ? 82  LEU D CB  1 
ATOM   5439  C CG  . LEU D  2 83  ? 43.334  42.820  126.776 1.00 73.39  ? 82  LEU D CG  1 
ATOM   5440  C CD1 . LEU D  2 83  ? 41.876  42.624  126.399 1.00 72.28  ? 82  LEU D CD1 1 
ATOM   5441  C CD2 . LEU D  2 83  ? 43.569  44.222  127.316 1.00 72.65  ? 82  LEU D CD2 1 
ATOM   5442  N N   . SER D  2 84  A 42.837  39.441  125.504 1.00 76.47  ? 82  SER D N   1 
ATOM   5443  C CA  . SER D  2 84  A 43.173  38.780  124.258 1.00 76.17  ? 82  SER D CA  1 
ATOM   5444  C C   . SER D  2 84  A 43.385  39.757  123.111 1.00 75.95  ? 82  SER D C   1 
ATOM   5445  O O   . SER D  2 84  A 42.999  40.928  123.202 1.00 76.28  ? 82  SER D O   1 
ATOM   5446  C CB  . SER D  2 84  A 42.075  37.779  123.907 1.00 76.77  ? 82  SER D CB  1 
ATOM   5447  O OG  . SER D  2 84  A 40.792  38.325  124.167 1.00 77.23  ? 82  SER D OG  1 
ATOM   5448  N N   . SER D  2 85  B 44.007  39.261  122.039 1.00 74.97  ? 82  SER D N   1 
ATOM   5449  C CA  . SER D  2 85  B 44.300  40.047  120.834 1.00 74.29  ? 82  SER D CA  1 
ATOM   5450  C C   . SER D  2 85  B 44.833  41.461  121.117 1.00 73.06  ? 82  SER D C   1 
ATOM   5451  O O   . SER D  2 85  B 44.344  42.452  120.566 1.00 72.47  ? 82  SER D O   1 
ATOM   5452  C CB  . SER D  2 85  B 43.058  40.122  119.928 1.00 75.32  ? 82  SER D CB  1 
ATOM   5453  O OG  . SER D  2 85  B 42.777  38.875  119.296 1.00 75.67  ? 82  SER D OG  1 
ATOM   5454  N N   . LEU D  2 86  C 45.856  41.530  121.967 1.00 71.50  ? 82  LEU D N   1 
ATOM   5455  C CA  . LEU D  2 86  C 46.487  42.786  122.352 1.00 69.31  ? 82  LEU D CA  1 
ATOM   5456  C C   . LEU D  2 86  C 47.131  43.490  121.169 1.00 68.84  ? 82  LEU D C   1 
ATOM   5457  O O   . LEU D  2 86  C 47.855  42.880  120.386 1.00 68.52  ? 82  LEU D O   1 
ATOM   5458  C CB  . LEU D  2 86  C 47.573  42.532  123.395 1.00 67.94  ? 82  LEU D CB  1 
ATOM   5459  C CG  . LEU D  2 86  C 47.272  41.603  124.565 1.00 66.57  ? 82  LEU D CG  1 
ATOM   5460  C CD1 . LEU D  2 86  C 48.519  41.466  125.415 1.00 66.53  ? 82  LEU D CD1 1 
ATOM   5461  C CD2 . LEU D  2 86  C 46.138  42.151  125.384 1.00 65.90  ? 82  LEU D CD2 1 
ATOM   5462  N N   . ARG D  2 87  ? 46.867  44.781  121.047 1.00 68.08  ? 83  ARG D N   1 
ATOM   5463  C CA  . ARG D  2 87  ? 47.454  45.573  119.986 1.00 67.47  ? 83  ARG D CA  1 
ATOM   5464  C C   . ARG D  2 87  ? 48.244  46.693  120.650 1.00 67.51  ? 83  ARG D C   1 
ATOM   5465  O O   . ARG D  2 87  ? 48.219  46.829  121.875 1.00 66.58  ? 83  ARG D O   1 
ATOM   5466  C CB  . ARG D  2 87  ? 46.367  46.121  119.063 1.00 66.87  ? 83  ARG D CB  1 
ATOM   5467  C CG  . ARG D  2 87  ? 45.111  46.585  119.768 1.00 66.63  ? 83  ARG D CG  1 
ATOM   5468  C CD  . ARG D  2 87  ? 43.901  46.213  118.933 1.00 68.14  ? 83  ARG D CD  1 
ATOM   5469  N NE  . ARG D  2 87  ? 42.644  46.717  119.471 1.00 68.41  ? 83  ARG D NE  1 
ATOM   5470  C CZ  . ARG D  2 87  ? 42.331  48.005  119.548 1.00 69.17  ? 83  ARG D CZ  1 
ATOM   5471  N NH1 . ARG D  2 87  ? 43.184  48.932  119.123 1.00 68.45  ? 83  ARG D NH1 1 
ATOM   5472  N NH2 . ARG D  2 87  ? 41.156  48.366  120.043 1.00 69.80  ? 83  ARG D NH2 1 
ATOM   5473  N N   . SER D  2 88  ? 48.954  47.475  119.839 1.00 67.45  ? 84  SER D N   1 
ATOM   5474  C CA  . SER D  2 88  ? 49.796  48.578  120.315 1.00 65.55  ? 84  SER D CA  1 
ATOM   5475  C C   . SER D  2 88  ? 49.252  49.406  121.482 1.00 63.45  ? 84  SER D C   1 
ATOM   5476  O O   . SER D  2 88  ? 49.816  49.397  122.574 1.00 62.20  ? 84  SER D O   1 
ATOM   5477  C CB  . SER D  2 88  ? 50.138  49.523  119.148 1.00 66.03  ? 84  SER D CB  1 
ATOM   5478  O OG  . SER D  2 88  ? 50.841  48.856  118.108 1.00 66.41  ? 84  SER D OG  1 
ATOM   5479  N N   . GLU D  2 89  ? 48.156  50.111  121.248 1.00 61.41  ? 85  GLU D N   1 
ATOM   5480  C CA  . GLU D  2 89  ? 47.570  50.969  122.263 1.00 61.47  ? 85  GLU D CA  1 
ATOM   5481  C C   . GLU D  2 89  ? 47.083  50.271  123.539 1.00 60.76  ? 85  GLU D C   1 
ATOM   5482  O O   . GLU D  2 89  ? 46.175  50.756  124.218 1.00 60.44  ? 85  GLU D O   1 
ATOM   5483  C CB  . GLU D  2 89  ? 46.433  51.774  121.645 1.00 63.02  ? 85  GLU D CB  1 
ATOM   5484  C CG  . GLU D  2 89  ? 46.756  52.358  120.265 1.00 65.49  ? 85  GLU D CG  1 
ATOM   5485  C CD  . GLU D  2 89  ? 46.889  51.291  119.178 1.00 66.24  ? 85  GLU D CD  1 
ATOM   5486  O OE1 . GLU D  2 89  ? 45.994  50.423  119.063 1.00 66.78  ? 85  GLU D OE1 1 
ATOM   5487  O OE2 . GLU D  2 89  ? 47.890  51.326  118.434 1.00 66.39  ? 85  GLU D OE2 1 
ATOM   5488  N N   . ASP D  2 90  ? 47.697  49.138  123.865 1.00 60.12  ? 86  ASP D N   1 
ATOM   5489  C CA  . ASP D  2 90  ? 47.352  48.386  125.072 1.00 58.52  ? 86  ASP D CA  1 
ATOM   5490  C C   . ASP D  2 90  ? 48.525  48.493  126.041 1.00 57.00  ? 86  ASP D C   1 
ATOM   5491  O O   . ASP D  2 90  ? 48.356  48.366  127.248 1.00 55.88  ? 86  ASP D O   1 
ATOM   5492  C CB  . ASP D  2 90  ? 47.093  46.901  124.752 1.00 59.30  ? 86  ASP D CB  1 
ATOM   5493  C CG  . ASP D  2 90  ? 45.851  46.679  123.884 1.00 58.91  ? 86  ASP D CG  1 
ATOM   5494  O OD1 . ASP D  2 90  ? 44.746  47.106  124.287 1.00 58.78  ? 86  ASP D OD1 1 
ATOM   5495  O OD2 . ASP D  2 90  ? 45.984  46.064  122.801 1.00 58.30  ? 86  ASP D OD2 1 
ATOM   5496  N N   . THR D  2 91  ? 49.718  48.727  125.497 1.00 56.85  ? 87  THR D N   1 
ATOM   5497  C CA  . THR D  2 91  ? 50.928  48.858  126.316 1.00 56.96  ? 87  THR D CA  1 
ATOM   5498  C C   . THR D  2 91  ? 50.685  49.837  127.470 1.00 56.92  ? 87  THR D C   1 
ATOM   5499  O O   . THR D  2 91  ? 50.274  50.982  127.261 1.00 57.10  ? 87  THR D O   1 
ATOM   5500  C CB  . THR D  2 91  ? 52.155  49.355  125.476 1.00 55.77  ? 87  THR D CB  1 
ATOM   5501  O OG1 . THR D  2 91  ? 52.467  48.395  124.454 1.00 55.34  ? 87  THR D OG1 1 
ATOM   5502  C CG2 . THR D  2 91  ? 53.374  49.547  126.368 1.00 53.76  ? 87  THR D CG2 1 
ATOM   5503  N N   . ALA D  2 92  ? 50.939  49.390  128.691 1.00 56.03  ? 88  ALA D N   1 
ATOM   5504  C CA  . ALA D  2 92  ? 50.721  50.264  129.824 1.00 55.80  ? 88  ALA D CA  1 
ATOM   5505  C C   . ALA D  2 92  ? 51.085  49.617  131.138 1.00 55.14  ? 88  ALA D C   1 
ATOM   5506  O O   . ALA D  2 92  ? 51.598  48.504  131.193 1.00 56.32  ? 88  ALA D O   1 
ATOM   5507  C CB  . ALA D  2 92  ? 49.260  50.698  129.867 1.00 56.37  ? 88  ALA D CB  1 
ATOM   5508  N N   . VAL D  2 93  ? 50.817  50.346  132.205 1.00 53.38  ? 89  VAL D N   1 
ATOM   5509  C CA  . VAL D  2 93  ? 51.059  49.835  133.525 1.00 51.69  ? 89  VAL D CA  1 
ATOM   5510  C C   . VAL D  2 93  ? 49.671  49.494  134.018 1.00 51.57  ? 89  VAL D C   1 
ATOM   5511  O O   . VAL D  2 93  ? 48.732  50.284  133.846 1.00 50.14  ? 89  VAL D O   1 
ATOM   5512  C CB  . VAL D  2 93  ? 51.666  50.890  134.426 1.00 50.99  ? 89  VAL D CB  1 
ATOM   5513  C CG1 . VAL D  2 93  ? 51.729  50.375  135.843 1.00 50.18  ? 89  VAL D CG1 1 
ATOM   5514  C CG2 . VAL D  2 93  ? 53.037  51.250  133.921 1.00 51.47  ? 89  VAL D CG2 1 
ATOM   5515  N N   . TYR D  2 94  ? 49.533  48.301  134.588 1.00 51.43  ? 90  TYR D N   1 
ATOM   5516  C CA  . TYR D  2 94  ? 48.249  47.864  135.105 1.00 51.09  ? 90  TYR D CA  1 
ATOM   5517  C C   . TYR D  2 94  ? 48.324  47.712  136.603 1.00 52.74  ? 90  TYR D C   1 
ATOM   5518  O O   . TYR D  2 94  ? 49.277  47.158  137.151 1.00 53.08  ? 90  TYR D O   1 
ATOM   5519  C CB  . TYR D  2 94  ? 47.801  46.552  134.462 1.00 47.47  ? 90  TYR D CB  1 
ATOM   5520  C CG  . TYR D  2 94  ? 47.483  46.690  132.997 1.00 43.87  ? 90  TYR D CG  1 
ATOM   5521  C CD1 . TYR D  2 94  ? 48.502  46.893  132.065 1.00 43.20  ? 90  TYR D CD1 1 
ATOM   5522  C CD2 . TYR D  2 94  ? 46.167  46.646  132.542 1.00 42.53  ? 90  TYR D CD2 1 
ATOM   5523  C CE1 . TYR D  2 94  ? 48.229  47.050  130.720 1.00 41.89  ? 90  TYR D CE1 1 
ATOM   5524  C CE2 . TYR D  2 94  ? 45.873  46.801  131.190 1.00 42.38  ? 90  TYR D CE2 1 
ATOM   5525  C CZ  . TYR D  2 94  ? 46.916  47.004  130.282 1.00 42.21  ? 90  TYR D CZ  1 
ATOM   5526  O OH  . TYR D  2 94  ? 46.654  47.155  128.938 1.00 40.95  ? 90  TYR D OH  1 
ATOM   5527  N N   . PHE D  2 95  ? 47.303  48.254  137.248 1.00 54.45  ? 91  PHE D N   1 
ATOM   5528  C CA  . PHE D  2 95  ? 47.167  48.240  138.685 1.00 55.86  ? 91  PHE D CA  1 
ATOM   5529  C C   . PHE D  2 95  ? 45.950  47.392  139.010 1.00 57.76  ? 91  PHE D C   1 
ATOM   5530  O O   . PHE D  2 95  ? 45.445  46.630  138.182 1.00 58.89  ? 91  PHE D O   1 
ATOM   5531  C CB  . PHE D  2 95  ? 46.903  49.652  139.203 1.00 55.01  ? 91  PHE D CB  1 
ATOM   5532  C CG  . PHE D  2 95  ? 47.991  50.633  138.906 1.00 54.41  ? 91  PHE D CG  1 
ATOM   5533  C CD1 . PHE D  2 95  ? 47.701  51.820  138.242 1.00 54.83  ? 91  PHE D CD1 1 
ATOM   5534  C CD2 . PHE D  2 95  ? 49.288  50.414  139.356 1.00 54.07  ? 91  PHE D CD2 1 
ATOM   5535  C CE1 . PHE D  2 95  ? 48.693  52.787  138.036 1.00 54.96  ? 91  PHE D CE1 1 
ATOM   5536  C CE2 . PHE D  2 95  ? 50.284  51.367  139.161 1.00 53.91  ? 91  PHE D CE2 1 
ATOM   5537  C CZ  . PHE D  2 95  ? 49.987  52.559  138.501 1.00 53.99  ? 91  PHE D CZ  1 
ATOM   5538  N N   . CYS D  2 96  ? 45.487  47.554  140.234 1.00 57.97  ? 92  CYS D N   1 
ATOM   5539  C CA  . CYS D  2 96  ? 44.321  46.878  140.733 1.00 59.24  ? 92  CYS D CA  1 
ATOM   5540  C C   . CYS D  2 96  ? 44.249  47.509  142.082 1.00 58.45  ? 92  CYS D C   1 
ATOM   5541  O O   . CYS D  2 96  ? 45.263  47.695  142.749 1.00 57.34  ? 92  CYS D O   1 
ATOM   5542  C CB  . CYS D  2 96  ? 44.514  45.354  140.825 1.00 63.29  ? 92  CYS D CB  1 
ATOM   5543  S SG  . CYS D  2 96  ? 46.145  44.738  141.380 1.00 69.53  ? 92  CYS D SG  1 
ATOM   5544  N N   . ALA D  2 97  ? 43.050  47.897  142.462 1.00 58.42  ? 93  ALA D N   1 
ATOM   5545  C CA  . ALA D  2 97  ? 42.874  48.538  143.734 1.00 59.33  ? 93  ALA D CA  1 
ATOM   5546  C C   . ALA D  2 97  ? 41.636  48.005  144.423 1.00 59.72  ? 93  ALA D C   1 
ATOM   5547  O O   . ALA D  2 97  ? 40.683  47.555  143.778 1.00 59.00  ? 93  ALA D O   1 
ATOM   5548  C CB  . ALA D  2 97  ? 42.773  50.053  143.541 1.00 59.60  ? 93  ALA D CB  1 
ATOM   5549  N N   . LYS D  2 98  ? 41.686  48.047  145.747 1.00 59.56  ? 94  LYS D N   1 
ATOM   5550  C CA  . LYS D  2 98  ? 40.602  47.611  146.590 1.00 60.21  ? 94  LYS D CA  1 
ATOM   5551  C C   . LYS D  2 98  ? 39.875  48.890  146.964 1.00 61.21  ? 94  LYS D C   1 
ATOM   5552  O O   . LYS D  2 98  ? 40.506  49.914  147.225 1.00 61.74  ? 94  LYS D O   1 
ATOM   5553  C CB  . LYS D  2 98  ? 41.170  46.933  147.830 1.00 60.45  ? 94  LYS D CB  1 
ATOM   5554  C CG  . LYS D  2 98  ? 40.421  47.240  149.108 1.00 62.53  ? 94  LYS D CG  1 
ATOM   5555  C CD  . LYS D  2 98  ? 41.318  47.065  150.336 1.00 62.44  ? 94  LYS D CD  1 
ATOM   5556  C CE  . LYS D  2 98  ? 40.663  47.668  151.586 1.00 62.87  ? 94  LYS D CE  1 
ATOM   5557  N NZ  . LYS D  2 98  ? 40.332  49.132  151.425 1.00 60.57  ? 94  LYS D NZ  1 
ATOM   5558  N N   . GLY D  2 99  ? 38.548  48.832  146.974 1.00 62.44  ? 95  GLY D N   1 
ATOM   5559  C CA  . GLY D  2 99  ? 37.755  49.999  147.319 1.00 63.10  ? 95  GLY D CA  1 
ATOM   5560  C C   . GLY D  2 99  ? 37.882  50.413  148.777 1.00 63.60  ? 95  GLY D C   1 
ATOM   5561  O O   . GLY D  2 99  ? 38.804  49.985  149.472 1.00 63.43  ? 95  GLY D O   1 
ATOM   5562  N N   . GLY D  2 100 ? 36.958  51.252  149.237 1.00 63.62  ? 96  GLY D N   1 
ATOM   5563  C CA  . GLY D  2 100 ? 36.985  51.713  150.614 1.00 63.68  ? 96  GLY D CA  1 
ATOM   5564  C C   . GLY D  2 100 ? 37.991  50.987  151.484 1.00 64.23  ? 96  GLY D C   1 
ATOM   5565  O O   . GLY D  2 100 ? 37.644  50.035  152.179 1.00 64.25  ? 96  GLY D O   1 
ATOM   5566  N N   . HIS D  2 114 J 32.499  55.794  147.722 1.00 86.90  ? 100 HIS D N   1 
ATOM   5567  C CA  . HIS D  2 114 J 33.331  54.601  147.857 1.00 87.22  ? 100 HIS D CA  1 
ATOM   5568  C C   . HIS D  2 114 J 34.751  54.971  148.276 1.00 86.73  ? 100 HIS D C   1 
ATOM   5569  O O   . HIS D  2 114 J 34.990  55.432  149.399 1.00 86.81  ? 100 HIS D O   1 
ATOM   5570  C CB  . HIS D  2 114 J 33.393  53.818  146.530 1.00 88.01  ? 100 HIS D CB  1 
ATOM   5571  C CG  . HIS D  2 114 J 32.071  53.276  146.071 1.00 89.06  ? 100 HIS D CG  1 
ATOM   5572  N ND1 . HIS D  2 114 J 30.957  54.067  145.892 1.00 89.47  ? 100 HIS D ND1 1 
ATOM   5573  C CD2 . HIS D  2 114 J 31.676  52.007  145.802 1.00 89.36  ? 100 HIS D CD2 1 
ATOM   5574  C CE1 . HIS D  2 114 J 29.931  53.310  145.542 1.00 89.33  ? 100 HIS D CE1 1 
ATOM   5575  N NE2 . HIS D  2 114 J 30.341  52.056  145.481 1.00 89.68  ? 100 HIS D NE2 1 
ATOM   5576  N N   . GLY D  2 115 K 35.688  54.752  147.359 1.00 85.35  ? 100 GLY D N   1 
ATOM   5577  C CA  . GLY D  2 115 K 37.073  55.068  147.625 1.00 84.07  ? 100 GLY D CA  1 
ATOM   5578  C C   . GLY D  2 115 K 38.021  54.091  146.968 1.00 83.43  ? 100 GLY D C   1 
ATOM   5579  O O   . GLY D  2 115 K 37.594  53.243  146.189 1.00 83.45  ? 100 GLY D O   1 
ATOM   5580  N N   . MET D  2 116 L 39.308  54.221  147.291 1.00 82.10  ? 100 MET D N   1 
ATOM   5581  C CA  . MET D  2 116 L 40.360  53.364  146.759 1.00 80.29  ? 100 MET D CA  1 
ATOM   5582  C C   . MET D  2 116 L 41.699  53.927  147.201 1.00 79.56  ? 100 MET D C   1 
ATOM   5583  O O   . MET D  2 116 L 42.321  54.706  146.489 1.00 79.12  ? 100 MET D O   1 
ATOM   5584  C CB  . MET D  2 116 L 40.286  53.318  145.233 1.00 79.83  ? 100 MET D CB  1 
ATOM   5585  C CG  . MET D  2 116 L 40.335  51.911  144.659 1.00 78.91  ? 100 MET D CG  1 
ATOM   5586  S SD  . MET D  2 116 L 39.573  51.805  143.037 1.00 78.18  ? 100 MET D SD  1 
ATOM   5587  C CE  . MET D  2 116 L 38.177  50.751  143.413 1.00 77.50  ? 100 MET D CE  1 
ATOM   5588  N N   . ASP D  2 117 ? 42.134  53.515  148.384 1.00 79.44  ? 101 ASP D N   1 
ATOM   5589  C CA  . ASP D  2 117 ? 43.387  53.979  148.974 1.00 78.48  ? 101 ASP D CA  1 
ATOM   5590  C C   . ASP D  2 117 ? 44.493  52.935  148.904 1.00 76.92  ? 101 ASP D C   1 
ATOM   5591  O O   . ASP D  2 117 ? 45.611  53.166  149.369 1.00 75.90  ? 101 ASP D O   1 
ATOM   5592  C CB  . ASP D  2 117 ? 43.140  54.357  150.431 1.00 80.65  ? 101 ASP D CB  1 
ATOM   5593  C CG  . ASP D  2 117 ? 41.754  53.929  150.918 1.00 82.69  ? 101 ASP D CG  1 
ATOM   5594  O OD1 . ASP D  2 117 ? 41.329  52.779  150.635 1.00 83.31  ? 101 ASP D OD1 1 
ATOM   5595  O OD2 . ASP D  2 117 ? 41.090  54.750  151.590 1.00 83.23  ? 101 ASP D OD2 1 
ATOM   5596  N N   . VAL D  2 118 ? 44.171  51.785  148.323 1.00 75.39  ? 102 VAL D N   1 
ATOM   5597  C CA  . VAL D  2 118 ? 45.130  50.698  148.187 1.00 74.69  ? 102 VAL D CA  1 
ATOM   5598  C C   . VAL D  2 118 ? 45.267  50.259  146.717 1.00 73.93  ? 102 VAL D C   1 
ATOM   5599  O O   . VAL D  2 118 ? 44.281  49.899  146.063 1.00 73.85  ? 102 VAL D O   1 
ATOM   5600  C CB  . VAL D  2 118 ? 44.703  49.510  149.077 1.00 74.87  ? 102 VAL D CB  1 
ATOM   5601  C CG1 . VAL D  2 118 ? 43.206  49.276  148.928 1.00 74.54  ? 102 VAL D CG1 1 
ATOM   5602  C CG2 . VAL D  2 118 ? 45.512  48.259  148.721 1.00 74.44  ? 102 VAL D CG2 1 
ATOM   5603  N N   . TRP D  2 119 ? 46.499  50.289  146.207 1.00 71.81  ? 103 TRP D N   1 
ATOM   5604  C CA  . TRP D  2 119 ? 46.771  49.935  144.816 1.00 69.39  ? 103 TRP D CA  1 
ATOM   5605  C C   . TRP D  2 119 ? 47.792  48.827  144.675 1.00 66.99  ? 103 TRP D C   1 
ATOM   5606  O O   . TRP D  2 119 ? 48.480  48.494  145.627 1.00 66.57  ? 103 TRP D O   1 
ATOM   5607  C CB  . TRP D  2 119 ? 47.279  51.168  144.056 1.00 70.50  ? 103 TRP D CB  1 
ATOM   5608  C CG  . TRP D  2 119 ? 46.260  52.267  143.907 1.00 71.57  ? 103 TRP D CG  1 
ATOM   5609  C CD1 . TRP D  2 119 ? 45.734  53.054  144.906 1.00 70.91  ? 103 TRP D CD1 1 
ATOM   5610  C CD2 . TRP D  2 119 ? 45.604  52.665  142.693 1.00 70.73  ? 103 TRP D CD2 1 
ATOM   5611  N NE1 . TRP D  2 119 ? 44.790  53.908  144.382 1.00 71.47  ? 103 TRP D NE1 1 
ATOM   5612  C CE2 . TRP D  2 119 ? 44.691  53.692  143.029 1.00 70.91  ? 103 TRP D CE2 1 
ATOM   5613  C CE3 . TRP D  2 119 ? 45.699  52.252  141.359 1.00 68.78  ? 103 TRP D CE3 1 
ATOM   5614  C CZ2 . TRP D  2 119 ? 43.879  54.307  142.075 1.00 69.19  ? 103 TRP D CZ2 1 
ATOM   5615  C CZ3 . TRP D  2 119 ? 44.893  52.863  140.417 1.00 68.70  ? 103 TRP D CZ3 1 
ATOM   5616  C CH2 . TRP D  2 119 ? 43.994  53.879  140.780 1.00 68.75  ? 103 TRP D CH2 1 
ATOM   5617  N N   . GLY D  2 120 ? 47.891  48.274  143.469 1.00 65.10  ? 104 GLY D N   1 
ATOM   5618  C CA  . GLY D  2 120 ? 48.849  47.215  143.200 1.00 63.17  ? 104 GLY D CA  1 
ATOM   5619  C C   . GLY D  2 120 ? 50.228  47.755  142.867 1.00 61.68  ? 104 GLY D C   1 
ATOM   5620  O O   . GLY D  2 120 ? 50.385  48.933  142.588 1.00 61.26  ? 104 GLY D O   1 
ATOM   5621  N N   . GLN D  2 121 ? 51.241  46.901  142.884 1.00 61.28  ? 105 GLN D N   1 
ATOM   5622  C CA  . GLN D  2 121 ? 52.586  47.367  142.590 1.00 61.70  ? 105 GLN D CA  1 
ATOM   5623  C C   . GLN D  2 121 ? 52.722  47.663  141.102 1.00 60.99  ? 105 GLN D C   1 
ATOM   5624  O O   . GLN D  2 121 ? 53.733  48.209  140.660 1.00 62.12  ? 105 GLN D O   1 
ATOM   5625  C CB  . GLN D  2 121 ? 53.642  46.329  143.029 1.00 63.10  ? 105 GLN D CB  1 
ATOM   5626  C CG  . GLN D  2 121 ? 54.042  45.291  141.967 1.00 65.96  ? 105 GLN D CG  1 
ATOM   5627  C CD  . GLN D  2 121 ? 53.451  43.909  142.207 1.00 67.44  ? 105 GLN D CD  1 
ATOM   5628  O OE1 . GLN D  2 121 ? 52.288  43.783  142.585 1.00 69.08  ? 105 GLN D OE1 1 
ATOM   5629  N NE2 . GLN D  2 121 ? 54.247  42.863  141.968 1.00 67.23  ? 105 GLN D NE2 1 
ATOM   5630  N N   . GLY D  2 122 ? 51.702  47.303  140.331 1.00 59.27  ? 106 GLY D N   1 
ATOM   5631  C CA  . GLY D  2 122 ? 51.751  47.543  138.902 1.00 57.87  ? 106 GLY D CA  1 
ATOM   5632  C C   . GLY D  2 122 ? 52.571  46.521  138.123 1.00 57.41  ? 106 GLY D C   1 
ATOM   5633  O O   . GLY D  2 122 ? 53.648  46.085  138.546 1.00 55.63  ? 106 GLY D O   1 
ATOM   5634  N N   . THR D  2 123 ? 52.036  46.137  136.966 1.00 57.53  ? 107 THR D N   1 
ATOM   5635  C CA  . THR D  2 123 ? 52.676  45.176  136.071 1.00 56.62  ? 107 THR D CA  1 
ATOM   5636  C C   . THR D  2 123 ? 52.889  45.917  134.755 1.00 56.70  ? 107 THR D C   1 
ATOM   5637  O O   . THR D  2 123 ? 51.928  46.333  134.099 1.00 55.39  ? 107 THR D O   1 
ATOM   5638  C CB  . THR D  2 123 ? 51.769  43.953  135.821 1.00 55.89  ? 107 THR D CB  1 
ATOM   5639  O OG1 . THR D  2 123 ? 51.389  43.367  137.072 1.00 55.86  ? 107 THR D OG1 1 
ATOM   5640  C CG2 . THR D  2 123 ? 52.494  42.918  134.989 1.00 54.93  ? 107 THR D CG2 1 
ATOM   5641  N N   . THR D  2 124 ? 54.146  46.080  134.359 1.00 56.46  ? 108 THR D N   1 
ATOM   5642  C CA  . THR D  2 124 ? 54.423  46.822  133.144 1.00 55.98  ? 108 THR D CA  1 
ATOM   5643  C C   . THR D  2 124 ? 54.526  45.993  131.857 1.00 55.83  ? 108 THR D C   1 
ATOM   5644  O O   . THR D  2 124 ? 55.578  45.469  131.498 1.00 57.29  ? 108 THR D O   1 
ATOM   5645  C CB  . THR D  2 124 ? 55.680  47.725  133.359 1.00 55.65  ? 108 THR D CB  1 
ATOM   5646  O OG1 . THR D  2 124 ? 55.649  48.819  132.430 1.00 55.35  ? 108 THR D OG1 1 
ATOM   5647  C CG2 . THR D  2 124 ? 56.980  46.924  133.222 1.00 54.52  ? 108 THR D CG2 1 
ATOM   5648  N N   . VAL D  2 125 ? 53.399  45.882  131.171 1.00 55.07  ? 109 VAL D N   1 
ATOM   5649  C CA  . VAL D  2 125 ? 53.307  45.155  129.909 1.00 56.17  ? 109 VAL D CA  1 
ATOM   5650  C C   . VAL D  2 125 ? 53.873  45.992  128.761 1.00 55.52  ? 109 VAL D C   1 
ATOM   5651  O O   . VAL D  2 125 ? 53.583  47.180  128.667 1.00 56.79  ? 109 VAL D O   1 
ATOM   5652  C CB  . VAL D  2 125 ? 51.833  44.840  129.576 1.00 57.67  ? 109 VAL D CB  1 
ATOM   5653  C CG1 . VAL D  2 125 ? 51.681  44.535  128.089 1.00 57.41  ? 109 VAL D CG1 1 
ATOM   5654  C CG2 . VAL D  2 125 ? 51.346  43.677  130.433 1.00 57.99  ? 109 VAL D CG2 1 
ATOM   5655  N N   . THR D  2 126 ? 54.641  45.379  127.866 1.00 54.05  ? 110 THR D N   1 
ATOM   5656  C CA  . THR D  2 126 ? 55.216  46.127  126.753 1.00 51.55  ? 110 THR D CA  1 
ATOM   5657  C C   . THR D  2 126 ? 54.853  45.555  125.381 1.00 50.37  ? 110 THR D C   1 
ATOM   5658  O O   . THR D  2 126 ? 55.723  45.132  124.633 1.00 49.71  ? 110 THR D O   1 
ATOM   5659  C CB  . THR D  2 126 ? 56.737  46.187  126.907 1.00 52.15  ? 110 THR D CB  1 
ATOM   5660  O OG1 . THR D  2 126 ? 57.057  46.824  128.149 1.00 50.62  ? 110 THR D OG1 1 
ATOM   5661  C CG2 . THR D  2 126 ? 57.371  46.965  125.770 1.00 53.31  ? 110 THR D CG2 1 
ATOM   5662  N N   . VAL D  2 127 ? 53.561  45.562  125.063 1.00 49.93  ? 111 VAL D N   1 
ATOM   5663  C CA  . VAL D  2 127 ? 53.044  45.056  123.796 1.00 49.91  ? 111 VAL D CA  1 
ATOM   5664  C C   . VAL D  2 127 ? 53.828  45.523  122.596 1.00 50.75  ? 111 VAL D C   1 
ATOM   5665  O O   . VAL D  2 127 ? 53.642  46.637  122.118 1.00 52.07  ? 111 VAL D O   1 
ATOM   5666  C CB  . VAL D  2 127 ? 51.588  45.479  123.551 1.00 49.99  ? 111 VAL D CB  1 
ATOM   5667  C CG1 . VAL D  2 127 ? 51.255  45.357  122.071 1.00 49.85  ? 111 VAL D CG1 1 
ATOM   5668  C CG2 . VAL D  2 127 ? 50.658  44.603  124.345 1.00 51.06  ? 111 VAL D CG2 1 
ATOM   5669  N N   . ALA D  2 128 ? 54.679  44.643  122.090 1.00 51.08  ? 112 ALA D N   1 
ATOM   5670  C CA  . ALA D  2 128 ? 55.504  44.934  120.932 1.00 50.54  ? 112 ALA D CA  1 
ATOM   5671  C C   . ALA D  2 128 ? 55.936  43.613  120.280 1.00 50.73  ? 112 ALA D C   1 
ATOM   5672  O O   . ALA D  2 128 ? 55.730  42.530  120.836 1.00 51.27  ? 112 ALA D O   1 
ATOM   5673  C CB  . ALA D  2 128 ? 56.732  45.735  121.369 1.00 49.34  ? 112 ALA D CB  1 
ATOM   5674  N N   . SER D  2 129 ? 56.510  43.700  119.087 1.00 49.76  ? 113 SER D N   1 
ATOM   5675  C CA  . SER D  2 129 ? 56.999  42.513  118.421 1.00 48.59  ? 113 SER D CA  1 
ATOM   5676  C C   . SER D  2 129 ? 58.512  42.587  118.545 1.00 48.22  ? 113 SER D C   1 
ATOM   5677  O O   . SER D  2 129 ? 59.165  41.587  118.805 1.00 48.33  ? 113 SER D O   1 
ATOM   5678  C CB  . SER D  2 129 ? 56.571  42.488  116.950 1.00 49.19  ? 113 SER D CB  1 
ATOM   5679  O OG  . SER D  2 129 ? 57.213  43.487  116.182 1.00 50.57  ? 113 SER D OG  1 
ATOM   5680  N N   . ALA D  2 130 ? 59.056  43.789  118.388 1.00 48.15  ? 114 ALA D N   1 
ATOM   5681  C CA  . ALA D  2 130 ? 60.493  44.018  118.491 1.00 49.87  ? 114 ALA D CA  1 
ATOM   5682  C C   . ALA D  2 130 ? 61.194  42.977  119.377 1.00 50.44  ? 114 ALA D C   1 
ATOM   5683  O O   . ALA D  2 130 ? 60.761  42.710  120.492 1.00 51.28  ? 114 ALA D O   1 
ATOM   5684  C CB  . ALA D  2 130 ? 60.740  45.417  119.034 1.00 50.31  ? 114 ALA D CB  1 
ATOM   5685  N N   . SER D  2 131 ? 62.281  42.392  118.886 1.00 50.68  ? 115 SER D N   1 
ATOM   5686  C CA  . SER D  2 131 ? 63.001  41.379  119.659 1.00 50.66  ? 115 SER D CA  1 
ATOM   5687  C C   . SER D  2 131 ? 64.195  41.975  120.397 1.00 49.08  ? 115 SER D C   1 
ATOM   5688  O O   . SER D  2 131 ? 65.113  42.472  119.754 1.00 50.55  ? 115 SER D O   1 
ATOM   5689  C CB  . SER D  2 131 ? 63.487  40.256  118.731 1.00 52.36  ? 115 SER D CB  1 
ATOM   5690  O OG  . SER D  2 131 ? 64.005  39.157  119.470 1.00 53.48  ? 115 SER D OG  1 
ATOM   5691  N N   . THR D  2 132 ? 64.175  41.897  121.733 1.00 46.26  ? 116 THR D N   1 
ATOM   5692  C CA  . THR D  2 132 ? 65.232  42.419  122.619 1.00 43.78  ? 116 THR D CA  1 
ATOM   5693  C C   . THR D  2 132 ? 66.577  42.733  121.965 1.00 42.41  ? 116 THR D C   1 
ATOM   5694  O O   . THR D  2 132 ? 67.220  41.864  121.368 1.00 42.91  ? 116 THR D O   1 
ATOM   5695  C CB  . THR D  2 132 ? 65.477  41.463  123.834 1.00 43.74  ? 116 THR D CB  1 
ATOM   5696  O OG1 . THR D  2 132 ? 64.494  41.717  124.849 1.00 45.36  ? 116 THR D OG1 1 
ATOM   5697  C CG2 . THR D  2 132 ? 66.869  41.672  124.434 1.00 42.21  ? 116 THR D CG2 1 
ATOM   5698  N N   . LYS D  2 133 ? 67.002  43.985  122.093 1.00 39.84  ? 117 LYS D N   1 
ATOM   5699  C CA  . LYS D  2 133 ? 68.253  44.414  121.500 1.00 38.97  ? 117 LYS D CA  1 
ATOM   5700  C C   . LYS D  2 133 ? 69.034  45.311  122.428 1.00 38.25  ? 117 LYS D C   1 
ATOM   5701  O O   . LYS D  2 133 ? 68.450  46.113  123.160 1.00 37.18  ? 117 LYS D O   1 
ATOM   5702  C CB  . LYS D  2 133 ? 67.987  45.167  120.198 1.00 39.26  ? 117 LYS D CB  1 
ATOM   5703  C CG  . LYS D  2 133 ? 69.243  45.692  119.509 1.00 40.65  ? 117 LYS D CG  1 
ATOM   5704  C CD  . LYS D  2 133 ? 70.115  44.568  118.943 1.00 40.55  ? 117 LYS D CD  1 
ATOM   5705  C CE  . LYS D  2 133 ? 71.537  45.051  118.570 1.00 39.12  ? 117 LYS D CE  1 
ATOM   5706  N NZ  . LYS D  2 133 ? 72.496  45.030  119.720 1.00 36.18  ? 117 LYS D NZ  1 
ATOM   5707  N N   . GLY D  2 134 ? 70.357  45.158  122.405 1.00 36.93  ? 118 GLY D N   1 
ATOM   5708  C CA  . GLY D  2 134 ? 71.206  46.002  123.222 1.00 37.20  ? 118 GLY D CA  1 
ATOM   5709  C C   . GLY D  2 134 ? 71.175  47.321  122.476 1.00 37.52  ? 118 GLY D C   1 
ATOM   5710  O O   . GLY D  2 134 ? 70.752  47.324  121.323 1.00 38.60  ? 118 GLY D O   1 
ATOM   5711  N N   . PRO D  2 135 ? 71.608  48.450  123.059 1.00 36.68  ? 119 PRO D N   1 
ATOM   5712  C CA  . PRO D  2 135 ? 71.528  49.669  122.253 1.00 36.07  ? 119 PRO D CA  1 
ATOM   5713  C C   . PRO D  2 135 ? 72.772  49.933  121.430 1.00 35.95  ? 119 PRO D C   1 
ATOM   5714  O O   . PRO D  2 135 ? 73.629  49.067  121.276 1.00 35.74  ? 119 PRO D O   1 
ATOM   5715  C CB  . PRO D  2 135 ? 71.311  50.739  123.299 1.00 35.96  ? 119 PRO D CB  1 
ATOM   5716  C CG  . PRO D  2 135 ? 72.246  50.258  124.389 1.00 37.31  ? 119 PRO D CG  1 
ATOM   5717  C CD  . PRO D  2 135 ? 71.984  48.759  124.449 1.00 36.30  ? 119 PRO D CD  1 
ATOM   5718  N N   . SER D  2 136 ? 72.830  51.148  120.889 1.00 36.52  ? 120 SER D N   1 
ATOM   5719  C CA  . SER D  2 136 ? 73.953  51.660  120.090 1.00 35.50  ? 120 SER D CA  1 
ATOM   5720  C C   . SER D  2 136 ? 74.188  53.046  120.694 1.00 35.87  ? 120 SER D C   1 
ATOM   5721  O O   . SER D  2 136 ? 73.340  53.938  120.573 1.00 37.95  ? 120 SER D O   1 
ATOM   5722  C CB  . SER D  2 136 ? 73.576  51.787  118.598 1.00 33.54  ? 120 SER D CB  1 
ATOM   5723  O OG  . SER D  2 136 ? 73.877  50.614  117.874 1.00 28.06  ? 120 SER D OG  1 
ATOM   5724  N N   . VAL D  2 137 ? 75.314  53.228  121.372 1.00 35.00  ? 121 VAL D N   1 
ATOM   5725  C CA  . VAL D  2 137 ? 75.595  54.511  122.008 1.00 34.25  ? 121 VAL D CA  1 
ATOM   5726  C C   . VAL D  2 137 ? 76.476  55.329  121.126 1.00 34.41  ? 121 VAL D C   1 
ATOM   5727  O O   . VAL D  2 137 ? 77.549  54.888  120.757 1.00 36.49  ? 121 VAL D O   1 
ATOM   5728  C CB  . VAL D  2 137 ? 76.308  54.330  123.328 1.00 34.34  ? 121 VAL D CB  1 
ATOM   5729  C CG1 . VAL D  2 137 ? 76.457  55.667  124.006 1.00 35.09  ? 121 VAL D CG1 1 
ATOM   5730  C CG2 . VAL D  2 137 ? 75.533  53.339  124.193 1.00 35.03  ? 121 VAL D CG2 1 
ATOM   5731  N N   . PHE D  2 138 ? 76.023  56.521  120.776 1.00 34.31  ? 122 PHE D N   1 
ATOM   5732  C CA  . PHE D  2 138 ? 76.803  57.400  119.913 1.00 33.39  ? 122 PHE D CA  1 
ATOM   5733  C C   . PHE D  2 138 ? 77.187  58.628  120.703 1.00 33.92  ? 122 PHE D C   1 
ATOM   5734  O O   . PHE D  2 138 ? 76.555  58.942  121.705 1.00 36.94  ? 122 PHE D O   1 
ATOM   5735  C CB  . PHE D  2 138 ? 75.989  57.790  118.685 1.00 30.30  ? 122 PHE D CB  1 
ATOM   5736  C CG  . PHE D  2 138 ? 75.840  56.684  117.696 1.00 28.17  ? 122 PHE D CG  1 
ATOM   5737  C CD1 . PHE D  2 138 ? 76.934  56.246  116.966 1.00 26.18  ? 122 PHE D CD1 1 
ATOM   5738  C CD2 . PHE D  2 138 ? 74.605  56.073  117.491 1.00 28.32  ? 122 PHE D CD2 1 
ATOM   5739  C CE1 . PHE D  2 138 ? 76.810  55.230  116.055 1.00 24.07  ? 122 PHE D CE1 1 
ATOM   5740  C CE2 . PHE D  2 138 ? 74.472  55.046  116.574 1.00 26.12  ? 122 PHE D CE2 1 
ATOM   5741  C CZ  . PHE D  2 138 ? 75.581  54.625  115.854 1.00 25.46  ? 122 PHE D CZ  1 
ATOM   5742  N N   . PRO D  2 139 ? 78.234  59.331  120.275 1.00 33.26  ? 123 PRO D N   1 
ATOM   5743  C CA  . PRO D  2 139 ? 78.636  60.521  121.017 1.00 33.80  ? 123 PRO D CA  1 
ATOM   5744  C C   . PRO D  2 139 ? 78.272  61.894  120.446 1.00 34.59  ? 123 PRO D C   1 
ATOM   5745  O O   . PRO D  2 139 ? 78.834  62.310  119.444 1.00 34.19  ? 123 PRO D O   1 
ATOM   5746  C CB  . PRO D  2 139 ? 80.136  60.341  121.106 1.00 33.96  ? 123 PRO D CB  1 
ATOM   5747  C CG  . PRO D  2 139 ? 80.450  59.793  119.761 1.00 32.13  ? 123 PRO D CG  1 
ATOM   5748  C CD  . PRO D  2 139 ? 79.377  58.771  119.532 1.00 32.26  ? 123 PRO D CD  1 
ATOM   5749  N N   . LEU D  2 140 ? 77.351  62.606  121.087 1.00 35.33  ? 124 LEU D N   1 
ATOM   5750  C CA  . LEU D  2 140 ? 77.012  63.952  120.631 1.00 36.68  ? 124 LEU D CA  1 
ATOM   5751  C C   . LEU D  2 140 ? 78.263  64.762  120.997 1.00 38.67  ? 124 LEU D C   1 
ATOM   5752  O O   . LEU D  2 140 ? 78.425  65.195  122.133 1.00 38.07  ? 124 LEU D O   1 
ATOM   5753  C CB  . LEU D  2 140 ? 75.815  64.512  121.403 1.00 36.20  ? 124 LEU D CB  1 
ATOM   5754  C CG  . LEU D  2 140 ? 74.612  63.635  121.749 1.00 35.20  ? 124 LEU D CG  1 
ATOM   5755  C CD1 . LEU D  2 140 ? 73.872  64.232  122.915 1.00 32.19  ? 124 LEU D CD1 1 
ATOM   5756  C CD2 . LEU D  2 140 ? 73.707  63.494  120.554 1.00 36.70  ? 124 LEU D CD2 1 
ATOM   5757  N N   . ALA D  2 141 ? 79.153  64.955  120.035 1.00 42.18  ? 125 ALA D N   1 
ATOM   5758  C CA  . ALA D  2 141 ? 80.400  65.680  120.280 1.00 46.17  ? 125 ALA D CA  1 
ATOM   5759  C C   . ALA D  2 141 ? 80.246  67.167  120.612 1.00 48.85  ? 125 ALA D C   1 
ATOM   5760  O O   . ALA D  2 141 ? 79.424  67.853  120.012 1.00 50.08  ? 125 ALA D O   1 
ATOM   5761  C CB  . ALA D  2 141 ? 81.334  65.516  119.068 1.00 45.20  ? 125 ALA D CB  1 
ATOM   5762  N N   . PRO D  2 142 ? 81.045  67.679  121.577 1.00 51.26  ? 126 PRO D N   1 
ATOM   5763  C CA  . PRO D  2 142 ? 81.014  69.087  121.990 1.00 53.55  ? 126 PRO D CA  1 
ATOM   5764  C C   . PRO D  2 142 ? 81.761  69.834  120.907 1.00 56.19  ? 126 PRO D C   1 
ATOM   5765  O O   . PRO D  2 142 ? 82.722  69.306  120.345 1.00 56.00  ? 126 PRO D O   1 
ATOM   5766  C CB  . PRO D  2 142 ? 81.806  69.109  123.296 1.00 52.51  ? 126 PRO D CB  1 
ATOM   5767  C CG  . PRO D  2 142 ? 82.003  67.667  123.650 1.00 53.27  ? 126 PRO D CG  1 
ATOM   5768  C CD  . PRO D  2 142 ? 82.062  66.955  122.347 1.00 51.98  ? 126 PRO D CD  1 
ATOM   5769  N N   . SER D  2 143 ? 81.338  71.056  120.617 1.00 60.03  ? 127 SER D N   1 
ATOM   5770  C CA  . SER D  2 143 ? 81.986  71.829  119.569 1.00 64.07  ? 127 SER D CA  1 
ATOM   5771  C C   . SER D  2 143 ? 81.934  73.326  119.828 1.00 66.94  ? 127 SER D C   1 
ATOM   5772  O O   . SER D  2 143 ? 82.185  73.789  120.947 1.00 65.94  ? 127 SER D O   1 
ATOM   5773  C CB  . SER D  2 143 ? 81.352  71.498  118.188 1.00 63.61  ? 127 SER D CB  1 
ATOM   5774  O OG  . SER D  2 143 ? 79.929  71.596  118.181 1.00 60.32  ? 127 SER D OG  1 
ATOM   5775  N N   . SER D  2 144 ? 81.607  74.058  118.762 1.00 70.97  ? 128 SER D N   1 
ATOM   5776  C CA  . SER D  2 144 ? 81.481  75.518  118.749 1.00 73.72  ? 128 SER D CA  1 
ATOM   5777  C C   . SER D  2 144 ? 79.998  75.891  118.597 1.00 75.28  ? 128 SER D C   1 
ATOM   5778  O O   . SER D  2 144 ? 79.581  77.024  118.880 1.00 74.88  ? 128 SER D O   1 
ATOM   5779  C CB  . SER D  2 144 ? 82.283  76.071  117.569 1.00 73.83  ? 128 SER D CB  1 
ATOM   5780  O OG  . SER D  2 144 ? 82.020  75.307  116.396 1.00 73.05  ? 128 SER D OG  1 
ATOM   5781  N N   . LYS D  2 145 ? 79.221  74.907  118.144 1.00 77.26  ? 129 LYS D N   1 
ATOM   5782  C CA  . LYS D  2 145 ? 77.783  75.038  117.928 1.00 78.69  ? 129 LYS D CA  1 
ATOM   5783  C C   . LYS D  2 145 ? 77.036  74.719  119.233 1.00 79.13  ? 129 LYS D C   1 
ATOM   5784  O O   . LYS D  2 145 ? 75.801  74.642  119.255 1.00 78.47  ? 129 LYS D O   1 
ATOM   5785  C CB  . LYS D  2 145 ? 77.345  74.061  116.835 1.00 79.20  ? 129 LYS D CB  1 
ATOM   5786  C CG  . LYS D  2 145 ? 78.173  74.128  115.553 1.00 79.53  ? 129 LYS D CG  1 
ATOM   5787  C CD  . LYS D  2 145 ? 77.853  75.368  114.735 1.00 80.39  ? 129 LYS D CD  1 
ATOM   5788  C CE  . LYS D  2 145 ? 78.448  75.269  113.338 1.00 81.47  ? 129 LYS D CE  1 
ATOM   5789  N NZ  . LYS D  2 145 ? 77.849  76.270  112.411 1.00 82.24  ? 129 LYS D NZ  1 
ATOM   5790  N N   . SER D  2 146 ? 77.802  74.530  120.311 1.00 79.68  ? 130 SER D N   1 
ATOM   5791  C CA  . SER D  2 146 ? 77.240  74.216  121.622 1.00 79.31  ? 130 SER D CA  1 
ATOM   5792  C C   . SER D  2 146 ? 78.080  74.704  122.814 1.00 78.75  ? 130 SER D C   1 
ATOM   5793  O O   . SER D  2 146 ? 78.582  73.894  123.587 1.00 78.00  ? 130 SER D O   1 
ATOM   5794  C CB  . SER D  2 146 ? 77.013  72.699  121.753 1.00 79.44  ? 130 SER D CB  1 
ATOM   5795  O OG  . SER D  2 146 ? 78.179  72.014  122.172 1.00 77.33  ? 130 SER D OG  1 
ATOM   5796  N N   . THR D  2 147 ? 78.215  76.021  122.972 1.00 78.72  ? 131 THR D N   1 
ATOM   5797  C CA  . THR D  2 147 ? 78.981  76.569  124.091 1.00 79.46  ? 131 THR D CA  1 
ATOM   5798  C C   . THR D  2 147 ? 78.344  77.846  124.660 1.00 80.05  ? 131 THR D C   1 
ATOM   5799  O O   . THR D  2 147 ? 78.260  78.854  123.960 1.00 80.70  ? 131 THR D O   1 
ATOM   5800  C CB  . THR D  2 147 ? 80.431  76.898  123.674 1.00 79.35  ? 131 THR D CB  1 
ATOM   5801  O OG1 . THR D  2 147 ? 80.481  78.216  123.117 1.00 79.14  ? 131 THR D OG1 1 
ATOM   5802  C CG2 . THR D  2 147 ? 80.932  75.895  122.639 1.00 79.23  ? 131 THR D CG2 1 
ATOM   5803  N N   . SER D  2 148 ? 77.912  77.791  125.929 1.00 80.17  ? 132 SER D N   1 
ATOM   5804  C CA  . SER D  2 148 ? 77.272  78.920  126.644 1.00 79.33  ? 132 SER D CA  1 
ATOM   5805  C C   . SER D  2 148 ? 78.251  79.701  127.559 1.00 78.30  ? 132 SER D C   1 
ATOM   5806  O O   . SER D  2 148 ? 78.120  79.695  128.796 1.00 78.43  ? 132 SER D O   1 
ATOM   5807  C CB  . SER D  2 148 ? 76.082  78.395  127.482 1.00 80.16  ? 132 SER D CB  1 
ATOM   5808  O OG  . SER D  2 148 ? 75.426  79.419  128.224 1.00 79.86  ? 132 SER D OG  1 
ATOM   5809  N N   . GLY D  2 149 ? 79.215  80.385  126.938 1.00 76.36  ? 133 GLY D N   1 
ATOM   5810  C CA  . GLY D  2 149 ? 80.206  81.154  127.678 1.00 72.90  ? 133 GLY D CA  1 
ATOM   5811  C C   . GLY D  2 149 ? 81.395  80.273  127.995 1.00 70.23  ? 133 GLY D C   1 
ATOM   5812  O O   . GLY D  2 149 ? 82.203  79.947  127.116 1.00 70.50  ? 133 GLY D O   1 
ATOM   5813  N N   . GLY D  2 150 ? 81.509  79.897  129.263 1.00 66.62  ? 134 GLY D N   1 
ATOM   5814  C CA  . GLY D  2 150 ? 82.576  79.008  129.671 1.00 61.31  ? 134 GLY D CA  1 
ATOM   5815  C C   . GLY D  2 150 ? 81.898  77.678  129.918 1.00 57.47  ? 134 GLY D C   1 
ATOM   5816  O O   . GLY D  2 150 ? 82.320  76.897  130.757 1.00 57.66  ? 134 GLY D O   1 
ATOM   5817  N N   . THR D  2 151 ? 80.834  77.425  129.165 1.00 53.96  ? 135 THR D N   1 
ATOM   5818  C CA  . THR D  2 151 ? 80.060  76.208  129.322 1.00 50.71  ? 135 THR D CA  1 
ATOM   5819  C C   . THR D  2 151 ? 79.794  75.466  128.020 1.00 47.21  ? 135 THR D C   1 
ATOM   5820  O O   . THR D  2 151 ? 79.329  76.047  127.058 1.00 45.65  ? 135 THR D O   1 
ATOM   5821  C CB  . THR D  2 151 ? 78.706  76.524  129.991 1.00 51.78  ? 135 THR D CB  1 
ATOM   5822  O OG1 . THR D  2 151 ? 78.929  77.005  131.323 1.00 51.79  ? 135 THR D OG1 1 
ATOM   5823  C CG2 . THR D  2 151 ? 77.827  75.281  130.045 1.00 53.68  ? 135 THR D CG2 1 
ATOM   5824  N N   . ALA D  2 152 ? 80.076  74.166  128.013 1.00 44.89  ? 136 ALA D N   1 
ATOM   5825  C CA  . ALA D  2 152 ? 79.862  73.333  126.834 1.00 42.92  ? 136 ALA D CA  1 
ATOM   5826  C C   . ALA D  2 152 ? 78.837  72.244  127.098 1.00 41.77  ? 136 ALA D C   1 
ATOM   5827  O O   . ALA D  2 152 ? 78.665  71.802  128.231 1.00 43.04  ? 136 ALA D O   1 
ATOM   5828  C CB  . ALA D  2 152 ? 81.164  72.700  126.403 1.00 42.22  ? 136 ALA D CB  1 
ATOM   5829  N N   . ALA D  2 153 ? 78.147  71.821  126.048 1.00 39.41  ? 137 ALA D N   1 
ATOM   5830  C CA  . ALA D  2 153 ? 77.159  70.769  126.173 1.00 37.56  ? 137 ALA D CA  1 
ATOM   5831  C C   . ALA D  2 153 ? 77.626  69.603  125.323 1.00 37.17  ? 137 ALA D C   1 
ATOM   5832  O O   . ALA D  2 153 ? 78.129  69.798  124.209 1.00 36.85  ? 137 ALA D O   1 
ATOM   5833  C CB  . ALA D  2 153 ? 75.816  71.251  125.704 1.00 36.23  ? 137 ALA D CB  1 
ATOM   5834  N N   . LEU D  2 154 ? 77.475  68.396  125.865 1.00 35.51  ? 138 LEU D N   1 
ATOM   5835  C CA  . LEU D  2 154 ? 77.877  67.172  125.181 1.00 34.03  ? 138 LEU D CA  1 
ATOM   5836  C C   . LEU D  2 154 ? 76.996  66.067  125.668 1.00 31.81  ? 138 LEU D C   1 
ATOM   5837  O O   . LEU D  2 154 ? 76.119  66.300  126.477 1.00 29.99  ? 138 LEU D O   1 
ATOM   5838  C CB  . LEU D  2 154 ? 79.336  66.825  125.491 1.00 35.22  ? 138 LEU D CB  1 
ATOM   5839  C CG  . LEU D  2 154 ? 79.756  66.815  126.970 1.00 36.29  ? 138 LEU D CG  1 
ATOM   5840  C CD1 . LEU D  2 154 ? 78.828  65.898  127.773 1.00 36.28  ? 138 LEU D CD1 1 
ATOM   5841  C CD2 . LEU D  2 154 ? 81.206  66.368  127.095 1.00 33.77  ? 138 LEU D CD2 1 
ATOM   5842  N N   . GLY D  2 155 ? 77.248  64.856  125.202 1.00 31.18  ? 139 GLY D N   1 
ATOM   5843  C CA  . GLY D  2 155 ? 76.412  63.776  125.652 1.00 33.33  ? 139 GLY D CA  1 
ATOM   5844  C C   . GLY D  2 155 ? 76.568  62.428  124.999 1.00 33.56  ? 139 GLY D C   1 
ATOM   5845  O O   . GLY D  2 155 ? 77.657  61.991  124.658 1.00 33.41  ? 139 GLY D O   1 
ATOM   5846  N N   . CYS D  2 156 ? 75.432  61.777  124.818 1.00 34.59  ? 140 CYS D N   1 
ATOM   5847  C CA  . CYS D  2 156 ? 75.381  60.458  124.235 1.00 36.71  ? 140 CYS D CA  1 
ATOM   5848  C C   . CYS D  2 156 ? 74.061  60.183  123.519 1.00 35.22  ? 140 CYS D C   1 
ATOM   5849  O O   . CYS D  2 156 ? 73.009  60.656  123.920 1.00 35.48  ? 140 CYS D O   1 
ATOM   5850  C CB  . CYS D  2 156 ? 75.641  59.435  125.352 1.00 41.00  ? 140 CYS D CB  1 
ATOM   5851  S SG  . CYS D  2 156 ? 77.390  59.511  125.831 1.00 49.32  ? 140 CYS D SG  1 
ATOM   5852  N N   . LEU D  2 157 ? 74.121  59.457  122.421 1.00 33.40  ? 141 LEU D N   1 
ATOM   5853  C CA  . LEU D  2 157 ? 72.900  59.118  121.736 1.00 35.53  ? 141 LEU D CA  1 
ATOM   5854  C C   . LEU D  2 157 ? 72.759  57.608  121.961 1.00 37.18  ? 141 LEU D C   1 
ATOM   5855  O O   . LEU D  2 157 ? 73.430  56.786  121.316 1.00 37.12  ? 141 LEU D O   1 
ATOM   5856  C CB  . LEU D  2 157 ? 72.961  59.467  120.228 1.00 33.92  ? 141 LEU D CB  1 
ATOM   5857  C CG  . LEU D  2 157 ? 71.757  59.006  119.368 1.00 31.05  ? 141 LEU D CG  1 
ATOM   5858  C CD1 . LEU D  2 157 ? 70.450  59.501  119.987 1.00 30.42  ? 141 LEU D CD1 1 
ATOM   5859  C CD2 . LEU D  2 157 ? 71.893  59.484  117.950 1.00 25.56  ? 141 LEU D CD2 1 
ATOM   5860  N N   . VAL D  2 158 ? 71.904  57.257  122.915 1.00 36.63  ? 142 VAL D N   1 
ATOM   5861  C CA  . VAL D  2 158 ? 71.661  55.864  123.258 1.00 35.91  ? 142 VAL D CA  1 
ATOM   5862  C C   . VAL D  2 158 ? 70.528  55.473  122.345 1.00 34.83  ? 142 VAL D C   1 
ATOM   5863  O O   . VAL D  2 158 ? 69.370  55.678  122.658 1.00 35.57  ? 142 VAL D O   1 
ATOM   5864  C CB  . VAL D  2 158 ? 71.249  55.750  124.750 1.00 36.57  ? 142 VAL D CB  1 
ATOM   5865  C CG1 . VAL D  2 158 ? 71.021  54.298  125.137 1.00 35.02  ? 142 VAL D CG1 1 
ATOM   5866  C CG2 . VAL D  2 158 ? 72.328  56.386  125.625 1.00 34.27  ? 142 VAL D CG2 1 
ATOM   5867  N N   . LYS D  2 159 ? 70.875  54.892  121.214 1.00 35.15  ? 143 LYS D N   1 
ATOM   5868  C CA  . LYS D  2 159 ? 69.882  54.549  120.207 1.00 37.01  ? 143 LYS D CA  1 
ATOM   5869  C C   . LYS D  2 159 ? 69.561  53.070  119.909 1.00 39.03  ? 143 LYS D C   1 
ATOM   5870  O O   . LYS D  2 159 ? 70.389  52.173  120.074 1.00 39.38  ? 143 LYS D O   1 
ATOM   5871  C CB  . LYS D  2 159 ? 70.296  55.254  118.908 1.00 34.10  ? 143 LYS D CB  1 
ATOM   5872  C CG  . LYS D  2 159 ? 69.266  55.271  117.815 1.00 30.85  ? 143 LYS D CG  1 
ATOM   5873  C CD  . LYS D  2 159 ? 69.839  55.920  116.582 1.00 31.52  ? 143 LYS D CD  1 
ATOM   5874  C CE  . LYS D  2 159 ? 68.786  56.060  115.518 1.00 31.45  ? 143 LYS D CE  1 
ATOM   5875  N NZ  . LYS D  2 159 ? 67.592  56.741  116.095 1.00 31.35  ? 143 LYS D NZ  1 
ATOM   5876  N N   . ASP D  2 160 ? 68.325  52.847  119.475 1.00 40.89  ? 144 ASP D N   1 
ATOM   5877  C CA  . ASP D  2 160 ? 67.835  51.538  119.057 1.00 42.97  ? 144 ASP D CA  1 
ATOM   5878  C C   . ASP D  2 160 ? 67.999  50.370  120.011 1.00 43.88  ? 144 ASP D C   1 
ATOM   5879  O O   . ASP D  2 160 ? 68.977  49.639  119.925 1.00 44.63  ? 144 ASP D O   1 
ATOM   5880  C CB  . ASP D  2 160 ? 68.493  51.137  117.719 1.00 43.73  ? 144 ASP D CB  1 
ATOM   5881  C CG  . ASP D  2 160 ? 68.226  52.135  116.581 1.00 43.43  ? 144 ASP D CG  1 
ATOM   5882  O OD1 . ASP D  2 160 ? 67.036  52.422  116.280 1.00 42.47  ? 144 ASP D OD1 1 
ATOM   5883  O OD2 . ASP D  2 160 ? 69.220  52.612  115.979 1.00 41.58  ? 144 ASP D OD2 1 
ATOM   5884  N N   . TYR D  2 161 ? 67.033  50.163  120.893 1.00 45.82  ? 145 TYR D N   1 
ATOM   5885  C CA  . TYR D  2 161 ? 67.112  49.036  121.813 1.00 47.22  ? 145 TYR D CA  1 
ATOM   5886  C C   . TYR D  2 161 ? 65.732  48.662  122.338 1.00 47.69  ? 145 TYR D C   1 
ATOM   5887  O O   . TYR D  2 161 ? 64.826  49.490  122.391 1.00 47.65  ? 145 TYR D O   1 
ATOM   5888  C CB  . TYR D  2 161 ? 68.040  49.358  122.987 1.00 47.40  ? 145 TYR D CB  1 
ATOM   5889  C CG  . TYR D  2 161 ? 67.499  50.433  123.882 1.00 50.75  ? 145 TYR D CG  1 
ATOM   5890  C CD1 . TYR D  2 161 ? 66.324  50.238  124.600 1.00 52.64  ? 145 TYR D CD1 1 
ATOM   5891  C CD2 . TYR D  2 161 ? 68.112  51.681  123.953 1.00 53.07  ? 145 TYR D CD2 1 
ATOM   5892  C CE1 . TYR D  2 161 ? 65.759  51.262  125.360 1.00 54.91  ? 145 TYR D CE1 1 
ATOM   5893  C CE2 . TYR D  2 161 ? 67.555  52.722  124.712 1.00 54.46  ? 145 TYR D CE2 1 
ATOM   5894  C CZ  . TYR D  2 161 ? 66.376  52.506  125.410 1.00 54.69  ? 145 TYR D CZ  1 
ATOM   5895  O OH  . TYR D  2 161 ? 65.800  53.526  126.137 1.00 54.24  ? 145 TYR D OH  1 
ATOM   5896  N N   . PHE D  2 162 ? 65.587  47.399  122.721 1.00 48.62  ? 146 PHE D N   1 
ATOM   5897  C CA  . PHE D  2 162 ? 64.346  46.882  123.278 1.00 48.23  ? 146 PHE D CA  1 
ATOM   5898  C C   . PHE D  2 162 ? 64.720  45.799  124.285 1.00 46.36  ? 146 PHE D C   1 
ATOM   5899  O O   . PHE D  2 162 ? 65.637  45.027  124.045 1.00 46.88  ? 146 PHE D O   1 
ATOM   5900  C CB  . PHE D  2 162 ? 63.474  46.271  122.184 1.00 51.55  ? 146 PHE D CB  1 
ATOM   5901  C CG  . PHE D  2 162 ? 62.136  45.775  122.677 1.00 54.79  ? 146 PHE D CG  1 
ATOM   5902  C CD1 . PHE D  2 162 ? 61.031  46.617  122.700 1.00 55.67  ? 146 PHE D CD1 1 
ATOM   5903  C CD2 . PHE D  2 162 ? 61.985  44.463  123.119 1.00 55.79  ? 146 PHE D CD2 1 
ATOM   5904  C CE1 . PHE D  2 162 ? 59.791  46.158  123.154 1.00 56.76  ? 146 PHE D CE1 1 
ATOM   5905  C CE2 . PHE D  2 162 ? 60.752  43.996  123.575 1.00 56.40  ? 146 PHE D CE2 1 
ATOM   5906  C CZ  . PHE D  2 162 ? 59.652  44.847  123.591 1.00 56.92  ? 146 PHE D CZ  1 
ATOM   5907  N N   . PRO D  2 163 ? 64.050  45.769  125.447 1.00 44.13  ? 147 PRO D N   1 
ATOM   5908  C CA  . PRO D  2 163 ? 62.995  46.710  125.811 1.00 42.96  ? 147 PRO D CA  1 
ATOM   5909  C C   . PRO D  2 163 ? 63.588  47.693  126.789 1.00 42.30  ? 147 PRO D C   1 
ATOM   5910  O O   . PRO D  2 163 ? 64.785  47.652  127.067 1.00 40.63  ? 147 PRO D O   1 
ATOM   5911  C CB  . PRO D  2 163 ? 61.977  45.818  126.479 1.00 42.63  ? 147 PRO D CB  1 
ATOM   5912  C CG  . PRO D  2 163 ? 62.847  44.945  127.276 1.00 42.06  ? 147 PRO D CG  1 
ATOM   5913  C CD  . PRO D  2 163 ? 63.971  44.579  126.305 1.00 42.82  ? 147 PRO D CD  1 
ATOM   5914  N N   . GLU D  2 164 ? 62.760  48.587  127.305 1.00 43.18  ? 148 GLU D N   1 
ATOM   5915  C CA  . GLU D  2 164 ? 63.246  49.534  128.296 1.00 44.93  ? 148 GLU D CA  1 
ATOM   5916  C C   . GLU D  2 164 ? 63.674  48.656  129.464 1.00 46.26  ? 148 GLU D C   1 
ATOM   5917  O O   . GLU D  2 164 ? 63.405  47.460  129.468 1.00 47.90  ? 148 GLU D O   1 
ATOM   5918  C CB  . GLU D  2 164 ? 62.115  50.453  128.742 1.00 43.41  ? 148 GLU D CB  1 
ATOM   5919  C CG  . GLU D  2 164 ? 61.825  51.585  127.808 1.00 43.00  ? 148 GLU D CG  1 
ATOM   5920  C CD  . GLU D  2 164 ? 62.423  52.880  128.297 1.00 43.59  ? 148 GLU D CD  1 
ATOM   5921  O OE1 . GLU D  2 164 ? 63.673  52.994  128.391 1.00 42.05  ? 148 GLU D OE1 1 
ATOM   5922  O OE2 . GLU D  2 164 ? 61.624  53.787  128.595 1.00 44.21  ? 148 GLU D OE2 1 
ATOM   5923  N N   . PRO D  2 165 ? 64.382  49.214  130.448 1.00 46.98  ? 149 PRO D N   1 
ATOM   5924  C CA  . PRO D  2 165 ? 64.822  50.600  130.555 1.00 46.43  ? 149 PRO D CA  1 
ATOM   5925  C C   . PRO D  2 165 ? 66.333  50.611  130.351 1.00 44.91  ? 149 PRO D C   1 
ATOM   5926  O O   . PRO D  2 165 ? 66.937  49.566  130.102 1.00 43.78  ? 149 PRO D O   1 
ATOM   5927  C CB  . PRO D  2 165 ? 64.435  50.952  131.977 1.00 46.81  ? 149 PRO D CB  1 
ATOM   5928  C CG  . PRO D  2 165 ? 64.824  49.691  132.710 1.00 46.10  ? 149 PRO D CG  1 
ATOM   5929  C CD  . PRO D  2 165 ? 64.306  48.596  131.790 1.00 47.63  ? 149 PRO D CD  1 
ATOM   5930  N N   . VAL D  2 166 ? 66.936  51.787  130.470 1.00 43.40  ? 150 VAL D N   1 
ATOM   5931  C CA  . VAL D  2 166 ? 68.372  51.911  130.313 1.00 42.85  ? 150 VAL D CA  1 
ATOM   5932  C C   . VAL D  2 166 ? 68.889  52.954  131.278 1.00 43.41  ? 150 VAL D C   1 
ATOM   5933  O O   . VAL D  2 166 ? 68.320  54.025  131.386 1.00 46.05  ? 150 VAL D O   1 
ATOM   5934  C CB  . VAL D  2 166 ? 68.726  52.350  128.907 1.00 41.62  ? 150 VAL D CB  1 
ATOM   5935  C CG1 . VAL D  2 166 ? 67.958  53.601  128.559 1.00 40.65  ? 150 VAL D CG1 1 
ATOM   5936  C CG2 . VAL D  2 166 ? 70.204  52.587  128.809 1.00 41.90  ? 150 VAL D CG2 1 
ATOM   5937  N N   . THR D  2 167 ? 69.964  52.649  131.985 1.00 43.90  ? 151 THR D N   1 
ATOM   5938  C CA  . THR D  2 167 ? 70.512  53.612  132.922 1.00 44.92  ? 151 THR D CA  1 
ATOM   5939  C C   . THR D  2 167 ? 71.778  54.210  132.352 1.00 44.34  ? 151 THR D C   1 
ATOM   5940  O O   . THR D  2 167 ? 72.700  53.495  131.964 1.00 43.20  ? 151 THR D O   1 
ATOM   5941  C CB  . THR D  2 167 ? 70.824  52.965  134.304 1.00 46.57  ? 151 THR D CB  1 
ATOM   5942  O OG1 . THR D  2 167 ? 72.235  52.730  134.444 1.00 47.60  ? 151 THR D OG1 1 
ATOM   5943  C CG2 . THR D  2 167 ? 70.092  51.639  134.427 1.00 47.75  ? 151 THR D CG2 1 
ATOM   5944  N N   . VAL D  2 168 ? 71.813  55.533  132.288 1.00 44.39  ? 152 VAL D N   1 
ATOM   5945  C CA  . VAL D  2 168 ? 72.983  56.223  131.780 1.00 44.16  ? 152 VAL D CA  1 
ATOM   5946  C C   . VAL D  2 168 ? 73.656  56.844  132.967 1.00 44.89  ? 152 VAL D C   1 
ATOM   5947  O O   . VAL D  2 168 ? 73.000  57.106  133.976 1.00 45.41  ? 152 VAL D O   1 
ATOM   5948  C CB  . VAL D  2 168 ? 72.618  57.345  130.811 1.00 42.83  ? 152 VAL D CB  1 
ATOM   5949  C CG1 . VAL D  2 168 ? 73.835  58.182  130.514 1.00 42.05  ? 152 VAL D CG1 1 
ATOM   5950  C CG2 . VAL D  2 168 ? 72.071  56.757  129.531 1.00 43.77  ? 152 VAL D CG2 1 
ATOM   5951  N N   . SER D  2 169 ? 74.967  57.056  132.848 1.00 45.38  ? 153 SER D N   1 
ATOM   5952  C CA  . SER D  2 169 ? 75.761  57.687  133.902 1.00 44.71  ? 153 SER D CA  1 
ATOM   5953  C C   . SER D  2 169 ? 77.033  58.262  133.277 1.00 42.95  ? 153 SER D C   1 
ATOM   5954  O O   . SER D  2 169 ? 77.345  58.000  132.111 1.00 40.34  ? 153 SER D O   1 
ATOM   5955  C CB  . SER D  2 169 ? 76.142  56.671  134.973 1.00 45.40  ? 153 SER D CB  1 
ATOM   5956  O OG  . SER D  2 169 ? 77.227  55.885  134.517 1.00 48.32  ? 153 SER D OG  1 
ATOM   5957  N N   . TRP D  2 170 ? 77.765  59.044  134.057 1.00 41.53  ? 154 TRP D N   1 
ATOM   5958  C CA  . TRP D  2 170 ? 78.986  59.635  133.551 1.00 41.45  ? 154 TRP D CA  1 
ATOM   5959  C C   . TRP D  2 170 ? 80.232  59.392  134.420 1.00 42.16  ? 154 TRP D C   1 
ATOM   5960  O O   . TRP D  2 170 ? 80.221  59.599  135.640 1.00 41.58  ? 154 TRP D O   1 
ATOM   5961  C CB  . TRP D  2 170 ? 78.752  61.129  133.314 1.00 39.89  ? 154 TRP D CB  1 
ATOM   5962  C CG  . TRP D  2 170 ? 77.792  61.354  132.205 1.00 38.53  ? 154 TRP D CG  1 
ATOM   5963  C CD1 . TRP D  2 170 ? 76.428  61.299  132.277 1.00 37.50  ? 154 TRP D CD1 1 
ATOM   5964  C CD2 . TRP D  2 170 ? 78.117  61.536  130.822 1.00 36.54  ? 154 TRP D CD2 1 
ATOM   5965  N NE1 . TRP D  2 170 ? 75.889  61.426  131.026 1.00 37.04  ? 154 TRP D NE1 1 
ATOM   5966  C CE2 . TRP D  2 170 ? 76.904  61.568  130.112 1.00 38.17  ? 154 TRP D CE2 1 
ATOM   5967  C CE3 . TRP D  2 170 ? 79.321  61.667  130.112 1.00 36.04  ? 154 TRP D CE3 1 
ATOM   5968  C CZ2 . TRP D  2 170 ? 76.858  61.721  128.708 1.00 38.30  ? 154 TRP D CZ2 1 
ATOM   5969  C CZ3 . TRP D  2 170 ? 79.279  61.820  128.720 1.00 36.02  ? 154 TRP D CZ3 1 
ATOM   5970  C CH2 . TRP D  2 170 ? 78.055  61.843  128.037 1.00 35.77  ? 154 TRP D CH2 1 
ATOM   5971  N N   . ASN D  2 171 ? 81.308  58.955  133.771 1.00 41.85  ? 155 ASN D N   1 
ATOM   5972  C CA  . ASN D  2 171 ? 82.556  58.668  134.461 1.00 42.19  ? 155 ASN D CA  1 
ATOM   5973  C C   . ASN D  2 171 ? 82.292  57.637  135.544 1.00 43.02  ? 155 ASN D C   1 
ATOM   5974  O O   . ASN D  2 171 ? 82.632  57.828  136.718 1.00 42.71  ? 155 ASN D O   1 
ATOM   5975  C CB  . ASN D  2 171 ? 83.134  59.937  135.076 1.00 42.11  ? 155 ASN D CB  1 
ATOM   5976  C CG  . ASN D  2 171 ? 83.663  60.897  134.033 1.00 43.42  ? 155 ASN D CG  1 
ATOM   5977  O OD1 . ASN D  2 171 ? 84.169  60.481  132.987 1.00 43.72  ? 155 ASN D OD1 1 
ATOM   5978  N ND2 . ASN D  2 171 ? 83.572  62.191  134.319 1.00 44.04  ? 155 ASN D ND2 1 
ATOM   5979  N N   . SER D  2 172 ? 81.689  56.529  135.133 1.00 43.06  ? 156 SER D N   1 
ATOM   5980  C CA  . SER D  2 172 ? 81.347  55.468  136.060 1.00 42.56  ? 156 SER D CA  1 
ATOM   5981  C C   . SER D  2 172 ? 80.544  56.038  137.228 1.00 43.44  ? 156 SER D C   1 
ATOM   5982  O O   . SER D  2 172 ? 80.413  55.400  138.267 1.00 44.65  ? 156 SER D O   1 
ATOM   5983  C CB  . SER D  2 172 ? 82.610  54.752  136.561 1.00 41.54  ? 156 SER D CB  1 
ATOM   5984  O OG  . SER D  2 172 ? 83.048  53.749  135.649 1.00 37.44  ? 156 SER D OG  1 
ATOM   5985  N N   . GLY D  2 173 ? 80.009  57.245  137.057 1.00 44.23  ? 157 GLY D N   1 
ATOM   5986  C CA  . GLY D  2 173 ? 79.191  57.839  138.104 1.00 44.16  ? 157 GLY D CA  1 
ATOM   5987  C C   . GLY D  2 173 ? 79.701  59.082  138.804 1.00 44.40  ? 157 GLY D C   1 
ATOM   5988  O O   . GLY D  2 173 ? 78.953  59.712  139.557 1.00 43.04  ? 157 GLY D O   1 
ATOM   5989  N N   . ALA D  2 174 ? 80.961  59.443  138.567 1.00 45.31  ? 158 ALA D N   1 
ATOM   5990  C CA  . ALA D  2 174 ? 81.553  60.620  139.207 1.00 46.15  ? 158 ALA D CA  1 
ATOM   5991  C C   . ALA D  2 174 ? 80.735  61.875  138.925 1.00 47.74  ? 158 ALA D C   1 
ATOM   5992  O O   . ALA D  2 174 ? 80.055  62.405  139.806 1.00 49.24  ? 158 ALA D O   1 
ATOM   5993  C CB  . ALA D  2 174 ? 82.989  60.817  138.737 1.00 43.71  ? 158 ALA D CB  1 
ATOM   5994  N N   . LEU D  2 175 ? 80.787  62.335  137.685 1.00 48.38  ? 159 LEU D N   1 
ATOM   5995  C CA  . LEU D  2 175 ? 80.070  63.529  137.294 1.00 48.54  ? 159 LEU D CA  1 
ATOM   5996  C C   . LEU D  2 175 ? 78.562  63.341  137.287 1.00 49.88  ? 159 LEU D C   1 
ATOM   5997  O O   . LEU D  2 175 ? 78.043  62.511  136.545 1.00 50.49  ? 159 LEU D O   1 
ATOM   5998  C CB  . LEU D  2 175 ? 80.544  63.957  135.917 1.00 46.85  ? 159 LEU D CB  1 
ATOM   5999  C CG  . LEU D  2 175 ? 79.991  65.298  135.473 1.00 47.42  ? 159 LEU D CG  1 
ATOM   6000  C CD1 . LEU D  2 175 ? 79.740  66.226  136.678 1.00 46.54  ? 159 LEU D CD1 1 
ATOM   6001  C CD2 . LEU D  2 175 ? 80.976  65.894  134.495 1.00 46.73  ? 159 LEU D CD2 1 
ATOM   6002  N N   . THR D  2 176 ? 77.851  64.109  138.107 1.00 52.16  ? 160 THR D N   1 
ATOM   6003  C CA  . THR D  2 176 ? 76.389  63.993  138.147 1.00 54.85  ? 160 THR D CA  1 
ATOM   6004  C C   . THR D  2 176 ? 75.706  65.348  138.281 1.00 55.28  ? 160 THR D C   1 
ATOM   6005  O O   . THR D  2 176 ? 74.488  65.428  138.459 1.00 55.99  ? 160 THR D O   1 
ATOM   6006  C CB  . THR D  2 176 ? 75.887  63.098  139.314 1.00 55.33  ? 160 THR D CB  1 
ATOM   6007  O OG1 . THR D  2 176 ? 75.892  63.848  140.536 1.00 55.73  ? 160 THR D OG1 1 
ATOM   6008  C CG2 . THR D  2 176 ? 76.773  61.870  139.466 1.00 56.42  ? 160 THR D CG2 1 
ATOM   6009  N N   . SER D  2 177 ? 76.495  66.412  138.210 1.00 55.01  ? 161 SER D N   1 
ATOM   6010  C CA  . SER D  2 177 ? 75.945  67.754  138.300 1.00 54.28  ? 161 SER D CA  1 
ATOM   6011  C C   . SER D  2 177 ? 75.770  68.331  136.909 1.00 53.06  ? 161 SER D C   1 
ATOM   6012  O O   . SER D  2 177 ? 76.719  68.362  136.117 1.00 54.54  ? 161 SER D O   1 
ATOM   6013  C CB  . SER D  2 177 ? 76.874  68.669  139.090 1.00 55.64  ? 161 SER D CB  1 
ATOM   6014  O OG  . SER D  2 177 ? 76.886  69.969  138.513 1.00 56.34  ? 161 SER D OG  1 
ATOM   6015  N N   . GLY D  2 178 ? 74.563  68.791  136.612 1.00 49.90  ? 162 GLY D N   1 
ATOM   6016  C CA  . GLY D  2 178 ? 74.319  69.381  135.313 1.00 46.77  ? 162 GLY D CA  1 
ATOM   6017  C C   . GLY D  2 178 ? 74.003  68.383  134.228 1.00 44.61  ? 162 GLY D C   1 
ATOM   6018  O O   . GLY D  2 178 ? 74.064  68.720  133.045 1.00 44.30  ? 162 GLY D O   1 
ATOM   6019  N N   . VAL D  2 179 ? 73.661  67.163  134.632 1.00 42.36  ? 163 VAL D N   1 
ATOM   6020  C CA  . VAL D  2 179 ? 73.315  66.105  133.691 1.00 40.27  ? 163 VAL D CA  1 
ATOM   6021  C C   . VAL D  2 179 ? 71.817  65.894  133.589 1.00 40.52  ? 163 VAL D C   1 
ATOM   6022  O O   . VAL D  2 179 ? 71.116  65.873  134.602 1.00 41.32  ? 163 VAL D O   1 
ATOM   6023  C CB  . VAL D  2 179 ? 73.944  64.777  134.097 1.00 39.11  ? 163 VAL D CB  1 
ATOM   6024  C CG1 . VAL D  2 179 ? 73.193  63.618  133.467 1.00 36.09  ? 163 VAL D CG1 1 
ATOM   6025  C CG2 . VAL D  2 179 ? 75.386  64.757  133.663 1.00 39.91  ? 163 VAL D CG2 1 
ATOM   6026  N N   . HIS D  2 180 ? 71.345  65.733  132.355 1.00 39.67  ? 164 HIS D N   1 
ATOM   6027  C CA  . HIS D  2 180 ? 69.936  65.501  132.057 1.00 38.76  ? 164 HIS D CA  1 
ATOM   6028  C C   . HIS D  2 180 ? 69.796  64.262  131.196 1.00 38.98  ? 164 HIS D C   1 
ATOM   6029  O O   . HIS D  2 180 ? 70.468  64.148  130.181 1.00 40.33  ? 164 HIS D O   1 
ATOM   6030  C CB  . HIS D  2 180 ? 69.361  66.647  131.250 1.00 38.30  ? 164 HIS D CB  1 
ATOM   6031  C CG  . HIS D  2 180 ? 69.148  67.891  132.032 1.00 38.21  ? 164 HIS D CG  1 
ATOM   6032  N ND1 . HIS D  2 180 ? 69.987  68.977  131.936 1.00 38.05  ? 164 HIS D ND1 1 
ATOM   6033  C CD2 . HIS D  2 180 ? 68.163  68.243  132.891 1.00 39.34  ? 164 HIS D CD2 1 
ATOM   6034  C CE1 . HIS D  2 180 ? 69.524  69.950  132.698 1.00 40.42  ? 164 HIS D CE1 1 
ATOM   6035  N NE2 . HIS D  2 180 ? 68.418  69.530  133.288 1.00 40.63  ? 164 HIS D NE2 1 
ATOM   6036  N N   . THR D  2 181 ? 68.924  63.336  131.567 1.00 37.96  ? 165 THR D N   1 
ATOM   6037  C CA  . THR D  2 181 ? 68.754  62.167  130.718 1.00 37.41  ? 165 THR D CA  1 
ATOM   6038  C C   . THR D  2 181 ? 67.293  62.080  130.281 1.00 36.57  ? 165 THR D C   1 
ATOM   6039  O O   . THR D  2 181 ? 66.481  61.418  130.929 1.00 36.89  ? 165 THR D O   1 
ATOM   6040  C CB  . THR D  2 181 ? 69.159  60.876  131.436 1.00 36.70  ? 165 THR D CB  1 
ATOM   6041  O OG1 . THR D  2 181 ? 70.300  61.122  132.258 1.00 37.97  ? 165 THR D OG1 1 
ATOM   6042  C CG2 . THR D  2 181 ? 69.545  59.832  130.423 1.00 35.59  ? 165 THR D CG2 1 
ATOM   6043  N N   . PHE D  2 182 ? 66.968  62.749  129.177 1.00 33.87  ? 166 PHE D N   1 
ATOM   6044  C CA  . PHE D  2 182 ? 65.603  62.764  128.673 1.00 31.54  ? 166 PHE D CA  1 
ATOM   6045  C C   . PHE D  2 182 ? 64.964  61.398  128.642 1.00 30.94  ? 166 PHE D C   1 
ATOM   6046  O O   . PHE D  2 182 ? 65.649  60.384  128.554 1.00 29.42  ? 166 PHE D O   1 
ATOM   6047  C CB  . PHE D  2 182 ? 65.546  63.385  127.282 1.00 28.03  ? 166 PHE D CB  1 
ATOM   6048  C CG  . PHE D  2 182 ? 66.246  64.681  127.205 1.00 27.70  ? 166 PHE D CG  1 
ATOM   6049  C CD1 . PHE D  2 182 ? 67.578  64.740  126.780 1.00 27.51  ? 166 PHE D CD1 1 
ATOM   6050  C CD2 . PHE D  2 182 ? 65.640  65.831  127.694 1.00 27.15  ? 166 PHE D CD2 1 
ATOM   6051  C CE1 . PHE D  2 182 ? 68.302  65.926  126.855 1.00 26.47  ? 166 PHE D CE1 1 
ATOM   6052  C CE2 . PHE D  2 182 ? 66.348  67.018  127.779 1.00 26.37  ? 166 PHE D CE2 1 
ATOM   6053  C CZ  . PHE D  2 182 ? 67.685  67.070  127.361 1.00 25.90  ? 166 PHE D CZ  1 
ATOM   6054  N N   . PRO D  2 183 ? 63.626  61.368  128.749 1.00 30.57  ? 167 PRO D N   1 
ATOM   6055  C CA  . PRO D  2 183 ? 62.723  60.221  128.748 1.00 30.66  ? 167 PRO D CA  1 
ATOM   6056  C C   . PRO D  2 183 ? 62.824  59.552  127.400 1.00 32.61  ? 167 PRO D C   1 
ATOM   6057  O O   . PRO D  2 183 ? 62.737  60.228  126.378 1.00 33.97  ? 167 PRO D O   1 
ATOM   6058  C CB  . PRO D  2 183 ? 61.375  60.869  128.935 1.00 29.62  ? 167 PRO D CB  1 
ATOM   6059  C CG  . PRO D  2 183 ? 61.705  62.065  129.737 1.00 29.67  ? 167 PRO D CG  1 
ATOM   6060  C CD  . PRO D  2 183 ? 62.874  62.596  129.039 1.00 29.01  ? 167 PRO D CD  1 
ATOM   6061  N N   . ALA D  2 184 ? 63.014  58.238  127.378 1.00 33.62  ? 168 ALA D N   1 
ATOM   6062  C CA  . ALA D  2 184 ? 63.142  57.553  126.099 1.00 33.68  ? 168 ALA D CA  1 
ATOM   6063  C C   . ALA D  2 184 ? 61.869  57.772  125.312 1.00 34.10  ? 168 ALA D C   1 
ATOM   6064  O O   . ALA D  2 184 ? 60.799  57.894  125.910 1.00 35.44  ? 168 ALA D O   1 
ATOM   6065  C CB  . ALA D  2 184 ? 63.370  56.075  126.324 1.00 33.83  ? 168 ALA D CB  1 
ATOM   6066  N N   . VAL D  2 185 ? 61.983  57.868  123.987 1.00 33.74  ? 169 VAL D N   1 
ATOM   6067  C CA  . VAL D  2 185 ? 60.815  58.034  123.125 1.00 33.96  ? 169 VAL D CA  1 
ATOM   6068  C C   . VAL D  2 185 ? 60.735  56.697  122.384 1.00 37.08  ? 169 VAL D C   1 
ATOM   6069  O O   . VAL D  2 185 ? 61.742  55.986  122.272 1.00 38.09  ? 169 VAL D O   1 
ATOM   6070  C CB  . VAL D  2 185 ? 60.992  59.173  122.060 1.00 32.63  ? 169 VAL D CB  1 
ATOM   6071  C CG1 . VAL D  2 185 ? 59.672  59.400  121.324 1.00 34.75  ? 169 VAL D CG1 1 
ATOM   6072  C CG2 . VAL D  2 185 ? 61.448  60.466  122.697 1.00 30.98  ? 169 VAL D CG2 1 
ATOM   6073  N N   . LEU D  2 186 ? 59.556  56.342  121.880 1.00 38.42  ? 170 LEU D N   1 
ATOM   6074  C CA  . LEU D  2 186 ? 59.411  55.093  121.146 1.00 37.47  ? 170 LEU D CA  1 
ATOM   6075  C C   . LEU D  2 186 ? 59.625  55.327  119.652 1.00 38.89  ? 170 LEU D C   1 
ATOM   6076  O O   . LEU D  2 186 ? 58.700  55.741  118.948 1.00 40.30  ? 170 LEU D O   1 
ATOM   6077  C CB  . LEU D  2 186 ? 58.026  54.495  121.379 1.00 35.57  ? 170 LEU D CB  1 
ATOM   6078  C CG  . LEU D  2 186 ? 57.676  53.297  120.494 1.00 34.59  ? 170 LEU D CG  1 
ATOM   6079  C CD1 . LEU D  2 186 ? 58.744  52.233  120.632 1.00 33.49  ? 170 LEU D CD1 1 
ATOM   6080  C CD2 . LEU D  2 186 ? 56.313  52.745  120.873 1.00 32.31  ? 170 LEU D CD2 1 
ATOM   6081  N N   . GLN D  2 187 ? 60.850  55.066  119.181 1.00 40.05  ? 171 GLN D N   1 
ATOM   6082  C CA  . GLN D  2 187 ? 61.216  55.226  117.766 1.00 38.74  ? 171 GLN D CA  1 
ATOM   6083  C C   . GLN D  2 187 ? 60.247  54.487  116.860 1.00 38.10  ? 171 GLN D C   1 
ATOM   6084  O O   . GLN D  2 187 ? 59.709  53.451  117.207 1.00 37.38  ? 171 GLN D O   1 
ATOM   6085  C CB  . GLN D  2 187 ? 62.633  54.696  117.485 1.00 38.64  ? 171 GLN D CB  1 
ATOM   6086  C CG  . GLN D  2 187 ? 63.796  55.612  117.879 1.00 38.68  ? 171 GLN D CG  1 
ATOM   6087  C CD  . GLN D  2 187 ? 65.074  55.345  117.051 1.00 39.64  ? 171 GLN D CD  1 
ATOM   6088  O OE1 . GLN D  2 187 ? 65.079  55.485  115.818 1.00 39.46  ? 171 GLN D OE1 1 
ATOM   6089  N NE2 . GLN D  2 187 ? 66.152  54.969  117.728 1.00 37.16  ? 171 GLN D NE2 1 
ATOM   6090  N N   . SER D  2 188 ? 60.045  55.034  115.678 1.00 39.22  ? 172 SER D N   1 
ATOM   6091  C CA  . SER D  2 188 ? 59.150  54.453  114.701 1.00 39.67  ? 172 SER D CA  1 
ATOM   6092  C C   . SER D  2 188 ? 59.710  53.159  114.158 1.00 40.44  ? 172 SER D C   1 
ATOM   6093  O O   . SER D  2 188 ? 59.132  52.548  113.255 1.00 41.80  ? 172 SER D O   1 
ATOM   6094  C CB  . SER D  2 188 ? 58.957  55.444  113.565 1.00 40.02  ? 172 SER D CB  1 
ATOM   6095  O OG  . SER D  2 188 ? 60.202  56.030  113.245 1.00 41.80  ? 172 SER D OG  1 
ATOM   6096  N N   . SER D  2 189 ? 60.849  52.745  114.692 1.00 41.56  ? 173 SER D N   1 
ATOM   6097  C CA  . SER D  2 189 ? 61.476  51.504  114.248 1.00 42.29  ? 173 SER D CA  1 
ATOM   6098  C C   . SER D  2 189 ? 60.802  50.320  114.939 1.00 42.19  ? 173 SER D C   1 
ATOM   6099  O O   . SER D  2 189 ? 60.483  49.315  114.312 1.00 41.58  ? 173 SER D O   1 
ATOM   6100  C CB  . SER D  2 189 ? 62.979  51.522  114.572 1.00 43.67  ? 173 SER D CB  1 
ATOM   6101  O OG  . SER D  2 189 ? 63.224  51.626  115.973 1.00 43.72  ? 173 SER D OG  1 
ATOM   6102  N N   . GLY D  2 190 ? 60.575  50.475  116.239 1.00 42.25  ? 174 GLY D N   1 
ATOM   6103  C CA  . GLY D  2 190 ? 59.960  49.444  117.044 1.00 41.70  ? 174 GLY D CA  1 
ATOM   6104  C C   . GLY D  2 190 ? 60.761  49.437  118.326 1.00 42.82  ? 174 GLY D C   1 
ATOM   6105  O O   . GLY D  2 190 ? 60.347  48.866  119.334 1.00 44.45  ? 174 GLY D O   1 
ATOM   6106  N N   . LEU D  2 191 ? 61.914  50.103  118.281 1.00 42.24  ? 175 LEU D N   1 
ATOM   6107  C CA  . LEU D  2 191 ? 62.831  50.182  119.413 1.00 41.43  ? 175 LEU D CA  1 
ATOM   6108  C C   . LEU D  2 191 ? 62.844  51.553  120.053 1.00 40.54  ? 175 LEU D C   1 
ATOM   6109  O O   . LEU D  2 191 ? 62.456  52.534  119.436 1.00 40.93  ? 175 LEU D O   1 
ATOM   6110  C CB  . LEU D  2 191 ? 64.255  49.874  118.951 1.00 42.45  ? 175 LEU D CB  1 
ATOM   6111  C CG  . LEU D  2 191 ? 64.513  48.594  118.159 1.00 42.69  ? 175 LEU D CG  1 
ATOM   6112  C CD1 . LEU D  2 191 ? 65.956  48.564  117.677 1.00 41.11  ? 175 LEU D CD1 1 
ATOM   6113  C CD2 . LEU D  2 191 ? 64.212  47.395  119.046 1.00 43.66  ? 175 LEU D CD2 1 
ATOM   6114  N N   . TYR D  2 192 ? 63.332  51.612  121.288 1.00 39.97  ? 176 TYR D N   1 
ATOM   6115  C CA  . TYR D  2 192 ? 63.435  52.858  122.031 1.00 37.24  ? 176 TYR D CA  1 
ATOM   6116  C C   . TYR D  2 192 ? 64.705  53.605  121.688 1.00 36.56  ? 176 TYR D C   1 
ATOM   6117  O O   . TYR D  2 192 ? 65.640  53.057  121.087 1.00 35.44  ? 176 TYR D O   1 
ATOM   6118  C CB  . TYR D  2 192 ? 63.418  52.584  123.516 1.00 36.29  ? 176 TYR D CB  1 
ATOM   6119  C CG  . TYR D  2 192 ? 62.110  52.041  123.953 1.00 37.23  ? 176 TYR D CG  1 
ATOM   6120  C CD1 . TYR D  2 192 ? 61.075  52.889  124.356 1.00 38.18  ? 176 TYR D CD1 1 
ATOM   6121  C CD2 . TYR D  2 192 ? 61.871  50.680  123.896 1.00 38.42  ? 176 TYR D CD2 1 
ATOM   6122  C CE1 . TYR D  2 192 ? 59.823  52.386  124.693 1.00 39.68  ? 176 TYR D CE1 1 
ATOM   6123  C CE2 . TYR D  2 192 ? 60.626  50.160  124.218 1.00 41.53  ? 176 TYR D CE2 1 
ATOM   6124  C CZ  . TYR D  2 192 ? 59.604  51.013  124.614 1.00 40.81  ? 176 TYR D CZ  1 
ATOM   6125  O OH  . TYR D  2 192 ? 58.376  50.468  124.889 1.00 39.95  ? 176 TYR D OH  1 
ATOM   6126  N N   . SER D  2 193 ? 64.718  54.874  122.075 1.00 34.59  ? 177 SER D N   1 
ATOM   6127  C CA  . SER D  2 193 ? 65.849  55.734  121.825 1.00 32.20  ? 177 SER D CA  1 
ATOM   6128  C C   . SER D  2 193 ? 65.810  56.898  122.785 1.00 30.71  ? 177 SER D C   1 
ATOM   6129  O O   . SER D  2 193 ? 64.731  57.320  123.212 1.00 30.22  ? 177 SER D O   1 
ATOM   6130  C CB  . SER D  2 193 ? 65.809  56.248  120.398 1.00 33.17  ? 177 SER D CB  1 
ATOM   6131  O OG  . SER D  2 193 ? 66.910  57.101  120.159 1.00 35.52  ? 177 SER D OG  1 
ATOM   6132  N N   . LEU D  2 194 ? 66.992  57.408  123.125 1.00 28.89  ? 178 LEU D N   1 
ATOM   6133  C CA  . LEU D  2 194 ? 67.098  58.520  124.050 1.00 28.71  ? 178 LEU D CA  1 
ATOM   6134  C C   . LEU D  2 194 ? 68.458  59.181  124.081 1.00 29.60  ? 178 LEU D C   1 
ATOM   6135  O O   . LEU D  2 194 ? 69.415  58.733  123.433 1.00 29.93  ? 178 LEU D O   1 
ATOM   6136  C CB  . LEU D  2 194 ? 66.741  58.067  125.474 1.00 28.19  ? 178 LEU D CB  1 
ATOM   6137  C CG  . LEU D  2 194 ? 67.701  57.266  126.358 1.00 25.11  ? 178 LEU D CG  1 
ATOM   6138  C CD1 . LEU D  2 194 ? 68.833  58.126  126.846 1.00 24.15  ? 178 LEU D CD1 1 
ATOM   6139  C CD2 . LEU D  2 194 ? 66.946  56.752  127.534 1.00 24.88  ? 178 LEU D CD2 1 
ATOM   6140  N N   . SER D  2 195 ? 68.522  60.261  124.853 1.00 30.64  ? 179 SER D N   1 
ATOM   6141  C CA  . SER D  2 195 ? 69.749  61.014  125.020 1.00 33.32  ? 179 SER D CA  1 
ATOM   6142  C C   . SER D  2 195 ? 69.967  61.507  126.440 1.00 34.64  ? 179 SER D C   1 
ATOM   6143  O O   . SER D  2 195 ? 69.022  61.806  127.194 1.00 35.18  ? 179 SER D O   1 
ATOM   6144  C CB  . SER D  2 195 ? 69.796  62.195  124.058 1.00 35.13  ? 179 SER D CB  1 
ATOM   6145  O OG  . SER D  2 195 ? 70.213  61.768  122.771 1.00 38.71  ? 179 SER D OG  1 
ATOM   6146  N N   . SER D  2 196 ? 71.246  61.570  126.784 1.00 33.51  ? 180 SER D N   1 
ATOM   6147  C CA  . SER D  2 196 ? 71.703  61.997  128.084 1.00 32.18  ? 180 SER D CA  1 
ATOM   6148  C C   . SER D  2 196 ? 72.825  62.960  127.774 1.00 32.56  ? 180 SER D C   1 
ATOM   6149  O O   . SER D  2 196 ? 73.733  62.611  127.035 1.00 34.07  ? 180 SER D O   1 
ATOM   6150  C CB  . SER D  2 196 ? 72.243  60.800  128.845 1.00 30.54  ? 180 SER D CB  1 
ATOM   6151  O OG  . SER D  2 196 ? 72.848  61.208  130.046 1.00 28.34  ? 180 SER D OG  1 
ATOM   6152  N N   . VAL D  2 197 ? 72.752  64.172  128.316 1.00 32.17  ? 181 VAL D N   1 
ATOM   6153  C CA  . VAL D  2 197 ? 73.769  65.188  128.082 1.00 31.56  ? 181 VAL D CA  1 
ATOM   6154  C C   . VAL D  2 197 ? 74.108  65.927  129.386 1.00 33.04  ? 181 VAL D C   1 
ATOM   6155  O O   . VAL D  2 197 ? 73.308  65.953  130.323 1.00 34.14  ? 181 VAL D O   1 
ATOM   6156  C CB  . VAL D  2 197 ? 73.284  66.217  127.004 1.00 29.39  ? 181 VAL D CB  1 
ATOM   6157  C CG1 . VAL D  2 197 ? 72.740  65.488  125.820 1.00 28.48  ? 181 VAL D CG1 1 
ATOM   6158  C CG2 . VAL D  2 197 ? 72.217  67.121  127.563 1.00 28.10  ? 181 VAL D CG2 1 
ATOM   6159  N N   . VAL D  2 198 ? 75.291  66.530  129.442 1.00 33.12  ? 182 VAL D N   1 
ATOM   6160  C CA  . VAL D  2 198 ? 75.709  67.277  130.619 1.00 33.38  ? 182 VAL D CA  1 
ATOM   6161  C C   . VAL D  2 198 ? 76.334  68.588  130.142 1.00 33.80  ? 182 VAL D C   1 
ATOM   6162  O O   . VAL D  2 198 ? 76.694  68.682  128.985 1.00 34.95  ? 182 VAL D O   1 
ATOM   6163  C CB  . VAL D  2 198 ? 76.714  66.416  131.447 1.00 33.50  ? 182 VAL D CB  1 
ATOM   6164  C CG1 . VAL D  2 198 ? 77.402  65.398  130.544 1.00 31.45  ? 182 VAL D CG1 1 
ATOM   6165  C CG2 . VAL D  2 198 ? 77.731  67.297  132.136 1.00 33.86  ? 182 VAL D CG2 1 
ATOM   6166  N N   . THR D  2 199 ? 76.432  69.602  131.001 1.00 35.68  ? 183 THR D N   1 
ATOM   6167  C CA  . THR D  2 199 ? 77.056  70.883  130.614 1.00 38.70  ? 183 THR D CA  1 
ATOM   6168  C C   . THR D  2 199 ? 78.214  71.253  131.550 1.00 41.30  ? 183 THR D C   1 
ATOM   6169  O O   . THR D  2 199 ? 78.018  71.713  132.680 1.00 41.65  ? 183 THR D O   1 
ATOM   6170  C CB  . THR D  2 199 ? 76.059  72.043  130.609 1.00 38.03  ? 183 THR D CB  1 
ATOM   6171  O OG1 . THR D  2 199 ? 75.408  72.109  131.877 1.00 39.79  ? 183 THR D OG1 1 
ATOM   6172  C CG2 . THR D  2 199 ? 75.023  71.851  129.533 1.00 37.97  ? 183 THR D CG2 1 
ATOM   6173  N N   . VAL D  2 200 ? 79.430  71.056  131.050 1.00 43.17  ? 184 VAL D N   1 
ATOM   6174  C CA  . VAL D  2 200 ? 80.647  71.307  131.809 1.00 43.25  ? 184 VAL D CA  1 
ATOM   6175  C C   . VAL D  2 200 ? 81.359  72.575  131.361 1.00 43.32  ? 184 VAL D C   1 
ATOM   6176  O O   . VAL D  2 200 ? 80.879  73.282  130.488 1.00 42.11  ? 184 VAL D O   1 
ATOM   6177  C CB  . VAL D  2 200 ? 81.622  70.102  131.670 1.00 42.60  ? 184 VAL D CB  1 
ATOM   6178  C CG1 . VAL D  2 200 ? 80.871  68.807  131.880 1.00 42.30  ? 184 VAL D CG1 1 
ATOM   6179  C CG2 . VAL D  2 200 ? 82.296  70.120  130.318 1.00 40.11  ? 184 VAL D CG2 1 
ATOM   6180  N N   . PRO D  2 201 ? 82.519  72.873  131.966 1.00 44.16  ? 185 PRO D N   1 
ATOM   6181  C CA  . PRO D  2 201 ? 83.297  74.062  131.618 1.00 45.53  ? 185 PRO D CA  1 
ATOM   6182  C C   . PRO D  2 201 ? 83.995  73.918  130.267 1.00 46.57  ? 185 PRO D C   1 
ATOM   6183  O O   . PRO D  2 201 ? 84.447  72.826  129.930 1.00 46.73  ? 185 PRO D O   1 
ATOM   6184  C CB  . PRO D  2 201 ? 84.307  74.155  132.760 1.00 45.51  ? 185 PRO D CB  1 
ATOM   6185  C CG  . PRO D  2 201 ? 83.618  73.433  133.905 1.00 44.51  ? 185 PRO D CG  1 
ATOM   6186  C CD  . PRO D  2 201 ? 83.047  72.258  133.199 1.00 43.44  ? 185 PRO D CD  1 
ATOM   6187  N N   . SER D  2 202 ? 84.086  75.013  129.504 1.00 48.16  ? 186 SER D N   1 
ATOM   6188  C CA  . SER D  2 202 ? 84.759  74.996  128.194 1.00 49.23  ? 186 SER D CA  1 
ATOM   6189  C C   . SER D  2 202 ? 86.242  74.732  128.402 1.00 49.77  ? 186 SER D C   1 
ATOM   6190  O O   . SER D  2 202 ? 86.815  73.842  127.792 1.00 51.17  ? 186 SER D O   1 
ATOM   6191  C CB  . SER D  2 202 ? 84.600  76.331  127.467 1.00 48.86  ? 186 SER D CB  1 
ATOM   6192  O OG  . SER D  2 202 ? 83.287  76.502  126.984 1.00 49.35  ? 186 SER D OG  1 
ATOM   6193  N N   . SER D  2 203 ? 86.860  75.520  129.267 1.00 50.27  ? 187 SER D N   1 
ATOM   6194  C CA  . SER D  2 203 ? 88.272  75.364  129.579 1.00 51.47  ? 187 SER D CA  1 
ATOM   6195  C C   . SER D  2 203 ? 88.712  73.898  129.778 1.00 51.67  ? 187 SER D C   1 
ATOM   6196  O O   . SER D  2 203 ? 89.831  73.521  129.419 1.00 52.05  ? 187 SER D O   1 
ATOM   6197  C CB  . SER D  2 203 ? 88.588  76.162  130.845 1.00 52.76  ? 187 SER D CB  1 
ATOM   6198  O OG  . SER D  2 203 ? 87.858  75.655  131.956 1.00 54.11  ? 187 SER D OG  1 
ATOM   6199  N N   . SER D  2 204 ? 87.827  73.083  130.345 1.00 52.16  ? 188 SER D N   1 
ATOM   6200  C CA  . SER D  2 204 ? 88.110  71.677  130.633 1.00 52.63  ? 188 SER D CA  1 
ATOM   6201  C C   . SER D  2 204 ? 88.287  70.769  129.421 1.00 53.48  ? 188 SER D C   1 
ATOM   6202  O O   . SER D  2 204 ? 89.127  69.870  129.437 1.00 53.51  ? 188 SER D O   1 
ATOM   6203  C CB  . SER D  2 204 ? 87.002  71.101  131.523 1.00 53.56  ? 188 SER D CB  1 
ATOM   6204  O OG  . SER D  2 204 ? 85.743  71.112  130.863 1.00 52.33  ? 188 SER D OG  1 
ATOM   6205  N N   . LEU D  2 205 ? 87.483  70.994  128.384 1.00 54.26  ? 189 LEU D N   1 
ATOM   6206  C CA  . LEU D  2 205 ? 87.546  70.189  127.165 1.00 53.99  ? 189 LEU D CA  1 
ATOM   6207  C C   . LEU D  2 205 ? 88.956  69.750  126.918 1.00 54.06  ? 189 LEU D C   1 
ATOM   6208  O O   . LEU D  2 205 ? 89.245  68.561  126.851 1.00 54.69  ? 189 LEU D O   1 
ATOM   6209  C CB  . LEU D  2 205 ? 87.070  70.985  125.955 1.00 53.94  ? 189 LEU D CB  1 
ATOM   6210  C CG  . LEU D  2 205 ? 85.594  71.371  125.926 1.00 55.23  ? 189 LEU D CG  1 
ATOM   6211  C CD1 . LEU D  2 205 ? 85.352  72.187  124.679 1.00 54.90  ? 189 LEU D CD1 1 
ATOM   6212  C CD2 . LEU D  2 205 ? 84.705  70.128  125.939 1.00 54.33  ? 189 LEU D CD2 1 
ATOM   6213  N N   . GLY D  2 206 ? 89.837  70.731  126.792 1.00 54.09  ? 190 GLY D N   1 
ATOM   6214  C CA  . GLY D  2 206 ? 91.225  70.426  126.546 1.00 54.16  ? 190 GLY D CA  1 
ATOM   6215  C C   . GLY D  2 206 ? 91.721  69.217  127.313 1.00 53.52  ? 190 GLY D C   1 
ATOM   6216  O O   . GLY D  2 206 ? 92.167  68.225  126.722 1.00 52.54  ? 190 GLY D O   1 
ATOM   6217  N N   . THR D  2 207 ? 91.611  69.290  128.633 1.00 52.31  ? 191 THR D N   1 
ATOM   6218  C CA  . THR D  2 207 ? 92.101  68.231  129.495 1.00 52.45  ? 191 THR D CA  1 
ATOM   6219  C C   . THR D  2 207 ? 91.090  67.198  130.012 1.00 52.41  ? 191 THR D C   1 
ATOM   6220  O O   . THR D  2 207 ? 91.124  66.037  129.595 1.00 52.32  ? 191 THR D O   1 
ATOM   6221  C CB  . THR D  2 207 ? 92.814  68.853  130.690 1.00 52.99  ? 191 THR D CB  1 
ATOM   6222  O OG1 . THR D  2 207 ? 91.864  69.599  131.463 1.00 54.61  ? 191 THR D OG1 1 
ATOM   6223  C CG2 . THR D  2 207 ? 93.940  69.788  130.219 1.00 51.48  ? 191 THR D CG2 1 
ATOM   6224  N N   . GLN D  2 208 ? 90.210  67.613  130.925 1.00 52.16  ? 192 GLN D N   1 
ATOM   6225  C CA  . GLN D  2 208 ? 89.213  66.711  131.512 1.00 51.15  ? 192 GLN D CA  1 
ATOM   6226  C C   . GLN D  2 208 ? 88.721  65.699  130.493 1.00 49.24  ? 192 GLN D C   1 
ATOM   6227  O O   . GLN D  2 208 ? 88.618  66.002  129.312 1.00 48.23  ? 192 GLN D O   1 
ATOM   6228  C CB  . GLN D  2 208 ? 88.020  67.498  132.062 1.00 53.41  ? 192 GLN D CB  1 
ATOM   6229  C CG  . GLN D  2 208 ? 86.986  66.654  132.827 1.00 58.20  ? 192 GLN D CG  1 
ATOM   6230  C CD  . GLN D  2 208 ? 87.368  66.357  134.283 1.00 61.90  ? 192 GLN D CD  1 
ATOM   6231  O OE1 . GLN D  2 208 ? 87.749  67.259  135.043 1.00 63.60  ? 192 GLN D OE1 1 
ATOM   6232  N NE2 . GLN D  2 208 ? 87.244  65.090  134.682 1.00 63.17  ? 192 GLN D NE2 1 
ATOM   6233  N N   . THR D  2 209 ? 88.420  64.494  130.960 1.00 47.54  ? 193 THR D N   1 
ATOM   6234  C CA  . THR D  2 209 ? 87.948  63.442  130.080 1.00 45.28  ? 193 THR D CA  1 
ATOM   6235  C C   . THR D  2 209 ? 86.527  63.033  130.497 1.00 43.74  ? 193 THR D C   1 
ATOM   6236  O O   . THR D  2 209 ? 86.230  62.923  131.682 1.00 43.15  ? 193 THR D O   1 
ATOM   6237  C CB  . THR D  2 209 ? 88.923  62.245  130.117 1.00 46.12  ? 193 THR D CB  1 
ATOM   6238  O OG1 . THR D  2 209 ? 90.209  62.691  130.588 1.00 46.40  ? 193 THR D OG1 1 
ATOM   6239  C CG2 . THR D  2 209 ? 89.111  61.671  128.714 1.00 44.15  ? 193 THR D CG2 1 
ATOM   6240  N N   . TYR D  2 210 ? 85.649  62.833  129.513 1.00 42.24  ? 194 TYR D N   1 
ATOM   6241  C CA  . TYR D  2 210 ? 84.258  62.484  129.765 1.00 39.50  ? 194 TYR D CA  1 
ATOM   6242  C C   . TYR D  2 210 ? 83.836  61.263  128.999 1.00 39.68  ? 194 TYR D C   1 
ATOM   6243  O O   . TYR D  2 210 ? 84.064  61.176  127.790 1.00 38.96  ? 194 TYR D O   1 
ATOM   6244  C CB  . TYR D  2 210 ? 83.358  63.633  129.353 1.00 38.81  ? 194 TYR D CB  1 
ATOM   6245  C CG  . TYR D  2 210 ? 83.756  64.956  129.954 1.00 37.84  ? 194 TYR D CG  1 
ATOM   6246  C CD1 . TYR D  2 210 ? 83.324  65.325  131.226 1.00 35.90  ? 194 TYR D CD1 1 
ATOM   6247  C CD2 . TYR D  2 210 ? 84.574  65.837  129.254 1.00 36.12  ? 194 TYR D CD2 1 
ATOM   6248  C CE1 . TYR D  2 210 ? 83.692  66.532  131.779 1.00 34.89  ? 194 TYR D CE1 1 
ATOM   6249  C CE2 . TYR D  2 210 ? 84.946  67.046  129.803 1.00 35.70  ? 194 TYR D CE2 1 
ATOM   6250  C CZ  . TYR D  2 210 ? 84.500  67.390  131.064 1.00 35.29  ? 194 TYR D CZ  1 
ATOM   6251  O OH  . TYR D  2 210 ? 84.851  68.607  131.594 1.00 35.26  ? 194 TYR D OH  1 
ATOM   6252  N N   . ILE D  2 211 ? 83.187  60.345  129.715 1.00 40.27  ? 195 ILE D N   1 
ATOM   6253  C CA  . ILE D  2 211 ? 82.695  59.075  129.171 1.00 40.96  ? 195 ILE D CA  1 
ATOM   6254  C C   . ILE D  2 211 ? 81.344  58.685  129.792 1.00 42.39  ? 195 ILE D C   1 
ATOM   6255  O O   . ILE D  2 211 ? 81.218  58.653  131.019 1.00 40.49  ? 195 ILE D O   1 
ATOM   6256  C CB  . ILE D  2 211 ? 83.689  57.941  129.488 1.00 40.29  ? 195 ILE D CB  1 
ATOM   6257  C CG1 . ILE D  2 211 ? 85.056  58.244  128.857 1.00 41.08  ? 195 ILE D CG1 1 
ATOM   6258  C CG2 . ILE D  2 211 ? 83.109  56.613  129.042 1.00 38.59  ? 195 ILE D CG2 1 
ATOM   6259  C CD1 . ILE D  2 211 ? 86.239  57.588  129.553 1.00 39.21  ? 195 ILE D CD1 1 
ATOM   6260  N N   . CYS D  2 212 ? 80.333  58.400  128.966 1.00 45.37  ? 196 CYS D N   1 
ATOM   6261  C CA  . CYS D  2 212 ? 79.038  57.987  129.521 1.00 48.63  ? 196 CYS D CA  1 
ATOM   6262  C C   . CYS D  2 212 ? 79.010  56.460  129.616 1.00 49.95  ? 196 CYS D C   1 
ATOM   6263  O O   . CYS D  2 212 ? 79.568  55.748  128.761 1.00 47.64  ? 196 CYS D O   1 
ATOM   6264  C CB  . CYS D  2 212 ? 77.823  58.488  128.687 1.00 48.82  ? 196 CYS D CB  1 
ATOM   6265  S SG  . CYS D  2 212 ? 77.729  57.868  126.971 1.00 52.32  ? 196 CYS D SG  1 
ATOM   6266  N N   . ASN D  2 213 ? 78.370  55.979  130.682 1.00 51.85  ? 197 ASN D N   1 
ATOM   6267  C CA  . ASN D  2 213 ? 78.237  54.555  130.936 1.00 53.23  ? 197 ASN D CA  1 
ATOM   6268  C C   . ASN D  2 213 ? 76.795  54.134  130.748 1.00 53.16  ? 197 ASN D C   1 
ATOM   6269  O O   . ASN D  2 213 ? 75.984  54.182  131.672 1.00 52.31  ? 197 ASN D O   1 
ATOM   6270  C CB  . ASN D  2 213 ? 78.685  54.205  132.356 1.00 55.22  ? 197 ASN D CB  1 
ATOM   6271  C CG  . ASN D  2 213 ? 80.057  54.756  132.688 1.00 57.96  ? 197 ASN D CG  1 
ATOM   6272  O OD1 . ASN D  2 213 ? 80.184  55.884  133.180 1.00 60.51  ? 197 ASN D OD1 1 
ATOM   6273  N ND2 . ASN D  2 213 ? 81.096  53.972  132.410 1.00 57.11  ? 197 ASN D ND2 1 
ATOM   6274  N N   . VAL D  2 214 ? 76.490  53.727  129.527 1.00 54.13  ? 198 VAL D N   1 
ATOM   6275  C CA  . VAL D  2 214 ? 75.158  53.277  129.179 1.00 56.07  ? 198 VAL D CA  1 
ATOM   6276  C C   . VAL D  2 214 ? 74.955  51.884  129.765 1.00 56.68  ? 198 VAL D C   1 
ATOM   6277  O O   . VAL D  2 214 ? 75.843  51.028  129.676 1.00 57.32  ? 198 VAL D O   1 
ATOM   6278  C CB  . VAL D  2 214 ? 75.000  53.226  127.670 1.00 55.79  ? 198 VAL D CB  1 
ATOM   6279  C CG1 . VAL D  2 214 ? 73.565  52.905  127.310 1.00 55.99  ? 198 VAL D CG1 1 
ATOM   6280  C CG2 . VAL D  2 214 ? 75.440  54.552  127.083 1.00 57.16  ? 198 VAL D CG2 1 
ATOM   6281  N N   . ASN D  2 215 ? 73.784  51.651  130.350 1.00 56.39  ? 199 ASN D N   1 
ATOM   6282  C CA  . ASN D  2 215 ? 73.527  50.375  130.977 1.00 56.03  ? 199 ASN D CA  1 
ATOM   6283  C C   . ASN D  2 215 ? 72.180  49.771  130.667 1.00 54.92  ? 199 ASN D C   1 
ATOM   6284  O O   . ASN D  2 215 ? 71.169  50.142  131.251 1.00 55.36  ? 199 ASN D O   1 
ATOM   6285  C CB  . ASN D  2 215 ? 73.665  50.523  132.487 1.00 60.41  ? 199 ASN D CB  1 
ATOM   6286  C CG  . ASN D  2 215 ? 74.199  49.272  133.149 1.00 63.26  ? 199 ASN D CG  1 
ATOM   6287  O OD1 . ASN D  2 215 ? 73.646  48.177  132.981 1.00 64.79  ? 199 ASN D OD1 1 
ATOM   6288  N ND2 . ASN D  2 215 ? 75.284  49.427  133.915 1.00 64.17  ? 199 ASN D ND2 1 
ATOM   6289  N N   . HIS D  2 216 ? 72.173  48.827  129.741 1.00 53.44  ? 200 HIS D N   1 
ATOM   6290  C CA  . HIS D  2 216 ? 70.955  48.130  129.386 1.00 51.52  ? 200 HIS D CA  1 
ATOM   6291  C C   . HIS D  2 216 ? 71.192  46.780  130.018 1.00 51.81  ? 200 HIS D C   1 
ATOM   6292  O O   . HIS D  2 216 ? 72.195  46.129  129.724 1.00 51.67  ? 200 HIS D O   1 
ATOM   6293  C CB  . HIS D  2 216 ? 70.835  47.994  127.868 1.00 49.18  ? 200 HIS D CB  1 
ATOM   6294  C CG  . HIS D  2 216 ? 69.549  47.379  127.411 1.00 46.31  ? 200 HIS D CG  1 
ATOM   6295  N ND1 . HIS D  2 216 ? 69.490  46.151  126.789 1.00 45.61  ? 200 HIS D ND1 1 
ATOM   6296  C CD2 . HIS D  2 216 ? 68.275  47.828  127.476 1.00 45.47  ? 200 HIS D CD2 1 
ATOM   6297  C CE1 . HIS D  2 216 ? 68.236  45.870  126.489 1.00 45.00  ? 200 HIS D CE1 1 
ATOM   6298  N NE2 . HIS D  2 216 ? 67.478  46.872  126.895 1.00 46.09  ? 200 HIS D NE2 1 
ATOM   6299  N N   . LYS D  2 217 ? 70.310  46.377  130.923 1.00 51.68  ? 201 LYS D N   1 
ATOM   6300  C CA  . LYS D  2 217 ? 70.472  45.087  131.567 1.00 52.30  ? 201 LYS D CA  1 
ATOM   6301  C C   . LYS D  2 217 ? 69.693  44.006  130.847 1.00 53.67  ? 201 LYS D C   1 
ATOM   6302  O O   . LYS D  2 217 ? 70.154  42.886  130.713 1.00 54.56  ? 201 LYS D O   1 
ATOM   6303  C CB  . LYS D  2 217 ? 70.051  45.148  133.036 1.00 51.29  ? 201 LYS D CB  1 
ATOM   6304  C CG  . LYS D  2 217 ? 71.157  45.632  133.969 1.00 50.11  ? 201 LYS D CG  1 
ATOM   6305  C CD  . LYS D  2 217 ? 70.916  45.215  135.416 1.00 48.55  ? 201 LYS D CD  1 
ATOM   6306  C CE  . LYS D  2 217 ? 69.768  45.984  136.046 1.00 49.08  ? 201 LYS D CE  1 
ATOM   6307  N NZ  . LYS D  2 217 ? 69.573  45.652  137.496 1.00 50.07  ? 201 LYS D NZ  1 
ATOM   6308  N N   . PRO D  2 218 ? 68.496  44.330  130.366 1.00 55.31  ? 202 PRO D N   1 
ATOM   6309  C CA  . PRO D  2 218 ? 67.680  43.346  129.659 1.00 55.76  ? 202 PRO D CA  1 
ATOM   6310  C C   . PRO D  2 218 ? 68.348  42.671  128.479 1.00 57.07  ? 202 PRO D C   1 
ATOM   6311  O O   . PRO D  2 218 ? 67.673  42.011  127.683 1.00 58.79  ? 202 PRO D O   1 
ATOM   6312  C CB  . PRO D  2 218 ? 66.471  44.153  129.244 1.00 55.71  ? 202 PRO D CB  1 
ATOM   6313  C CG  . PRO D  2 218 ? 66.284  45.049  130.434 1.00 57.60  ? 202 PRO D CG  1 
ATOM   6314  C CD  . PRO D  2 218 ? 67.703  45.527  130.689 1.00 56.87  ? 202 PRO D CD  1 
ATOM   6315  N N   . SER D  2 219 ? 69.662  42.832  128.348 1.00 56.78  ? 203 SER D N   1 
ATOM   6316  C CA  . SER D  2 219 ? 70.375  42.189  127.251 1.00 56.37  ? 203 SER D CA  1 
ATOM   6317  C C   . SER D  2 219 ? 71.855  42.096  127.549 1.00 56.94  ? 203 SER D C   1 
ATOM   6318  O O   . SER D  2 219 ? 72.664  41.885  126.647 1.00 57.60  ? 203 SER D O   1 
ATOM   6319  C CB  . SER D  2 219 ? 70.165  42.955  125.949 1.00 55.69  ? 203 SER D CB  1 
ATOM   6320  O OG  . SER D  2 219 ? 70.853  44.193  125.970 1.00 54.63  ? 203 SER D OG  1 
ATOM   6321  N N   . ASN D  2 220 ? 72.215  42.248  128.817 1.00 56.97  ? 204 ASN D N   1 
ATOM   6322  C CA  . ASN D  2 220 ? 73.617  42.179  129.205 1.00 57.79  ? 204 ASN D CA  1 
ATOM   6323  C C   . ASN D  2 220 ? 74.433  43.097  128.321 1.00 56.97  ? 204 ASN D C   1 
ATOM   6324  O O   . ASN D  2 220 ? 75.192  42.615  127.489 1.00 56.63  ? 204 ASN D O   1 
ATOM   6325  C CB  . ASN D  2 220 ? 74.163  40.760  129.033 1.00 60.19  ? 204 ASN D CB  1 
ATOM   6326  C CG  . ASN D  2 220 ? 74.435  40.067  130.354 1.00 61.83  ? 204 ASN D CG  1 
ATOM   6327  O OD1 . ASN D  2 220 ? 74.969  40.669  131.295 1.00 61.73  ? 204 ASN D OD1 1 
ATOM   6328  N ND2 . ASN D  2 220 ? 74.091  38.780  130.423 1.00 61.42  ? 204 ASN D ND2 1 
ATOM   6329  N N   . THR D  2 221 ? 74.269  44.408  128.482 1.00 56.76  ? 205 THR D N   1 
ATOM   6330  C CA  . THR D  2 221 ? 75.032  45.358  127.678 1.00 56.24  ? 205 THR D CA  1 
ATOM   6331  C C   . THR D  2 221 ? 75.697  46.440  128.543 1.00 55.71  ? 205 THR D C   1 
ATOM   6332  O O   . THR D  2 221 ? 75.033  47.356  129.030 1.00 55.29  ? 205 THR D O   1 
ATOM   6333  C CB  . THR D  2 221 ? 74.147  46.045  126.597 1.00 56.02  ? 205 THR D CB  1 
ATOM   6334  O OG1 . THR D  2 221 ? 73.003  45.231  126.313 1.00 55.64  ? 205 THR D OG1 1 
ATOM   6335  C CG2 . THR D  2 221 ? 74.945  46.229  125.299 1.00 55.66  ? 205 THR D CG2 1 
ATOM   6336  N N   . LYS D  2 222 ? 77.011  46.315  128.733 1.00 55.05  ? 206 LYS D N   1 
ATOM   6337  C CA  . LYS D  2 222 ? 77.783  47.271  129.518 1.00 54.34  ? 206 LYS D CA  1 
ATOM   6338  C C   . LYS D  2 222 ? 78.650  48.063  128.561 1.00 52.69  ? 206 LYS D C   1 
ATOM   6339  O O   . LYS D  2 222 ? 79.823  47.755  128.348 1.00 52.22  ? 206 LYS D O   1 
ATOM   6340  C CB  . LYS D  2 222 ? 78.656  46.546  130.559 1.00 56.71  ? 206 LYS D CB  1 
ATOM   6341  C CG  . LYS D  2 222 ? 78.390  46.996  132.022 1.00 58.74  ? 206 LYS D CG  1 
ATOM   6342  C CD  . LYS D  2 222 ? 78.894  45.973  133.062 1.00 59.13  ? 206 LYS D CD  1 
ATOM   6343  C CE  . LYS D  2 222 ? 78.594  46.416  134.500 1.00 59.44  ? 206 LYS D CE  1 
ATOM   6344  N NZ  . LYS D  2 222 ? 78.933  45.371  135.522 1.00 58.68  ? 206 LYS D NZ  1 
ATOM   6345  N N   . VAL D  2 223 ? 78.050  49.082  127.973 1.00 50.80  ? 207 VAL D N   1 
ATOM   6346  C CA  . VAL D  2 223 ? 78.752  49.925  127.031 1.00 50.24  ? 207 VAL D CA  1 
ATOM   6347  C C   . VAL D  2 223 ? 79.222  51.210  127.716 1.00 51.04  ? 207 VAL D C   1 
ATOM   6348  O O   . VAL D  2 223 ? 78.533  51.760  128.584 1.00 51.29  ? 207 VAL D O   1 
ATOM   6349  C CB  . VAL D  2 223 ? 77.837  50.291  125.858 1.00 49.57  ? 207 VAL D CB  1 
ATOM   6350  C CG1 . VAL D  2 223 ? 78.582  51.138  124.867 1.00 47.87  ? 207 VAL D CG1 1 
ATOM   6351  C CG2 . VAL D  2 223 ? 77.302  49.029  125.209 1.00 50.27  ? 207 VAL D CG2 1 
ATOM   6352  N N   . ASP D  2 224 ? 80.406  51.672  127.326 1.00 50.85  ? 208 ASP D N   1 
ATOM   6353  C CA  . ASP D  2 224 ? 81.001  52.887  127.868 1.00 50.56  ? 208 ASP D CA  1 
ATOM   6354  C C   . ASP D  2 224 ? 81.709  53.553  126.701 1.00 49.04  ? 208 ASP D C   1 
ATOM   6355  O O   . ASP D  2 224 ? 82.657  52.986  126.167 1.00 47.21  ? 208 ASP D O   1 
ATOM   6356  C CB  . ASP D  2 224 ? 82.034  52.547  128.957 1.00 54.52  ? 208 ASP D CB  1 
ATOM   6357  C CG  . ASP D  2 224 ? 81.407  52.315  130.350 1.00 56.82  ? 208 ASP D CG  1 
ATOM   6358  O OD1 . ASP D  2 224 ? 82.180  52.169  131.324 1.00 57.06  ? 208 ASP D OD1 1 
ATOM   6359  O OD2 . ASP D  2 224 ? 80.161  52.276  130.484 1.00 58.18  ? 208 ASP D OD2 1 
ATOM   6360  N N   . LYS D  2 225 ? 81.248  54.745  126.311 1.00 48.39  ? 209 LYS D N   1 
ATOM   6361  C CA  . LYS D  2 225 ? 81.838  55.478  125.182 1.00 46.74  ? 209 LYS D CA  1 
ATOM   6362  C C   . LYS D  2 225 ? 82.331  56.885  125.558 1.00 46.05  ? 209 LYS D C   1 
ATOM   6363  O O   . LYS D  2 225 ? 81.692  57.610  126.332 1.00 44.09  ? 209 LYS D O   1 
ATOM   6364  C CB  . LYS D  2 225 ? 80.827  55.585  124.035 1.00 46.40  ? 209 LYS D CB  1 
ATOM   6365  C CG  . LYS D  2 225 ? 81.440  55.664  122.650 1.00 47.45  ? 209 LYS D CG  1 
ATOM   6366  C CD  . LYS D  2 225 ? 81.654  54.272  122.060 1.00 49.64  ? 209 LYS D CD  1 
ATOM   6367  C CE  . LYS D  2 225 ? 82.279  54.318  120.660 1.00 50.25  ? 209 LYS D CE  1 
ATOM   6368  N NZ  . LYS D  2 225 ? 83.744  54.637  120.689 1.00 50.78  ? 209 LYS D NZ  1 
ATOM   6369  N N   . LYS D  2 226 ? 83.476  57.251  124.980 1.00 46.17  ? 210 LYS D N   1 
ATOM   6370  C CA  . LYS D  2 226 ? 84.136  58.540  125.210 1.00 45.13  ? 210 LYS D CA  1 
ATOM   6371  C C   . LYS D  2 226 ? 83.573  59.696  124.373 1.00 42.35  ? 210 LYS D C   1 
ATOM   6372  O O   . LYS D  2 226 ? 83.330  59.545  123.172 1.00 42.36  ? 210 LYS D O   1 
ATOM   6373  C CB  . LYS D  2 226 ? 85.645  58.396  124.943 1.00 46.99  ? 210 LYS D CB  1 
ATOM   6374  C CG  . LYS D  2 226 ? 86.406  59.719  124.955 1.00 49.41  ? 210 LYS D CG  1 
ATOM   6375  C CD  . LYS D  2 226 ? 87.858  59.563  125.347 1.00 50.37  ? 210 LYS D CD  1 
ATOM   6376  C CE  . LYS D  2 226 ? 88.481  60.933  125.543 1.00 52.39  ? 210 LYS D CE  1 
ATOM   6377  N NZ  . LYS D  2 226 ? 89.909  60.835  125.943 1.00 56.48  ? 210 LYS D NZ  1 
ATOM   6378  N N   . VAL D  2 227 ? 83.391  60.852  125.005 1.00 37.61  ? 211 VAL D N   1 
ATOM   6379  C CA  . VAL D  2 227 ? 82.848  61.992  124.305 1.00 34.25  ? 211 VAL D CA  1 
ATOM   6380  C C   . VAL D  2 227 ? 83.855  63.112  124.138 1.00 35.45  ? 211 VAL D C   1 
ATOM   6381  O O   . VAL D  2 227 ? 83.916  64.050  124.924 1.00 34.54  ? 211 VAL D O   1 
ATOM   6382  C CB  . VAL D  2 227 ? 81.601  62.499  125.016 1.00 31.18  ? 211 VAL D CB  1 
ATOM   6383  C CG1 . VAL D  2 227 ? 81.024  63.674  124.295 1.00 28.15  ? 211 VAL D CG1 1 
ATOM   6384  C CG2 . VAL D  2 227 ? 80.597  61.398  125.089 1.00 28.38  ? 211 VAL D CG2 1 
ATOM   6385  N N   . GLU D  2 228 ? 84.639  63.002  123.076 1.00 38.00  ? 212 GLU D N   1 
ATOM   6386  C CA  . GLU D  2 228 ? 85.664  63.985  122.738 1.00 40.71  ? 212 GLU D CA  1 
ATOM   6387  C C   . GLU D  2 228 ? 85.139  65.158  121.906 1.00 39.86  ? 212 GLU D C   1 
ATOM   6388  O O   . GLU D  2 228 ? 84.148  65.038  121.213 1.00 40.88  ? 212 GLU D O   1 
ATOM   6389  C CB  . GLU D  2 228 ? 86.799  63.283  121.981 1.00 44.44  ? 212 GLU D CB  1 
ATOM   6390  C CG  . GLU D  2 228 ? 87.838  62.635  122.897 1.00 50.85  ? 212 GLU D CG  1 
ATOM   6391  C CD  . GLU D  2 228 ? 88.502  61.410  122.286 1.00 54.60  ? 212 GLU D CD  1 
ATOM   6392  O OE1 . GLU D  2 228 ? 89.025  61.504  121.149 1.00 58.31  ? 212 GLU D OE1 1 
ATOM   6393  O OE2 . GLU D  2 228 ? 88.509  60.348  122.950 1.00 55.92  ? 212 GLU D OE2 1 
ATOM   6394  N N   . PRO D  2 229 ? 85.806  66.311  121.979 1.00 39.19  ? 213 PRO D N   1 
ATOM   6395  C CA  . PRO D  2 229 ? 85.503  67.557  121.278 1.00 38.66  ? 213 PRO D CA  1 
ATOM   6396  C C   . PRO D  2 229 ? 85.407  67.367  119.779 1.00 39.35  ? 213 PRO D C   1 
ATOM   6397  O O   . PRO D  2 229 ? 84.746  68.206  119.130 1.00 40.39  ? 213 PRO D O   1 
ATOM   6398  C CB  . PRO D  2 229 ? 86.679  68.435  121.637 1.00 39.85  ? 213 PRO D CB  1 
ATOM   6399  C CG  . PRO D  2 229 ? 86.977  68.007  123.017 1.00 41.81  ? 213 PRO D CG  1 
ATOM   6400  C CD  . PRO D  2 229 ? 86.925  66.513  122.908 1.00 40.75  ? 213 PRO D CD  1 
ATOM   6401  N N   . ILE E  1 2   ? 36.128  21.978  69.229  1.00 62.42  ? 2   ILE E N   1 
ATOM   6402  C CA  . ILE E  1 2   ? 35.501  22.140  67.893  1.00 63.37  ? 2   ILE E CA  1 
ATOM   6403  C C   . ILE E  1 2   ? 34.749  20.885  67.486  1.00 64.07  ? 2   ILE E C   1 
ATOM   6404  O O   . ILE E  1 2   ? 34.366  20.751  66.320  1.00 64.41  ? 2   ILE E O   1 
ATOM   6405  C CB  . ILE E  1 2   ? 36.550  22.402  66.767  1.00 62.84  ? 2   ILE E CB  1 
ATOM   6406  C CG1 . ILE E  1 2   ? 37.418  21.158  66.557  1.00 62.79  ? 2   ILE E CG1 1 
ATOM   6407  C CG2 . ILE E  1 2   ? 37.410  23.594  67.112  1.00 62.70  ? 2   ILE E CG2 1 
ATOM   6408  C CD1 . ILE E  1 2   ? 38.214  21.148  65.258  1.00 62.93  ? 2   ILE E CD1 1 
ATOM   6409  N N   . GLN E  1 3   ? 34.532  19.962  68.417  1.00 63.39  ? 3   GLN E N   1 
ATOM   6410  C CA  . GLN E  1 3   ? 33.858  18.741  68.018  1.00 63.82  ? 3   GLN E CA  1 
ATOM   6411  C C   . GLN E  1 3   ? 33.285  17.873  69.116  1.00 63.35  ? 3   GLN E C   1 
ATOM   6412  O O   . GLN E  1 3   ? 33.773  16.765  69.373  1.00 62.87  ? 3   GLN E O   1 
ATOM   6413  C CB  . GLN E  1 3   ? 34.803  17.906  67.156  1.00 65.45  ? 3   GLN E CB  1 
ATOM   6414  C CG  . GLN E  1 3   ? 34.094  17.231  66.019  1.00 66.59  ? 3   GLN E CG  1 
ATOM   6415  C CD  . GLN E  1 3   ? 33.217  18.204  65.270  1.00 67.40  ? 3   GLN E CD  1 
ATOM   6416  O OE1 . GLN E  1 3   ? 33.709  19.096  64.570  1.00 67.94  ? 3   GLN E OE1 1 
ATOM   6417  N NE2 . GLN E  1 3   ? 31.904  18.053  65.427  1.00 67.97  ? 3   GLN E NE2 1 
ATOM   6418  N N   . MET E  1 4   ? 32.222  18.368  69.742  1.00 62.96  ? 4   MET E N   1 
ATOM   6419  C CA  . MET E  1 4   ? 31.569  17.629  70.812  1.00 62.04  ? 4   MET E CA  1 
ATOM   6420  C C   . MET E  1 4   ? 30.661  16.600  70.166  1.00 60.72  ? 4   MET E C   1 
ATOM   6421  O O   . MET E  1 4   ? 29.739  16.957  69.435  1.00 60.46  ? 4   MET E O   1 
ATOM   6422  C CB  . MET E  1 4   ? 30.750  18.575  71.710  1.00 62.03  ? 4   MET E CB  1 
ATOM   6423  C CG  . MET E  1 4   ? 31.529  19.782  72.239  1.00 60.91  ? 4   MET E CG  1 
ATOM   6424  S SD  . MET E  1 4   ? 32.952  19.382  73.326  1.00 60.50  ? 4   MET E SD  1 
ATOM   6425  C CE  . MET E  1 4   ? 32.143  19.379  74.928  1.00 59.51  ? 4   MET E CE  1 
ATOM   6426  N N   . THR E  1 5   ? 30.945  15.329  70.430  1.00 59.35  ? 5   THR E N   1 
ATOM   6427  C CA  . THR E  1 5   ? 30.165  14.224  69.885  1.00 59.36  ? 5   THR E CA  1 
ATOM   6428  C C   . THR E  1 5   ? 29.192  13.659  70.949  1.00 61.18  ? 5   THR E C   1 
ATOM   6429  O O   . THR E  1 5   ? 29.509  13.736  72.122  1.00 61.97  ? 5   THR E O   1 
ATOM   6430  C CB  . THR E  1 5   ? 31.084  13.140  69.393  1.00 58.40  ? 5   THR E CB  1 
ATOM   6431  O OG1 . THR E  1 5   ? 31.772  13.605  68.231  1.00 57.70  ? 5   THR E OG1 1 
ATOM   6432  C CG2 . THR E  1 5   ? 30.298  11.897  69.048  1.00 60.28  ? 5   THR E CG2 1 
ATOM   6433  N N   . GLN E  1 6   ? 28.024  13.070  70.616  1.00 62.33  ? 6   GLN E N   1 
ATOM   6434  C CA  . GLN E  1 6   ? 26.991  12.644  71.705  1.00 63.47  ? 6   GLN E CA  1 
ATOM   6435  C C   . GLN E  1 6   ? 25.968  11.894  70.984  1.00 63.25  ? 6   GLN E C   1 
ATOM   6436  O O   . GLN E  1 6   ? 25.401  12.441  70.075  1.00 63.52  ? 6   GLN E O   1 
ATOM   6437  C CB  . GLN E  1 6   ? 26.100  13.729  72.151  1.00 64.75  ? 6   GLN E CB  1 
ATOM   6438  C CG  . GLN E  1 6   ? 26.701  14.671  73.044  1.00 66.69  ? 6   GLN E CG  1 
ATOM   6439  C CD  . GLN E  1 6   ? 25.763  15.875  73.152  1.00 67.58  ? 6   GLN E CD  1 
ATOM   6440  O OE1 . GLN E  1 6   ? 25.619  16.565  72.201  1.00 69.00  ? 6   GLN E OE1 1 
ATOM   6441  N NE2 . GLN E  1 6   ? 25.138  16.106  74.281  1.00 67.26  ? 6   GLN E NE2 1 
ATOM   6442  N N   . SER E  1 7   ? 25.513  10.753  71.344  1.00 62.64  ? 7   SER E N   1 
ATOM   6443  C CA  . SER E  1 7   ? 24.794  10.278  70.185  1.00 60.57  ? 7   SER E CA  1 
ATOM   6444  C C   . SER E  1 7   ? 23.293  9.903   70.020  1.00 59.58  ? 7   SER E C   1 
ATOM   6445  O O   . SER E  1 7   ? 23.189  8.740   70.019  1.00 59.07  ? 7   SER E O   1 
ATOM   6446  C CB  . SER E  1 7   ? 25.461  8.948   69.841  1.00 61.23  ? 7   SER E CB  1 
ATOM   6447  O OG  . SER E  1 7   ? 25.234  8.023   70.915  1.00 61.00  ? 7   SER E OG  1 
ATOM   6448  N N   . PRO E  1 8   ? 22.143  10.703  69.948  1.00 58.69  ? 8   PRO E N   1 
ATOM   6449  C CA  . PRO E  1 8   ? 21.399  11.988  70.141  1.00 57.32  ? 8   PRO E CA  1 
ATOM   6450  C C   . PRO E  1 8   ? 19.960  11.587  70.269  1.00 55.38  ? 8   PRO E C   1 
ATOM   6451  O O   . PRO E  1 8   ? 18.989  12.291  69.887  1.00 54.55  ? 8   PRO E O   1 
ATOM   6452  C CB  . PRO E  1 8   ? 21.543  12.771  68.812  1.00 58.54  ? 8   PRO E CB  1 
ATOM   6453  C CG  . PRO E  1 8   ? 22.354  11.936  68.039  1.00 57.85  ? 8   PRO E CG  1 
ATOM   6454  C CD  . PRO E  1 8   ? 22.074  10.513  68.521  1.00 58.47  ? 8   PRO E CD  1 
ATOM   6455  N N   . SER E  1 9   ? 19.954  10.395  70.883  1.00 52.36  ? 10  SER E N   1 
ATOM   6456  C CA  . SER E  1 9   ? 18.877  9.477   71.261  1.00 49.80  ? 10  SER E CA  1 
ATOM   6457  C C   . SER E  1 9   ? 19.318  8.329   72.210  1.00 47.81  ? 10  SER E C   1 
ATOM   6458  O O   . SER E  1 9   ? 20.424  7.798   72.118  1.00 46.61  ? 10  SER E O   1 
ATOM   6459  C CB  . SER E  1 9   ? 18.268  8.906   69.970  1.00 50.94  ? 10  SER E CB  1 
ATOM   6460  O OG  . SER E  1 9   ? 17.140  8.090   70.245  1.00 52.16  ? 10  SER E OG  1 
ATOM   6461  N N   . LEU E  1 10  ? 18.409  7.981   73.115  1.00 47.10  ? 11  LEU E N   1 
ATOM   6462  C CA  . LEU E  1 10  ? 18.619  6.955   74.128  1.00 46.39  ? 11  LEU E CA  1 
ATOM   6463  C C   . LEU E  1 10  ? 17.286  6.692   74.850  1.00 46.07  ? 11  LEU E C   1 
ATOM   6464  O O   . LEU E  1 10  ? 16.776  7.540   75.582  1.00 45.71  ? 11  LEU E O   1 
ATOM   6465  C CB  . LEU E  1 10  ? 19.686  7.449   75.116  1.00 45.84  ? 11  LEU E CB  1 
ATOM   6466  C CG  . LEU E  1 10  ? 20.208  6.558   76.239  1.00 43.26  ? 11  LEU E CG  1 
ATOM   6467  C CD1 . LEU E  1 10  ? 19.142  6.387   77.298  1.00 41.85  ? 11  LEU E CD1 1 
ATOM   6468  C CD2 . LEU E  1 10  ? 20.645  5.226   75.657  1.00 42.90  ? 11  LEU E CD2 1 
ATOM   6469  N N   . SER E  1 11  ? 16.709  5.522   74.623  1.00 46.57  ? 12  SER E N   1 
ATOM   6470  C CA  . SER E  1 11  ? 15.447  5.191   75.268  1.00 47.19  ? 12  SER E CA  1 
ATOM   6471  C C   . SER E  1 11  ? 15.830  4.542   76.565  1.00 46.10  ? 12  SER E C   1 
ATOM   6472  O O   . SER E  1 11  ? 16.877  3.896   76.658  1.00 45.30  ? 12  SER E O   1 
ATOM   6473  C CB  . SER E  1 11  ? 14.634  4.205   74.432  1.00 50.06  ? 12  SER E CB  1 
ATOM   6474  O OG  . SER E  1 11  ? 14.430  4.687   73.111  1.00 54.40  ? 12  SER E OG  1 
ATOM   6475  N N   . ALA E  1 12  ? 14.978  4.697   77.563  1.00 44.35  ? 13  ALA E N   1 
ATOM   6476  C CA  . ALA E  1 12  ? 15.274  4.138   78.863  1.00 43.89  ? 13  ALA E CA  1 
ATOM   6477  C C   . ALA E  1 12  ? 14.000  3.955   79.658  1.00 42.71  ? 13  ALA E C   1 
ATOM   6478  O O   . ALA E  1 12  ? 12.941  4.394   79.231  1.00 42.81  ? 13  ALA E O   1 
ATOM   6479  C CB  . ALA E  1 12  ? 16.241  5.061   79.606  1.00 44.82  ? 13  ALA E CB  1 
ATOM   6480  N N   . SER E  1 13  ? 14.113  3.296   80.807  1.00 41.39  ? 14  SER E N   1 
ATOM   6481  C CA  . SER E  1 13  ? 12.970  3.047   81.675  1.00 41.44  ? 14  SER E CA  1 
ATOM   6482  C C   . SER E  1 13  ? 13.142  3.875   82.921  1.00 41.19  ? 14  SER E C   1 
ATOM   6483  O O   . SER E  1 13  ? 14.245  4.270   83.249  1.00 40.15  ? 14  SER E O   1 
ATOM   6484  C CB  . SER E  1 13  ? 12.899  1.569   82.065  1.00 40.82  ? 14  SER E CB  1 
ATOM   6485  O OG  . SER E  1 13  ? 13.016  0.726   80.936  1.00 40.76  ? 14  SER E OG  1 
ATOM   6486  N N   . VAL E  1 14  ? 12.059  4.139   83.630  1.00 44.00  ? 15  VAL E N   1 
ATOM   6487  C CA  . VAL E  1 14  ? 12.194  4.933   84.842  1.00 48.11  ? 15  VAL E CA  1 
ATOM   6488  C C   . VAL E  1 14  ? 12.978  4.087   85.874  1.00 49.69  ? 15  VAL E C   1 
ATOM   6489  O O   . VAL E  1 14  ? 12.919  2.854   85.856  1.00 49.73  ? 15  VAL E O   1 
ATOM   6490  C CB  . VAL E  1 14  ? 10.802  5.361   85.403  1.00 48.52  ? 15  VAL E CB  1 
ATOM   6491  C CG1 . VAL E  1 14  ? 10.951  6.632   86.231  1.00 48.01  ? 15  VAL E CG1 1 
ATOM   6492  C CG2 . VAL E  1 14  ? 9.805   5.582   84.259  1.00 47.35  ? 15  VAL E CG2 1 
ATOM   6493  N N   . GLY E  1 15  ? 13.730  4.754   86.748  1.00 50.70  ? 16  GLY E N   1 
ATOM   6494  C CA  . GLY E  1 15  ? 14.522  4.041   87.732  1.00 51.00  ? 16  GLY E CA  1 
ATOM   6495  C C   . GLY E  1 15  ? 15.882  3.640   87.182  1.00 52.58  ? 16  GLY E C   1 
ATOM   6496  O O   . GLY E  1 15  ? 16.842  3.484   87.940  1.00 53.15  ? 16  GLY E O   1 
ATOM   6497  N N   . ASP E  1 16  ? 15.961  3.489   85.858  1.00 52.96  ? 17  ASP E N   1 
ATOM   6498  C CA  . ASP E  1 16  ? 17.187  3.097   85.151  1.00 52.62  ? 17  ASP E CA  1 
ATOM   6499  C C   . ASP E  1 16  ? 18.398  3.990   85.372  1.00 51.20  ? 17  ASP E C   1 
ATOM   6500  O O   . ASP E  1 16  ? 18.256  5.153   85.713  1.00 51.86  ? 17  ASP E O   1 
ATOM   6501  C CB  . ASP E  1 16  ? 16.899  3.019   83.658  1.00 55.31  ? 17  ASP E CB  1 
ATOM   6502  C CG  . ASP E  1 16  ? 15.910  1.922   83.317  1.00 57.95  ? 17  ASP E CG  1 
ATOM   6503  O OD1 . ASP E  1 16  ? 15.006  1.670   84.156  1.00 59.00  ? 17  ASP E OD1 1 
ATOM   6504  O OD2 . ASP E  1 16  ? 16.034  1.327   82.212  1.00 57.97  ? 17  ASP E OD2 1 
ATOM   6505  N N   . ARG E  1 17  ? 19.589  3.440   85.155  1.00 50.35  ? 18  ARG E N   1 
ATOM   6506  C CA  . ARG E  1 17  ? 20.825  4.191   85.346  1.00 50.34  ? 18  ARG E CA  1 
ATOM   6507  C C   . ARG E  1 17  ? 21.544  4.525   84.037  1.00 49.96  ? 18  ARG E C   1 
ATOM   6508  O O   . ARG E  1 17  ? 22.290  3.722   83.500  1.00 50.29  ? 18  ARG E O   1 
ATOM   6509  C CB  . ARG E  1 17  ? 21.770  3.415   86.259  1.00 50.57  ? 18  ARG E CB  1 
ATOM   6510  C CG  . ARG E  1 17  ? 22.977  4.225   86.676  1.00 53.01  ? 18  ARG E CG  1 
ATOM   6511  C CD  . ARG E  1 17  ? 23.866  3.505   87.681  1.00 55.08  ? 18  ARG E CD  1 
ATOM   6512  N NE  . ARG E  1 17  ? 24.756  4.451   88.347  1.00 56.84  ? 18  ARG E NE  1 
ATOM   6513  C CZ  . ARG E  1 17  ? 24.383  5.254   89.348  1.00 59.28  ? 18  ARG E CZ  1 
ATOM   6514  N NH1 . ARG E  1 17  ? 23.131  5.211   89.803  1.00 57.73  ? 18  ARG E NH1 1 
ATOM   6515  N NH2 . ARG E  1 17  ? 25.257  6.109   89.890  1.00 58.94  ? 18  ARG E NH2 1 
ATOM   6516  N N   . VAL E  1 18  ? 21.333  5.736   83.543  1.00 50.05  ? 19  VAL E N   1 
ATOM   6517  C CA  . VAL E  1 18  ? 21.939  6.191   82.301  1.00 49.93  ? 19  VAL E CA  1 
ATOM   6518  C C   . VAL E  1 18  ? 23.242  6.964   82.536  1.00 49.14  ? 19  VAL E C   1 
ATOM   6519  O O   . VAL E  1 18  ? 23.467  7.524   83.606  1.00 49.24  ? 19  VAL E O   1 
ATOM   6520  C CB  . VAL E  1 18  ? 20.943  7.105   81.523  1.00 51.51  ? 19  VAL E CB  1 
ATOM   6521  C CG1 . VAL E  1 18  ? 21.575  7.616   80.219  1.00 50.83  ? 19  VAL E CG1 1 
ATOM   6522  C CG2 . VAL E  1 18  ? 19.650  6.336   81.238  1.00 52.15  ? 19  VAL E CG2 1 
ATOM   6523  N N   . THR E  1 19  ? 24.087  6.992   81.511  1.00 47.95  ? 20  THR E N   1 
ATOM   6524  C CA  . THR E  1 19  ? 25.365  7.688   81.546  1.00 45.43  ? 20  THR E CA  1 
ATOM   6525  C C   . THR E  1 19  ? 25.629  8.229   80.135  1.00 45.33  ? 20  THR E C   1 
ATOM   6526  O O   . THR E  1 19  ? 25.955  7.476   79.212  1.00 44.12  ? 20  THR E O   1 
ATOM   6527  C CB  . THR E  1 19  ? 26.471  6.729   81.922  1.00 44.93  ? 20  THR E CB  1 
ATOM   6528  O OG1 . THR E  1 19  ? 26.092  6.002   83.093  1.00 43.25  ? 20  THR E OG1 1 
ATOM   6529  C CG2 . THR E  1 19  ? 27.729  7.480   82.189  1.00 46.16  ? 20  THR E CG2 1 
ATOM   6530  N N   . ILE E  1 20  ? 25.470  9.537   79.972  1.00 45.23  ? 21  ILE E N   1 
ATOM   6531  C CA  . ILE E  1 20  ? 25.657  10.176  78.674  1.00 44.84  ? 21  ILE E CA  1 
ATOM   6532  C C   . ILE E  1 20  ? 27.062  10.722  78.489  1.00 43.97  ? 21  ILE E C   1 
ATOM   6533  O O   . ILE E  1 20  ? 27.525  11.558  79.263  1.00 44.33  ? 21  ILE E O   1 
ATOM   6534  C CB  . ILE E  1 20  ? 24.664  11.338  78.472  1.00 45.16  ? 21  ILE E CB  1 
ATOM   6535  C CG1 . ILE E  1 20  ? 23.310  11.001  79.097  1.00 45.18  ? 21  ILE E CG1 1 
ATOM   6536  C CG2 . ILE E  1 20  ? 24.460  11.576  76.993  1.00 45.88  ? 21  ILE E CG2 1 
ATOM   6537  C CD1 . ILE E  1 20  ? 22.275  12.105  78.947  1.00 43.88  ? 21  ILE E CD1 1 
ATOM   6538  N N   . THR E  1 21  ? 27.733  10.255  77.446  1.00 43.88  ? 22  THR E N   1 
ATOM   6539  C CA  . THR E  1 21  ? 29.087  10.692  77.170  1.00 45.32  ? 22  THR E CA  1 
ATOM   6540  C C   . THR E  1 21  ? 29.227  11.623  75.968  1.00 45.90  ? 22  THR E C   1 
ATOM   6541  O O   . THR E  1 21  ? 28.704  11.370  74.899  1.00 45.29  ? 22  THR E O   1 
ATOM   6542  C CB  . THR E  1 21  ? 30.019  9.487   76.980  1.00 46.19  ? 22  THR E CB  1 
ATOM   6543  O OG1 . THR E  1 21  ? 30.940  9.766   75.915  1.00 48.81  ? 22  THR E OG1 1 
ATOM   6544  C CG2 . THR E  1 21  ? 29.217  8.226   76.671  1.00 45.75  ? 22  THR E CG2 1 
ATOM   6545  N N   . CYS E  1 22  ? 29.955  12.706  76.182  1.00 47.67  ? 23  CYS E N   1 
ATOM   6546  C CA  . CYS E  1 22  ? 30.229  13.733  75.196  1.00 50.14  ? 23  CYS E CA  1 
ATOM   6547  C C   . CYS E  1 22  ? 31.732  13.560  74.952  1.00 50.61  ? 23  CYS E C   1 
ATOM   6548  O O   . CYS E  1 22  ? 32.441  13.104  75.841  1.00 50.68  ? 23  CYS E O   1 
ATOM   6549  C CB  . CYS E  1 22  ? 29.915  15.090  75.854  1.00 53.64  ? 23  CYS E CB  1 
ATOM   6550  S SG  . CYS E  1 22  ? 30.009  16.677  74.933  1.00 61.30  ? 23  CYS E SG  1 
ATOM   6551  N N   . ARG E  1 23  ? 32.216  13.890  73.756  1.00 51.89  ? 24  ARG E N   1 
ATOM   6552  C CA  . ARG E  1 23  ? 33.648  13.782  73.432  1.00 51.93  ? 24  ARG E CA  1 
ATOM   6553  C C   . ARG E  1 23  ? 34.071  15.008  72.635  1.00 52.73  ? 24  ARG E C   1 
ATOM   6554  O O   . ARG E  1 23  ? 33.466  15.344  71.619  1.00 52.81  ? 24  ARG E O   1 
ATOM   6555  C CB  . ARG E  1 23  ? 33.946  12.496  72.645  1.00 51.70  ? 24  ARG E CB  1 
ATOM   6556  C CG  . ARG E  1 23  ? 34.562  11.383  73.496  1.00 50.14  ? 24  ARG E CG  1 
ATOM   6557  C CD  . ARG E  1 23  ? 34.066  9.992   73.094  1.00 49.61  ? 24  ARG E CD  1 
ATOM   6558  N NE  . ARG E  1 23  ? 34.543  8.956   74.014  1.00 48.84  ? 24  ARG E NE  1 
ATOM   6559  C CZ  . ARG E  1 23  ? 34.109  7.695   74.038  1.00 47.94  ? 24  ARG E CZ  1 
ATOM   6560  N NH1 . ARG E  1 23  ? 33.173  7.299   73.187  1.00 47.42  ? 24  ARG E NH1 1 
ATOM   6561  N NH2 . ARG E  1 23  ? 34.611  6.823   74.914  1.00 44.59  ? 24  ARG E NH2 1 
ATOM   6562  N N   . ALA E  1 24  ? 35.115  15.673  73.116  1.00 54.20  ? 25  ALA E N   1 
ATOM   6563  C CA  . ALA E  1 24  ? 35.619  16.900  72.503  1.00 55.37  ? 25  ALA E CA  1 
ATOM   6564  C C   . ALA E  1 24  ? 36.812  16.717  71.564  1.00 55.61  ? 25  ALA E C   1 
ATOM   6565  O O   . ALA E  1 24  ? 37.762  15.999  71.870  1.00 55.03  ? 25  ALA E O   1 
ATOM   6566  C CB  . ALA E  1 24  ? 35.972  17.902  73.603  1.00 55.25  ? 25  ALA E CB  1 
ATOM   6567  N N   . SER E  1 25  ? 36.752  17.400  70.428  1.00 56.49  ? 26  SER E N   1 
ATOM   6568  C CA  . SER E  1 25  ? 37.792  17.323  69.417  1.00 57.97  ? 26  SER E CA  1 
ATOM   6569  C C   . SER E  1 25  ? 39.164  17.100  70.022  1.00 60.02  ? 26  SER E C   1 
ATOM   6570  O O   . SER E  1 25  ? 39.913  16.241  69.566  1.00 59.77  ? 26  SER E O   1 
ATOM   6571  C CB  . SER E  1 25  ? 37.779  18.600  68.600  1.00 56.67  ? 26  SER E CB  1 
ATOM   6572  O OG  . SER E  1 25  ? 36.813  19.480  69.138  1.00 56.45  ? 26  SER E OG  1 
ATOM   6573  N N   . GLN E  1 26  ? 39.491  17.874  71.051  1.00 63.11  ? 27  GLN E N   1 
ATOM   6574  C CA  . GLN E  1 26  ? 40.788  17.755  71.720  1.00 66.08  ? 27  GLN E CA  1 
ATOM   6575  C C   . GLN E  1 26  ? 40.697  18.094  73.211  1.00 66.24  ? 27  GLN E C   1 
ATOM   6576  O O   . GLN E  1 26  ? 39.712  18.676  73.673  1.00 65.85  ? 27  GLN E O   1 
ATOM   6577  C CB  . GLN E  1 26  ? 41.836  18.665  71.057  1.00 68.40  ? 27  GLN E CB  1 
ATOM   6578  C CG  . GLN E  1 26  ? 42.118  18.372  69.579  1.00 71.81  ? 27  GLN E CG  1 
ATOM   6579  C CD  . GLN E  1 26  ? 41.047  18.926  68.648  1.00 74.04  ? 27  GLN E CD  1 
ATOM   6580  O OE1 . GLN E  1 26  ? 40.736  20.121  68.681  1.00 74.88  ? 27  GLN E OE1 1 
ATOM   6581  N NE2 . GLN E  1 26  ? 40.481  18.059  67.808  1.00 75.57  ? 27  GLN E NE2 1 
ATOM   6582  N N   . SER E  1 27  ? 41.737  17.729  73.955  1.00 66.55  ? 28  SER E N   1 
ATOM   6583  C CA  . SER E  1 27  ? 41.768  17.972  75.393  1.00 66.30  ? 28  SER E CA  1 
ATOM   6584  C C   . SER E  1 27  ? 41.305  19.362  75.776  1.00 65.24  ? 28  SER E C   1 
ATOM   6585  O O   . SER E  1 27  ? 41.983  20.355  75.517  1.00 64.89  ? 28  SER E O   1 
ATOM   6586  C CB  . SER E  1 27  ? 43.170  17.744  75.953  1.00 67.56  ? 28  SER E CB  1 
ATOM   6587  O OG  . SER E  1 27  ? 43.251  18.183  77.299  1.00 67.18  ? 28  SER E OG  1 
ATOM   6588  N N   . ILE E  1 28  ? 40.134  19.415  76.392  1.00 63.95  ? 29  ILE E N   1 
ATOM   6589  C CA  . ILE E  1 28  ? 39.567  20.666  76.836  1.00 63.08  ? 29  ILE E CA  1 
ATOM   6590  C C   . ILE E  1 28  ? 39.653  20.679  78.357  1.00 63.77  ? 29  ILE E C   1 
ATOM   6591  O O   . ILE E  1 28  ? 39.232  21.639  79.015  1.00 64.97  ? 29  ILE E O   1 
ATOM   6592  C CB  . ILE E  1 28  ? 38.095  20.813  76.374  1.00 62.28  ? 29  ILE E CB  1 
ATOM   6593  C CG1 . ILE E  1 28  ? 37.325  19.517  76.637  1.00 61.76  ? 29  ILE E CG1 1 
ATOM   6594  C CG2 . ILE E  1 28  ? 38.049  21.179  74.907  1.00 60.70  ? 29  ILE E CG2 1 
ATOM   6595  C CD1 . ILE E  1 28  ? 35.825  19.715  76.740  1.00 60.26  ? 29  ILE E CD1 1 
ATOM   6596  N N   . SER E  1 29  ? 40.204  19.596  78.907  1.00 62.77  ? 30  SER E N   1 
ATOM   6597  C CA  . SER E  1 29  ? 40.394  19.445  80.353  1.00 62.26  ? 30  SER E CA  1 
ATOM   6598  C C   . SER E  1 29  ? 39.093  19.454  81.152  1.00 62.99  ? 30  SER E C   1 
ATOM   6599  O O   . SER E  1 29  ? 38.184  18.660  80.899  1.00 63.42  ? 30  SER E O   1 
ATOM   6600  C CB  . SER E  1 29  ? 41.311  20.553  80.886  1.00 60.75  ? 30  SER E CB  1 
ATOM   6601  O OG  . SER E  1 29  ? 40.603  21.771  81.062  1.00 58.32  ? 30  SER E OG  1 
ATOM   6602  N N   . SER E  1 30  ? 39.022  20.347  82.134  1.00 62.68  ? 31  SER E N   1 
ATOM   6603  C CA  . SER E  1 30  ? 37.841  20.469  82.967  1.00 62.51  ? 31  SER E CA  1 
ATOM   6604  C C   . SER E  1 30  ? 37.124  21.777  82.644  1.00 62.16  ? 31  SER E C   1 
ATOM   6605  O O   . SER E  1 30  ? 36.937  22.649  83.495  1.00 62.02  ? 31  SER E O   1 
ATOM   6606  C CB  . SER E  1 30  ? 38.233  20.396  84.448  1.00 62.55  ? 31  SER E CB  1 
ATOM   6607  O OG  . SER E  1 30  ? 38.748  19.113  84.776  1.00 61.67  ? 31  SER E OG  1 
ATOM   6608  N N   . TYR E  1 31  ? 36.737  21.900  81.382  1.00 62.07  ? 32  TYR E N   1 
ATOM   6609  C CA  . TYR E  1 31  ? 36.021  23.073  80.890  1.00 61.53  ? 32  TYR E CA  1 
ATOM   6610  C C   . TYR E  1 31  ? 34.772  22.634  80.126  1.00 59.20  ? 32  TYR E C   1 
ATOM   6611  O O   . TYR E  1 31  ? 34.367  23.259  79.140  1.00 58.76  ? 32  TYR E O   1 
ATOM   6612  C CB  . TYR E  1 31  ? 36.939  23.908  79.992  1.00 62.75  ? 32  TYR E CB  1 
ATOM   6613  C CG  . TYR E  1 31  ? 37.751  24.923  80.767  1.00 64.27  ? 32  TYR E CG  1 
ATOM   6614  C CD1 . TYR E  1 31  ? 38.936  25.442  80.245  1.00 65.07  ? 32  TYR E CD1 1 
ATOM   6615  C CD2 . TYR E  1 31  ? 37.313  25.398  82.009  1.00 64.12  ? 32  TYR E CD2 1 
ATOM   6616  C CE1 . TYR E  1 31  ? 39.672  26.413  80.932  1.00 65.55  ? 32  TYR E CE1 1 
ATOM   6617  C CE2 . TYR E  1 31  ? 38.038  26.374  82.710  1.00 65.34  ? 32  TYR E CE2 1 
ATOM   6618  C CZ  . TYR E  1 31  ? 39.218  26.879  82.162  1.00 65.75  ? 32  TYR E CZ  1 
ATOM   6619  O OH  . TYR E  1 31  ? 39.930  27.860  82.824  1.00 63.98  ? 32  TYR E OH  1 
ATOM   6620  N N   . LEU E  1 32  ? 34.173  21.547  80.603  1.00 55.27  ? 33  LEU E N   1 
ATOM   6621  C CA  . LEU E  1 32  ? 32.987  21.001  79.991  1.00 50.61  ? 33  LEU E CA  1 
ATOM   6622  C C   . LEU E  1 32  ? 31.799  21.424  80.831  1.00 48.92  ? 33  LEU E C   1 
ATOM   6623  O O   . LEU E  1 32  ? 31.932  21.714  82.014  1.00 46.88  ? 33  LEU E O   1 
ATOM   6624  C CB  . LEU E  1 32  ? 33.098  19.480  79.909  1.00 48.36  ? 33  LEU E CB  1 
ATOM   6625  C CG  . LEU E  1 32  ? 32.001  18.716  79.167  1.00 47.19  ? 33  LEU E CG  1 
ATOM   6626  C CD1 . LEU E  1 32  ? 30.810  18.472  80.051  1.00 45.98  ? 33  LEU E CD1 1 
ATOM   6627  C CD2 . LEU E  1 32  ? 31.600  19.498  77.951  1.00 47.75  ? 33  LEU E CD2 1 
ATOM   6628  N N   . ASN E  1 33  ? 30.639  21.467  80.194  1.00 47.97  ? 34  ASN E N   1 
ATOM   6629  C CA  . ASN E  1 33  ? 29.399  21.877  80.826  1.00 47.19  ? 34  ASN E CA  1 
ATOM   6630  C C   . ASN E  1 33  ? 28.246  21.066  80.279  1.00 44.94  ? 34  ASN E C   1 
ATOM   6631  O O   . ASN E  1 33  ? 28.211  20.735  79.108  1.00 44.38  ? 34  ASN E O   1 
ATOM   6632  C CB  . ASN E  1 33  ? 29.129  23.355  80.534  1.00 50.25  ? 34  ASN E CB  1 
ATOM   6633  C CG  . ASN E  1 33  ? 29.751  24.281  81.557  1.00 51.82  ? 34  ASN E CG  1 
ATOM   6634  O OD1 . ASN E  1 33  ? 29.288  24.369  82.698  1.00 50.12  ? 34  ASN E OD1 1 
ATOM   6635  N ND2 . ASN E  1 33  ? 30.807  24.981  81.153  1.00 53.19  ? 34  ASN E ND2 1 
ATOM   6636  N N   . TRP E  1 34  ? 27.286  20.765  81.129  1.00 43.29  ? 35  TRP E N   1 
ATOM   6637  C CA  . TRP E  1 34  ? 26.145  20.002  80.689  1.00 43.65  ? 35  TRP E CA  1 
ATOM   6638  C C   . TRP E  1 34  ? 24.880  20.773  80.967  1.00 43.14  ? 35  TRP E C   1 
ATOM   6639  O O   . TRP E  1 34  ? 24.655  21.206  82.089  1.00 43.43  ? 35  TRP E O   1 
ATOM   6640  C CB  . TRP E  1 34  ? 26.064  18.657  81.422  1.00 43.64  ? 35  TRP E CB  1 
ATOM   6641  C CG  . TRP E  1 34  ? 27.120  17.635  81.076  1.00 41.61  ? 35  TRP E CG  1 
ATOM   6642  C CD1 . TRP E  1 34  ? 28.307  17.440  81.708  1.00 41.24  ? 35  TRP E CD1 1 
ATOM   6643  C CD2 . TRP E  1 34  ? 27.014  16.600  80.103  1.00 39.21  ? 35  TRP E CD2 1 
ATOM   6644  N NE1 . TRP E  1 34  ? 28.945  16.335  81.201  1.00 39.74  ? 35  TRP E NE1 1 
ATOM   6645  C CE2 . TRP E  1 34  ? 28.169  15.799  80.214  1.00 39.34  ? 35  TRP E CE2 1 
ATOM   6646  C CE3 . TRP E  1 34  ? 26.049  16.268  79.152  1.00 39.21  ? 35  TRP E CE3 1 
ATOM   6647  C CZ2 . TRP E  1 34  ? 28.387  14.687  79.419  1.00 40.81  ? 35  TRP E CZ2 1 
ATOM   6648  C CZ3 . TRP E  1 34  ? 26.260  15.160  78.355  1.00 41.09  ? 35  TRP E CZ3 1 
ATOM   6649  C CH2 . TRP E  1 34  ? 27.422  14.379  78.494  1.00 43.05  ? 35  TRP E CH2 1 
ATOM   6650  N N   . TYR E  1 35  ? 24.050  20.931  79.948  1.00 42.99  ? 36  TYR E N   1 
ATOM   6651  C CA  . TYR E  1 35  ? 22.784  21.627  80.103  1.00 43.95  ? 36  TYR E CA  1 
ATOM   6652  C C   . TYR E  1 35  ? 21.634  20.655  79.837  1.00 44.27  ? 36  TYR E C   1 
ATOM   6653  O O   . TYR E  1 35  ? 21.796  19.678  79.116  1.00 44.10  ? 36  TYR E O   1 
ATOM   6654  C CB  . TYR E  1 35  ? 22.693  22.787  79.105  1.00 45.12  ? 36  TYR E CB  1 
ATOM   6655  C CG  . TYR E  1 35  ? 23.782  23.829  79.212  1.00 45.39  ? 36  TYR E CG  1 
ATOM   6656  C CD1 . TYR E  1 35  ? 25.005  23.655  78.581  1.00 44.72  ? 36  TYR E CD1 1 
ATOM   6657  C CD2 . TYR E  1 35  ? 23.579  24.997  79.955  1.00 46.34  ? 36  TYR E CD2 1 
ATOM   6658  C CE1 . TYR E  1 35  ? 26.006  24.623  78.681  1.00 47.04  ? 36  TYR E CE1 1 
ATOM   6659  C CE2 . TYR E  1 35  ? 24.568  25.965  80.068  1.00 46.03  ? 36  TYR E CE2 1 
ATOM   6660  C CZ  . TYR E  1 35  ? 25.782  25.778  79.431  1.00 47.04  ? 36  TYR E CZ  1 
ATOM   6661  O OH  . TYR E  1 35  ? 26.771  26.733  79.560  1.00 46.37  ? 36  TYR E OH  1 
ATOM   6662  N N   . GLN E  1 36  ? 20.478  20.911  80.426  1.00 45.01  ? 37  GLN E N   1 
ATOM   6663  C CA  . GLN E  1 36  ? 19.314  20.067  80.183  1.00 47.47  ? 37  GLN E CA  1 
ATOM   6664  C C   . GLN E  1 36  ? 18.283  20.946  79.491  1.00 48.91  ? 37  GLN E C   1 
ATOM   6665  O O   . GLN E  1 36  ? 18.365  22.172  79.554  1.00 49.29  ? 37  GLN E O   1 
ATOM   6666  C CB  . GLN E  1 36  ? 18.733  19.543  81.501  1.00 48.82  ? 37  GLN E CB  1 
ATOM   6667  C CG  . GLN E  1 36  ? 17.327  18.895  81.396  1.00 49.46  ? 37  GLN E CG  1 
ATOM   6668  C CD  . GLN E  1 36  ? 16.751  18.461  82.756  1.00 49.62  ? 37  GLN E CD  1 
ATOM   6669  O OE1 . GLN E  1 36  ? 16.831  19.204  83.741  1.00 51.27  ? 37  GLN E OE1 1 
ATOM   6670  N NE2 . GLN E  1 36  ? 16.164  17.262  82.807  1.00 46.59  ? 37  GLN E NE2 1 
ATOM   6671  N N   . GLN E  1 37  ? 17.320  20.335  78.816  1.00 50.28  ? 38  GLN E N   1 
ATOM   6672  C CA  . GLN E  1 37  ? 16.282  21.113  78.158  1.00 52.01  ? 38  GLN E CA  1 
ATOM   6673  C C   . GLN E  1 37  ? 15.108  20.256  77.734  1.00 53.92  ? 38  GLN E C   1 
ATOM   6674  O O   . GLN E  1 37  ? 15.292  19.165  77.185  1.00 54.13  ? 38  GLN E O   1 
ATOM   6675  C CB  . GLN E  1 37  ? 16.839  21.819  76.932  1.00 51.67  ? 38  GLN E CB  1 
ATOM   6676  C CG  . GLN E  1 37  ? 15.803  22.644  76.190  1.00 51.23  ? 38  GLN E CG  1 
ATOM   6677  C CD  . GLN E  1 37  ? 16.191  22.890  74.745  1.00 52.39  ? 38  GLN E CD  1 
ATOM   6678  O OE1 . GLN E  1 37  ? 16.401  21.946  73.963  1.00 51.81  ? 38  GLN E OE1 1 
ATOM   6679  N NE2 . GLN E  1 37  ? 16.294  24.159  74.378  1.00 52.00  ? 38  GLN E NE2 1 
ATOM   6680  N N   . LYS E  1 38  ? 13.902  20.748  78.011  1.00 55.40  ? 39  LYS E N   1 
ATOM   6681  C CA  . LYS E  1 38  ? 12.677  20.052  77.618  1.00 56.58  ? 39  LYS E CA  1 
ATOM   6682  C C   . LYS E  1 38  ? 11.995  20.922  76.564  1.00 57.36  ? 39  LYS E C   1 
ATOM   6683  O O   . LYS E  1 38  ? 12.395  22.071  76.354  1.00 57.47  ? 39  LYS E O   1 
ATOM   6684  C CB  . LYS E  1 38  ? 11.736  19.843  78.811  1.00 56.42  ? 39  LYS E CB  1 
ATOM   6685  C CG  . LYS E  1 38  ? 12.213  18.824  79.839  1.00 57.16  ? 39  LYS E CG  1 
ATOM   6686  C CD  . LYS E  1 38  ? 11.090  18.390  80.772  1.00 57.44  ? 39  LYS E CD  1 
ATOM   6687  C CE  . LYS E  1 38  ? 11.483  18.532  82.246  1.00 60.37  ? 39  LYS E CE  1 
ATOM   6688  N NZ  . LYS E  1 38  ? 10.354  18.245  83.214  1.00 61.29  ? 39  LYS E NZ  1 
ATOM   6689  N N   . PRO E  1 39  ? 10.971  20.380  75.877  1.00 58.21  ? 40  PRO E N   1 
ATOM   6690  C CA  . PRO E  1 39  ? 10.198  21.064  74.829  1.00 58.46  ? 40  PRO E CA  1 
ATOM   6691  C C   . PRO E  1 39  ? 9.826   22.537  75.078  1.00 58.83  ? 40  PRO E C   1 
ATOM   6692  O O   . PRO E  1 39  ? 8.914   22.848  75.854  1.00 57.70  ? 40  PRO E O   1 
ATOM   6693  C CB  . PRO E  1 39  ? 8.976   20.169  74.685  1.00 57.99  ? 40  PRO E CB  1 
ATOM   6694  C CG  . PRO E  1 39  ? 9.590   18.816  74.817  1.00 57.74  ? 40  PRO E CG  1 
ATOM   6695  C CD  . PRO E  1 39  ? 10.520  18.981  76.009  1.00 58.21  ? 40  PRO E CD  1 
ATOM   6696  N N   . GLY E  1 40  ? 10.547  23.426  74.393  1.00 59.58  ? 41  GLY E N   1 
ATOM   6697  C CA  . GLY E  1 40  ? 10.320  24.854  74.504  1.00 60.40  ? 41  GLY E CA  1 
ATOM   6698  C C   . GLY E  1 40  ? 10.565  25.401  75.892  1.00 61.32  ? 41  GLY E C   1 
ATOM   6699  O O   . GLY E  1 40  ? 9.680   26.019  76.480  1.00 62.12  ? 41  GLY E O   1 
ATOM   6700  N N   . LYS E  1 41  ? 11.765  25.184  76.421  1.00 61.97  ? 42  LYS E N   1 
ATOM   6701  C CA  . LYS E  1 41  ? 12.102  25.665  77.756  1.00 62.90  ? 42  LYS E CA  1 
ATOM   6702  C C   . LYS E  1 41  ? 13.535  26.173  77.824  1.00 63.16  ? 42  LYS E C   1 
ATOM   6703  O O   . LYS E  1 41  ? 14.469  25.434  77.505  1.00 64.30  ? 42  LYS E O   1 
ATOM   6704  C CB  . LYS E  1 41  ? 11.942  24.538  78.776  1.00 63.83  ? 42  LYS E CB  1 
ATOM   6705  C CG  . LYS E  1 41  ? 10.603  23.799  78.723  1.00 65.20  ? 42  LYS E CG  1 
ATOM   6706  C CD  . LYS E  1 41  ? 9.461   24.524  79.436  1.00 63.75  ? 42  LYS E CD  1 
ATOM   6707  C CE  . LYS E  1 41  ? 8.204   23.667  79.380  1.00 63.90  ? 42  LYS E CE  1 
ATOM   6708  N NZ  . LYS E  1 41  ? 7.066   24.196  80.177  1.00 65.17  ? 42  LYS E NZ  1 
ATOM   6709  N N   . VAL E  1 42  ? 13.711  27.429  78.235  1.00 63.05  ? 43  VAL E N   1 
ATOM   6710  C CA  . VAL E  1 42  ? 15.052  27.994  78.367  1.00 62.30  ? 43  VAL E CA  1 
ATOM   6711  C C   . VAL E  1 42  ? 15.885  26.856  78.966  1.00 62.43  ? 43  VAL E C   1 
ATOM   6712  O O   . VAL E  1 42  ? 15.498  26.258  79.981  1.00 62.90  ? 43  VAL E O   1 
ATOM   6713  C CB  . VAL E  1 42  ? 15.094  29.202  79.365  1.00 61.66  ? 43  VAL E CB  1 
ATOM   6714  C CG1 . VAL E  1 42  ? 16.402  29.963  79.199  1.00 60.06  ? 43  VAL E CG1 1 
ATOM   6715  C CG2 . VAL E  1 42  ? 13.895  30.121  79.162  1.00 60.33  ? 43  VAL E CG2 1 
ATOM   6716  N N   . PRO E  1 43  ? 17.022  26.523  78.342  1.00 61.36  ? 44  PRO E N   1 
ATOM   6717  C CA  . PRO E  1 43  ? 17.848  25.440  78.877  1.00 60.65  ? 44  PRO E CA  1 
ATOM   6718  C C   . PRO E  1 43  ? 18.350  25.753  80.296  1.00 59.98  ? 44  PRO E C   1 
ATOM   6719  O O   . PRO E  1 43  ? 18.677  26.899  80.627  1.00 59.62  ? 44  PRO E O   1 
ATOM   6720  C CB  . PRO E  1 43  ? 18.990  25.348  77.865  1.00 61.60  ? 44  PRO E CB  1 
ATOM   6721  C CG  . PRO E  1 43  ? 18.412  25.927  76.622  1.00 61.33  ? 44  PRO E CG  1 
ATOM   6722  C CD  . PRO E  1 43  ? 17.637  27.097  77.140  1.00 61.03  ? 44  PRO E CD  1 
ATOM   6723  N N   . LYS E  1 44  ? 18.411  24.721  81.124  1.00 58.76  ? 45  LYS E N   1 
ATOM   6724  C CA  . LYS E  1 44  ? 18.857  24.853  82.501  1.00 58.09  ? 45  LYS E CA  1 
ATOM   6725  C C   . LYS E  1 44  ? 20.289  24.284  82.614  1.00 58.35  ? 45  LYS E C   1 
ATOM   6726  O O   . LYS E  1 44  ? 20.572  23.206  82.083  1.00 60.38  ? 45  LYS E O   1 
ATOM   6727  C CB  . LYS E  1 44  ? 17.868  24.090  83.384  1.00 56.48  ? 45  LYS E CB  1 
ATOM   6728  C CG  . LYS E  1 44  ? 18.087  24.159  84.876  1.00 55.91  ? 45  LYS E CG  1 
ATOM   6729  C CD  . LYS E  1 44  ? 16.946  23.414  85.576  1.00 54.56  ? 45  LYS E CD  1 
ATOM   6730  C CE  . LYS E  1 44  ? 17.388  22.777  86.881  1.00 53.13  ? 45  LYS E CE  1 
ATOM   6731  N NZ  . LYS E  1 44  ? 16.574  21.571  87.183  1.00 51.73  ? 45  LYS E NZ  1 
ATOM   6732  N N   . LEU E  1 45  ? 21.197  25.011  83.270  1.00 56.23  ? 46  LEU E N   1 
ATOM   6733  C CA  . LEU E  1 45  ? 22.571  24.541  83.421  1.00 54.10  ? 46  LEU E CA  1 
ATOM   6734  C C   . LEU E  1 45  ? 22.639  23.483  84.502  1.00 52.88  ? 46  LEU E C   1 
ATOM   6735  O O   . LEU E  1 45  ? 22.591  23.796  85.675  1.00 52.11  ? 46  LEU E O   1 
ATOM   6736  C CB  . LEU E  1 45  ? 23.507  25.685  83.787  1.00 54.76  ? 46  LEU E CB  1 
ATOM   6737  C CG  . LEU E  1 45  ? 24.963  25.266  84.051  1.00 54.22  ? 46  LEU E CG  1 
ATOM   6738  C CD1 . LEU E  1 45  ? 25.446  24.352  82.939  1.00 53.99  ? 46  LEU E CD1 1 
ATOM   6739  C CD2 . LEU E  1 45  ? 25.865  26.507  84.146  1.00 54.27  ? 46  LEU E CD2 1 
ATOM   6740  N N   . LEU E  1 46  ? 22.771  22.231  84.087  1.00 52.12  ? 47  LEU E N   1 
ATOM   6741  C CA  . LEU E  1 46  ? 22.813  21.101  84.995  1.00 51.85  ? 47  LEU E CA  1 
ATOM   6742  C C   . LEU E  1 46  ? 24.162  20.782  85.635  1.00 53.36  ? 47  LEU E C   1 
ATOM   6743  O O   . LEU E  1 46  ? 24.217  20.386  86.806  1.00 53.85  ? 47  LEU E O   1 
ATOM   6744  C CB  . LEU E  1 46  ? 22.296  19.860  84.267  1.00 50.41  ? 47  LEU E CB  1 
ATOM   6745  C CG  . LEU E  1 46  ? 20.936  19.298  84.683  1.00 50.00  ? 47  LEU E CG  1 
ATOM   6746  C CD1 . LEU E  1 46  ? 21.129  18.304  85.807  1.00 49.02  ? 47  LEU E CD1 1 
ATOM   6747  C CD2 . LEU E  1 46  ? 19.997  20.423  85.086  1.00 47.91  ? 47  LEU E CD2 1 
ATOM   6748  N N   . ILE E  1 47  ? 25.247  20.942  84.883  1.00 53.71  ? 48  ILE E N   1 
ATOM   6749  C CA  . ILE E  1 47  ? 26.567  20.617  85.413  1.00 54.14  ? 48  ILE E CA  1 
ATOM   6750  C C   . ILE E  1 47  ? 27.709  21.346  84.735  1.00 55.60  ? 48  ILE E C   1 
ATOM   6751  O O   . ILE E  1 47  ? 27.865  21.269  83.519  1.00 56.77  ? 48  ILE E O   1 
ATOM   6752  C CB  . ILE E  1 47  ? 26.844  19.093  85.303  1.00 52.74  ? 48  ILE E CB  1 
ATOM   6753  C CG1 . ILE E  1 47  ? 26.146  18.363  86.449  1.00 51.70  ? 48  ILE E CG1 1 
ATOM   6754  C CG2 . ILE E  1 47  ? 28.347  18.819  85.289  1.00 51.33  ? 48  ILE E CG2 1 
ATOM   6755  C CD1 . ILE E  1 47  ? 26.234  16.872  86.359  1.00 51.97  ? 48  ILE E CD1 1 
ATOM   6756  N N   . TYR E  1 48  ? 28.515  22.051  85.519  1.00 56.84  ? 49  TYR E N   1 
ATOM   6757  C CA  . TYR E  1 48  ? 29.654  22.751  84.952  1.00 57.81  ? 49  TYR E CA  1 
ATOM   6758  C C   . TYR E  1 48  ? 30.951  22.114  85.441  1.00 57.20  ? 49  TYR E C   1 
ATOM   6759  O O   . TYR E  1 48  ? 30.935  21.189  86.260  1.00 55.59  ? 49  TYR E O   1 
ATOM   6760  C CB  . TYR E  1 48  ? 29.624  24.261  85.281  1.00 60.09  ? 49  TYR E CB  1 
ATOM   6761  C CG  . TYR E  1 48  ? 29.767  24.637  86.740  1.00 62.97  ? 49  TYR E CG  1 
ATOM   6762  C CD1 . TYR E  1 48  ? 30.185  25.922  87.108  1.00 64.22  ? 49  TYR E CD1 1 
ATOM   6763  C CD2 . TYR E  1 48  ? 29.474  23.723  87.755  1.00 64.51  ? 49  TYR E CD2 1 
ATOM   6764  C CE1 . TYR E  1 48  ? 30.312  26.284  88.458  1.00 66.29  ? 49  TYR E CE1 1 
ATOM   6765  C CE2 . TYR E  1 48  ? 29.593  24.072  89.106  1.00 66.52  ? 49  TYR E CE2 1 
ATOM   6766  C CZ  . TYR E  1 48  ? 30.014  25.350  89.452  1.00 67.07  ? 49  TYR E CZ  1 
ATOM   6767  O OH  . TYR E  1 48  ? 30.147  25.672  90.787  1.00 67.63  ? 49  TYR E OH  1 
ATOM   6768  N N   . ALA E  1 49  ? 32.063  22.608  84.903  1.00 56.91  ? 50  ALA E N   1 
ATOM   6769  C CA  . ALA E  1 49  ? 33.404  22.127  85.230  1.00 55.79  ? 50  ALA E CA  1 
ATOM   6770  C C   . ALA E  1 49  ? 33.526  20.608  85.386  1.00 54.17  ? 50  ALA E C   1 
ATOM   6771  O O   . ALA E  1 49  ? 34.119  20.114  86.341  1.00 53.56  ? 50  ALA E O   1 
ATOM   6772  C CB  . ALA E  1 49  ? 33.921  22.832  86.480  1.00 56.21  ? 50  ALA E CB  1 
ATOM   6773  N N   . ALA E  1 50  ? 32.955  19.876  84.439  1.00 52.35  ? 51  ALA E N   1 
ATOM   6774  C CA  . ALA E  1 50  ? 33.027  18.428  84.442  1.00 50.79  ? 51  ALA E CA  1 
ATOM   6775  C C   . ALA E  1 50  ? 32.267  17.691  85.553  1.00 50.33  ? 51  ALA E C   1 
ATOM   6776  O O   . ALA E  1 50  ? 31.208  17.116  85.318  1.00 50.06  ? 51  ALA E O   1 
ATOM   6777  C CB  . ALA E  1 50  ? 34.492  18.008  84.451  1.00 49.11  ? 51  ALA E CB  1 
ATOM   6778  N N   . SER E  1 51  ? 32.814  17.719  86.763  1.00 49.81  ? 52  SER E N   1 
ATOM   6779  C CA  . SER E  1 51  ? 32.243  16.999  87.899  1.00 48.66  ? 52  SER E CA  1 
ATOM   6780  C C   . SER E  1 51  ? 31.272  17.724  88.808  1.00 47.52  ? 52  SER E C   1 
ATOM   6781  O O   . SER E  1 51  ? 30.419  17.098  89.426  1.00 45.27  ? 52  SER E O   1 
ATOM   6782  C CB  . SER E  1 51  ? 33.381  16.467  88.768  1.00 49.84  ? 52  SER E CB  1 
ATOM   6783  O OG  . SER E  1 51  ? 34.156  17.539  89.290  1.00 50.43  ? 52  SER E OG  1 
ATOM   6784  N N   . SER E  1 52  ? 31.426  19.037  88.907  1.00 48.41  ? 53  SER E N   1 
ATOM   6785  C CA  . SER E  1 52  ? 30.594  19.853  89.783  1.00 49.34  ? 53  SER E CA  1 
ATOM   6786  C C   . SER E  1 52  ? 29.125  19.912  89.428  1.00 49.66  ? 53  SER E C   1 
ATOM   6787  O O   . SER E  1 52  ? 28.747  20.260  88.321  1.00 49.27  ? 53  SER E O   1 
ATOM   6788  C CB  . SER E  1 52  ? 31.148  21.274  89.867  1.00 48.30  ? 53  SER E CB  1 
ATOM   6789  O OG  . SER E  1 52  ? 31.344  21.794  88.572  1.00 49.54  ? 53  SER E OG  1 
ATOM   6790  N N   . LEU E  1 53  ? 28.301  19.567  90.401  1.00 51.85  ? 54  LEU E N   1 
ATOM   6791  C CA  . LEU E  1 53  ? 26.871  19.588  90.228  1.00 53.84  ? 54  LEU E CA  1 
ATOM   6792  C C   . LEU E  1 53  ? 26.372  20.993  90.523  1.00 55.26  ? 54  LEU E C   1 
ATOM   6793  O O   . LEU E  1 53  ? 26.395  21.448  91.660  1.00 54.60  ? 54  LEU E O   1 
ATOM   6794  C CB  . LEU E  1 53  ? 26.220  18.603  91.182  1.00 54.44  ? 54  LEU E CB  1 
ATOM   6795  C CG  . LEU E  1 53  ? 24.713  18.542  91.004  1.00 55.51  ? 54  LEU E CG  1 
ATOM   6796  C CD1 . LEU E  1 53  ? 24.403  18.078  89.571  1.00 55.83  ? 54  LEU E CD1 1 
ATOM   6797  C CD2 . LEU E  1 53  ? 24.115  17.605  92.041  1.00 56.18  ? 54  LEU E CD2 1 
ATOM   6798  N N   . GLN E  1 54  ? 25.923  21.679  89.482  1.00 57.78  ? 55  GLN E N   1 
ATOM   6799  C CA  . GLN E  1 54  ? 25.423  23.040  89.610  1.00 59.74  ? 55  GLN E CA  1 
ATOM   6800  C C   . GLN E  1 54  ? 24.437  23.249  90.748  1.00 59.79  ? 55  GLN E C   1 
ATOM   6801  O O   . GLN E  1 54  ? 23.623  22.381  91.073  1.00 59.19  ? 55  GLN E O   1 
ATOM   6802  C CB  . GLN E  1 54  ? 24.765  23.482  88.302  1.00 61.64  ? 55  GLN E CB  1 
ATOM   6803  C CG  . GLN E  1 54  ? 23.983  24.805  88.380  1.00 63.85  ? 55  GLN E CG  1 
ATOM   6804  C CD  . GLN E  1 54  ? 24.855  26.001  88.739  1.00 65.10  ? 55  GLN E CD  1 
ATOM   6805  O OE1 . GLN E  1 54  ? 25.203  26.201  89.910  1.00 67.68  ? 55  GLN E OE1 1 
ATOM   6806  N NE2 . GLN E  1 54  ? 25.218  26.799  87.733  1.00 62.73  ? 55  GLN E NE2 1 
ATOM   6807  N N   . SER E  1 55  ? 24.525  24.434  91.337  1.00 60.01  ? 56  SER E N   1 
ATOM   6808  C CA  . SER E  1 55  ? 23.660  24.840  92.426  1.00 60.49  ? 56  SER E CA  1 
ATOM   6809  C C   . SER E  1 55  ? 22.175  24.622  92.079  1.00 59.47  ? 56  SER E C   1 
ATOM   6810  O O   . SER E  1 55  ? 21.709  25.014  91.004  1.00 59.86  ? 56  SER E O   1 
ATOM   6811  C CB  . SER E  1 55  ? 23.919  26.316  92.744  1.00 61.03  ? 56  SER E CB  1 
ATOM   6812  O OG  . SER E  1 55  ? 23.088  26.754  93.806  1.00 63.04  ? 56  SER E OG  1 
ATOM   6813  N N   . GLY E  1 56  ? 21.443  23.991  92.996  1.00 57.52  ? 57  GLY E N   1 
ATOM   6814  C CA  . GLY E  1 56  ? 20.031  23.741  92.776  1.00 55.15  ? 57  GLY E CA  1 
ATOM   6815  C C   . GLY E  1 56  ? 19.786  22.566  91.852  1.00 53.47  ? 57  GLY E C   1 
ATOM   6816  O O   . GLY E  1 56  ? 18.872  22.590  91.032  1.00 52.92  ? 57  GLY E O   1 
ATOM   6817  N N   . VAL E  1 57  ? 20.601  21.529  91.980  1.00 52.09  ? 58  VAL E N   1 
ATOM   6818  C CA  . VAL E  1 57  ? 20.440  20.362  91.140  1.00 49.53  ? 58  VAL E CA  1 
ATOM   6819  C C   . VAL E  1 57  ? 20.381  19.095  91.959  1.00 48.89  ? 58  VAL E C   1 
ATOM   6820  O O   . VAL E  1 57  ? 21.127  18.928  92.924  1.00 48.15  ? 58  VAL E O   1 
ATOM   6821  C CB  . VAL E  1 57  ? 21.588  20.239  90.141  1.00 49.10  ? 58  VAL E CB  1 
ATOM   6822  C CG1 . VAL E  1 57  ? 21.373  19.016  89.268  1.00 48.44  ? 58  VAL E CG1 1 
ATOM   6823  C CG2 . VAL E  1 57  ? 21.674  21.501  89.298  1.00 48.14  ? 58  VAL E CG2 1 
ATOM   6824  N N   . PRO E  1 58  ? 19.477  18.186  91.585  1.00 48.82  ? 59  PRO E N   1 
ATOM   6825  C CA  . PRO E  1 58  ? 19.271  16.896  92.248  1.00 49.15  ? 59  PRO E CA  1 
ATOM   6826  C C   . PRO E  1 58  ? 20.573  16.133  92.448  1.00 47.77  ? 59  PRO E C   1 
ATOM   6827  O O   . PRO E  1 58  ? 21.571  16.442  91.828  1.00 46.98  ? 59  PRO E O   1 
ATOM   6828  C CB  . PRO E  1 58  ? 18.310  16.181  91.300  1.00 49.32  ? 59  PRO E CB  1 
ATOM   6829  C CG  . PRO E  1 58  ? 17.434  17.298  90.867  1.00 49.52  ? 59  PRO E CG  1 
ATOM   6830  C CD  . PRO E  1 58  ? 18.435  18.413  90.569  1.00 49.30  ? 59  PRO E CD  1 
ATOM   6831  N N   . SER E  1 59  ? 20.553  15.141  93.324  1.00 47.33  ? 60  SER E N   1 
ATOM   6832  C CA  . SER E  1 59  ? 21.739  14.352  93.591  1.00 47.02  ? 60  SER E CA  1 
ATOM   6833  C C   . SER E  1 59  ? 21.840  13.182  92.615  1.00 46.74  ? 60  SER E C   1 
ATOM   6834  O O   . SER E  1 59  ? 22.829  12.453  92.611  1.00 46.14  ? 60  SER E O   1 
ATOM   6835  C CB  . SER E  1 59  ? 21.712  13.809  95.023  1.00 46.98  ? 60  SER E CB  1 
ATOM   6836  O OG  . SER E  1 59  ? 20.884  12.655  95.126  1.00 45.92  ? 60  SER E OG  1 
ATOM   6837  N N   . ARG E  1 60  ? 20.823  12.982  91.789  1.00 46.66  ? 61  ARG E N   1 
ATOM   6838  C CA  . ARG E  1 60  ? 20.904  11.878  90.857  1.00 47.23  ? 61  ARG E CA  1 
ATOM   6839  C C   . ARG E  1 60  ? 21.599  12.233  89.546  1.00 47.46  ? 61  ARG E C   1 
ATOM   6840  O O   . ARG E  1 60  ? 21.433  11.547  88.550  1.00 48.07  ? 61  ARG E O   1 
ATOM   6841  C CB  . ARG E  1 60  ? 19.521  11.281  90.598  1.00 47.31  ? 61  ARG E CB  1 
ATOM   6842  C CG  . ARG E  1 60  ? 18.431  12.241  90.195  1.00 48.76  ? 61  ARG E CG  1 
ATOM   6843  C CD  . ARG E  1 60  ? 17.246  11.440  89.674  1.00 49.89  ? 61  ARG E CD  1 
ATOM   6844  N NE  . ARG E  1 60  ? 16.224  12.286  89.080  1.00 52.34  ? 61  ARG E NE  1 
ATOM   6845  C CZ  . ARG E  1 60  ? 15.428  13.096  89.772  1.00 54.80  ? 61  ARG E CZ  1 
ATOM   6846  N NH1 . ARG E  1 60  ? 15.542  13.169  91.091  1.00 55.31  ? 61  ARG E NH1 1 
ATOM   6847  N NH2 . ARG E  1 60  ? 14.505  13.823  89.145  1.00 55.35  ? 61  ARG E NH2 1 
ATOM   6848  N N   . PHE E  1 61  ? 22.400  13.294  89.566  1.00 48.42  ? 62  PHE E N   1 
ATOM   6849  C CA  . PHE E  1 61  ? 23.141  13.740  88.390  1.00 49.44  ? 62  PHE E CA  1 
ATOM   6850  C C   . PHE E  1 61  ? 24.614  13.932  88.711  1.00 51.22  ? 62  PHE E C   1 
ATOM   6851  O O   . PHE E  1 61  ? 25.023  14.986  89.205  1.00 51.40  ? 62  PHE E O   1 
ATOM   6852  C CB  . PHE E  1 61  ? 22.593  15.063  87.863  1.00 49.12  ? 62  PHE E CB  1 
ATOM   6853  C CG  . PHE E  1 61  ? 21.197  14.976  87.333  1.00 48.49  ? 62  PHE E CG  1 
ATOM   6854  C CD1 . PHE E  1 61  ? 20.112  15.001  88.194  1.00 47.90  ? 62  PHE E CD1 1 
ATOM   6855  C CD2 . PHE E  1 61  ? 20.969  14.852  85.966  1.00 48.13  ? 62  PHE E CD2 1 
ATOM   6856  C CE1 . PHE E  1 61  ? 18.819  14.904  87.702  1.00 48.35  ? 62  PHE E CE1 1 
ATOM   6857  C CE2 . PHE E  1 61  ? 19.685  14.754  85.465  1.00 47.00  ? 62  PHE E CE2 1 
ATOM   6858  C CZ  . PHE E  1 61  ? 18.608  14.780  86.332  1.00 48.08  ? 62  PHE E CZ  1 
ATOM   6859  N N   . SER E  1 62  ? 25.408  12.907  88.421  1.00 53.03  ? 63  SER E N   1 
ATOM   6860  C CA  . SER E  1 62  ? 26.846  12.932  88.666  1.00 53.13  ? 63  SER E CA  1 
ATOM   6861  C C   . SER E  1 62  ? 27.516  13.493  87.422  1.00 53.67  ? 63  SER E C   1 
ATOM   6862  O O   . SER E  1 62  ? 26.976  13.380  86.325  1.00 54.41  ? 63  SER E O   1 
ATOM   6863  C CB  . SER E  1 62  ? 27.346  11.511  88.925  1.00 52.97  ? 63  SER E CB  1 
ATOM   6864  O OG  . SER E  1 62  ? 26.346  10.740  89.579  1.00 53.68  ? 63  SER E OG  1 
ATOM   6865  N N   . GLY E  1 63  ? 28.685  14.098  87.597  1.00 54.24  ? 64  GLY E N   1 
ATOM   6866  C CA  . GLY E  1 63  ? 29.418  14.662  86.472  1.00 54.26  ? 64  GLY E CA  1 
ATOM   6867  C C   . GLY E  1 63  ? 30.841  14.174  86.579  1.00 54.62  ? 64  GLY E C   1 
ATOM   6868  O O   . GLY E  1 63  ? 31.375  14.123  87.685  1.00 55.56  ? 64  GLY E O   1 
ATOM   6869  N N   . SER E  1 64  ? 31.467  13.831  85.457  1.00 55.19  ? 65  SER E N   1 
ATOM   6870  C CA  . SER E  1 64  ? 32.825  13.290  85.494  1.00 55.99  ? 65  SER E CA  1 
ATOM   6871  C C   . SER E  1 64  ? 33.554  13.396  84.179  1.00 55.59  ? 65  SER E C   1 
ATOM   6872  O O   . SER E  1 64  ? 32.987  13.846  83.197  1.00 57.37  ? 65  SER E O   1 
ATOM   6873  C CB  . SER E  1 64  ? 32.758  11.821  85.880  1.00 57.62  ? 65  SER E CB  1 
ATOM   6874  O OG  . SER E  1 64  ? 31.694  11.195  85.169  1.00 59.19  ? 65  SER E OG  1 
ATOM   6875  N N   . GLY E  1 65  ? 34.803  12.948  84.159  1.00 54.86  ? 66  GLY E N   1 
ATOM   6876  C CA  . GLY E  1 65  ? 35.587  13.012  82.938  1.00 56.48  ? 66  GLY E CA  1 
ATOM   6877  C C   . GLY E  1 65  ? 36.626  14.118  82.980  1.00 57.97  ? 66  GLY E C   1 
ATOM   6878  O O   . GLY E  1 65  ? 36.871  14.698  84.036  1.00 58.66  ? 66  GLY E O   1 
ATOM   6879  N N   . SER E  1 66  ? 37.240  14.410  81.836  1.00 58.51  ? 67  SER E N   1 
ATOM   6880  C CA  . SER E  1 66  ? 38.265  15.456  81.728  1.00 58.84  ? 67  SER E CA  1 
ATOM   6881  C C   . SER E  1 66  ? 39.118  15.192  80.489  1.00 58.95  ? 67  SER E C   1 
ATOM   6882  O O   . SER E  1 66  ? 39.461  14.053  80.203  1.00 59.26  ? 67  SER E O   1 
ATOM   6883  C CB  . SER E  1 66  ? 39.156  15.476  82.974  1.00 58.21  ? 67  SER E CB  1 
ATOM   6884  O OG  . SER E  1 66  ? 39.777  14.219  83.174  1.00 57.78  ? 67  SER E OG  1 
ATOM   6885  N N   . GLY E  1 67  ? 39.464  16.241  79.754  1.00 59.15  ? 68  GLY E N   1 
ATOM   6886  C CA  . GLY E  1 67  ? 40.249  16.045  78.551  1.00 59.69  ? 68  GLY E CA  1 
ATOM   6887  C C   . GLY E  1 67  ? 39.335  15.861  77.354  1.00 60.52  ? 68  GLY E C   1 
ATOM   6888  O O   . GLY E  1 67  ? 38.983  16.838  76.685  1.00 61.25  ? 68  GLY E O   1 
ATOM   6889  N N   . THR E  1 68  ? 38.938  14.618  77.083  1.00 60.34  ? 69  THR E N   1 
ATOM   6890  C CA  . THR E  1 68  ? 38.049  14.327  75.957  1.00 59.75  ? 69  THR E CA  1 
ATOM   6891  C C   . THR E  1 68  ? 36.840  13.492  76.348  1.00 59.73  ? 69  THR E C   1 
ATOM   6892  O O   . THR E  1 68  ? 35.758  13.684  75.806  1.00 59.50  ? 69  THR E O   1 
ATOM   6893  C CB  . THR E  1 68  ? 38.773  13.557  74.813  1.00 59.16  ? 69  THR E CB  1 
ATOM   6894  O OG1 . THR E  1 68  ? 39.296  12.319  75.313  1.00 57.92  ? 69  THR E OG1 1 
ATOM   6895  C CG2 . THR E  1 68  ? 39.898  14.386  74.230  1.00 58.73  ? 69  THR E CG2 1 
ATOM   6896  N N   . ASP E  1 69  ? 37.033  12.558  77.275  1.00 60.21  ? 70  ASP E N   1 
ATOM   6897  C CA  . ASP E  1 69  ? 35.961  11.665  77.706  1.00 60.24  ? 70  ASP E CA  1 
ATOM   6898  C C   . ASP E  1 69  ? 35.184  12.192  78.880  1.00 59.74  ? 70  ASP E C   1 
ATOM   6899  O O   . ASP E  1 69  ? 35.655  12.168  80.015  1.00 60.46  ? 70  ASP E O   1 
ATOM   6900  C CB  . ASP E  1 69  ? 36.505  10.282  78.073  1.00 62.09  ? 70  ASP E CB  1 
ATOM   6901  C CG  . ASP E  1 69  ? 37.093  9.544   76.882  1.00 64.92  ? 70  ASP E CG  1 
ATOM   6902  O OD1 . ASP E  1 69  ? 37.558  8.397   77.078  1.00 66.89  ? 70  ASP E OD1 1 
ATOM   6903  O OD2 . ASP E  1 69  ? 37.098  10.104  75.756  1.00 65.61  ? 70  ASP E OD2 1 
ATOM   6904  N N   . PHE E  1 70  ? 33.977  12.659  78.602  1.00 58.93  ? 71  PHE E N   1 
ATOM   6905  C CA  . PHE E  1 70  ? 33.124  13.182  79.649  1.00 57.48  ? 71  PHE E CA  1 
ATOM   6906  C C   . PHE E  1 70  ? 31.893  12.313  79.780  1.00 56.32  ? 71  PHE E C   1 
ATOM   6907  O O   . PHE E  1 70  ? 31.479  11.637  78.831  1.00 55.54  ? 71  PHE E O   1 
ATOM   6908  C CB  . PHE E  1 70  ? 32.784  14.646  79.364  1.00 57.05  ? 71  PHE E CB  1 
ATOM   6909  C CG  . PHE E  1 70  ? 33.982  15.528  79.399  1.00 56.70  ? 71  PHE E CG  1 
ATOM   6910  C CD1 . PHE E  1 70  ? 34.909  15.494  78.364  1.00 57.14  ? 71  PHE E CD1 1 
ATOM   6911  C CD2 . PHE E  1 70  ? 34.246  16.315  80.506  1.00 56.56  ? 71  PHE E CD2 1 
ATOM   6912  C CE1 . PHE E  1 70  ? 36.081  16.224  78.433  1.00 57.04  ? 71  PHE E CE1 1 
ATOM   6913  C CE2 . PHE E  1 70  ? 35.419  17.054  80.591  1.00 57.13  ? 71  PHE E CE2 1 
ATOM   6914  C CZ  . PHE E  1 70  ? 36.338  17.008  79.552  1.00 57.36  ? 71  PHE E CZ  1 
ATOM   6915  N N   . THR E  1 71  ? 31.314  12.321  80.970  1.00 54.48  ? 72  THR E N   1 
ATOM   6916  C CA  . THR E  1 71  ? 30.175  11.480  81.211  1.00 52.79  ? 72  THR E CA  1 
ATOM   6917  C C   . THR E  1 71  ? 29.278  11.955  82.334  1.00 52.35  ? 72  THR E C   1 
ATOM   6918  O O   . THR E  1 71  ? 29.598  11.787  83.519  1.00 52.98  ? 72  THR E O   1 
ATOM   6919  C CB  . THR E  1 71  ? 30.664  10.056  81.511  1.00 52.56  ? 72  THR E CB  1 
ATOM   6920  O OG1 . THR E  1 71  ? 29.632  9.314   82.158  1.00 52.28  ? 72  THR E OG1 1 
ATOM   6921  C CG2 . THR E  1 71  ? 31.894  10.099  82.399  1.00 51.53  ? 72  THR E CG2 1 
ATOM   6922  N N   . LEU E  1 72  ? 28.157  12.557  81.946  1.00 49.45  ? 73  LEU E N   1 
ATOM   6923  C CA  . LEU E  1 72  ? 27.157  13.026  82.899  1.00 46.84  ? 73  LEU E CA  1 
ATOM   6924  C C   . LEU E  1 72  ? 26.258  11.819  83.224  1.00 45.53  ? 73  LEU E C   1 
ATOM   6925  O O   . LEU E  1 72  ? 25.635  11.262  82.326  1.00 46.06  ? 73  LEU E O   1 
ATOM   6926  C CB  . LEU E  1 72  ? 26.344  14.151  82.253  1.00 45.10  ? 73  LEU E CB  1 
ATOM   6927  C CG  . LEU E  1 72  ? 24.930  14.455  82.745  1.00 42.98  ? 73  LEU E CG  1 
ATOM   6928  C CD1 . LEU E  1 72  ? 24.949  14.755  84.226  1.00 44.72  ? 73  LEU E CD1 1 
ATOM   6929  C CD2 . LEU E  1 72  ? 24.378  15.628  81.979  1.00 41.49  ? 73  LEU E CD2 1 
ATOM   6930  N N   . THR E  1 73  ? 26.186  11.401  84.485  1.00 43.15  ? 74  THR E N   1 
ATOM   6931  C CA  . THR E  1 73  ? 25.357  10.238  84.811  1.00 42.33  ? 74  THR E CA  1 
ATOM   6932  C C   . THR E  1 73  ? 24.097  10.502  85.635  1.00 43.13  ? 74  THR E C   1 
ATOM   6933  O O   . THR E  1 73  ? 24.078  11.402  86.471  1.00 44.77  ? 74  THR E O   1 
ATOM   6934  C CB  . THR E  1 73  ? 26.190  9.146   85.550  1.00 39.88  ? 74  THR E CB  1 
ATOM   6935  O OG1 . THR E  1 73  ? 27.122  8.557   84.639  1.00 38.19  ? 74  THR E OG1 1 
ATOM   6936  C CG2 . THR E  1 73  ? 25.288  8.045   86.101  1.00 36.03  ? 74  THR E CG2 1 
ATOM   6937  N N   . ILE E  1 74  ? 23.039  9.726   85.377  1.00 42.59  ? 75  ILE E N   1 
ATOM   6938  C CA  . ILE E  1 74  ? 21.806  9.825   86.157  1.00 42.97  ? 75  ILE E CA  1 
ATOM   6939  C C   . ILE E  1 74  ? 21.588  8.457   86.788  1.00 44.49  ? 75  ILE E C   1 
ATOM   6940  O O   . ILE E  1 74  ? 21.364  7.471   86.089  1.00 43.14  ? 75  ILE E O   1 
ATOM   6941  C CB  . ILE E  1 74  ? 20.559  10.184  85.326  1.00 42.60  ? 75  ILE E CB  1 
ATOM   6942  C CG1 . ILE E  1 74  ? 20.621  11.647  84.870  1.00 42.59  ? 75  ILE E CG1 1 
ATOM   6943  C CG2 . ILE E  1 74  ? 19.310  9.983   86.172  1.00 39.15  ? 75  ILE E CG2 1 
ATOM   6944  C CD1 . ILE E  1 74  ? 19.656  11.982  83.719  1.00 42.43  ? 75  ILE E CD1 1 
ATOM   6945  N N   . SER E  1 75  ? 21.669  8.439   88.122  1.00 46.96  ? 76  SER E N   1 
ATOM   6946  C CA  . SER E  1 75  ? 21.539  7.261   88.990  1.00 47.77  ? 76  SER E CA  1 
ATOM   6947  C C   . SER E  1 75  ? 20.246  6.422   88.975  1.00 49.20  ? 76  SER E C   1 
ATOM   6948  O O   . SER E  1 75  ? 20.295  5.192   88.813  1.00 49.60  ? 76  SER E O   1 
ATOM   6949  C CB  . SER E  1 75  ? 21.829  7.719   90.406  1.00 47.14  ? 76  SER E CB  1 
ATOM   6950  O OG  . SER E  1 75  ? 21.836  9.133   90.422  1.00 46.22  ? 76  SER E OG  1 
ATOM   6951  N N   . SER E  1 76  ? 19.104  7.076   89.178  1.00 48.59  ? 77  SER E N   1 
ATOM   6952  C CA  . SER E  1 76  ? 17.809  6.394   89.171  1.00 48.14  ? 77  SER E CA  1 
ATOM   6953  C C   . SER E  1 76  ? 16.819  7.305   88.452  1.00 47.64  ? 77  SER E C   1 
ATOM   6954  O O   . SER E  1 76  ? 16.311  8.287   89.029  1.00 48.31  ? 77  SER E O   1 
ATOM   6955  C CB  . SER E  1 76  ? 17.339  6.118   90.605  1.00 49.37  ? 77  SER E CB  1 
ATOM   6956  O OG  . SER E  1 76  ? 16.178  5.302   90.633  1.00 49.17  ? 77  SER E OG  1 
ATOM   6957  N N   . LEU E  1 77  ? 16.549  6.961   87.193  1.00 45.19  ? 78  LEU E N   1 
ATOM   6958  C CA  . LEU E  1 77  ? 15.672  7.737   86.323  1.00 43.23  ? 78  LEU E CA  1 
ATOM   6959  C C   . LEU E  1 77  ? 14.290  8.128   86.849  1.00 42.23  ? 78  LEU E C   1 
ATOM   6960  O O   . LEU E  1 77  ? 13.569  7.331   87.460  1.00 41.14  ? 78  LEU E O   1 
ATOM   6961  C CB  . LEU E  1 77  ? 15.559  7.042   84.953  1.00 41.46  ? 78  LEU E CB  1 
ATOM   6962  C CG  . LEU E  1 77  ? 15.828  7.990   83.768  1.00 41.00  ? 78  LEU E CG  1 
ATOM   6963  C CD1 . LEU E  1 77  ? 17.126  8.755   84.007  1.00 40.04  ? 78  LEU E CD1 1 
ATOM   6964  C CD2 . LEU E  1 77  ? 15.888  7.231   82.460  1.00 38.08  ? 78  LEU E CD2 1 
ATOM   6965  N N   . GLN E  1 78  ? 13.948  9.387   86.586  1.00 41.12  ? 79  GLN E N   1 
ATOM   6966  C CA  . GLN E  1 78  ? 12.696  9.988   87.004  1.00 40.56  ? 79  GLN E CA  1 
ATOM   6967  C C   . GLN E  1 78  ? 11.946  10.582  85.823  1.00 40.16  ? 79  GLN E C   1 
ATOM   6968  O O   . GLN E  1 78  ? 12.562  11.137  84.909  1.00 39.06  ? 79  GLN E O   1 
ATOM   6969  C CB  . GLN E  1 78  ? 12.992  11.093  88.001  1.00 43.08  ? 79  GLN E CB  1 
ATOM   6970  C CG  . GLN E  1 78  ? 13.807  10.638  89.195  1.00 46.87  ? 79  GLN E CG  1 
ATOM   6971  C CD  . GLN E  1 78  ? 12.954  10.455  90.424  1.00 48.12  ? 79  GLN E CD  1 
ATOM   6972  O OE1 . GLN E  1 78  ? 12.322  11.405  90.901  1.00 48.80  ? 79  GLN E OE1 1 
ATOM   6973  N NE2 . GLN E  1 78  ? 12.921  9.231   90.944  1.00 48.91  ? 79  GLN E NE2 1 
ATOM   6974  N N   . PRO E  1 79  ? 10.598  10.477  85.830  1.00 40.46  ? 80  PRO E N   1 
ATOM   6975  C CA  . PRO E  1 79  ? 9.690   10.984  84.792  1.00 40.92  ? 80  PRO E CA  1 
ATOM   6976  C C   . PRO E  1 79  ? 9.959   12.396  84.270  1.00 42.05  ? 80  PRO E C   1 
ATOM   6977  O O   . PRO E  1 79  ? 9.498   12.758  83.192  1.00 43.44  ? 80  PRO E O   1 
ATOM   6978  C CB  . PRO E  1 79  ? 8.301   10.847  85.432  1.00 39.52  ? 80  PRO E CB  1 
ATOM   6979  C CG  . PRO E  1 79  ? 8.554   10.492  86.851  1.00 39.53  ? 80  PRO E CG  1 
ATOM   6980  C CD  . PRO E  1 79  ? 9.830   9.719   86.825  1.00 39.99  ? 80  PRO E CD  1 
ATOM   6981  N N   . GLU E  1 80  ? 10.702  13.192  85.028  1.00 42.93  ? 81  GLU E N   1 
ATOM   6982  C CA  . GLU E  1 80  ? 11.048  14.542  84.603  1.00 42.63  ? 81  GLU E CA  1 
ATOM   6983  C C   . GLU E  1 80  ? 12.504  14.540  84.141  1.00 42.12  ? 81  GLU E C   1 
ATOM   6984  O O   . GLU E  1 80  ? 13.030  15.561  83.713  1.00 41.94  ? 81  GLU E O   1 
ATOM   6985  C CB  . GLU E  1 80  ? 10.859  15.534  85.750  1.00 42.34  ? 81  GLU E CB  1 
ATOM   6986  C CG  . GLU E  1 80  ? 11.503  15.096  87.040  1.00 44.42  ? 81  GLU E CG  1 
ATOM   6987  C CD  . GLU E  1 80  ? 10.623  14.148  87.830  1.00 46.27  ? 81  GLU E CD  1 
ATOM   6988  O OE1 . GLU E  1 80  ? 9.853   13.403  87.189  1.00 46.04  ? 81  GLU E OE1 1 
ATOM   6989  O OE2 . GLU E  1 80  ? 10.706  14.135  89.085  1.00 46.79  ? 81  GLU E OE2 1 
ATOM   6990  N N   . ASP E  1 81  ? 13.155  13.386  84.246  1.00 41.78  ? 82  ASP E N   1 
ATOM   6991  C CA  . ASP E  1 81  ? 14.541  13.271  83.817  1.00 42.02  ? 82  ASP E CA  1 
ATOM   6992  C C   . ASP E  1 81  ? 14.546  13.056  82.309  1.00 41.64  ? 82  ASP E C   1 
ATOM   6993  O O   . ASP E  1 81  ? 15.600  13.098  81.660  1.00 41.82  ? 82  ASP E O   1 
ATOM   6994  C CB  . ASP E  1 81  ? 15.251  12.094  84.502  1.00 42.44  ? 82  ASP E CB  1 
ATOM   6995  C CG  . ASP E  1 81  ? 15.491  12.328  85.983  1.00 43.11  ? 82  ASP E CG  1 
ATOM   6996  O OD1 . ASP E  1 81  ? 15.481  13.503  86.421  1.00 41.51  ? 82  ASP E OD1 1 
ATOM   6997  O OD2 . ASP E  1 81  ? 15.709  11.329  86.707  1.00 43.28  ? 82  ASP E OD2 1 
ATOM   6998  N N   . PHE E  1 82  ? 13.365  12.823  81.749  1.00 39.06  ? 83  PHE E N   1 
ATOM   6999  C CA  . PHE E  1 82  ? 13.279  12.627  80.319  1.00 37.31  ? 83  PHE E CA  1 
ATOM   7000  C C   . PHE E  1 82  ? 13.165  13.952  79.565  1.00 35.85  ? 83  PHE E C   1 
ATOM   7001  O O   . PHE E  1 82  ? 12.197  14.695  79.711  1.00 34.68  ? 83  PHE E O   1 
ATOM   7002  C CB  . PHE E  1 82  ? 12.113  11.705  79.996  1.00 37.86  ? 83  PHE E CB  1 
ATOM   7003  C CG  . PHE E  1 82  ? 12.272  10.335  80.570  1.00 38.82  ? 83  PHE E CG  1 
ATOM   7004  C CD1 . PHE E  1 82  ? 12.062  10.102  81.917  1.00 39.54  ? 83  PHE E CD1 1 
ATOM   7005  C CD2 . PHE E  1 82  ? 12.673  9.273   79.763  1.00 38.41  ? 83  PHE E CD2 1 
ATOM   7006  C CE1 . PHE E  1 82  ? 12.252  8.824   82.449  1.00 40.08  ? 83  PHE E CE1 1 
ATOM   7007  C CE2 . PHE E  1 82  ? 12.866  8.001   80.287  1.00 35.71  ? 83  PHE E CE2 1 
ATOM   7008  C CZ  . PHE E  1 82  ? 12.655  7.776   81.620  1.00 37.91  ? 83  PHE E CZ  1 
ATOM   7009  N N   . ALA E  1 83  ? 14.192  14.240  78.775  1.00 33.79  ? 84  ALA E N   1 
ATOM   7010  C CA  . ALA E  1 83  ? 14.263  15.453  77.974  1.00 33.25  ? 84  ALA E CA  1 
ATOM   7011  C C   . ALA E  1 83  ? 15.532  15.432  77.113  1.00 34.13  ? 84  ALA E C   1 
ATOM   7012  O O   . ALA E  1 83  ? 15.998  14.361  76.689  1.00 34.61  ? 84  ALA E O   1 
ATOM   7013  C CB  . ALA E  1 83  ? 14.253  16.674  78.859  1.00 28.17  ? 84  ALA E CB  1 
ATOM   7014  N N   . THR E  1 84  ? 16.090  16.609  76.850  1.00 33.55  ? 85  THR E N   1 
ATOM   7015  C CA  . THR E  1 84  ? 17.283  16.688  76.023  1.00 33.99  ? 85  THR E CA  1 
ATOM   7016  C C   . THR E  1 84  ? 18.483  17.064  76.864  1.00 33.16  ? 85  THR E C   1 
ATOM   7017  O O   . THR E  1 84  ? 18.342  17.835  77.810  1.00 32.64  ? 85  THR E O   1 
ATOM   7018  C CB  . THR E  1 84  ? 17.127  17.738  74.912  1.00 35.22  ? 85  THR E CB  1 
ATOM   7019  O OG1 . THR E  1 84  ? 17.556  17.190  73.658  1.00 34.94  ? 85  THR E OG1 1 
ATOM   7020  C CG2 . THR E  1 84  ? 17.971  18.965  75.231  1.00 36.03  ? 85  THR E CG2 1 
ATOM   7021  N N   . TYR E  1 85  ? 19.651  16.527  76.502  1.00 32.07  ? 86  TYR E N   1 
ATOM   7022  C CA  . TYR E  1 85  ? 20.880  16.806  77.222  1.00 32.74  ? 86  TYR E CA  1 
ATOM   7023  C C   . TYR E  1 85  ? 22.028  17.233  76.333  1.00 34.74  ? 86  TYR E C   1 
ATOM   7024  O O   . TYR E  1 85  ? 22.564  16.443  75.565  1.00 32.85  ? 86  TYR E O   1 
ATOM   7025  C CB  . TYR E  1 85  ? 21.305  15.606  78.066  1.00 30.40  ? 86  TYR E CB  1 
ATOM   7026  C CG  . TYR E  1 85  ? 20.458  15.434  79.296  1.00 28.33  ? 86  TYR E CG  1 
ATOM   7027  C CD1 . TYR E  1 85  ? 19.568  14.373  79.407  1.00 28.89  ? 86  TYR E CD1 1 
ATOM   7028  C CD2 . TYR E  1 85  ? 20.487  16.374  80.318  1.00 27.17  ? 86  TYR E CD2 1 
ATOM   7029  C CE1 . TYR E  1 85  ? 18.721  14.256  80.502  1.00 27.84  ? 86  TYR E CE1 1 
ATOM   7030  C CE2 . TYR E  1 85  ? 19.644  16.263  81.415  1.00 27.50  ? 86  TYR E CE2 1 
ATOM   7031  C CZ  . TYR E  1 85  ? 18.763  15.203  81.495  1.00 27.89  ? 86  TYR E CZ  1 
ATOM   7032  O OH  . TYR E  1 85  ? 17.894  15.099  82.555  1.00 30.13  ? 86  TYR E OH  1 
ATOM   7033  N N   . TYR E  1 86  ? 22.397  18.503  76.475  1.00 39.38  ? 87  TYR E N   1 
ATOM   7034  C CA  . TYR E  1 86  ? 23.478  19.113  75.718  1.00 44.33  ? 87  TYR E CA  1 
ATOM   7035  C C   . TYR E  1 86  ? 24.722  19.232  76.578  1.00 46.94  ? 87  TYR E C   1 
ATOM   7036  O O   . TYR E  1 86  ? 24.638  19.199  77.809  1.00 47.48  ? 87  TYR E O   1 
ATOM   7037  C CB  . TYR E  1 86  ? 23.110  20.527  75.264  1.00 45.49  ? 87  TYR E CB  1 
ATOM   7038  C CG  . TYR E  1 86  ? 21.920  20.644  74.341  1.00 46.70  ? 87  TYR E CG  1 
ATOM   7039  C CD1 . TYR E  1 86  ? 20.696  21.108  74.820  1.00 47.06  ? 87  TYR E CD1 1 
ATOM   7040  C CD2 . TYR E  1 86  ? 22.035  20.349  72.982  1.00 46.38  ? 87  TYR E CD2 1 
ATOM   7041  C CE1 . TYR E  1 86  ? 19.620  21.286  73.977  1.00 48.74  ? 87  TYR E CE1 1 
ATOM   7042  C CE2 . TYR E  1 86  ? 20.963  20.519  72.122  1.00 49.10  ? 87  TYR E CE2 1 
ATOM   7043  C CZ  . TYR E  1 86  ? 19.750  20.992  72.627  1.00 51.06  ? 87  TYR E CZ  1 
ATOM   7044  O OH  . TYR E  1 86  ? 18.659  21.170  71.795  1.00 53.54  ? 87  TYR E OH  1 
ATOM   7045  N N   . CYS E  1 87  ? 25.869  19.379  75.915  1.00 49.63  ? 88  CYS E N   1 
ATOM   7046  C CA  . CYS E  1 87  ? 27.154  19.538  76.584  1.00 52.82  ? 88  CYS E CA  1 
ATOM   7047  C C   . CYS E  1 87  ? 27.940  20.638  75.889  1.00 53.10  ? 88  CYS E C   1 
ATOM   7048  O O   . CYS E  1 87  ? 27.990  20.698  74.666  1.00 54.02  ? 88  CYS E O   1 
ATOM   7049  C CB  . CYS E  1 87  ? 27.942  18.226  76.575  1.00 54.94  ? 88  CYS E CB  1 
ATOM   7050  S SG  . CYS E  1 87  ? 28.106  17.419  74.955  1.00 59.20  ? 88  CYS E SG  1 
ATOM   7051  N N   . GLN E  1 88  ? 28.572  21.496  76.673  1.00 53.78  ? 89  GLN E N   1 
ATOM   7052  C CA  . GLN E  1 88  ? 29.302  22.612  76.109  1.00 55.33  ? 89  GLN E CA  1 
ATOM   7053  C C   . GLN E  1 88  ? 30.778  22.743  76.524  1.00 56.10  ? 89  GLN E C   1 
ATOM   7054  O O   . GLN E  1 88  ? 31.114  22.629  77.703  1.00 55.93  ? 89  GLN E O   1 
ATOM   7055  C CB  . GLN E  1 88  ? 28.547  23.883  76.473  1.00 55.35  ? 89  GLN E CB  1 
ATOM   7056  C CG  . GLN E  1 88  ? 29.071  25.126  75.821  1.00 55.07  ? 89  GLN E CG  1 
ATOM   7057  C CD  . GLN E  1 88  ? 29.054  26.285  76.766  1.00 53.92  ? 89  GLN E CD  1 
ATOM   7058  O OE1 . GLN E  1 88  ? 28.002  26.673  77.273  1.00 53.84  ? 89  GLN E OE1 1 
ATOM   7059  N NE2 . GLN E  1 88  ? 30.225  26.849  77.020  1.00 54.39  ? 89  GLN E NE2 1 
ATOM   7060  N N   . GLN E  1 89  ? 31.652  23.004  75.551  1.00 56.70  ? 90  GLN E N   1 
ATOM   7061  C CA  . GLN E  1 89  ? 33.076  23.171  75.829  1.00 57.51  ? 90  GLN E CA  1 
ATOM   7062  C C   . GLN E  1 89  ? 33.400  24.651  76.008  1.00 59.02  ? 90  GLN E C   1 
ATOM   7063  O O   . GLN E  1 89  ? 32.920  25.503  75.268  1.00 58.75  ? 90  GLN E O   1 
ATOM   7064  C CB  . GLN E  1 89  ? 33.947  22.582  74.703  1.00 56.68  ? 90  GLN E CB  1 
ATOM   7065  C CG  . GLN E  1 89  ? 34.651  23.617  73.828  1.00 56.46  ? 90  GLN E CG  1 
ATOM   7066  C CD  . GLN E  1 89  ? 33.721  24.239  72.807  1.00 57.97  ? 90  GLN E CD  1 
ATOM   7067  O OE1 . GLN E  1 89  ? 32.575  24.557  73.118  1.00 58.82  ? 90  GLN E OE1 1 
ATOM   7068  N NE2 . GLN E  1 89  ? 34.210  24.424  71.584  1.00 55.90  ? 90  GLN E NE2 1 
ATOM   7069  N N   . SER E  1 90  ? 34.223  24.948  77.002  1.00 60.96  ? 91  SER E N   1 
ATOM   7070  C CA  . SER E  1 90  ? 34.599  26.312  77.273  1.00 62.58  ? 91  SER E CA  1 
ATOM   7071  C C   . SER E  1 90  ? 36.105  26.453  77.409  1.00 64.86  ? 91  SER E C   1 
ATOM   7072  O O   . SER E  1 90  ? 36.598  27.135  78.305  1.00 65.79  ? 91  SER E O   1 
ATOM   7073  C CB  . SER E  1 90  ? 33.905  26.776  78.541  1.00 61.77  ? 91  SER E CB  1 
ATOM   7074  O OG  . SER E  1 90  ? 32.517  26.564  78.419  1.00 61.38  ? 91  SER E OG  1 
ATOM   7075  N N   . TYR E  1 91  ? 36.846  25.798  76.526  1.00 67.33  ? 92  TYR E N   1 
ATOM   7076  C CA  . TYR E  1 91  ? 38.291  25.919  76.574  1.00 70.03  ? 92  TYR E CA  1 
ATOM   7077  C C   . TYR E  1 91  ? 38.629  27.058  75.634  1.00 70.52  ? 92  TYR E C   1 
ATOM   7078  O O   . TYR E  1 91  ? 39.186  28.074  76.046  1.00 71.11  ? 92  TYR E O   1 
ATOM   7079  C CB  . TYR E  1 91  ? 38.988  24.643  76.098  1.00 72.27  ? 92  TYR E CB  1 
ATOM   7080  C CG  . TYR E  1 91  ? 40.373  24.485  76.704  1.00 75.20  ? 92  TYR E CG  1 
ATOM   7081  C CD1 . TYR E  1 91  ? 40.527  24.194  78.058  1.00 75.68  ? 92  TYR E CD1 1 
ATOM   7082  C CD2 . TYR E  1 91  ? 41.528  24.671  75.936  1.00 76.57  ? 92  TYR E CD2 1 
ATOM   7083  C CE1 . TYR E  1 91  ? 41.794  24.094  78.641  1.00 78.27  ? 92  TYR E CE1 1 
ATOM   7084  C CE2 . TYR E  1 91  ? 42.808  24.572  76.506  1.00 78.03  ? 92  TYR E CE2 1 
ATOM   7085  C CZ  . TYR E  1 91  ? 42.935  24.281  77.863  1.00 79.25  ? 92  TYR E CZ  1 
ATOM   7086  O OH  . TYR E  1 91  ? 44.190  24.163  78.447  1.00 78.99  ? 92  TYR E OH  1 
ATOM   7087  N N   . SER E  1 92  ? 38.264  26.877  74.367  1.00 70.75  ? 93  SER E N   1 
ATOM   7088  C CA  . SER E  1 92  ? 38.487  27.864  73.312  1.00 70.26  ? 93  SER E CA  1 
ATOM   7089  C C   . SER E  1 92  ? 37.615  29.116  73.409  1.00 71.31  ? 93  SER E C   1 
ATOM   7090  O O   . SER E  1 92  ? 36.889  29.325  74.384  1.00 71.29  ? 93  SER E O   1 
ATOM   7091  C CB  . SER E  1 92  ? 38.239  27.220  71.951  1.00 69.20  ? 93  SER E CB  1 
ATOM   7092  O OG  . SER E  1 92  ? 37.587  28.121  71.075  1.00 67.75  ? 93  SER E OG  1 
ATOM   7093  N N   . THR E  1 93  ? 37.703  29.950  72.377  1.00 72.55  ? 94  THR E N   1 
ATOM   7094  C CA  . THR E  1 93  ? 36.915  31.172  72.289  1.00 72.66  ? 94  THR E CA  1 
ATOM   7095  C C   . THR E  1 93  ? 35.633  30.750  71.589  1.00 72.43  ? 94  THR E C   1 
ATOM   7096  O O   . THR E  1 93  ? 34.676  31.518  71.474  1.00 72.24  ? 94  THR E O   1 
ATOM   7097  C CB  . THR E  1 93  ? 37.597  32.216  71.406  1.00 72.96  ? 94  THR E CB  1 
ATOM   7098  O OG1 . THR E  1 93  ? 37.252  31.968  70.036  1.00 72.77  ? 94  THR E OG1 1 
ATOM   7099  C CG2 . THR E  1 93  ? 39.124  32.131  71.561  1.00 73.31  ? 94  THR E CG2 1 
ATOM   7100  N N   . SER E  1 94  ? 35.649  29.510  71.107  1.00 71.88  ? 95  SER E N   1 
ATOM   7101  C CA  . SER E  1 94  ? 34.518  28.932  70.404  1.00 70.81  ? 95  SER E CA  1 
ATOM   7102  C C   . SER E  1 94  ? 33.694  28.005  71.293  1.00 69.17  ? 95  SER E C   1 
ATOM   7103  O O   . SER E  1 94  ? 33.700  26.787  71.105  1.00 69.10  ? 95  SER E O   1 
ATOM   7104  C CB  . SER E  1 94  ? 35.003  28.164  69.167  1.00 71.41  ? 95  SER E CB  1 
ATOM   7105  O OG  . SER E  1 94  ? 35.919  27.140  69.515  1.00 71.89  ? 95  SER E OG  1 
ATOM   7106  N N   . HIS E  1 95  ? 33.006  28.576  72.274  1.00 66.52  ? 96  HIS E N   1 
ATOM   7107  C CA  . HIS E  1 95  ? 32.164  27.766  73.127  1.00 65.27  ? 96  HIS E CA  1 
ATOM   7108  C C   . HIS E  1 95  ? 31.201  27.158  72.112  1.00 64.63  ? 96  HIS E C   1 
ATOM   7109  O O   . HIS E  1 95  ? 30.650  27.878  71.287  1.00 65.43  ? 96  HIS E O   1 
ATOM   7110  C CB  . HIS E  1 95  ? 31.425  28.647  74.130  1.00 66.10  ? 96  HIS E CB  1 
ATOM   7111  C CG  . HIS E  1 95  ? 32.326  29.534  74.936  1.00 66.72  ? 96  HIS E CG  1 
ATOM   7112  N ND1 . HIS E  1 95  ? 31.981  30.008  76.185  1.00 65.90  ? 96  HIS E ND1 1 
ATOM   7113  C CD2 . HIS E  1 95  ? 33.547  30.054  74.660  1.00 66.72  ? 96  HIS E CD2 1 
ATOM   7114  C CE1 . HIS E  1 95  ? 32.950  30.781  76.643  1.00 66.31  ? 96  HIS E CE1 1 
ATOM   7115  N NE2 . HIS E  1 95  ? 33.911  30.826  75.737  1.00 67.00  ? 96  HIS E NE2 1 
ATOM   7116  N N   . THR E  1 96  ? 31.001  25.844  72.150  1.00 63.16  ? 97  THR E N   1 
ATOM   7117  C CA  . THR E  1 96  ? 30.145  25.187  71.161  1.00 60.74  ? 97  THR E CA  1 
ATOM   7118  C C   . THR E  1 96  ? 29.564  23.867  71.642  1.00 59.95  ? 97  THR E C   1 
ATOM   7119  O O   . THR E  1 96  ? 30.307  22.910  71.862  1.00 60.32  ? 97  THR E O   1 
ATOM   7120  C CB  . THR E  1 96  ? 30.953  24.901  69.894  1.00 60.61  ? 97  THR E CB  1 
ATOM   7121  O OG1 . THR E  1 96  ? 32.183  24.254  70.261  1.00 57.96  ? 97  THR E OG1 1 
ATOM   7122  C CG2 . THR E  1 96  ? 31.250  26.202  69.135  1.00 60.13  ? 97  THR E CG2 1 
ATOM   7123  N N   . PHE E  1 97  ? 28.240  23.802  71.765  1.00 58.12  ? 98  PHE E N   1 
ATOM   7124  C CA  . PHE E  1 97  ? 27.570  22.586  72.241  1.00 56.47  ? 98  PHE E CA  1 
ATOM   7125  C C   . PHE E  1 97  ? 27.682  21.370  71.331  1.00 55.62  ? 98  PHE E C   1 
ATOM   7126  O O   . PHE E  1 97  ? 28.362  21.378  70.294  1.00 55.40  ? 98  PHE E O   1 
ATOM   7127  C CB  . PHE E  1 97  ? 26.075  22.818  72.457  1.00 55.44  ? 98  PHE E CB  1 
ATOM   7128  C CG  . PHE E  1 97  ? 25.729  24.192  72.901  1.00 55.20  ? 98  PHE E CG  1 
ATOM   7129  C CD1 . PHE E  1 97  ? 25.795  25.254  72.012  1.00 54.67  ? 98  PHE E CD1 1 
ATOM   7130  C CD2 . PHE E  1 97  ? 25.340  24.432  74.214  1.00 55.37  ? 98  PHE E CD2 1 
ATOM   7131  C CE1 . PHE E  1 97  ? 25.479  26.542  72.427  1.00 55.12  ? 98  PHE E CE1 1 
ATOM   7132  C CE2 . PHE E  1 97  ? 25.022  25.714  74.644  1.00 55.00  ? 98  PHE E CE2 1 
ATOM   7133  C CZ  . PHE E  1 97  ? 25.091  26.775  73.750  1.00 55.04  ? 98  PHE E CZ  1 
ATOM   7134  N N   . GLY E  1 98  ? 26.985  20.323  71.752  1.00 53.94  ? 99  GLY E N   1 
ATOM   7135  C CA  . GLY E  1 98  ? 26.935  19.100  70.985  1.00 54.63  ? 99  GLY E CA  1 
ATOM   7136  C C   . GLY E  1 98  ? 25.529  19.109  70.420  1.00 54.84  ? 99  GLY E C   1 
ATOM   7137  O O   . GLY E  1 98  ? 24.780  20.061  70.667  1.00 55.42  ? 99  GLY E O   1 
ATOM   7138  N N   . GLN E  1 99  ? 25.158  18.077  69.667  1.00 53.24  ? 100 GLN E N   1 
ATOM   7139  C CA  . GLN E  1 99  ? 23.821  18.004  69.094  1.00 50.35  ? 100 GLN E CA  1 
ATOM   7140  C C   . GLN E  1 99  ? 22.783  17.760  70.170  1.00 49.23  ? 100 GLN E C   1 
ATOM   7141  O O   . GLN E  1 99  ? 21.600  17.976  69.958  1.00 50.74  ? 100 GLN E O   1 
ATOM   7142  C CB  . GLN E  1 99  ? 23.765  16.879  68.086  1.00 50.92  ? 100 GLN E CB  1 
ATOM   7143  C CG  . GLN E  1 99  ? 24.663  15.712  68.452  1.00 52.53  ? 100 GLN E CG  1 
ATOM   7144  C CD  . GLN E  1 99  ? 24.817  14.733  67.313  1.00 54.02  ? 100 GLN E CD  1 
ATOM   7145  O OE1 . GLN E  1 99  ? 23.933  13.905  67.058  1.00 54.73  ? 100 GLN E OE1 1 
ATOM   7146  N NE2 . GLN E  1 99  ? 25.935  14.834  66.598  1.00 54.05  ? 100 GLN E NE2 1 
ATOM   7147  N N   . GLY E  1 100 ? 23.232  17.305  71.331  1.00 48.10  ? 101 GLY E N   1 
ATOM   7148  C CA  . GLY E  1 100 ? 22.320  17.026  72.420  1.00 46.17  ? 101 GLY E CA  1 
ATOM   7149  C C   . GLY E  1 100 ? 21.794  15.605  72.325  1.00 45.54  ? 101 GLY E C   1 
ATOM   7150  O O   . GLY E  1 100 ? 21.424  15.157  71.235  1.00 45.64  ? 101 GLY E O   1 
ATOM   7151  N N   . THR E  1 101 ? 21.796  14.879  73.446  1.00 44.03  ? 102 THR E N   1 
ATOM   7152  C CA  . THR E  1 101 ? 21.272  13.517  73.474  1.00 41.87  ? 102 THR E CA  1 
ATOM   7153  C C   . THR E  1 101 ? 19.892  13.644  74.080  1.00 41.97  ? 102 THR E C   1 
ATOM   7154  O O   . THR E  1 101 ? 19.677  14.501  74.926  1.00 42.68  ? 102 THR E O   1 
ATOM   7155  C CB  . THR E  1 101 ? 22.103  12.578  74.343  1.00 40.06  ? 102 THR E CB  1 
ATOM   7156  O OG1 . THR E  1 101 ? 23.383  12.364  73.739  1.00 39.65  ? 102 THR E OG1 1 
ATOM   7157  C CG2 . THR E  1 101 ? 21.392  11.248  74.481  1.00 38.41  ? 102 THR E CG2 1 
ATOM   7158  N N   . LYS E  1 102 ? 18.958  12.806  73.661  1.00 42.34  ? 103 LYS E N   1 
ATOM   7159  C CA  . LYS E  1 102 ? 17.612  12.908  74.180  1.00 44.59  ? 103 LYS E CA  1 
ATOM   7160  C C   . LYS E  1 102 ? 17.063  11.588  74.677  1.00 46.78  ? 103 LYS E C   1 
ATOM   7161  O O   . LYS E  1 102 ? 16.948  10.632  73.908  1.00 47.77  ? 103 LYS E O   1 
ATOM   7162  C CB  . LYS E  1 102 ? 16.700  13.450  73.098  1.00 43.87  ? 103 LYS E CB  1 
ATOM   7163  C CG  . LYS E  1 102 ? 15.265  13.570  73.526  1.00 44.47  ? 103 LYS E CG  1 
ATOM   7164  C CD  . LYS E  1 102 ? 14.392  13.892  72.342  1.00 44.57  ? 103 LYS E CD  1 
ATOM   7165  C CE  . LYS E  1 102 ? 13.062  14.449  72.781  1.00 46.12  ? 103 LYS E CE  1 
ATOM   7166  N NZ  . LYS E  1 102 ? 12.255  14.859  71.604  1.00 47.11  ? 103 LYS E NZ  1 
ATOM   7167  N N   . LEU E  1 103 ? 16.713  11.541  75.961  1.00 48.84  ? 104 LEU E N   1 
ATOM   7168  C CA  . LEU E  1 103 ? 16.162  10.323  76.558  1.00 50.45  ? 104 LEU E CA  1 
ATOM   7169  C C   . LEU E  1 103 ? 14.659  10.272  76.379  1.00 51.93  ? 104 LEU E C   1 
ATOM   7170  O O   . LEU E  1 103 ? 13.933  11.209  76.744  1.00 51.75  ? 104 LEU E O   1 
ATOM   7171  C CB  . LEU E  1 103 ? 16.434  10.243  78.058  1.00 50.78  ? 104 LEU E CB  1 
ATOM   7172  C CG  . LEU E  1 103 ? 17.804  10.484  78.678  1.00 52.35  ? 104 LEU E CG  1 
ATOM   7173  C CD1 . LEU E  1 103 ? 17.657  10.194  80.161  1.00 50.54  ? 104 LEU E CD1 1 
ATOM   7174  C CD2 . LEU E  1 103 ? 18.892  9.610   78.043  1.00 52.08  ? 104 LEU E CD2 1 
ATOM   7175  N N   . GLU E  1 104 ? 14.192  9.161   75.835  1.00 52.83  ? 105 GLU E N   1 
ATOM   7176  C CA  . GLU E  1 104 ? 12.773  8.977   75.632  1.00 53.96  ? 105 GLU E CA  1 
ATOM   7177  C C   . GLU E  1 104 ? 12.322  7.910   76.627  1.00 53.76  ? 105 GLU E C   1 
ATOM   7178  O O   . GLU E  1 104 ? 13.130  7.089   77.056  1.00 54.12  ? 105 GLU E O   1 
ATOM   7179  C CB  . GLU E  1 104 ? 12.514  8.516   74.199  1.00 55.05  ? 105 GLU E CB  1 
ATOM   7180  C CG  . GLU E  1 104 ? 12.967  7.094   73.932  1.00 56.47  ? 105 GLU E CG  1 
ATOM   7181  C CD  . GLU E  1 104 ? 11.869  6.253   73.310  1.00 57.07  ? 105 GLU E CD  1 
ATOM   7182  O OE1 . GLU E  1 104 ? 11.974  5.007   73.356  1.00 57.04  ? 105 GLU E OE1 1 
ATOM   7183  O OE2 . GLU E  1 104 ? 10.902  6.839   72.773  1.00 57.56  ? 105 GLU E OE2 1 
ATOM   7184  N N   . ILE E  1 105 ? 11.040  7.922   76.985  1.00 54.03  ? 106 ILE E N   1 
ATOM   7185  C CA  . ILE E  1 105 ? 10.484  6.955   77.931  1.00 53.96  ? 106 ILE E CA  1 
ATOM   7186  C C   . ILE E  1 105 ? 10.208  5.651   77.230  1.00 54.67  ? 106 ILE E C   1 
ATOM   7187  O O   . ILE E  1 105 ? 9.263   5.559   76.457  1.00 55.04  ? 106 ILE E O   1 
ATOM   7188  C CB  . ILE E  1 105 ? 9.141   7.422   78.524  1.00 54.02  ? 106 ILE E CB  1 
ATOM   7189  C CG1 . ILE E  1 105 ? 9.296   8.788   79.222  1.00 55.64  ? 106 ILE E CG1 1 
ATOM   7190  C CG2 . ILE E  1 105 ? 8.632   6.372   79.478  1.00 52.28  ? 106 ILE E CG2 1 
ATOM   7191  C CD1 . ILE E  1 105 ? 8.168   9.814   78.900  1.00 54.73  ? 106 ILE E CD1 1 
ATOM   7192  N N   . LYS E  1 106 ? 11.034  4.646   77.497  1.00 56.17  ? 107 LYS E N   1 
ATOM   7193  C CA  . LYS E  1 106 ? 10.869  3.325   76.890  1.00 56.71  ? 107 LYS E CA  1 
ATOM   7194  C C   . LYS E  1 106 ? 9.671   2.594   77.509  1.00 55.16  ? 107 LYS E C   1 
ATOM   7195  O O   . LYS E  1 106 ? 9.189   2.973   78.572  1.00 54.50  ? 107 LYS E O   1 
ATOM   7196  C CB  . LYS E  1 106 ? 12.149  2.493   77.088  1.00 58.28  ? 107 LYS E CB  1 
ATOM   7197  C CG  . LYS E  1 106 ? 11.896  0.988   77.104  1.00 61.68  ? 107 LYS E CG  1 
ATOM   7198  C CD  . LYS E  1 106 ? 13.118  0.179   77.504  1.00 64.25  ? 107 LYS E CD  1 
ATOM   7199  C CE  . LYS E  1 106 ? 14.119  0.048   76.363  1.00 67.03  ? 107 LYS E CE  1 
ATOM   7200  N NZ  . LYS E  1 106 ? 15.300  -0.813  76.736  1.00 69.25  ? 107 LYS E NZ  1 
ATOM   7201  N N   . ARG E  1 107 ? 9.181   1.563   76.831  1.00 53.50  ? 108 ARG E N   1 
ATOM   7202  C CA  . ARG E  1 107 ? 8.065   0.775   77.343  1.00 53.48  ? 108 ARG E CA  1 
ATOM   7203  C C   . ARG E  1 107 ? 7.623   -0.321  76.382  1.00 53.91  ? 108 ARG E C   1 
ATOM   7204  O O   . ARG E  1 107 ? 8.356   -0.701  75.458  1.00 54.28  ? 108 ARG E O   1 
ATOM   7205  C CB  . ARG E  1 107 ? 6.856   1.659   77.679  1.00 51.53  ? 108 ARG E CB  1 
ATOM   7206  C CG  . ARG E  1 107 ? 6.404   2.538   76.555  1.00 50.40  ? 108 ARG E CG  1 
ATOM   7207  C CD  . ARG E  1 107 ? 4.935   2.838   76.650  1.00 47.57  ? 108 ARG E CD  1 
ATOM   7208  N NE  . ARG E  1 107 ? 4.154   1.695   76.209  1.00 44.77  ? 108 ARG E NE  1 
ATOM   7209  C CZ  . ARG E  1 107 ? 2.828   1.685   76.130  1.00 43.39  ? 108 ARG E CZ  1 
ATOM   7210  N NH1 . ARG E  1 107 ? 2.119   2.766   76.459  1.00 41.05  ? 108 ARG E NH1 1 
ATOM   7211  N NH2 . ARG E  1 107 ? 2.212   0.583   75.735  1.00 42.45  ? 108 ARG E NH2 1 
ATOM   7212  N N   . THR E  1 108 ? 6.418   -0.830  76.623  1.00 53.02  ? 109 THR E N   1 
ATOM   7213  C CA  . THR E  1 108 ? 5.841   -1.888  75.809  1.00 52.25  ? 109 THR E CA  1 
ATOM   7214  C C   . THR E  1 108 ? 5.440   -1.324  74.456  1.00 50.42  ? 109 THR E C   1 
ATOM   7215  O O   . THR E  1 108 ? 4.989   -0.178  74.371  1.00 50.14  ? 109 THR E O   1 
ATOM   7216  C CB  . THR E  1 108 ? 4.595   -2.487  76.494  1.00 53.75  ? 109 THR E CB  1 
ATOM   7217  O OG1 . THR E  1 108 ? 3.786   -1.427  77.016  1.00 56.21  ? 109 THR E OG1 1 
ATOM   7218  C CG2 . THR E  1 108 ? 4.992   -3.408  77.633  1.00 54.06  ? 109 THR E CG2 1 
ATOM   7219  N N   . VAL E  1 109 ? 5.618   -2.133  73.409  1.00 48.23  ? 110 VAL E N   1 
ATOM   7220  C CA  . VAL E  1 109 ? 5.282   -1.754  72.036  1.00 45.44  ? 110 VAL E CA  1 
ATOM   7221  C C   . VAL E  1 109 ? 3.778   -1.696  71.894  1.00 45.71  ? 110 VAL E C   1 
ATOM   7222  O O   . VAL E  1 109 ? 3.049   -2.237  72.726  1.00 46.21  ? 110 VAL E O   1 
ATOM   7223  C CB  . VAL E  1 109 ? 5.856   -2.779  71.021  1.00 43.06  ? 110 VAL E CB  1 
ATOM   7224  C CG1 . VAL E  1 109 ? 5.133   -2.713  69.709  1.00 41.32  ? 110 VAL E CG1 1 
ATOM   7225  C CG2 . VAL E  1 109 ? 7.299   -2.491  70.784  1.00 43.26  ? 110 VAL E CG2 1 
ATOM   7226  N N   . ALA E  1 110 ? 3.314   -1.028  70.846  1.00 45.58  ? 111 ALA E N   1 
ATOM   7227  C CA  . ALA E  1 110 ? 1.888   -0.912  70.593  1.00 45.87  ? 111 ALA E CA  1 
ATOM   7228  C C   . ALA E  1 110 ? 1.658   -0.477  69.162  1.00 45.59  ? 111 ALA E C   1 
ATOM   7229  O O   . ALA E  1 110 ? 2.190   0.531   68.717  1.00 45.13  ? 111 ALA E O   1 
ATOM   7230  C CB  . ALA E  1 110 ? 1.254   0.100   71.564  1.00 45.63  ? 111 ALA E CB  1 
ATOM   7231  N N   . ALA E  1 111 ? 0.871   -1.250  68.432  1.00 47.04  ? 112 ALA E N   1 
ATOM   7232  C CA  . ALA E  1 111 ? 0.570   -0.905  67.052  1.00 48.06  ? 112 ALA E CA  1 
ATOM   7233  C C   . ALA E  1 111 ? -0.258  0.376   67.062  1.00 49.45  ? 112 ALA E C   1 
ATOM   7234  O O   . ALA E  1 111 ? -1.039  0.621   67.992  1.00 49.64  ? 112 ALA E O   1 
ATOM   7235  C CB  . ALA E  1 111 ? -0.215  -2.037  66.373  1.00 46.31  ? 112 ALA E CB  1 
ATOM   7236  N N   . PRO E  1 112 ? -0.092  1.220   66.031  1.00 50.60  ? 113 PRO E N   1 
ATOM   7237  C CA  . PRO E  1 112 ? -0.855  2.462   65.975  1.00 50.40  ? 113 PRO E CA  1 
ATOM   7238  C C   . PRO E  1 112 ? -2.218  2.084   65.458  1.00 50.41  ? 113 PRO E C   1 
ATOM   7239  O O   . PRO E  1 112 ? -2.418  0.962   64.999  1.00 50.46  ? 113 PRO E O   1 
ATOM   7240  C CB  . PRO E  1 112 ? -0.103  3.261   64.928  1.00 50.69  ? 113 PRO E CB  1 
ATOM   7241  C CG  . PRO E  1 112 ? 0.180   2.190   63.894  1.00 49.91  ? 113 PRO E CG  1 
ATOM   7242  C CD  . PRO E  1 112 ? 0.701   1.050   64.794  1.00 51.29  ? 113 PRO E CD  1 
ATOM   7243  N N   . SER E  1 113 ? -3.164  3.002   65.539  1.00 50.75  ? 114 SER E N   1 
ATOM   7244  C CA  . SER E  1 113 ? -4.471  2.725   64.970  1.00 50.14  ? 114 SER E CA  1 
ATOM   7245  C C   . SER E  1 113 ? -4.359  3.430   63.621  1.00 48.71  ? 114 SER E C   1 
ATOM   7246  O O   . SER E  1 113 ? -3.948  4.594   63.577  1.00 48.49  ? 114 SER E O   1 
ATOM   7247  C CB  . SER E  1 113 ? -5.583  3.337   65.824  1.00 50.68  ? 114 SER E CB  1 
ATOM   7248  O OG  . SER E  1 113 ? -5.875  2.518   66.939  1.00 51.88  ? 114 SER E OG  1 
ATOM   7249  N N   . VAL E  1 114 ? -4.673  2.732   62.526  1.00 46.74  ? 115 VAL E N   1 
ATOM   7250  C CA  . VAL E  1 114 ? -4.583  3.352   61.202  1.00 44.02  ? 115 VAL E CA  1 
ATOM   7251  C C   . VAL E  1 114 ? -5.919  3.950   60.750  1.00 42.57  ? 115 VAL E C   1 
ATOM   7252  O O   . VAL E  1 114 ? -6.970  3.326   60.884  1.00 41.36  ? 115 VAL E O   1 
ATOM   7253  C CB  . VAL E  1 114 ? -4.075  2.358   60.133  1.00 43.12  ? 115 VAL E CB  1 
ATOM   7254  C CG1 . VAL E  1 114 ? -3.854  3.093   58.813  1.00 41.73  ? 115 VAL E CG1 1 
ATOM   7255  C CG2 . VAL E  1 114 ? -2.786  1.704   60.597  1.00 40.32  ? 115 VAL E CG2 1 
ATOM   7256  N N   . PHE E  1 115 ? -5.851  5.177   60.237  1.00 41.25  ? 116 PHE E N   1 
ATOM   7257  C CA  . PHE E  1 115 ? -7.016  5.912   59.766  1.00 40.77  ? 116 PHE E CA  1 
ATOM   7258  C C   . PHE E  1 115 ? -6.718  6.546   58.422  1.00 41.05  ? 116 PHE E C   1 
ATOM   7259  O O   . PHE E  1 115 ? -5.562  6.590   58.001  1.00 43.52  ? 116 PHE E O   1 
ATOM   7260  C CB  . PHE E  1 115 ? -7.381  7.006   60.754  1.00 40.38  ? 116 PHE E CB  1 
ATOM   7261  C CG  . PHE E  1 115 ? -7.789  6.493   62.099  1.00 40.18  ? 116 PHE E CG  1 
ATOM   7262  C CD1 . PHE E  1 115 ? -6.855  6.298   63.095  1.00 39.54  ? 116 PHE E CD1 1 
ATOM   7263  C CD2 . PHE E  1 115 ? -9.115  6.191   62.364  1.00 39.67  ? 116 PHE E CD2 1 
ATOM   7264  C CE1 . PHE E  1 115 ? -7.239  5.812   64.328  1.00 38.39  ? 116 PHE E CE1 1 
ATOM   7265  C CE2 . PHE E  1 115 ? -9.503  5.705   63.589  1.00 37.91  ? 116 PHE E CE2 1 
ATOM   7266  C CZ  . PHE E  1 115 ? -8.566  5.515   64.569  1.00 38.39  ? 116 PHE E CZ  1 
ATOM   7267  N N   . ILE E  1 116 ? -7.751  7.045   57.746  1.00 39.94  ? 117 ILE E N   1 
ATOM   7268  C CA  . ILE E  1 116 ? -7.557  7.662   56.434  1.00 37.29  ? 117 ILE E CA  1 
ATOM   7269  C C   . ILE E  1 116 ? -8.701  8.636   56.070  1.00 35.76  ? 117 ILE E C   1 
ATOM   7270  O O   . ILE E  1 116 ? -9.876  8.339   56.277  1.00 35.59  ? 117 ILE E O   1 
ATOM   7271  C CB  . ILE E  1 116 ? -7.354  6.544   55.358  1.00 35.09  ? 117 ILE E CB  1 
ATOM   7272  C CG1 . ILE E  1 116 ? -6.686  7.110   54.118  1.00 36.42  ? 117 ILE E CG1 1 
ATOM   7273  C CG2 . ILE E  1 116 ? -8.646  5.935   54.994  1.00 34.33  ? 117 ILE E CG2 1 
ATOM   7274  C CD1 . ILE E  1 116 ? -6.313  6.062   53.132  1.00 35.33  ? 117 ILE E CD1 1 
ATOM   7275  N N   . PHE E  1 117 ? -8.328  9.807   55.551  1.00 34.27  ? 118 PHE E N   1 
ATOM   7276  C CA  . PHE E  1 117 ? -9.263  10.874  55.183  1.00 34.11  ? 118 PHE E CA  1 
ATOM   7277  C C   . PHE E  1 117 ? -9.059  11.458  53.788  1.00 34.07  ? 118 PHE E C   1 
ATOM   7278  O O   . PHE E  1 117 ? -8.051  12.113  53.554  1.00 35.91  ? 118 PHE E O   1 
ATOM   7279  C CB  . PHE E  1 117 ? -9.132  12.051  56.158  1.00 31.94  ? 118 PHE E CB  1 
ATOM   7280  C CG  . PHE E  1 117 ? -9.426  11.705  57.574  1.00 31.18  ? 118 PHE E CG  1 
ATOM   7281  C CD1 . PHE E  1 117 ? -10.692 11.287  57.948  1.00 28.79  ? 118 PHE E CD1 1 
ATOM   7282  C CD2 . PHE E  1 117 ? -8.435  11.828  58.548  1.00 31.94  ? 118 PHE E CD2 1 
ATOM   7283  C CE1 . PHE E  1 117 ? -10.974 10.999  59.259  1.00 30.28  ? 118 PHE E CE1 1 
ATOM   7284  C CE2 . PHE E  1 117 ? -8.701  11.541  59.874  1.00 30.86  ? 118 PHE E CE2 1 
ATOM   7285  C CZ  . PHE E  1 117 ? -9.977  11.126  60.234  1.00 32.14  ? 118 PHE E CZ  1 
ATOM   7286  N N   . PRO E  1 118 ? -10.011 11.266  52.853  1.00 33.36  ? 119 PRO E N   1 
ATOM   7287  C CA  . PRO E  1 118 ? -9.769  11.862  51.533  1.00 34.25  ? 119 PRO E CA  1 
ATOM   7288  C C   . PRO E  1 118 ? -9.918  13.379  51.596  1.00 35.09  ? 119 PRO E C   1 
ATOM   7289  O O   . PRO E  1 118 ? -10.411 13.922  52.578  1.00 33.12  ? 119 PRO E O   1 
ATOM   7290  C CB  . PRO E  1 118 ? -10.816 11.199  50.639  1.00 31.60  ? 119 PRO E CB  1 
ATOM   7291  C CG  . PRO E  1 118 ? -11.900 10.889  51.571  1.00 32.74  ? 119 PRO E CG  1 
ATOM   7292  C CD  . PRO E  1 118 ? -11.206 10.414  52.825  1.00 32.89  ? 119 PRO E CD  1 
ATOM   7293  N N   . PRO E  1 119 ? -9.486  14.088  50.551  1.00 37.35  ? 120 PRO E N   1 
ATOM   7294  C CA  . PRO E  1 119 ? -9.645  15.534  50.652  1.00 39.95  ? 120 PRO E CA  1 
ATOM   7295  C C   . PRO E  1 119 ? -11.117 15.865  50.703  1.00 41.89  ? 120 PRO E C   1 
ATOM   7296  O O   . PRO E  1 119 ? -11.953 14.969  50.741  1.00 41.77  ? 120 PRO E O   1 
ATOM   7297  C CB  . PRO E  1 119 ? -8.952  16.048  49.389  1.00 40.31  ? 120 PRO E CB  1 
ATOM   7298  C CG  . PRO E  1 119 ? -9.176  14.952  48.403  1.00 39.18  ? 120 PRO E CG  1 
ATOM   7299  C CD  . PRO E  1 119 ? -8.987  13.690  49.224  1.00 38.74  ? 120 PRO E CD  1 
ATOM   7300  N N   . SER E  1 120 ? -11.438 17.147  50.722  1.00 44.90  ? 121 SER E N   1 
ATOM   7301  C CA  . SER E  1 120 ? -12.832 17.551  50.756  1.00 49.49  ? 121 SER E CA  1 
ATOM   7302  C C   . SER E  1 120 ? -13.153 18.360  49.500  1.00 52.71  ? 121 SER E C   1 
ATOM   7303  O O   . SER E  1 120 ? -12.247 18.841  48.814  1.00 53.13  ? 121 SER E O   1 
ATOM   7304  C CB  . SER E  1 120 ? -13.118 18.367  52.028  1.00 48.37  ? 121 SER E CB  1 
ATOM   7305  O OG  . SER E  1 120 ? -12.175 19.413  52.216  1.00 47.92  ? 121 SER E OG  1 
ATOM   7306  N N   . ASP E  1 121 ? -14.437 18.489  49.186  1.00 56.21  ? 122 ASP E N   1 
ATOM   7307  C CA  . ASP E  1 121 ? -14.845 19.254  48.015  1.00 59.65  ? 122 ASP E CA  1 
ATOM   7308  C C   . ASP E  1 121 ? -14.262 20.639  48.176  1.00 60.12  ? 122 ASP E C   1 
ATOM   7309  O O   . ASP E  1 121 ? -13.610 21.172  47.282  1.00 59.64  ? 122 ASP E O   1 
ATOM   7310  C CB  . ASP E  1 121 ? -16.364 19.327  47.946  1.00 63.65  ? 122 ASP E CB  1 
ATOM   7311  C CG  . ASP E  1 121 ? -17.007 17.946  47.922  1.00 68.37  ? 122 ASP E CG  1 
ATOM   7312  O OD1 . ASP E  1 121 ? -16.737 17.177  46.961  1.00 69.72  ? 122 ASP E OD1 1 
ATOM   7313  O OD2 . ASP E  1 121 ? -17.776 17.631  48.865  1.00 70.77  ? 122 ASP E OD2 1 
ATOM   7314  N N   . GLU E  1 122 ? -14.502 21.199  49.351  1.00 61.02  ? 123 GLU E N   1 
ATOM   7315  C CA  . GLU E  1 122 ? -14.015 22.512  49.732  1.00 62.43  ? 123 GLU E CA  1 
ATOM   7316  C C   . GLU E  1 122 ? -12.577 22.717  49.233  1.00 61.41  ? 123 GLU E C   1 
ATOM   7317  O O   . GLU E  1 122 ? -12.211 23.796  48.757  1.00 62.60  ? 123 GLU E O   1 
ATOM   7318  C CB  . GLU E  1 122 ? -14.038 22.637  51.264  1.00 65.83  ? 123 GLU E CB  1 
ATOM   7319  C CG  . GLU E  1 122 ? -15.405 22.381  51.960  1.00 71.75  ? 123 GLU E CG  1 
ATOM   7320  C CD  . GLU E  1 122 ? -15.884 20.905  51.969  1.00 74.25  ? 123 GLU E CD  1 
ATOM   7321  O OE1 . GLU E  1 122 ? -16.680 20.555  52.877  1.00 74.91  ? 123 GLU E OE1 1 
ATOM   7322  O OE2 . GLU E  1 122 ? -15.498 20.105  51.081  1.00 74.58  ? 123 GLU E OE2 1 
ATOM   7323  N N   . GLN E  1 123 ? -11.764 21.671  49.335  1.00 58.13  ? 124 GLN E N   1 
ATOM   7324  C CA  . GLN E  1 123 ? -10.381 21.768  48.926  1.00 54.98  ? 124 GLN E CA  1 
ATOM   7325  C C   . GLN E  1 123 ? -10.136 21.442  47.453  1.00 54.04  ? 124 GLN E C   1 
ATOM   7326  O O   . GLN E  1 123 ? -9.067  21.747  46.923  1.00 54.31  ? 124 GLN E O   1 
ATOM   7327  C CB  . GLN E  1 123 ? -9.523  20.873  49.817  1.00 54.68  ? 124 GLN E CB  1 
ATOM   7328  C CG  . GLN E  1 123 ? -8.025  21.070  49.636  1.00 55.09  ? 124 GLN E CG  1 
ATOM   7329  C CD  . GLN E  1 123 ? -7.205  19.940  50.219  1.00 54.20  ? 124 GLN E CD  1 
ATOM   7330  O OE1 . GLN E  1 123 ? -7.489  18.765  49.986  1.00 52.51  ? 124 GLN E OE1 1 
ATOM   7331  N NE2 . GLN E  1 123 ? -6.170  20.291  50.972  1.00 54.85  ? 124 GLN E NE2 1 
ATOM   7332  N N   . LEU E  1 124 ? -11.095 20.811  46.781  1.00 52.65  ? 125 LEU E N   1 
ATOM   7333  C CA  . LEU E  1 124 ? -10.903 20.510  45.357  1.00 51.30  ? 125 LEU E CA  1 
ATOM   7334  C C   . LEU E  1 124 ? -11.251 21.772  44.573  1.00 50.96  ? 125 LEU E C   1 
ATOM   7335  O O   . LEU E  1 124 ? -10.602 22.111  43.574  1.00 47.45  ? 125 LEU E O   1 
ATOM   7336  C CB  . LEU E  1 124 ? -11.790 19.343  44.911  1.00 49.63  ? 125 LEU E CB  1 
ATOM   7337  C CG  . LEU E  1 124 ? -11.541 17.991  45.579  1.00 48.13  ? 125 LEU E CG  1 
ATOM   7338  C CD1 . LEU E  1 124 ? -12.151 16.913  44.730  1.00 47.75  ? 125 LEU E CD1 1 
ATOM   7339  C CD2 . LEU E  1 124 ? -10.055 17.740  45.733  1.00 48.56  ? 125 LEU E CD2 1 
ATOM   7340  N N   . LYS E  1 125 ? -12.282 22.463  45.062  1.00 52.93  ? 126 LYS E N   1 
ATOM   7341  C CA  . LYS E  1 125 ? -12.745 23.715  44.477  1.00 54.23  ? 126 LYS E CA  1 
ATOM   7342  C C   . LYS E  1 125 ? -11.547 24.643  44.471  1.00 54.87  ? 126 LYS E C   1 
ATOM   7343  O O   . LYS E  1 125 ? -11.375 25.431  43.544  1.00 56.95  ? 126 LYS E O   1 
ATOM   7344  C CB  . LYS E  1 125 ? -13.880 24.323  45.305  1.00 54.34  ? 126 LYS E CB  1 
ATOM   7345  C CG  . LYS E  1 125 ? -15.280 23.835  44.939  1.00 55.71  ? 126 LYS E CG  1 
ATOM   7346  C CD  . LYS E  1 125 ? -15.497 22.350  45.254  1.00 58.11  ? 126 LYS E CD  1 
ATOM   7347  C CE  . LYS E  1 125 ? -15.027 21.411  44.134  1.00 58.48  ? 126 LYS E CE  1 
ATOM   7348  N NZ  . LYS E  1 125 ? -15.184 19.967  44.491  1.00 57.85  ? 126 LYS E NZ  1 
ATOM   7349  N N   . SER E  1 126 ? -10.728 24.555  45.514  1.00 53.90  ? 127 SER E N   1 
ATOM   7350  C CA  . SER E  1 126 ? -9.510  25.348  45.574  1.00 53.51  ? 127 SER E CA  1 
ATOM   7351  C C   . SER E  1 126 ? -8.665  24.915  44.379  1.00 53.17  ? 127 SER E C   1 
ATOM   7352  O O   . SER E  1 126 ? -8.151  25.751  43.627  1.00 53.83  ? 127 SER E O   1 
ATOM   7353  C CB  . SER E  1 126 ? -8.729  25.048  46.851  1.00 55.17  ? 127 SER E CB  1 
ATOM   7354  O OG  . SER E  1 126 ? -7.335  24.927  46.581  1.00 54.85  ? 127 SER E OG  1 
ATOM   7355  N N   . GLY E  1 127 ? -8.532  23.597  44.214  1.00 51.43  ? 128 GLY E N   1 
ATOM   7356  C CA  . GLY E  1 127 ? -7.747  23.053  43.121  1.00 48.73  ? 128 GLY E CA  1 
ATOM   7357  C C   . GLY E  1 127 ? -6.552  22.234  43.581  1.00 46.98  ? 128 GLY E C   1 
ATOM   7358  O O   . GLY E  1 127 ? -5.504  22.228  42.925  1.00 45.59  ? 128 GLY E O   1 
ATOM   7359  N N   . THR E  1 128 ? -6.718  21.545  44.710  1.00 45.10  ? 129 THR E N   1 
ATOM   7360  C CA  . THR E  1 128 ? -5.673  20.703  45.282  1.00 43.28  ? 129 THR E CA  1 
ATOM   7361  C C   . THR E  1 128 ? -6.251  19.650  46.234  1.00 41.93  ? 129 THR E C   1 
ATOM   7362  O O   . THR E  1 128 ? -7.151  19.947  47.022  1.00 40.74  ? 129 THR E O   1 
ATOM   7363  C CB  . THR E  1 128 ? -4.648  21.560  46.020  1.00 43.53  ? 129 THR E CB  1 
ATOM   7364  O OG1 . THR E  1 128 ? -5.302  22.716  46.549  1.00 44.46  ? 129 THR E OG1 1 
ATOM   7365  C CG2 . THR E  1 128 ? -3.547  22.007  45.073  1.00 44.49  ? 129 THR E CG2 1 
ATOM   7366  N N   . ALA E  1 129 ? -5.729  18.422  46.145  1.00 40.21  ? 130 ALA E N   1 
ATOM   7367  C CA  . ALA E  1 129 ? -6.177  17.292  46.968  1.00 38.42  ? 130 ALA E CA  1 
ATOM   7368  C C   . ALA E  1 129 ? -5.188  16.958  48.078  1.00 37.98  ? 130 ALA E C   1 
ATOM   7369  O O   . ALA E  1 129 ? -3.985  16.923  47.848  1.00 38.86  ? 130 ALA E O   1 
ATOM   7370  C CB  . ALA E  1 129 ? -6.387  16.078  46.098  1.00 36.51  ? 130 ALA E CB  1 
ATOM   7371  N N   . SER E  1 130 ? -5.702  16.719  49.285  1.00 37.04  ? 131 SER E N   1 
ATOM   7372  C CA  . SER E  1 130 ? -4.874  16.377  50.447  1.00 35.42  ? 131 SER E CA  1 
ATOM   7373  C C   . SER E  1 130 ? -5.395  15.068  51.055  1.00 34.14  ? 131 SER E C   1 
ATOM   7374  O O   . SER E  1 130 ? -6.505  15.032  51.570  1.00 34.63  ? 131 SER E O   1 
ATOM   7375  C CB  . SER E  1 130 ? -4.943  17.500  51.520  1.00 36.93  ? 131 SER E CB  1 
ATOM   7376  O OG  . SER E  1 130 ? -3.875  18.459  51.450  1.00 35.82  ? 131 SER E OG  1 
ATOM   7377  N N   . VAL E  1 131 ? -4.608  13.999  50.996  1.00 31.48  ? 132 VAL E N   1 
ATOM   7378  C CA  . VAL E  1 131 ? -5.036  12.724  51.573  1.00 30.62  ? 132 VAL E CA  1 
ATOM   7379  C C   . VAL E  1 131 ? -4.353  12.585  52.920  1.00 31.47  ? 132 VAL E C   1 
ATOM   7380  O O   . VAL E  1 131 ? -3.136  12.648  52.981  1.00 33.08  ? 132 VAL E O   1 
ATOM   7381  C CB  . VAL E  1 131 ? -4.592  11.538  50.724  1.00 29.30  ? 132 VAL E CB  1 
ATOM   7382  C CG1 . VAL E  1 131 ? -5.354  10.306  51.129  1.00 28.50  ? 132 VAL E CG1 1 
ATOM   7383  C CG2 . VAL E  1 131 ? -4.787  11.843  49.265  1.00 30.04  ? 132 VAL E CG2 1 
ATOM   7384  N N   . VAL E  1 132 ? -5.102  12.374  53.997  1.00 31.44  ? 133 VAL E N   1 
ATOM   7385  C CA  . VAL E  1 132 ? -4.468  12.275  55.303  1.00 32.36  ? 133 VAL E CA  1 
ATOM   7386  C C   . VAL E  1 132 ? -4.582  10.938  56.045  1.00 35.44  ? 133 VAL E C   1 
ATOM   7387  O O   . VAL E  1 132 ? -5.498  10.705  56.808  1.00 36.79  ? 133 VAL E O   1 
ATOM   7388  C CB  . VAL E  1 132 ? -4.960  13.411  56.248  1.00 29.45  ? 133 VAL E CB  1 
ATOM   7389  C CG1 . VAL E  1 132 ? -4.351  13.240  57.589  1.00 30.40  ? 133 VAL E CG1 1 
ATOM   7390  C CG2 . VAL E  1 132 ? -4.564  14.772  55.722  1.00 27.52  ? 133 VAL E CG2 1 
ATOM   7391  N N   . CYS E  1 133 ? -3.624  10.061  55.818  1.00 40.01  ? 134 CYS E N   1 
ATOM   7392  C CA  . CYS E  1 133 ? -3.565  8.774   56.496  1.00 44.02  ? 134 CYS E CA  1 
ATOM   7393  C C   . CYS E  1 133 ? -3.290  9.151   57.954  1.00 44.72  ? 134 CYS E C   1 
ATOM   7394  O O   . CYS E  1 133 ? -2.745  10.225  58.206  1.00 45.56  ? 134 CYS E O   1 
ATOM   7395  C CB  . CYS E  1 133 ? -2.374  7.995   55.949  1.00 48.06  ? 134 CYS E CB  1 
ATOM   7396  S SG  . CYS E  1 133 ? -2.149  6.270   56.474  1.00 53.77  ? 134 CYS E SG  1 
ATOM   7397  N N   . LEU E  1 134 ? -3.643  8.284   58.906  1.00 45.27  ? 135 LEU E N   1 
ATOM   7398  C CA  . LEU E  1 134 ? -3.409  8.557   60.336  1.00 43.80  ? 135 LEU E CA  1 
ATOM   7399  C C   . LEU E  1 134 ? -2.940  7.298   61.077  1.00 44.17  ? 135 LEU E C   1 
ATOM   7400  O O   . LEU E  1 134 ? -3.520  6.225   60.918  1.00 44.50  ? 135 LEU E O   1 
ATOM   7401  C CB  . LEU E  1 134 ? -4.682  9.105   60.987  1.00 42.27  ? 135 LEU E CB  1 
ATOM   7402  C CG  . LEU E  1 134 ? -4.633  9.393   62.487  1.00 43.09  ? 135 LEU E CG  1 
ATOM   7403  C CD1 . LEU E  1 134 ? -3.376  10.188  62.826  1.00 43.37  ? 135 LEU E CD1 1 
ATOM   7404  C CD2 . LEU E  1 134 ? -5.893  10.133  62.910  1.00 40.71  ? 135 LEU E CD2 1 
ATOM   7405  N N   . LEU E  1 135 ? -1.870  7.445   61.863  1.00 43.80  ? 136 LEU E N   1 
ATOM   7406  C CA  . LEU E  1 135 ? -1.257  6.363   62.657  1.00 41.87  ? 136 LEU E CA  1 
ATOM   7407  C C   . LEU E  1 135 ? -1.458  6.792   64.101  1.00 42.64  ? 136 LEU E C   1 
ATOM   7408  O O   . LEU E  1 135 ? -0.741  7.677   64.575  1.00 43.87  ? 136 LEU E O   1 
ATOM   7409  C CB  . LEU E  1 135 ? 0.257   6.278   62.371  1.00 38.68  ? 136 LEU E CB  1 
ATOM   7410  C CG  . LEU E  1 135 ? 0.884   5.494   61.207  1.00 34.60  ? 136 LEU E CG  1 
ATOM   7411  C CD1 . LEU E  1 135 ? 0.281   5.856   59.889  1.00 30.49  ? 136 LEU E CD1 1 
ATOM   7412  C CD2 . LEU E  1 135 ? 2.357   5.783   61.195  1.00 33.66  ? 136 LEU E CD2 1 
ATOM   7413  N N   . ASN E  1 136 ? -2.396  6.161   64.810  1.00 43.05  ? 137 ASN E N   1 
ATOM   7414  C CA  . ASN E  1 136 ? -2.711  6.570   66.191  1.00 43.12  ? 137 ASN E CA  1 
ATOM   7415  C C   . ASN E  1 136 ? -2.116  5.846   67.418  1.00 42.36  ? 137 ASN E C   1 
ATOM   7416  O O   . ASN E  1 136 ? -2.172  4.611   67.521  1.00 42.02  ? 137 ASN E O   1 
ATOM   7417  C CB  . ASN E  1 136 ? -4.238  6.643   66.344  1.00 42.48  ? 137 ASN E CB  1 
ATOM   7418  C CG  . ASN E  1 136 ? -4.667  7.494   67.527  1.00 42.70  ? 137 ASN E CG  1 
ATOM   7419  O OD1 . ASN E  1 136 ? -4.020  8.492   67.866  1.00 41.61  ? 137 ASN E OD1 1 
ATOM   7420  N ND2 . ASN E  1 136 ? -5.776  7.114   68.149  1.00 42.95  ? 137 ASN E ND2 1 
ATOM   7421  N N   . ASN E  1 137 ? -1.569  6.660   68.335  1.00 40.31  ? 138 ASN E N   1 
ATOM   7422  C CA  . ASN E  1 137 ? -0.974  6.237   69.610  1.00 38.80  ? 138 ASN E CA  1 
ATOM   7423  C C   . ASN E  1 137 ? -0.277  4.890   69.624  1.00 38.25  ? 138 ASN E C   1 
ATOM   7424  O O   . ASN E  1 137 ? -0.859  3.898   70.059  1.00 38.09  ? 138 ASN E O   1 
ATOM   7425  C CB  . ASN E  1 137 ? -2.042  6.257   70.712  1.00 38.97  ? 138 ASN E CB  1 
ATOM   7426  C CG  . ASN E  1 137 ? -2.208  7.635   71.358  1.00 39.77  ? 138 ASN E CG  1 
ATOM   7427  O OD1 . ASN E  1 137 ? -3.251  7.926   71.929  1.00 38.86  ? 138 ASN E OD1 1 
ATOM   7428  N ND2 . ASN E  1 137 ? -1.171  8.472   71.289  1.00 39.69  ? 138 ASN E ND2 1 
ATOM   7429  N N   . PHE E  1 138 ? 0.991   4.885   69.204  1.00 38.28  ? 139 PHE E N   1 
ATOM   7430  C CA  . PHE E  1 138 ? 1.809   3.673   69.103  1.00 37.75  ? 139 PHE E CA  1 
ATOM   7431  C C   . PHE E  1 138 ? 3.197   3.770   69.720  1.00 39.04  ? 139 PHE E C   1 
ATOM   7432  O O   . PHE E  1 138 ? 3.630   4.836   70.148  1.00 39.15  ? 139 PHE E O   1 
ATOM   7433  C CB  . PHE E  1 138 ? 1.987   3.311   67.631  1.00 37.73  ? 139 PHE E CB  1 
ATOM   7434  C CG  . PHE E  1 138 ? 2.587   4.420   66.816  1.00 35.41  ? 139 PHE E CG  1 
ATOM   7435  C CD1 . PHE E  1 138 ? 1.822   5.520   66.448  1.00 34.61  ? 139 PHE E CD1 1 
ATOM   7436  C CD2 . PHE E  1 138 ? 3.927   4.400   66.483  1.00 32.52  ? 139 PHE E CD2 1 
ATOM   7437  C CE1 . PHE E  1 138 ? 2.388   6.578   65.771  1.00 33.35  ? 139 PHE E CE1 1 
ATOM   7438  C CE2 . PHE E  1 138 ? 4.494   5.448   65.810  1.00 31.20  ? 139 PHE E CE2 1 
ATOM   7439  C CZ  . PHE E  1 138 ? 3.729   6.542   65.452  1.00 31.40  ? 139 PHE E CZ  1 
ATOM   7440  N N   . TYR E  1 139 ? 3.895   2.632   69.724  1.00 41.41  ? 140 TYR E N   1 
ATOM   7441  C CA  . TYR E  1 139 ? 5.258   2.513   70.257  1.00 42.25  ? 140 TYR E CA  1 
ATOM   7442  C C   . TYR E  1 139 ? 5.997   1.244   69.768  1.00 41.75  ? 140 TYR E C   1 
ATOM   7443  O O   . TYR E  1 139 ? 5.409   0.175   69.701  1.00 43.11  ? 140 TYR E O   1 
ATOM   7444  C CB  . TYR E  1 139 ? 5.227   2.525   71.787  1.00 41.48  ? 140 TYR E CB  1 
ATOM   7445  C CG  . TYR E  1 139 ? 6.610   2.652   72.374  1.00 42.64  ? 140 TYR E CG  1 
ATOM   7446  C CD1 . TYR E  1 139 ? 7.439   1.540   72.502  1.00 42.50  ? 140 TYR E CD1 1 
ATOM   7447  C CD2 . TYR E  1 139 ? 7.131   3.898   72.698  1.00 43.23  ? 140 TYR E CD2 1 
ATOM   7448  C CE1 . TYR E  1 139 ? 8.750   1.665   72.924  1.00 42.41  ? 140 TYR E CE1 1 
ATOM   7449  C CE2 . TYR E  1 139 ? 8.440   4.038   73.121  1.00 43.73  ? 140 TYR E CE2 1 
ATOM   7450  C CZ  . TYR E  1 139 ? 9.250   2.918   73.228  1.00 42.98  ? 140 TYR E CZ  1 
ATOM   7451  O OH  . TYR E  1 139 ? 10.567  3.059   73.605  1.00 41.52  ? 140 TYR E OH  1 
ATOM   7452  N N   . PRO E  1 140 ? 7.305   1.346   69.449  1.00 41.17  ? 141 PRO E N   1 
ATOM   7453  C CA  . PRO E  1 140 ? 8.156   2.538   69.501  1.00 41.81  ? 141 PRO E CA  1 
ATOM   7454  C C   . PRO E  1 140 ? 7.860   3.553   68.418  1.00 43.30  ? 141 PRO E C   1 
ATOM   7455  O O   . PRO E  1 140 ? 6.977   3.367   67.583  1.00 44.28  ? 141 PRO E O   1 
ATOM   7456  C CB  . PRO E  1 140 ? 9.565   1.975   69.389  1.00 38.80  ? 141 PRO E CB  1 
ATOM   7457  C CG  . PRO E  1 140 ? 9.367   0.780   68.574  1.00 39.67  ? 141 PRO E CG  1 
ATOM   7458  C CD  . PRO E  1 140 ? 8.122   0.162   69.154  1.00 39.88  ? 141 PRO E CD  1 
ATOM   7459  N N   . ARG E  1 141 ? 8.624   4.630   68.445  1.00 44.07  ? 142 ARG E N   1 
ATOM   7460  C CA  . ARG E  1 141 ? 8.466   5.728   67.518  1.00 44.59  ? 142 ARG E CA  1 
ATOM   7461  C C   . ARG E  1 141 ? 8.633   5.325   66.081  1.00 45.19  ? 142 ARG E C   1 
ATOM   7462  O O   . ARG E  1 141 ? 7.840   5.692   65.238  1.00 44.64  ? 142 ARG E O   1 
ATOM   7463  C CB  . ARG E  1 141 ? 9.479   6.809   67.851  1.00 45.87  ? 142 ARG E CB  1 
ATOM   7464  C CG  . ARG E  1 141 ? 9.219   8.108   67.170  1.00 46.13  ? 142 ARG E CG  1 
ATOM   7465  C CD  . ARG E  1 141 ? 9.886   9.218   67.931  1.00 45.86  ? 142 ARG E CD  1 
ATOM   7466  N NE  . ARG E  1 141 ? 9.273   10.500  67.626  1.00 44.52  ? 142 ARG E NE  1 
ATOM   7467  C CZ  . ARG E  1 141 ? 9.330   11.077  66.441  1.00 43.45  ? 142 ARG E CZ  1 
ATOM   7468  N NH1 . ARG E  1 141 ? 9.979   10.481  65.456  1.00 44.41  ? 142 ARG E NH1 1 
ATOM   7469  N NH2 . ARG E  1 141 ? 8.731   12.239  66.243  1.00 45.49  ? 142 ARG E NH2 1 
ATOM   7470  N N   . GLU E  1 142 ? 9.686   4.568   65.813  1.00 46.91  ? 143 GLU E N   1 
ATOM   7471  C CA  . GLU E  1 142 ? 10.006  4.116   64.467  1.00 47.99  ? 143 GLU E CA  1 
ATOM   7472  C C   . GLU E  1 142 ? 8.851   3.449   63.726  1.00 47.99  ? 143 GLU E C   1 
ATOM   7473  O O   . GLU E  1 142 ? 8.684   2.227   63.781  1.00 49.96  ? 143 GLU E O   1 
ATOM   7474  C CB  . GLU E  1 142 ? 11.209  3.171   64.521  1.00 49.52  ? 143 GLU E CB  1 
ATOM   7475  C CG  . GLU E  1 142 ? 12.511  3.847   64.927  1.00 52.61  ? 143 GLU E CG  1 
ATOM   7476  C CD  . GLU E  1 142 ? 12.359  4.739   66.157  1.00 56.31  ? 143 GLU E CD  1 
ATOM   7477  O OE1 . GLU E  1 142 ? 11.886  5.895   66.014  1.00 56.76  ? 143 GLU E OE1 1 
ATOM   7478  O OE2 . GLU E  1 142 ? 12.705  4.280   67.274  1.00 58.55  ? 143 GLU E OE2 1 
ATOM   7479  N N   . ALA E  1 143 ? 8.059   4.272   63.041  1.00 46.48  ? 144 ALA E N   1 
ATOM   7480  C CA  . ALA E  1 143 ? 6.928   3.814   62.235  1.00 44.86  ? 144 ALA E CA  1 
ATOM   7481  C C   . ALA E  1 143 ? 7.376   4.039   60.797  1.00 44.03  ? 144 ALA E C   1 
ATOM   7482  O O   . ALA E  1 143 ? 8.466   4.577   60.579  1.00 44.39  ? 144 ALA E O   1 
ATOM   7483  C CB  . ALA E  1 143 ? 5.684   4.640   62.531  1.00 43.88  ? 144 ALA E CB  1 
ATOM   7484  N N   . LYS E  1 144 ? 6.553   3.649   59.825  1.00 42.62  ? 145 LYS E N   1 
ATOM   7485  C CA  . LYS E  1 144 ? 6.917   3.811   58.417  1.00 41.55  ? 145 LYS E CA  1 
ATOM   7486  C C   . LYS E  1 144 ? 5.693   3.915   57.499  1.00 41.44  ? 145 LYS E C   1 
ATOM   7487  O O   . LYS E  1 144 ? 5.017   2.919   57.253  1.00 41.29  ? 145 LYS E O   1 
ATOM   7488  C CB  . LYS E  1 144 ? 7.789   2.635   57.993  1.00 41.00  ? 145 LYS E CB  1 
ATOM   7489  C CG  . LYS E  1 144 ? 8.203   2.678   56.560  1.00 42.79  ? 145 LYS E CG  1 
ATOM   7490  C CD  . LYS E  1 144 ? 9.026   1.473   56.186  1.00 44.38  ? 145 LYS E CD  1 
ATOM   7491  C CE  . LYS E  1 144 ? 9.211   1.444   54.684  1.00 45.63  ? 145 LYS E CE  1 
ATOM   7492  N NZ  . LYS E  1 144 ? 7.897   1.619   54.003  1.00 45.08  ? 145 LYS E NZ  1 
ATOM   7493  N N   . VAL E  1 145 ? 5.414   5.111   56.980  1.00 41.09  ? 146 VAL E N   1 
ATOM   7494  C CA  . VAL E  1 145 ? 4.245   5.291   56.118  1.00 40.50  ? 146 VAL E CA  1 
ATOM   7495  C C   . VAL E  1 145 ? 4.523   5.399   54.622  1.00 41.64  ? 146 VAL E C   1 
ATOM   7496  O O   . VAL E  1 145 ? 4.979   6.431   54.130  1.00 41.47  ? 146 VAL E O   1 
ATOM   7497  C CB  . VAL E  1 145 ? 3.414   6.505   56.554  1.00 38.59  ? 146 VAL E CB  1 
ATOM   7498  C CG1 . VAL E  1 145 ? 2.342   6.790   55.537  1.00 37.18  ? 146 VAL E CG1 1 
ATOM   7499  C CG2 . VAL E  1 145 ? 2.769   6.217   57.889  1.00 37.15  ? 146 VAL E CG2 1 
ATOM   7500  N N   . GLN E  1 146 ? 4.194   4.314   53.921  1.00 42.54  ? 147 GLN E N   1 
ATOM   7501  C CA  . GLN E  1 146 ? 4.361   4.160   52.480  1.00 43.20  ? 147 GLN E CA  1 
ATOM   7502  C C   . GLN E  1 146 ? 3.052   4.308   51.692  1.00 44.27  ? 147 GLN E C   1 
ATOM   7503  O O   . GLN E  1 146 ? 2.164   3.460   51.768  1.00 43.30  ? 147 GLN E O   1 
ATOM   7504  C CB  . GLN E  1 146 ? 4.955   2.785   52.200  1.00 44.63  ? 147 GLN E CB  1 
ATOM   7505  C CG  . GLN E  1 146 ? 5.049   2.434   50.741  1.00 45.98  ? 147 GLN E CG  1 
ATOM   7506  C CD  . GLN E  1 146 ? 5.901   3.416   49.988  1.00 47.67  ? 147 GLN E CD  1 
ATOM   7507  O OE1 . GLN E  1 146 ? 5.404   4.188   49.155  1.00 47.02  ? 147 GLN E OE1 1 
ATOM   7508  N NE2 . GLN E  1 146 ? 7.203   3.405   50.282  1.00 48.22  ? 147 GLN E NE2 1 
ATOM   7509  N N   . TRP E  1 147 ? 2.951   5.392   50.927  1.00 46.45  ? 148 TRP E N   1 
ATOM   7510  C CA  . TRP E  1 147 ? 1.775   5.677   50.102  1.00 47.51  ? 148 TRP E CA  1 
ATOM   7511  C C   . TRP E  1 147 ? 1.859   4.975   48.747  1.00 49.11  ? 148 TRP E C   1 
ATOM   7512  O O   . TRP E  1 147 ? 2.940   4.625   48.271  1.00 49.69  ? 148 TRP E O   1 
ATOM   7513  C CB  . TRP E  1 147 ? 1.642   7.178   49.823  1.00 45.45  ? 148 TRP E CB  1 
ATOM   7514  C CG  . TRP E  1 147 ? 1.122   8.016   50.926  1.00 41.86  ? 148 TRP E CG  1 
ATOM   7515  C CD1 . TRP E  1 147 ? 1.847   8.736   51.825  1.00 41.49  ? 148 TRP E CD1 1 
ATOM   7516  C CD2 . TRP E  1 147 ? -0.248  8.259   51.227  1.00 41.66  ? 148 TRP E CD2 1 
ATOM   7517  N NE1 . TRP E  1 147 ? 1.009   9.424   52.674  1.00 40.52  ? 148 TRP E NE1 1 
ATOM   7518  C CE2 . TRP E  1 147 ? -0.285  9.141   52.329  1.00 41.87  ? 148 TRP E CE2 1 
ATOM   7519  C CE3 . TRP E  1 147 ? -1.454  7.815   50.676  1.00 41.28  ? 148 TRP E CE3 1 
ATOM   7520  C CZ2 . TRP E  1 147 ? -1.479  9.581   52.892  1.00 42.39  ? 148 TRP E CZ2 1 
ATOM   7521  C CZ3 . TRP E  1 147 ? -2.642  8.255   51.238  1.00 42.56  ? 148 TRP E CZ3 1 
ATOM   7522  C CH2 . TRP E  1 147 ? -2.646  9.128   52.336  1.00 41.73  ? 148 TRP E CH2 1 
ATOM   7523  N N   . LYS E  1 148 ? 0.700   4.806   48.127  1.00 50.73  ? 149 LYS E N   1 
ATOM   7524  C CA  . LYS E  1 148 ? 0.582   4.174   46.818  1.00 52.96  ? 149 LYS E CA  1 
ATOM   7525  C C   . LYS E  1 148 ? -0.679  4.750   46.187  1.00 53.49  ? 149 LYS E C   1 
ATOM   7526  O O   . LYS E  1 148 ? -1.687  4.959   46.863  1.00 53.12  ? 149 LYS E O   1 
ATOM   7527  C CB  . LYS E  1 148 ? 0.440   2.648   46.957  1.00 54.40  ? 149 LYS E CB  1 
ATOM   7528  C CG  . LYS E  1 148 ? 1.709   1.934   47.406  1.00 56.12  ? 149 LYS E CG  1 
ATOM   7529  C CD  . LYS E  1 148 ? 1.408   0.589   48.051  1.00 58.31  ? 149 LYS E CD  1 
ATOM   7530  C CE  . LYS E  1 148 ? 0.814   0.762   49.451  1.00 59.10  ? 149 LYS E CE  1 
ATOM   7531  N NZ  . LYS E  1 148 ? 0.352   -0.527  50.072  1.00 60.09  ? 149 LYS E NZ  1 
ATOM   7532  N N   . VAL E  1 149 ? -0.617  5.030   44.896  1.00 54.00  ? 150 VAL E N   1 
ATOM   7533  C CA  . VAL E  1 149 ? -1.771  5.571   44.191  1.00 54.36  ? 150 VAL E CA  1 
ATOM   7534  C C   . VAL E  1 149 ? -1.902  4.739   42.933  1.00 54.55  ? 150 VAL E C   1 
ATOM   7535  O O   . VAL E  1 149 ? -0.907  4.494   42.260  1.00 56.13  ? 150 VAL E O   1 
ATOM   7536  C CB  . VAL E  1 149 ? -1.563  7.069   43.813  1.00 54.57  ? 150 VAL E CB  1 
ATOM   7537  C CG1 . VAL E  1 149 ? -2.727  7.551   42.947  1.00 53.82  ? 150 VAL E CG1 1 
ATOM   7538  C CG2 . VAL E  1 149 ? -1.433  7.934   45.082  1.00 50.44  ? 150 VAL E CG2 1 
ATOM   7539  N N   . ASP E  1 150 ? -3.113  4.291   42.621  1.00 55.01  ? 151 ASP E N   1 
ATOM   7540  C CA  . ASP E  1 150 ? -3.336  3.459   41.432  1.00 55.82  ? 151 ASP E CA  1 
ATOM   7541  C C   . ASP E  1 150 ? -2.447  2.228   41.477  1.00 54.89  ? 151 ASP E C   1 
ATOM   7542  O O   . ASP E  1 150 ? -2.427  1.451   40.527  1.00 55.25  ? 151 ASP E O   1 
ATOM   7543  C CB  . ASP E  1 150 ? -3.028  4.231   40.138  1.00 55.53  ? 151 ASP E CB  1 
ATOM   7544  C CG  . ASP E  1 150 ? -4.268  4.841   39.498  1.00 57.30  ? 151 ASP E CG  1 
ATOM   7545  O OD1 . ASP E  1 150 ? -5.373  4.774   40.098  1.00 55.82  ? 151 ASP E OD1 1 
ATOM   7546  O OD2 . ASP E  1 150 ? -4.124  5.393   38.381  1.00 58.73  ? 151 ASP E OD2 1 
ATOM   7547  N N   . ASN E  1 151 ? -1.717  2.071   42.579  1.00 53.73  ? 152 ASN E N   1 
ATOM   7548  C CA  . ASN E  1 151 ? -0.798  0.956   42.783  1.00 53.09  ? 152 ASN E CA  1 
ATOM   7549  C C   . ASN E  1 151 ? 0.660   1.416   42.832  1.00 52.27  ? 152 ASN E C   1 
ATOM   7550  O O   . ASN E  1 151 ? 1.460   0.876   43.595  1.00 52.73  ? 152 ASN E O   1 
ATOM   7551  C CB  . ASN E  1 151 ? -0.966  -0.105  41.687  1.00 54.87  ? 152 ASN E CB  1 
ATOM   7552  C CG  . ASN E  1 151 ? -1.303  -1.479  42.244  1.00 55.66  ? 152 ASN E CG  1 
ATOM   7553  O OD1 . ASN E  1 151 ? -0.403  -2.283  42.509  1.00 54.36  ? 152 ASN E OD1 1 
ATOM   7554  N ND2 . ASN E  1 151 ? -2.605  -1.751  42.437  1.00 56.10  ? 152 ASN E ND2 1 
ATOM   7555  N N   . ALA E  1 152 ? 1.005   2.415   42.029  1.00 50.45  ? 153 ALA E N   1 
ATOM   7556  C CA  . ALA E  1 152 ? 2.369   2.931   42.003  1.00 49.18  ? 153 ALA E CA  1 
ATOM   7557  C C   . ALA E  1 152 ? 2.820   3.427   43.367  1.00 48.07  ? 153 ALA E C   1 
ATOM   7558  O O   . ALA E  1 152 ? 2.217   4.341   43.929  1.00 47.16  ? 153 ALA E O   1 
ATOM   7559  C CB  . ALA E  1 152 ? 2.475   4.061   41.001  1.00 50.85  ? 153 ALA E CB  1 
ATOM   7560  N N   . LEU E  1 153 ? 3.880   2.824   43.892  1.00 46.94  ? 154 LEU E N   1 
ATOM   7561  C CA  . LEU E  1 153 ? 4.417   3.233   45.179  1.00 46.94  ? 154 LEU E CA  1 
ATOM   7562  C C   . LEU E  1 153 ? 4.762   4.706   45.038  1.00 46.28  ? 154 LEU E C   1 
ATOM   7563  O O   . LEU E  1 153 ? 5.345   5.110   44.033  1.00 45.96  ? 154 LEU E O   1 
ATOM   7564  C CB  . LEU E  1 153 ? 5.691   2.451   45.513  1.00 48.71  ? 154 LEU E CB  1 
ATOM   7565  C CG  . LEU E  1 153 ? 5.721   0.915   45.521  1.00 49.41  ? 154 LEU E CG  1 
ATOM   7566  C CD1 . LEU E  1 153 ? 4.772   0.311   46.567  1.00 50.33  ? 154 LEU E CD1 1 
ATOM   7567  C CD2 . LEU E  1 153 ? 5.364   0.436   44.134  1.00 51.60  ? 154 LEU E CD2 1 
ATOM   7568  N N   . GLN E  1 154 ? 4.406   5.506   46.037  1.00 45.12  ? 155 GLN E N   1 
ATOM   7569  C CA  . GLN E  1 154 ? 4.674   6.938   45.977  1.00 44.97  ? 155 GLN E CA  1 
ATOM   7570  C C   . GLN E  1 154 ? 5.747   7.393   46.956  1.00 45.98  ? 155 GLN E C   1 
ATOM   7571  O O   . GLN E  1 154 ? 6.125   6.666   47.886  1.00 45.65  ? 155 GLN E O   1 
ATOM   7572  C CB  . GLN E  1 154 ? 3.393   7.721   46.250  1.00 43.63  ? 155 GLN E CB  1 
ATOM   7573  C CG  . GLN E  1 154 ? 2.302   7.501   45.230  1.00 43.54  ? 155 GLN E CG  1 
ATOM   7574  C CD  . GLN E  1 154 ? 2.524   8.282   43.963  1.00 43.18  ? 155 GLN E CD  1 
ATOM   7575  O OE1 . GLN E  1 154 ? 2.767   9.484   44.013  1.00 43.22  ? 155 GLN E OE1 1 
ATOM   7576  N NE2 . GLN E  1 154 ? 2.431   7.610   42.811  1.00 42.80  ? 155 GLN E NE2 1 
ATOM   7577  N N   . SER E  1 155 ? 6.219   8.620   46.739  1.00 45.62  ? 156 SER E N   1 
ATOM   7578  C CA  . SER E  1 155 ? 7.244   9.224   47.574  1.00 43.47  ? 156 SER E CA  1 
ATOM   7579  C C   . SER E  1 155 ? 7.716   10.591  47.086  1.00 42.74  ? 156 SER E C   1 
ATOM   7580  O O   . SER E  1 155 ? 8.242   10.722  45.983  1.00 43.54  ? 156 SER E O   1 
ATOM   7581  C CB  . SER E  1 155 ? 8.446   8.297   47.659  1.00 42.24  ? 156 SER E CB  1 
ATOM   7582  O OG  . SER E  1 155 ? 9.550   9.005   48.173  1.00 43.07  ? 156 SER E OG  1 
ATOM   7583  N N   . GLY E  1 156 ? 7.534   11.606  47.921  1.00 42.44  ? 157 GLY E N   1 
ATOM   7584  C CA  . GLY E  1 156 ? 7.984   12.950  47.578  1.00 41.71  ? 157 GLY E CA  1 
ATOM   7585  C C   . GLY E  1 156 ? 6.935   14.031  47.763  1.00 40.36  ? 157 GLY E C   1 
ATOM   7586  O O   . GLY E  1 156 ? 7.242   15.196  48.036  1.00 39.81  ? 157 GLY E O   1 
ATOM   7587  N N   . ASN E  1 157 ? 5.685   13.608  47.634  1.00 38.35  ? 158 ASN E N   1 
ATOM   7588  C CA  . ASN E  1 157 ? 4.527   14.467  47.733  1.00 36.71  ? 158 ASN E CA  1 
ATOM   7589  C C   . ASN E  1 157 ? 3.923   14.565  49.102  1.00 36.28  ? 158 ASN E C   1 
ATOM   7590  O O   . ASN E  1 157 ? 3.121   15.459  49.340  1.00 38.13  ? 158 ASN E O   1 
ATOM   7591  C CB  . ASN E  1 157 ? 3.482   13.929  46.792  1.00 37.24  ? 158 ASN E CB  1 
ATOM   7592  C CG  . ASN E  1 157 ? 3.718   12.484  46.477  1.00 36.74  ? 158 ASN E CG  1 
ATOM   7593  O OD1 . ASN E  1 157 ? 3.925   11.662  47.378  1.00 36.87  ? 158 ASN E OD1 1 
ATOM   7594  N ND2 . ASN E  1 157 ? 3.709   12.158  45.200  1.00 36.13  ? 158 ASN E ND2 1 
ATOM   7595  N N   . SER E  1 158 ? 4.292   13.645  49.993  1.00 36.08  ? 159 SER E N   1 
ATOM   7596  C CA  . SER E  1 158 ? 3.749   13.607  51.357  1.00 34.75  ? 159 SER E CA  1 
ATOM   7597  C C   . SER E  1 158 ? 4.703   14.019  52.463  1.00 34.20  ? 159 SER E C   1 
ATOM   7598  O O   . SER E  1 158 ? 5.914   13.862  52.345  1.00 33.58  ? 159 SER E O   1 
ATOM   7599  C CB  . SER E  1 158 ? 3.244   12.209  51.682  1.00 34.10  ? 159 SER E CB  1 
ATOM   7600  O OG  . SER E  1 158 ? 4.323   11.378  52.062  1.00 34.64  ? 159 SER E OG  1 
ATOM   7601  N N   . GLN E  1 159 ? 4.122   14.527  53.547  1.00 33.97  ? 160 GLN E N   1 
ATOM   7602  C CA  . GLN E  1 159 ? 4.856   14.966  54.733  1.00 34.32  ? 160 GLN E CA  1 
ATOM   7603  C C   . GLN E  1 159 ? 4.240   14.373  56.024  1.00 34.31  ? 160 GLN E C   1 
ATOM   7604  O O   . GLN E  1 159 ? 3.068   14.005  56.056  1.00 33.75  ? 160 GLN E O   1 
ATOM   7605  C CB  . GLN E  1 159 ? 4.828   16.506  54.844  1.00 35.15  ? 160 GLN E CB  1 
ATOM   7606  C CG  . GLN E  1 159 ? 5.532   17.328  53.738  1.00 35.35  ? 160 GLN E CG  1 
ATOM   7607  C CD  . GLN E  1 159 ? 5.681   18.818  54.121  1.00 35.91  ? 160 GLN E CD  1 
ATOM   7608  O OE1 . GLN E  1 159 ? 4.694   19.512  54.369  1.00 35.14  ? 160 GLN E OE1 1 
ATOM   7609  N NE2 . GLN E  1 159 ? 6.922   19.301  54.175  1.00 36.91  ? 160 GLN E NE2 1 
ATOM   7610  N N   . GLU E  1 160 ? 5.032   14.273  57.088  1.00 36.10  ? 161 GLU E N   1 
ATOM   7611  C CA  . GLU E  1 160 ? 4.517   13.774  58.363  1.00 37.39  ? 161 GLU E CA  1 
ATOM   7612  C C   . GLU E  1 160 ? 4.917   14.583  59.592  1.00 36.98  ? 161 GLU E C   1 
ATOM   7613  O O   . GLU E  1 160 ? 5.967   15.227  59.632  1.00 36.83  ? 161 GLU E O   1 
ATOM   7614  C CB  . GLU E  1 160 ? 4.858   12.291  58.585  1.00 38.82  ? 161 GLU E CB  1 
ATOM   7615  C CG  . GLU E  1 160 ? 6.157   11.812  58.025  1.00 41.73  ? 161 GLU E CG  1 
ATOM   7616  C CD  . GLU E  1 160 ? 5.975   10.525  57.238  1.00 45.45  ? 161 GLU E CD  1 
ATOM   7617  O OE1 . GLU E  1 160 ? 5.290   10.560  56.179  1.00 46.01  ? 161 GLU E OE1 1 
ATOM   7618  O OE2 . GLU E  1 160 ? 6.509   9.480   57.681  1.00 47.64  ? 161 GLU E OE2 1 
ATOM   7619  N N   . SER E  1 161 ? 4.042   14.542  60.589  1.00 35.96  ? 162 SER E N   1 
ATOM   7620  C CA  . SER E  1 161 ? 4.232   15.259  61.830  1.00 36.01  ? 162 SER E CA  1 
ATOM   7621  C C   . SER E  1 161 ? 4.066   14.255  62.956  1.00 35.28  ? 162 SER E C   1 
ATOM   7622  O O   . SER E  1 161 ? 3.386   13.249  62.806  1.00 34.11  ? 162 SER E O   1 
ATOM   7623  C CB  . SER E  1 161 ? 3.183   16.377  61.933  1.00 38.64  ? 162 SER E CB  1 
ATOM   7624  O OG  . SER E  1 161 ? 3.534   17.384  62.875  1.00 41.02  ? 162 SER E OG  1 
ATOM   7625  N N   . VAL E  1 162 ? 4.687   14.531  64.091  1.00 36.43  ? 163 VAL E N   1 
ATOM   7626  C CA  . VAL E  1 162 ? 4.606   13.615  65.212  1.00 36.59  ? 163 VAL E CA  1 
ATOM   7627  C C   . VAL E  1 162 ? 4.489   14.279  66.578  1.00 37.91  ? 163 VAL E C   1 
ATOM   7628  O O   . VAL E  1 162 ? 5.440   14.875  67.087  1.00 38.03  ? 163 VAL E O   1 
ATOM   7629  C CB  . VAL E  1 162 ? 5.840   12.685  65.255  1.00 35.11  ? 163 VAL E CB  1 
ATOM   7630  C CG1 . VAL E  1 162 ? 5.514   11.433  66.034  1.00 33.23  ? 163 VAL E CG1 1 
ATOM   7631  C CG2 . VAL E  1 162 ? 6.294   12.349  63.850  1.00 34.79  ? 163 VAL E CG2 1 
ATOM   7632  N N   . THR E  1 163 ? 3.314   14.155  67.174  1.00 39.15  ? 164 THR E N   1 
ATOM   7633  C CA  . THR E  1 163 ? 3.073   14.671  68.503  1.00 40.60  ? 164 THR E CA  1 
ATOM   7634  C C   . THR E  1 163 ? 4.201   14.119  69.371  1.00 41.06  ? 164 THR E C   1 
ATOM   7635  O O   . THR E  1 163 ? 4.697   13.031  69.124  1.00 41.19  ? 164 THR E O   1 
ATOM   7636  C CB  . THR E  1 163 ? 1.722   14.152  69.025  1.00 41.20  ? 164 THR E CB  1 
ATOM   7637  O OG1 . THR E  1 163 ? 1.473   14.657  70.345  1.00 47.94  ? 164 THR E OG1 1 
ATOM   7638  C CG2 . THR E  1 163 ? 1.721   12.645  69.054  1.00 39.77  ? 164 THR E CG2 1 
ATOM   7639  N N   . GLU E  1 164 ? 4.627   14.866  70.375  1.00 43.60  ? 165 GLU E N   1 
ATOM   7640  C CA  . GLU E  1 164 ? 5.693   14.383  71.254  1.00 46.11  ? 165 GLU E CA  1 
ATOM   7641  C C   . GLU E  1 164 ? 5.183   13.257  72.173  1.00 46.25  ? 165 GLU E C   1 
ATOM   7642  O O   . GLU E  1 164 ? 3.968   13.035  72.296  1.00 46.50  ? 165 GLU E O   1 
ATOM   7643  C CB  . GLU E  1 164 ? 6.236   15.538  72.101  1.00 48.11  ? 165 GLU E CB  1 
ATOM   7644  C CG  . GLU E  1 164 ? 7.614   16.025  71.704  1.00 52.52  ? 165 GLU E CG  1 
ATOM   7645  C CD  . GLU E  1 164 ? 8.744   15.254  72.380  1.00 57.34  ? 165 GLU E CD  1 
ATOM   7646  O OE1 . GLU E  1 164 ? 9.919   15.639  72.166  1.00 58.49  ? 165 GLU E OE1 1 
ATOM   7647  O OE2 . GLU E  1 164 ? 8.468   14.274  73.123  1.00 60.13  ? 165 GLU E OE2 1 
ATOM   7648  N N   . GLN E  1 165 ? 6.112   12.559  72.824  1.00 45.27  ? 166 GLN E N   1 
ATOM   7649  C CA  . GLN E  1 165 ? 5.766   11.461  73.726  1.00 45.29  ? 166 GLN E CA  1 
ATOM   7650  C C   . GLN E  1 165 ? 4.674   11.827  74.757  1.00 45.30  ? 166 GLN E C   1 
ATOM   7651  O O   . GLN E  1 165 ? 4.865   12.718  75.577  1.00 45.13  ? 166 GLN E O   1 
ATOM   7652  C CB  . GLN E  1 165 ? 7.034   10.994  74.432  1.00 44.87  ? 166 GLN E CB  1 
ATOM   7653  C CG  . GLN E  1 165 ? 6.983   9.573   74.972  1.00 42.89  ? 166 GLN E CG  1 
ATOM   7654  C CD  . GLN E  1 165 ? 8.372   8.991   75.172  1.00 42.29  ? 166 GLN E CD  1 
ATOM   7655  O OE1 . GLN E  1 165 ? 9.326   9.716   75.464  1.00 40.59  ? 166 GLN E OE1 1 
ATOM   7656  N NE2 . GLN E  1 165 ? 8.491   7.677   75.020  1.00 42.67  ? 166 GLN E NE2 1 
ATOM   7657  N N   . ASP E  1 166 ? 3.539   11.123  74.711  1.00 44.91  ? 167 ASP E N   1 
ATOM   7658  C CA  . ASP E  1 166 ? 2.409   11.371  75.614  1.00 43.70  ? 167 ASP E CA  1 
ATOM   7659  C C   . ASP E  1 166 ? 2.776   11.232  77.077  1.00 44.11  ? 167 ASP E C   1 
ATOM   7660  O O   . ASP E  1 166 ? 3.424   10.269  77.484  1.00 43.60  ? 167 ASP E O   1 
ATOM   7661  C CB  . ASP E  1 166 ? 1.246   10.421  75.305  1.00 42.70  ? 167 ASP E CB  1 
ATOM   7662  C CG  . ASP E  1 166 ? -0.044  10.810  76.028  1.00 42.09  ? 167 ASP E CG  1 
ATOM   7663  O OD1 . ASP E  1 166 ? -0.032  10.977  77.269  1.00 43.30  ? 167 ASP E OD1 1 
ATOM   7664  O OD2 . ASP E  1 166 ? -1.082  10.948  75.357  1.00 39.96  ? 167 ASP E OD2 1 
ATOM   7665  N N   . SER E  1 167 ? 2.318   12.200  77.865  1.00 45.69  ? 168 SER E N   1 
ATOM   7666  C CA  . SER E  1 167 ? 2.588   12.272  79.295  1.00 46.67  ? 168 SER E CA  1 
ATOM   7667  C C   . SER E  1 167 ? 2.113   11.082  80.085  1.00 47.24  ? 168 SER E C   1 
ATOM   7668  O O   . SER E  1 167 ? 2.911   10.415  80.740  1.00 48.04  ? 168 SER E O   1 
ATOM   7669  C CB  . SER E  1 167 ? 1.923   13.497  79.891  1.00 48.01  ? 168 SER E CB  1 
ATOM   7670  O OG  . SER E  1 167 ? 0.569   13.199  80.187  1.00 48.50  ? 168 SER E OG  1 
ATOM   7671  N N   . LYS E  1 168 ? 0.813   10.817  80.024  1.00 47.50  ? 169 LYS E N   1 
ATOM   7672  C CA  . LYS E  1 168 ? 0.229   9.718   80.789  1.00 48.91  ? 169 LYS E CA  1 
ATOM   7673  C C   . LYS E  1 168 ? 0.131   8.313   80.179  1.00 48.06  ? 169 LYS E C   1 
ATOM   7674  O O   . LYS E  1 168 ? -0.455  7.435   80.805  1.00 48.57  ? 169 LYS E O   1 
ATOM   7675  C CB  . LYS E  1 168 ? -1.157  10.130  81.296  1.00 50.84  ? 169 LYS E CB  1 
ATOM   7676  C CG  . LYS E  1 168 ? -2.137  10.512  80.202  1.00 52.36  ? 169 LYS E CG  1 
ATOM   7677  C CD  . LYS E  1 168 ? -3.458  10.957  80.805  1.00 54.81  ? 169 LYS E CD  1 
ATOM   7678  C CE  . LYS E  1 168 ? -4.515  11.232  79.738  1.00 56.20  ? 169 LYS E CE  1 
ATOM   7679  N NZ  . LYS E  1 168 ? -5.845  11.576  80.347  1.00 57.71  ? 169 LYS E NZ  1 
ATOM   7680  N N   . ASP E  1 169 ? 0.688   8.086   78.989  1.00 46.63  ? 170 ASP E N   1 
ATOM   7681  C CA  . ASP E  1 169 ? 0.629   6.762   78.370  1.00 45.41  ? 170 ASP E CA  1 
ATOM   7682  C C   . ASP E  1 169 ? 1.813   6.522   77.435  1.00 45.62  ? 170 ASP E C   1 
ATOM   7683  O O   . ASP E  1 169 ? 1.900   5.490   76.754  1.00 45.68  ? 170 ASP E O   1 
ATOM   7684  C CB  . ASP E  1 169 ? -0.695  6.571   77.630  1.00 46.72  ? 170 ASP E CB  1 
ATOM   7685  C CG  . ASP E  1 169 ? -0.740  7.289   76.294  1.00 48.54  ? 170 ASP E CG  1 
ATOM   7686  O OD1 . ASP E  1 169 ? -1.858  7.440   75.741  1.00 50.27  ? 170 ASP E OD1 1 
ATOM   7687  O OD2 . ASP E  1 169 ? 0.329   7.686   75.785  1.00 48.98  ? 170 ASP E OD2 1 
ATOM   7688  N N   . SER E  1 170 ? 2.701   7.511   77.401  1.00 44.46  ? 171 SER E N   1 
ATOM   7689  C CA  . SER E  1 170 ? 3.950   7.483   76.645  1.00 43.69  ? 171 SER E CA  1 
ATOM   7690  C C   . SER E  1 170 ? 4.001   6.853   75.246  1.00 43.56  ? 171 SER E C   1 
ATOM   7691  O O   . SER E  1 170 ? 4.917   6.087   74.933  1.00 43.67  ? 171 SER E O   1 
ATOM   7692  C CB  . SER E  1 170 ? 5.003   6.836   77.544  1.00 42.80  ? 171 SER E CB  1 
ATOM   7693  O OG  . SER E  1 170 ? 4.965   7.432   78.836  1.00 42.80  ? 171 SER E OG  1 
ATOM   7694  N N   . THR E  1 171 ? 3.043   7.200   74.396  1.00 43.60  ? 172 THR E N   1 
ATOM   7695  C CA  . THR E  1 171 ? 2.984   6.664   73.037  1.00 42.62  ? 172 THR E CA  1 
ATOM   7696  C C   . THR E  1 171 ? 3.133   7.799   72.052  1.00 42.31  ? 172 THR E C   1 
ATOM   7697  O O   . THR E  1 171 ? 3.223   8.958   72.449  1.00 42.31  ? 172 THR E O   1 
ATOM   7698  C CB  . THR E  1 171 ? 1.640   6.016   72.755  1.00 43.12  ? 172 THR E CB  1 
ATOM   7699  O OG1 . THR E  1 171 ? 0.615   7.026   72.759  1.00 42.67  ? 172 THR E OG1 1 
ATOM   7700  C CG2 . THR E  1 171 ? 1.332   4.984   73.817  1.00 44.78  ? 172 THR E CG2 1 
ATOM   7701  N N   . TYR E  1 172 ? 3.137   7.465   70.766  1.00 41.39  ? 173 TYR E N   1 
ATOM   7702  C CA  . TYR E  1 172 ? 3.272   8.472   69.733  1.00 40.57  ? 173 TYR E CA  1 
ATOM   7703  C C   . TYR E  1 172 ? 2.154   8.453   68.724  1.00 41.29  ? 173 TYR E C   1 
ATOM   7704  O O   . TYR E  1 172 ? 1.445   7.461   68.558  1.00 41.66  ? 173 TYR E O   1 
ATOM   7705  C CB  . TYR E  1 172 ? 4.570   8.287   68.989  1.00 40.08  ? 173 TYR E CB  1 
ATOM   7706  C CG  . TYR E  1 172 ? 5.779   8.440   69.840  1.00 41.49  ? 173 TYR E CG  1 
ATOM   7707  C CD1 . TYR E  1 172 ? 6.013   9.610   70.548  1.00 43.68  ? 173 TYR E CD1 1 
ATOM   7708  C CD2 . TYR E  1 172 ? 6.722   7.428   69.917  1.00 43.66  ? 173 TYR E CD2 1 
ATOM   7709  C CE1 . TYR E  1 172 ? 7.174   9.769   71.317  1.00 44.24  ? 173 TYR E CE1 1 
ATOM   7710  C CE2 . TYR E  1 172 ? 7.882   7.578   70.679  1.00 44.26  ? 173 TYR E CE2 1 
ATOM   7711  C CZ  . TYR E  1 172 ? 8.098   8.746   71.366  1.00 43.28  ? 173 TYR E CZ  1 
ATOM   7712  O OH  . TYR E  1 172 ? 9.261   8.900   72.058  1.00 44.24  ? 173 TYR E OH  1 
ATOM   7713  N N   . SER E  1 173 ? 2.006   9.571   68.034  1.00 42.38  ? 174 SER E N   1 
ATOM   7714  C CA  . SER E  1 173 ? 0.991   9.685   67.001  1.00 43.30  ? 174 SER E CA  1 
ATOM   7715  C C   . SER E  1 173 ? 1.595   10.435  65.807  1.00 43.31  ? 174 SER E C   1 
ATOM   7716  O O   . SER E  1 173 ? 2.258   11.462  65.963  1.00 41.79  ? 174 SER E O   1 
ATOM   7717  C CB  . SER E  1 173 ? -0.252  10.389  67.556  1.00 42.65  ? 174 SER E CB  1 
ATOM   7718  O OG  . SER E  1 173 ? -0.813  9.636   68.618  1.00 40.62  ? 174 SER E OG  1 
ATOM   7719  N N   . LEU E  1 174 ? 1.389   9.882   64.616  1.00 44.15  ? 175 LEU E N   1 
ATOM   7720  C CA  . LEU E  1 174 ? 1.927   10.462  63.395  1.00 44.32  ? 175 LEU E CA  1 
ATOM   7721  C C   . LEU E  1 174 ? 0.849   10.635  62.352  1.00 44.71  ? 175 LEU E C   1 
ATOM   7722  O O   . LEU E  1 174 ? -0.091  9.838   62.254  1.00 45.33  ? 175 LEU E O   1 
ATOM   7723  C CB  . LEU E  1 174 ? 3.045   9.570   62.835  1.00 44.07  ? 175 LEU E CB  1 
ATOM   7724  C CG  . LEU E  1 174 ? 3.640   9.837   61.450  1.00 43.20  ? 175 LEU E CG  1 
ATOM   7725  C CD1 . LEU E  1 174 ? 4.861   8.975   61.312  1.00 42.89  ? 175 LEU E CD1 1 
ATOM   7726  C CD2 . LEU E  1 174 ? 2.647   9.537   60.333  1.00 41.19  ? 175 LEU E CD2 1 
ATOM   7727  N N   . SER E  1 175 ? 1.003   11.691  61.566  1.00 44.10  ? 176 SER E N   1 
ATOM   7728  C CA  . SER E  1 175 ? 0.064   11.992  60.509  1.00 42.97  ? 176 SER E CA  1 
ATOM   7729  C C   . SER E  1 175 ? 0.856   12.219  59.248  1.00 42.75  ? 176 SER E C   1 
ATOM   7730  O O   . SER E  1 175 ? 1.855   12.936  59.260  1.00 43.31  ? 176 SER E O   1 
ATOM   7731  C CB  . SER E  1 175 ? -0.739  13.253  60.837  1.00 42.23  ? 176 SER E CB  1 
ATOM   7732  O OG  . SER E  1 175 ? 0.088   14.403  60.843  1.00 40.29  ? 176 SER E OG  1 
ATOM   7733  N N   . SER E  1 176 ? 0.415   11.581  58.169  1.00 41.48  ? 177 SER E N   1 
ATOM   7734  C CA  . SER E  1 176 ? 1.042   11.730  56.871  1.00 38.83  ? 177 SER E CA  1 
ATOM   7735  C C   . SER E  1 176 ? 0.020   12.412  55.981  1.00 38.01  ? 177 SER E C   1 
ATOM   7736  O O   . SER E  1 176 ? -1.148  12.039  55.959  1.00 36.67  ? 177 SER E O   1 
ATOM   7737  C CB  . SER E  1 176 ? 1.398   10.371  56.280  1.00 38.56  ? 177 SER E CB  1 
ATOM   7738  O OG  . SER E  1 176 ? 1.501   10.481  54.867  1.00 38.27  ? 177 SER E OG  1 
ATOM   7739  N N   . THR E  1 177 ? 0.448   13.423  55.251  1.00 37.66  ? 178 THR E N   1 
ATOM   7740  C CA  . THR E  1 177 ? -0.478  14.107  54.375  1.00 37.87  ? 178 THR E CA  1 
ATOM   7741  C C   . THR E  1 177 ? 0.013   14.179  52.943  1.00 37.43  ? 178 THR E C   1 
ATOM   7742  O O   . THR E  1 177 ? 0.826   15.030  52.599  1.00 38.40  ? 178 THR E O   1 
ATOM   7743  C CB  . THR E  1 177 ? -0.774  15.535  54.875  1.00 38.40  ? 178 THR E CB  1 
ATOM   7744  O OG1 . THR E  1 177 ? -1.433  15.461  56.145  1.00 39.94  ? 178 THR E OG1 1 
ATOM   7745  C CG2 . THR E  1 177 ? -1.678  16.277  53.890  1.00 38.50  ? 178 THR E CG2 1 
ATOM   7746  N N   . LEU E  1 178 ? -0.473  13.260  52.120  1.00 36.74  ? 179 LEU E N   1 
ATOM   7747  C CA  . LEU E  1 178 ? -0.125  13.243  50.717  1.00 36.26  ? 179 LEU E CA  1 
ATOM   7748  C C   . LEU E  1 178 ? -0.921  14.388  50.120  1.00 37.91  ? 179 LEU E C   1 
ATOM   7749  O O   . LEU E  1 178 ? -2.107  14.557  50.432  1.00 37.52  ? 179 LEU E O   1 
ATOM   7750  C CB  . LEU E  1 178 ? -0.537  11.907  50.100  1.00 34.66  ? 179 LEU E CB  1 
ATOM   7751  C CG  . LEU E  1 178 ? -0.715  11.717  48.593  1.00 33.01  ? 179 LEU E CG  1 
ATOM   7752  C CD1 . LEU E  1 178 ? 0.360   12.400  47.789  1.00 32.79  ? 179 LEU E CD1 1 
ATOM   7753  C CD2 . LEU E  1 178 ? -0.700  10.242  48.340  1.00 32.31  ? 179 LEU E CD2 1 
ATOM   7754  N N   . THR E  1 179 ? -0.265  15.199  49.295  1.00 39.46  ? 180 THR E N   1 
ATOM   7755  C CA  . THR E  1 179 ? -0.933  16.326  48.658  1.00 40.70  ? 180 THR E CA  1 
ATOM   7756  C C   . THR E  1 179 ? -0.771  16.262  47.163  1.00 40.99  ? 180 THR E C   1 
ATOM   7757  O O   . THR E  1 179 ? 0.344   16.258  46.645  1.00 40.79  ? 180 THR E O   1 
ATOM   7758  C CB  . THR E  1 179 ? -0.389  17.684  49.132  1.00 41.71  ? 180 THR E CB  1 
ATOM   7759  O OG1 . THR E  1 179 ? -1.174  18.169  50.232  1.00 43.97  ? 180 THR E OG1 1 
ATOM   7760  C CG2 . THR E  1 179 ? -0.459  18.693  48.005  1.00 42.75  ? 180 THR E CG2 1 
ATOM   7761  N N   . LEU E  1 180 ? -1.911  16.234  46.484  1.00 42.38  ? 181 LEU E N   1 
ATOM   7762  C CA  . LEU E  1 180 ? -1.989  16.168  45.032  1.00 43.20  ? 181 LEU E CA  1 
ATOM   7763  C C   . LEU E  1 180 ? -2.874  17.323  44.541  1.00 43.98  ? 181 LEU E C   1 
ATOM   7764  O O   . LEU E  1 180 ? -3.813  17.722  45.234  1.00 44.40  ? 181 LEU E O   1 
ATOM   7765  C CB  . LEU E  1 180 ? -2.614  14.830  44.630  1.00 42.84  ? 181 LEU E CB  1 
ATOM   7766  C CG  . LEU E  1 180 ? -1.979  13.611  45.300  1.00 43.49  ? 181 LEU E CG  1 
ATOM   7767  C CD1 . LEU E  1 180 ? -2.952  12.456  45.283  1.00 43.23  ? 181 LEU E CD1 1 
ATOM   7768  C CD2 . LEU E  1 180 ? -0.673  13.255  44.601  1.00 42.65  ? 181 LEU E CD2 1 
ATOM   7769  N N   . SER E  1 181 ? -2.569  17.867  43.362  1.00 44.02  ? 182 SER E N   1 
ATOM   7770  C CA  . SER E  1 181 ? -3.371  18.942  42.787  1.00 43.85  ? 182 SER E CA  1 
ATOM   7771  C C   . SER E  1 181 ? -4.710  18.320  42.412  1.00 44.43  ? 182 SER E C   1 
ATOM   7772  O O   . SER E  1 181 ? -4.785  17.115  42.147  1.00 44.70  ? 182 SER E O   1 
ATOM   7773  C CB  . SER E  1 181 ? -2.714  19.488  41.523  1.00 44.06  ? 182 SER E CB  1 
ATOM   7774  O OG  . SER E  1 181 ? -2.963  18.633  40.417  1.00 43.07  ? 182 SER E OG  1 
ATOM   7775  N N   . LYS E  1 182 ? -5.765  19.123  42.388  1.00 44.38  ? 183 LYS E N   1 
ATOM   7776  C CA  . LYS E  1 182 ? -7.075  18.596  42.044  1.00 46.07  ? 183 LYS E CA  1 
ATOM   7777  C C   . LYS E  1 182 ? -6.939  17.825  40.724  1.00 46.80  ? 183 LYS E C   1 
ATOM   7778  O O   . LYS E  1 182 ? -7.642  16.824  40.473  1.00 44.77  ? 183 LYS E O   1 
ATOM   7779  C CB  . LYS E  1 182 ? -8.074  19.742  41.899  1.00 46.47  ? 183 LYS E CB  1 
ATOM   7780  C CG  . LYS E  1 182 ? -9.491  19.321  41.570  1.00 46.87  ? 183 LYS E CG  1 
ATOM   7781  C CD  . LYS E  1 182 ? -10.266 20.492  40.961  1.00 49.65  ? 183 LYS E CD  1 
ATOM   7782  C CE  . LYS E  1 182 ? -11.625 20.064  40.403  1.00 50.26  ? 183 LYS E CE  1 
ATOM   7783  N NZ  . LYS E  1 182 ? -11.496 19.001  39.353  1.00 51.06  ? 183 LYS E NZ  1 
ATOM   7784  N N   . ALA E  1 183 ? -6.003  18.289  39.899  1.00 47.19  ? 184 ALA E N   1 
ATOM   7785  C CA  . ALA E  1 183 ? -5.746  17.675  38.603  1.00 48.78  ? 184 ALA E CA  1 
ATOM   7786  C C   . ALA E  1 183 ? -5.211  16.242  38.705  1.00 49.71  ? 184 ALA E C   1 
ATOM   7787  O O   . ALA E  1 183 ? -5.685  15.350  37.993  1.00 49.25  ? 184 ALA E O   1 
ATOM   7788  C CB  . ALA E  1 183 ? -4.780  18.536  37.811  1.00 48.23  ? 184 ALA E CB  1 
ATOM   7789  N N   . ASP E  1 184 ? -4.229  16.019  39.581  1.00 50.26  ? 185 ASP E N   1 
ATOM   7790  C CA  . ASP E  1 184 ? -3.650  14.686  39.745  1.00 50.75  ? 185 ASP E CA  1 
ATOM   7791  C C   . ASP E  1 184 ? -4.615  13.748  40.426  1.00 50.12  ? 185 ASP E C   1 
ATOM   7792  O O   . ASP E  1 184 ? -4.695  12.568  40.077  1.00 49.72  ? 185 ASP E O   1 
ATOM   7793  C CB  . ASP E  1 184 ? -2.360  14.735  40.566  1.00 52.74  ? 185 ASP E CB  1 
ATOM   7794  C CG  . ASP E  1 184 ? -1.223  15.425  39.833  1.00 55.41  ? 185 ASP E CG  1 
ATOM   7795  O OD1 . ASP E  1 184 ? -1.140  15.268  38.586  1.00 55.94  ? 185 ASP E OD1 1 
ATOM   7796  O OD2 . ASP E  1 184 ? -0.410  16.110  40.507  1.00 55.55  ? 185 ASP E OD2 1 
ATOM   7797  N N   . TYR E  1 185 ? -5.346  14.283  41.399  1.00 48.59  ? 186 TYR E N   1 
ATOM   7798  C CA  . TYR E  1 185 ? -6.306  13.491  42.152  1.00 48.70  ? 186 TYR E CA  1 
ATOM   7799  C C   . TYR E  1 185 ? -7.273  12.725  41.250  1.00 48.60  ? 186 TYR E C   1 
ATOM   7800  O O   . TYR E  1 185 ? -7.572  11.562  41.484  1.00 47.85  ? 186 TYR E O   1 
ATOM   7801  C CB  . TYR E  1 185 ? -7.087  14.394  43.135  1.00 47.65  ? 186 TYR E CB  1 
ATOM   7802  C CG  . TYR E  1 185 ? -7.965  13.635  44.136  1.00 45.98  ? 186 TYR E CG  1 
ATOM   7803  C CD1 . TYR E  1 185 ? -7.448  12.563  44.885  1.00 44.10  ? 186 TYR E CD1 1 
ATOM   7804  C CD2 . TYR E  1 185 ? -9.311  13.983  44.329  1.00 44.39  ? 186 TYR E CD2 1 
ATOM   7805  C CE1 . TYR E  1 185 ? -8.241  11.865  45.784  1.00 42.23  ? 186 TYR E CE1 1 
ATOM   7806  C CE2 . TYR E  1 185 ? -10.115 13.286  45.234  1.00 42.88  ? 186 TYR E CE2 1 
ATOM   7807  C CZ  . TYR E  1 185 ? -9.570  12.231  45.953  1.00 42.41  ? 186 TYR E CZ  1 
ATOM   7808  O OH  . TYR E  1 185 ? -10.344 11.538  46.842  1.00 41.69  ? 186 TYR E OH  1 
ATOM   7809  N N   . GLU E  1 186 ? -7.760  13.366  40.207  1.00 49.74  ? 187 GLU E N   1 
ATOM   7810  C CA  . GLU E  1 186 ? -8.697  12.681  39.337  1.00 51.67  ? 187 GLU E CA  1 
ATOM   7811  C C   . GLU E  1 186 ? -8.018  11.638  38.449  1.00 52.44  ? 187 GLU E C   1 
ATOM   7812  O O   . GLU E  1 186 ? -8.544  10.541  38.259  1.00 52.57  ? 187 GLU E O   1 
ATOM   7813  C CB  . GLU E  1 186 ? -9.437  13.707  38.495  1.00 51.61  ? 187 GLU E CB  1 
ATOM   7814  C CG  . GLU E  1 186 ? -9.813  14.946  39.294  1.00 51.90  ? 187 GLU E CG  1 
ATOM   7815  C CD  . GLU E  1 186 ? -10.810 14.680  40.415  1.00 50.48  ? 187 GLU E CD  1 
ATOM   7816  O OE1 . GLU E  1 186 ? -10.998 15.604  41.223  1.00 51.37  ? 187 GLU E OE1 1 
ATOM   7817  O OE2 . GLU E  1 186 ? -11.406 13.581  40.496  1.00 47.73  ? 187 GLU E OE2 1 
ATOM   7818  N N   . LYS E  1 187 ? -6.848  11.976  37.916  1.00 53.41  ? 188 LYS E N   1 
ATOM   7819  C CA  . LYS E  1 187 ? -6.107  11.060  37.055  1.00 54.36  ? 188 LYS E CA  1 
ATOM   7820  C C   . LYS E  1 187 ? -6.025  9.644   37.621  1.00 54.34  ? 188 LYS E C   1 
ATOM   7821  O O   . LYS E  1 187 ? -5.899  8.675   36.868  1.00 54.76  ? 188 LYS E O   1 
ATOM   7822  C CB  . LYS E  1 187 ? -4.683  11.580  36.826  1.00 55.95  ? 188 LYS E CB  1 
ATOM   7823  C CG  . LYS E  1 187 ? -4.514  12.419  35.573  1.00 60.69  ? 188 LYS E CG  1 
ATOM   7824  C CD  . LYS E  1 187 ? -3.087  12.969  35.416  1.00 63.45  ? 188 LYS E CD  1 
ATOM   7825  C CE  . LYS E  1 187 ? -2.972  13.859  34.167  1.00 65.56  ? 188 LYS E CE  1 
ATOM   7826  N NZ  . LYS E  1 187 ? -1.823  14.813  34.218  1.00 67.77  ? 188 LYS E NZ  1 
ATOM   7827  N N   . HIS E  1 188 ? -6.107  9.526   38.944  1.00 53.16  ? 189 HIS E N   1 
ATOM   7828  C CA  . HIS E  1 188 ? -5.984  8.235   39.600  1.00 51.26  ? 189 HIS E CA  1 
ATOM   7829  C C   . HIS E  1 188 ? -7.231  7.818   40.328  1.00 51.69  ? 189 HIS E C   1 
ATOM   7830  O O   . HIS E  1 188 ? -8.000  8.677   40.749  1.00 51.12  ? 189 HIS E O   1 
ATOM   7831  C CB  . HIS E  1 188 ? -4.817  8.310   40.546  1.00 49.60  ? 189 HIS E CB  1 
ATOM   7832  C CG  . HIS E  1 188 ? -3.600  8.868   39.903  1.00 48.30  ? 189 HIS E CG  1 
ATOM   7833  N ND1 . HIS E  1 188 ? -2.730  8.095   39.168  1.00 49.16  ? 189 HIS E ND1 1 
ATOM   7834  C CD2 . HIS E  1 188 ? -3.148  10.139  39.810  1.00 49.28  ? 189 HIS E CD2 1 
ATOM   7835  C CE1 . HIS E  1 188 ? -1.789  8.863   38.653  1.00 50.51  ? 189 HIS E CE1 1 
ATOM   7836  N NE2 . HIS E  1 188 ? -2.020  10.109  39.026  1.00 52.62  ? 189 HIS E NE2 1 
ATOM   7837  N N   . LYS E  1 189 ? -7.413  6.498   40.474  1.00 52.26  ? 190 LYS E N   1 
ATOM   7838  C CA  . LYS E  1 189 ? -8.596  5.904   41.120  1.00 51.72  ? 190 LYS E CA  1 
ATOM   7839  C C   . LYS E  1 189 ? -8.341  5.313   42.494  1.00 50.85  ? 190 LYS E C   1 
ATOM   7840  O O   . LYS E  1 189 ? -9.142  5.494   43.413  1.00 51.58  ? 190 LYS E O   1 
ATOM   7841  C CB  . LYS E  1 189 ? -9.193  4.806   40.228  1.00 51.84  ? 190 LYS E CB  1 
ATOM   7842  C CG  . LYS E  1 189 ? -10.202 3.881   40.923  1.00 53.04  ? 190 LYS E CG  1 
ATOM   7843  C CD  . LYS E  1 189 ? -10.513 2.607   40.083  1.00 55.24  ? 190 LYS E CD  1 
ATOM   7844  C CE  . LYS E  1 189 ? -11.335 2.894   38.793  1.00 55.64  ? 190 LYS E CE  1 
ATOM   7845  N NZ  . LYS E  1 189 ? -11.520 1.719   37.878  1.00 52.56  ? 190 LYS E NZ  1 
ATOM   7846  N N   . VAL E  1 190 ? -7.238  4.594   42.643  1.00 48.30  ? 191 VAL E N   1 
ATOM   7847  C CA  . VAL E  1 190 ? -6.961  3.984   43.932  1.00 45.67  ? 191 VAL E CA  1 
ATOM   7848  C C   . VAL E  1 190 ? -6.027  4.834   44.784  1.00 43.63  ? 191 VAL E C   1 
ATOM   7849  O O   . VAL E  1 190 ? -5.068  5.423   44.298  1.00 42.75  ? 191 VAL E O   1 
ATOM   7850  C CB  . VAL E  1 190 ? -6.382  2.563   43.749  1.00 45.02  ? 191 VAL E CB  1 
ATOM   7851  C CG1 . VAL E  1 190 ? -6.320  1.839   45.103  1.00 43.11  ? 191 VAL E CG1 1 
ATOM   7852  C CG2 . VAL E  1 190 ? -7.241  1.791   42.741  1.00 42.98  ? 191 VAL E CG2 1 
ATOM   7853  N N   . TYR E  1 191 ? -6.327  4.892   46.067  1.00 40.88  ? 192 TYR E N   1 
ATOM   7854  C CA  . TYR E  1 191 ? -5.533  5.673   46.981  1.00 40.01  ? 192 TYR E CA  1 
ATOM   7855  C C   . TYR E  1 191 ? -5.265  4.879   48.261  1.00 39.40  ? 192 TYR E C   1 
ATOM   7856  O O   . TYR E  1 191 ? -6.198  4.447   48.933  1.00 37.40  ? 192 TYR E O   1 
ATOM   7857  C CB  . TYR E  1 191 ? -6.275  6.987   47.277  1.00 41.45  ? 192 TYR E CB  1 
ATOM   7858  C CG  . TYR E  1 191 ? -6.270  7.958   46.106  1.00 39.78  ? 192 TYR E CG  1 
ATOM   7859  C CD1 . TYR E  1 191 ? -5.085  8.566   45.701  1.00 40.34  ? 192 TYR E CD1 1 
ATOM   7860  C CD2 . TYR E  1 191 ? -7.421  8.212   45.366  1.00 37.16  ? 192 TYR E CD2 1 
ATOM   7861  C CE1 . TYR E  1 191 ? -5.039  9.382   44.591  1.00 39.17  ? 192 TYR E CE1 1 
ATOM   7862  C CE2 . TYR E  1 191 ? -7.382  9.032   44.261  1.00 36.36  ? 192 TYR E CE2 1 
ATOM   7863  C CZ  . TYR E  1 191 ? -6.184  9.603   43.878  1.00 38.00  ? 192 TYR E CZ  1 
ATOM   7864  O OH  . TYR E  1 191 ? -6.086  10.359  42.746  1.00 39.37  ? 192 TYR E OH  1 
ATOM   7865  N N   . ALA E  1 192 ? -3.987  4.708   48.606  1.00 39.32  ? 193 ALA E N   1 
ATOM   7866  C CA  . ALA E  1 192 ? -3.632  3.929   49.787  1.00 39.59  ? 193 ALA E CA  1 
ATOM   7867  C C   . ALA E  1 192 ? -2.369  4.283   50.574  1.00 39.85  ? 193 ALA E C   1 
ATOM   7868  O O   . ALA E  1 192 ? -1.423  4.853   50.048  1.00 38.75  ? 193 ALA E O   1 
ATOM   7869  C CB  . ALA E  1 192 ? -3.556  2.468   49.392  1.00 39.00  ? 193 ALA E CB  1 
ATOM   7870  N N   . CYS E  1 193 ? -2.382  3.932   51.857  1.00 40.95  ? 194 CYS E N   1 
ATOM   7871  C CA  . CYS E  1 193 ? -1.223  4.113   52.714  1.00 43.91  ? 194 CYS E CA  1 
ATOM   7872  C C   . CYS E  1 193 ? -1.065  2.812   53.486  1.00 43.18  ? 194 CYS E C   1 
ATOM   7873  O O   . CYS E  1 193 ? -2.024  2.294   54.062  1.00 41.64  ? 194 CYS E O   1 
ATOM   7874  C CB  . CYS E  1 193 ? -1.358  5.316   53.673  1.00 47.43  ? 194 CYS E CB  1 
ATOM   7875  S SG  . CYS E  1 193 ? -2.791  5.335   54.795  1.00 56.92  ? 194 CYS E SG  1 
ATOM   7876  N N   . GLU E  1 194 ? 0.155   2.281   53.441  1.00 43.32  ? 195 GLU E N   1 
ATOM   7877  C CA  . GLU E  1 194 ? 0.530   1.036   54.093  1.00 43.50  ? 195 GLU E CA  1 
ATOM   7878  C C   . GLU E  1 194 ? 1.499   1.340   55.224  1.00 44.04  ? 195 GLU E C   1 
ATOM   7879  O O   . GLU E  1 194 ? 2.632   1.762   54.977  1.00 45.37  ? 195 GLU E O   1 
ATOM   7880  C CB  . GLU E  1 194 ? 1.193   0.120   53.073  1.00 43.40  ? 195 GLU E CB  1 
ATOM   7881  C CG  . GLU E  1 194 ? 1.894   -1.074  53.650  1.00 44.50  ? 195 GLU E CG  1 
ATOM   7882  C CD  . GLU E  1 194 ? 2.554   -1.886  52.569  1.00 45.98  ? 195 GLU E CD  1 
ATOM   7883  O OE1 . GLU E  1 194 ? 1.811   -2.471  51.763  1.00 46.92  ? 195 GLU E OE1 1 
ATOM   7884  O OE2 . GLU E  1 194 ? 3.806   -1.929  52.511  1.00 46.71  ? 195 GLU E OE2 1 
ATOM   7885  N N   . VAL E  1 195 ? 1.043   1.103   56.456  1.00 43.62  ? 196 VAL E N   1 
ATOM   7886  C CA  . VAL E  1 195 ? 1.802   1.364   57.686  1.00 42.17  ? 196 VAL E CA  1 
ATOM   7887  C C   . VAL E  1 195 ? 2.650   0.185   58.188  1.00 42.30  ? 196 VAL E C   1 
ATOM   7888  O O   . VAL E  1 195 ? 2.173   -0.659  58.929  1.00 42.14  ? 196 VAL E O   1 
ATOM   7889  C CB  . VAL E  1 195 ? 0.817   1.791   58.795  1.00 40.76  ? 196 VAL E CB  1 
ATOM   7890  C CG1 . VAL E  1 195 ? 1.547   2.127   60.061  1.00 40.73  ? 196 VAL E CG1 1 
ATOM   7891  C CG2 . VAL E  1 195 ? -0.009  2.968   58.311  1.00 40.20  ? 196 VAL E CG2 1 
ATOM   7892  N N   . THR E  1 196 ? 3.910   0.127   57.784  1.00 43.57  ? 197 THR E N   1 
ATOM   7893  C CA  . THR E  1 196 ? 4.784   -0.955  58.224  1.00 44.97  ? 197 THR E CA  1 
ATOM   7894  C C   . THR E  1 196 ? 5.258   -0.523  59.588  1.00 44.98  ? 197 THR E C   1 
ATOM   7895  O O   . THR E  1 196 ? 5.574   0.642   59.784  1.00 42.55  ? 197 THR E O   1 
ATOM   7896  C CB  . THR E  1 196 ? 6.008   -1.125  57.304  1.00 45.92  ? 197 THR E CB  1 
ATOM   7897  O OG1 . THR E  1 196 ? 7.128   -0.432  57.875  1.00 46.29  ? 197 THR E OG1 1 
ATOM   7898  C CG2 . THR E  1 196 ? 5.705   -0.567  55.900  1.00 43.29  ? 197 THR E CG2 1 
ATOM   7899  N N   . HIS E  1 197 ? 5.330   -1.458  60.523  1.00 48.35  ? 198 HIS E N   1 
ATOM   7900  C CA  . HIS E  1 197 ? 5.722   -1.111  61.890  1.00 52.49  ? 198 HIS E CA  1 
ATOM   7901  C C   . HIS E  1 197 ? 6.086   -2.341  62.733  1.00 54.73  ? 198 HIS E C   1 
ATOM   7902  O O   . HIS E  1 197 ? 5.673   -3.468  62.426  1.00 55.91  ? 198 HIS E O   1 
ATOM   7903  C CB  . HIS E  1 197 ? 4.560   -0.316  62.529  1.00 51.63  ? 198 HIS E CB  1 
ATOM   7904  C CG  . HIS E  1 197 ? 4.683   -0.100  64.004  1.00 50.15  ? 198 HIS E CG  1 
ATOM   7905  N ND1 . HIS E  1 197 ? 4.444   -1.094  64.927  1.00 50.23  ? 198 HIS E ND1 1 
ATOM   7906  C CD2 . HIS E  1 197 ? 4.978   1.009   64.718  1.00 51.30  ? 198 HIS E CD2 1 
ATOM   7907  C CE1 . HIS E  1 197 ? 4.586   -0.606  66.145  1.00 50.90  ? 198 HIS E CE1 1 
ATOM   7908  N NE2 . HIS E  1 197 ? 4.909   0.670   66.047  1.00 51.70  ? 198 HIS E NE2 1 
ATOM   7909  N N   . GLN E  1 198 ? 6.860   -2.105  63.793  1.00 56.08  ? 199 GLN E N   1 
ATOM   7910  C CA  . GLN E  1 198 ? 7.316   -3.152  64.710  1.00 56.93  ? 199 GLN E CA  1 
ATOM   7911  C C   . GLN E  1 198 ? 6.199   -3.999  65.304  1.00 57.19  ? 199 GLN E C   1 
ATOM   7912  O O   . GLN E  1 198 ? 6.150   -5.209  65.081  1.00 56.48  ? 199 GLN E O   1 
ATOM   7913  C CB  . GLN E  1 198 ? 8.122   -2.514  65.833  1.00 57.77  ? 199 GLN E CB  1 
ATOM   7914  C CG  . GLN E  1 198 ? 8.622   -3.484  66.875  1.00 59.73  ? 199 GLN E CG  1 
ATOM   7915  C CD  . GLN E  1 198 ? 9.495   -4.567  66.289  1.00 61.28  ? 199 GLN E CD  1 
ATOM   7916  O OE1 . GLN E  1 198 ? 10.239  -4.329  65.338  1.00 63.27  ? 199 GLN E OE1 1 
ATOM   7917  N NE2 . GLN E  1 198 ? 9.425   -5.763  66.863  1.00 61.94  ? 199 GLN E NE2 1 
ATOM   7918  N N   . GLY E  1 199 ? 5.319   -3.348  66.066  1.00 57.77  ? 200 GLY E N   1 
ATOM   7919  C CA  . GLY E  1 199 ? 4.200   -4.019  66.701  1.00 59.32  ? 200 GLY E CA  1 
ATOM   7920  C C   . GLY E  1 199 ? 3.124   -4.540  65.760  1.00 61.70  ? 200 GLY E C   1 
ATOM   7921  O O   . GLY E  1 199 ? 2.029   -4.900  66.200  1.00 63.45  ? 200 GLY E O   1 
ATOM   7922  N N   . LEU E  1 200 ? 3.412   -4.583  64.465  1.00 62.60  ? 201 LEU E N   1 
ATOM   7923  C CA  . LEU E  1 200 ? 2.448   -5.090  63.496  1.00 63.41  ? 201 LEU E CA  1 
ATOM   7924  C C   . LEU E  1 200 ? 3.114   -6.255  62.793  1.00 64.73  ? 201 LEU E C   1 
ATOM   7925  O O   . LEU E  1 200 ? 4.092   -6.051  62.073  1.00 65.19  ? 201 LEU E O   1 
ATOM   7926  C CB  . LEU E  1 200 ? 2.110   -4.025  62.453  1.00 63.61  ? 201 LEU E CB  1 
ATOM   7927  C CG  . LEU E  1 200 ? 1.347   -2.765  62.862  1.00 64.39  ? 201 LEU E CG  1 
ATOM   7928  C CD1 . LEU E  1 200 ? 1.369   -1.780  61.719  1.00 63.81  ? 201 LEU E CD1 1 
ATOM   7929  C CD2 . LEU E  1 200 ? -0.078  -3.109  63.255  1.00 64.93  ? 201 LEU E CD2 1 
ATOM   7930  N N   . SER E  1 201 ? 2.602   -7.470  63.000  1.00 65.75  ? 202 SER E N   1 
ATOM   7931  C CA  . SER E  1 201 ? 3.168   -8.663  62.354  1.00 65.83  ? 202 SER E CA  1 
ATOM   7932  C C   . SER E  1 201 ? 3.194   -8.429  60.847  1.00 66.19  ? 202 SER E C   1 
ATOM   7933  O O   . SER E  1 201 ? 4.235   -8.553  60.199  1.00 66.78  ? 202 SER E O   1 
ATOM   7934  C CB  . SER E  1 201 ? 2.317   -9.901  62.646  1.00 65.66  ? 202 SER E CB  1 
ATOM   7935  O OG  . SER E  1 201 ? 1.152   -9.922  61.835  1.00 66.16  ? 202 SER E OG  1 
ATOM   7936  N N   . SER E  1 202 ? 2.025   -8.091  60.310  1.00 65.72  ? 203 SER E N   1 
ATOM   7937  C CA  . SER E  1 202 ? 1.841   -7.807  58.897  1.00 64.14  ? 203 SER E CA  1 
ATOM   7938  C C   . SER E  1 202 ? 1.500   -6.314  58.790  1.00 63.73  ? 203 SER E C   1 
ATOM   7939  O O   . SER E  1 202 ? 0.709   -5.796  59.582  1.00 63.66  ? 203 SER E O   1 
ATOM   7940  C CB  . SER E  1 202 ? 0.693   -8.660  58.367  1.00 63.58  ? 203 SER E CB  1 
ATOM   7941  O OG  . SER E  1 202 ? 0.119   -8.087  57.212  1.00 63.69  ? 203 SER E OG  1 
ATOM   7942  N N   . PRO E  1 203 ? 2.102   -5.599  57.819  1.00 62.67  ? 204 PRO E N   1 
ATOM   7943  C CA  . PRO E  1 203 ? 1.835   -4.163  57.643  1.00 60.71  ? 204 PRO E CA  1 
ATOM   7944  C C   . PRO E  1 203 ? 0.343   -3.877  57.486  1.00 58.70  ? 204 PRO E C   1 
ATOM   7945  O O   . PRO E  1 203 ? -0.382  -4.636  56.840  1.00 58.81  ? 204 PRO E O   1 
ATOM   7946  C CB  . PRO E  1 203 ? 2.602   -3.816  56.367  1.00 61.17  ? 204 PRO E CB  1 
ATOM   7947  C CG  . PRO E  1 203 ? 3.697   -4.817  56.340  1.00 62.06  ? 204 PRO E CG  1 
ATOM   7948  C CD  . PRO E  1 203 ? 3.015   -6.089  56.773  1.00 62.21  ? 204 PRO E CD  1 
ATOM   7949  N N   . VAL E  1 204 ? -0.107  -2.776  58.069  1.00 56.24  ? 205 VAL E N   1 
ATOM   7950  C CA  . VAL E  1 204 ? -1.508  -2.385  57.983  1.00 54.74  ? 205 VAL E CA  1 
ATOM   7951  C C   . VAL E  1 204 ? -1.726  -1.564  56.724  1.00 53.30  ? 205 VAL E C   1 
ATOM   7952  O O   . VAL E  1 204 ? -0.778  -1.057  56.138  1.00 53.72  ? 205 VAL E O   1 
ATOM   7953  C CB  . VAL E  1 204 ? -1.910  -1.519  59.195  1.00 55.59  ? 205 VAL E CB  1 
ATOM   7954  C CG1 . VAL E  1 204 ? -3.372  -1.131  59.106  1.00 55.33  ? 205 VAL E CG1 1 
ATOM   7955  C CG2 . VAL E  1 204 ? -1.640  -2.273  60.485  1.00 56.95  ? 205 VAL E CG2 1 
ATOM   7956  N N   . THR E  1 205 ? -2.976  -1.439  56.299  1.00 51.49  ? 206 THR E N   1 
ATOM   7957  C CA  . THR E  1 205 ? -3.281  -0.637  55.126  1.00 49.28  ? 206 THR E CA  1 
ATOM   7958  C C   . THR E  1 205 ? -4.735  -0.182  55.007  1.00 48.41  ? 206 THR E C   1 
ATOM   7959  O O   . THR E  1 205 ? -5.668  -0.985  54.996  1.00 48.07  ? 206 THR E O   1 
ATOM   7960  C CB  . THR E  1 205 ? -2.865  -1.360  53.835  1.00 48.80  ? 206 THR E CB  1 
ATOM   7961  O OG1 . THR E  1 205 ? -1.435  -1.446  53.780  1.00 47.23  ? 206 THR E OG1 1 
ATOM   7962  C CG2 . THR E  1 205 ? -3.367  -0.600  52.605  1.00 47.90  ? 206 THR E CG2 1 
ATOM   7963  N N   . LYS E  1 206 ? -4.901  1.132   54.949  1.00 47.38  ? 207 LYS E N   1 
ATOM   7964  C CA  . LYS E  1 206 ? -6.200  1.752   54.779  1.00 47.98  ? 207 LYS E CA  1 
ATOM   7965  C C   . LYS E  1 206 ? -6.124  2.279   53.346  1.00 48.07  ? 207 LYS E C   1 
ATOM   7966  O O   . LYS E  1 206 ? -5.019  2.435   52.819  1.00 46.77  ? 207 LYS E O   1 
ATOM   7967  C CB  . LYS E  1 206 ? -6.372  2.918   55.751  1.00 47.81  ? 207 LYS E CB  1 
ATOM   7968  C CG  . LYS E  1 206 ? -7.482  2.745   56.759  1.00 47.87  ? 207 LYS E CG  1 
ATOM   7969  C CD  . LYS E  1 206 ? -7.134  1.695   57.781  1.00 49.41  ? 207 LYS E CD  1 
ATOM   7970  C CE  . LYS E  1 206 ? -8.141  1.684   58.931  1.00 51.16  ? 207 LYS E CE  1 
ATOM   7971  N NZ  . LYS E  1 206 ? -7.554  1.103   60.188  1.00 52.32  ? 207 LYS E NZ  1 
ATOM   7972  N N   . SER E  1 207 ? -7.272  2.545   52.720  1.00 48.57  ? 208 SER E N   1 
ATOM   7973  C CA  . SER E  1 207 ? -7.295  3.048   51.346  1.00 50.23  ? 208 SER E CA  1 
ATOM   7974  C C   . SER E  1 207 ? -8.698  3.193   50.772  1.00 51.51  ? 208 SER E C   1 
ATOM   7975  O O   . SER E  1 207 ? -9.625  2.496   51.198  1.00 52.46  ? 208 SER E O   1 
ATOM   7976  C CB  . SER E  1 207 ? -6.522  2.107   50.424  1.00 50.59  ? 208 SER E CB  1 
ATOM   7977  O OG  . SER E  1 207 ? -7.266  0.929   50.166  1.00 51.35  ? 208 SER E OG  1 
ATOM   7978  N N   . PHE E  1 208 ? -8.847  4.086   49.791  1.00 52.02  ? 209 PHE E N   1 
ATOM   7979  C CA  . PHE E  1 208 ? -10.132 4.287   49.125  1.00 52.18  ? 209 PHE E CA  1 
ATOM   7980  C C   . PHE E  1 208 ? -9.949  4.527   47.634  1.00 54.07  ? 209 PHE E C   1 
ATOM   7981  O O   . PHE E  1 208 ? -8.833  4.724   47.151  1.00 55.07  ? 209 PHE E O   1 
ATOM   7982  C CB  . PHE E  1 208 ? -10.888 5.472   49.723  1.00 50.67  ? 209 PHE E CB  1 
ATOM   7983  C CG  . PHE E  1 208 ? -10.188 6.787   49.557  1.00 48.87  ? 209 PHE E CG  1 
ATOM   7984  C CD1 . PHE E  1 208 ? -9.566  7.392   50.631  1.00 47.33  ? 209 PHE E CD1 1 
ATOM   7985  C CD2 . PHE E  1 208 ? -10.123 7.400   48.312  1.00 47.48  ? 209 PHE E CD2 1 
ATOM   7986  C CE1 . PHE E  1 208 ? -8.885  8.586   50.463  1.00 48.18  ? 209 PHE E CE1 1 
ATOM   7987  C CE2 . PHE E  1 208 ? -9.447  8.590   48.137  1.00 47.22  ? 209 PHE E CE2 1 
ATOM   7988  C CZ  . PHE E  1 208 ? -8.822  9.188   49.213  1.00 46.60  ? 209 PHE E CZ  1 
ATOM   7989  N N   . ASN E  1 209 ? -11.065 4.529   46.912  1.00 56.08  ? 210 ASN E N   1 
ATOM   7990  C CA  . ASN E  1 209 ? -11.067 4.748   45.470  1.00 58.00  ? 210 ASN E CA  1 
ATOM   7991  C C   . ASN E  1 209 ? -11.890 6.000   45.166  1.00 59.49  ? 210 ASN E C   1 
ATOM   7992  O O   . ASN E  1 209 ? -13.111 5.932   45.132  1.00 59.85  ? 210 ASN E O   1 
ATOM   7993  C CB  . ASN E  1 209 ? -11.708 3.559   44.770  1.00 57.97  ? 210 ASN E CB  1 
ATOM   7994  C CG  . ASN E  1 209 ? -11.549 2.271   45.549  1.00 58.96  ? 210 ASN E CG  1 
ATOM   7995  O OD1 . ASN E  1 209 ? -12.280 1.307   45.315  1.00 59.75  ? 210 ASN E OD1 1 
ATOM   7996  N ND2 . ASN E  1 209 ? -10.592 2.241   46.481  1.00 58.77  ? 210 ASN E ND2 1 
ATOM   7997  N N   . ARG E  1 210 ? -11.218 7.130   44.952  1.00 61.94  ? 211 ARG E N   1 
ATOM   7998  C CA  . ARG E  1 210 ? -11.873 8.408   44.661  1.00 64.01  ? 211 ARG E CA  1 
ATOM   7999  C C   . ARG E  1 210 ? -13.231 8.164   44.022  1.00 66.07  ? 211 ARG E C   1 
ATOM   8000  O O   . ARG E  1 210 ? -13.320 7.609   42.928  1.00 67.09  ? 211 ARG E O   1 
ATOM   8001  C CB  . ARG E  1 210 ? -10.992 9.243   43.729  1.00 63.41  ? 211 ARG E CB  1 
ATOM   8002  C CG  . ARG E  1 210 ? -11.477 10.660  43.473  1.00 63.32  ? 211 ARG E CG  1 
ATOM   8003  C CD  . ARG E  1 210 ? -10.491 11.404  42.576  1.00 62.86  ? 211 ARG E CD  1 
ATOM   8004  N NE  . ARG E  1 210 ? -10.199 10.659  41.354  1.00 62.88  ? 211 ARG E NE  1 
ATOM   8005  C CZ  . ARG E  1 210 ? -11.085 10.423  40.390  1.00 62.11  ? 211 ARG E CZ  1 
ATOM   8006  N NH1 . ARG E  1 210 ? -12.325 10.883  40.503  1.00 63.19  ? 211 ARG E NH1 1 
ATOM   8007  N NH2 . ARG E  1 210 ? -10.741 9.712   39.329  1.00 59.12  ? 211 ARG E NH2 1 
ATOM   8008  N N   . GLY E  1 211 ? -14.287 8.575   44.717  1.00 68.05  ? 212 GLY E N   1 
ATOM   8009  C CA  . GLY E  1 211 ? -15.636 8.358   44.223  1.00 70.03  ? 212 GLY E CA  1 
ATOM   8010  C C   . GLY E  1 211 ? -16.248 7.132   44.897  1.00 71.97  ? 212 GLY E C   1 
ATOM   8011  O O   . GLY E  1 211 ? -16.116 5.998   44.403  1.00 72.01  ? 212 GLY E O   1 
ATOM   8012  N N   . GLU E  1 212 ? -16.902 7.358   46.036  1.00 71.98  ? 213 GLU E N   1 
ATOM   8013  C CA  . GLU E  1 212 ? -17.543 6.288   46.790  1.00 72.58  ? 213 GLU E CA  1 
ATOM   8014  C C   . GLU E  1 212 ? -18.105 6.854   48.092  1.00 72.05  ? 213 GLU E C   1 
ATOM   8015  O O   . GLU E  1 212 ? -18.210 8.071   48.258  1.00 71.03  ? 213 GLU E O   1 
ATOM   8016  C CB  . GLU E  1 212 ? -16.535 5.176   47.105  1.00 74.53  ? 213 GLU E CB  1 
ATOM   8017  C CG  . GLU E  1 212 ? -17.159 3.902   47.671  1.00 77.65  ? 213 GLU E CG  1 
ATOM   8018  C CD  . GLU E  1 212 ? -16.188 3.100   48.535  1.00 79.85  ? 213 GLU E CD  1 
ATOM   8019  O OE1 . GLU E  1 212 ? -15.005 2.964   48.146  1.00 80.60  ? 213 GLU E OE1 1 
ATOM   8020  O OE2 . GLU E  1 212 ? -16.615 2.601   49.604  1.00 80.29  ? 213 GLU E OE2 1 
ATOM   8021  N N   . GLN F  2 1   ? 18.989  37.163  90.701  1.00 103.64 ? 1   GLN F N   1 
ATOM   8022  C CA  . GLN F  2 1   ? 17.925  37.624  89.821  1.00 103.63 ? 1   GLN F CA  1 
ATOM   8023  C C   . GLN F  2 1   ? 18.446  38.001  88.432  1.00 103.54 ? 1   GLN F C   1 
ATOM   8024  O O   . GLN F  2 1   ? 17.938  37.502  87.429  1.00 103.85 ? 1   GLN F O   1 
ATOM   8025  C CB  . GLN F  2 1   ? 17.209  38.836  90.430  1.00 103.87 ? 1   GLN F CB  1 
ATOM   8026  C CG  . GLN F  2 1   ? 16.727  38.647  91.857  1.00 105.04 ? 1   GLN F CG  1 
ATOM   8027  C CD  . GLN F  2 1   ? 17.793  38.974  92.893  1.00 106.30 ? 1   GLN F CD  1 
ATOM   8028  O OE1 . GLN F  2 1   ? 18.195  40.132  93.053  1.00 106.44 ? 1   GLN F OE1 1 
ATOM   8029  N NE2 . GLN F  2 1   ? 18.256  37.950  93.605  1.00 107.24 ? 1   GLN F NE2 1 
ATOM   8030  N N   . VAL F  2 2   ? 19.451  38.879  88.387  1.00 103.07 ? 2   VAL F N   1 
ATOM   8031  C CA  . VAL F  2 2   ? 20.053  39.361  87.135  1.00 102.67 ? 2   VAL F CA  1 
ATOM   8032  C C   . VAL F  2 2   ? 19.537  38.657  85.884  1.00 102.42 ? 2   VAL F C   1 
ATOM   8033  O O   . VAL F  2 2   ? 20.050  37.608  85.497  1.00 102.59 ? 2   VAL F O   1 
ATOM   8034  C CB  . VAL F  2 2   ? 21.594  39.235  87.166  1.00 102.57 ? 2   VAL F CB  1 
ATOM   8035  C CG1 . VAL F  2 2   ? 22.004  37.828  87.581  1.00 102.64 ? 2   VAL F CG1 1 
ATOM   8036  C CG2 . VAL F  2 2   ? 22.160  39.576  85.799  1.00 101.62 ? 2   VAL F CG2 1 
ATOM   8037  N N   . GLN F  2 3   ? 18.530  39.240  85.242  1.00 102.37 ? 3   GLN F N   1 
ATOM   8038  C CA  . GLN F  2 3   ? 17.965  38.615  84.055  1.00 102.40 ? 3   GLN F CA  1 
ATOM   8039  C C   . GLN F  2 3   ? 18.083  39.448  82.781  1.00 101.20 ? 3   GLN F C   1 
ATOM   8040  O O   . GLN F  2 3   ? 18.149  40.681  82.829  1.00 101.66 ? 3   GLN F O   1 
ATOM   8041  C CB  . GLN F  2 3   ? 16.503  38.259  84.312  1.00 103.19 ? 3   GLN F CB  1 
ATOM   8042  C CG  . GLN F  2 3   ? 15.893  37.365  83.245  1.00 104.29 ? 3   GLN F CG  1 
ATOM   8043  C CD  . GLN F  2 3   ? 14.602  36.719  83.709  1.00 105.31 ? 3   GLN F CD  1 
ATOM   8044  O OE1 . GLN F  2 3   ? 13.624  37.406  84.018  1.00 105.16 ? 3   GLN F OE1 1 
ATOM   8045  N NE2 . GLN F  2 3   ? 14.593  35.389  83.765  1.00 105.14 ? 3   GLN F NE2 1 
ATOM   8046  N N   . LEU F  2 4   ? 18.101  38.751  81.645  1.00 99.09  ? 4   LEU F N   1 
ATOM   8047  C CA  . LEU F  2 4   ? 18.220  39.366  80.322  1.00 96.74  ? 4   LEU F CA  1 
ATOM   8048  C C   . LEU F  2 4   ? 16.860  39.626  79.671  1.00 95.88  ? 4   LEU F C   1 
ATOM   8049  O O   . LEU F  2 4   ? 15.894  38.904  79.957  1.00 96.39  ? 4   LEU F O   1 
ATOM   8050  C CB  . LEU F  2 4   ? 19.042  38.458  79.405  1.00 97.06  ? 4   LEU F CB  1 
ATOM   8051  C CG  . LEU F  2 4   ? 20.469  38.145  79.855  1.00 95.82  ? 4   LEU F CG  1 
ATOM   8052  C CD1 . LEU F  2 4   ? 20.954  36.824  79.260  1.00 95.86  ? 4   LEU F CD1 1 
ATOM   8053  C CD2 . LEU F  2 4   ? 21.365  39.294  79.441  1.00 96.41  ? 4   LEU F CD2 1 
ATOM   8054  N N   . LEU F  2 5   ? 16.794  40.666  78.827  1.00 94.29  ? 5   LEU F N   1 
ATOM   8055  C CA  . LEU F  2 5   ? 15.566  41.040  78.112  1.00 93.66  ? 5   LEU F CA  1 
ATOM   8056  C C   . LEU F  2 5   ? 15.796  41.177  76.616  1.00 92.07  ? 5   LEU F C   1 
ATOM   8057  O O   . LEU F  2 5   ? 16.504  42.062  76.122  1.00 92.69  ? 5   LEU F O   1 
ATOM   8058  C CB  . LEU F  2 5   ? 14.986  42.346  78.661  1.00 94.91  ? 5   LEU F CB  1 
ATOM   8059  C CG  . LEU F  2 5   ? 14.611  42.351  80.145  1.00 97.51  ? 5   LEU F CG  1 
ATOM   8060  C CD1 . LEU F  2 5   ? 14.057  43.713  80.556  1.00 96.24  ? 5   LEU F CD1 1 
ATOM   8061  C CD2 . LEU F  2 5   ? 13.591  41.255  80.442  1.00 95.79  ? 5   LEU F CD2 1 
ATOM   8062  N N   . GLN F  2 6   ? 15.124  40.295  75.909  1.00 89.94  ? 6   GLN F N   1 
ATOM   8063  C CA  . GLN F  2 6   ? 15.221  40.232  74.486  1.00 87.66  ? 6   GLN F CA  1 
ATOM   8064  C C   . GLN F  2 6   ? 14.125  40.907  73.708  1.00 85.99  ? 6   GLN F C   1 
ATOM   8065  O O   . GLN F  2 6   ? 13.059  41.283  74.208  1.00 84.90  ? 6   GLN F O   1 
ATOM   8066  C CB  . GLN F  2 6   ? 15.207  38.782  74.014  1.00 89.13  ? 6   GLN F CB  1 
ATOM   8067  C CG  . GLN F  2 6   ? 16.408  37.928  74.326  1.00 88.63  ? 6   GLN F CG  1 
ATOM   8068  C CD  . GLN F  2 6   ? 16.250  36.443  73.811  1.00 89.23  ? 6   GLN F CD  1 
ATOM   8069  O OE1 . GLN F  2 6   ? 17.110  35.661  74.042  1.00 90.00  ? 6   GLN F OE1 1 
ATOM   8070  N NE2 . GLN F  2 6   ? 15.175  36.101  73.140  1.00 89.13  ? 6   GLN F NE2 1 
ATOM   8071  N N   . SER F  2 7   ? 14.446  40.994  72.427  1.00 84.67  ? 7   SER F N   1 
ATOM   8072  C CA  . SER F  2 7   ? 13.574  41.590  71.447  1.00 82.83  ? 7   SER F CA  1 
ATOM   8073  C C   . SER F  2 7   ? 12.461  40.675  70.965  1.00 82.18  ? 7   SER F C   1 
ATOM   8074  O O   . SER F  2 7   ? 12.473  39.461  71.168  1.00 81.68  ? 7   SER F O   1 
ATOM   8075  C CB  . SER F  2 7   ? 14.384  42.101  70.253  1.00 81.17  ? 7   SER F CB  1 
ATOM   8076  O OG  . SER F  2 7   ? 15.480  41.248  69.971  1.00 77.63  ? 7   SER F OG  1 
ATOM   8077  N N   . GLY F  2 8   ? 11.489  41.286  70.296  1.00 81.41  ? 8   GLY F N   1 
ATOM   8078  C CA  . GLY F  2 8   ? 10.320  40.568  69.801  1.00 80.92  ? 8   GLY F CA  1 
ATOM   8079  C C   . GLY F  2 8   ? 10.565  39.752  68.537  1.00 80.70  ? 8   GLY F C   1 
ATOM   8080  O O   . GLY F  2 8   ? 11.469  40.037  67.742  1.00 80.64  ? 8   GLY F O   1 
ATOM   8081  N N   . ALA F  2 9   ? 9.741   38.719  68.364  1.00 80.45  ? 9   ALA F N   1 
ATOM   8082  C CA  . ALA F  2 9   ? 9.822   37.814  67.220  1.00 79.53  ? 9   ALA F CA  1 
ATOM   8083  C C   . ALA F  2 9   ? 9.542   38.549  65.911  1.00 79.20  ? 9   ALA F C   1 
ATOM   8084  O O   . ALA F  2 9   ? 8.385   38.727  65.525  1.00 78.45  ? 9   ALA F O   1 
ATOM   8085  C CB  . ALA F  2 9   ? 8.839   36.670  67.395  1.00 78.99  ? 9   ALA F CB  1 
ATOM   8086  N N   . GLU F  2 10  ? 10.616  38.970  65.240  1.00 79.63  ? 10  GLU F N   1 
ATOM   8087  C CA  . GLU F  2 10  ? 10.526  39.702  63.975  1.00 78.99  ? 10  GLU F CA  1 
ATOM   8088  C C   . GLU F  2 10  ? 10.360  38.753  62.789  1.00 76.94  ? 10  GLU F C   1 
ATOM   8089  O O   . GLU F  2 10  ? 10.405  37.526  62.941  1.00 75.71  ? 10  GLU F O   1 
ATOM   8090  C CB  . GLU F  2 10  ? 11.782  40.577  63.757  1.00 80.82  ? 10  GLU F CB  1 
ATOM   8091  C CG  . GLU F  2 10  ? 12.101  41.578  64.897  1.00 84.56  ? 10  GLU F CG  1 
ATOM   8092  C CD  . GLU F  2 10  ? 13.109  42.685  64.506  1.00 87.03  ? 10  GLU F CD  1 
ATOM   8093  O OE1 . GLU F  2 10  ? 12.745  43.574  63.696  1.00 88.35  ? 10  GLU F OE1 1 
ATOM   8094  O OE2 . GLU F  2 10  ? 14.262  42.674  65.011  1.00 86.83  ? 10  GLU F OE2 1 
ATOM   8095  N N   . VAL F  2 11  ? 10.153  39.337  61.612  1.00 74.83  ? 11  VAL F N   1 
ATOM   8096  C CA  . VAL F  2 11  ? 9.995   38.570  60.385  1.00 72.80  ? 11  VAL F CA  1 
ATOM   8097  C C   . VAL F  2 11  ? 10.651  39.294  59.229  1.00 71.81  ? 11  VAL F C   1 
ATOM   8098  O O   . VAL F  2 11  ? 10.015  40.084  58.551  1.00 71.31  ? 11  VAL F O   1 
ATOM   8099  C CB  . VAL F  2 11  ? 8.521   38.358  60.025  1.00 72.38  ? 11  VAL F CB  1 
ATOM   8100  C CG1 . VAL F  2 11  ? 8.420   37.535  58.750  1.00 71.82  ? 11  VAL F CG1 1 
ATOM   8101  C CG2 . VAL F  2 11  ? 7.799   37.676  61.169  1.00 71.64  ? 11  VAL F CG2 1 
ATOM   8102  N N   . LYS F  2 12  ? 11.929  39.022  59.005  1.00 72.02  ? 12  LYS F N   1 
ATOM   8103  C CA  . LYS F  2 12  ? 12.649  39.665  57.919  1.00 72.76  ? 12  LYS F CA  1 
ATOM   8104  C C   . LYS F  2 12  ? 12.491  38.899  56.624  1.00 72.41  ? 12  LYS F C   1 
ATOM   8105  O O   . LYS F  2 12  ? 12.085  37.740  56.622  1.00 73.30  ? 12  LYS F O   1 
ATOM   8106  C CB  . LYS F  2 12  ? 14.129  39.801  58.266  1.00 73.40  ? 12  LYS F CB  1 
ATOM   8107  C CG  . LYS F  2 12  ? 14.390  40.724  59.459  1.00 75.29  ? 12  LYS F CG  1 
ATOM   8108  C CD  . LYS F  2 12  ? 13.962  42.176  59.182  1.00 75.37  ? 12  LYS F CD  1 
ATOM   8109  C CE  . LYS F  2 12  ? 14.328  43.088  60.346  1.00 74.81  ? 12  LYS F CE  1 
ATOM   8110  N NZ  . LYS F  2 12  ? 14.096  44.520  60.035  1.00 75.28  ? 12  LYS F NZ  1 
ATOM   8111  N N   . LYS F  2 13  ? 12.800  39.563  55.519  1.00 71.73  ? 13  LYS F N   1 
ATOM   8112  C CA  . LYS F  2 13  ? 12.680  38.950  54.208  1.00 70.85  ? 13  LYS F CA  1 
ATOM   8113  C C   . LYS F  2 13  ? 14.006  38.348  53.796  1.00 70.13  ? 13  LYS F C   1 
ATOM   8114  O O   . LYS F  2 13  ? 15.056  38.941  54.037  1.00 69.58  ? 13  LYS F O   1 
ATOM   8115  C CB  . LYS F  2 13  ? 12.246  39.992  53.176  1.00 70.86  ? 13  LYS F CB  1 
ATOM   8116  C CG  . LYS F  2 13  ? 10.739  40.207  53.065  1.00 71.15  ? 13  LYS F CG  1 
ATOM   8117  C CD  . LYS F  2 13  ? 10.110  39.235  52.066  1.00 70.95  ? 13  LYS F CD  1 
ATOM   8118  C CE  . LYS F  2 13  ? 8.695   39.647  51.659  1.00 70.08  ? 13  LYS F CE  1 
ATOM   8119  N NZ  . LYS F  2 13  ? 7.668   39.437  52.723  1.00 68.58  ? 13  LYS F NZ  1 
ATOM   8120  N N   . PRO F  2 14  ? 13.973  37.155  53.171  1.00 69.81  ? 14  PRO F N   1 
ATOM   8121  C CA  . PRO F  2 14  ? 15.165  36.443  52.707  1.00 69.39  ? 14  PRO F CA  1 
ATOM   8122  C C   . PRO F  2 14  ? 16.145  37.372  51.981  1.00 70.14  ? 14  PRO F C   1 
ATOM   8123  O O   . PRO F  2 14  ? 15.797  37.998  50.980  1.00 70.98  ? 14  PRO F O   1 
ATOM   8124  C CB  . PRO F  2 14  ? 14.574  35.373  51.797  1.00 68.41  ? 14  PRO F CB  1 
ATOM   8125  C CG  . PRO F  2 14  ? 13.326  35.016  52.501  1.00 68.31  ? 14  PRO F CG  1 
ATOM   8126  C CD  . PRO F  2 14  ? 12.759  36.377  52.855  1.00 69.31  ? 14  PRO F CD  1 
ATOM   8127  N N   . GLY F  2 15  ? 17.372  37.459  52.491  1.00 70.55  ? 15  GLY F N   1 
ATOM   8128  C CA  . GLY F  2 15  ? 18.372  38.326  51.888  1.00 69.94  ? 15  GLY F CA  1 
ATOM   8129  C C   . GLY F  2 15  ? 18.536  39.630  52.657  1.00 69.60  ? 15  GLY F C   1 
ATOM   8130  O O   . GLY F  2 15  ? 19.395  40.459  52.326  1.00 68.76  ? 15  GLY F O   1 
ATOM   8131  N N   . SER F  2 16  ? 17.698  39.811  53.680  1.00 68.73  ? 16  SER F N   1 
ATOM   8132  C CA  . SER F  2 16  ? 17.731  40.995  54.528  1.00 67.56  ? 16  SER F CA  1 
ATOM   8133  C C   . SER F  2 16  ? 18.556  40.705  55.780  1.00 68.72  ? 16  SER F C   1 
ATOM   8134  O O   . SER F  2 16  ? 19.125  39.622  55.916  1.00 68.91  ? 16  SER F O   1 
ATOM   8135  C CB  . SER F  2 16  ? 16.321  41.387  54.937  1.00 65.35  ? 16  SER F CB  1 
ATOM   8136  O OG  . SER F  2 16  ? 16.367  42.498  55.806  1.00 62.80  ? 16  SER F OG  1 
ATOM   8137  N N   . SER F  2 17  ? 18.623  41.670  56.690  1.00 69.59  ? 17  SER F N   1 
ATOM   8138  C CA  . SER F  2 17  ? 19.380  41.499  57.929  1.00 70.88  ? 17  SER F CA  1 
ATOM   8139  C C   . SER F  2 17  ? 18.491  41.851  59.117  1.00 72.01  ? 17  SER F C   1 
ATOM   8140  O O   . SER F  2 17  ? 17.335  42.224  58.938  1.00 72.42  ? 17  SER F O   1 
ATOM   8141  C CB  . SER F  2 17  ? 20.610  42.404  57.929  1.00 70.47  ? 17  SER F CB  1 
ATOM   8142  O OG  . SER F  2 17  ? 20.245  43.772  57.964  1.00 71.57  ? 17  SER F OG  1 
ATOM   8143  N N   . VAL F  2 18  ? 19.020  41.731  60.329  1.00 73.60  ? 18  VAL F N   1 
ATOM   8144  C CA  . VAL F  2 18  ? 18.235  42.056  61.514  1.00 75.43  ? 18  VAL F CA  1 
ATOM   8145  C C   . VAL F  2 18  ? 19.057  42.139  62.794  1.00 76.30  ? 18  VAL F C   1 
ATOM   8146  O O   . VAL F  2 18  ? 20.131  41.542  62.906  1.00 76.31  ? 18  VAL F O   1 
ATOM   8147  C CB  . VAL F  2 18  ? 17.091  41.037  61.733  1.00 75.65  ? 18  VAL F CB  1 
ATOM   8148  C CG1 . VAL F  2 18  ? 17.652  39.624  61.790  1.00 75.45  ? 18  VAL F CG1 1 
ATOM   8149  C CG2 . VAL F  2 18  ? 16.337  41.372  63.019  1.00 75.84  ? 18  VAL F CG2 1 
ATOM   8150  N N   . LYS F  2 19  ? 18.531  42.893  63.753  1.00 77.59  ? 19  LYS F N   1 
ATOM   8151  C CA  . LYS F  2 19  ? 19.171  43.086  65.046  1.00 79.30  ? 19  LYS F CA  1 
ATOM   8152  C C   . LYS F  2 19  ? 18.269  42.472  66.110  1.00 79.16  ? 19  LYS F C   1 
ATOM   8153  O O   . LYS F  2 19  ? 17.055  42.699  66.111  1.00 78.64  ? 19  LYS F O   1 
ATOM   8154  C CB  . LYS F  2 19  ? 19.347  44.581  65.325  1.00 80.90  ? 19  LYS F CB  1 
ATOM   8155  C CG  . LYS F  2 19  ? 20.785  45.089  65.372  1.00 81.54  ? 19  LYS F CG  1 
ATOM   8156  C CD  . LYS F  2 19  ? 20.789  46.579  65.713  1.00 83.22  ? 19  LYS F CD  1 
ATOM   8157  C CE  . LYS F  2 19  ? 22.191  47.115  65.948  1.00 85.17  ? 19  LYS F CE  1 
ATOM   8158  N NZ  . LYS F  2 19  ? 22.182  48.495  66.523  1.00 86.83  ? 19  LYS F NZ  1 
ATOM   8159  N N   . VAL F  2 20  ? 18.872  41.696  67.008  1.00 79.11  ? 20  VAL F N   1 
ATOM   8160  C CA  . VAL F  2 20  ? 18.141  41.035  68.082  1.00 79.26  ? 20  VAL F CA  1 
ATOM   8161  C C   . VAL F  2 20  ? 18.150  41.949  69.314  1.00 79.54  ? 20  VAL F C   1 
ATOM   8162  O O   . VAL F  2 20  ? 17.900  43.145  69.186  1.00 80.14  ? 20  VAL F O   1 
ATOM   8163  C CB  . VAL F  2 20  ? 18.782  39.650  68.407  1.00 78.68  ? 20  VAL F CB  1 
ATOM   8164  C CG1 . VAL F  2 20  ? 17.845  38.819  69.265  1.00 79.22  ? 20  VAL F CG1 1 
ATOM   8165  C CG2 . VAL F  2 20  ? 19.080  38.904  67.124  1.00 77.33  ? 20  VAL F CG2 1 
ATOM   8166  N N   . SER F  2 21  ? 18.414  41.400  70.498  1.00 79.62  ? 21  SER F N   1 
ATOM   8167  C CA  . SER F  2 21  ? 18.464  42.207  71.718  1.00 79.59  ? 21  SER F CA  1 
ATOM   8168  C C   . SER F  2 21  ? 18.706  41.375  72.983  1.00 80.01  ? 21  SER F C   1 
ATOM   8169  O O   . SER F  2 21  ? 18.577  40.143  72.965  1.00 80.42  ? 21  SER F O   1 
ATOM   8170  C CB  . SER F  2 21  ? 17.169  42.995  71.896  1.00 79.25  ? 21  SER F CB  1 
ATOM   8171  O OG  . SER F  2 21  ? 16.346  42.361  72.851  1.00 77.10  ? 21  SER F OG  1 
ATOM   8172  N N   . CYS F  2 22  ? 19.053  42.064  74.075  1.00 79.10  ? 22  CYS F N   1 
ATOM   8173  C CA  . CYS F  2 22  ? 19.325  41.428  75.365  1.00 77.81  ? 22  CYS F CA  1 
ATOM   8174  C C   . CYS F  2 22  ? 19.631  42.516  76.381  1.00 77.72  ? 22  CYS F C   1 
ATOM   8175  O O   . CYS F  2 22  ? 20.709  43.100  76.348  1.00 76.91  ? 22  CYS F O   1 
ATOM   8176  C CB  . CYS F  2 22  ? 20.530  40.483  75.259  1.00 77.34  ? 22  CYS F CB  1 
ATOM   8177  S SG  . CYS F  2 22  ? 20.382  38.961  76.254  1.00 74.54  ? 22  CYS F SG  1 
ATOM   8178  N N   . LYS F  2 23  ? 18.680  42.770  77.280  1.00 78.93  ? 23  LYS F N   1 
ATOM   8179  C CA  . LYS F  2 23  ? 18.801  43.802  78.318  1.00 80.57  ? 23  LYS F CA  1 
ATOM   8180  C C   . LYS F  2 23  ? 19.395  43.263  79.615  1.00 82.15  ? 23  LYS F C   1 
ATOM   8181  O O   . LYS F  2 23  ? 18.981  42.217  80.117  1.00 82.15  ? 23  LYS F O   1 
ATOM   8182  C CB  . LYS F  2 23  ? 17.428  44.407  78.618  1.00 79.92  ? 23  LYS F CB  1 
ATOM   8183  C CG  . LYS F  2 23  ? 17.400  45.925  78.804  1.00 80.17  ? 23  LYS F CG  1 
ATOM   8184  C CD  . LYS F  2 23  ? 17.818  46.397  80.192  1.00 80.38  ? 23  LYS F CD  1 
ATOM   8185  C CE  . LYS F  2 23  ? 17.525  47.895  80.340  1.00 80.97  ? 23  LYS F CE  1 
ATOM   8186  N NZ  . LYS F  2 23  ? 17.980  48.490  81.626  1.00 80.41  ? 23  LYS F NZ  1 
ATOM   8187  N N   . ALA F  2 24  ? 20.354  44.000  80.165  1.00 83.91  ? 24  ALA F N   1 
ATOM   8188  C CA  . ALA F  2 24  ? 21.017  43.597  81.395  1.00 85.51  ? 24  ALA F CA  1 
ATOM   8189  C C   . ALA F  2 24  ? 20.441  44.259  82.650  1.00 86.75  ? 24  ALA F C   1 
ATOM   8190  O O   . ALA F  2 24  ? 21.180  44.617  83.570  1.00 86.65  ? 24  ALA F O   1 
ATOM   8191  C CB  . ALA F  2 24  ? 22.509  43.879  81.287  1.00 85.14  ? 24  ALA F CB  1 
ATOM   8192  N N   . SER F  2 25  ? 19.121  44.422  82.685  1.00 88.18  ? 25  SER F N   1 
ATOM   8193  C CA  . SER F  2 25  ? 18.467  45.012  83.846  1.00 89.35  ? 25  SER F CA  1 
ATOM   8194  C C   . SER F  2 25  ? 18.596  44.003  84.980  1.00 90.60  ? 25  SER F C   1 
ATOM   8195  O O   . SER F  2 25  ? 17.605  43.584  85.581  1.00 90.35  ? 25  SER F O   1 
ATOM   8196  C CB  . SER F  2 25  ? 16.992  45.294  83.546  1.00 88.95  ? 25  SER F CB  1 
ATOM   8197  O OG  . SER F  2 25  ? 16.353  44.147  83.015  1.00 88.26  ? 25  SER F OG  1 
ATOM   8198  N N   . GLY F  2 26  ? 19.838  43.608  85.251  1.00 91.92  ? 26  GLY F N   1 
ATOM   8199  C CA  . GLY F  2 26  ? 20.104  42.644  86.298  1.00 93.57  ? 26  GLY F CA  1 
ATOM   8200  C C   . GLY F  2 26  ? 21.306  42.999  87.155  1.00 94.89  ? 26  GLY F C   1 
ATOM   8201  O O   . GLY F  2 26  ? 21.344  44.068  87.770  1.00 94.57  ? 26  GLY F O   1 
ATOM   8202  N N   . GLY F  2 27  ? 22.289  42.101  87.189  1.00 95.79  ? 27  GLY F N   1 
ATOM   8203  C CA  . GLY F  2 27  ? 23.485  42.317  87.989  1.00 96.70  ? 27  GLY F CA  1 
ATOM   8204  C C   . GLY F  2 27  ? 24.490  43.298  87.408  1.00 97.31  ? 27  GLY F C   1 
ATOM   8205  O O   . GLY F  2 27  ? 24.332  44.511  87.539  1.00 98.03  ? 27  GLY F O   1 
ATOM   8206  N N   . THR F  2 28  ? 25.535  42.777  86.770  1.00 97.21  ? 28  THR F N   1 
ATOM   8207  C CA  . THR F  2 28  ? 26.566  43.624  86.180  1.00 96.75  ? 28  THR F CA  1 
ATOM   8208  C C   . THR F  2 28  ? 26.848  43.293  84.712  1.00 96.19  ? 28  THR F C   1 
ATOM   8209  O O   . THR F  2 28  ? 27.730  42.499  84.389  1.00 95.74  ? 28  THR F O   1 
ATOM   8210  C CB  . THR F  2 28  ? 27.879  43.544  87.001  1.00 97.53  ? 28  THR F CB  1 
ATOM   8211  O OG1 . THR F  2 28  ? 28.117  42.187  87.406  1.00 97.07  ? 28  THR F OG1 1 
ATOM   8212  C CG2 . THR F  2 28  ? 27.794  44.445  88.235  1.00 97.63  ? 28  THR F CG2 1 
ATOM   8213  N N   . PHE F  2 29  ? 26.077  43.924  83.833  1.00 95.87  ? 29  PHE F N   1 
ATOM   8214  C CA  . PHE F  2 29  ? 26.186  43.744  82.388  1.00 95.10  ? 29  PHE F CA  1 
ATOM   8215  C C   . PHE F  2 29  ? 27.610  43.825  81.857  1.00 94.12  ? 29  PHE F C   1 
ATOM   8216  O O   . PHE F  2 29  ? 28.146  42.843  81.346  1.00 93.59  ? 29  PHE F O   1 
ATOM   8217  C CB  . PHE F  2 29  ? 25.309  44.790  81.684  1.00 95.19  ? 29  PHE F CB  1 
ATOM   8218  C CG  . PHE F  2 29  ? 25.651  45.017  80.231  1.00 95.38  ? 29  PHE F CG  1 
ATOM   8219  C CD1 . PHE F  2 29  ? 26.726  45.827  79.868  1.00 94.74  ? 29  PHE F CD1 1 
ATOM   8220  C CD2 . PHE F  2 29  ? 24.886  44.433  79.223  1.00 95.33  ? 29  PHE F CD2 1 
ATOM   8221  C CE1 . PHE F  2 29  ? 27.032  46.054  78.535  1.00 94.16  ? 29  PHE F CE1 1 
ATOM   8222  C CE2 . PHE F  2 29  ? 25.186  44.656  77.880  1.00 95.09  ? 29  PHE F CE2 1 
ATOM   8223  C CZ  . PHE F  2 29  ? 26.262  45.469  77.539  1.00 94.32  ? 29  PHE F CZ  1 
ATOM   8224  N N   . SER F  2 30  ? 28.206  45.006  81.978  1.00 93.55  ? 30  SER F N   1 
ATOM   8225  C CA  . SER F  2 30  ? 29.554  45.251  81.488  1.00 93.43  ? 30  SER F CA  1 
ATOM   8226  C C   . SER F  2 30  ? 30.634  44.342  82.070  1.00 93.17  ? 30  SER F C   1 
ATOM   8227  O O   . SER F  2 30  ? 31.745  44.287  81.543  1.00 92.54  ? 30  SER F O   1 
ATOM   8228  C CB  . SER F  2 30  ? 29.924  46.728  81.699  1.00 93.71  ? 30  SER F CB  1 
ATOM   8229  O OG  . SER F  2 30  ? 29.689  47.152  83.032  1.00 93.18  ? 30  SER F OG  1 
ATOM   8230  N N   . SER F  2 31  ? 30.310  43.629  83.147  1.00 93.51  ? 31  SER F N   1 
ATOM   8231  C CA  . SER F  2 31  ? 31.263  42.709  83.776  1.00 93.40  ? 31  SER F CA  1 
ATOM   8232  C C   . SER F  2 31  ? 31.021  41.298  83.227  1.00 92.94  ? 31  SER F C   1 
ATOM   8233  O O   . SER F  2 31  ? 31.959  40.579  82.868  1.00 92.86  ? 31  SER F O   1 
ATOM   8234  C CB  . SER F  2 31  ? 31.085  42.708  85.300  1.00 93.67  ? 31  SER F CB  1 
ATOM   8235  O OG  . SER F  2 31  ? 29.943  41.961  85.687  1.00 92.67  ? 31  SER F OG  1 
ATOM   8236  N N   . TYR F  2 32  ? 29.749  40.917  83.178  1.00 92.12  ? 32  TYR F N   1 
ATOM   8237  C CA  . TYR F  2 32  ? 29.340  39.622  82.661  1.00 91.13  ? 32  TYR F CA  1 
ATOM   8238  C C   . TYR F  2 32  ? 29.847  39.485  81.227  1.00 89.79  ? 32  TYR F C   1 
ATOM   8239  O O   . TYR F  2 32  ? 30.153  40.483  80.577  1.00 89.81  ? 32  TYR F O   1 
ATOM   8240  C CB  . TYR F  2 32  ? 27.812  39.528  82.675  1.00 92.72  ? 32  TYR F CB  1 
ATOM   8241  C CG  . TYR F  2 32  ? 27.177  39.345  84.044  1.00 93.81  ? 32  TYR F CG  1 
ATOM   8242  C CD1 . TYR F  2 32  ? 25.785  39.341  84.186  1.00 94.46  ? 32  TYR F CD1 1 
ATOM   8243  C CD2 . TYR F  2 32  ? 27.953  39.099  85.183  1.00 94.20  ? 32  TYR F CD2 1 
ATOM   8244  C CE1 . TYR F  2 32  ? 25.180  39.088  85.420  1.00 94.69  ? 32  TYR F CE1 1 
ATOM   8245  C CE2 . TYR F  2 32  ? 27.354  38.842  86.430  1.00 94.39  ? 32  TYR F CE2 1 
ATOM   8246  C CZ  . TYR F  2 32  ? 25.964  38.834  86.539  1.00 94.83  ? 32  TYR F CZ  1 
ATOM   8247  O OH  . TYR F  2 32  ? 25.356  38.545  87.746  1.00 94.21  ? 32  TYR F OH  1 
ATOM   8248  N N   . ALA F  2 33  ? 29.928  38.255  80.731  1.00 88.22  ? 33  ALA F N   1 
ATOM   8249  C CA  . ALA F  2 33  ? 30.395  38.015  79.365  1.00 86.69  ? 33  ALA F CA  1 
ATOM   8250  C C   . ALA F  2 33  ? 29.287  37.368  78.541  1.00 85.14  ? 33  ALA F C   1 
ATOM   8251  O O   . ALA F  2 33  ? 29.339  36.167  78.268  1.00 85.57  ? 33  ALA F O   1 
ATOM   8252  C CB  . ALA F  2 33  ? 31.620  37.109  79.384  1.00 87.46  ? 33  ALA F CB  1 
ATOM   8253  N N   . ILE F  2 34  ? 28.301  38.168  78.133  1.00 82.81  ? 34  ILE F N   1 
ATOM   8254  C CA  . ILE F  2 34  ? 27.158  37.669  77.368  1.00 79.88  ? 34  ILE F CA  1 
ATOM   8255  C C   . ILE F  2 34  ? 27.496  36.807  76.158  1.00 78.21  ? 34  ILE F C   1 
ATOM   8256  O O   . ILE F  2 34  ? 28.500  37.018  75.476  1.00 77.22  ? 34  ILE F O   1 
ATOM   8257  C CB  . ILE F  2 34  ? 26.233  38.825  76.929  1.00 79.71  ? 34  ILE F CB  1 
ATOM   8258  C CG1 . ILE F  2 34  ? 25.003  38.881  77.841  1.00 79.94  ? 34  ILE F CG1 1 
ATOM   8259  C CG2 . ILE F  2 34  ? 25.781  38.630  75.491  1.00 80.66  ? 34  ILE F CG2 1 
ATOM   8260  C CD1 . ILE F  2 34  ? 25.290  39.305  79.267  1.00 80.22  ? 34  ILE F CD1 1 
ATOM   8261  N N   . SER F  2 35  ? 26.625  35.838  75.898  1.00 76.18  ? 35  SER F N   1 
ATOM   8262  C CA  . SER F  2 35  ? 26.804  34.910  74.797  1.00 74.02  ? 35  SER F CA  1 
ATOM   8263  C C   . SER F  2 35  ? 25.518  34.772  73.959  1.00 72.71  ? 35  SER F C   1 
ATOM   8264  O O   . SER F  2 35  ? 24.412  34.748  74.501  1.00 72.31  ? 35  SER F O   1 
ATOM   8265  C CB  . SER F  2 35  ? 27.225  33.558  75.374  1.00 74.16  ? 35  SER F CB  1 
ATOM   8266  O OG  . SER F  2 35  ? 27.929  32.777  74.428  1.00 75.87  ? 35  SER F OG  1 
ATOM   8267  N N   . TRP F  2 36  ? 25.672  34.700  72.637  1.00 71.47  ? 36  TRP F N   1 
ATOM   8268  C CA  . TRP F  2 36  ? 24.540  34.557  71.723  1.00 69.58  ? 36  TRP F CA  1 
ATOM   8269  C C   . TRP F  2 36  ? 24.508  33.176  71.093  1.00 68.65  ? 36  TRP F C   1 
ATOM   8270  O O   . TRP F  2 36  ? 25.355  32.823  70.269  1.00 66.42  ? 36  TRP F O   1 
ATOM   8271  C CB  . TRP F  2 36  ? 24.587  35.627  70.631  1.00 69.91  ? 36  TRP F CB  1 
ATOM   8272  C CG  . TRP F  2 36  ? 24.241  36.988  71.159  1.00 71.24  ? 36  TRP F CG  1 
ATOM   8273  C CD1 . TRP F  2 36  ? 25.049  37.828  71.883  1.00 71.60  ? 36  TRP F CD1 1 
ATOM   8274  C CD2 . TRP F  2 36  ? 22.956  37.608  71.122  1.00 71.38  ? 36  TRP F CD2 1 
ATOM   8275  N NE1 . TRP F  2 36  ? 24.340  38.928  72.306  1.00 71.38  ? 36  TRP F NE1 1 
ATOM   8276  C CE2 . TRP F  2 36  ? 23.051  38.817  71.855  1.00 72.04  ? 36  TRP F CE2 1 
ATOM   8277  C CE3 . TRP F  2 36  ? 21.729  37.258  70.548  1.00 70.52  ? 36  TRP F CE3 1 
ATOM   8278  C CZ2 . TRP F  2 36  ? 21.963  39.670  72.028  1.00 71.81  ? 36  TRP F CZ2 1 
ATOM   8279  C CZ3 . TRP F  2 36  ? 20.652  38.102  70.721  1.00 71.49  ? 36  TRP F CZ3 1 
ATOM   8280  C CH2 . TRP F  2 36  ? 20.774  39.297  71.457  1.00 72.26  ? 36  TRP F CH2 1 
ATOM   8281  N N   . VAL F  2 37  ? 23.509  32.403  71.507  1.00 68.83  ? 37  VAL F N   1 
ATOM   8282  C CA  . VAL F  2 37  ? 23.306  31.036  71.035  1.00 69.08  ? 37  VAL F CA  1 
ATOM   8283  C C   . VAL F  2 37  ? 21.879  30.842  70.541  1.00 68.17  ? 37  VAL F C   1 
ATOM   8284  O O   . VAL F  2 37  ? 20.934  31.229  71.219  1.00 69.60  ? 37  VAL F O   1 
ATOM   8285  C CB  . VAL F  2 37  ? 23.528  30.025  72.160  1.00 69.64  ? 37  VAL F CB  1 
ATOM   8286  C CG1 . VAL F  2 37  ? 23.273  28.624  71.627  1.00 69.61  ? 37  VAL F CG1 1 
ATOM   8287  C CG2 . VAL F  2 37  ? 24.939  30.173  72.738  1.00 68.67  ? 37  VAL F CG2 1 
ATOM   8288  N N   . ARG F  2 38  ? 21.717  30.219  69.381  1.00 66.57  ? 38  ARG F N   1 
ATOM   8289  C CA  . ARG F  2 38  ? 20.385  30.012  68.831  1.00 64.73  ? 38  ARG F CA  1 
ATOM   8290  C C   . ARG F  2 38  ? 20.010  28.537  68.652  1.00 64.29  ? 38  ARG F C   1 
ATOM   8291  O O   . ARG F  2 38  ? 20.860  27.640  68.715  1.00 63.30  ? 38  ARG F O   1 
ATOM   8292  C CB  . ARG F  2 38  ? 20.273  30.729  67.491  1.00 64.45  ? 38  ARG F CB  1 
ATOM   8293  C CG  . ARG F  2 38  ? 21.193  30.158  66.431  1.00 63.73  ? 38  ARG F CG  1 
ATOM   8294  C CD  . ARG F  2 38  ? 20.949  30.814  65.099  1.00 63.00  ? 38  ARG F CD  1 
ATOM   8295  N NE  . ARG F  2 38  ? 21.452  29.997  64.005  1.00 63.50  ? 38  ARG F NE  1 
ATOM   8296  C CZ  . ARG F  2 38  ? 21.753  30.473  62.802  1.00 64.71  ? 38  ARG F CZ  1 
ATOM   8297  N NH1 . ARG F  2 38  ? 21.605  31.769  62.540  1.00 64.51  ? 38  ARG F NH1 1 
ATOM   8298  N NH2 . ARG F  2 38  ? 22.198  29.653  61.858  1.00 64.80  ? 38  ARG F NH2 1 
ATOM   8299  N N   . GLN F  2 39  ? 18.727  28.296  68.397  1.00 62.86  ? 39  GLN F N   1 
ATOM   8300  C CA  . GLN F  2 39  ? 18.235  26.940  68.226  1.00 60.76  ? 39  GLN F CA  1 
ATOM   8301  C C   . GLN F  2 39  ? 17.186  26.861  67.130  1.00 59.51  ? 39  GLN F C   1 
ATOM   8302  O O   . GLN F  2 39  ? 16.007  27.114  67.375  1.00 59.40  ? 39  GLN F O   1 
ATOM   8303  C CB  . GLN F  2 39  ? 17.638  26.462  69.547  1.00 61.68  ? 39  GLN F CB  1 
ATOM   8304  C CG  . GLN F  2 39  ? 17.247  24.999  69.590  1.00 62.66  ? 39  GLN F CG  1 
ATOM   8305  C CD  . GLN F  2 39  ? 16.510  24.629  70.867  1.00 62.48  ? 39  GLN F CD  1 
ATOM   8306  O OE1 . GLN F  2 39  ? 17.000  24.864  71.976  1.00 61.83  ? 39  GLN F OE1 1 
ATOM   8307  N NE2 . GLN F  2 39  ? 15.324  24.049  70.715  1.00 62.80  ? 39  GLN F NE2 1 
ATOM   8308  N N   . ALA F  2 40  ? 17.607  26.515  65.920  1.00 59.19  ? 40  ALA F N   1 
ATOM   8309  C CA  . ALA F  2 40  ? 16.662  26.403  64.816  1.00 58.87  ? 40  ALA F CA  1 
ATOM   8310  C C   . ALA F  2 40  ? 15.634  25.369  65.219  1.00 59.57  ? 40  ALA F C   1 
ATOM   8311  O O   . ALA F  2 40  ? 15.909  24.508  66.049  1.00 59.11  ? 40  ALA F O   1 
ATOM   8312  C CB  . ALA F  2 40  ? 17.362  25.967  63.552  1.00 57.48  ? 40  ALA F CB  1 
ATOM   8313  N N   . PRO F  2 41  ? 14.432  25.439  64.636  1.00 61.12  ? 41  PRO F N   1 
ATOM   8314  C CA  . PRO F  2 41  ? 13.338  24.504  64.934  1.00 62.47  ? 41  PRO F CA  1 
ATOM   8315  C C   . PRO F  2 41  ? 13.732  23.032  64.778  1.00 63.69  ? 41  PRO F C   1 
ATOM   8316  O O   . PRO F  2 41  ? 14.018  22.571  63.667  1.00 64.14  ? 41  PRO F O   1 
ATOM   8317  C CB  . PRO F  2 41  ? 12.254  24.920  63.942  1.00 62.78  ? 41  PRO F CB  1 
ATOM   8318  C CG  . PRO F  2 41  ? 12.515  26.391  63.752  1.00 61.97  ? 41  PRO F CG  1 
ATOM   8319  C CD  . PRO F  2 41  ? 14.016  26.427  63.625  1.00 61.46  ? 41  PRO F CD  1 
ATOM   8320  N N   . GLY F  2 42  ? 13.732  22.303  65.894  1.00 64.44  ? 42  GLY F N   1 
ATOM   8321  C CA  . GLY F  2 42  ? 14.102  20.896  65.871  1.00 64.90  ? 42  GLY F CA  1 
ATOM   8322  C C   . GLY F  2 42  ? 15.581  20.806  65.599  1.00 65.34  ? 42  GLY F C   1 
ATOM   8323  O O   . GLY F  2 42  ? 16.055  19.950  64.848  1.00 66.07  ? 42  GLY F O   1 
ATOM   8324  N N   . GLN F  2 43  ? 16.310  21.725  66.212  1.00 65.76  ? 43  GLN F N   1 
ATOM   8325  C CA  . GLN F  2 43  ? 17.749  21.801  66.048  1.00 66.65  ? 43  GLN F CA  1 
ATOM   8326  C C   . GLN F  2 43  ? 18.430  22.086  67.378  1.00 67.14  ? 43  GLN F C   1 
ATOM   8327  O O   . GLN F  2 43  ? 17.814  22.631  68.294  1.00 67.03  ? 43  GLN F O   1 
ATOM   8328  C CB  . GLN F  2 43  ? 18.097  22.894  65.044  1.00 66.50  ? 43  GLN F CB  1 
ATOM   8329  C CG  . GLN F  2 43  ? 17.819  22.525  63.606  1.00 66.84  ? 43  GLN F CG  1 
ATOM   8330  C CD  . GLN F  2 43  ? 18.618  21.324  63.165  1.00 67.48  ? 43  GLN F CD  1 
ATOM   8331  O OE1 . GLN F  2 43  ? 18.210  20.178  63.381  1.00 67.93  ? 43  GLN F OE1 1 
ATOM   8332  N NE2 . GLN F  2 43  ? 19.774  21.576  62.554  1.00 66.84  ? 43  GLN F NE2 1 
ATOM   8333  N N   . GLY F  2 44  ? 19.704  21.712  67.474  1.00 67.05  ? 44  GLY F N   1 
ATOM   8334  C CA  . GLY F  2 44  ? 20.449  21.921  68.699  1.00 67.00  ? 44  GLY F CA  1 
ATOM   8335  C C   . GLY F  2 44  ? 20.927  23.346  68.840  1.00 67.19  ? 44  GLY F C   1 
ATOM   8336  O O   . GLY F  2 44  ? 21.001  24.086  67.856  1.00 67.17  ? 44  GLY F O   1 
ATOM   8337  N N   . LEU F  2 45  ? 21.246  23.734  70.070  1.00 66.95  ? 45  LEU F N   1 
ATOM   8338  C CA  . LEU F  2 45  ? 21.729  25.079  70.343  1.00 66.54  ? 45  LEU F CA  1 
ATOM   8339  C C   . LEU F  2 45  ? 22.912  25.376  69.434  1.00 66.84  ? 45  LEU F C   1 
ATOM   8340  O O   . LEU F  2 45  ? 23.599  24.472  68.963  1.00 66.48  ? 45  LEU F O   1 
ATOM   8341  C CB  . LEU F  2 45  ? 22.179  25.208  71.801  1.00 65.17  ? 45  LEU F CB  1 
ATOM   8342  C CG  . LEU F  2 45  ? 21.221  24.792  72.912  1.00 63.66  ? 45  LEU F CG  1 
ATOM   8343  C CD1 . LEU F  2 45  ? 21.926  24.950  74.237  1.00 63.34  ? 45  LEU F CD1 1 
ATOM   8344  C CD2 . LEU F  2 45  ? 19.957  25.621  72.870  1.00 63.51  ? 45  LEU F CD2 1 
ATOM   8345  N N   . GLU F  2 46  ? 23.149  26.654  69.194  1.00 68.06  ? 46  GLU F N   1 
ATOM   8346  C CA  . GLU F  2 46  ? 24.249  27.067  68.347  1.00 68.71  ? 46  GLU F CA  1 
ATOM   8347  C C   . GLU F  2 46  ? 24.905  28.308  68.946  1.00 67.30  ? 46  GLU F C   1 
ATOM   8348  O O   . GLU F  2 46  ? 24.298  29.380  69.033  1.00 66.05  ? 46  GLU F O   1 
ATOM   8349  C CB  . GLU F  2 46  ? 23.731  27.341  66.928  1.00 71.42  ? 46  GLU F CB  1 
ATOM   8350  C CG  . GLU F  2 46  ? 24.775  27.808  65.913  1.00 75.42  ? 46  GLU F CG  1 
ATOM   8351  C CD  . GLU F  2 46  ? 24.320  27.615  64.453  1.00 77.57  ? 46  GLU F CD  1 
ATOM   8352  O OE1 . GLU F  2 46  ? 23.161  27.982  64.127  1.00 78.33  ? 46  GLU F OE1 1 
ATOM   8353  O OE2 . GLU F  2 46  ? 25.126  27.105  63.633  1.00 76.72  ? 46  GLU F OE2 1 
ATOM   8354  N N   . TRP F  2 47  ? 26.143  28.139  69.394  1.00 65.81  ? 47  TRP F N   1 
ATOM   8355  C CA  . TRP F  2 47  ? 26.892  29.242  69.966  1.00 63.70  ? 47  TRP F CA  1 
ATOM   8356  C C   . TRP F  2 47  ? 27.340  30.073  68.782  1.00 63.16  ? 47  TRP F C   1 
ATOM   8357  O O   . TRP F  2 47  ? 27.997  29.564  67.868  1.00 62.49  ? 47  TRP F O   1 
ATOM   8358  C CB  . TRP F  2 47  ? 28.113  28.730  70.721  1.00 62.36  ? 47  TRP F CB  1 
ATOM   8359  C CG  . TRP F  2 47  ? 28.832  29.807  71.458  1.00 60.79  ? 47  TRP F CG  1 
ATOM   8360  C CD1 . TRP F  2 47  ? 28.583  30.245  72.729  1.00 59.40  ? 47  TRP F CD1 1 
ATOM   8361  C CD2 . TRP F  2 47  ? 29.920  30.591  70.967  1.00 60.21  ? 47  TRP F CD2 1 
ATOM   8362  N NE1 . TRP F  2 47  ? 29.451  31.250  73.057  1.00 58.60  ? 47  TRP F NE1 1 
ATOM   8363  C CE2 . TRP F  2 47  ? 30.285  31.484  71.994  1.00 60.10  ? 47  TRP F CE2 1 
ATOM   8364  C CE3 . TRP F  2 47  ? 30.626  30.624  69.756  1.00 59.98  ? 47  TRP F CE3 1 
ATOM   8365  C CZ2 . TRP F  2 47  ? 31.333  32.403  71.847  1.00 61.00  ? 47  TRP F CZ2 1 
ATOM   8366  C CZ3 . TRP F  2 47  ? 31.664  31.534  69.610  1.00 60.47  ? 47  TRP F CZ3 1 
ATOM   8367  C CH2 . TRP F  2 47  ? 32.009  32.411  70.651  1.00 61.02  ? 47  TRP F CH2 1 
ATOM   8368  N N   . MET F  2 48  ? 26.977  31.348  68.787  1.00 62.44  ? 48  MET F N   1 
ATOM   8369  C CA  . MET F  2 48  ? 27.344  32.214  67.678  1.00 62.35  ? 48  MET F CA  1 
ATOM   8370  C C   . MET F  2 48  ? 28.564  33.063  68.005  1.00 62.61  ? 48  MET F C   1 
ATOM   8371  O O   . MET F  2 48  ? 29.450  33.272  67.166  1.00 60.99  ? 48  MET F O   1 
ATOM   8372  C CB  . MET F  2 48  ? 26.156  33.105  67.305  1.00 61.14  ? 48  MET F CB  1 
ATOM   8373  C CG  . MET F  2 48  ? 24.965  32.350  66.722  1.00 58.93  ? 48  MET F CG  1 
ATOM   8374  S SD  . MET F  2 48  ? 23.562  33.431  66.453  1.00 56.15  ? 48  MET F SD  1 
ATOM   8375  C CE  . MET F  2 48  ? 23.940  34.090  64.842  1.00 54.39  ? 48  MET F CE  1 
ATOM   8376  N N   . GLY F  2 49  ? 28.606  33.543  69.241  1.00 63.77  ? 49  GLY F N   1 
ATOM   8377  C CA  . GLY F  2 49  ? 29.714  34.372  69.665  1.00 64.76  ? 49  GLY F CA  1 
ATOM   8378  C C   . GLY F  2 49  ? 29.476  34.984  71.023  1.00 64.79  ? 49  GLY F C   1 
ATOM   8379  O O   . GLY F  2 49  ? 28.549  34.589  71.719  1.00 63.82  ? 49  GLY F O   1 
ATOM   8380  N N   . GLY F  2 50  ? 30.322  35.942  71.398  1.00 66.23  ? 50  GLY F N   1 
ATOM   8381  C CA  . GLY F  2 50  ? 30.178  36.601  72.686  1.00 68.48  ? 50  GLY F CA  1 
ATOM   8382  C C   . GLY F  2 50  ? 30.963  37.894  72.808  1.00 69.26  ? 50  GLY F C   1 
ATOM   8383  O O   . GLY F  2 50  ? 31.959  38.078  72.111  1.00 69.23  ? 50  GLY F O   1 
ATOM   8384  N N   . ILE F  2 51  ? 30.508  38.791  73.685  1.00 70.60  ? 51  ILE F N   1 
ATOM   8385  C CA  . ILE F  2 51  ? 31.180  40.071  73.918  1.00 71.93  ? 51  ILE F CA  1 
ATOM   8386  C C   . ILE F  2 51  ? 31.246  40.449  75.400  1.00 72.65  ? 51  ILE F C   1 
ATOM   8387  O O   . ILE F  2 51  ? 30.251  40.398  76.127  1.00 72.47  ? 51  ILE F O   1 
ATOM   8388  C CB  . ILE F  2 51  ? 30.492  41.232  73.171  1.00 72.34  ? 51  ILE F CB  1 
ATOM   8389  C CG1 . ILE F  2 51  ? 31.338  42.505  73.301  1.00 73.02  ? 51  ILE F CG1 1 
ATOM   8390  C CG2 . ILE F  2 51  ? 29.100  41.475  73.748  1.00 73.04  ? 51  ILE F CG2 1 
ATOM   8391  C CD1 . ILE F  2 51  ? 30.852  43.677  72.453  1.00 72.57  ? 51  ILE F CD1 1 
ATOM   8392  N N   . ILE F  2 52  ? 32.437  40.815  75.846  1.00 73.79  ? 52  ILE F N   1 
ATOM   8393  C CA  . ILE F  2 52  ? 32.619  41.222  77.222  1.00 75.83  ? 52  ILE F CA  1 
ATOM   8394  C C   . ILE F  2 52  ? 32.660  42.747  77.191  1.00 77.16  ? 52  ILE F C   1 
ATOM   8395  O O   . ILE F  2 52  ? 33.732  43.361  77.183  1.00 75.76  ? 52  ILE F O   1 
ATOM   8396  C CB  . ILE F  2 52  ? 33.925  40.663  77.818  1.00 75.86  ? 52  ILE F CB  1 
ATOM   8397  C CG1 . ILE F  2 52  ? 33.953  39.141  77.660  1.00 75.79  ? 52  ILE F CG1 1 
ATOM   8398  C CG2 . ILE F  2 52  ? 34.018  41.030  79.295  1.00 75.88  ? 52  ILE F CG2 1 
ATOM   8399  C CD1 . ILE F  2 52  ? 35.139  38.460  78.324  1.00 75.20  ? 52  ILE F CD1 1 
ATOM   8400  N N   . PRO F  2 53  A 31.473  43.372  77.194  1.00 78.54  ? 52  PRO F N   1 
ATOM   8401  C CA  . PRO F  2 53  A 31.286  44.820  77.160  1.00 80.09  ? 52  PRO F CA  1 
ATOM   8402  C C   . PRO F  2 53  A 32.598  45.566  77.270  1.00 81.76  ? 52  PRO F C   1 
ATOM   8403  O O   . PRO F  2 53  A 33.126  46.051  76.281  1.00 82.46  ? 52  PRO F O   1 
ATOM   8404  C CB  . PRO F  2 53  A 30.381  45.062  78.352  1.00 80.14  ? 52  PRO F CB  1 
ATOM   8405  C CG  . PRO F  2 53  A 29.446  43.901  78.260  1.00 79.94  ? 52  PRO F CG  1 
ATOM   8406  C CD  . PRO F  2 53  A 30.315  42.721  77.839  1.00 78.92  ? 52  PRO F CD  1 
ATOM   8407  N N   . VAL F  2 54  ? 33.109  45.643  78.489  1.00 83.99  ? 53  VAL F N   1 
ATOM   8408  C CA  . VAL F  2 54  ? 34.369  46.305  78.791  1.00 86.53  ? 53  VAL F CA  1 
ATOM   8409  C C   . VAL F  2 54  ? 35.103  46.875  77.575  1.00 87.60  ? 53  VAL F C   1 
ATOM   8410  O O   . VAL F  2 54  ? 35.244  48.095  77.428  1.00 87.86  ? 53  VAL F O   1 
ATOM   8411  C CB  . VAL F  2 54  ? 35.321  45.322  79.493  1.00 87.46  ? 53  VAL F CB  1 
ATOM   8412  C CG1 . VAL F  2 54  ? 36.471  46.084  80.135  1.00 88.43  ? 53  VAL F CG1 1 
ATOM   8413  C CG2 . VAL F  2 54  ? 34.554  44.498  80.519  1.00 86.83  ? 53  VAL F CG2 1 
ATOM   8414  N N   . PHE F  2 55  ? 35.563  45.966  76.715  1.00 88.79  ? 54  PHE F N   1 
ATOM   8415  C CA  . PHE F  2 55  ? 36.323  46.292  75.497  1.00 88.98  ? 54  PHE F CA  1 
ATOM   8416  C C   . PHE F  2 55  ? 35.793  45.590  74.231  1.00 87.87  ? 54  PHE F C   1 
ATOM   8417  O O   . PHE F  2 55  ? 36.333  44.555  73.826  1.00 87.21  ? 54  PHE F O   1 
ATOM   8418  C CB  . PHE F  2 55  ? 37.789  45.899  75.715  1.00 90.11  ? 54  PHE F CB  1 
ATOM   8419  C CG  . PHE F  2 55  ? 37.961  44.687  76.597  1.00 90.84  ? 54  PHE F CG  1 
ATOM   8420  C CD1 . PHE F  2 55  ? 37.318  43.487  76.291  1.00 91.16  ? 54  PHE F CD1 1 
ATOM   8421  C CD2 . PHE F  2 55  ? 38.733  44.755  77.754  1.00 91.04  ? 54  PHE F CD2 1 
ATOM   8422  C CE1 . PHE F  2 55  ? 37.439  42.377  77.126  1.00 91.13  ? 54  PHE F CE1 1 
ATOM   8423  C CE2 . PHE F  2 55  ? 38.861  43.650  78.597  1.00 90.73  ? 54  PHE F CE2 1 
ATOM   8424  C CZ  . PHE F  2 55  ? 38.212  42.461  78.281  1.00 91.08  ? 54  PHE F CZ  1 
ATOM   8425  N N   . GLY F  2 56  ? 34.754  46.161  73.611  1.00 86.56  ? 55  GLY F N   1 
ATOM   8426  C CA  . GLY F  2 56  ? 34.171  45.577  72.409  1.00 84.79  ? 55  GLY F CA  1 
ATOM   8427  C C   . GLY F  2 56  ? 35.154  44.671  71.696  1.00 83.79  ? 55  GLY F C   1 
ATOM   8428  O O   . GLY F  2 56  ? 36.161  45.140  71.176  1.00 83.62  ? 55  GLY F O   1 
ATOM   8429  N N   . SER F  2 57  ? 34.877  43.374  71.665  1.00 83.09  ? 56  SER F N   1 
ATOM   8430  C CA  . SER F  2 57  ? 35.803  42.441  71.033  1.00 82.72  ? 56  SER F CA  1 
ATOM   8431  C C   . SER F  2 57  ? 35.143  41.221  70.390  1.00 82.06  ? 56  SER F C   1 
ATOM   8432  O O   . SER F  2 57  ? 35.824  40.369  69.814  1.00 81.67  ? 56  SER F O   1 
ATOM   8433  C CB  . SER F  2 57  ? 36.828  41.979  72.076  1.00 83.11  ? 56  SER F CB  1 
ATOM   8434  O OG  . SER F  2 57  ? 36.216  41.788  73.345  1.00 82.13  ? 56  SER F OG  1 
ATOM   8435  N N   . ALA F  2 58  ? 33.820  41.153  70.495  1.00 81.01  ? 57  ALA F N   1 
ATOM   8436  C CA  . ALA F  2 58  ? 33.021  40.054  69.959  1.00 79.47  ? 57  ALA F CA  1 
ATOM   8437  C C   . ALA F  2 58  ? 33.795  38.897  69.339  1.00 78.97  ? 57  ALA F C   1 
ATOM   8438  O O   . ALA F  2 58  ? 34.481  39.071  68.335  1.00 78.66  ? 57  ALA F O   1 
ATOM   8439  C CB  . ALA F  2 58  ? 32.026  40.598  68.955  1.00 79.11  ? 57  ALA F CB  1 
ATOM   8440  N N   . ASN F  2 59  ? 33.682  37.721  69.954  1.00 79.00  ? 58  ASN F N   1 
ATOM   8441  C CA  . ASN F  2 59  ? 34.327  36.500  69.465  1.00 78.76  ? 58  ASN F CA  1 
ATOM   8442  C C   . ASN F  2 59  ? 33.267  35.787  68.655  1.00 78.83  ? 58  ASN F C   1 
ATOM   8443  O O   . ASN F  2 59  ? 32.261  35.364  69.216  1.00 78.79  ? 58  ASN F O   1 
ATOM   8444  C CB  . ASN F  2 59  ? 34.722  35.585  70.619  1.00 79.37  ? 58  ASN F CB  1 
ATOM   8445  C CG  . ASN F  2 59  ? 35.965  36.046  71.340  1.00 80.01  ? 58  ASN F CG  1 
ATOM   8446  O OD1 . ASN F  2 59  ? 37.073  35.969  70.806  1.00 80.12  ? 58  ASN F OD1 1 
ATOM   8447  N ND2 . ASN F  2 59  ? 35.790  36.523  72.569  1.00 80.19  ? 58  ASN F ND2 1 
ATOM   8448  N N   . TYR F  2 60  ? 33.488  35.633  67.352  1.00 78.58  ? 59  TYR F N   1 
ATOM   8449  C CA  . TYR F  2 60  ? 32.500  34.977  66.498  1.00 78.70  ? 59  TYR F CA  1 
ATOM   8450  C C   . TYR F  2 60  ? 32.714  33.486  66.264  1.00 79.32  ? 59  TYR F C   1 
ATOM   8451  O O   . TYR F  2 60  ? 33.824  32.963  66.380  1.00 79.23  ? 59  TYR F O   1 
ATOM   8452  C CB  . TYR F  2 60  ? 32.424  35.689  65.143  1.00 77.36  ? 59  TYR F CB  1 
ATOM   8453  C CG  . TYR F  2 60  ? 31.974  37.122  65.231  1.00 75.94  ? 59  TYR F CG  1 
ATOM   8454  C CD1 . TYR F  2 60  ? 32.067  37.970  64.133  1.00 76.03  ? 59  TYR F CD1 1 
ATOM   8455  C CD2 . TYR F  2 60  ? 31.493  37.641  66.424  1.00 75.61  ? 59  TYR F CD2 1 
ATOM   8456  C CE1 . TYR F  2 60  ? 31.701  39.306  64.231  1.00 75.99  ? 59  TYR F CE1 1 
ATOM   8457  C CE2 . TYR F  2 60  ? 31.124  38.967  66.533  1.00 75.81  ? 59  TYR F CE2 1 
ATOM   8458  C CZ  . TYR F  2 60  ? 31.233  39.799  65.441  1.00 75.57  ? 59  TYR F CZ  1 
ATOM   8459  O OH  . TYR F  2 60  ? 30.912  41.130  65.587  1.00 75.27  ? 59  TYR F OH  1 
ATOM   8460  N N   . ALA F  2 61  ? 31.625  32.810  65.926  1.00 79.89  ? 60  ALA F N   1 
ATOM   8461  C CA  . ALA F  2 61  ? 31.669  31.388  65.653  1.00 81.09  ? 60  ALA F CA  1 
ATOM   8462  C C   . ALA F  2 61  ? 32.085  31.140  64.200  1.00 81.61  ? 60  ALA F C   1 
ATOM   8463  O O   . ALA F  2 61  ? 31.336  31.455  63.270  1.00 81.18  ? 60  ALA F O   1 
ATOM   8464  C CB  . ALA F  2 61  ? 30.301  30.773  65.922  1.00 81.97  ? 60  ALA F CB  1 
ATOM   8465  N N   . GLN F  2 62  ? 33.281  30.579  64.026  1.00 82.24  ? 61  GLN F N   1 
ATOM   8466  C CA  . GLN F  2 62  ? 33.851  30.257  62.712  1.00 83.05  ? 61  GLN F CA  1 
ATOM   8467  C C   . GLN F  2 62  ? 33.030  30.624  61.480  1.00 83.26  ? 61  GLN F C   1 
ATOM   8468  O O   . GLN F  2 62  ? 33.237  31.673  60.877  1.00 83.12  ? 61  GLN F O   1 
ATOM   8469  C CB  . GLN F  2 62  ? 34.193  28.762  62.642  1.00 83.92  ? 61  GLN F CB  1 
ATOM   8470  C CG  . GLN F  2 62  ? 33.050  27.809  63.023  1.00 84.76  ? 61  GLN F CG  1 
ATOM   8471  C CD  . GLN F  2 62  ? 33.416  26.334  62.835  1.00 85.22  ? 61  GLN F CD  1 
ATOM   8472  O OE1 . GLN F  2 62  ? 33.768  25.897  61.732  1.00 84.01  ? 61  GLN F OE1 1 
ATOM   8473  N NE2 . GLN F  2 62  ? 33.338  25.566  63.917  1.00 84.80  ? 61  GLN F NE2 1 
ATOM   8474  N N   . LYS F  2 63  ? 32.112  29.742  61.102  1.00 84.06  ? 62  LYS F N   1 
ATOM   8475  C CA  . LYS F  2 63  ? 31.266  29.949  59.934  1.00 84.89  ? 62  LYS F CA  1 
ATOM   8476  C C   . LYS F  2 63  ? 30.717  31.363  59.786  1.00 85.39  ? 62  LYS F C   1 
ATOM   8477  O O   . LYS F  2 63  ? 30.936  32.008  58.758  1.00 85.17  ? 62  LYS F O   1 
ATOM   8478  C CB  . LYS F  2 63  ? 30.115  28.947  59.957  1.00 85.46  ? 62  LYS F CB  1 
ATOM   8479  C CG  . LYS F  2 63  ? 29.641  28.588  61.348  1.00 85.92  ? 62  LYS F CG  1 
ATOM   8480  C CD  . LYS F  2 63  ? 28.396  27.730  61.291  1.00 88.04  ? 62  LYS F CD  1 
ATOM   8481  C CE  . LYS F  2 63  ? 27.286  28.421  60.502  1.00 89.07  ? 62  LYS F CE  1 
ATOM   8482  N NZ  . LYS F  2 63  ? 26.004  27.651  60.524  1.00 90.63  ? 62  LYS F NZ  1 
ATOM   8483  N N   . PHE F  2 64  ? 30.008  31.842  60.808  1.00 86.12  ? 63  PHE F N   1 
ATOM   8484  C CA  . PHE F  2 64  ? 29.421  33.183  60.774  1.00 86.48  ? 63  PHE F CA  1 
ATOM   8485  C C   . PHE F  2 64  ? 30.475  34.283  60.702  1.00 86.55  ? 63  PHE F C   1 
ATOM   8486  O O   . PHE F  2 64  ? 30.358  35.297  61.392  1.00 85.95  ? 63  PHE F O   1 
ATOM   8487  C CB  . PHE F  2 64  ? 28.562  33.454  62.011  1.00 86.49  ? 63  PHE F CB  1 
ATOM   8488  C CG  . PHE F  2 64  ? 27.610  32.350  62.368  1.00 86.78  ? 63  PHE F CG  1 
ATOM   8489  C CD1 . PHE F  2 64  ? 28.080  31.142  62.867  1.00 87.50  ? 63  PHE F CD1 1 
ATOM   8490  C CD2 . PHE F  2 64  ? 26.239  32.552  62.299  1.00 86.69  ? 63  PHE F CD2 1 
ATOM   8491  C CE1 . PHE F  2 64  ? 27.195  30.154  63.304  1.00 87.61  ? 63  PHE F CE1 1 
ATOM   8492  C CE2 . PHE F  2 64  ? 25.348  31.570  62.732  1.00 86.89  ? 63  PHE F CE2 1 
ATOM   8493  C CZ  . PHE F  2 64  ? 25.828  30.372  63.237  1.00 87.26  ? 63  PHE F CZ  1 
ATOM   8494  N N   . GLN F  2 65  ? 31.500  34.097  59.875  1.00 87.12  ? 64  GLN F N   1 
ATOM   8495  C CA  . GLN F  2 65  ? 32.548  35.109  59.756  1.00 87.07  ? 64  GLN F CA  1 
ATOM   8496  C C   . GLN F  2 65  ? 32.037  36.261  58.892  1.00 86.22  ? 64  GLN F C   1 
ATOM   8497  O O   . GLN F  2 65  ? 31.704  36.062  57.721  1.00 86.71  ? 64  GLN F O   1 
ATOM   8498  C CB  . GLN F  2 65  ? 33.820  34.506  59.140  1.00 87.55  ? 64  GLN F CB  1 
ATOM   8499  C CG  . GLN F  2 65  ? 35.095  35.310  59.424  1.00 87.28  ? 64  GLN F CG  1 
ATOM   8500  C CD  . GLN F  2 65  ? 35.445  35.367  60.904  1.00 87.09  ? 64  GLN F CD  1 
ATOM   8501  O OE1 . GLN F  2 65  ? 36.011  34.425  61.459  1.00 87.17  ? 64  GLN F OE1 1 
ATOM   8502  N NE2 . GLN F  2 65  ? 35.097  36.474  61.551  1.00 86.77  ? 64  GLN F NE2 1 
ATOM   8503  N N   . GLY F  2 66  ? 31.972  37.457  59.483  1.00 84.56  ? 65  GLY F N   1 
ATOM   8504  C CA  . GLY F  2 66  ? 31.488  38.629  58.775  1.00 81.22  ? 65  GLY F CA  1 
ATOM   8505  C C   . GLY F  2 66  ? 29.973  38.624  58.765  1.00 79.17  ? 65  GLY F C   1 
ATOM   8506  O O   . GLY F  2 66  ? 29.329  39.666  58.719  1.00 79.23  ? 65  GLY F O   1 
ATOM   8507  N N   . ARG F  2 67  ? 29.407  37.426  58.817  1.00 77.05  ? 66  ARG F N   1 
ATOM   8508  C CA  . ARG F  2 67  ? 27.969  37.249  58.813  1.00 75.05  ? 66  ARG F CA  1 
ATOM   8509  C C   . ARG F  2 67  ? 27.299  38.023  59.930  1.00 73.17  ? 66  ARG F C   1 
ATOM   8510  O O   . ARG F  2 67  ? 26.470  38.892  59.680  1.00 71.70  ? 66  ARG F O   1 
ATOM   8511  C CB  . ARG F  2 67  ? 27.634  35.759  58.943  1.00 76.83  ? 66  ARG F CB  1 
ATOM   8512  C CG  . ARG F  2 67  ? 27.555  35.010  57.607  1.00 78.48  ? 66  ARG F CG  1 
ATOM   8513  C CD  . ARG F  2 67  ? 26.156  35.129  56.984  1.00 79.51  ? 66  ARG F CD  1 
ATOM   8514  N NE  . ARG F  2 67  ? 25.315  33.976  57.301  1.00 79.57  ? 66  ARG F NE  1 
ATOM   8515  C CZ  . ARG F  2 67  ? 23.991  34.010  57.404  1.00 79.89  ? 66  ARG F CZ  1 
ATOM   8516  N NH1 . ARG F  2 67  ? 23.330  35.147  57.223  1.00 79.29  ? 66  ARG F NH1 1 
ATOM   8517  N NH2 . ARG F  2 67  ? 23.326  32.898  57.682  1.00 80.26  ? 66  ARG F NH2 1 
ATOM   8518  N N   . VAL F  2 68  ? 27.678  37.705  61.163  1.00 72.41  ? 67  VAL F N   1 
ATOM   8519  C CA  . VAL F  2 68  ? 27.101  38.336  62.349  1.00 70.98  ? 67  VAL F CA  1 
ATOM   8520  C C   . VAL F  2 68  ? 27.954  39.401  63.027  1.00 69.98  ? 67  VAL F C   1 
ATOM   8521  O O   . VAL F  2 68  ? 29.181  39.346  62.987  1.00 69.72  ? 67  VAL F O   1 
ATOM   8522  C CB  . VAL F  2 68  ? 26.735  37.266  63.417  1.00 70.73  ? 67  VAL F CB  1 
ATOM   8523  C CG1 . VAL F  2 68  ? 27.852  36.247  63.556  1.00 69.17  ? 67  VAL F CG1 1 
ATOM   8524  C CG2 . VAL F  2 68  ? 26.481  37.934  64.750  1.00 70.72  ? 67  VAL F CG2 1 
ATOM   8525  N N   . THR F  2 69  ? 27.279  40.369  63.647  1.00 69.78  ? 68  THR F N   1 
ATOM   8526  C CA  . THR F  2 69  ? 27.931  41.457  64.380  1.00 69.78  ? 68  THR F CA  1 
ATOM   8527  C C   . THR F  2 69  ? 27.354  41.515  65.810  1.00 69.37  ? 68  THR F C   1 
ATOM   8528  O O   . THR F  2 69  ? 26.140  41.415  66.008  1.00 68.79  ? 68  THR F O   1 
ATOM   8529  C CB  . THR F  2 69  ? 27.729  42.827  63.673  1.00 69.71  ? 68  THR F CB  1 
ATOM   8530  O OG1 . THR F  2 69  ? 28.319  42.790  62.365  1.00 69.89  ? 68  THR F OG1 1 
ATOM   8531  C CG2 . THR F  2 69  ? 28.390  43.940  64.475  1.00 69.73  ? 68  THR F CG2 1 
ATOM   8532  N N   . ILE F  2 70  ? 28.232  41.677  66.797  1.00 68.94  ? 69  ILE F N   1 
ATOM   8533  C CA  . ILE F  2 70  ? 27.830  41.710  68.201  1.00 69.03  ? 69  ILE F CA  1 
ATOM   8534  C C   . ILE F  2 70  ? 28.189  42.987  68.960  1.00 70.75  ? 69  ILE F C   1 
ATOM   8535  O O   . ILE F  2 70  ? 29.367  43.311  69.097  1.00 71.11  ? 69  ILE F O   1 
ATOM   8536  C CB  . ILE F  2 70  ? 28.475  40.546  68.962  1.00 66.91  ? 69  ILE F CB  1 
ATOM   8537  C CG1 . ILE F  2 70  ? 27.974  39.220  68.396  1.00 64.83  ? 69  ILE F CG1 1 
ATOM   8538  C CG2 . ILE F  2 70  ? 28.197  40.686  70.445  1.00 65.45  ? 69  ILE F CG2 1 
ATOM   8539  C CD1 . ILE F  2 70  ? 28.466  38.018  69.145  1.00 63.46  ? 69  ILE F CD1 1 
ATOM   8540  N N   . THR F  2 71  ? 27.187  43.698  69.472  1.00 72.61  ? 70  THR F N   1 
ATOM   8541  C CA  . THR F  2 71  ? 27.450  44.919  70.241  1.00 75.01  ? 70  THR F CA  1 
ATOM   8542  C C   . THR F  2 71  ? 26.876  44.829  71.656  1.00 76.06  ? 70  THR F C   1 
ATOM   8543  O O   . THR F  2 71  ? 26.447  43.759  72.099  1.00 76.83  ? 70  THR F O   1 
ATOM   8544  C CB  . THR F  2 71  ? 26.869  46.191  69.560  1.00 75.04  ? 70  THR F CB  1 
ATOM   8545  O OG1 . THR F  2 71  ? 25.489  45.979  69.239  1.00 76.28  ? 70  THR F OG1 1 
ATOM   8546  C CG2 . THR F  2 71  ? 27.652  46.540  68.297  1.00 74.80  ? 70  THR F CG2 1 
ATOM   8547  N N   . ALA F  2 72  ? 26.884  45.960  72.359  1.00 77.59  ? 71  ALA F N   1 
ATOM   8548  C CA  . ALA F  2 72  ? 26.367  46.047  73.728  1.00 78.79  ? 71  ALA F CA  1 
ATOM   8549  C C   . ALA F  2 72  ? 26.638  47.421  74.352  1.00 79.25  ? 71  ALA F C   1 
ATOM   8550  O O   . ALA F  2 72  ? 27.735  47.692  74.834  1.00 79.08  ? 71  ALA F O   1 
ATOM   8551  C CB  . ALA F  2 72  ? 26.974  44.948  74.587  1.00 79.07  ? 71  ALA F CB  1 
ATOM   8552  N N   . ASP F  2 73  ? 25.618  48.271  74.343  1.00 80.35  ? 72  ASP F N   1 
ATOM   8553  C CA  . ASP F  2 73  ? 25.688  49.636  74.865  1.00 81.64  ? 72  ASP F CA  1 
ATOM   8554  C C   . ASP F  2 73  ? 25.748  49.686  76.412  1.00 81.97  ? 72  ASP F C   1 
ATOM   8555  O O   . ASP F  2 73  ? 24.717  49.611  77.090  1.00 81.37  ? 72  ASP F O   1 
ATOM   8556  C CB  . ASP F  2 73  ? 24.467  50.393  74.317  1.00 82.74  ? 72  ASP F CB  1 
ATOM   8557  C CG  . ASP F  2 73  ? 24.523  51.884  74.564  1.00 83.16  ? 72  ASP F CG  1 
ATOM   8558  O OD1 . ASP F  2 73  ? 23.442  52.514  74.529  1.00 82.55  ? 72  ASP F OD1 1 
ATOM   8559  O OD2 . ASP F  2 73  ? 25.629  52.425  74.776  1.00 83.64  ? 72  ASP F OD2 1 
ATOM   8560  N N   . GLU F  2 74  ? 26.962  49.815  76.959  1.00 82.06  ? 73  GLU F N   1 
ATOM   8561  C CA  . GLU F  2 74  ? 27.159  49.853  78.414  1.00 81.94  ? 73  GLU F CA  1 
ATOM   8562  C C   . GLU F  2 74  ? 26.339  50.944  79.063  1.00 81.35  ? 73  GLU F C   1 
ATOM   8563  O O   . GLU F  2 74  ? 25.994  50.851  80.239  1.00 81.26  ? 73  GLU F O   1 
ATOM   8564  C CB  . GLU F  2 74  ? 28.630  50.095  78.788  1.00 82.19  ? 73  GLU F CB  1 
ATOM   8565  C CG  . GLU F  2 74  ? 29.627  49.095  78.236  1.00 82.85  ? 73  GLU F CG  1 
ATOM   8566  C CD  . GLU F  2 74  ? 30.359  49.627  77.019  1.00 83.68  ? 73  GLU F CD  1 
ATOM   8567  O OE1 . GLU F  2 74  ? 29.694  49.884  75.994  1.00 83.80  ? 73  GLU F OE1 1 
ATOM   8568  O OE2 . GLU F  2 74  ? 31.598  49.793  77.089  1.00 84.29  ? 73  GLU F OE2 1 
ATOM   8569  N N   . ALA F  2 75  ? 26.053  51.988  78.293  1.00 80.57  ? 74  ALA F N   1 
ATOM   8570  C CA  . ALA F  2 75  ? 25.283  53.119  78.789  1.00 80.05  ? 74  ALA F CA  1 
ATOM   8571  C C   . ALA F  2 75  ? 23.840  52.707  79.043  1.00 79.72  ? 74  ALA F C   1 
ATOM   8572  O O   . ALA F  2 75  ? 23.057  53.457  79.627  1.00 78.96  ? 74  ALA F O   1 
ATOM   8573  C CB  . ALA F  2 75  ? 25.342  54.264  77.785  1.00 79.45  ? 74  ALA F CB  1 
ATOM   8574  N N   . THR F  2 76  ? 23.498  51.502  78.607  1.00 80.03  ? 75  THR F N   1 
ATOM   8575  C CA  . THR F  2 76  ? 22.149  50.993  78.782  1.00 80.64  ? 75  THR F CA  1 
ATOM   8576  C C   . THR F  2 76  ? 22.155  49.489  79.019  1.00 80.99  ? 75  THR F C   1 
ATOM   8577  O O   . THR F  2 76  ? 21.096  48.856  79.031  1.00 81.30  ? 75  THR F O   1 
ATOM   8578  C CB  . THR F  2 76  ? 21.279  51.308  77.544  1.00 80.87  ? 75  THR F CB  1 
ATOM   8579  O OG1 . THR F  2 76  ? 22.024  51.036  76.347  1.00 79.19  ? 75  THR F OG1 1 
ATOM   8580  C CG2 . THR F  2 76  ? 20.846  52.773  77.561  1.00 80.89  ? 75  THR F CG2 1 
ATOM   8581  N N   . SER F  2 77  ? 23.348  48.927  79.219  1.00 80.59  ? 76  SER F N   1 
ATOM   8582  C CA  . SER F  2 77  ? 23.505  47.489  79.447  1.00 79.97  ? 76  SER F CA  1 
ATOM   8583  C C   . SER F  2 77  ? 22.621  46.684  78.484  1.00 78.75  ? 76  SER F C   1 
ATOM   8584  O O   . SER F  2 77  ? 21.811  45.850  78.891  1.00 78.11  ? 76  SER F O   1 
ATOM   8585  C CB  . SER F  2 77  ? 23.174  47.130  80.906  1.00 80.78  ? 76  SER F CB  1 
ATOM   8586  O OG  . SER F  2 77  ? 21.838  47.456  81.257  1.00 82.32  ? 76  SER F OG  1 
ATOM   8587  N N   . THR F  2 78  ? 22.794  46.952  77.196  1.00 76.91  ? 77  THR F N   1 
ATOM   8588  C CA  . THR F  2 78  ? 22.037  46.278  76.167  1.00 75.21  ? 77  THR F CA  1 
ATOM   8589  C C   . THR F  2 78  ? 23.022  45.583  75.254  1.00 74.59  ? 77  THR F C   1 
ATOM   8590  O O   . THR F  2 78  ? 24.165  46.017  75.135  1.00 73.33  ? 77  THR F O   1 
ATOM   8591  C CB  . THR F  2 78  ? 21.227  47.288  75.339  1.00 75.57  ? 77  THR F CB  1 
ATOM   8592  O OG1 . THR F  2 78  ? 20.384  48.046  76.213  1.00 75.38  ? 77  THR F OG1 1 
ATOM   8593  C CG2 . THR F  2 78  ? 20.366  46.573  74.294  1.00 75.15  ? 77  THR F CG2 1 
ATOM   8594  N N   . THR F  2 79  ? 22.567  44.502  74.621  1.00 74.69  ? 78  THR F N   1 
ATOM   8595  C CA  . THR F  2 79  ? 23.378  43.730  73.681  1.00 73.99  ? 78  THR F CA  1 
ATOM   8596  C C   . THR F  2 79  ? 22.606  43.596  72.383  1.00 73.59  ? 78  THR F C   1 
ATOM   8597  O O   . THR F  2 79  ? 21.400  43.366  72.395  1.00 73.48  ? 78  THR F O   1 
ATOM   8598  C CB  . THR F  2 79  ? 23.641  42.319  74.186  1.00 73.97  ? 78  THR F CB  1 
ATOM   8599  O OG1 . THR F  2 79  ? 23.236  42.227  75.559  1.00 74.11  ? 78  THR F OG1 1 
ATOM   8600  C CG2 . THR F  2 79  ? 25.119  41.969  74.034  1.00 72.35  ? 78  THR F CG2 1 
ATOM   8601  N N   . TYR F  2 80  ? 23.297  43.747  71.264  1.00 73.53  ? 79  TYR F N   1 
ATOM   8602  C CA  . TYR F  2 80  ? 22.653  43.616  69.971  1.00 74.58  ? 79  TYR F CA  1 
ATOM   8603  C C   . TYR F  2 80  ? 23.318  42.487  69.222  1.00 74.13  ? 79  TYR F C   1 
ATOM   8604  O O   . TYR F  2 80  ? 24.515  42.262  69.364  1.00 74.29  ? 79  TYR F O   1 
ATOM   8605  C CB  . TYR F  2 80  ? 22.766  44.913  69.178  1.00 76.54  ? 79  TYR F CB  1 
ATOM   8606  C CG  . TYR F  2 80  ? 21.984  46.051  69.778  1.00 78.93  ? 79  TYR F CG  1 
ATOM   8607  C CD1 . TYR F  2 80  ? 22.414  47.367  69.621  1.00 80.17  ? 79  TYR F CD1 1 
ATOM   8608  C CD2 . TYR F  2 80  ? 20.836  45.813  70.538  1.00 80.44  ? 79  TYR F CD2 1 
ATOM   8609  C CE1 . TYR F  2 80  ? 21.730  48.424  70.216  1.00 82.50  ? 79  TYR F CE1 1 
ATOM   8610  C CE2 . TYR F  2 80  ? 20.138  46.863  71.140  1.00 82.51  ? 79  TYR F CE2 1 
ATOM   8611  C CZ  . TYR F  2 80  ? 20.595  48.170  70.979  1.00 82.96  ? 79  TYR F CZ  1 
ATOM   8612  O OH  . TYR F  2 80  ? 19.951  49.219  71.602  1.00 82.25  ? 79  TYR F OH  1 
ATOM   8613  N N   . MET F  2 81  ? 22.536  41.773  68.429  1.00 73.78  ? 80  MET F N   1 
ATOM   8614  C CA  . MET F  2 81  ? 23.065  40.660  67.671  1.00 73.93  ? 80  MET F CA  1 
ATOM   8615  C C   . MET F  2 81  ? 22.760  40.884  66.193  1.00 74.26  ? 80  MET F C   1 
ATOM   8616  O O   . MET F  2 81  ? 21.879  40.253  65.608  1.00 74.22  ? 80  MET F O   1 
ATOM   8617  C CB  . MET F  2 81  ? 22.447  39.351  68.184  1.00 73.89  ? 80  MET F CB  1 
ATOM   8618  C CG  . MET F  2 81  ? 23.184  38.082  67.785  1.00 72.17  ? 80  MET F CG  1 
ATOM   8619  S SD  . MET F  2 81  ? 23.288  37.882  66.014  1.00 72.12  ? 80  MET F SD  1 
ATOM   8620  C CE  . MET F  2 81  ? 21.787  37.057  65.669  1.00 70.84  ? 80  MET F CE  1 
ATOM   8621  N N   . GLU F  2 82  ? 23.497  41.814  65.606  1.00 74.13  ? 81  GLU F N   1 
ATOM   8622  C CA  . GLU F  2 82  ? 23.358  42.147  64.200  1.00 75.23  ? 81  GLU F CA  1 
ATOM   8623  C C   . GLU F  2 82  ? 23.589  40.910  63.327  1.00 75.54  ? 81  GLU F C   1 
ATOM   8624  O O   . GLU F  2 82  ? 24.385  40.045  63.675  1.00 75.05  ? 81  GLU F O   1 
ATOM   8625  C CB  . GLU F  2 82  ? 24.380  43.238  63.858  1.00 75.48  ? 81  GLU F CB  1 
ATOM   8626  C CG  . GLU F  2 82  ? 24.721  43.410  62.385  1.00 76.38  ? 81  GLU F CG  1 
ATOM   8627  C CD  . GLU F  2 82  ? 23.559  43.918  61.561  1.00 76.81  ? 81  GLU F CD  1 
ATOM   8628  O OE1 . GLU F  2 82  ? 22.953  44.934  61.957  1.00 76.74  ? 81  GLU F OE1 1 
ATOM   8629  O OE2 . GLU F  2 82  ? 23.259  43.307  60.513  1.00 76.73  ? 81  GLU F OE2 1 
ATOM   8630  N N   . LEU F  2 83  ? 22.875  40.823  62.208  1.00 76.32  ? 82  LEU F N   1 
ATOM   8631  C CA  . LEU F  2 83  ? 23.037  39.714  61.261  1.00 77.98  ? 82  LEU F CA  1 
ATOM   8632  C C   . LEU F  2 83  ? 22.406  40.064  59.914  1.00 78.40  ? 82  LEU F C   1 
ATOM   8633  O O   . LEU F  2 83  ? 21.209  40.339  59.827  1.00 79.03  ? 82  LEU F O   1 
ATOM   8634  C CB  . LEU F  2 83  ? 22.423  38.409  61.798  1.00 78.49  ? 82  LEU F CB  1 
ATOM   8635  C CG  . LEU F  2 83  ? 22.467  37.185  60.853  1.00 78.21  ? 82  LEU F CG  1 
ATOM   8636  C CD1 . LEU F  2 83  ? 23.868  36.965  60.287  1.00 77.21  ? 82  LEU F CD1 1 
ATOM   8637  C CD2 . LEU F  2 83  ? 22.008  35.951  61.607  1.00 77.62  ? 82  LEU F CD2 1 
ATOM   8638  N N   . SER F  2 84  A 23.218  40.044  58.863  1.00 78.60  ? 82  SER F N   1 
ATOM   8639  C CA  . SER F  2 84  A 22.742  40.379  57.532  1.00 78.50  ? 82  SER F CA  1 
ATOM   8640  C C   . SER F  2 84  A 22.793  39.200  56.581  1.00 78.51  ? 82  SER F C   1 
ATOM   8641  O O   . SER F  2 84  A 23.445  38.190  56.863  1.00 78.11  ? 82  SER F O   1 
ATOM   8642  C CB  . SER F  2 84  A 23.570  41.528  56.950  1.00 79.14  ? 82  SER F CB  1 
ATOM   8643  O OG  . SER F  2 84  A 24.890  41.111  56.639  1.00 79.24  ? 82  SER F OG  1 
ATOM   8644  N N   . SER F  2 85  B 22.091  39.354  55.456  1.00 78.75  ? 82  SER F N   1 
ATOM   8645  C CA  . SER F  2 85  B 22.020  38.350  54.393  1.00 77.97  ? 82  SER F CA  1 
ATOM   8646  C C   . SER F  2 85  B 21.196  37.140  54.821  1.00 77.37  ? 82  SER F C   1 
ATOM   8647  O O   . SER F  2 85  B 21.422  36.029  54.343  1.00 77.05  ? 82  SER F O   1 
ATOM   8648  C CB  . SER F  2 85  B 23.434  37.897  54.020  1.00 78.37  ? 82  SER F CB  1 
ATOM   8649  O OG  . SER F  2 85  B 24.366  38.960  54.155  1.00 78.41  ? 82  SER F OG  1 
ATOM   8650  N N   . LEU F  2 86  C 20.241  37.365  55.721  1.00 76.66  ? 82  LEU F N   1 
ATOM   8651  C CA  . LEU F  2 86  C 19.397  36.296  56.246  1.00 76.28  ? 82  LEU F CA  1 
ATOM   8652  C C   . LEU F  2 86  C 18.975  35.276  55.199  1.00 76.56  ? 82  LEU F C   1 
ATOM   8653  O O   . LEU F  2 86  C 18.942  35.562  54.002  1.00 76.79  ? 82  LEU F O   1 
ATOM   8654  C CB  . LEU F  2 86  C 18.151  36.877  56.923  1.00 74.60  ? 82  LEU F CB  1 
ATOM   8655  C CG  . LEU F  2 86  C 18.376  37.835  58.093  1.00 73.41  ? 82  LEU F CG  1 
ATOM   8656  C CD1 . LEU F  2 86  C 17.042  38.358  58.585  1.00 72.31  ? 82  LEU F CD1 1 
ATOM   8657  C CD2 . LEU F  2 86  C 19.110  37.126  59.207  1.00 72.29  ? 82  LEU F CD2 1 
ATOM   8658  N N   . ARG F  2 87  ? 18.658  34.076  55.669  1.00 76.65  ? 83  ARG F N   1 
ATOM   8659  C CA  . ARG F  2 87  ? 18.235  32.997  54.797  1.00 76.73  ? 83  ARG F CA  1 
ATOM   8660  C C   . ARG F  2 87  ? 17.070  32.287  55.467  1.00 77.86  ? 83  ARG F C   1 
ATOM   8661  O O   . ARG F  2 87  ? 16.435  32.828  56.377  1.00 78.88  ? 83  ARG F O   1 
ATOM   8662  C CB  . ARG F  2 87  ? 19.383  32.019  54.592  1.00 75.36  ? 83  ARG F CB  1 
ATOM   8663  C CG  . ARG F  2 87  ? 20.727  32.698  54.416  1.00 74.97  ? 83  ARG F CG  1 
ATOM   8664  C CD  . ARG F  2 87  ? 21.846  31.687  54.251  1.00 73.94  ? 83  ARG F CD  1 
ATOM   8665  N NE  . ARG F  2 87  ? 23.142  32.337  54.099  1.00 72.59  ? 83  ARG F NE  1 
ATOM   8666  C CZ  . ARG F  2 87  ? 24.264  31.701  53.786  1.00 72.23  ? 83  ARG F CZ  1 
ATOM   8667  N NH1 . ARG F  2 87  ? 24.260  30.390  53.589  1.00 71.87  ? 83  ARG F NH1 1 
ATOM   8668  N NH2 . ARG F  2 87  ? 25.391  32.380  53.660  1.00 72.03  ? 83  ARG F NH2 1 
ATOM   8669  N N   . SER F  2 88  ? 16.780  31.076  55.013  1.00 78.15  ? 84  SER F N   1 
ATOM   8670  C CA  . SER F  2 88  ? 15.695  30.298  55.589  1.00 76.88  ? 84  SER F CA  1 
ATOM   8671  C C   . SER F  2 88  ? 16.345  29.496  56.704  1.00 75.79  ? 84  SER F C   1 
ATOM   8672  O O   . SER F  2 88  ? 15.665  28.869  57.515  1.00 75.71  ? 84  SER F O   1 
ATOM   8673  C CB  . SER F  2 88  ? 15.085  29.367  54.528  1.00 77.81  ? 84  SER F CB  1 
ATOM   8674  O OG  . SER F  2 88  ? 15.711  29.538  53.263  1.00 77.79  ? 84  SER F OG  1 
ATOM   8675  N N   . GLU F  2 89  ? 17.678  29.541  56.731  1.00 74.34  ? 85  GLU F N   1 
ATOM   8676  C CA  . GLU F  2 89  ? 18.467  28.835  57.734  1.00 73.79  ? 85  GLU F CA  1 
ATOM   8677  C C   . GLU F  2 89  ? 18.966  29.834  58.759  1.00 72.96  ? 85  GLU F C   1 
ATOM   8678  O O   . GLU F  2 89  ? 20.141  29.835  59.118  1.00 72.99  ? 85  GLU F O   1 
ATOM   8679  C CB  . GLU F  2 89  ? 19.659  28.141  57.090  1.00 74.23  ? 85  GLU F CB  1 
ATOM   8680  C CG  . GLU F  2 89  ? 19.306  27.420  55.820  1.00 76.29  ? 85  GLU F CG  1 
ATOM   8681  C CD  . GLU F  2 89  ? 18.925  28.384  54.710  1.00 77.58  ? 85  GLU F CD  1 
ATOM   8682  O OE1 . GLU F  2 89  ? 19.763  29.247  54.362  1.00 76.87  ? 85  GLU F OE1 1 
ATOM   8683  O OE2 . GLU F  2 89  ? 17.788  28.279  54.192  1.00 79.23  ? 85  GLU F OE2 1 
ATOM   8684  N N   . ASP F  2 90  ? 18.049  30.690  59.204  1.00 71.62  ? 86  ASP F N   1 
ATOM   8685  C CA  . ASP F  2 90  ? 18.305  31.723  60.200  1.00 69.97  ? 86  ASP F CA  1 
ATOM   8686  C C   . ASP F  2 90  ? 16.993  31.895  60.970  1.00 69.92  ? 86  ASP F C   1 
ATOM   8687  O O   . ASP F  2 90  ? 16.966  32.420  62.096  1.00 70.19  ? 86  ASP F O   1 
ATOM   8688  C CB  . ASP F  2 90  ? 18.687  33.040  59.522  1.00 69.54  ? 86  ASP F CB  1 
ATOM   8689  C CG  . ASP F  2 90  ? 20.011  32.963  58.795  1.00 69.18  ? 86  ASP F CG  1 
ATOM   8690  O OD1 . ASP F  2 90  ? 21.061  32.923  59.468  1.00 69.68  ? 86  ASP F OD1 1 
ATOM   8691  O OD2 . ASP F  2 90  ? 20.001  32.944  57.549  1.00 69.44  ? 86  ASP F OD2 1 
ATOM   8692  N N   . THR F  2 91  ? 15.904  31.453  60.336  1.00 68.82  ? 87  THR F N   1 
ATOM   8693  C CA  . THR F  2 91  ? 14.562  31.508  60.921  1.00 66.99  ? 87  THR F CA  1 
ATOM   8694  C C   . THR F  2 91  ? 14.611  30.616  62.153  1.00 65.77  ? 87  THR F C   1 
ATOM   8695  O O   . THR F  2 91  ? 14.636  29.389  62.037  1.00 65.12  ? 87  THR F O   1 
ATOM   8696  C CB  . THR F  2 91  ? 13.500  30.945  59.942  1.00 66.88  ? 87  THR F CB  1 
ATOM   8697  O OG1 . THR F  2 91  ? 13.621  31.592  58.667  1.00 67.42  ? 87  THR F OG1 1 
ATOM   8698  C CG2 . THR F  2 91  ? 12.102  31.164  60.489  1.00 65.85  ? 87  THR F CG2 1 
ATOM   8699  N N   . ALA F  2 92  ? 14.644  31.216  63.335  1.00 64.52  ? 88  ALA F N   1 
ATOM   8700  C CA  . ALA F  2 92  ? 14.721  30.399  64.533  1.00 63.62  ? 88  ALA F CA  1 
ATOM   8701  C C   . ALA F  2 92  ? 14.411  31.143  65.826  1.00 62.74  ? 88  ALA F C   1 
ATOM   8702  O O   . ALA F  2 92  ? 13.507  31.977  65.889  1.00 64.95  ? 88  ALA F O   1 
ATOM   8703  C CB  . ALA F  2 92  ? 16.106  29.754  64.619  1.00 62.71  ? 88  ALA F CB  1 
ATOM   8704  N N   . VAL F  2 93  ? 15.157  30.802  66.867  1.00 60.44  ? 89  VAL F N   1 
ATOM   8705  C CA  . VAL F  2 93  ? 14.999  31.416  68.167  1.00 56.68  ? 89  VAL F CA  1 
ATOM   8706  C C   . VAL F  2 93  ? 16.369  31.731  68.701  1.00 55.49  ? 89  VAL F C   1 
ATOM   8707  O O   . VAL F  2 93  ? 17.232  30.850  68.841  1.00 53.05  ? 89  VAL F O   1 
ATOM   8708  C CB  . VAL F  2 93  ? 14.307  30.495  69.153  1.00 55.95  ? 89  VAL F CB  1 
ATOM   8709  C CG1 . VAL F  2 93  ? 14.474  31.040  70.563  1.00 55.64  ? 89  VAL F CG1 1 
ATOM   8710  C CG2 . VAL F  2 93  ? 12.852  30.378  68.795  1.00 54.76  ? 89  VAL F CG2 1 
ATOM   8711  N N   . TYR F  2 94  ? 16.552  33.005  69.009  1.00 54.55  ? 90  TYR F N   1 
ATOM   8712  C CA  . TYR F  2 94  ? 17.816  33.474  69.515  1.00 54.10  ? 90  TYR F CA  1 
ATOM   8713  C C   . TYR F  2 94  ? 17.835  33.714  71.031  1.00 55.42  ? 90  TYR F C   1 
ATOM   8714  O O   . TYR F  2 94  ? 17.039  34.476  71.593  1.00 54.87  ? 90  TYR F O   1 
ATOM   8715  C CB  . TYR F  2 94  ? 18.246  34.711  68.721  1.00 50.52  ? 90  TYR F CB  1 
ATOM   8716  C CG  . TYR F  2 94  ? 18.469  34.403  67.256  1.00 46.08  ? 90  TYR F CG  1 
ATOM   8717  C CD1 . TYR F  2 94  ? 17.391  34.162  66.400  1.00 45.10  ? 90  TYR F CD1 1 
ATOM   8718  C CD2 . TYR F  2 94  ? 19.753  34.308  66.735  1.00 44.72  ? 90  TYR F CD2 1 
ATOM   8719  C CE1 . TYR F  2 94  ? 17.587  33.835  65.059  1.00 43.76  ? 90  TYR F CE1 1 
ATOM   8720  C CE2 . TYR F  2 94  ? 19.965  33.978  65.398  1.00 44.62  ? 90  TYR F CE2 1 
ATOM   8721  C CZ  . TYR F  2 94  ? 18.877  33.742  64.567  1.00 44.17  ? 90  TYR F CZ  1 
ATOM   8722  O OH  . TYR F  2 94  ? 19.083  33.401  63.255  1.00 42.77  ? 90  TYR F OH  1 
ATOM   8723  N N   . PHE F  2 95  ? 18.755  32.995  71.668  1.00 56.63  ? 91  PHE F N   1 
ATOM   8724  C CA  . PHE F  2 95  ? 18.979  33.030  73.096  1.00 58.10  ? 91  PHE F CA  1 
ATOM   8725  C C   . PHE F  2 95  ? 20.324  33.697  73.337  1.00 60.34  ? 91  PHE F C   1 
ATOM   8726  O O   . PHE F  2 95  ? 21.310  33.418  72.646  1.00 59.51  ? 91  PHE F O   1 
ATOM   8727  C CB  . PHE F  2 95  ? 19.041  31.605  73.663  1.00 56.92  ? 91  PHE F CB  1 
ATOM   8728  C CG  . PHE F  2 95  ? 17.761  30.825  73.530  1.00 55.21  ? 91  PHE F CG  1 
ATOM   8729  C CD1 . PHE F  2 95  ? 17.791  29.502  73.085  1.00 53.74  ? 91  PHE F CD1 1 
ATOM   8730  C CD2 . PHE F  2 95  ? 16.535  31.389  73.894  1.00 54.37  ? 91  PHE F CD2 1 
ATOM   8731  C CE1 . PHE F  2 95  ? 16.623  28.749  73.006  1.00 53.72  ? 91  PHE F CE1 1 
ATOM   8732  C CE2 . PHE F  2 95  ? 15.356  30.645  73.819  1.00 53.91  ? 91  PHE F CE2 1 
ATOM   8733  C CZ  . PHE F  2 95  ? 15.400  29.322  73.375  1.00 54.00  ? 91  PHE F CZ  1 
ATOM   8734  N N   . CYS F  2 96  ? 20.352  34.589  74.317  1.00 63.08  ? 92  CYS F N   1 
ATOM   8735  C CA  . CYS F  2 96  ? 21.571  35.277  74.694  1.00 64.96  ? 92  CYS F CA  1 
ATOM   8736  C C   . CYS F  2 96  ? 21.709  34.963  76.181  1.00 64.87  ? 92  CYS F C   1 
ATOM   8737  O O   . CYS F  2 96  ? 20.809  35.252  76.971  1.00 64.62  ? 92  CYS F O   1 
ATOM   8738  C CB  . CYS F  2 96  ? 21.440  36.785  74.425  1.00 67.79  ? 92  CYS F CB  1 
ATOM   8739  S SG  . CYS F  2 96  ? 19.843  37.534  74.905  1.00 72.34  ? 92  CYS F SG  1 
ATOM   8740  N N   . ALA F  2 97  ? 22.815  34.320  76.546  1.00 64.49  ? 93  ALA F N   1 
ATOM   8741  C CA  . ALA F  2 97  ? 23.054  33.948  77.928  1.00 63.79  ? 93  ALA F CA  1 
ATOM   8742  C C   . ALA F  2 97  ? 24.334  34.574  78.416  1.00 64.43  ? 93  ALA F C   1 
ATOM   8743  O O   . ALA F  2 97  ? 24.984  35.332  77.697  1.00 62.90  ? 93  ALA F O   1 
ATOM   8744  C CB  . ALA F  2 97  ? 23.136  32.443  78.055  1.00 62.94  ? 93  ALA F CB  1 
ATOM   8745  N N   . LYS F  2 98  ? 24.688  34.236  79.650  1.00 66.68  ? 94  LYS F N   1 
ATOM   8746  C CA  . LYS F  2 98  ? 25.891  34.740  80.309  1.00 68.51  ? 94  LYS F CA  1 
ATOM   8747  C C   . LYS F  2 98  ? 26.096  33.945  81.599  1.00 69.87  ? 94  LYS F C   1 
ATOM   8748  O O   . LYS F  2 98  ? 25.162  33.298  82.086  1.00 69.76  ? 94  LYS F O   1 
ATOM   8749  C CB  . LYS F  2 98  ? 25.730  36.247  80.612  1.00 68.29  ? 94  LYS F CB  1 
ATOM   8750  C CG  . LYS F  2 98  ? 26.462  36.761  81.853  1.00 67.11  ? 94  LYS F CG  1 
ATOM   8751  C CD  . LYS F  2 98  ? 25.787  36.244  83.126  1.00 67.04  ? 94  LYS F CD  1 
ATOM   8752  C CE  . LYS F  2 98  ? 26.791  35.980  84.239  1.00 65.36  ? 94  LYS F CE  1 
ATOM   8753  N NZ  . LYS F  2 98  ? 26.281  35.043  85.293  1.00 63.92  ? 94  LYS F NZ  1 
ATOM   8754  N N   . GLY F  2 99  ? 27.308  34.005  82.154  1.00 71.19  ? 95  GLY F N   1 
ATOM   8755  C CA  . GLY F  2 99  ? 27.599  33.288  83.387  1.00 72.51  ? 95  GLY F CA  1 
ATOM   8756  C C   . GLY F  2 99  ? 28.723  33.875  84.237  1.00 73.22  ? 95  GLY F C   1 
ATOM   8757  O O   . GLY F  2 99  ? 29.730  34.363  83.714  1.00 72.74  ? 95  GLY F O   1 
ATOM   8758  N N   . GLY F  2 100 ? 28.546  33.823  85.556  1.00 73.99  ? 96  GLY F N   1 
ATOM   8759  C CA  . GLY F  2 100 ? 29.551  34.343  86.468  1.00 74.34  ? 96  GLY F CA  1 
ATOM   8760  C C   . GLY F  2 100 ? 29.548  33.634  87.811  1.00 74.83  ? 96  GLY F C   1 
ATOM   8761  O O   . GLY F  2 100 ? 28.508  33.508  88.465  1.00 74.90  ? 96  GLY F O   1 
ATOM   8762  N N   . HIS F  2 114 J 33.315  27.974  84.264  1.00 80.97  ? 100 HIS F N   1 
ATOM   8763  C CA  . HIS F  2 114 J 32.447  28.551  83.244  1.00 82.10  ? 100 HIS F CA  1 
ATOM   8764  C C   . HIS F  2 114 J 30.989  28.197  83.509  1.00 82.65  ? 100 HIS F C   1 
ATOM   8765  O O   . HIS F  2 114 J 30.576  28.047  84.662  1.00 83.66  ? 100 HIS F O   1 
ATOM   8766  C CB  . HIS F  2 114 J 32.858  28.040  81.862  1.00 82.18  ? 100 HIS F CB  1 
ATOM   8767  C CG  . HIS F  2 114 J 33.955  28.832  81.219  1.00 82.34  ? 100 HIS F CG  1 
ATOM   8768  N ND1 . HIS F  2 114 J 33.737  30.052  80.613  1.00 81.76  ? 100 HIS F ND1 1 
ATOM   8769  C CD2 . HIS F  2 114 J 35.276  28.573  81.076  1.00 81.78  ? 100 HIS F CD2 1 
ATOM   8770  C CE1 . HIS F  2 114 J 34.876  30.507  80.123  1.00 82.00  ? 100 HIS F CE1 1 
ATOM   8771  N NE2 . HIS F  2 114 J 35.825  29.628  80.390  1.00 81.99  ? 100 HIS F NE2 1 
ATOM   8772  N N   . GLY F  2 115 K 30.211  28.076  82.436  1.00 82.79  ? 100 GLY F N   1 
ATOM   8773  C CA  . GLY F  2 115 K 28.808  27.715  82.569  1.00 82.26  ? 100 GLY F CA  1 
ATOM   8774  C C   . GLY F  2 115 K 27.852  28.866  82.356  1.00 81.27  ? 100 GLY F C   1 
ATOM   8775  O O   . GLY F  2 115 K 28.007  29.921  82.964  1.00 81.40  ? 100 GLY F O   1 
ATOM   8776  N N   . MET F  2 116 L 26.859  28.665  81.495  1.00 80.52  ? 100 MET F N   1 
ATOM   8777  C CA  . MET F  2 116 L 25.892  29.715  81.223  1.00 79.31  ? 100 MET F CA  1 
ATOM   8778  C C   . MET F  2 116 L 24.746  29.730  82.210  1.00 78.02  ? 100 MET F C   1 
ATOM   8779  O O   . MET F  2 116 L 23.746  29.025  82.073  1.00 76.40  ? 100 MET F O   1 
ATOM   8780  C CB  . MET F  2 116 L 25.375  29.621  79.792  1.00 80.06  ? 100 MET F CB  1 
ATOM   8781  C CG  . MET F  2 116 L 25.857  30.777  78.941  1.00 81.01  ? 100 MET F CG  1 
ATOM   8782  S SD  . MET F  2 116 L 25.614  30.511  77.194  1.00 84.67  ? 100 MET F SD  1 
ATOM   8783  C CE  . MET F  2 116 L 27.322  30.251  76.628  1.00 82.52  ? 100 MET F CE  1 
ATOM   8784  N N   . ASP F  2 117 ? 24.941  30.573  83.215  1.00 77.49  ? 101 ASP F N   1 
ATOM   8785  C CA  . ASP F  2 117 ? 24.014  30.796  84.306  1.00 76.50  ? 101 ASP F CA  1 
ATOM   8786  C C   . ASP F  2 117 ? 22.610  31.137  83.797  1.00 74.99  ? 101 ASP F C   1 
ATOM   8787  O O   . ASP F  2 117 ? 21.715  30.291  83.800  1.00 74.59  ? 101 ASP F O   1 
ATOM   8788  C CB  . ASP F  2 117 ? 24.571  31.937  85.175  1.00 77.60  ? 101 ASP F CB  1 
ATOM   8789  C CG  . ASP F  2 117 ? 24.310  31.738  86.665  1.00 78.56  ? 101 ASP F CG  1 
ATOM   8790  O OD1 . ASP F  2 117 ? 24.449  30.588  87.131  1.00 79.00  ? 101 ASP F OD1 1 
ATOM   8791  O OD2 . ASP F  2 117 ? 23.992  32.731  87.373  1.00 77.66  ? 101 ASP F OD2 1 
ATOM   8792  N N   . VAL F  2 118 ? 22.433  32.369  83.336  1.00 73.30  ? 102 VAL F N   1 
ATOM   8793  C CA  . VAL F  2 118 ? 21.134  32.829  82.866  1.00 73.49  ? 102 VAL F CA  1 
ATOM   8794  C C   . VAL F  2 118 ? 21.069  33.165  81.362  1.00 73.15  ? 102 VAL F C   1 
ATOM   8795  O O   . VAL F  2 118 ? 22.042  33.656  80.767  1.00 73.28  ? 102 VAL F O   1 
ATOM   8796  C CB  . VAL F  2 118 ? 20.700  34.057  83.714  1.00 74.49  ? 102 VAL F CB  1 
ATOM   8797  C CG1 . VAL F  2 118 ? 21.849  35.053  83.789  1.00 74.95  ? 102 VAL F CG1 1 
ATOM   8798  C CG2 . VAL F  2 118 ? 19.449  34.710  83.136  1.00 74.63  ? 102 VAL F CG2 1 
ATOM   8799  N N   . TRP F  2 119 ? 19.904  32.898  80.765  1.00 71.69  ? 103 TRP F N   1 
ATOM   8800  C CA  . TRP F  2 119 ? 19.652  33.141  79.335  1.00 69.28  ? 103 TRP F CA  1 
ATOM   8801  C C   . TRP F  2 119 ? 18.402  34.003  79.131  1.00 68.91  ? 103 TRP F C   1 
ATOM   8802  O O   . TRP F  2 119 ? 17.552  34.093  80.015  1.00 68.66  ? 103 TRP F O   1 
ATOM   8803  C CB  . TRP F  2 119 ? 19.379  31.829  78.597  1.00 66.71  ? 103 TRP F CB  1 
ATOM   8804  C CG  . TRP F  2 119 ? 20.189  30.638  78.990  1.00 62.65  ? 103 TRP F CG  1 
ATOM   8805  C CD1 . TRP F  2 119 ? 20.524  30.242  80.252  1.00 60.97  ? 103 TRP F CD1 1 
ATOM   8806  C CD2 . TRP F  2 119 ? 20.670  29.624  78.109  1.00 60.69  ? 103 TRP F CD2 1 
ATOM   8807  N NE1 . TRP F  2 119 ? 21.179  29.044  80.209  1.00 60.38  ? 103 TRP F NE1 1 
ATOM   8808  C CE2 . TRP F  2 119 ? 21.283  28.641  78.903  1.00 60.18  ? 103 TRP F CE2 1 
ATOM   8809  C CE3 . TRP F  2 119 ? 20.636  29.450  76.723  1.00 59.21  ? 103 TRP F CE3 1 
ATOM   8810  C CZ2 . TRP F  2 119 ? 21.859  27.495  78.356  1.00 58.94  ? 103 TRP F CZ2 1 
ATOM   8811  C CZ3 . TRP F  2 119 ? 21.205  28.318  76.186  1.00 58.67  ? 103 TRP F CZ3 1 
ATOM   8812  C CH2 . TRP F  2 119 ? 21.810  27.353  77.001  1.00 57.83  ? 103 TRP F CH2 1 
ATOM   8813  N N   . GLY F  2 120 ? 18.273  34.605  77.953  1.00 69.07  ? 104 GLY F N   1 
ATOM   8814  C CA  . GLY F  2 120 ? 17.090  35.404  77.667  1.00 70.04  ? 104 GLY F CA  1 
ATOM   8815  C C   . GLY F  2 120 ? 15.895  34.472  77.511  1.00 70.25  ? 104 GLY F C   1 
ATOM   8816  O O   . GLY F  2 120 ? 16.003  33.285  77.817  1.00 71.30  ? 104 GLY F O   1 
ATOM   8817  N N   . GLN F  2 121 ? 14.762  34.973  77.030  1.00 69.83  ? 105 GLN F N   1 
ATOM   8818  C CA  . GLN F  2 121 ? 13.588  34.117  76.876  1.00 70.09  ? 105 GLN F CA  1 
ATOM   8819  C C   . GLN F  2 121 ? 13.395  33.611  75.459  1.00 69.26  ? 105 GLN F C   1 
ATOM   8820  O O   . GLN F  2 121 ? 13.521  32.410  75.208  1.00 70.28  ? 105 GLN F O   1 
ATOM   8821  C CB  . GLN F  2 121 ? 12.312  34.838  77.334  1.00 71.99  ? 105 GLN F CB  1 
ATOM   8822  C CG  . GLN F  2 121 ? 11.872  36.000  76.447  1.00 74.88  ? 105 GLN F CG  1 
ATOM   8823  C CD  . GLN F  2 121 ? 12.895  37.130  76.381  1.00 77.13  ? 105 GLN F CD  1 
ATOM   8824  O OE1 . GLN F  2 121 ? 14.069  36.914  76.048  1.00 78.22  ? 105 GLN F OE1 1 
ATOM   8825  N NE2 . GLN F  2 121 ? 12.450  38.347  76.694  1.00 76.77  ? 105 GLN F NE2 1 
ATOM   8826  N N   . GLY F  2 122 ? 13.085  34.507  74.526  1.00 67.49  ? 106 GLY F N   1 
ATOM   8827  C CA  . GLY F  2 122 ? 12.886  34.046  73.166  1.00 66.31  ? 106 GLY F CA  1 
ATOM   8828  C C   . GLY F  2 122 ? 12.473  35.015  72.073  1.00 64.99  ? 106 GLY F C   1 
ATOM   8829  O O   . GLY F  2 122 ? 11.357  35.540  72.048  1.00 64.12  ? 106 GLY F O   1 
ATOM   8830  N N   . THR F  2 123 ? 13.403  35.232  71.153  1.00 64.36  ? 107 THR F N   1 
ATOM   8831  C CA  . THR F  2 123 ? 13.186  36.093  69.998  1.00 63.52  ? 107 THR F CA  1 
ATOM   8832  C C   . THR F  2 123 ? 13.087  35.075  68.852  1.00 63.37  ? 107 THR F C   1 
ATOM   8833  O O   . THR F  2 123 ? 14.066  34.381  68.552  1.00 63.06  ? 107 THR F O   1 
ATOM   8834  C CB  . THR F  2 123 ? 14.395  37.064  69.771  1.00 62.31  ? 107 THR F CB  1 
ATOM   8835  O OG1 . THR F  2 123 ? 14.537  37.949  70.895  1.00 59.51  ? 107 THR F OG1 1 
ATOM   8836  C CG2 . THR F  2 123 ? 14.184  37.891  68.518  1.00 60.49  ? 107 THR F CG2 1 
ATOM   8837  N N   . THR F  2 124 ? 11.903  34.968  68.241  1.00 62.26  ? 108 THR F N   1 
ATOM   8838  C CA  . THR F  2 124 ? 11.674  34.004  67.161  1.00 59.82  ? 108 THR F CA  1 
ATOM   8839  C C   . THR F  2 124 ? 11.759  34.533  65.743  1.00 59.16  ? 108 THR F C   1 
ATOM   8840  O O   . THR F  2 124 ? 10.744  34.860  65.133  1.00 60.13  ? 108 THR F O   1 
ATOM   8841  C CB  . THR F  2 124 ? 10.315  33.346  67.286  1.00 58.73  ? 108 THR F CB  1 
ATOM   8842  O OG1 . THR F  2 124 ? 9.673   33.794  68.484  1.00 59.37  ? 108 THR F OG1 1 
ATOM   8843  C CG2 . THR F  2 124 ? 10.474  31.851  67.310  1.00 58.35  ? 108 THR F CG2 1 
ATOM   8844  N N   . VAL F  2 125 ? 12.972  34.593  65.214  1.00 58.29  ? 109 VAL F N   1 
ATOM   8845  C CA  . VAL F  2 125 ? 13.189  35.057  63.854  1.00 57.16  ? 109 VAL F CA  1 
ATOM   8846  C C   . VAL F  2 125 ? 12.486  34.185  62.828  1.00 55.78  ? 109 VAL F C   1 
ATOM   8847  O O   . VAL F  2 125 ? 12.695  32.971  62.776  1.00 54.93  ? 109 VAL F O   1 
ATOM   8848  C CB  . VAL F  2 125 ? 14.682  35.057  63.477  1.00 57.76  ? 109 VAL F CB  1 
ATOM   8849  C CG1 . VAL F  2 125 ? 14.832  35.318  61.977  1.00 57.57  ? 109 VAL F CG1 1 
ATOM   8850  C CG2 . VAL F  2 125 ? 15.422  36.114  64.278  1.00 57.89  ? 109 VAL F CG2 1 
ATOM   8851  N N   . THR F  2 126 ? 11.652  34.822  62.018  1.00 54.00  ? 110 THR F N   1 
ATOM   8852  C CA  . THR F  2 126 ? 10.952  34.139  60.950  1.00 53.41  ? 110 THR F CA  1 
ATOM   8853  C C   . THR F  2 126 ? 11.395  34.894  59.691  1.00 53.56  ? 110 THR F C   1 
ATOM   8854  O O   . THR F  2 126 ? 11.102  36.068  59.514  1.00 54.42  ? 110 THR F O   1 
ATOM   8855  C CB  . THR F  2 126 ? 9.428   34.208  61.154  1.00 53.50  ? 110 THR F CB  1 
ATOM   8856  O OG1 . THR F  2 126 ? 9.108   33.688  62.450  1.00 52.53  ? 110 THR F OG1 1 
ATOM   8857  C CG2 . THR F  2 126 ? 8.696   33.382  60.093  1.00 50.76  ? 110 THR F CG2 1 
ATOM   8858  N N   . VAL F  2 127 ? 12.138  34.220  58.832  1.00 52.97  ? 111 VAL F N   1 
ATOM   8859  C CA  . VAL F  2 127 ? 12.643  34.852  57.641  1.00 52.61  ? 111 VAL F CA  1 
ATOM   8860  C C   . VAL F  2 127 ? 11.918  34.355  56.430  1.00 54.53  ? 111 VAL F C   1 
ATOM   8861  O O   . VAL F  2 127 ? 12.462  33.596  55.635  1.00 55.80  ? 111 VAL F O   1 
ATOM   8862  C CB  . VAL F  2 127 ? 14.134  34.587  57.498  1.00 51.21  ? 111 VAL F CB  1 
ATOM   8863  C CG1 . VAL F  2 127 ? 14.609  34.914  56.105  1.00 50.24  ? 111 VAL F CG1 1 
ATOM   8864  C CG2 . VAL F  2 127 ? 14.869  35.438  58.501  1.00 52.61  ? 111 VAL F CG2 1 
ATOM   8865  N N   . ALA F  2 128 ? 10.678  34.785  56.283  1.00 56.14  ? 112 ALA F N   1 
ATOM   8866  C CA  . ALA F  2 128 ? 9.912   34.356  55.136  1.00 58.80  ? 112 ALA F CA  1 
ATOM   8867  C C   . ALA F  2 128 ? 9.654   35.488  54.152  1.00 60.13  ? 112 ALA F C   1 
ATOM   8868  O O   . ALA F  2 128 ? 9.602   36.664  54.530  1.00 60.80  ? 112 ALA F O   1 
ATOM   8869  C CB  . ALA F  2 128 ? 8.595   33.752  55.589  1.00 59.54  ? 112 ALA F CB  1 
ATOM   8870  N N   . SER F  2 129 ? 9.516   35.116  52.883  1.00 60.38  ? 113 SER F N   1 
ATOM   8871  C CA  . SER F  2 129 ? 9.211   36.067  51.828  1.00 60.11  ? 113 SER F CA  1 
ATOM   8872  C C   . SER F  2 129 ? 7.702   36.017  51.807  1.00 59.67  ? 113 SER F C   1 
ATOM   8873  O O   . SER F  2 129 ? 7.032   36.961  51.409  1.00 60.62  ? 113 SER F O   1 
ATOM   8874  C CB  . SER F  2 129 ? 9.771   35.597  50.474  1.00 60.51  ? 113 SER F CB  1 
ATOM   8875  O OG  . SER F  2 129 ? 9.206   34.362  50.040  1.00 60.58  ? 113 SER F OG  1 
ATOM   8876  N N   . ALA F  2 130 ? 7.180   34.886  52.260  1.00 58.87  ? 114 ALA F N   1 
ATOM   8877  C CA  . ALA F  2 130 ? 5.752   34.671  52.306  1.00 58.39  ? 114 ALA F CA  1 
ATOM   8878  C C   . ALA F  2 130 ? 5.025   35.864  52.921  1.00 57.71  ? 114 ALA F C   1 
ATOM   8879  O O   . ALA F  2 130 ? 5.515   36.504  53.850  1.00 56.48  ? 114 ALA F O   1 
ATOM   8880  C CB  . ALA F  2 130 ? 5.458   33.412  53.093  1.00 58.99  ? 114 ALA F CB  1 
ATOM   8881  N N   . SER F  2 131 ? 3.854   36.164  52.380  1.00 57.97  ? 115 SER F N   1 
ATOM   8882  C CA  . SER F  2 131 ? 3.040   37.266  52.874  1.00 59.03  ? 115 SER F CA  1 
ATOM   8883  C C   . SER F  2 131 ? 2.037   36.781  53.916  1.00 57.86  ? 115 SER F C   1 
ATOM   8884  O O   . SER F  2 131 ? 1.494   35.687  53.785  1.00 58.85  ? 115 SER F O   1 
ATOM   8885  C CB  . SER F  2 131 ? 2.274   37.907  51.720  1.00 60.68  ? 115 SER F CB  1 
ATOM   8886  O OG  . SER F  2 131 ? 1.214   38.704  52.228  1.00 61.90  ? 115 SER F OG  1 
ATOM   8887  N N   . THR F  2 132 ? 1.778   37.586  54.941  1.00 55.44  ? 116 THR F N   1 
ATOM   8888  C CA  . THR F  2 132 ? 0.816   37.177  55.953  1.00 54.60  ? 116 THR F CA  1 
ATOM   8889  C C   . THR F  2 132 ? -0.409  36.596  55.271  1.00 54.58  ? 116 THR F C   1 
ATOM   8890  O O   . THR F  2 132 ? -0.999  37.225  54.388  1.00 55.35  ? 116 THR F O   1 
ATOM   8891  C CB  . THR F  2 132 ? 0.371   38.350  56.845  1.00 54.33  ? 116 THR F CB  1 
ATOM   8892  O OG1 . THR F  2 132 ? 1.431   38.681  57.753  1.00 57.04  ? 116 THR F OG1 1 
ATOM   8893  C CG2 . THR F  2 132 ? -0.874  37.973  57.649  1.00 52.82  ? 116 THR F CG2 1 
ATOM   8894  N N   . LYS F  2 133 ? -0.778  35.386  55.680  1.00 53.86  ? 117 LYS F N   1 
ATOM   8895  C CA  . LYS F  2 133 ? -1.922  34.691  55.114  1.00 52.48  ? 117 LYS F CA  1 
ATOM   8896  C C   . LYS F  2 133 ? -2.798  34.089  56.193  1.00 51.59  ? 117 LYS F C   1 
ATOM   8897  O O   . LYS F  2 133 ? -2.295  33.452  57.114  1.00 52.92  ? 117 LYS F O   1 
ATOM   8898  C CB  . LYS F  2 133 ? -1.441  33.572  54.208  1.00 52.90  ? 117 LYS F CB  1 
ATOM   8899  C CG  . LYS F  2 133 ? -2.554  32.819  53.520  1.00 56.70  ? 117 LYS F CG  1 
ATOM   8900  C CD  . LYS F  2 133 ? -2.058  31.488  52.930  1.00 59.67  ? 117 LYS F CD  1 
ATOM   8901  C CE  . LYS F  2 133 ? -3.146  30.777  52.122  1.00 61.53  ? 117 LYS F CE  1 
ATOM   8902  N NZ  . LYS F  2 133 ? -4.412  30.556  52.899  1.00 62.51  ? 117 LYS F NZ  1 
ATOM   8903  N N   . GLY F  2 134 ? -4.105  34.302  56.095  1.00 50.54  ? 118 GLY F N   1 
ATOM   8904  C CA  . GLY F  2 134 ? -5.011  33.708  57.062  1.00 48.60  ? 118 GLY F CA  1 
ATOM   8905  C C   . GLY F  2 134 ? -5.059  32.235  56.692  1.00 48.00  ? 118 GLY F C   1 
ATOM   8906  O O   . GLY F  2 134 ? -4.768  31.894  55.545  1.00 47.89  ? 118 GLY F O   1 
ATOM   8907  N N   . PRO F  2 135 ? -5.425  31.332  57.611  1.00 47.15  ? 119 PRO F N   1 
ATOM   8908  C CA  . PRO F  2 135 ? -5.457  29.911  57.245  1.00 46.38  ? 119 PRO F CA  1 
ATOM   8909  C C   . PRO F  2 135 ? -6.763  29.452  56.638  1.00 46.72  ? 119 PRO F C   1 
ATOM   8910  O O   . PRO F  2 135 ? -7.805  30.101  56.800  1.00 47.27  ? 119 PRO F O   1 
ATOM   8911  C CB  . PRO F  2 135 ? -5.215  29.225  58.568  1.00 46.18  ? 119 PRO F CB  1 
ATOM   8912  C CG  . PRO F  2 135 ? -6.052  30.093  59.490  1.00 46.65  ? 119 PRO F CG  1 
ATOM   8913  C CD  . PRO F  2 135 ? -5.712  31.512  59.045  1.00 46.26  ? 119 PRO F CD  1 
ATOM   8914  N N   . SER F  2 136 ? -6.699  28.321  55.942  1.00 45.70  ? 120 SER F N   1 
ATOM   8915  C CA  . SER F  2 136 ? -7.883  27.714  55.345  1.00 45.47  ? 120 SER F CA  1 
ATOM   8916  C C   . SER F  2 136 ? -8.097  26.441  56.158  1.00 44.93  ? 120 SER F C   1 
ATOM   8917  O O   . SER F  2 136 ? -7.151  25.687  56.345  1.00 48.05  ? 120 SER F O   1 
ATOM   8918  C CB  . SER F  2 136 ? -7.621  27.373  53.886  1.00 44.93  ? 120 SER F CB  1 
ATOM   8919  O OG  . SER F  2 136 ? -7.297  28.545  53.169  1.00 46.92  ? 120 SER F OG  1 
ATOM   8920  N N   . VAL F  2 137 ? -9.302  26.190  56.661  1.00 41.46  ? 121 VAL F N   1 
ATOM   8921  C CA  . VAL F  2 137 ? -9.497  24.985  57.453  1.00 39.15  ? 121 VAL F CA  1 
ATOM   8922  C C   . VAL F  2 137 ? -10.468 23.994  56.861  1.00 39.47  ? 121 VAL F C   1 
ATOM   8923  O O   . VAL F  2 137 ? -11.691 24.184  56.887  1.00 36.64  ? 121 VAL F O   1 
ATOM   8924  C CB  . VAL F  2 137 ? -9.952  25.325  58.847  1.00 39.27  ? 121 VAL F CB  1 
ATOM   8925  C CG1 . VAL F  2 137 ? -9.914  24.086  59.714  1.00 39.77  ? 121 VAL F CG1 1 
ATOM   8926  C CG2 . VAL F  2 137 ? -9.076  26.418  59.405  1.00 39.00  ? 121 VAL F CG2 1 
ATOM   8927  N N   . PHE F  2 138 ? -9.901  22.920  56.329  1.00 40.77  ? 122 PHE F N   1 
ATOM   8928  C CA  . PHE F  2 138 ? -10.680 21.856  55.701  1.00 42.95  ? 122 PHE F CA  1 
ATOM   8929  C C   . PHE F  2 138 ? -10.971 20.764  56.715  1.00 42.72  ? 122 PHE F C   1 
ATOM   8930  O O   . PHE F  2 138 ? -10.260 20.630  57.702  1.00 45.05  ? 122 PHE F O   1 
ATOM   8931  C CB  . PHE F  2 138 ? -9.898  21.292  54.528  1.00 42.86  ? 122 PHE F CB  1 
ATOM   8932  C CG  . PHE F  2 138 ? -9.475  22.338  53.539  1.00 44.74  ? 122 PHE F CG  1 
ATOM   8933  C CD1 . PHE F  2 138 ? -10.346 22.767  52.545  1.00 44.30  ? 122 PHE F CD1 1 
ATOM   8934  C CD2 . PHE F  2 138 ? -8.191  22.887  53.595  1.00 44.61  ? 122 PHE F CD2 1 
ATOM   8935  C CE1 . PHE F  2 138 ? -9.938  23.717  51.624  1.00 44.56  ? 122 PHE F CE1 1 
ATOM   8936  C CE2 . PHE F  2 138 ? -7.777  23.837  52.677  1.00 42.30  ? 122 PHE F CE2 1 
ATOM   8937  C CZ  . PHE F  2 138 ? -8.645  24.250  51.694  1.00 44.04  ? 122 PHE F CZ  1 
ATOM   8938  N N   . PRO F  2 139 ? -12.024 19.979  56.499  1.00 41.67  ? 123 PRO F N   1 
ATOM   8939  C CA  . PRO F  2 139 ? -12.249 18.956  57.515  1.00 42.25  ? 123 PRO F CA  1 
ATOM   8940  C C   . PRO F  2 139 ? -11.983 17.495  57.154  1.00 42.68  ? 123 PRO F C   1 
ATOM   8941  O O   . PRO F  2 139 ? -12.315 17.029  56.068  1.00 43.47  ? 123 PRO F O   1 
ATOM   8942  C CB  . PRO F  2 139 ? -13.701 19.194  57.895  1.00 43.22  ? 123 PRO F CB  1 
ATOM   8943  C CG  . PRO F  2 139 ? -14.321 19.489  56.572  1.00 43.54  ? 123 PRO F CG  1 
ATOM   8944  C CD  . PRO F  2 139 ? -13.298 20.396  55.888  1.00 42.91  ? 123 PRO F CD  1 
ATOM   8945  N N   . LEU F  2 140 ? -11.394 16.770  58.093  1.00 43.16  ? 124 LEU F N   1 
ATOM   8946  C CA  . LEU F  2 140 ? -11.120 15.354  57.903  1.00 45.14  ? 124 LEU F CA  1 
ATOM   8947  C C   . LEU F  2 140 ? -12.367 14.639  58.448  1.00 47.02  ? 124 LEU F C   1 
ATOM   8948  O O   . LEU F  2 140 ? -12.565 14.554  59.661  1.00 46.59  ? 124 LEU F O   1 
ATOM   8949  C CB  . LEU F  2 140 ? -9.879  14.967  58.704  1.00 43.31  ? 124 LEU F CB  1 
ATOM   8950  C CG  . LEU F  2 140 ? -8.834  16.073  58.774  1.00 40.81  ? 124 LEU F CG  1 
ATOM   8951  C CD1 . LEU F  2 140 ? -7.647  15.618  59.584  1.00 39.61  ? 124 LEU F CD1 1 
ATOM   8952  C CD2 . LEU F  2 140 ? -8.438  16.462  57.374  1.00 39.62  ? 124 LEU F CD2 1 
ATOM   8953  N N   . ALA F  2 141 ? -13.206 14.128  57.554  1.00 49.16  ? 125 ALA F N   1 
ATOM   8954  C CA  . ALA F  2 141 ? -14.446 13.477  57.964  1.00 52.45  ? 125 ALA F CA  1 
ATOM   8955  C C   . ALA F  2 141 ? -14.353 12.022  58.411  1.00 55.52  ? 125 ALA F C   1 
ATOM   8956  O O   . ALA F  2 141 ? -13.562 11.247  57.866  1.00 56.28  ? 125 ALA F O   1 
ATOM   8957  C CB  . ALA F  2 141 ? -15.456 13.589  56.855  1.00 53.85  ? 125 ALA F CB  1 
ATOM   8958  N N   . PRO F  2 142 ? -15.193 11.630  59.400  1.00 57.46  ? 126 PRO F N   1 
ATOM   8959  C CA  . PRO F  2 142 ? -15.278 10.288  59.984  1.00 59.01  ? 126 PRO F CA  1 
ATOM   8960  C C   . PRO F  2 142 ? -15.907 9.355   58.984  1.00 61.78  ? 126 PRO F C   1 
ATOM   8961  O O   . PRO F  2 142 ? -16.772 9.764   58.209  1.00 62.13  ? 126 PRO F O   1 
ATOM   8962  C CB  . PRO F  2 142 ? -16.197 10.472  61.182  1.00 57.92  ? 126 PRO F CB  1 
ATOM   8963  C CG  . PRO F  2 142 ? -16.205 11.938  61.433  1.00 58.75  ? 126 PRO F CG  1 
ATOM   8964  C CD  . PRO F  2 142 ? -16.164 12.515  60.055  1.00 58.09  ? 126 PRO F CD  1 
ATOM   8965  N N   . SER F  2 143 ? -15.475 8.103   59.014  1.00 65.13  ? 127 SER F N   1 
ATOM   8966  C CA  . SER F  2 143 ? -15.989 7.081   58.113  1.00 69.19  ? 127 SER F CA  1 
ATOM   8967  C C   . SER F  2 143 ? -16.002 5.763   58.872  1.00 71.61  ? 127 SER F C   1 
ATOM   8968  O O   . SER F  2 143 ? -16.227 5.745   60.088  1.00 72.20  ? 127 SER F O   1 
ATOM   8969  C CB  . SER F  2 143 ? -15.095 6.968   56.856  1.00 69.59  ? 127 SER F CB  1 
ATOM   8970  O OG  . SER F  2 143 ? -13.722 6.764   57.168  1.00 68.66  ? 127 SER F OG  1 
ATOM   8971  N N   . SER F  2 144 ? -15.778 4.670   58.146  1.00 73.35  ? 128 SER F N   1 
ATOM   8972  C CA  . SER F  2 144 ? -15.705 3.337   58.730  1.00 74.42  ? 128 SER F CA  1 
ATOM   8973  C C   . SER F  2 144 ? -14.272 2.911   58.440  1.00 75.35  ? 128 SER F C   1 
ATOM   8974  O O   . SER F  2 144 ? -13.804 1.864   58.894  1.00 74.21  ? 128 SER F O   1 
ATOM   8975  C CB  . SER F  2 144 ? -16.698 2.399   58.046  1.00 74.73  ? 128 SER F CB  1 
ATOM   8976  O OG  . SER F  2 144 ? -16.631 2.553   56.640  1.00 74.73  ? 128 SER F OG  1 
ATOM   8977  N N   . LYS F  2 145 ? -13.595 3.757   57.660  1.00 77.11  ? 129 LYS F N   1 
ATOM   8978  C CA  . LYS F  2 145 ? -12.195 3.572   57.276  1.00 79.26  ? 129 LYS F CA  1 
ATOM   8979  C C   . LYS F  2 145 ? -11.328 4.307   58.307  1.00 80.22  ? 129 LYS F C   1 
ATOM   8980  O O   . LYS F  2 145 ? -10.099 4.403   58.175  1.00 79.33  ? 129 LYS F O   1 
ATOM   8981  C CB  . LYS F  2 145 ? -11.942 4.150   55.877  1.00 79.54  ? 129 LYS F CB  1 
ATOM   8982  C CG  . LYS F  2 145 ? -12.226 3.202   54.705  1.00 79.54  ? 129 LYS F CG  1 
ATOM   8983  C CD  . LYS F  2 145 ? -11.130 2.149   54.532  1.00 79.76  ? 129 LYS F CD  1 
ATOM   8984  C CE  . LYS F  2 145 ? -11.356 1.313   53.271  1.00 79.86  ? 129 LYS F CE  1 
ATOM   8985  N NZ  . LYS F  2 145 ? -10.184 0.452   52.914  1.00 78.92  ? 129 LYS F NZ  1 
ATOM   8986  N N   . SER F  2 146 ? -11.998 4.822   59.336  1.00 81.52  ? 130 SER F N   1 
ATOM   8987  C CA  . SER F  2 146 ? -11.350 5.546   60.422  1.00 81.98  ? 130 SER F CA  1 
ATOM   8988  C C   . SER F  2 146 ? -12.092 5.221   61.708  1.00 82.01  ? 130 SER F C   1 
ATOM   8989  O O   . SER F  2 146 ? -12.449 6.112   62.468  1.00 81.78  ? 130 SER F O   1 
ATOM   8990  C CB  . SER F  2 146 ? -11.415 7.050   60.173  1.00 81.63  ? 130 SER F CB  1 
ATOM   8991  O OG  . SER F  2 146 ? -12.705 7.542   60.474  1.00 81.79  ? 130 SER F OG  1 
ATOM   8992  N N   . THR F  2 147 ? -12.309 3.934   61.954  1.00 83.09  ? 131 THR F N   1 
ATOM   8993  C CA  . THR F  2 147 ? -13.040 3.508   63.138  1.00 84.52  ? 131 THR F CA  1 
ATOM   8994  C C   . THR F  2 147 ? -12.706 2.106   63.653  1.00 84.72  ? 131 THR F C   1 
ATOM   8995  O O   . THR F  2 147 ? -13.147 1.110   63.080  1.00 84.71  ? 131 THR F O   1 
ATOM   8996  C CB  . THR F  2 147 ? -14.556 3.557   62.872  1.00 85.49  ? 131 THR F CB  1 
ATOM   8997  O OG1 . THR F  2 147 ? -14.860 2.760   61.715  1.00 86.32  ? 131 THR F OG1 1 
ATOM   8998  C CG2 . THR F  2 147 ? -15.018 5.002   62.646  1.00 85.64  ? 131 THR F CG2 1 
ATOM   8999  N N   . SER F  2 148 ? -11.947 2.034   64.747  1.00 85.25  ? 132 SER F N   1 
ATOM   9000  C CA  . SER F  2 148 ? -11.581 0.749   65.348  1.00 85.35  ? 132 SER F CA  1 
ATOM   9001  C C   . SER F  2 148 ? -12.500 0.438   66.543  1.00 84.19  ? 132 SER F C   1 
ATOM   9002  O O   . SER F  2 148 ? -12.363 1.026   67.623  1.00 84.35  ? 132 SER F O   1 
ATOM   9003  C CB  . SER F  2 148 ? -10.112 0.772   65.806  1.00 86.60  ? 132 SER F CB  1 
ATOM   9004  O OG  . SER F  2 148 ? -9.704  -0.494  66.314  1.00 87.69  ? 132 SER F OG  1 
ATOM   9005  N N   . GLY F  2 149 ? -13.436 -0.485  66.339  1.00 82.21  ? 133 GLY F N   1 
ATOM   9006  C CA  . GLY F  2 149 ? -14.359 -0.848  67.399  1.00 79.78  ? 133 GLY F CA  1 
ATOM   9007  C C   . GLY F  2 149 ? -15.325 0.280   67.721  1.00 78.04  ? 133 GLY F C   1 
ATOM   9008  O O   . GLY F  2 149 ? -16.236 0.577   66.933  1.00 77.82  ? 133 GLY F O   1 
ATOM   9009  N N   . GLY F  2 150 ? -15.122 0.911   68.878  1.00 75.42  ? 134 GLY F N   1 
ATOM   9010  C CA  . GLY F  2 150 ? -15.983 2.008   69.299  1.00 71.60  ? 134 GLY F CA  1 
ATOM   9011  C C   . GLY F  2 150 ? -15.368 3.390   69.143  1.00 68.53  ? 134 GLY F C   1 
ATOM   9012  O O   . GLY F  2 150 ? -15.899 4.373   69.664  1.00 67.68  ? 134 GLY F O   1 
ATOM   9013  N N   . THR F  2 151 ? -14.246 3.461   68.430  1.00 65.46  ? 135 THR F N   1 
ATOM   9014  C CA  . THR F  2 151 ? -13.566 4.726   68.198  1.00 62.82  ? 135 THR F CA  1 
ATOM   9015  C C   . THR F  2 151 ? -13.673 5.140   66.741  1.00 60.69  ? 135 THR F C   1 
ATOM   9016  O O   . THR F  2 151 ? -13.648 4.314   65.844  1.00 59.96  ? 135 THR F O   1 
ATOM   9017  C CB  . THR F  2 151 ? -12.060 4.663   68.521  1.00 63.38  ? 135 THR F CB  1 
ATOM   9018  O OG1 . THR F  2 151 ? -11.729 3.380   69.070  1.00 64.77  ? 135 THR F OG1 1 
ATOM   9019  C CG2 . THR F  2 151 ? -11.682 5.780   69.490  1.00 61.75  ? 135 THR F CG2 1 
ATOM   9020  N N   . ALA F  2 152 ? -13.775 6.442   66.525  1.00 58.89  ? 136 ALA F N   1 
ATOM   9021  C CA  . ALA F  2 152 ? -13.868 7.013   65.195  1.00 55.78  ? 136 ALA F CA  1 
ATOM   9022  C C   . ALA F  2 152 ? -12.979 8.252   65.164  1.00 53.60  ? 136 ALA F C   1 
ATOM   9023  O O   . ALA F  2 152 ? -13.146 9.169   65.967  1.00 54.09  ? 136 ALA F O   1 
ATOM   9024  C CB  . ALA F  2 152 ? -15.303 7.392   64.903  1.00 57.06  ? 136 ALA F CB  1 
ATOM   9025  N N   . ALA F  2 153 ? -12.023 8.281   64.249  1.00 49.55  ? 137 ALA F N   1 
ATOM   9026  C CA  . ALA F  2 153 ? -11.146 9.422   64.172  1.00 45.87  ? 137 ALA F CA  1 
ATOM   9027  C C   . ALA F  2 153 ? -11.641 10.457  63.173  1.00 44.39  ? 137 ALA F C   1 
ATOM   9028  O O   . ALA F  2 153 ? -12.248 10.126  62.151  1.00 41.84  ? 137 ALA F O   1 
ATOM   9029  C CB  . ALA F  2 153 ? -9.743  8.972   63.811  1.00 44.84  ? 137 ALA F CB  1 
ATOM   9030  N N   . LEU F  2 154 ? -11.389 11.719  63.508  1.00 43.72  ? 138 LEU F N   1 
ATOM   9031  C CA  . LEU F  2 154 ? -11.735 12.853  62.666  1.00 42.96  ? 138 LEU F CA  1 
ATOM   9032  C C   . LEU F  2 154 ? -10.762 13.975  62.950  1.00 42.80  ? 138 LEU F C   1 
ATOM   9033  O O   . LEU F  2 154 ? -9.867  13.831  63.776  1.00 41.36  ? 138 LEU F O   1 
ATOM   9034  C CB  . LEU F  2 154 ? -13.172 13.317  62.909  1.00 41.42  ? 138 LEU F CB  1 
ATOM   9035  C CG  . LEU F  2 154 ? -13.676 13.563  64.321  1.00 40.59  ? 138 LEU F CG  1 
ATOM   9036  C CD1 . LEU F  2 154 ? -13.355 14.985  64.772  1.00 40.30  ? 138 LEU F CD1 1 
ATOM   9037  C CD2 . LEU F  2 154 ? -15.172 13.318  64.322  1.00 38.76  ? 138 LEU F CD2 1 
ATOM   9038  N N   . GLY F  2 155 ? -10.925 15.084  62.240  1.00 44.08  ? 139 GLY F N   1 
ATOM   9039  C CA  . GLY F  2 155 ? -10.037 16.207  62.443  1.00 44.75  ? 139 GLY F CA  1 
ATOM   9040  C C   . GLY F  2 155 ? -10.198 17.388  61.511  1.00 44.69  ? 139 GLY F C   1 
ATOM   9041  O O   . GLY F  2 155 ? -11.120 17.483  60.710  1.00 44.24  ? 139 GLY F O   1 
ATOM   9042  N N   . CYS F  2 156 ? -9.260  18.303  61.639  1.00 46.12  ? 140 CYS F N   1 
ATOM   9043  C CA  . CYS F  2 156 ? -9.234  19.512  60.848  1.00 48.59  ? 140 CYS F CA  1 
ATOM   9044  C C   . CYS F  2 156 ? -7.877  19.657  60.144  1.00 48.52  ? 140 CYS F C   1 
ATOM   9045  O O   . CYS F  2 156 ? -6.825  19.278  60.673  1.00 49.74  ? 140 CYS F O   1 
ATOM   9046  C CB  . CYS F  2 156 ? -9.457  20.739  61.757  1.00 51.70  ? 140 CYS F CB  1 
ATOM   9047  S SG  . CYS F  2 156 ? -11.182 21.291  61.992  1.00 57.71  ? 140 CYS F SG  1 
ATOM   9048  N N   . LEU F  2 157 ? -7.895  20.181  58.933  1.00 45.82  ? 141 LEU F N   1 
ATOM   9049  C CA  . LEU F  2 157 ? -6.654  20.426  58.262  1.00 43.50  ? 141 LEU F CA  1 
ATOM   9050  C C   . LEU F  2 157 ? -6.616  21.948  58.229  1.00 42.92  ? 141 LEU F C   1 
ATOM   9051  O O   . LEU F  2 157 ? -7.499  22.605  57.666  1.00 43.09  ? 141 LEU F O   1 
ATOM   9052  C CB  . LEU F  2 157 ? -6.660  19.841  56.856  1.00 43.15  ? 141 LEU F CB  1 
ATOM   9053  C CG  . LEU F  2 157 ? -5.319  20.027  56.140  1.00 43.42  ? 141 LEU F CG  1 
ATOM   9054  C CD1 . LEU F  2 157 ? -4.185  19.443  56.966  1.00 42.54  ? 141 LEU F CD1 1 
ATOM   9055  C CD2 . LEU F  2 157 ? -5.385  19.368  54.785  1.00 43.40  ? 141 LEU F CD2 1 
ATOM   9056  N N   . VAL F  2 158 ? -5.619  22.505  58.891  1.00 41.54  ? 142 VAL F N   1 
ATOM   9057  C CA  . VAL F  2 158 ? -5.449  23.945  58.955  1.00 41.84  ? 142 VAL F CA  1 
ATOM   9058  C C   . VAL F  2 158 ? -4.267  24.245  58.058  1.00 42.66  ? 142 VAL F C   1 
ATOM   9059  O O   . VAL F  2 158 ? -3.158  24.489  58.530  1.00 43.84  ? 142 VAL F O   1 
ATOM   9060  C CB  . VAL F  2 158 ? -5.143  24.405  60.413  1.00 41.69  ? 142 VAL F CB  1 
ATOM   9061  C CG1 . VAL F  2 158 ? -4.985  25.925  60.490  1.00 40.50  ? 142 VAL F CG1 1 
ATOM   9062  C CG2 . VAL F  2 158 ? -6.252  23.944  61.329  1.00 41.58  ? 142 VAL F CG2 1 
ATOM   9063  N N   . LYS F  2 159 ? -4.508  24.215  56.753  1.00 43.40  ? 143 LYS F N   1 
ATOM   9064  C CA  . LYS F  2 159 ? -3.455  24.455  55.776  1.00 43.11  ? 143 LYS F CA  1 
ATOM   9065  C C   . LYS F  2 159 ? -3.271  25.917  55.322  1.00 44.71  ? 143 LYS F C   1 
ATOM   9066  O O   . LYS F  2 159 ? -4.232  26.695  55.248  1.00 44.99  ? 143 LYS F O   1 
ATOM   9067  C CB  . LYS F  2 159 ? -3.684  23.540  54.565  1.00 39.73  ? 143 LYS F CB  1 
ATOM   9068  C CG  . LYS F  2 159 ? -2.619  23.663  53.492  1.00 37.71  ? 143 LYS F CG  1 
ATOM   9069  C CD  . LYS F  2 159 ? -2.670  22.513  52.534  1.00 34.93  ? 143 LYS F CD  1 
ATOM   9070  C CE  . LYS F  2 159 ? -1.649  22.701  51.448  1.00 34.85  ? 143 LYS F CE  1 
ATOM   9071  N NZ  . LYS F  2 159 ? -2.056  23.772  50.505  1.00 33.07  ? 143 LYS F NZ  1 
ATOM   9072  N N   . ASP F  2 160 ? -2.012  26.270  55.056  1.00 46.11  ? 144 ASP F N   1 
ATOM   9073  C CA  . ASP F  2 160 ? -1.601  27.584  54.567  1.00 47.50  ? 144 ASP F CA  1 
ATOM   9074  C C   . ASP F  2 160 ? -1.924  28.857  55.321  1.00 47.93  ? 144 ASP F C   1 
ATOM   9075  O O   . ASP F  2 160 ? -3.017  29.400  55.210  1.00 46.69  ? 144 ASP F O   1 
ATOM   9076  C CB  . ASP F  2 160 ? -2.083  27.766  53.145  1.00 50.17  ? 144 ASP F CB  1 
ATOM   9077  C CG  . ASP F  2 160 ? -1.618  26.662  52.243  1.00 53.12  ? 144 ASP F CG  1 
ATOM   9078  O OD1 . ASP F  2 160 ? -0.388  26.404  52.217  1.00 54.92  ? 144 ASP F OD1 1 
ATOM   9079  O OD2 . ASP F  2 160 ? -2.486  26.058  51.565  1.00 54.05  ? 144 ASP F OD2 1 
ATOM   9080  N N   . TYR F  2 161 ? -0.930  29.332  56.064  1.00 49.50  ? 145 TYR F N   1 
ATOM   9081  C CA  . TYR F  2 161 ? -1.008  30.567  56.820  1.00 49.71  ? 145 TYR F CA  1 
ATOM   9082  C C   . TYR F  2 161 ? 0.400   30.963  57.225  1.00 50.10  ? 145 TYR F C   1 
ATOM   9083  O O   . TYR F  2 161 ? 1.291   30.122  57.323  1.00 48.53  ? 145 TYR F O   1 
ATOM   9084  C CB  . TYR F  2 161 ? -1.893  30.422  58.054  1.00 50.02  ? 145 TYR F CB  1 
ATOM   9085  C CG  . TYR F  2 161 ? -1.450  29.377  59.031  1.00 53.11  ? 145 TYR F CG  1 
ATOM   9086  C CD1 . TYR F  2 161 ? -1.704  29.521  60.392  1.00 53.87  ? 145 TYR F CD1 1 
ATOM   9087  C CD2 . TYR F  2 161 ? -0.788  28.224  58.604  1.00 56.33  ? 145 TYR F CD2 1 
ATOM   9088  C CE1 . TYR F  2 161 ? -1.303  28.544  61.307  1.00 55.75  ? 145 TYR F CE1 1 
ATOM   9089  C CE2 . TYR F  2 161 ? -0.390  27.229  59.516  1.00 57.03  ? 145 TYR F CE2 1 
ATOM   9090  C CZ  . TYR F  2 161 ? -0.648  27.399  60.863  1.00 56.38  ? 145 TYR F CZ  1 
ATOM   9091  O OH  . TYR F  2 161 ? -0.257  26.429  61.758  1.00 56.88  ? 145 TYR F OH  1 
ATOM   9092  N N   . PHE F  2 162 ? 0.592   32.261  57.422  1.00 52.52  ? 146 PHE F N   1 
ATOM   9093  C CA  . PHE F  2 162 ? 1.873   32.822  57.826  1.00 55.03  ? 146 PHE F CA  1 
ATOM   9094  C C   . PHE F  2 162 ? 1.583   34.077  58.648  1.00 56.68  ? 146 PHE F C   1 
ATOM   9095  O O   . PHE F  2 162 ? 0.732   34.878  58.275  1.00 57.29  ? 146 PHE F O   1 
ATOM   9096  C CB  . PHE F  2 162 ? 2.710   33.201  56.602  1.00 56.27  ? 146 PHE F CB  1 
ATOM   9097  C CG  . PHE F  2 162 ? 3.989   33.930  56.938  1.00 59.16  ? 146 PHE F CG  1 
ATOM   9098  C CD1 . PHE F  2 162 ? 5.020   33.289  57.610  1.00 59.32  ? 146 PHE F CD1 1 
ATOM   9099  C CD2 . PHE F  2 162 ? 4.149   35.272  56.606  1.00 60.69  ? 146 PHE F CD2 1 
ATOM   9100  C CE1 . PHE F  2 162 ? 6.180   33.971  57.945  1.00 58.86  ? 146 PHE F CE1 1 
ATOM   9101  C CE2 . PHE F  2 162 ? 5.314   35.960  56.942  1.00 59.52  ? 146 PHE F CE2 1 
ATOM   9102  C CZ  . PHE F  2 162 ? 6.322   35.306  57.610  1.00 59.28  ? 146 PHE F CZ  1 
ATOM   9103  N N   . PRO F  2 163 ? 2.281   34.253  59.793  1.00 58.00  ? 147 PRO F N   1 
ATOM   9104  C CA  . PRO F  2 163 ? 3.281   33.306  60.268  1.00 58.14  ? 147 PRO F CA  1 
ATOM   9105  C C   . PRO F  2 163 ? 2.675   32.541  61.420  1.00 59.07  ? 147 PRO F C   1 
ATOM   9106  O O   . PRO F  2 163 ? 1.518   32.755  61.788  1.00 58.57  ? 147 PRO F O   1 
ATOM   9107  C CB  . PRO F  2 163 ? 4.381   34.222  60.761  1.00 56.69  ? 147 PRO F CB  1 
ATOM   9108  C CG  . PRO F  2 163 ? 3.566   35.217  61.535  1.00 56.37  ? 147 PRO F CG  1 
ATOM   9109  C CD  . PRO F  2 163 ? 2.339   35.472  60.625  1.00 57.33  ? 147 PRO F CD  1 
ATOM   9110  N N   . GLU F  2 164 ? 3.470   31.650  61.992  1.00 60.65  ? 148 GLU F N   1 
ATOM   9111  C CA  . GLU F  2 164 ? 3.022   30.902  63.146  1.00 60.74  ? 148 GLU F CA  1 
ATOM   9112  C C   . GLU F  2 164 ? 2.791   31.992  64.182  1.00 59.70  ? 148 GLU F C   1 
ATOM   9113  O O   . GLU F  2 164 ? 3.262   33.118  64.020  1.00 60.32  ? 148 GLU F O   1 
ATOM   9114  C CB  . GLU F  2 164 ? 4.124   29.952  63.610  1.00 61.64  ? 148 GLU F CB  1 
ATOM   9115  C CG  . GLU F  2 164 ? 4.299   28.717  62.743  1.00 63.74  ? 148 GLU F CG  1 
ATOM   9116  C CD  . GLU F  2 164 ? 3.556   27.509  63.294  1.00 65.31  ? 148 GLU F CD  1 
ATOM   9117  O OE1 . GLU F  2 164 ? 2.305   27.530  63.384  1.00 63.95  ? 148 GLU F OE1 1 
ATOM   9118  O OE2 . GLU F  2 164 ? 4.243   26.530  63.648  1.00 67.82  ? 148 GLU F OE2 1 
ATOM   9119  N N   . PRO F  2 165 ? 2.053   31.687  65.250  1.00 59.09  ? 149 PRO F N   1 
ATOM   9120  C CA  . PRO F  2 165 ? 1.444   30.383  65.494  1.00 57.93  ? 149 PRO F CA  1 
ATOM   9121  C C   . PRO F  2 165 ? -0.056  30.491  65.346  1.00 56.62  ? 149 PRO F C   1 
ATOM   9122  O O   . PRO F  2 165 ? -0.593  31.581  65.147  1.00 56.88  ? 149 PRO F O   1 
ATOM   9123  C CB  . PRO F  2 165 ? 1.847   30.099  66.922  1.00 59.29  ? 149 PRO F CB  1 
ATOM   9124  C CG  . PRO F  2 165 ? 1.670   31.457  67.551  1.00 58.94  ? 149 PRO F CG  1 
ATOM   9125  C CD  . PRO F  2 165 ? 2.260   32.409  66.521  1.00 59.23  ? 149 PRO F CD  1 
ATOM   9126  N N   . VAL F  2 166 ? -0.728  29.356  65.440  1.00 54.77  ? 150 VAL F N   1 
ATOM   9127  C CA  . VAL F  2 166 ? -2.172  29.335  65.340  1.00 54.02  ? 150 VAL F CA  1 
ATOM   9128  C C   . VAL F  2 166 ? -2.620  28.469  66.505  1.00 54.07  ? 150 VAL F C   1 
ATOM   9129  O O   . VAL F  2 166 ? -1.802  27.760  67.091  1.00 55.02  ? 150 VAL F O   1 
ATOM   9130  C CB  . VAL F  2 166 ? -2.624  28.717  64.000  1.00 53.31  ? 150 VAL F CB  1 
ATOM   9131  C CG1 . VAL F  2 166 ? -2.632  27.202  64.085  1.00 52.47  ? 150 VAL F CG1 1 
ATOM   9132  C CG2 . VAL F  2 166 ? -3.981  29.257  63.610  1.00 54.04  ? 150 VAL F CG2 1 
ATOM   9133  N N   . THR F  2 167 ? -3.897  28.525  66.856  1.00 53.77  ? 151 THR F N   1 
ATOM   9134  C CA  . THR F  2 167 ? -4.387  27.714  67.962  1.00 54.40  ? 151 THR F CA  1 
ATOM   9135  C C   . THR F  2 167 ? -5.642  26.932  67.578  1.00 53.61  ? 151 THR F C   1 
ATOM   9136  O O   . THR F  2 167 ? -6.556  27.461  66.946  1.00 51.68  ? 151 THR F O   1 
ATOM   9137  C CB  . THR F  2 167 ? -4.677  28.587  69.229  1.00 55.49  ? 151 THR F CB  1 
ATOM   9138  O OG1 . THR F  2 167 ? -5.881  29.350  69.047  1.00 56.98  ? 151 THR F OG1 1 
ATOM   9139  C CG2 . THR F  2 167 ? -3.515  29.542  69.495  1.00 55.25  ? 151 THR F CG2 1 
ATOM   9140  N N   . VAL F  2 168 ? -5.672  25.661  67.958  1.00 54.15  ? 152 VAL F N   1 
ATOM   9141  C CA  . VAL F  2 168 ? -6.818  24.821  67.654  1.00 55.53  ? 152 VAL F CA  1 
ATOM   9142  C C   . VAL F  2 168 ? -7.488  24.326  68.927  1.00 56.78  ? 152 VAL F C   1 
ATOM   9143  O O   . VAL F  2 168 ? -6.826  24.162  69.958  1.00 56.86  ? 152 VAL F O   1 
ATOM   9144  C CB  . VAL F  2 168 ? -6.410  23.597  66.813  1.00 54.70  ? 152 VAL F CB  1 
ATOM   9145  C CG1 . VAL F  2 168 ? -7.653  22.875  66.289  1.00 53.72  ? 152 VAL F CG1 1 
ATOM   9146  C CG2 . VAL F  2 168 ? -5.523  24.041  65.680  1.00 54.35  ? 152 VAL F CG2 1 
ATOM   9147  N N   . SER F  2 169 ? -8.801  24.093  68.838  1.00 57.47  ? 153 SER F N   1 
ATOM   9148  C CA  . SER F  2 169 ? -9.604  23.597  69.952  1.00 57.41  ? 153 SER F CA  1 
ATOM   9149  C C   . SER F  2 169 ? -10.796 22.851  69.384  1.00 57.38  ? 153 SER F C   1 
ATOM   9150  O O   . SER F  2 169 ? -10.884 22.637  68.175  1.00 56.22  ? 153 SER F O   1 
ATOM   9151  C CB  . SER F  2 169 ? -10.133 24.746  70.793  1.00 58.05  ? 153 SER F CB  1 
ATOM   9152  O OG  . SER F  2 169 ? -11.378 25.180  70.278  1.00 60.34  ? 153 SER F OG  1 
ATOM   9153  N N   . TRP F  2 170 ? -11.713 22.461  70.263  1.00 58.03  ? 154 TRP F N   1 
ATOM   9154  C CA  . TRP F  2 170 ? -12.919 21.769  69.830  1.00 58.57  ? 154 TRP F CA  1 
ATOM   9155  C C   . TRP F  2 170 ? -14.147 22.153  70.651  1.00 59.95  ? 154 TRP F C   1 
ATOM   9156  O O   . TRP F  2 170 ? -14.057 22.458  71.842  1.00 59.28  ? 154 TRP F O   1 
ATOM   9157  C CB  . TRP F  2 170 ? -12.730 20.245  69.852  1.00 56.71  ? 154 TRP F CB  1 
ATOM   9158  C CG  . TRP F  2 170 ? -11.844 19.746  68.749  1.00 54.98  ? 154 TRP F CG  1 
ATOM   9159  C CD1 . TRP F  2 170 ? -10.482 19.686  68.761  1.00 54.44  ? 154 TRP F CD1 1 
ATOM   9160  C CD2 . TRP F  2 170 ? -12.253 19.307  67.447  1.00 53.46  ? 154 TRP F CD2 1 
ATOM   9161  N NE1 . TRP F  2 170 ? -10.018 19.240  67.552  1.00 53.64  ? 154 TRP F NE1 1 
ATOM   9162  C CE2 . TRP F  2 170 ? -11.082 19.000  66.724  1.00 53.51  ? 154 TRP F CE2 1 
ATOM   9163  C CE3 . TRP F  2 170 ? -13.494 19.147  66.819  1.00 52.28  ? 154 TRP F CE3 1 
ATOM   9164  C CZ2 . TRP F  2 170 ? -11.113 18.539  65.397  1.00 53.37  ? 154 TRP F CZ2 1 
ATOM   9165  C CZ3 . TRP F  2 170 ? -13.526 18.691  65.497  1.00 52.23  ? 154 TRP F CZ3 1 
ATOM   9166  C CH2 . TRP F  2 170 ? -12.341 18.393  64.804  1.00 52.91  ? 154 TRP F CH2 1 
ATOM   9167  N N   . ASN F  2 171 ? -15.297 22.135  69.981  1.00 61.52  ? 155 ASN F N   1 
ATOM   9168  C CA  . ASN F  2 171 ? -16.570 22.480  70.588  1.00 62.25  ? 155 ASN F CA  1 
ATOM   9169  C C   . ASN F  2 171 ? -16.404 23.664  71.514  1.00 62.46  ? 155 ASN F C   1 
ATOM   9170  O O   . ASN F  2 171 ? -16.867 23.650  72.647  1.00 63.33  ? 155 ASN F O   1 
ATOM   9171  C CB  . ASN F  2 171 ? -17.135 21.293  71.365  1.00 63.52  ? 155 ASN F CB  1 
ATOM   9172  C CG  . ASN F  2 171 ? -17.222 20.039  70.525  1.00 65.18  ? 155 ASN F CG  1 
ATOM   9173  O OD1 . ASN F  2 171 ? -17.607 20.083  69.349  1.00 65.28  ? 155 ASN F OD1 1 
ATOM   9174  N ND2 . ASN F  2 171 ? -16.869 18.905  71.125  1.00 65.61  ? 155 ASN F ND2 1 
ATOM   9175  N N   . SER F  2 172 ? -15.721 24.689  71.027  1.00 62.58  ? 156 SER F N   1 
ATOM   9176  C CA  . SER F  2 172 ? -15.508 25.902  71.800  1.00 62.68  ? 156 SER F CA  1 
ATOM   9177  C C   . SER F  2 172 ? -14.717 25.707  73.087  1.00 62.84  ? 156 SER F C   1 
ATOM   9178  O O   . SER F  2 172 ? -14.893 26.456  74.039  1.00 63.92  ? 156 SER F O   1 
ATOM   9179  C CB  . SER F  2 172 ? -16.855 26.545  72.127  1.00 62.05  ? 156 SER F CB  1 
ATOM   9180  O OG  . SER F  2 172 ? -17.598 26.781  70.942  1.00 62.71  ? 156 SER F OG  1 
ATOM   9181  N N   . GLY F  2 173 ? -13.843 24.709  73.123  1.00 62.77  ? 157 GLY F N   1 
ATOM   9182  C CA  . GLY F  2 173 ? -13.050 24.491  74.320  1.00 60.94  ? 157 GLY F CA  1 
ATOM   9183  C C   . GLY F  2 173 ? -13.386 23.216  75.066  1.00 60.10  ? 157 GLY F C   1 
ATOM   9184  O O   . GLY F  2 173 ? -12.516 22.616  75.701  1.00 60.64  ? 157 GLY F O   1 
ATOM   9185  N N   . ALA F  2 174 ? -14.646 22.801  74.981  1.00 58.66  ? 158 ALA F N   1 
ATOM   9186  C CA  . ALA F  2 174 ? -15.122 21.601  75.660  1.00 57.62  ? 158 ALA F CA  1 
ATOM   9187  C C   . ALA F  2 174 ? -14.244 20.375  75.414  1.00 57.33  ? 158 ALA F C   1 
ATOM   9188  O O   . ALA F  2 174 ? -13.310 20.094  76.161  1.00 56.76  ? 158 ALA F O   1 
ATOM   9189  C CB  . ALA F  2 174 ? -16.562 21.302  75.237  1.00 56.78  ? 158 ALA F CB  1 
ATOM   9190  N N   . LEU F  2 175 ? -14.569 19.646  74.357  1.00 57.58  ? 159 LEU F N   1 
ATOM   9191  C CA  . LEU F  2 175 ? -13.855 18.440  73.973  1.00 57.19  ? 159 LEU F CA  1 
ATOM   9192  C C   . LEU F  2 175 ? -12.323 18.591  74.038  1.00 57.62  ? 159 LEU F C   1 
ATOM   9193  O O   . LEU F  2 175 ? -11.722 19.337  73.254  1.00 58.56  ? 159 LEU F O   1 
ATOM   9194  C CB  . LEU F  2 175 ? -14.313 18.052  72.568  1.00 55.24  ? 159 LEU F CB  1 
ATOM   9195  C CG  . LEU F  2 175 ? -13.866 16.731  71.976  1.00 54.93  ? 159 LEU F CG  1 
ATOM   9196  C CD1 . LEU F  2 175 ? -14.200 15.585  72.914  1.00 55.12  ? 159 LEU F CD1 1 
ATOM   9197  C CD2 . LEU F  2 175 ? -14.544 16.570  70.641  1.00 53.86  ? 159 LEU F CD2 1 
ATOM   9198  N N   . THR F  2 176 ? -11.701 17.889  74.989  1.00 57.84  ? 160 THR F N   1 
ATOM   9199  C CA  . THR F  2 176 ? -10.236 17.922  75.161  1.00 56.90  ? 160 THR F CA  1 
ATOM   9200  C C   . THR F  2 176 ? -9.674  16.528  75.424  1.00 54.89  ? 160 THR F C   1 
ATOM   9201  O O   . THR F  2 176 ? -8.461  16.320  75.376  1.00 53.62  ? 160 THR F O   1 
ATOM   9202  C CB  . THR F  2 176 ? -9.777  18.854  76.337  1.00 57.47  ? 160 THR F CB  1 
ATOM   9203  O OG1 . THR F  2 176 ? -10.153 18.285  77.599  1.00 58.08  ? 160 THR F OG1 1 
ATOM   9204  C CG2 . THR F  2 176 ? -10.386 20.243  76.189  1.00 57.70  ? 160 THR F CG2 1 
ATOM   9205  N N   . SER F  2 177 ? -10.560 15.582  75.710  1.00 53.37  ? 161 SER F N   1 
ATOM   9206  C CA  . SER F  2 177 ? -10.131 14.217  75.956  1.00 52.59  ? 161 SER F CA  1 
ATOM   9207  C C   . SER F  2 177 ? -10.082 13.484  74.625  1.00 51.85  ? 161 SER F C   1 
ATOM   9208  O O   . SER F  2 177 ? -11.124 13.290  73.985  1.00 53.05  ? 161 SER F O   1 
ATOM   9209  C CB  . SER F  2 177 ? -11.107 13.504  76.894  1.00 53.44  ? 161 SER F CB  1 
ATOM   9210  O OG  . SER F  2 177 ? -10.692 12.168  77.154  1.00 51.94  ? 161 SER F OG  1 
ATOM   9211  N N   . GLY F  2 178 ? -8.875  13.103  74.205  1.00 49.61  ? 162 GLY F N   1 
ATOM   9212  C CA  . GLY F  2 178 ? -8.710  12.378  72.958  1.00 46.77  ? 162 GLY F CA  1 
ATOM   9213  C C   . GLY F  2 178 ? -8.297  13.192  71.751  1.00 44.91  ? 162 GLY F C   1 
ATOM   9214  O O   . GLY F  2 178 ? -8.502  12.748  70.627  1.00 45.07  ? 162 GLY F O   1 
ATOM   9215  N N   . VAL F  2 179 ? -7.713  14.365  71.980  1.00 43.67  ? 163 VAL F N   1 
ATOM   9216  C CA  . VAL F  2 179 ? -7.262  15.266  70.910  1.00 42.83  ? 163 VAL F CA  1 
ATOM   9217  C C   . VAL F  2 179 ? -5.777  15.087  70.590  1.00 42.58  ? 163 VAL F C   1 
ATOM   9218  O O   . VAL F  2 179 ? -5.017  14.568  71.408  1.00 44.20  ? 163 VAL F O   1 
ATOM   9219  C CB  . VAL F  2 179 ? -7.495  16.748  71.305  1.00 42.37  ? 163 VAL F CB  1 
ATOM   9220  C CG1 . VAL F  2 179 ? -6.795  17.689  70.334  1.00 40.75  ? 163 VAL F CG1 1 
ATOM   9221  C CG2 . VAL F  2 179 ? -8.985  17.036  71.326  1.00 44.45  ? 163 VAL F CG2 1 
ATOM   9222  N N   . HIS F  2 180 ? -5.376  15.526  69.398  1.00 41.15  ? 164 HIS F N   1 
ATOM   9223  C CA  . HIS F  2 180 ? -3.993  15.444  68.932  1.00 38.49  ? 164 HIS F CA  1 
ATOM   9224  C C   . HIS F  2 180 ? -3.746  16.538  67.917  1.00 37.55  ? 164 HIS F C   1 
ATOM   9225  O O   . HIS F  2 180 ? -4.135  16.413  66.759  1.00 39.22  ? 164 HIS F O   1 
ATOM   9226  C CB  . HIS F  2 180 ? -3.735  14.097  68.268  1.00 38.03  ? 164 HIS F CB  1 
ATOM   9227  C CG  . HIS F  2 180 ? -3.106  13.092  69.172  1.00 38.70  ? 164 HIS F CG  1 
ATOM   9228  N ND1 . HIS F  2 180 ? -3.637  11.836  69.369  1.00 38.02  ? 164 HIS F ND1 1 
ATOM   9229  C CD2 . HIS F  2 180 ? -1.971  13.145  69.910  1.00 39.13  ? 164 HIS F CD2 1 
ATOM   9230  C CE1 . HIS F  2 180 ? -2.855  11.156  70.188  1.00 38.73  ? 164 HIS F CE1 1 
ATOM   9231  N NE2 . HIS F  2 180 ? -1.838  11.927  70.531  1.00 40.16  ? 164 HIS F NE2 1 
ATOM   9232  N N   . THR F  2 181 ? -3.102  17.616  68.335  1.00 35.13  ? 165 THR F N   1 
ATOM   9233  C CA  . THR F  2 181 ? -2.828  18.706  67.405  1.00 33.54  ? 165 THR F CA  1 
ATOM   9234  C C   . THR F  2 181 ? -1.359  18.703  66.991  1.00 31.86  ? 165 THR F C   1 
ATOM   9235  O O   . THR F  2 181 ? -0.510  19.287  67.655  1.00 32.57  ? 165 THR F O   1 
ATOM   9236  C CB  . THR F  2 181 ? -3.221  20.047  68.042  1.00 33.55  ? 165 THR F CB  1 
ATOM   9237  O OG1 . THR F  2 181 ? -4.620  20.015  68.353  1.00 36.90  ? 165 THR F OG1 1 
ATOM   9238  C CG2 . THR F  2 181 ? -2.960  21.197  67.103  1.00 32.46  ? 165 THR F CG2 1 
ATOM   9239  N N   . PHE F  2 182 ? -1.059  18.042  65.882  1.00 29.62  ? 166 PHE F N   1 
ATOM   9240  C CA  . PHE F  2 182 ? 0.317   17.952  65.420  1.00 28.67  ? 166 PHE F CA  1 
ATOM   9241  C C   . PHE F  2 182 ? 1.048   19.274  65.270  1.00 28.19  ? 166 PHE F C   1 
ATOM   9242  O O   . PHE F  2 182 ? 0.448   20.347  65.250  1.00 26.40  ? 166 PHE F O   1 
ATOM   9243  C CB  . PHE F  2 182 ? 0.384   17.176  64.107  1.00 28.81  ? 166 PHE F CB  1 
ATOM   9244  C CG  . PHE F  2 182 ? -0.267  15.821  64.178  1.00 29.10  ? 166 PHE F CG  1 
ATOM   9245  C CD1 . PHE F  2 182 ? -1.655  15.697  64.114  1.00 28.14  ? 166 PHE F CD1 1 
ATOM   9246  C CD2 . PHE F  2 182 ? 0.504   14.675  64.357  1.00 27.50  ? 166 PHE F CD2 1 
ATOM   9247  C CE1 . PHE F  2 182 ? -2.259  14.457  64.228  1.00 27.50  ? 166 PHE F CE1 1 
ATOM   9248  C CE2 . PHE F  2 182 ? -0.092  13.434  64.474  1.00 26.94  ? 166 PHE F CE2 1 
ATOM   9249  C CZ  . PHE F  2 182 ? -1.477  13.323  64.410  1.00 27.46  ? 166 PHE F CZ  1 
ATOM   9250  N N   . PRO F  2 183 ? 2.379   19.207  65.192  1.00 29.19  ? 167 PRO F N   1 
ATOM   9251  C CA  . PRO F  2 183 ? 3.236   20.384  65.048  1.00 30.14  ? 167 PRO F CA  1 
ATOM   9252  C C   . PRO F  2 183 ? 3.118   20.927  63.653  1.00 31.14  ? 167 PRO F C   1 
ATOM   9253  O O   . PRO F  2 183 ? 3.360   20.202  62.706  1.00 32.08  ? 167 PRO F O   1 
ATOM   9254  C CB  . PRO F  2 183 ? 4.622   19.828  65.299  1.00 29.79  ? 167 PRO F CB  1 
ATOM   9255  C CG  . PRO F  2 183 ? 4.361   18.675  66.191  1.00 29.48  ? 167 PRO F CG  1 
ATOM   9256  C CD  . PRO F  2 183 ? 3.186   18.034  65.549  1.00 29.32  ? 167 PRO F CD  1 
ATOM   9257  N N   . ALA F  2 184 ? 2.731   22.191  63.523  1.00 31.83  ? 168 ALA F N   1 
ATOM   9258  C CA  . ALA F  2 184 ? 2.593   22.802  62.208  1.00 29.59  ? 168 ALA F CA  1 
ATOM   9259  C C   . ALA F  2 184 ? 3.836   22.434  61.444  1.00 28.77  ? 168 ALA F C   1 
ATOM   9260  O O   . ALA F  2 184 ? 4.922   22.442  62.018  1.00 27.98  ? 168 ALA F O   1 
ATOM   9261  C CB  . ALA F  2 184 ? 2.507   24.309  62.346  1.00 30.18  ? 168 ALA F CB  1 
ATOM   9262  N N   . VAL F  2 185 ? 3.677   22.073  60.173  1.00 27.92  ? 169 VAL F N   1 
ATOM   9263  C CA  . VAL F  2 185 ? 4.816   21.726  59.321  1.00 28.57  ? 169 VAL F CA  1 
ATOM   9264  C C   . VAL F  2 185 ? 4.925   22.769  58.231  1.00 30.92  ? 169 VAL F C   1 
ATOM   9265  O O   . VAL F  2 185 ? 3.912   23.213  57.666  1.00 31.27  ? 169 VAL F O   1 
ATOM   9266  C CB  . VAL F  2 185 ? 4.669   20.337  58.631  1.00 27.94  ? 169 VAL F CB  1 
ATOM   9267  C CG1 . VAL F  2 185 ? 5.517   20.289  57.358  1.00 28.09  ? 169 VAL F CG1 1 
ATOM   9268  C CG2 . VAL F  2 185 ? 5.121   19.227  59.561  1.00 26.99  ? 169 VAL F CG2 1 
ATOM   9269  N N   . LEU F  2 186 ? 6.155   23.167  57.940  1.00 33.14  ? 170 LEU F N   1 
ATOM   9270  C CA  . LEU F  2 186 ? 6.381   24.142  56.897  1.00 35.62  ? 170 LEU F CA  1 
ATOM   9271  C C   . LEU F  2 186 ? 6.366   23.449  55.533  1.00 38.89  ? 170 LEU F C   1 
ATOM   9272  O O   . LEU F  2 186 ? 7.106   22.475  55.278  1.00 40.01  ? 170 LEU F O   1 
ATOM   9273  C CB  . LEU F  2 186 ? 7.700   24.870  57.107  1.00 34.74  ? 170 LEU F CB  1 
ATOM   9274  C CG  . LEU F  2 186 ? 7.988   25.929  56.052  1.00 34.15  ? 170 LEU F CG  1 
ATOM   9275  C CD1 . LEU F  2 186 ? 6.748   26.763  55.832  1.00 36.78  ? 170 LEU F CD1 1 
ATOM   9276  C CD2 . LEU F  2 186 ? 9.136   26.801  56.490  1.00 34.55  ? 170 LEU F CD2 1 
ATOM   9277  N N   . GLN F  2 187 ? 5.498   23.976  54.670  1.00 40.31  ? 171 GLN F N   1 
ATOM   9278  C CA  . GLN F  2 187 ? 5.288   23.478  53.333  1.00 40.77  ? 171 GLN F CA  1 
ATOM   9279  C C   . GLN F  2 187 ? 6.279   23.956  52.294  1.00 43.42  ? 171 GLN F C   1 
ATOM   9280  O O   . GLN F  2 187 ? 6.996   24.946  52.456  1.00 43.45  ? 171 GLN F O   1 
ATOM   9281  C CB  . GLN F  2 187 ? 3.907   23.876  52.858  1.00 39.60  ? 171 GLN F CB  1 
ATOM   9282  C CG  . GLN F  2 187 ? 2.786   23.434  53.741  1.00 40.36  ? 171 GLN F CG  1 
ATOM   9283  C CD  . GLN F  2 187 ? 1.444   23.808  53.154  1.00 40.87  ? 171 GLN F CD  1 
ATOM   9284  O OE1 . GLN F  2 187 ? 1.134   23.461  52.015  1.00 40.63  ? 171 GLN F OE1 1 
ATOM   9285  N NE2 . GLN F  2 187 ? 0.638   24.521  53.929  1.00 42.44  ? 171 GLN F NE2 1 
ATOM   9286  N N   . SER F  2 188 ? 6.284   23.223  51.197  1.00 46.44  ? 172 SER F N   1 
ATOM   9287  C CA  . SER F  2 188 ? 7.122   23.530  50.065  1.00 49.99  ? 172 SER F CA  1 
ATOM   9288  C C   . SER F  2 188 ? 6.877   25.001  49.672  1.00 51.68  ? 172 SER F C   1 
ATOM   9289  O O   . SER F  2 188 ? 7.814   25.777  49.496  1.00 52.35  ? 172 SER F O   1 
ATOM   9290  C CB  . SER F  2 188 ? 6.747   22.569  48.924  1.00 50.50  ? 172 SER F CB  1 
ATOM   9291  O OG  . SER F  2 188 ? 5.380   22.170  49.030  1.00 50.38  ? 172 SER F OG  1 
ATOM   9292  N N   . SER F  2 189 ? 5.603   25.368  49.555  1.00 52.88  ? 173 SER F N   1 
ATOM   9293  C CA  . SER F  2 189 ? 5.197   26.720  49.188  1.00 53.23  ? 173 SER F CA  1 
ATOM   9294  C C   . SER F  2 189 ? 5.678   27.761  50.189  1.00 53.49  ? 173 SER F C   1 
ATOM   9295  O O   . SER F  2 189 ? 5.544   28.962  49.950  1.00 53.57  ? 173 SER F O   1 
ATOM   9296  C CB  . SER F  2 189 ? 3.669   26.802  49.101  1.00 55.19  ? 173 SER F CB  1 
ATOM   9297  O OG  . SER F  2 189 ? 3.057   26.730  50.390  1.00 57.19  ? 173 SER F OG  1 
ATOM   9298  N N   . GLY F  2 190 ? 6.230   27.302  51.309  1.00 53.44  ? 174 GLY F N   1 
ATOM   9299  C CA  . GLY F  2 190 ? 6.695   28.222  52.333  1.00 53.53  ? 174 GLY F CA  1 
ATOM   9300  C C   . GLY F  2 190 ? 5.523   28.794  53.116  1.00 53.56  ? 174 GLY F C   1 
ATOM   9301  O O   . GLY F  2 190 ? 5.414   30.005  53.295  1.00 53.28  ? 174 GLY F O   1 
ATOM   9302  N N   . LEU F  2 191 ? 4.642   27.909  53.575  1.00 53.56  ? 175 LEU F N   1 
ATOM   9303  C CA  . LEU F  2 191 ? 3.450   28.283  54.336  1.00 52.47  ? 175 LEU F CA  1 
ATOM   9304  C C   . LEU F  2 191 ? 3.035   27.147  55.246  1.00 51.19  ? 175 LEU F C   1 
ATOM   9305  O O   . LEU F  2 191 ? 2.877   26.008  54.822  1.00 51.19  ? 175 LEU F O   1 
ATOM   9306  C CB  . LEU F  2 191 ? 2.284   28.614  53.402  1.00 53.91  ? 175 LEU F CB  1 
ATOM   9307  C CG  . LEU F  2 191 ? 2.208   30.001  52.768  1.00 53.64  ? 175 LEU F CG  1 
ATOM   9308  C CD1 . LEU F  2 191 ? 0.886   30.125  52.049  1.00 54.31  ? 175 LEU F CD1 1 
ATOM   9309  C CD2 . LEU F  2 191 ? 2.326   31.080  53.833  1.00 52.95  ? 175 LEU F CD2 1 
ATOM   9310  N N   . TYR F  2 192 ? 2.818   27.474  56.505  1.00 50.88  ? 176 TYR F N   1 
ATOM   9311  C CA  . TYR F  2 192 ? 2.471   26.474  57.490  1.00 49.18  ? 176 TYR F CA  1 
ATOM   9312  C C   . TYR F  2 192 ? 1.187   25.713  57.287  1.00 46.81  ? 176 TYR F C   1 
ATOM   9313  O O   . TYR F  2 192 ? 0.234   26.206  56.702  1.00 45.18  ? 176 TYR F O   1 
ATOM   9314  C CB  . TYR F  2 192 ? 2.510   27.120  58.867  1.00 49.98  ? 176 TYR F CB  1 
ATOM   9315  C CG  . TYR F  2 192 ? 3.891   27.593  59.186  1.00 51.71  ? 176 TYR F CG  1 
ATOM   9316  C CD1 . TYR F  2 192 ? 4.959   26.698  59.147  1.00 52.73  ? 176 TYR F CD1 1 
ATOM   9317  C CD2 . TYR F  2 192 ? 4.150   28.930  59.473  1.00 52.18  ? 176 TYR F CD2 1 
ATOM   9318  C CE1 . TYR F  2 192 ? 6.254   27.115  59.379  1.00 54.46  ? 176 TYR F CE1 1 
ATOM   9319  C CE2 . TYR F  2 192 ? 5.451   29.365  59.715  1.00 53.77  ? 176 TYR F CE2 1 
ATOM   9320  C CZ  . TYR F  2 192 ? 6.499   28.447  59.662  1.00 55.02  ? 176 TYR F CZ  1 
ATOM   9321  O OH  . TYR F  2 192 ? 7.800   28.836  59.869  1.00 56.74  ? 176 TYR F OH  1 
ATOM   9322  N N   . SER F  2 193 ? 1.194   24.482  57.770  1.00 45.26  ? 177 SER F N   1 
ATOM   9323  C CA  . SER F  2 193 ? 0.034   23.627  57.674  1.00 44.78  ? 177 SER F CA  1 
ATOM   9324  C C   . SER F  2 193 ? 0.059   22.619  58.801  1.00 42.69  ? 177 SER F C   1 
ATOM   9325  O O   . SER F  2 193 ? 1.118   22.322  59.346  1.00 42.66  ? 177 SER F O   1 
ATOM   9326  C CB  . SER F  2 193 ? 0.025   22.891  56.337  1.00 46.94  ? 177 SER F CB  1 
ATOM   9327  O OG  . SER F  2 193 ? -1.099  22.021  56.232  1.00 50.34  ? 177 SER F OG  1 
ATOM   9328  N N   . LEU F  2 194 ? -1.115  22.112  59.153  1.00 40.07  ? 178 LEU F N   1 
ATOM   9329  C CA  . LEU F  2 194 ? -1.237  21.113  60.199  1.00 39.68  ? 178 LEU F CA  1 
ATOM   9330  C C   . LEU F  2 194 ? -2.623  20.501  60.168  1.00 40.23  ? 178 LEU F C   1 
ATOM   9331  O O   . LEU F  2 194 ? -3.397  20.768  59.244  1.00 42.27  ? 178 LEU F O   1 
ATOM   9332  C CB  . LEU F  2 194 ? -0.931  21.717  61.573  1.00 39.41  ? 178 LEU F CB  1 
ATOM   9333  C CG  . LEU F  2 194 ? -1.608  22.958  62.153  1.00 38.52  ? 178 LEU F CG  1 
ATOM   9334  C CD1 . LEU F  2 194 ? -3.068  22.687  62.435  1.00 37.39  ? 178 LEU F CD1 1 
ATOM   9335  C CD2 . LEU F  2 194 ? -0.896  23.326  63.439  1.00 37.80  ? 178 LEU F CD2 1 
ATOM   9336  N N   . SER F  2 195 ? -2.944  19.671  61.155  1.00 39.14  ? 179 SER F N   1 
ATOM   9337  C CA  . SER F  2 195 ? -4.253  19.027  61.185  1.00 38.62  ? 179 SER F CA  1 
ATOM   9338  C C   . SER F  2 195 ? -4.527  18.476  62.566  1.00 38.43  ? 179 SER F C   1 
ATOM   9339  O O   . SER F  2 195 ? -3.768  17.649  63.077  1.00 40.16  ? 179 SER F O   1 
ATOM   9340  C CB  . SER F  2 195 ? -4.305  17.897  60.163  1.00 39.14  ? 179 SER F CB  1 
ATOM   9341  O OG  . SER F  2 195 ? -3.202  17.030  60.337  1.00 38.34  ? 179 SER F OG  1 
ATOM   9342  N N   . SER F  2 196 ? -5.629  18.927  63.155  1.00 36.75  ? 180 SER F N   1 
ATOM   9343  C CA  . SER F  2 196 ? -6.024  18.543  64.509  1.00 34.84  ? 180 SER F CA  1 
ATOM   9344  C C   . SER F  2 196 ? -7.012  17.371  64.527  1.00 35.23  ? 180 SER F C   1 
ATOM   9345  O O   . SER F  2 196 ? -8.169  17.547  64.183  1.00 38.16  ? 180 SER F O   1 
ATOM   9346  C CB  . SER F  2 196 ? -6.642  19.774  65.193  1.00 30.58  ? 180 SER F CB  1 
ATOM   9347  O OG  . SER F  2 196 ? -6.374  19.807  66.573  1.00 25.02  ? 180 SER F OG  1 
ATOM   9348  N N   . VAL F  2 197 ? -6.570  16.179  64.923  1.00 34.04  ? 181 VAL F N   1 
ATOM   9349  C CA  . VAL F  2 197 ? -7.461  15.015  64.980  1.00 32.24  ? 181 VAL F CA  1 
ATOM   9350  C C   . VAL F  2 197 ? -7.984  14.849  66.410  1.00 33.95  ? 181 VAL F C   1 
ATOM   9351  O O   . VAL F  2 197 ? -7.529  15.542  67.313  1.00 34.55  ? 181 VAL F O   1 
ATOM   9352  C CB  . VAL F  2 197 ? -6.726  13.735  64.561  1.00 29.15  ? 181 VAL F CB  1 
ATOM   9353  C CG1 . VAL F  2 197 ? -6.089  13.937  63.221  1.00 28.00  ? 181 VAL F CG1 1 
ATOM   9354  C CG2 . VAL F  2 197 ? -5.670  13.381  65.585  1.00 27.49  ? 181 VAL F CG2 1 
ATOM   9355  N N   . VAL F  2 198 ? -8.932  13.936  66.626  1.00 35.28  ? 182 VAL F N   1 
ATOM   9356  C CA  . VAL F  2 198 ? -9.490  13.717  67.969  1.00 35.27  ? 182 VAL F CA  1 
ATOM   9357  C C   . VAL F  2 198 ? -10.421 12.489  68.058  1.00 36.27  ? 182 VAL F C   1 
ATOM   9358  O O   . VAL F  2 198 ? -11.633 12.636  67.988  1.00 37.46  ? 182 VAL F O   1 
ATOM   9359  C CB  . VAL F  2 198 ? -10.243 15.010  68.440  1.00 33.51  ? 182 VAL F CB  1 
ATOM   9360  C CG1 . VAL F  2 198 ? -11.039 15.572  67.289  1.00 33.97  ? 182 VAL F CG1 1 
ATOM   9361  C CG2 . VAL F  2 198 ? -11.152 14.728  69.632  1.00 31.83  ? 182 VAL F CG2 1 
ATOM   9362  N N   . THR F  2 199 ? -9.862  11.290  68.233  1.00 37.08  ? 183 THR F N   1 
ATOM   9363  C CA  . THR F  2 199 ? -10.671 10.058  68.306  1.00 39.04  ? 183 THR F CA  1 
ATOM   9364  C C   . THR F  2 199 ? -11.871 10.177  69.249  1.00 39.53  ? 183 THR F C   1 
ATOM   9365  O O   . THR F  2 199 ? -11.742 10.709  70.350  1.00 39.74  ? 183 THR F O   1 
ATOM   9366  C CB  . THR F  2 199 ? -9.819  8.830   68.747  1.00 39.17  ? 183 THR F CB  1 
ATOM   9367  O OG1 . THR F  2 199 ? -9.444  8.960   70.122  1.00 40.39  ? 183 THR F OG1 1 
ATOM   9368  C CG2 . THR F  2 199 ? -8.559  8.737   67.922  1.00 38.62  ? 183 THR F CG2 1 
ATOM   9369  N N   . VAL F  2 200 ? -13.033 9.683   68.809  1.00 40.74  ? 184 VAL F N   1 
ATOM   9370  C CA  . VAL F  2 200 ? -14.271 9.740   69.603  1.00 42.54  ? 184 VAL F CA  1 
ATOM   9371  C C   . VAL F  2 200 ? -15.197 8.550   69.314  1.00 44.50  ? 184 VAL F C   1 
ATOM   9372  O O   . VAL F  2 200 ? -14.883 7.712   68.485  1.00 43.56  ? 184 VAL F O   1 
ATOM   9373  C CB  . VAL F  2 200 ? -15.080 11.055  69.328  1.00 41.57  ? 184 VAL F CB  1 
ATOM   9374  C CG1 . VAL F  2 200 ? -14.142 12.230  69.166  1.00 40.33  ? 184 VAL F CG1 1 
ATOM   9375  C CG2 . VAL F  2 200 ? -15.998 10.883  68.122  1.00 41.28  ? 184 VAL F CG2 1 
ATOM   9376  N N   . PRO F  2 201 ? -16.358 8.476   69.994  1.00 47.59  ? 185 PRO F N   1 
ATOM   9377  C CA  . PRO F  2 201 ? -17.350 7.404   69.834  1.00 50.46  ? 185 PRO F CA  1 
ATOM   9378  C C   . PRO F  2 201 ? -17.897 7.254   68.419  1.00 53.52  ? 185 PRO F C   1 
ATOM   9379  O O   . PRO F  2 201 ? -18.179 8.253   67.757  1.00 54.70  ? 185 PRO F O   1 
ATOM   9380  C CB  . PRO F  2 201 ? -18.453 7.809   70.801  1.00 49.15  ? 185 PRO F CB  1 
ATOM   9381  C CG  . PRO F  2 201 ? -17.721 8.535   71.865  1.00 48.67  ? 185 PRO F CG  1 
ATOM   9382  C CD  . PRO F  2 201 ? -16.771 9.381   71.081  1.00 48.85  ? 185 PRO F CD  1 
ATOM   9383  N N   . SER F  2 202 ? -18.060 6.001   67.979  1.00 56.08  ? 186 SER F N   1 
ATOM   9384  C CA  . SER F  2 202 ? -18.591 5.670   66.646  1.00 57.17  ? 186 SER F CA  1 
ATOM   9385  C C   . SER F  2 202 ? -20.101 5.888   66.649  1.00 58.15  ? 186 SER F C   1 
ATOM   9386  O O   . SER F  2 202 ? -20.692 6.320   65.660  1.00 58.63  ? 186 SER F O   1 
ATOM   9387  C CB  . SER F  2 202 ? -18.302 4.206   66.306  1.00 56.59  ? 186 SER F CB  1 
ATOM   9388  O OG  . SER F  2 202 ? -17.050 3.799   66.829  1.00 56.59  ? 186 SER F OG  1 
ATOM   9389  N N   . SER F  2 203 ? -20.714 5.570   67.780  1.00 59.55  ? 187 SER F N   1 
ATOM   9390  C CA  . SER F  2 203 ? -22.145 5.726   67.965  1.00 61.23  ? 187 SER F CA  1 
ATOM   9391  C C   . SER F  2 203 ? -22.486 7.203   68.176  1.00 61.75  ? 187 SER F C   1 
ATOM   9392  O O   . SER F  2 203 ? -23.645 7.605   68.069  1.00 61.92  ? 187 SER F O   1 
ATOM   9393  C CB  . SER F  2 203 ? -22.600 4.903   69.180  1.00 61.81  ? 187 SER F CB  1 
ATOM   9394  O OG  . SER F  2 203 ? -22.032 5.401   70.389  1.00 62.96  ? 187 SER F OG  1 
ATOM   9395  N N   . SER F  2 204 ? -21.472 8.011   68.472  1.00 62.68  ? 188 SER F N   1 
ATOM   9396  C CA  . SER F  2 204 ? -21.684 9.439   68.705  1.00 62.90  ? 188 SER F CA  1 
ATOM   9397  C C   . SER F  2 204 ? -21.895 10.237  67.420  1.00 62.18  ? 188 SER F C   1 
ATOM   9398  O O   . SER F  2 204 ? -22.647 11.214  67.416  1.00 62.05  ? 188 SER F O   1 
ATOM   9399  C CB  . SER F  2 204 ? -20.506 10.037  69.502  1.00 64.18  ? 188 SER F CB  1 
ATOM   9400  O OG  . SER F  2 204 ? -19.267 9.965   68.800  1.00 62.45  ? 188 SER F OG  1 
ATOM   9401  N N   . LEU F  2 205 ? -21.242 9.812   66.338  1.00 61.07  ? 189 LEU F N   1 
ATOM   9402  C CA  . LEU F  2 205 ? -21.338 10.490  65.051  1.00 60.38  ? 189 LEU F CA  1 
ATOM   9403  C C   . LEU F  2 205 ? -22.725 10.430  64.437  1.00 61.66  ? 189 LEU F C   1 
ATOM   9404  O O   . LEU F  2 205 ? -22.891 10.634  63.235  1.00 62.29  ? 189 LEU F O   1 
ATOM   9405  C CB  . LEU F  2 205 ? -20.353 9.890   64.067  1.00 58.45  ? 189 LEU F CB  1 
ATOM   9406  C CG  . LEU F  2 205 ? -18.904 9.855   64.499  1.00 57.05  ? 189 LEU F CG  1 
ATOM   9407  C CD1 . LEU F  2 205 ? -18.079 9.404   63.325  1.00 55.49  ? 189 LEU F CD1 1 
ATOM   9408  C CD2 . LEU F  2 205 ? -18.470 11.223  64.989  1.00 57.82  ? 189 LEU F CD2 1 
ATOM   9409  N N   . GLY F  2 206 ? -23.722 10.125  65.251  1.00 62.83  ? 190 GLY F N   1 
ATOM   9410  C CA  . GLY F  2 206 ? -25.072 10.077  64.741  1.00 63.04  ? 190 GLY F CA  1 
ATOM   9411  C C   . GLY F  2 206 ? -25.696 11.430  64.985  1.00 63.85  ? 190 GLY F C   1 
ATOM   9412  O O   . GLY F  2 206 ? -26.122 12.119  64.058  1.00 64.86  ? 190 GLY F O   1 
ATOM   9413  N N   . THR F  2 207 ? -25.703 11.834  66.247  1.00 63.71  ? 191 THR F N   1 
ATOM   9414  C CA  . THR F  2 207 ? -26.306 13.094  66.641  1.00 63.66  ? 191 THR F CA  1 
ATOM   9415  C C   . THR F  2 207 ? -25.333 14.088  67.273  1.00 62.64  ? 191 THR F C   1 
ATOM   9416  O O   . THR F  2 207 ? -25.621 15.289  67.339  1.00 63.09  ? 191 THR F O   1 
ATOM   9417  C CB  . THR F  2 207 ? -27.443 12.831  67.641  1.00 64.66  ? 191 THR F CB  1 
ATOM   9418  O OG1 . THR F  2 207 ? -26.950 11.992  68.694  1.00 65.07  ? 191 THR F OG1 1 
ATOM   9419  C CG2 . THR F  2 207 ? -28.628 12.143  66.956  1.00 64.48  ? 191 THR F CG2 1 
ATOM   9420  N N   . GLN F  2 208 ? -24.194 13.589  67.744  1.00 60.63  ? 192 GLN F N   1 
ATOM   9421  C CA  . GLN F  2 208 ? -23.198 14.441  68.389  1.00 58.83  ? 192 GLN F CA  1 
ATOM   9422  C C   . GLN F  2 208 ? -22.592 15.465  67.430  1.00 57.05  ? 192 GLN F C   1 
ATOM   9423  O O   . GLN F  2 208 ? -22.401 15.185  66.248  1.00 57.24  ? 192 GLN F O   1 
ATOM   9424  C CB  . GLN F  2 208 ? -22.094 13.583  68.997  1.00 59.56  ? 192 GLN F CB  1 
ATOM   9425  C CG  . GLN F  2 208 ? -21.179 14.354  69.905  1.00 61.10  ? 192 GLN F CG  1 
ATOM   9426  C CD  . GLN F  2 208 ? -21.926 14.973  71.067  1.00 62.43  ? 192 GLN F CD  1 
ATOM   9427  O OE1 . GLN F  2 208 ? -22.510 14.266  71.891  1.00 63.71  ? 192 GLN F OE1 1 
ATOM   9428  N NE2 . GLN F  2 208 ? -21.915 16.301  71.140  1.00 62.94  ? 192 GLN F NE2 1 
ATOM   9429  N N   . THR F  2 209 ? -22.290 16.654  67.943  1.00 54.79  ? 193 THR F N   1 
ATOM   9430  C CA  . THR F  2 209 ? -21.733 17.714  67.116  1.00 52.82  ? 193 THR F CA  1 
ATOM   9431  C C   . THR F  2 209 ? -20.289 17.966  67.479  1.00 51.24  ? 193 THR F C   1 
ATOM   9432  O O   . THR F  2 209 ? -19.913 17.889  68.643  1.00 51.30  ? 193 THR F O   1 
ATOM   9433  C CB  . THR F  2 209 ? -22.478 19.046  67.302  1.00 54.12  ? 193 THR F CB  1 
ATOM   9434  O OG1 . THR F  2 209 ? -23.865 18.806  67.598  1.00 56.58  ? 193 THR F OG1 1 
ATOM   9435  C CG2 . THR F  2 209 ? -22.369 19.873  66.031  1.00 54.18  ? 193 THR F CG2 1 
ATOM   9436  N N   . TYR F  2 210 ? -19.486 18.297  66.476  1.00 49.71  ? 194 TYR F N   1 
ATOM   9437  C CA  . TYR F  2 210 ? -18.069 18.557  66.675  1.00 46.63  ? 194 TYR F CA  1 
ATOM   9438  C C   . TYR F  2 210 ? -17.655 19.754  65.838  1.00 46.15  ? 194 TYR F C   1 
ATOM   9439  O O   . TYR F  2 210 ? -18.043 19.858  64.678  1.00 44.45  ? 194 TYR F O   1 
ATOM   9440  C CB  . TYR F  2 210 ? -17.261 17.333  66.249  1.00 45.68  ? 194 TYR F CB  1 
ATOM   9441  C CG  . TYR F  2 210 ? -17.587 16.071  67.013  1.00 43.85  ? 194 TYR F CG  1 
ATOM   9442  C CD1 . TYR F  2 210 ? -17.199 15.919  68.342  1.00 43.21  ? 194 TYR F CD1 1 
ATOM   9443  C CD2 . TYR F  2 210 ? -18.297 15.035  66.409  1.00 42.94  ? 194 TYR F CD2 1 
ATOM   9444  C CE1 . TYR F  2 210 ? -17.507 14.773  69.049  1.00 44.15  ? 194 TYR F CE1 1 
ATOM   9445  C CE2 . TYR F  2 210 ? -18.614 13.888  67.101  1.00 43.86  ? 194 TYR F CE2 1 
ATOM   9446  C CZ  . TYR F  2 210 ? -18.217 13.758  68.424  1.00 46.16  ? 194 TYR F CZ  1 
ATOM   9447  O OH  . TYR F  2 210 ? -18.529 12.610  69.121  1.00 48.59  ? 194 TYR F OH  1 
ATOM   9448  N N   . ILE F  2 211 ? -16.867 20.650  66.429  1.00 46.82  ? 195 ILE F N   1 
ATOM   9449  C CA  . ILE F  2 211 ? -16.382 21.841  65.728  1.00 49.02  ? 195 ILE F CA  1 
ATOM   9450  C C   . ILE F  2 211 ? -14.982 22.272  66.199  1.00 51.18  ? 195 ILE F C   1 
ATOM   9451  O O   . ILE F  2 211 ? -14.851 22.791  67.308  1.00 51.55  ? 195 ILE F O   1 
ATOM   9452  C CB  . ILE F  2 211 ? -17.315 23.052  65.955  1.00 48.39  ? 195 ILE F CB  1 
ATOM   9453  C CG1 . ILE F  2 211 ? -18.742 22.723  65.509  1.00 48.56  ? 195 ILE F CG1 1 
ATOM   9454  C CG2 . ILE F  2 211 ? -16.769 24.262  65.207  1.00 47.59  ? 195 ILE F CG2 1 
ATOM   9455  C CD1 . ILE F  2 211 ? -19.749 23.839  65.777  1.00 47.18  ? 195 ILE F CD1 1 
ATOM   9456  N N   . CYS F  2 212 ? -13.938 22.067  65.388  1.00 52.98  ? 196 CYS F N   1 
ATOM   9457  C CA  . CYS F  2 212 ? -12.610 22.508  65.822  1.00 54.99  ? 196 CYS F CA  1 
ATOM   9458  C C   . CYS F  2 212 ? -12.665 24.018  65.645  1.00 55.23  ? 196 CYS F C   1 
ATOM   9459  O O   . CYS F  2 212 ? -13.306 24.494  64.707  1.00 54.27  ? 196 CYS F O   1 
ATOM   9460  C CB  . CYS F  2 212 ? -11.485 21.896  64.971  1.00 55.69  ? 196 CYS F CB  1 
ATOM   9461  S SG  . CYS F  2 212 ? -11.114 22.754  63.410  1.00 59.36  ? 196 CYS F SG  1 
ATOM   9462  N N   . ASN F  2 213 ? -12.023 24.771  66.543  1.00 56.11  ? 197 ASN F N   1 
ATOM   9463  C CA  . ASN F  2 213 ? -12.065 26.242  66.471  1.00 55.98  ? 197 ASN F CA  1 
ATOM   9464  C C   . ASN F  2 213 ? -10.783 26.939  66.046  1.00 55.43  ? 197 ASN F C   1 
ATOM   9465  O O   . ASN F  2 213 ? -10.258 27.782  66.769  1.00 55.32  ? 197 ASN F O   1 
ATOM   9466  C CB  . ASN F  2 213 ? -12.521 26.825  67.812  1.00 55.11  ? 197 ASN F CB  1 
ATOM   9467  C CG  . ASN F  2 213 ? -13.786 26.171  68.327  1.00 55.20  ? 197 ASN F CG  1 
ATOM   9468  O OD1 . ASN F  2 213 ? -13.731 25.186  69.067  1.00 54.51  ? 197 ASN F OD1 1 
ATOM   9469  N ND2 . ASN F  2 213 ? -14.938 26.703  67.922  1.00 54.45  ? 197 ASN F ND2 1 
ATOM   9470  N N   . VAL F  2 214 ? -10.307 26.592  64.858  1.00 54.57  ? 198 VAL F N   1 
ATOM   9471  C CA  . VAL F  2 214 ? -9.098  27.168  64.295  1.00 55.10  ? 198 VAL F CA  1 
ATOM   9472  C C   . VAL F  2 214 ? -9.022  28.664  64.560  1.00 54.81  ? 198 VAL F C   1 
ATOM   9473  O O   . VAL F  2 214 ? -9.964  29.388  64.269  1.00 54.51  ? 198 VAL F O   1 
ATOM   9474  C CB  . VAL F  2 214 ? -9.084  26.934  62.797  1.00 56.19  ? 198 VAL F CB  1 
ATOM   9475  C CG1 . VAL F  2 214 ? -7.721  27.257  62.222  1.00 56.55  ? 198 VAL F CG1 1 
ATOM   9476  C CG2 . VAL F  2 214 ? -9.491  25.503  62.520  1.00 57.01  ? 198 VAL F CG2 1 
ATOM   9477  N N   . ASN F  2 215 ? -7.904  29.134  65.104  1.00 55.06  ? 199 ASN F N   1 
ATOM   9478  C CA  . ASN F  2 215 ? -7.780  30.556  65.398  1.00 55.72  ? 199 ASN F CA  1 
ATOM   9479  C C   . ASN F  2 215 ? -6.391  31.151  65.189  1.00 56.56  ? 199 ASN F C   1 
ATOM   9480  O O   . ASN F  2 215 ? -5.465  30.893  65.950  1.00 57.76  ? 199 ASN F O   1 
ATOM   9481  C CB  . ASN F  2 215 ? -8.250  30.822  66.829  1.00 55.54  ? 199 ASN F CB  1 
ATOM   9482  C CG  . ASN F  2 215 ? -8.148  32.283  67.226  1.00 55.88  ? 199 ASN F CG  1 
ATOM   9483  O OD1 . ASN F  2 215 ? -8.869  32.743  68.113  1.00 56.40  ? 199 ASN F OD1 1 
ATOM   9484  N ND2 . ASN F  2 215 ? -7.250  33.017  66.584  1.00 55.29  ? 199 ASN F ND2 1 
ATOM   9485  N N   . HIS F  2 216 ? -6.270  31.971  64.151  1.00 57.15  ? 200 HIS F N   1 
ATOM   9486  C CA  . HIS F  2 216 ? -5.027  32.654  63.815  1.00 56.88  ? 200 HIS F CA  1 
ATOM   9487  C C   . HIS F  2 216 ? -5.180  34.076  64.387  1.00 57.81  ? 200 HIS F C   1 
ATOM   9488  O O   . HIS F  2 216 ? -6.276  34.650  64.381  1.00 58.09  ? 200 HIS F O   1 
ATOM   9489  C CB  . HIS F  2 216 ? -4.868  32.701  62.291  1.00 56.45  ? 200 HIS F CB  1 
ATOM   9490  C CG  . HIS F  2 216 ? -3.456  32.876  61.819  1.00 55.41  ? 200 HIS F CG  1 
ATOM   9491  N ND1 . HIS F  2 216 ? -3.148  33.271  60.534  1.00 55.28  ? 200 HIS F ND1 1 
ATOM   9492  C CD2 . HIS F  2 216 ? -2.273  32.689  62.447  1.00 54.73  ? 200 HIS F CD2 1 
ATOM   9493  C CE1 . HIS F  2 216 ? -1.838  33.323  60.392  1.00 54.66  ? 200 HIS F CE1 1 
ATOM   9494  N NE2 . HIS F  2 216 ? -1.283  32.976  61.538  1.00 55.37  ? 200 HIS F NE2 1 
ATOM   9495  N N   . LYS F  2 217 ? -4.095  34.640  64.897  1.00 57.83  ? 201 LYS F N   1 
ATOM   9496  C CA  . LYS F  2 217 ? -4.159  35.974  65.470  1.00 57.97  ? 201 LYS F CA  1 
ATOM   9497  C C   . LYS F  2 217 ? -3.512  37.040  64.607  1.00 56.90  ? 201 LYS F C   1 
ATOM   9498  O O   . LYS F  2 217 ? -3.944  38.187  64.603  1.00 56.22  ? 201 LYS F O   1 
ATOM   9499  C CB  . LYS F  2 217 ? -3.499  35.986  66.844  1.00 60.31  ? 201 LYS F CB  1 
ATOM   9500  C CG  . LYS F  2 217 ? -3.943  34.868  67.761  1.00 62.55  ? 201 LYS F CG  1 
ATOM   9501  C CD  . LYS F  2 217 ? -3.508  35.157  69.179  1.00 64.03  ? 201 LYS F CD  1 
ATOM   9502  C CE  . LYS F  2 217 ? -4.352  36.254  69.809  1.00 65.92  ? 201 LYS F CE  1 
ATOM   9503  N NZ  . LYS F  2 217 ? -3.810  36.638  71.158  1.00 69.45  ? 201 LYS F NZ  1 
ATOM   9504  N N   . PRO F  2 218 ? -2.453  36.680  63.876  1.00 56.68  ? 202 PRO F N   1 
ATOM   9505  C CA  . PRO F  2 218 ? -1.777  37.651  63.022  1.00 56.60  ? 202 PRO F CA  1 
ATOM   9506  C C   . PRO F  2 218 ? -2.718  38.270  61.989  1.00 57.68  ? 202 PRO F C   1 
ATOM   9507  O O   . PRO F  2 218 ? -2.434  39.346  61.453  1.00 58.38  ? 202 PRO F O   1 
ATOM   9508  C CB  . PRO F  2 218 ? -0.681  36.819  62.370  1.00 56.11  ? 202 PRO F CB  1 
ATOM   9509  C CG  . PRO F  2 218 ? -0.387  35.788  63.383  1.00 55.83  ? 202 PRO F CG  1 
ATOM   9510  C CD  . PRO F  2 218 ? -1.743  35.390  63.852  1.00 56.49  ? 202 PRO F CD  1 
ATOM   9511  N N   . SER F  2 219 ? -3.833  37.589  61.715  1.00 57.38  ? 203 SER F N   1 
ATOM   9512  C CA  . SER F  2 219 ? -4.807  38.061  60.729  1.00 57.12  ? 203 SER F CA  1 
ATOM   9513  C C   . SER F  2 219 ? -6.232  38.203  61.260  1.00 58.41  ? 203 SER F C   1 
ATOM   9514  O O   . SER F  2 219 ? -7.124  38.682  60.557  1.00 58.54  ? 203 SER F O   1 
ATOM   9515  C CB  . SER F  2 219 ? -4.804  37.127  59.515  1.00 54.47  ? 203 SER F CB  1 
ATOM   9516  O OG  . SER F  2 219 ? -4.684  35.776  59.912  1.00 50.08  ? 203 SER F OG  1 
ATOM   9517  N N   . ASN F  2 220 ? -6.437  37.797  62.506  1.00 59.53  ? 204 ASN F N   1 
ATOM   9518  C CA  . ASN F  2 220 ? -7.749  37.861  63.138  1.00 60.69  ? 204 ASN F CA  1 
ATOM   9519  C C   . ASN F  2 220 ? -8.658  36.779  62.580  1.00 60.64  ? 204 ASN F C   1 
ATOM   9520  O O   . ASN F  2 220 ? -9.865  36.812  62.804  1.00 61.56  ? 204 ASN F O   1 
ATOM   9521  C CB  . ASN F  2 220 ? -8.417  39.224  62.912  1.00 62.80  ? 204 ASN F CB  1 
ATOM   9522  C CG  . ASN F  2 220 ? -7.489  40.393  63.199  1.00 65.62  ? 204 ASN F CG  1 
ATOM   9523  O OD1 . ASN F  2 220 ? -6.453  40.241  63.850  1.00 66.47  ? 204 ASN F OD1 1 
ATOM   9524  N ND2 . ASN F  2 220 ? -7.865  41.577  62.713  1.00 67.41  ? 204 ASN F ND2 1 
ATOM   9525  N N   . THR F  2 221 ? -8.084  35.818  61.860  1.00 60.17  ? 205 THR F N   1 
ATOM   9526  C CA  . THR F  2 221 ? -8.872  34.742  61.269  1.00 59.33  ? 205 THR F CA  1 
ATOM   9527  C C   . THR F  2 221 ? -9.393  33.760  62.314  1.00 59.10  ? 205 THR F C   1 
ATOM   9528  O O   . THR F  2 221 ? -8.839  32.670  62.458  1.00 60.64  ? 205 THR F O   1 
ATOM   9529  C CB  . THR F  2 221 ? -8.049  33.934  60.245  1.00 59.12  ? 205 THR F CB  1 
ATOM   9530  O OG1 . THR F  2 221 ? -6.925  34.711  59.823  1.00 60.25  ? 205 THR F OG1 1 
ATOM   9531  C CG2 . THR F  2 221 ? -8.904  33.586  59.020  1.00 58.74  ? 205 THR F CG2 1 
ATOM   9532  N N   . LYS F  2 222 ? -10.446 34.137  63.039  1.00 57.11  ? 206 LYS F N   1 
ATOM   9533  C CA  . LYS F  2 222 ? -11.034 33.249  64.038  1.00 55.38  ? 206 LYS F CA  1 
ATOM   9534  C C   . LYS F  2 222 ? -12.046 32.360  63.316  1.00 55.70  ? 206 LYS F C   1 
ATOM   9535  O O   . LYS F  2 222 ? -13.229 32.674  63.247  1.00 56.93  ? 206 LYS F O   1 
ATOM   9536  C CB  . LYS F  2 222 ? -11.731 34.052  65.149  1.00 54.22  ? 206 LYS F CB  1 
ATOM   9537  C CG  . LYS F  2 222 ? -10.818 35.023  65.930  1.00 51.92  ? 206 LYS F CG  1 
ATOM   9538  C CD  . LYS F  2 222 ? -11.321 35.290  67.358  1.00 48.93  ? 206 LYS F CD  1 
ATOM   9539  C CE  . LYS F  2 222 ? -12.802 35.690  67.414  1.00 47.21  ? 206 LYS F CE  1 
ATOM   9540  N NZ  . LYS F  2 222 ? -13.294 36.017  68.790  1.00 42.26  ? 206 LYS F NZ  1 
ATOM   9541  N N   . VAL F  2 223 ? -11.563 31.249  62.775  1.00 55.54  ? 207 VAL F N   1 
ATOM   9542  C CA  . VAL F  2 223 ? -12.389 30.314  62.017  1.00 55.32  ? 207 VAL F CA  1 
ATOM   9543  C C   . VAL F  2 223 ? -13.111 29.256  62.871  1.00 56.84  ? 207 VAL F C   1 
ATOM   9544  O O   . VAL F  2 223 ? -12.632 28.860  63.936  1.00 58.04  ? 207 VAL F O   1 
ATOM   9545  C CB  . VAL F  2 223 ? -11.515 29.588  60.960  1.00 53.98  ? 207 VAL F CB  1 
ATOM   9546  C CG1 . VAL F  2 223 ? -12.389 28.778  60.017  1.00 51.72  ? 207 VAL F CG1 1 
ATOM   9547  C CG2 . VAL F  2 223 ? -10.658 30.599  60.205  1.00 51.79  ? 207 VAL F CG2 1 
ATOM   9548  N N   . ASP F  2 224 ? -14.268 28.809  62.390  1.00 58.01  ? 208 ASP F N   1 
ATOM   9549  C CA  . ASP F  2 224 ? -15.077 27.776  63.053  1.00 59.68  ? 208 ASP F CA  1 
ATOM   9550  C C   . ASP F  2 224 ? -15.424 26.767  61.962  1.00 60.05  ? 208 ASP F C   1 
ATOM   9551  O O   . ASP F  2 224 ? -16.108 27.123  61.003  1.00 61.65  ? 208 ASP F O   1 
ATOM   9552  C CB  . ASP F  2 224 ? -16.385 28.367  63.602  1.00 61.10  ? 208 ASP F CB  1 
ATOM   9553  C CG  . ASP F  2 224 ? -16.277 28.833  65.051  1.00 61.98  ? 208 ASP F CG  1 
ATOM   9554  O OD1 . ASP F  2 224 ? -17.303 29.317  65.573  1.00 62.38  ? 208 ASP F OD1 1 
ATOM   9555  O OD2 . ASP F  2 224 ? -15.192 28.714  65.667  1.00 62.76  ? 208 ASP F OD2 1 
ATOM   9556  N N   . LYS F  2 225 ? -14.977 25.519  62.090  1.00 59.40  ? 209 LYS F N   1 
ATOM   9557  C CA  . LYS F  2 225 ? -15.267 24.542  61.041  1.00 57.94  ? 209 LYS F CA  1 
ATOM   9558  C C   . LYS F  2 225 ? -15.788 23.181  61.503  1.00 57.20  ? 209 LYS F C   1 
ATOM   9559  O O   . LYS F  2 225 ? -15.059 22.364  62.061  1.00 57.10  ? 209 LYS F O   1 
ATOM   9560  C CB  . LYS F  2 225 ? -14.029 24.356  60.161  1.00 57.34  ? 209 LYS F CB  1 
ATOM   9561  C CG  . LYS F  2 225 ? -14.350 23.875  58.751  1.00 57.47  ? 209 LYS F CG  1 
ATOM   9562  C CD  . LYS F  2 225 ? -15.213 24.867  57.987  1.00 54.42  ? 209 LYS F CD  1 
ATOM   9563  C CE  . LYS F  2 225 ? -15.802 24.214  56.753  1.00 53.57  ? 209 LYS F CE  1 
ATOM   9564  N NZ  . LYS F  2 225 ? -16.985 24.953  56.226  1.00 53.70  ? 209 LYS F NZ  1 
ATOM   9565  N N   . LYS F  2 226 ? -17.068 22.956  61.238  1.00 56.70  ? 210 LYS F N   1 
ATOM   9566  C CA  . LYS F  2 226 ? -17.759 21.726  61.601  1.00 56.79  ? 210 LYS F CA  1 
ATOM   9567  C C   . LYS F  2 226 ? -17.233 20.552  60.787  1.00 55.07  ? 210 LYS F C   1 
ATOM   9568  O O   . LYS F  2 226 ? -17.107 20.639  59.570  1.00 54.09  ? 210 LYS F O   1 
ATOM   9569  C CB  . LYS F  2 226 ? -19.275 21.895  61.367  1.00 59.24  ? 210 LYS F CB  1 
ATOM   9570  C CG  . LYS F  2 226 ? -20.149 20.745  61.890  1.00 61.58  ? 210 LYS F CG  1 
ATOM   9571  C CD  . LYS F  2 226 ? -21.650 21.039  61.773  1.00 62.02  ? 210 LYS F CD  1 
ATOM   9572  C CE  . LYS F  2 226 ? -22.486 19.895  62.354  1.00 62.58  ? 210 LYS F CE  1 
ATOM   9573  N NZ  . LYS F  2 226 ? -23.953 20.133  62.223  1.00 63.41  ? 210 LYS F NZ  1 
ATOM   9574  N N   . VAL F  2 227 ? -16.926 19.457  61.471  1.00 53.48  ? 211 VAL F N   1 
ATOM   9575  C CA  . VAL F  2 227 ? -16.414 18.273  60.813  1.00 52.45  ? 211 VAL F CA  1 
ATOM   9576  C C   . VAL F  2 227 ? -17.487 17.202  60.792  1.00 53.09  ? 211 VAL F C   1 
ATOM   9577  O O   . VAL F  2 227 ? -17.625 16.423  61.724  1.00 53.19  ? 211 VAL F O   1 
ATOM   9578  C CB  . VAL F  2 227 ? -15.161 17.739  61.534  1.00 51.18  ? 211 VAL F CB  1 
ATOM   9579  C CG1 . VAL F  2 227 ? -14.746 16.407  60.939  1.00 50.51  ? 211 VAL F CG1 1 
ATOM   9580  C CG2 . VAL F  2 227 ? -14.030 18.744  61.422  1.00 49.27  ? 211 VAL F CG2 1 
ATOM   9581  N N   . GLU F  2 228 ? -18.247 17.165  59.711  1.00 54.71  ? 212 GLU F N   1 
ATOM   9582  C CA  . GLU F  2 228 ? -19.315 16.191  59.573  1.00 56.54  ? 212 GLU F CA  1 
ATOM   9583  C C   . GLU F  2 228 ? -18.865 14.976  58.758  1.00 56.49  ? 212 GLU F C   1 
ATOM   9584  O O   . GLU F  2 228 ? -18.040 15.085  57.859  1.00 57.14  ? 212 GLU F O   1 
ATOM   9585  C CB  . GLU F  2 228 ? -20.529 16.872  58.942  1.00 58.72  ? 212 GLU F CB  1 
ATOM   9586  C CG  . GLU F  2 228 ? -20.777 18.253  59.542  1.00 62.66  ? 212 GLU F CG  1 
ATOM   9587  C CD  . GLU F  2 228 ? -22.229 18.694  59.501  1.00 64.06  ? 212 GLU F CD  1 
ATOM   9588  O OE1 . GLU F  2 228 ? -23.069 18.033  60.153  1.00 64.70  ? 212 GLU F OE1 1 
ATOM   9589  O OE2 . GLU F  2 228 ? -22.527 19.707  58.825  1.00 65.04  ? 212 GLU F OE2 1 
ATOM   9590  N N   . PRO F  2 229 ? -19.415 13.803  59.068  1.00 55.96  ? 213 PRO F N   1 
ATOM   9591  C CA  . PRO F  2 229 ? -19.173 12.483  58.476  1.00 57.26  ? 213 PRO F CA  1 
ATOM   9592  C C   . PRO F  2 229 ? -19.128 12.287  56.953  1.00 59.28  ? 213 PRO F C   1 
ATOM   9593  O O   . PRO F  2 229 ? -18.059 12.356  56.337  1.00 60.08  ? 213 PRO F O   1 
ATOM   9594  C CB  . PRO F  2 229 ? -20.256 11.628  59.117  1.00 57.48  ? 213 PRO F CB  1 
ATOM   9595  C CG  . PRO F  2 229 ? -20.449 12.287  60.448  1.00 56.95  ? 213 PRO F CG  1 
ATOM   9596  C CD  . PRO F  2 229 ? -20.467 13.727  60.091  1.00 55.62  ? 213 PRO F CD  1 
ATOM   9597  N N   . LYS F  2 230 ? -20.294 11.995  56.369  1.00 60.40  ? 214 LYS F N   1 
ATOM   9598  C CA  . LYS F  2 230 ? -20.463 11.726  54.932  1.00 60.29  ? 214 LYS F CA  1 
ATOM   9599  C C   . LYS F  2 230 ? -19.484 10.683  54.379  1.00 60.44  ? 214 LYS F C   1 
ATOM   9600  O O   . LYS F  2 230 ? -19.046 9.801   55.153  1.00 59.94  ? 214 LYS F O   1 
ATOM   9601  C CB  . LYS F  2 230 ? -20.384 13.024  54.109  1.00 59.84  ? 214 LYS F CB  1 
ATOM   9602  C CG  . LYS F  2 230 ? -20.699 12.840  52.615  1.00 58.66  ? 214 LYS F CG  1 
ATOM   9603  C CD  . LYS F  2 230 ? -21.805 11.808  52.395  1.00 57.80  ? 214 LYS F CD  1 
ATOM   9604  C CE  . LYS F  2 230 ? -22.199 11.697  50.929  1.00 58.18  ? 214 LYS F CE  1 
ATOM   9605  N NZ  . LYS F  2 230 ? -22.842 12.950  50.425  1.00 58.37  ? 214 LYS F NZ  1 
ATOM   9606  O OXT . LYS F  2 230 ? -19.190 10.734  53.166  1.00 61.39  ? 214 LYS F OXT 1 
ATOM   9607  N N   . ILE G  1 2   ? 51.307  48.074  69.148  1.00 48.43  ? 2   ILE G N   1 
ATOM   9608  C CA  . ILE G  1 2   ? 52.671  48.675  69.202  1.00 48.55  ? 2   ILE G CA  1 
ATOM   9609  C C   . ILE G  1 2   ? 52.659  50.053  68.537  1.00 48.87  ? 2   ILE G C   1 
ATOM   9610  O O   . ILE G  1 2   ? 53.381  50.964  68.936  1.00 49.13  ? 2   ILE G O   1 
ATOM   9611  C CB  . ILE G  1 2   ? 53.710  47.808  68.434  1.00 47.84  ? 2   ILE G CB  1 
ATOM   9612  C CG1 . ILE G  1 2   ? 53.167  46.402  68.223  1.00 46.29  ? 2   ILE G CG1 1 
ATOM   9613  C CG2 . ILE G  1 2   ? 55.044  47.775  69.192  1.00 47.02  ? 2   ILE G CG2 1 
ATOM   9614  C CD1 . ILE G  1 2   ? 54.013  45.584  67.288  1.00 48.17  ? 2   ILE G CD1 1 
ATOM   9615  N N   . GLN G  1 3   ? 51.831  50.196  67.516  1.00 48.60  ? 3   GLN G N   1 
ATOM   9616  C CA  . GLN G  1 3   ? 51.761  51.436  66.771  1.00 48.94  ? 3   GLN G CA  1 
ATOM   9617  C C   . GLN G  1 3   ? 51.136  52.580  67.567  1.00 48.61  ? 3   GLN G C   1 
ATOM   9618  O O   . GLN G  1 3   ? 50.045  52.424  68.125  1.00 47.63  ? 3   GLN G O   1 
ATOM   9619  C CB  . GLN G  1 3   ? 50.958  51.201  65.471  1.00 50.45  ? 3   GLN G CB  1 
ATOM   9620  C CG  . GLN G  1 3   ? 51.447  51.969  64.253  1.00 51.25  ? 3   GLN G CG  1 
ATOM   9621  C CD  . GLN G  1 3   ? 52.844  51.539  63.811  1.00 53.63  ? 3   GLN G CD  1 
ATOM   9622  O OE1 . GLN G  1 3   ? 53.553  50.824  64.532  1.00 53.45  ? 3   GLN G OE1 1 
ATOM   9623  N NE2 . GLN G  1 3   ? 53.250  51.985  62.624  1.00 53.13  ? 3   GLN G NE2 1 
ATOM   9624  N N   . MET G  1 4   ? 51.840  53.716  67.627  1.00 48.17  ? 4   MET G N   1 
ATOM   9625  C CA  . MET G  1 4   ? 51.342  54.937  68.283  1.00 46.97  ? 4   MET G CA  1 
ATOM   9626  C C   . MET G  1 4   ? 50.992  55.890  67.149  1.00 47.41  ? 4   MET G C   1 
ATOM   9627  O O   . MET G  1 4   ? 51.549  55.783  66.064  1.00 47.55  ? 4   MET G O   1 
ATOM   9628  C CB  . MET G  1 4   ? 52.404  55.571  69.171  1.00 45.69  ? 4   MET G CB  1 
ATOM   9629  C CG  . MET G  1 4   ? 52.617  54.834  70.456  1.00 43.06  ? 4   MET G CG  1 
ATOM   9630  S SD  . MET G  1 4   ? 51.061  54.178  71.043  1.00 42.18  ? 4   MET G SD  1 
ATOM   9631  C CE  . MET G  1 4   ? 50.152  55.662  71.492  1.00 38.58  ? 4   MET G CE  1 
ATOM   9632  N N   . THR G  1 5   ? 50.098  56.837  67.376  1.00 48.08  ? 5   THR G N   1 
ATOM   9633  C CA  . THR G  1 5   ? 49.717  57.699  66.269  1.00 49.04  ? 5   THR G CA  1 
ATOM   9634  C C   . THR G  1 5   ? 49.154  59.046  66.669  1.00 48.50  ? 5   THR G C   1 
ATOM   9635  O O   . THR G  1 5   ? 48.243  59.132  67.481  1.00 48.73  ? 5   THR G O   1 
ATOM   9636  C CB  . THR G  1 5   ? 48.658  56.999  65.376  1.00 50.72  ? 5   THR G CB  1 
ATOM   9637  O OG1 . THR G  1 5   ? 49.051  55.640  65.129  1.00 51.16  ? 5   THR G OG1 1 
ATOM   9638  C CG2 . THR G  1 5   ? 48.506  57.741  64.050  1.00 51.09  ? 5   THR G CG2 1 
ATOM   9639  N N   . GLN G  1 6   ? 49.681  60.101  66.063  1.00 49.50  ? 6   GLN G N   1 
ATOM   9640  C CA  . GLN G  1 6   ? 49.220  61.462  66.357  1.00 50.88  ? 6   GLN G CA  1 
ATOM   9641  C C   . GLN G  1 6   ? 49.352  62.292  65.091  1.00 51.53  ? 6   GLN G C   1 
ATOM   9642  O O   . GLN G  1 6   ? 49.867  61.850  64.108  1.00 49.40  ? 6   GLN G O   1 
ATOM   9643  C CB  . GLN G  1 6   ? 50.017  62.057  67.505  1.00 50.63  ? 6   GLN G CB  1 
ATOM   9644  C CG  . GLN G  1 6   ? 51.522  62.094  67.273  1.00 52.07  ? 6   GLN G CG  1 
ATOM   9645  C CD  . GLN G  1 6   ? 52.294  62.373  68.542  1.00 53.04  ? 6   GLN G CD  1 
ATOM   9646  O OE1 . GLN G  1 6   ? 53.502  62.163  68.612  1.00 53.23  ? 6   GLN G OE1 1 
ATOM   9647  N NE2 . GLN G  1 6   ? 51.595  62.853  69.557  1.00 55.89  ? 6   GLN G NE2 1 
ATOM   9648  N N   . SER G  1 7   ? 48.840  63.480  64.957  1.00 53.51  ? 7   SER G N   1 
ATOM   9649  C CA  . SER G  1 7   ? 49.103  63.990  63.588  1.00 54.40  ? 7   SER G CA  1 
ATOM   9650  C C   . SER G  1 7   ? 50.602  64.416  63.746  1.00 54.80  ? 7   SER G C   1 
ATOM   9651  O O   . SER G  1 7   ? 51.155  63.888  64.683  1.00 56.87  ? 7   SER G O   1 
ATOM   9652  C CB  . SER G  1 7   ? 48.215  65.177  63.297  1.00 54.69  ? 7   SER G CB  1 
ATOM   9653  O OG  . SER G  1 7   ? 46.855  64.799  63.184  1.00 51.70  ? 7   SER G OG  1 
ATOM   9654  N N   . PRO G  1 8   ? 51.337  65.356  62.932  1.00 54.70  ? 8   PRO G N   1 
ATOM   9655  C CA  . PRO G  1 8   ? 52.113  66.357  62.061  1.00 54.73  ? 8   PRO G CA  1 
ATOM   9656  C C   . PRO G  1 8   ? 52.374  67.902  62.241  1.00 55.43  ? 8   PRO G C   1 
ATOM   9657  O O   . PRO G  1 8   ? 53.540  68.368  62.316  1.00 56.20  ? 8   PRO G O   1 
ATOM   9658  C CB  . PRO G  1 8   ? 51.574  66.176  60.607  1.00 54.25  ? 8   PRO G CB  1 
ATOM   9659  C CG  . PRO G  1 8   ? 51.143  64.851  60.637  1.00 54.81  ? 8   PRO G CG  1 
ATOM   9660  C CD  . PRO G  1 8   ? 50.408  64.792  61.948  1.00 54.25  ? 8   PRO G CD  1 
ATOM   9661  N N   . SER G  1 9   ? 51.240  68.605  62.331  1.00 55.32  ? 10  SER G N   1 
ATOM   9662  C CA  . SER G  1 9   ? 51.024  70.063  62.323  1.00 55.08  ? 10  SER G CA  1 
ATOM   9663  C C   . SER G  1 9   ? 49.784  70.459  63.164  1.00 53.17  ? 10  SER G C   1 
ATOM   9664  O O   . SER G  1 9   ? 48.942  69.601  63.407  1.00 52.28  ? 10  SER G O   1 
ATOM   9665  C CB  . SER G  1 9   ? 50.738  70.409  60.862  1.00 55.80  ? 10  SER G CB  1 
ATOM   9666  O OG  . SER G  1 9   ? 50.760  71.804  60.659  1.00 58.42  ? 10  SER G OG  1 
ATOM   9667  N N   . LEU G  1 10  ? 49.666  71.721  63.592  1.00 50.63  ? 11  LEU G N   1 
ATOM   9668  C CA  . LEU G  1 10  ? 48.519  72.173  64.371  1.00 48.28  ? 11  LEU G CA  1 
ATOM   9669  C C   . LEU G  1 10  ? 48.839  73.617  64.623  1.00 47.33  ? 11  LEU G C   1 
ATOM   9670  O O   . LEU G  1 10  ? 49.699  73.938  65.430  1.00 46.65  ? 11  LEU G O   1 
ATOM   9671  C CB  . LEU G  1 10  ? 48.397  71.426  65.695  1.00 46.68  ? 11  LEU G CB  1 
ATOM   9672  C CG  . LEU G  1 10  ? 47.077  71.617  66.452  1.00 45.60  ? 11  LEU G CG  1 
ATOM   9673  C CD1 . LEU G  1 10  ? 46.826  73.076  66.757  1.00 46.29  ? 11  LEU G CD1 1 
ATOM   9674  C CD2 . LEU G  1 10  ? 45.944  71.065  65.621  1.00 45.27  ? 11  LEU G CD2 1 
ATOM   9675  N N   . SER G  1 11  ? 48.163  74.478  63.875  1.00 47.44  ? 12  SER G N   1 
ATOM   9676  C CA  . SER G  1 11  ? 48.344  75.916  63.970  1.00 46.84  ? 12  SER G CA  1 
ATOM   9677  C C   . SER G  1 11  ? 47.276  76.498  64.872  1.00 46.45  ? 12  SER G C   1 
ATOM   9678  O O   . SER G  1 11  ? 46.090  76.406  64.588  1.00 45.81  ? 12  SER G O   1 
ATOM   9679  C CB  . SER G  1 11  ? 48.250  76.555  62.577  1.00 46.72  ? 12  SER G CB  1 
ATOM   9680  O OG  . SER G  1 11  ? 49.252  76.050  61.699  1.00 47.75  ? 12  SER G OG  1 
ATOM   9681  N N   . ALA G  1 12  ? 47.707  77.083  65.978  1.00 47.14  ? 13  ALA G N   1 
ATOM   9682  C CA  . ALA G  1 12  ? 46.786  77.700  66.917  1.00 47.12  ? 13  ALA G CA  1 
ATOM   9683  C C   . ALA G  1 12  ? 47.395  79.043  67.274  1.00 47.60  ? 13  ALA G C   1 
ATOM   9684  O O   . ALA G  1 12  ? 48.506  79.356  66.825  1.00 48.26  ? 13  ALA G O   1 
ATOM   9685  C CB  . ALA G  1 12  ? 46.636  76.843  68.141  1.00 47.74  ? 13  ALA G CB  1 
ATOM   9686  N N   . SER G  1 13  ? 46.676  79.831  68.068  1.00 46.86  ? 14  SER G N   1 
ATOM   9687  C CA  . SER G  1 13  ? 47.142  81.158  68.469  1.00 47.42  ? 14  SER G CA  1 
ATOM   9688  C C   . SER G  1 13  ? 47.469  81.206  69.962  1.00 47.64  ? 14  SER G C   1 
ATOM   9689  O O   . SER G  1 13  ? 47.184  80.260  70.695  1.00 48.60  ? 14  SER G O   1 
ATOM   9690  C CB  . SER G  1 13  ? 46.065  82.199  68.143  1.00 47.93  ? 14  SER G CB  1 
ATOM   9691  O OG  . SER G  1 13  ? 45.608  82.073  66.802  1.00 47.87  ? 14  SER G OG  1 
ATOM   9692  N N   . VAL G  1 14  ? 48.075  82.297  70.418  1.00 47.69  ? 15  VAL G N   1 
ATOM   9693  C CA  . VAL G  1 14  ? 48.394  82.417  71.840  1.00 47.39  ? 15  VAL G CA  1 
ATOM   9694  C C   . VAL G  1 14  ? 47.075  82.417  72.589  1.00 48.38  ? 15  VAL G C   1 
ATOM   9695  O O   . VAL G  1 14  ? 46.186  83.191  72.262  1.00 49.69  ? 15  VAL G O   1 
ATOM   9696  C CB  . VAL G  1 14  ? 49.126  83.741  72.177  1.00 45.87  ? 15  VAL G CB  1 
ATOM   9697  C CG1 . VAL G  1 14  ? 49.091  83.988  73.662  1.00 44.74  ? 15  VAL G CG1 1 
ATOM   9698  C CG2 . VAL G  1 14  ? 50.562  83.682  71.715  1.00 45.73  ? 15  VAL G CG2 1 
ATOM   9699  N N   . GLY G  1 15  ? 46.938  81.536  73.573  1.00 48.88  ? 16  GLY G N   1 
ATOM   9700  C CA  . GLY G  1 15  ? 45.714  81.494  74.352  1.00 49.24  ? 16  GLY G CA  1 
ATOM   9701  C C   . GLY G  1 15  ? 44.592  80.630  73.813  1.00 49.59  ? 16  GLY G C   1 
ATOM   9702  O O   . GLY G  1 15  ? 43.534  80.521  74.431  1.00 51.15  ? 16  GLY G O   1 
ATOM   9703  N N   . ASP G  1 16  ? 44.801  80.020  72.661  1.00 49.40  ? 17  ASP G N   1 
ATOM   9704  C CA  . ASP G  1 16  ? 43.784  79.163  72.087  1.00 49.79  ? 17  ASP G CA  1 
ATOM   9705  C C   . ASP G  1 16  ? 43.873  77.867  72.865  1.00 48.50  ? 17  ASP G C   1 
ATOM   9706  O O   . ASP G  1 16  ? 44.960  77.433  73.199  1.00 49.19  ? 17  ASP G O   1 
ATOM   9707  C CB  . ASP G  1 16  ? 44.098  78.932  70.613  1.00 53.84  ? 17  ASP G CB  1 
ATOM   9708  C CG  . ASP G  1 16  ? 44.317  80.244  69.850  1.00 57.55  ? 17  ASP G CG  1 
ATOM   9709  O OD1 . ASP G  1 16  ? 44.690  81.252  70.499  1.00 59.18  ? 17  ASP G OD1 1 
ATOM   9710  O OD2 . ASP G  1 16  ? 44.133  80.270  68.608  1.00 58.24  ? 17  ASP G OD2 1 
ATOM   9711  N N   . ARG G  1 17  ? 42.742  77.259  73.193  1.00 48.30  ? 18  ARG G N   1 
ATOM   9712  C CA  . ARG G  1 17  ? 42.782  75.997  73.935  1.00 47.58  ? 18  ARG G CA  1 
ATOM   9713  C C   . ARG G  1 17  ? 43.143  74.949  72.905  1.00 45.72  ? 18  ARG G C   1 
ATOM   9714  O O   . ARG G  1 17  ? 42.816  75.089  71.737  1.00 45.29  ? 18  ARG G O   1 
ATOM   9715  C CB  . ARG G  1 17  ? 41.424  75.666  74.570  1.00 48.85  ? 18  ARG G CB  1 
ATOM   9716  C CG  . ARG G  1 17  ? 41.447  74.457  75.501  1.00 50.55  ? 18  ARG G CG  1 
ATOM   9717  C CD  . ARG G  1 17  ? 40.038  73.949  75.801  1.00 52.89  ? 18  ARG G CD  1 
ATOM   9718  N NE  . ARG G  1 17  ? 39.929  73.280  77.098  1.00 54.20  ? 18  ARG G NE  1 
ATOM   9719  C CZ  . ARG G  1 17  ? 40.188  73.869  78.265  1.00 56.63  ? 18  ARG G CZ  1 
ATOM   9720  N NH1 . ARG G  1 17  ? 40.577  75.138  78.302  1.00 57.32  ? 18  ARG G NH1 1 
ATOM   9721  N NH2 . ARG G  1 17  ? 40.042  73.201  79.406  1.00 58.14  ? 18  ARG G NH2 1 
ATOM   9722  N N   . VAL G  1 18  ? 43.815  73.895  73.328  1.00 44.72  ? 19  VAL G N   1 
ATOM   9723  C CA  . VAL G  1 18  ? 44.229  72.889  72.380  1.00 44.08  ? 19  VAL G CA  1 
ATOM   9724  C C   . VAL G  1 18  ? 44.239  71.518  73.006  1.00 43.47  ? 19  VAL G C   1 
ATOM   9725  O O   . VAL G  1 18  ? 44.275  71.388  74.224  1.00 43.22  ? 19  VAL G O   1 
ATOM   9726  C CB  . VAL G  1 18  ? 45.632  73.231  71.865  1.00 45.44  ? 19  VAL G CB  1 
ATOM   9727  C CG1 . VAL G  1 18  ? 46.085  72.224  70.832  1.00 47.15  ? 19  VAL G CG1 1 
ATOM   9728  C CG2 . VAL G  1 18  ? 45.629  74.629  71.279  1.00 45.75  ? 19  VAL G CG2 1 
ATOM   9729  N N   . THR G  1 19  ? 44.205  70.494  72.161  1.00 43.45  ? 20  THR G N   1 
ATOM   9730  C CA  . THR G  1 19  ? 44.219  69.113  72.621  1.00 44.72  ? 20  THR G CA  1 
ATOM   9731  C C   . THR G  1 19  ? 44.929  68.212  71.613  1.00 44.05  ? 20  THR G C   1 
ATOM   9732  O O   . THR G  1 19  ? 44.461  68.061  70.488  1.00 44.65  ? 20  THR G O   1 
ATOM   9733  C CB  . THR G  1 19  ? 42.779  68.586  72.822  1.00 45.94  ? 20  THR G CB  1 
ATOM   9734  O OG1 . THR G  1 19  ? 42.155  69.287  73.904  1.00 47.62  ? 20  THR G OG1 1 
ATOM   9735  C CG2 . THR G  1 19  ? 42.791  67.102  73.137  1.00 47.44  ? 20  THR G CG2 1 
ATOM   9736  N N   . ILE G  1 20  ? 46.046  67.608  72.010  1.00 43.12  ? 21  ILE G N   1 
ATOM   9737  C CA  . ILE G  1 20  ? 46.781  66.713  71.108  1.00 43.07  ? 21  ILE G CA  1 
ATOM   9738  C C   . ILE G  1 20  ? 46.486  65.251  71.457  1.00 42.75  ? 21  ILE G C   1 
ATOM   9739  O O   . ILE G  1 20  ? 47.133  64.663  72.315  1.00 43.34  ? 21  ILE G O   1 
ATOM   9740  C CB  . ILE G  1 20  ? 48.311  66.965  71.203  1.00 43.30  ? 21  ILE G CB  1 
ATOM   9741  C CG1 . ILE G  1 20  ? 48.598  68.448  70.945  1.00 42.66  ? 21  ILE G CG1 1 
ATOM   9742  C CG2 . ILE G  1 20  ? 49.065  66.074  70.220  1.00 41.73  ? 21  ILE G CG2 1 
ATOM   9743  C CD1 . ILE G  1 20  ? 50.054  68.825  71.013  1.00 41.00  ? 21  ILE G CD1 1 
ATOM   9744  N N   . THR G  1 21  ? 45.504  64.663  70.790  1.00 42.70  ? 22  THR G N   1 
ATOM   9745  C CA  . THR G  1 21  ? 45.137  63.289  71.074  1.00 42.58  ? 22  THR G CA  1 
ATOM   9746  C C   . THR G  1 21  ? 46.170  62.351  70.480  1.00 42.87  ? 22  THR G C   1 
ATOM   9747  O O   . THR G  1 21  ? 46.849  62.696  69.523  1.00 41.51  ? 22  THR G O   1 
ATOM   9748  C CB  . THR G  1 21  ? 43.785  62.933  70.480  1.00 42.78  ? 22  THR G CB  1 
ATOM   9749  O OG1 . THR G  1 21  ? 44.007  62.320  69.215  1.00 44.85  ? 22  THR G OG1 1 
ATOM   9750  C CG2 . THR G  1 21  ? 42.909  64.182  70.289  1.00 41.97  ? 22  THR G CG2 1 
ATOM   9751  N N   . CYS G  1 22  ? 46.261  61.150  71.038  1.00 44.95  ? 23  CYS G N   1 
ATOM   9752  C CA  . CYS G  1 22  ? 47.240  60.160  70.601  1.00 46.65  ? 23  CYS G CA  1 
ATOM   9753  C C   . CYS G  1 22  ? 46.704  58.747  70.832  1.00 45.36  ? 23  CYS G C   1 
ATOM   9754  O O   . CYS G  1 22  ? 46.715  58.274  71.953  1.00 45.77  ? 23  CYS G O   1 
ATOM   9755  C CB  . CYS G  1 22  ? 48.548  60.396  71.393  1.00 49.06  ? 23  CYS G CB  1 
ATOM   9756  S SG  . CYS G  1 22  ? 49.733  59.008  71.566  1.00 56.26  ? 23  CYS G SG  1 
ATOM   9757  N N   . ARG G  1 23  ? 46.240  58.078  69.776  1.00 44.76  ? 24  ARG G N   1 
ATOM   9758  C CA  . ARG G  1 23  ? 45.687  56.722  69.895  1.00 44.65  ? 24  ARG G CA  1 
ATOM   9759  C C   . ARG G  1 23  ? 46.673  55.568  69.695  1.00 44.19  ? 24  ARG G C   1 
ATOM   9760  O O   . ARG G  1 23  ? 47.722  55.727  69.089  1.00 43.37  ? 24  ARG G O   1 
ATOM   9761  C CB  . ARG G  1 23  ? 44.490  56.553  68.950  1.00 45.37  ? 24  ARG G CB  1 
ATOM   9762  C CG  . ARG G  1 23  ? 44.334  57.667  67.911  1.00 50.38  ? 24  ARG G CG  1 
ATOM   9763  C CD  . ARG G  1 23  ? 42.924  57.705  67.263  1.00 52.82  ? 24  ARG G CD  1 
ATOM   9764  N NE  . ARG G  1 23  ? 41.834  57.800  68.251  1.00 54.47  ? 24  ARG G NE  1 
ATOM   9765  C CZ  . ARG G  1 23  ? 40.804  58.647  68.179  1.00 53.60  ? 24  ARG G CZ  1 
ATOM   9766  N NH1 . ARG G  1 23  ? 40.696  59.502  67.168  1.00 53.88  ? 24  ARG G NH1 1 
ATOM   9767  N NH2 . ARG G  1 23  ? 39.866  58.632  69.118  1.00 52.17  ? 24  ARG G NH2 1 
ATOM   9768  N N   . ALA G  1 24  ? 46.316  54.398  70.215  1.00 44.47  ? 25  ALA G N   1 
ATOM   9769  C CA  . ALA G  1 24  ? 47.164  53.210  70.134  1.00 45.02  ? 25  ALA G CA  1 
ATOM   9770  C C   . ALA G  1 24  ? 46.527  52.067  69.340  1.00 46.38  ? 25  ALA G C   1 
ATOM   9771  O O   . ALA G  1 24  ? 45.316  52.053  69.124  1.00 47.19  ? 25  ALA G O   1 
ATOM   9772  C CB  . ALA G  1 24  ? 47.494  52.732  71.539  1.00 43.90  ? 25  ALA G CB  1 
ATOM   9773  N N   . SER G  1 25  ? 47.343  51.105  68.912  1.00 47.17  ? 26  SER G N   1 
ATOM   9774  C CA  . SER G  1 25  ? 46.849  49.958  68.150  1.00 47.59  ? 26  SER G CA  1 
ATOM   9775  C C   . SER G  1 25  ? 46.223  48.916  69.071  1.00 48.32  ? 26  SER G C   1 
ATOM   9776  O O   . SER G  1 25  ? 45.195  48.325  68.744  1.00 47.56  ? 26  SER G O   1 
ATOM   9777  C CB  . SER G  1 25  ? 47.991  49.334  67.346  1.00 48.12  ? 26  SER G CB  1 
ATOM   9778  O OG  . SER G  1 25  ? 49.206  49.337  68.082  1.00 48.75  ? 26  SER G OG  1 
ATOM   9779  N N   . GLN G  1 26  ? 46.862  48.707  70.222  1.00 49.45  ? 27  GLN G N   1 
ATOM   9780  C CA  . GLN G  1 26  ? 46.418  47.767  71.258  1.00 51.49  ? 27  GLN G CA  1 
ATOM   9781  C C   . GLN G  1 26  ? 46.434  48.570  72.563  1.00 52.15  ? 27  GLN G C   1 
ATOM   9782  O O   . GLN G  1 26  ? 47.044  49.635  72.611  1.00 53.10  ? 27  GLN G O   1 
ATOM   9783  C CB  . GLN G  1 26  ? 47.377  46.566  71.355  1.00 52.25  ? 27  GLN G CB  1 
ATOM   9784  C CG  . GLN G  1 26  ? 47.237  45.508  70.239  1.00 55.31  ? 27  GLN G CG  1 
ATOM   9785  C CD  . GLN G  1 26  ? 47.542  46.038  68.821  1.00 57.19  ? 27  GLN G CD  1 
ATOM   9786  O OE1 . GLN G  1 26  ? 48.663  46.480  68.524  1.00 57.29  ? 27  GLN G OE1 1 
ATOM   9787  N NE2 . GLN G  1 26  ? 46.540  45.985  67.943  1.00 56.38  ? 27  GLN G NE2 1 
ATOM   9788  N N   . SER G  1 27  ? 45.787  48.082  73.618  1.00 52.53  ? 28  SER G N   1 
ATOM   9789  C CA  . SER G  1 27  ? 45.740  48.844  74.874  1.00 53.60  ? 28  SER G CA  1 
ATOM   9790  C C   . SER G  1 27  ? 47.043  48.928  75.685  1.00 54.12  ? 28  SER G C   1 
ATOM   9791  O O   . SER G  1 27  ? 47.711  47.929  75.953  1.00 53.84  ? 28  SER G O   1 
ATOM   9792  C CB  . SER G  1 27  ? 44.609  48.320  75.772  1.00 53.61  ? 28  SER G CB  1 
ATOM   9793  O OG  . SER G  1 27  ? 44.227  49.290  76.741  1.00 51.55  ? 28  SER G OG  1 
ATOM   9794  N N   . ILE G  1 28  ? 47.385  50.145  76.086  1.00 55.29  ? 29  ILE G N   1 
ATOM   9795  C CA  . ILE G  1 28  ? 48.597  50.384  76.859  1.00 57.08  ? 29  ILE G CA  1 
ATOM   9796  C C   . ILE G  1 28  ? 48.249  50.737  78.303  1.00 57.92  ? 29  ILE G C   1 
ATOM   9797  O O   . ILE G  1 28  ? 49.139  50.871  79.147  1.00 59.11  ? 29  ILE G O   1 
ATOM   9798  C CB  . ILE G  1 28  ? 49.439  51.562  76.261  1.00 57.75  ? 29  ILE G CB  1 
ATOM   9799  C CG1 . ILE G  1 28  ? 48.660  52.874  76.352  1.00 57.31  ? 29  ILE G CG1 1 
ATOM   9800  C CG2 . ILE G  1 28  ? 49.756  51.305  74.798  1.00 56.74  ? 29  ILE G CG2 1 
ATOM   9801  C CD1 . ILE G  1 28  ? 49.427  54.058  75.830  1.00 56.84  ? 29  ILE G CD1 1 
ATOM   9802  N N   . SER G  1 29  ? 46.953  50.877  78.580  1.00 57.69  ? 30  SER G N   1 
ATOM   9803  C CA  . SER G  1 29  ? 46.475  51.244  79.912  1.00 56.16  ? 30  SER G CA  1 
ATOM   9804  C C   . SER G  1 29  ? 46.812  52.713  80.166  1.00 56.25  ? 30  SER G C   1 
ATOM   9805  O O   . SER G  1 29  ? 46.215  53.607  79.553  1.00 55.69  ? 30  SER G O   1 
ATOM   9806  C CB  . SER G  1 29  ? 47.124  50.373  80.988  1.00 54.15  ? 30  SER G CB  1 
ATOM   9807  O OG  . SER G  1 29  ? 46.628  50.729  82.266  1.00 53.95  ? 30  SER G OG  1 
ATOM   9808  N N   . SER G  1 30  ? 47.773  52.953  81.061  1.00 55.49  ? 31  SER G N   1 
ATOM   9809  C CA  . SER G  1 30  ? 48.213  54.308  81.396  1.00 54.56  ? 31  SER G CA  1 
ATOM   9810  C C   . SER G  1 30  ? 49.707  54.430  81.222  1.00 53.65  ? 31  SER G C   1 
ATOM   9811  O O   . SER G  1 30  ? 50.383  54.981  82.082  1.00 55.45  ? 31  SER G O   1 
ATOM   9812  C CB  . SER G  1 30  ? 47.866  54.637  82.836  1.00 53.66  ? 31  SER G CB  1 
ATOM   9813  O OG  . SER G  1 30  ? 46.498  54.391  83.057  1.00 56.54  ? 31  SER G OG  1 
ATOM   9814  N N   . TYR G  1 31  ? 50.217  53.914  80.110  1.00 52.87  ? 32  TYR G N   1 
ATOM   9815  C CA  . TYR G  1 31  ? 51.647  53.945  79.831  1.00 52.31  ? 32  TYR G CA  1 
ATOM   9816  C C   . TYR G  1 31  ? 51.992  54.928  78.725  1.00 50.73  ? 32  TYR G C   1 
ATOM   9817  O O   . TYR G  1 31  ? 52.951  54.757  77.976  1.00 50.37  ? 32  TYR G O   1 
ATOM   9818  C CB  . TYR G  1 31  ? 52.125  52.531  79.502  1.00 53.87  ? 32  TYR G CB  1 
ATOM   9819  C CG  . TYR G  1 31  ? 52.006  51.609  80.703  1.00 55.77  ? 32  TYR G CG  1 
ATOM   9820  C CD1 . TYR G  1 31  ? 50.810  51.528  81.422  1.00 56.26  ? 32  TYR G CD1 1 
ATOM   9821  C CD2 . TYR G  1 31  ? 53.088  50.853  81.143  1.00 56.02  ? 32  TYR G CD2 1 
ATOM   9822  C CE1 . TYR G  1 31  ? 50.689  50.731  82.543  1.00 56.70  ? 32  TYR G CE1 1 
ATOM   9823  C CE2 . TYR G  1 31  ? 52.979  50.040  82.273  1.00 57.50  ? 32  TYR G CE2 1 
ATOM   9824  C CZ  . TYR G  1 31  ? 51.772  49.989  82.970  1.00 57.94  ? 32  TYR G CZ  1 
ATOM   9825  O OH  . TYR G  1 31  ? 51.647  49.218  84.111  1.00 58.47  ? 32  TYR G OH  1 
ATOM   9826  N N   . LEU G  1 32  ? 51.193  55.985  78.660  1.00 49.51  ? 33  LEU G N   1 
ATOM   9827  C CA  . LEU G  1 32  ? 51.365  57.039  77.679  1.00 46.72  ? 33  LEU G CA  1 
ATOM   9828  C C   . LEU G  1 32  ? 52.068  58.197  78.380  1.00 45.41  ? 33  LEU G C   1 
ATOM   9829  O O   . LEU G  1 32  ? 51.577  58.724  79.392  1.00 43.51  ? 33  LEU G O   1 
ATOM   9830  C CB  . LEU G  1 32  ? 49.990  57.461  77.143  1.00 44.53  ? 33  LEU G CB  1 
ATOM   9831  C CG  . LEU G  1 32  ? 49.903  58.392  75.935  1.00 44.26  ? 33  LEU G CG  1 
ATOM   9832  C CD1 . LEU G  1 32  ? 50.026  59.840  76.363  1.00 43.17  ? 33  LEU G CD1 1 
ATOM   9833  C CD2 . LEU G  1 32  ? 50.982  58.019  74.939  1.00 44.32  ? 33  LEU G CD2 1 
ATOM   9834  N N   . ASN G  1 33  ? 53.231  58.561  77.848  1.00 43.94  ? 34  ASN G N   1 
ATOM   9835  C CA  . ASN G  1 33  ? 54.029  59.647  78.396  1.00 44.48  ? 34  ASN G CA  1 
ATOM   9836  C C   . ASN G  1 33  ? 54.074  60.745  77.355  1.00 44.94  ? 34  ASN G C   1 
ATOM   9837  O O   . ASN G  1 33  ? 54.053  60.449  76.166  1.00 46.34  ? 34  ASN G O   1 
ATOM   9838  C CB  . ASN G  1 33  ? 55.435  59.148  78.674  1.00 43.67  ? 34  ASN G CB  1 
ATOM   9839  C CG  . ASN G  1 33  ? 55.440  57.741  79.187  1.00 43.96  ? 34  ASN G CG  1 
ATOM   9840  O OD1 . ASN G  1 33  ? 55.702  57.492  80.363  1.00 42.89  ? 34  ASN G OD1 1 
ATOM   9841  N ND2 . ASN G  1 33  ? 55.118  56.801  78.308  1.00 43.92  ? 34  ASN G ND2 1 
ATOM   9842  N N   . TRP G  1 34  ? 54.127  62.003  77.785  1.00 44.88  ? 35  TRP G N   1 
ATOM   9843  C CA  . TRP G  1 34  ? 54.177  63.118  76.835  1.00 44.58  ? 35  TRP G CA  1 
ATOM   9844  C C   . TRP G  1 34  ? 55.510  63.833  76.919  1.00 43.44  ? 35  TRP G C   1 
ATOM   9845  O O   . TRP G  1 34  ? 56.099  63.903  77.995  1.00 45.15  ? 35  TRP G O   1 
ATOM   9846  C CB  . TRP G  1 34  ? 53.064  64.133  77.118  1.00 44.66  ? 35  TRP G CB  1 
ATOM   9847  C CG  . TRP G  1 34  ? 51.667  63.678  76.773  1.00 44.78  ? 35  TRP G CG  1 
ATOM   9848  C CD1 . TRP G  1 34  ? 50.678  63.342  77.648  1.00 44.88  ? 35  TRP G CD1 1 
ATOM   9849  C CD2 . TRP G  1 34  ? 51.103  63.535  75.457  1.00 44.51  ? 35  TRP G CD2 1 
ATOM   9850  N NE1 . TRP G  1 34  ? 49.530  63.002  76.967  1.00 45.48  ? 35  TRP G NE1 1 
ATOM   9851  C CE2 . TRP G  1 34  ? 49.762  63.111  75.621  1.00 44.59  ? 35  TRP G CE2 1 
ATOM   9852  C CE3 . TRP G  1 34  ? 51.600  63.724  74.159  1.00 43.85  ? 35  TRP G CE3 1 
ATOM   9853  C CZ2 . TRP G  1 34  ? 48.906  62.870  74.533  1.00 43.85  ? 35  TRP G CZ2 1 
ATOM   9854  C CZ3 . TRP G  1 34  ? 50.746  63.484  73.075  1.00 45.60  ? 35  TRP G CZ3 1 
ATOM   9855  C CH2 . TRP G  1 34  ? 49.411  63.061  73.275  1.00 44.55  ? 35  TRP G CH2 1 
ATOM   9856  N N   . TYR G  1 35  ? 55.986  64.369  75.798  1.00 41.02  ? 36  TYR G N   1 
ATOM   9857  C CA  . TYR G  1 35  ? 57.259  65.093  75.797  1.00 39.01  ? 36  TYR G CA  1 
ATOM   9858  C C   . TYR G  1 35  ? 57.247  66.362  74.975  1.00 37.73  ? 36  TYR G C   1 
ATOM   9859  O O   . TYR G  1 35  ? 56.743  66.364  73.874  1.00 39.86  ? 36  TYR G O   1 
ATOM   9860  C CB  . TYR G  1 35  ? 58.387  64.230  75.251  1.00 37.17  ? 36  TYR G CB  1 
ATOM   9861  C CG  . TYR G  1 35  ? 58.694  63.015  76.057  1.00 34.86  ? 36  TYR G CG  1 
ATOM   9862  C CD1 . TYR G  1 35  ? 58.071  61.817  75.777  1.00 33.32  ? 36  TYR G CD1 1 
ATOM   9863  C CD2 . TYR G  1 35  ? 59.673  63.047  77.046  1.00 34.13  ? 36  TYR G CD2 1 
ATOM   9864  C CE1 . TYR G  1 35  ? 58.420  60.673  76.439  1.00 35.53  ? 36  TYR G CE1 1 
ATOM   9865  C CE2 . TYR G  1 35  ? 60.033  61.907  77.724  1.00 34.67  ? 36  TYR G CE2 1 
ATOM   9866  C CZ  . TYR G  1 35  ? 59.408  60.713  77.410  1.00 36.07  ? 36  TYR G CZ  1 
ATOM   9867  O OH  . TYR G  1 35  ? 59.783  59.539  78.024  1.00 36.51  ? 36  TYR G OH  1 
ATOM   9868  N N   . GLN G  1 36  ? 57.816  67.437  75.497  1.00 35.66  ? 37  GLN G N   1 
ATOM   9869  C CA  . GLN G  1 36  ? 57.881  68.676  74.747  1.00 35.05  ? 37  GLN G CA  1 
ATOM   9870  C C   . GLN G  1 36  ? 59.266  68.599  74.089  1.00 36.01  ? 37  GLN G C   1 
ATOM   9871  O O   . GLN G  1 36  ? 60.175  68.003  74.646  1.00 35.65  ? 37  GLN G O   1 
ATOM   9872  C CB  . GLN G  1 36  ? 57.781  69.861  75.701  1.00 33.73  ? 37  GLN G CB  1 
ATOM   9873  C CG  . GLN G  1 36  ? 57.242  71.147  75.098  1.00 31.86  ? 37  GLN G CG  1 
ATOM   9874  C CD  . GLN G  1 36  ? 57.564  72.364  75.960  1.00 30.31  ? 37  GLN G CD  1 
ATOM   9875  O OE1 . GLN G  1 36  ? 58.713  72.566  76.357  1.00 27.90  ? 37  GLN G OE1 1 
ATOM   9876  N NE2 . GLN G  1 36  ? 56.554  73.178  76.246  1.00 28.09  ? 37  GLN G NE2 1 
ATOM   9877  N N   . GLN G  1 37  ? 59.426  69.170  72.900  1.00 38.23  ? 38  GLN G N   1 
ATOM   9878  C CA  . GLN G  1 37  ? 60.715  69.118  72.186  1.00 40.24  ? 38  GLN G CA  1 
ATOM   9879  C C   . GLN G  1 37  ? 60.917  70.379  71.327  1.00 41.39  ? 38  GLN G C   1 
ATOM   9880  O O   . GLN G  1 37  ? 60.488  70.436  70.165  1.00 41.84  ? 38  GLN G O   1 
ATOM   9881  C CB  . GLN G  1 37  ? 60.755  67.866  71.294  1.00 38.69  ? 38  GLN G CB  1 
ATOM   9882  C CG  . GLN G  1 37  ? 62.009  67.017  71.406  1.00 38.18  ? 38  GLN G CG  1 
ATOM   9883  C CD  . GLN G  1 37  ? 63.112  67.433  70.461  1.00 37.58  ? 38  GLN G CD  1 
ATOM   9884  O OE1 . GLN G  1 37  ? 62.848  67.966  69.391  1.00 38.75  ? 38  GLN G OE1 1 
ATOM   9885  N NE2 . GLN G  1 37  ? 64.357  67.160  70.836  1.00 36.55  ? 38  GLN G NE2 1 
ATOM   9886  N N   . LYS G  1 38  ? 61.566  71.387  71.900  1.00 41.94  ? 39  LYS G N   1 
ATOM   9887  C CA  . LYS G  1 38  ? 61.793  72.626  71.189  1.00 43.55  ? 39  LYS G CA  1 
ATOM   9888  C C   . LYS G  1 38  ? 62.856  72.392  70.134  1.00 46.31  ? 39  LYS G C   1 
ATOM   9889  O O   . LYS G  1 38  ? 63.584  71.407  70.190  1.00 45.67  ? 39  LYS G O   1 
ATOM   9890  C CB  . LYS G  1 38  ? 62.222  73.718  72.151  1.00 42.87  ? 39  LYS G CB  1 
ATOM   9891  C CG  . LYS G  1 38  ? 61.235  73.976  73.263  1.00 43.64  ? 39  LYS G CG  1 
ATOM   9892  C CD  . LYS G  1 38  ? 59.975  74.642  72.766  1.00 44.60  ? 39  LYS G CD  1 
ATOM   9893  C CE  . LYS G  1 38  ? 59.069  75.045  73.941  1.00 46.11  ? 39  LYS G CE  1 
ATOM   9894  N NZ  . LYS G  1 38  ? 57.973  75.992  73.545  1.00 46.13  ? 39  LYS G NZ  1 
ATOM   9895  N N   . PRO G  1 39  ? 62.955  73.303  69.151  1.00 49.24  ? 40  PRO G N   1 
ATOM   9896  C CA  . PRO G  1 39  ? 63.917  73.221  68.051  1.00 50.72  ? 40  PRO G CA  1 
ATOM   9897  C C   . PRO G  1 39  ? 65.380  73.318  68.470  1.00 52.25  ? 40  PRO G C   1 
ATOM   9898  O O   . PRO G  1 39  ? 65.848  74.382  68.895  1.00 53.71  ? 40  PRO G O   1 
ATOM   9899  C CB  . PRO G  1 39  ? 63.515  74.391  67.151  1.00 50.44  ? 40  PRO G CB  1 
ATOM   9900  C CG  . PRO G  1 39  ? 62.089  74.644  67.499  1.00 50.44  ? 40  PRO G CG  1 
ATOM   9901  C CD  . PRO G  1 39  ? 62.115  74.501  68.991  1.00 50.58  ? 40  PRO G CD  1 
ATOM   9902  N N   . GLY G  1 40  ? 66.096  72.205  68.343  1.00 51.96  ? 41  GLY G N   1 
ATOM   9903  C CA  . GLY G  1 40  ? 67.506  72.194  68.674  1.00 50.06  ? 41  GLY G CA  1 
ATOM   9904  C C   . GLY G  1 40  ? 67.840  71.783  70.082  1.00 49.34  ? 41  GLY G C   1 
ATOM   9905  O O   . GLY G  1 40  ? 68.999  71.452  70.353  1.00 50.14  ? 41  GLY G O   1 
ATOM   9906  N N   . LYS G  1 41  ? 66.847  71.809  70.971  1.00 47.82  ? 42  LYS G N   1 
ATOM   9907  C CA  . LYS G  1 41  ? 67.060  71.436  72.369  1.00 47.97  ? 42  LYS G CA  1 
ATOM   9908  C C   . LYS G  1 41  ? 66.862  69.951  72.656  1.00 46.51  ? 42  LYS G C   1 
ATOM   9909  O O   . LYS G  1 41  ? 66.811  69.122  71.742  1.00 46.11  ? 42  LYS G O   1 
ATOM   9910  C CB  . LYS G  1 41  ? 66.160  72.258  73.306  1.00 49.20  ? 42  LYS G CB  1 
ATOM   9911  C CG  . LYS G  1 41  ? 66.823  73.509  73.894  1.00 53.07  ? 42  LYS G CG  1 
ATOM   9912  C CD  . LYS G  1 41  ? 68.069  73.171  74.756  1.00 56.34  ? 42  LYS G CD  1 
ATOM   9913  C CE  . LYS G  1 41  ? 68.554  74.352  75.650  1.00 56.50  ? 42  LYS G CE  1 
ATOM   9914  N NZ  . LYS G  1 41  ? 69.054  75.562  74.914  1.00 56.79  ? 42  LYS G NZ  1 
ATOM   9915  N N   . VAL G  1 42  ? 66.757  69.630  73.940  1.00 45.06  ? 43  VAL G N   1 
ATOM   9916  C CA  . VAL G  1 42  ? 66.596  68.259  74.389  1.00 44.98  ? 43  VAL G CA  1 
ATOM   9917  C C   . VAL G  1 42  ? 65.165  67.970  74.826  1.00 45.26  ? 43  VAL G C   1 
ATOM   9918  O O   . VAL G  1 42  ? 64.487  68.826  75.383  1.00 45.02  ? 43  VAL G O   1 
ATOM   9919  C CB  . VAL G  1 42  ? 67.551  67.979  75.566  1.00 44.95  ? 43  VAL G CB  1 
ATOM   9920  C CG1 . VAL G  1 42  ? 67.434  66.524  76.027  1.00 43.66  ? 43  VAL G CG1 1 
ATOM   9921  C CG2 . VAL G  1 42  ? 68.975  68.313  75.149  1.00 44.51  ? 43  VAL G CG2 1 
ATOM   9922  N N   . PRO G  1 43  ? 64.682  66.747  74.576  1.00 45.81  ? 44  PRO G N   1 
ATOM   9923  C CA  . PRO G  1 43  ? 63.308  66.421  74.981  1.00 45.36  ? 44  PRO G CA  1 
ATOM   9924  C C   . PRO G  1 43  ? 63.078  66.562  76.494  1.00 45.24  ? 44  PRO G C   1 
ATOM   9925  O O   . PRO G  1 43  ? 63.875  66.081  77.294  1.00 45.98  ? 44  PRO G O   1 
ATOM   9926  C CB  . PRO G  1 43  ? 63.150  64.970  74.520  1.00 44.65  ? 44  PRO G CB  1 
ATOM   9927  C CG  . PRO G  1 43  ? 64.099  64.869  73.363  1.00 44.18  ? 44  PRO G CG  1 
ATOM   9928  C CD  . PRO G  1 43  ? 65.301  65.631  73.836  1.00 44.23  ? 44  PRO G CD  1 
ATOM   9929  N N   . LYS G  1 44  ? 62.004  67.230  76.893  1.00 44.66  ? 45  LYS G N   1 
ATOM   9930  C CA  . LYS G  1 44  ? 61.703  67.347  78.312  1.00 43.82  ? 45  LYS G CA  1 
ATOM   9931  C C   . LYS G  1 44  ? 60.590  66.358  78.605  1.00 42.95  ? 45  LYS G C   1 
ATOM   9932  O O   . LYS G  1 44  ? 59.742  66.126  77.749  1.00 42.95  ? 45  LYS G O   1 
ATOM   9933  C CB  . LYS G  1 44  ? 61.226  68.754  78.669  1.00 44.42  ? 45  LYS G CB  1 
ATOM   9934  C CG  . LYS G  1 44  ? 60.561  68.802  80.036  1.00 49.05  ? 45  LYS G CG  1 
ATOM   9935  C CD  . LYS G  1 44  ? 60.444  70.219  80.614  1.00 54.18  ? 45  LYS G CD  1 
ATOM   9936  C CE  . LYS G  1 44  ? 60.299  70.190  82.160  1.00 55.11  ? 45  LYS G CE  1 
ATOM   9937  N NZ  . LYS G  1 44  ? 60.109  71.546  82.783  1.00 54.64  ? 45  LYS G NZ  1 
ATOM   9938  N N   . LEU G  1 45  ? 60.594  65.733  79.777  1.00 41.76  ? 46  LEU G N   1 
ATOM   9939  C CA  . LEU G  1 45  ? 59.485  64.838  80.066  1.00 41.56  ? 46  LEU G CA  1 
ATOM   9940  C C   . LEU G  1 45  ? 58.364  65.791  80.458  1.00 40.70  ? 46  LEU G C   1 
ATOM   9941  O O   . LEU G  1 45  ? 58.608  66.771  81.163  1.00 39.13  ? 46  LEU G O   1 
ATOM   9942  C CB  . LEU G  1 45  ? 59.777  63.892  81.236  1.00 41.87  ? 46  LEU G CB  1 
ATOM   9943  C CG  . LEU G  1 45  ? 58.548  63.045  81.634  1.00 40.85  ? 46  LEU G CG  1 
ATOM   9944  C CD1 . LEU G  1 45  ? 58.244  61.997  80.557  1.00 37.24  ? 46  LEU G CD1 1 
ATOM   9945  C CD2 . LEU G  1 45  ? 58.803  62.383  82.981  1.00 40.97  ? 46  LEU G CD2 1 
ATOM   9946  N N   . LEU G  1 46  ? 57.151  65.511  79.989  1.00 40.04  ? 47  LEU G N   1 
ATOM   9947  C CA  . LEU G  1 46  ? 56.003  66.354  80.287  1.00 39.93  ? 47  LEU G CA  1 
ATOM   9948  C C   . LEU G  1 46  ? 54.906  65.576  81.009  1.00 39.93  ? 47  LEU G C   1 
ATOM   9949  O O   . LEU G  1 46  ? 54.242  66.097  81.902  1.00 37.08  ? 47  LEU G O   1 
ATOM   9950  C CB  . LEU G  1 46  ? 55.450  66.968  78.997  1.00 40.63  ? 47  LEU G CB  1 
ATOM   9951  C CG  . LEU G  1 46  ? 54.409  68.091  79.125  1.00 42.81  ? 47  LEU G CG  1 
ATOM   9952  C CD1 . LEU G  1 46  ? 54.567  68.987  77.934  1.00 44.02  ? 47  LEU G CD1 1 
ATOM   9953  C CD2 . LEU G  1 46  ? 52.963  67.563  79.213  1.00 43.50  ? 47  LEU G CD2 1 
ATOM   9954  N N   . ILE G  1 47  ? 54.702  64.326  80.618  1.00 41.10  ? 48  ILE G N   1 
ATOM   9955  C CA  . ILE G  1 47  ? 53.684  63.529  81.275  1.00 42.10  ? 48  ILE G CA  1 
ATOM   9956  C C   . ILE G  1 47  ? 54.090  62.073  81.369  1.00 43.05  ? 48  ILE G C   1 
ATOM   9957  O O   . ILE G  1 47  ? 54.867  61.570  80.552  1.00 43.49  ? 48  ILE G O   1 
ATOM   9958  C CB  . ILE G  1 47  ? 52.300  63.673  80.570  1.00 42.09  ? 48  ILE G CB  1 
ATOM   9959  C CG1 . ILE G  1 47  ? 51.763  65.090  80.830  1.00 42.04  ? 48  ILE G CG1 1 
ATOM   9960  C CG2 . ILE G  1 47  ? 51.316  62.602  81.063  1.00 40.36  ? 48  ILE G CG2 1 
ATOM   9961  C CD1 . ILE G  1 47  ? 50.261  65.223  80.937  1.00 41.66  ? 48  ILE G CD1 1 
ATOM   9962  N N   . TYR G  1 48  ? 53.575  61.423  82.404  1.00 42.49  ? 49  TYR G N   1 
ATOM   9963  C CA  . TYR G  1 48  ? 53.834  60.025  82.662  1.00 42.67  ? 49  TYR G CA  1 
ATOM   9964  C C   . TYR G  1 48  ? 52.576  59.440  83.307  1.00 43.15  ? 49  TYR G C   1 
ATOM   9965  O O   . TYR G  1 48  ? 51.863  60.137  84.036  1.00 42.51  ? 49  TYR G O   1 
ATOM   9966  C CB  . TYR G  1 48  ? 55.044  59.890  83.593  1.00 43.81  ? 49  TYR G CB  1 
ATOM   9967  C CG  . TYR G  1 48  ? 54.882  60.462  85.007  1.00 43.81  ? 49  TYR G CG  1 
ATOM   9968  C CD1 . TYR G  1 48  ? 54.356  59.686  86.044  1.00 42.82  ? 49  TYR G CD1 1 
ATOM   9969  C CD2 . TYR G  1 48  ? 55.286  61.764  85.310  1.00 42.61  ? 49  TYR G CD2 1 
ATOM   9970  C CE1 . TYR G  1 48  ? 54.242  60.187  87.334  1.00 43.20  ? 49  TYR G CE1 1 
ATOM   9971  C CE2 . TYR G  1 48  ? 55.175  62.271  86.600  1.00 42.84  ? 49  TYR G CE2 1 
ATOM   9972  C CZ  . TYR G  1 48  ? 54.654  61.478  87.610  1.00 43.34  ? 49  TYR G CZ  1 
ATOM   9973  O OH  . TYR G  1 48  ? 54.554  61.968  88.899  1.00 42.43  ? 49  TYR G OH  1 
ATOM   9974  N N   . ALA G  1 49  ? 52.289  58.171  83.026  1.00 42.94  ? 50  ALA G N   1 
ATOM   9975  C CA  . ALA G  1 49  ? 51.114  57.514  83.594  1.00 42.30  ? 50  ALA G CA  1 
ATOM   9976  C C   . ALA G  1 49  ? 49.855  58.132  83.053  1.00 42.03  ? 50  ALA G C   1 
ATOM   9977  O O   . ALA G  1 49  ? 48.937  58.443  83.818  1.00 42.66  ? 50  ALA G O   1 
ATOM   9978  C CB  . ALA G  1 49  ? 51.113  57.637  85.119  1.00 43.57  ? 50  ALA G CB  1 
ATOM   9979  N N   . ALA G  1 50  ? 49.817  58.339  81.744  1.00 41.23  ? 51  ALA G N   1 
ATOM   9980  C CA  . ALA G  1 50  ? 48.635  58.922  81.123  1.00 42.22  ? 51  ALA G CA  1 
ATOM   9981  C C   . ALA G  1 50  ? 48.311  60.387  81.486  1.00 42.21  ? 51  ALA G C   1 
ATOM   9982  O O   . ALA G  1 50  ? 47.929  61.166  80.600  1.00 42.24  ? 51  ALA G O   1 
ATOM   9983  C CB  . ALA G  1 50  ? 47.407  58.035  81.425  1.00 41.34  ? 51  ALA G CB  1 
ATOM   9984  N N   . SER G  1 51  ? 48.461  60.772  82.760  1.00 40.69  ? 52  SER G N   1 
ATOM   9985  C CA  . SER G  1 51  ? 48.110  62.138  83.149  1.00 39.50  ? 52  SER G CA  1 
ATOM   9986  C C   . SER G  1 51  ? 48.786  62.807  84.346  1.00 38.63  ? 52  SER G C   1 
ATOM   9987  O O   . SER G  1 51  ? 48.247  63.781  84.875  1.00 37.29  ? 52  SER G O   1 
ATOM   9988  C CB  . SER G  1 51  ? 46.601  62.215  83.368  1.00 39.41  ? 52  SER G CB  1 
ATOM   9989  O OG  . SER G  1 51  ? 46.199  61.374  84.436  1.00 39.73  ? 52  SER G OG  1 
ATOM   9990  N N   . SER G  1 52  ? 49.956  62.330  84.761  1.00 37.89  ? 53  SER G N   1 
ATOM   9991  C CA  . SER G  1 52  ? 50.637  62.916  85.915  1.00 37.20  ? 53  SER G CA  1 
ATOM   9992  C C   . SER G  1 52  ? 51.675  63.983  85.562  1.00 37.53  ? 53  SER G C   1 
ATOM   9993  O O   . SER G  1 52  ? 52.772  63.661  85.121  1.00 38.88  ? 53  SER G O   1 
ATOM   9994  C CB  . SER G  1 52  ? 51.293  61.807  86.727  1.00 36.69  ? 53  SER G CB  1 
ATOM   9995  O OG  . SER G  1 52  ? 50.345  60.806  87.062  1.00 39.92  ? 53  SER G OG  1 
ATOM   9996  N N   . LEU G  1 53  ? 51.336  65.252  85.784  1.00 38.04  ? 54  LEU G N   1 
ATOM   9997  C CA  . LEU G  1 53  ? 52.233  66.364  85.463  1.00 38.26  ? 54  LEU G CA  1 
ATOM   9998  C C   . LEU G  1 53  ? 53.687  66.216  85.937  1.00 39.58  ? 54  LEU G C   1 
ATOM   9999  O O   . LEU G  1 53  ? 54.010  66.440  87.105  1.00 40.05  ? 54  LEU G O   1 
ATOM   10000 C CB  . LEU G  1 53  ? 51.650  67.668  86.000  1.00 37.62  ? 54  LEU G CB  1 
ATOM   10001 C CG  . LEU G  1 53  ? 51.208  68.719  84.986  1.00 37.19  ? 54  LEU G CG  1 
ATOM   10002 C CD1 . LEU G  1 53  ? 50.074  68.178  84.151  1.00 36.23  ? 54  LEU G CD1 1 
ATOM   10003 C CD2 . LEU G  1 53  ? 50.753  69.968  85.720  1.00 38.04  ? 54  LEU G CD2 1 
ATOM   10004 N N   . GLN G  1 54  ? 54.564  65.843  85.010  1.00 40.97  ? 55  GLN G N   1 
ATOM   10005 C CA  . GLN G  1 54  ? 55.986  65.678  85.299  1.00 41.62  ? 55  GLN G CA  1 
ATOM   10006 C C   . GLN G  1 54  ? 56.457  66.821  86.160  1.00 41.37  ? 55  GLN G C   1 
ATOM   10007 O O   . GLN G  1 54  ? 56.016  67.952  86.011  1.00 41.49  ? 55  GLN G O   1 
ATOM   10008 C CB  . GLN G  1 54  ? 56.792  65.637  83.996  1.00 42.68  ? 55  GLN G CB  1 
ATOM   10009 C CG  . GLN G  1 54  ? 58.291  65.803  84.153  1.00 44.46  ? 55  GLN G CG  1 
ATOM   10010 C CD  . GLN G  1 54  ? 58.842  65.092  85.371  1.00 44.58  ? 55  GLN G CD  1 
ATOM   10011 O OE1 . GLN G  1 54  ? 58.356  64.030  85.757  1.00 44.37  ? 55  GLN G OE1 1 
ATOM   10012 N NE2 . GLN G  1 54  ? 59.873  65.673  85.979  1.00 44.04  ? 55  GLN G NE2 1 
ATOM   10013 N N   . SER G  1 55  ? 57.369  66.526  87.062  1.00 42.13  ? 56  SER G N   1 
ATOM   10014 C CA  . SER G  1 55  ? 57.843  67.553  87.959  1.00 44.12  ? 56  SER G CA  1 
ATOM   10015 C C   . SER G  1 55  ? 58.231  68.880  87.304  1.00 43.48  ? 56  SER G C   1 
ATOM   10016 O O   . SER G  1 55  ? 58.993  68.918  86.338  1.00 41.83  ? 56  SER G O   1 
ATOM   10017 C CB  . SER G  1 55  ? 59.006  67.018  88.800  1.00 45.28  ? 56  SER G CB  1 
ATOM   10018 O OG  . SER G  1 55  ? 59.101  67.736  90.026  1.00 46.38  ? 56  SER G OG  1 
ATOM   10019 N N   . GLY G  1 56  ? 57.671  69.959  87.856  1.00 43.07  ? 57  GLY G N   1 
ATOM   10020 C CA  . GLY G  1 56  ? 57.957  71.309  87.404  1.00 43.72  ? 57  GLY G CA  1 
ATOM   10021 C C   . GLY G  1 56  ? 57.215  71.807  86.186  1.00 44.89  ? 57  GLY G C   1 
ATOM   10022 O O   . GLY G  1 56  ? 57.660  72.765  85.541  1.00 44.22  ? 57  GLY G O   1 
ATOM   10023 N N   . VAL G  1 57  ? 56.082  71.174  85.878  1.00 46.31  ? 58  VAL G N   1 
ATOM   10024 C CA  . VAL G  1 57  ? 55.273  71.541  84.701  1.00 46.24  ? 58  VAL G CA  1 
ATOM   10025 C C   . VAL G  1 57  ? 54.120  72.485  85.049  1.00 45.71  ? 58  VAL G C   1 
ATOM   10026 O O   . VAL G  1 57  ? 53.486  72.349  86.094  1.00 45.75  ? 58  VAL G O   1 
ATOM   10027 C CB  . VAL G  1 57  ? 54.704  70.260  83.979  1.00 45.56  ? 58  VAL G CB  1 
ATOM   10028 C CG1 . VAL G  1 57  ? 53.581  70.624  83.040  1.00 44.35  ? 58  VAL G CG1 1 
ATOM   10029 C CG2 . VAL G  1 57  ? 55.811  69.569  83.204  1.00 43.33  ? 58  VAL G CG2 1 
ATOM   10030 N N   . PRO G  1 58  ? 53.854  73.469  84.177  1.00 45.02  ? 59  PRO G N   1 
ATOM   10031 C CA  . PRO G  1 58  ? 52.785  74.458  84.352  1.00 44.95  ? 59  PRO G CA  1 
ATOM   10032 C C   . PRO G  1 58  ? 51.395  73.821  84.383  1.00 44.35  ? 59  PRO G C   1 
ATOM   10033 O O   . PRO G  1 58  ? 51.209  72.695  83.916  1.00 43.36  ? 59  PRO G O   1 
ATOM   10034 C CB  . PRO G  1 58  ? 52.983  75.382  83.158  1.00 45.16  ? 59  PRO G CB  1 
ATOM   10035 C CG  . PRO G  1 58  ? 54.465  75.345  82.980  1.00 45.75  ? 59  PRO G CG  1 
ATOM   10036 C CD  . PRO G  1 58  ? 54.759  73.873  83.091  1.00 44.93  ? 59  PRO G CD  1 
ATOM   10037 N N   . SER G  1 59  ? 50.418  74.548  84.923  1.00 44.06  ? 60  SER G N   1 
ATOM   10038 C CA  . SER G  1 59  ? 49.063  74.009  85.042  1.00 43.02  ? 60  SER G CA  1 
ATOM   10039 C C   . SER G  1 59  ? 48.267  74.193  83.788  1.00 40.90  ? 60  SER G C   1 
ATOM   10040 O O   . SER G  1 59  ? 47.172  73.656  83.665  1.00 40.63  ? 60  SER G O   1 
ATOM   10041 C CB  . SER G  1 59  ? 48.310  74.654  86.212  1.00 43.02  ? 60  SER G CB  1 
ATOM   10042 O OG  . SER G  1 59  ? 47.808  75.925  85.847  1.00 43.96  ? 60  SER G OG  1 
ATOM   10043 N N   . ARG G  1 60  ? 48.799  74.976  82.863  1.00 40.60  ? 61  ARG G N   1 
ATOM   10044 C CA  . ARG G  1 60  ? 48.098  75.162  81.611  1.00 41.26  ? 61  ARG G CA  1 
ATOM   10045 C C   . ARG G  1 60  ? 48.252  73.838  80.866  1.00 43.51  ? 61  ARG G C   1 
ATOM   10046 O O   . ARG G  1 60  ? 47.706  73.670  79.774  1.00 45.65  ? 61  ARG G O   1 
ATOM   10047 C CB  . ARG G  1 60  ? 48.692  76.307  80.792  1.00 37.78  ? 61  ARG G CB  1 
ATOM   10048 C CG  . ARG G  1 60  ? 50.055  76.020  80.219  1.00 36.46  ? 61  ARG G CG  1 
ATOM   10049 C CD  . ARG G  1 60  ? 50.450  77.078  79.215  1.00 35.66  ? 61  ARG G CD  1 
ATOM   10050 N NE  . ARG G  1 60  ? 51.894  77.183  79.077  1.00 35.40  ? 61  ARG G NE  1 
ATOM   10051 C CZ  . ARG G  1 60  ? 52.689  77.708  80.001  1.00 35.04  ? 61  ARG G CZ  1 
ATOM   10052 N NH1 . ARG G  1 60  ? 52.168  78.176  81.124  1.00 34.54  ? 61  ARG G NH1 1 
ATOM   10053 N NH2 . ARG G  1 60  ? 54.001  77.770  79.804  1.00 34.73  ? 61  ARG G NH2 1 
ATOM   10054 N N   . PHE G  1 61  ? 48.994  72.902  81.469  1.00 44.29  ? 62  PHE G N   1 
ATOM   10055 C CA  . PHE G  1 61  ? 49.209  71.571  80.899  1.00 44.06  ? 62  PHE G CA  1 
ATOM   10056 C C   . PHE G  1 61  ? 48.452  70.494  81.655  1.00 43.41  ? 62  PHE G C   1 
ATOM   10057 O O   . PHE G  1 61  ? 48.450  70.464  82.884  1.00 42.59  ? 62  PHE G O   1 
ATOM   10058 C CB  . PHE G  1 61  ? 50.686  71.205  80.905  1.00 45.91  ? 62  PHE G CB  1 
ATOM   10059 C CG  . PHE G  1 61  ? 51.497  71.947  79.893  1.00 48.47  ? 62  PHE G CG  1 
ATOM   10060 C CD1 . PHE G  1 61  ? 51.836  73.281  80.100  1.00 48.06  ? 62  PHE G CD1 1 
ATOM   10061 C CD2 . PHE G  1 61  ? 51.936  71.305  78.734  1.00 48.79  ? 62  PHE G CD2 1 
ATOM   10062 C CE1 . PHE G  1 61  ? 52.610  73.973  79.168  1.00 49.81  ? 62  PHE G CE1 1 
ATOM   10063 C CE2 . PHE G  1 61  ? 52.705  71.985  77.799  1.00 50.71  ? 62  PHE G CE2 1 
ATOM   10064 C CZ  . PHE G  1 61  ? 53.046  73.327  78.017  1.00 50.99  ? 62  PHE G CZ  1 
ATOM   10065 N N   . SER G  1 62  ? 47.816  69.602  80.907  1.00 43.71  ? 63  SER G N   1 
ATOM   10066 C CA  . SER G  1 62  ? 47.053  68.514  81.506  1.00 44.86  ? 63  SER G CA  1 
ATOM   10067 C C   . SER G  1 62  ? 47.008  67.285  80.603  1.00 44.10  ? 63  SER G C   1 
ATOM   10068 O O   . SER G  1 62  ? 46.723  67.393  79.417  1.00 44.55  ? 63  SER G O   1 
ATOM   10069 C CB  . SER G  1 62  ? 45.624  68.988  81.832  1.00 45.99  ? 63  SER G CB  1 
ATOM   10070 O OG  . SER G  1 62  ? 44.944  69.473  80.680  1.00 47.82  ? 63  SER G OG  1 
ATOM   10071 N N   . GLY G  1 63  ? 47.302  66.119  81.162  1.00 44.25  ? 64  GLY G N   1 
ATOM   10072 C CA  . GLY G  1 63  ? 47.266  64.910  80.362  1.00 47.44  ? 64  GLY G CA  1 
ATOM   10073 C C   . GLY G  1 63  ? 46.108  64.025  80.766  1.00 49.15  ? 64  GLY G C   1 
ATOM   10074 O O   . GLY G  1 63  ? 45.504  64.266  81.806  1.00 48.87  ? 64  GLY G O   1 
ATOM   10075 N N   . SER G  1 64  ? 45.792  63.012  79.956  1.00 51.14  ? 65  SER G N   1 
ATOM   10076 C CA  . SER G  1 64  ? 44.686  62.091  80.262  1.00 53.02  ? 65  SER G CA  1 
ATOM   10077 C C   . SER G  1 64  ? 44.427  61.044  79.164  1.00 53.74  ? 65  SER G C   1 
ATOM   10078 O O   . SER G  1 64  ? 44.868  61.195  78.020  1.00 54.08  ? 65  SER G O   1 
ATOM   10079 C CB  . SER G  1 64  ? 43.385  62.873  80.523  1.00 52.94  ? 65  SER G CB  1 
ATOM   10080 O OG  . SER G  1 64  ? 42.680  63.136  79.316  1.00 52.34  ? 65  SER G OG  1 
ATOM   10081 N N   . GLY G  1 65  ? 43.698  59.990  79.535  1.00 54.38  ? 66  GLY G N   1 
ATOM   10082 C CA  . GLY G  1 65  ? 43.363  58.914  78.611  1.00 55.41  ? 66  GLY G CA  1 
ATOM   10083 C C   . GLY G  1 65  ? 43.539  57.570  79.296  1.00 54.91  ? 66  GLY G C   1 
ATOM   10084 O O   . GLY G  1 65  ? 43.905  57.544  80.468  1.00 55.98  ? 66  GLY G O   1 
ATOM   10085 N N   . SER G  1 66  ? 43.284  56.467  78.593  1.00 54.26  ? 67  SER G N   1 
ATOM   10086 C CA  . SER G  1 66  ? 43.445  55.137  79.186  1.00 55.72  ? 67  SER G CA  1 
ATOM   10087 C C   . SER G  1 66  ? 43.188  53.965  78.226  1.00 55.94  ? 67  SER G C   1 
ATOM   10088 O O   . SER G  1 66  ? 42.054  53.709  77.823  1.00 56.12  ? 67  SER G O   1 
ATOM   10089 C CB  . SER G  1 66  ? 42.539  55.008  80.406  1.00 56.72  ? 67  SER G CB  1 
ATOM   10090 O OG  . SER G  1 66  ? 41.252  55.535  80.124  1.00 60.25  ? 67  SER G OG  1 
ATOM   10091 N N   . GLY G  1 67  ? 44.252  53.244  77.876  1.00 55.66  ? 68  GLY G N   1 
ATOM   10092 C CA  . GLY G  1 67  ? 44.122  52.125  76.962  1.00 53.47  ? 68  GLY G CA  1 
ATOM   10093 C C   . GLY G  1 67  ? 44.609  52.511  75.582  1.00 52.44  ? 68  GLY G C   1 
ATOM   10094 O O   . GLY G  1 67  ? 45.797  52.411  75.283  1.00 52.13  ? 68  GLY G O   1 
ATOM   10095 N N   . THR G  1 68  ? 43.693  52.960  74.733  1.00 52.31  ? 69  THR G N   1 
ATOM   10096 C CA  . THR G  1 68  ? 44.067  53.363  73.383  1.00 51.93  ? 69  THR G CA  1 
ATOM   10097 C C   . THR G  1 68  ? 43.965  54.882  73.212  1.00 51.70  ? 69  THR G C   1 
ATOM   10098 O O   . THR G  1 68  ? 44.926  55.516  72.793  1.00 51.45  ? 69  THR G O   1 
ATOM   10099 C CB  . THR G  1 68  ? 43.197  52.649  72.294  1.00 51.17  ? 69  THR G CB  1 
ATOM   10100 O OG1 . THR G  1 68  ? 41.828  53.057  72.408  1.00 50.82  ? 69  THR G OG1 1 
ATOM   10101 C CG2 . THR G  1 68  ? 43.271  51.143  72.457  1.00 50.37  ? 69  THR G CG2 1 
ATOM   10102 N N   . ASP G  1 69  ? 42.814  55.466  73.542  1.00 50.85  ? 70  ASP G N   1 
ATOM   10103 C CA  . ASP G  1 69  ? 42.631  56.912  73.400  1.00 49.97  ? 70  ASP G CA  1 
ATOM   10104 C C   . ASP G  1 69  ? 43.470  57.648  74.429  1.00 48.43  ? 70  ASP G C   1 
ATOM   10105 O O   . ASP G  1 69  ? 43.494  57.260  75.583  1.00 49.12  ? 70  ASP G O   1 
ATOM   10106 C CB  . ASP G  1 69  ? 41.163  57.316  73.620  1.00 52.19  ? 70  ASP G CB  1 
ATOM   10107 C CG  . ASP G  1 69  ? 40.198  56.660  72.637  1.00 54.58  ? 70  ASP G CG  1 
ATOM   10108 O OD1 . ASP G  1 69  ? 38.994  57.036  72.657  1.00 55.16  ? 70  ASP G OD1 1 
ATOM   10109 O OD2 . ASP G  1 69  ? 40.629  55.774  71.858  1.00 54.81  ? 70  ASP G OD2 1 
ATOM   10110 N N   . PHE G  1 70  ? 44.151  58.710  74.016  1.00 46.99  ? 71  PHE G N   1 
ATOM   10111 C CA  . PHE G  1 70  ? 44.959  59.513  74.940  1.00 45.65  ? 71  PHE G CA  1 
ATOM   10112 C C   . PHE G  1 70  ? 45.009  60.995  74.546  1.00 44.70  ? 71  PHE G C   1 
ATOM   10113 O O   . PHE G  1 70  ? 45.222  61.336  73.372  1.00 44.85  ? 71  PHE G O   1 
ATOM   10114 C CB  . PHE G  1 70  ? 46.378  58.951  75.046  1.00 45.32  ? 71  PHE G CB  1 
ATOM   10115 C CG  . PHE G  1 70  ? 46.442  57.618  75.701  1.00 43.86  ? 71  PHE G CG  1 
ATOM   10116 C CD1 . PHE G  1 70  ? 46.220  56.462  74.966  1.00 43.79  ? 71  PHE G CD1 1 
ATOM   10117 C CD2 . PHE G  1 70  ? 46.667  57.520  77.071  1.00 43.81  ? 71  PHE G CD2 1 
ATOM   10118 C CE1 . PHE G  1 70  ? 46.214  55.215  75.580  1.00 45.53  ? 71  PHE G CE1 1 
ATOM   10119 C CE2 . PHE G  1 70  ? 46.665  56.284  77.709  1.00 44.96  ? 71  PHE G CE2 1 
ATOM   10120 C CZ  . PHE G  1 70  ? 46.437  55.121  76.963  1.00 46.16  ? 71  PHE G CZ  1 
ATOM   10121 N N   . THR G  1 71  ? 44.844  61.873  75.530  1.00 41.91  ? 72  THR G N   1 
ATOM   10122 C CA  . THR G  1 71  ? 44.826  63.307  75.255  1.00 40.88  ? 72  THR G CA  1 
ATOM   10123 C C   . THR G  1 71  ? 45.755  64.232  76.061  1.00 40.51  ? 72  THR G C   1 
ATOM   10124 O O   . THR G  1 71  ? 45.875  64.131  77.287  1.00 40.35  ? 72  THR G O   1 
ATOM   10125 C CB  . THR G  1 71  ? 43.355  63.843  75.379  1.00 40.42  ? 72  THR G CB  1 
ATOM   10126 O OG1 . THR G  1 71  ? 42.902  64.285  74.097  1.00 37.95  ? 72  THR G OG1 1 
ATOM   10127 C CG2 . THR G  1 71  ? 43.248  64.996  76.403  1.00 38.20  ? 72  THR G CG2 1 
ATOM   10128 N N   . LEU G  1 72  ? 46.417  65.136  75.350  1.00 39.17  ? 73  LEU G N   1 
ATOM   10129 C CA  . LEU G  1 72  ? 47.263  66.117  76.004  1.00 37.97  ? 73  LEU G CA  1 
ATOM   10130 C C   . LEU G  1 72  ? 46.562  67.430  75.762  1.00 38.43  ? 73  LEU G C   1 
ATOM   10131 O O   . LEU G  1 72  ? 46.360  67.836  74.620  1.00 37.55  ? 73  LEU G O   1 
ATOM   10132 C CB  . LEU G  1 72  ? 48.657  66.174  75.401  1.00 35.71  ? 73  LEU G CB  1 
ATOM   10133 C CG  . LEU G  1 72  ? 49.518  67.295  75.981  1.00 33.05  ? 73  LEU G CG  1 
ATOM   10134 C CD1 . LEU G  1 72  ? 50.938  67.051  75.622  1.00 33.34  ? 73  LEU G CD1 1 
ATOM   10135 C CD2 . LEU G  1 72  ? 49.087  68.637  75.448  1.00 32.74  ? 73  LEU G CD2 1 
ATOM   10136 N N   . THR G  1 73  ? 46.192  68.082  76.851  1.00 39.35  ? 74  THR G N   1 
ATOM   10137 C CA  . THR G  1 73  ? 45.500  69.349  76.793  1.00 40.54  ? 74  THR G CA  1 
ATOM   10138 C C   . THR G  1 73  ? 46.398  70.478  77.263  1.00 41.71  ? 74  THR G C   1 
ATOM   10139 O O   . THR G  1 73  ? 47.358  70.269  78.008  1.00 41.94  ? 74  THR G O   1 
ATOM   10140 C CB  . THR G  1 73  ? 44.267  69.325  77.693  1.00 41.11  ? 74  THR G CB  1 
ATOM   10141 O OG1 . THR G  1 73  ? 43.484  68.161  77.397  1.00 42.57  ? 74  THR G OG1 1 
ATOM   10142 C CG2 . THR G  1 73  ? 43.429  70.576  77.476  1.00 41.84  ? 74  THR G CG2 1 
ATOM   10143 N N   . ILE G  1 74  ? 46.078  71.679  76.810  1.00 42.60  ? 75  ILE G N   1 
ATOM   10144 C CA  . ILE G  1 74  ? 46.813  72.870  77.190  1.00 43.52  ? 75  ILE G CA  1 
ATOM   10145 C C   . ILE G  1 74  ? 45.766  73.963  77.228  1.00 46.45  ? 75  ILE G C   1 
ATOM   10146 O O   . ILE G  1 74  ? 45.690  74.786  76.322  1.00 48.08  ? 75  ILE G O   1 
ATOM   10147 C CB  . ILE G  1 74  ? 47.901  73.234  76.163  1.00 41.53  ? 75  ILE G CB  1 
ATOM   10148 C CG1 . ILE G  1 74  ? 48.946  72.121  76.088  1.00 39.78  ? 75  ILE G CG1 1 
ATOM   10149 C CG2 . ILE G  1 74  ? 48.563  74.552  76.546  1.00 39.51  ? 75  ILE G CG2 1 
ATOM   10150 C CD1 . ILE G  1 74  ? 49.986  72.347  75.016  1.00 39.09  ? 75  ILE G CD1 1 
ATOM   10151 N N   . SER G  1 75  ? 44.940  73.931  78.272  1.00 49.08  ? 76  SER G N   1 
ATOM   10152 C CA  . SER G  1 75  ? 43.861  74.899  78.486  1.00 50.84  ? 76  SER G CA  1 
ATOM   10153 C C   . SER G  1 75  ? 44.045  76.224  77.738  1.00 52.88  ? 76  SER G C   1 
ATOM   10154 O O   . SER G  1 75  ? 43.175  76.618  76.956  1.00 55.15  ? 76  SER G O   1 
ATOM   10155 C CB  . SER G  1 75  ? 43.718  75.199  79.972  1.00 49.51  ? 76  SER G CB  1 
ATOM   10156 O OG  . SER G  1 75  ? 44.814  75.978  80.412  1.00 49.55  ? 76  SER G OG  1 
ATOM   10157 N N   . SER G  1 76  ? 45.158  76.913  77.993  1.00 53.20  ? 77  SER G N   1 
ATOM   10158 C CA  . SER G  1 76  ? 45.458  78.186  77.334  1.00 54.35  ? 77  SER G CA  1 
ATOM   10159 C C   . SER G  1 76  ? 46.907  78.240  76.868  1.00 54.46  ? 77  SER G C   1 
ATOM   10160 O O   . SER G  1 76  ? 47.817  77.941  77.633  1.00 55.55  ? 77  SER G O   1 
ATOM   10161 C CB  . SER G  1 76  ? 45.195  79.358  78.280  1.00 55.84  ? 77  SER G CB  1 
ATOM   10162 O OG  . SER G  1 76  ? 45.582  80.585  77.674  1.00 57.58  ? 77  SER G OG  1 
ATOM   10163 N N   . LEU G  1 77  ? 47.123  78.647  75.622  1.00 53.85  ? 78  LEU G N   1 
ATOM   10164 C CA  . LEU G  1 77  ? 48.471  78.706  75.056  1.00 53.65  ? 78  LEU G CA  1 
ATOM   10165 C C   . LEU G  1 77  ? 49.377  79.849  75.522  1.00 54.11  ? 78  LEU G C   1 
ATOM   10166 O O   . LEU G  1 77  ? 48.911  80.922  75.888  1.00 55.54  ? 78  LEU G O   1 
ATOM   10167 C CB  . LEU G  1 77  ? 48.380  78.745  73.535  1.00 52.11  ? 78  LEU G CB  1 
ATOM   10168 C CG  . LEU G  1 77  ? 49.025  77.602  72.766  1.00 51.10  ? 78  LEU G CG  1 
ATOM   10169 C CD1 . LEU G  1 77  ? 48.702  76.261  73.409  1.00 50.48  ? 78  LEU G CD1 1 
ATOM   10170 C CD2 . LEU G  1 77  ? 48.514  77.663  71.342  1.00 50.79  ? 78  LEU G CD2 1 
ATOM   10171 N N   . GLN G  1 78  ? 50.680  79.591  75.494  1.00 53.77  ? 79  GLN G N   1 
ATOM   10172 C CA  . GLN G  1 78  ? 51.706  80.552  75.874  1.00 53.38  ? 79  GLN G CA  1 
ATOM   10173 C C   . GLN G  1 78  ? 52.780  80.450  74.800  1.00 53.37  ? 79  GLN G C   1 
ATOM   10174 O O   . GLN G  1 78  ? 53.167  79.348  74.427  1.00 53.66  ? 79  GLN G O   1 
ATOM   10175 C CB  . GLN G  1 78  ? 52.344  80.161  77.201  1.00 55.28  ? 79  GLN G CB  1 
ATOM   10176 C CG  . GLN G  1 78  ? 51.450  80.175  78.411  1.00 57.13  ? 79  GLN G CG  1 
ATOM   10177 C CD  . GLN G  1 78  ? 51.182  81.569  78.926  1.00 59.03  ? 79  GLN G CD  1 
ATOM   10178 O OE1 . GLN G  1 78  ? 50.927  81.760  80.124  1.00 60.09  ? 79  GLN G OE1 1 
ATOM   10179 N NE2 . GLN G  1 78  ? 51.222  82.555  78.028  1.00 58.48  ? 79  GLN G NE2 1 
ATOM   10180 N N   . PRO G  1 79  ? 53.295  81.585  74.304  1.00 52.97  ? 80  PRO G N   1 
ATOM   10181 C CA  . PRO G  1 79  ? 54.324  81.488  73.274  1.00 52.91  ? 80  PRO G CA  1 
ATOM   10182 C C   . PRO G  1 79  ? 55.334  80.355  73.453  1.00 53.46  ? 80  PRO G C   1 
ATOM   10183 O O   . PRO G  1 79  ? 55.793  79.785  72.465  1.00 54.46  ? 80  PRO G O   1 
ATOM   10184 C CB  . PRO G  1 79  ? 54.979  82.876  73.299  1.00 52.29  ? 80  PRO G CB  1 
ATOM   10185 C CG  . PRO G  1 79  ? 54.622  83.431  74.618  1.00 51.21  ? 80  PRO G CG  1 
ATOM   10186 C CD  . PRO G  1 79  ? 53.205  82.966  74.795  1.00 53.17  ? 80  PRO G CD  1 
ATOM   10187 N N   . GLU G  1 80  ? 55.667  80.004  74.693  1.00 52.32  ? 81  GLU G N   1 
ATOM   10188 C CA  . GLU G  1 80  ? 56.640  78.940  74.902  1.00 52.11  ? 81  GLU G CA  1 
ATOM   10189 C C   . GLU G  1 80  ? 56.065  77.533  74.951  1.00 49.89  ? 81  GLU G C   1 
ATOM   10190 O O   . GLU G  1 80  ? 56.676  76.617  75.491  1.00 48.83  ? 81  GLU G O   1 
ATOM   10191 C CB  . GLU G  1 80  ? 57.489  79.205  76.155  1.00 55.10  ? 81  GLU G CB  1 
ATOM   10192 C CG  . GLU G  1 80  ? 56.736  79.342  77.454  1.00 59.50  ? 81  GLU G CG  1 
ATOM   10193 C CD  . GLU G  1 80  ? 56.072  80.693  77.591  1.00 63.62  ? 81  GLU G CD  1 
ATOM   10194 O OE1 . GLU G  1 80  ? 55.135  80.964  76.810  1.00 65.50  ? 81  GLU G OE1 1 
ATOM   10195 O OE2 . GLU G  1 80  ? 56.489  81.486  78.473  1.00 65.42  ? 81  GLU G OE2 1 
ATOM   10196 N N   . ASP G  1 81  ? 54.881  77.358  74.391  1.00 48.47  ? 82  ASP G N   1 
ATOM   10197 C CA  . ASP G  1 81  ? 54.289  76.036  74.362  1.00 48.16  ? 82  ASP G CA  1 
ATOM   10198 C C   . ASP G  1 81  ? 54.317  75.562  72.917  1.00 47.93  ? 82  ASP G C   1 
ATOM   10199 O O   . ASP G  1 81  ? 53.711  74.545  72.576  1.00 49.03  ? 82  ASP G O   1 
ATOM   10200 C CB  . ASP G  1 81  ? 52.849  76.032  74.899  1.00 47.58  ? 82  ASP G CB  1 
ATOM   10201 C CG  . ASP G  1 81  ? 52.753  76.491  76.351  1.00 47.16  ? 82  ASP G CG  1 
ATOM   10202 O OD1 . ASP G  1 81  ? 53.675  76.210  77.145  1.00 47.11  ? 82  ASP G OD1 1 
ATOM   10203 O OD2 . ASP G  1 81  ? 51.735  77.121  76.703  1.00 46.28  ? 82  ASP G OD2 1 
ATOM   10204 N N   . PHE G  1 82  ? 55.003  76.314  72.058  1.00 47.28  ? 83  PHE G N   1 
ATOM   10205 C CA  . PHE G  1 82  ? 55.136  75.913  70.655  1.00 46.91  ? 83  PHE G CA  1 
ATOM   10206 C C   . PHE G  1 82  ? 56.411  75.113  70.531  1.00 45.11  ? 83  PHE G C   1 
ATOM   10207 O O   . PHE G  1 82  ? 57.507  75.653  70.335  1.00 44.75  ? 83  PHE G O   1 
ATOM   10208 C CB  . PHE G  1 82  ? 55.199  77.106  69.704  1.00 48.83  ? 83  PHE G CB  1 
ATOM   10209 C CG  . PHE G  1 82  ? 53.875  77.728  69.450  1.00 50.11  ? 83  PHE G CG  1 
ATOM   10210 C CD1 . PHE G  1 82  ? 53.518  78.908  70.085  1.00 50.64  ? 83  PHE G CD1 1 
ATOM   10211 C CD2 . PHE G  1 82  ? 52.948  77.089  68.636  1.00 49.88  ? 83  PHE G CD2 1 
ATOM   10212 C CE1 . PHE G  1 82  ? 52.245  79.442  69.917  1.00 53.31  ? 83  PHE G CE1 1 
ATOM   10213 C CE2 . PHE G  1 82  ? 51.679  77.608  68.462  1.00 51.22  ? 83  PHE G CE2 1 
ATOM   10214 C CZ  . PHE G  1 82  ? 51.320  78.788  69.102  1.00 53.56  ? 83  PHE G CZ  1 
ATOM   10215 N N   . ALA G  1 83  ? 56.243  73.811  70.677  1.00 42.59  ? 84  ALA G N   1 
ATOM   10216 C CA  . ALA G  1 83  ? 57.331  72.871  70.609  1.00 39.88  ? 84  ALA G CA  1 
ATOM   10217 C C   . ALA G  1 83  ? 56.705  71.724  69.866  1.00 38.03  ? 84  ALA G C   1 
ATOM   10218 O O   . ALA G  1 83  ? 55.575  71.849  69.405  1.00 36.59  ? 84  ALA G O   1 
ATOM   10219 C CB  . ALA G  1 83  ? 57.732  72.438  72.012  1.00 38.29  ? 84  ALA G CB  1 
ATOM   10220 N N   . THR G  1 84  ? 57.442  70.624  69.739  1.00 36.62  ? 85  THR G N   1 
ATOM   10221 C CA  . THR G  1 84  ? 56.923  69.433  69.083  1.00 34.70  ? 85  THR G CA  1 
ATOM   10222 C C   . THR G  1 84  ? 56.593  68.463  70.201  1.00 32.69  ? 85  THR G C   1 
ATOM   10223 O O   . THR G  1 84  ? 57.345  68.334  71.146  1.00 29.38  ? 85  THR G O   1 
ATOM   10224 C CB  . THR G  1 84  ? 57.947  68.778  68.134  1.00 34.01  ? 85  THR G CB  1 
ATOM   10225 O OG1 . THR G  1 84  ? 58.196  69.648  67.025  1.00 34.43  ? 85  THR G OG1 1 
ATOM   10226 C CG2 . THR G  1 84  ? 57.410  67.458  67.622  1.00 31.55  ? 85  THR G CG2 1 
ATOM   10227 N N   . TYR G  1 85  ? 55.457  67.796  70.088  1.00 32.83  ? 86  TYR G N   1 
ATOM   10228 C CA  . TYR G  1 85  ? 55.040  66.858  71.108  1.00 34.91  ? 86  TYR G CA  1 
ATOM   10229 C C   . TYR G  1 85  ? 54.985  65.391  70.654  1.00 36.74  ? 86  TYR G C   1 
ATOM   10230 O O   . TYR G  1 85  ? 54.278  65.037  69.703  1.00 38.08  ? 86  TYR G O   1 
ATOM   10231 C CB  . TYR G  1 85  ? 53.690  67.303  71.687  1.00 32.01  ? 86  TYR G CB  1 
ATOM   10232 C CG  . TYR G  1 85  ? 53.778  68.623  72.393  1.00 29.78  ? 86  TYR G CG  1 
ATOM   10233 C CD1 . TYR G  1 85  ? 53.766  69.824  71.685  1.00 30.86  ? 86  TYR G CD1 1 
ATOM   10234 C CD2 . TYR G  1 85  ? 53.921  68.676  73.763  1.00 29.56  ? 86  TYR G CD2 1 
ATOM   10235 C CE1 . TYR G  1 85  ? 53.894  71.066  72.339  1.00 30.10  ? 86  TYR G CE1 1 
ATOM   10236 C CE2 . TYR G  1 85  ? 54.055  69.893  74.430  1.00 31.93  ? 86  TYR G CE2 1 
ATOM   10237 C CZ  . TYR G  1 85  ? 54.038  71.087  73.719  1.00 32.46  ? 86  TYR G CZ  1 
ATOM   10238 O OH  . TYR G  1 85  ? 54.150  72.281  74.415  1.00 31.73  ? 86  TYR G OH  1 
ATOM   10239 N N   . TYR G  1 86  ? 55.746  64.545  71.344  1.00 37.74  ? 87  TYR G N   1 
ATOM   10240 C CA  . TYR G  1 86  ? 55.789  63.129  71.034  1.00 39.31  ? 87  TYR G CA  1 
ATOM   10241 C C   . TYR G  1 86  ? 55.188  62.378  72.183  1.00 40.31  ? 87  TYR G C   1 
ATOM   10242 O O   . TYR G  1 86  ? 55.503  62.661  73.338  1.00 40.39  ? 87  TYR G O   1 
ATOM   10243 C CB  . TYR G  1 86  ? 57.222  62.649  70.862  1.00 39.36  ? 87  TYR G CB  1 
ATOM   10244 C CG  . TYR G  1 86  ? 58.004  63.374  69.802  1.00 39.63  ? 87  TYR G CG  1 
ATOM   10245 C CD1 . TYR G  1 86  ? 58.580  64.620  70.053  1.00 39.79  ? 87  TYR G CD1 1 
ATOM   10246 C CD2 . TYR G  1 86  ? 58.195  62.803  68.552  1.00 39.55  ? 87  TYR G CD2 1 
ATOM   10247 C CE1 . TYR G  1 86  ? 59.328  65.267  69.079  1.00 39.29  ? 87  TYR G CE1 1 
ATOM   10248 C CE2 . TYR G  1 86  ? 58.939  63.444  67.574  1.00 38.52  ? 87  TYR G CE2 1 
ATOM   10249 C CZ  . TYR G  1 86  ? 59.501  64.667  67.839  1.00 38.54  ? 87  TYR G CZ  1 
ATOM   10250 O OH  . TYR G  1 86  ? 60.229  65.289  66.852  1.00 40.18  ? 87  TYR G OH  1 
ATOM   10251 N N   . CYS G  1 87  ? 54.308  61.434  71.872  1.00 42.01  ? 88  CYS G N   1 
ATOM   10252 C CA  . CYS G  1 87  ? 53.706  60.632  72.918  1.00 43.78  ? 88  CYS G CA  1 
ATOM   10253 C C   . CYS G  1 87  ? 54.487  59.344  72.926  1.00 43.62  ? 88  CYS G C   1 
ATOM   10254 O O   . CYS G  1 87  ? 55.040  58.935  71.907  1.00 42.02  ? 88  CYS G O   1 
ATOM   10255 C CB  . CYS G  1 87  ? 52.198  60.396  72.690  1.00 46.46  ? 88  CYS G CB  1 
ATOM   10256 S SG  . CYS G  1 87  ? 51.594  59.735  71.091  1.00 52.70  ? 88  CYS G SG  1 
ATOM   10257 N N   . GLN G  1 88  ? 54.555  58.717  74.089  1.00 44.53  ? 89  GLN G N   1 
ATOM   10258 C CA  . GLN G  1 88  ? 55.321  57.494  74.221  1.00 45.31  ? 89  GLN G CA  1 
ATOM   10259 C C   . GLN G  1 88  ? 54.537  56.326  74.835  1.00 47.15  ? 89  GLN G C   1 
ATOM   10260 O O   . GLN G  1 88  ? 53.715  56.501  75.750  1.00 47.14  ? 89  GLN G O   1 
ATOM   10261 C CB  . GLN G  1 88  ? 56.559  57.780  75.062  1.00 42.51  ? 89  GLN G CB  1 
ATOM   10262 C CG  . GLN G  1 88  ? 57.795  57.073  74.604  1.00 39.62  ? 89  GLN G CG  1 
ATOM   10263 C CD  . GLN G  1 88  ? 58.650  56.642  75.763  1.00 37.92  ? 89  GLN G CD  1 
ATOM   10264 O OE1 . GLN G  1 88  ? 58.822  57.386  76.737  1.00 35.03  ? 89  GLN G OE1 1 
ATOM   10265 N NE2 . GLN G  1 88  ? 59.198  55.434  75.671  1.00 35.71  ? 89  GLN G NE2 1 
ATOM   10266 N N   . GLN G  1 89  ? 54.817  55.134  74.318  1.00 47.77  ? 90  GLN G N   1 
ATOM   10267 C CA  . GLN G  1 89  ? 54.193  53.916  74.784  1.00 48.41  ? 90  GLN G CA  1 
ATOM   10268 C C   . GLN G  1 89  ? 55.226  53.133  75.569  1.00 50.38  ? 90  GLN G C   1 
ATOM   10269 O O   . GLN G  1 89  ? 56.290  52.819  75.043  1.00 50.02  ? 90  GLN G O   1 
ATOM   10270 C CB  . GLN G  1 89  ? 53.726  53.112  73.587  1.00 48.62  ? 90  GLN G CB  1 
ATOM   10271 C CG  . GLN G  1 89  ? 53.029  51.824  73.921  1.00 46.46  ? 90  GLN G CG  1 
ATOM   10272 C CD  . GLN G  1 89  ? 53.994  50.707  74.214  1.00 44.31  ? 90  GLN G CD  1 
ATOM   10273 O OE1 . GLN G  1 89  ? 54.574  50.632  75.287  1.00 39.29  ? 90  GLN G OE1 1 
ATOM   10274 N NE2 . GLN G  1 89  ? 54.174  49.830  73.243  1.00 45.24  ? 90  GLN G NE2 1 
ATOM   10275 N N   . SER G  1 90  ? 54.893  52.825  76.825  1.00 53.48  ? 91  SER G N   1 
ATOM   10276 C CA  . SER G  1 90  ? 55.759  52.079  77.761  1.00 55.87  ? 91  SER G CA  1 
ATOM   10277 C C   . SER G  1 90  ? 55.266  50.647  77.994  1.00 57.38  ? 91  SER G C   1 
ATOM   10278 O O   . SER G  1 90  ? 56.062  49.705  78.063  1.00 58.08  ? 91  SER G O   1 
ATOM   10279 C CB  . SER G  1 90  ? 55.805  52.767  79.134  1.00 55.08  ? 91  SER G CB  1 
ATOM   10280 O OG  . SER G  1 90  ? 56.335  54.079  79.071  1.00 56.98  ? 91  SER G OG  1 
ATOM   10281 N N   . TYR G  1 91  ? 53.948  50.506  78.139  1.00 58.56  ? 92  TYR G N   1 
ATOM   10282 C CA  . TYR G  1 91  ? 53.311  49.215  78.387  1.00 58.24  ? 92  TYR G CA  1 
ATOM   10283 C C   . TYR G  1 91  ? 54.104  48.116  77.722  1.00 58.29  ? 92  TYR G C   1 
ATOM   10284 O O   . TYR G  1 91  ? 54.895  47.428  78.367  1.00 56.75  ? 92  TYR G O   1 
ATOM   10285 C CB  . TYR G  1 91  ? 51.889  49.221  77.850  1.00 57.74  ? 92  TYR G CB  1 
ATOM   10286 C CG  . TYR G  1 91  ? 51.034  48.170  78.481  1.00 58.28  ? 92  TYR G CG  1 
ATOM   10287 C CD1 . TYR G  1 91  ? 50.789  48.190  79.850  1.00 57.98  ? 92  TYR G CD1 1 
ATOM   10288 C CD2 . TYR G  1 91  ? 50.473  47.144  77.717  1.00 59.64  ? 92  TYR G CD2 1 
ATOM   10289 C CE1 . TYR G  1 91  ? 50.010  47.219  80.452  1.00 58.72  ? 92  TYR G CE1 1 
ATOM   10290 C CE2 . TYR G  1 91  ? 49.685  46.160  78.310  1.00 59.56  ? 92  TYR G CE2 1 
ATOM   10291 C CZ  . TYR G  1 91  ? 49.463  46.210  79.682  1.00 59.20  ? 92  TYR G CZ  1 
ATOM   10292 O OH  . TYR G  1 91  ? 48.706  45.248  80.295  1.00 60.52  ? 92  TYR G OH  1 
ATOM   10293 N N   . SER G  1 92  ? 53.882  47.958  76.424  1.00 59.98  ? 93  SER G N   1 
ATOM   10294 C CA  . SER G  1 92  ? 54.612  46.972  75.652  1.00 61.83  ? 93  SER G CA  1 
ATOM   10295 C C   . SER G  1 92  ? 56.074  47.131  76.072  1.00 63.20  ? 93  SER G C   1 
ATOM   10296 O O   . SER G  1 92  ? 56.581  48.254  76.156  1.00 63.37  ? 93  SER G O   1 
ATOM   10297 C CB  . SER G  1 92  ? 54.445  47.263  74.156  1.00 60.65  ? 93  SER G CB  1 
ATOM   10298 O OG  . SER G  1 92  ? 55.262  46.426  73.353  1.00 61.19  ? 93  SER G OG  1 
ATOM   10299 N N   . THR G  1 93  ? 56.745  46.022  76.367  1.00 64.33  ? 94  THR G N   1 
ATOM   10300 C CA  . THR G  1 93  ? 58.143  46.100  76.769  1.00 65.07  ? 94  THR G CA  1 
ATOM   10301 C C   . THR G  1 93  ? 58.939  46.754  75.645  1.00 65.32  ? 94  THR G C   1 
ATOM   10302 O O   . THR G  1 93  ? 59.999  47.340  75.879  1.00 65.83  ? 94  THR G O   1 
ATOM   10303 C CB  . THR G  1 93  ? 58.740  44.710  77.034  1.00 65.45  ? 94  THR G CB  1 
ATOM   10304 O OG1 . THR G  1 93  ? 59.800  44.834  77.990  1.00 66.46  ? 94  THR G OG1 1 
ATOM   10305 C CG2 . THR G  1 93  ? 59.303  44.104  75.736  1.00 64.52  ? 94  THR G CG2 1 
ATOM   10306 N N   . SER G  1 94  ? 58.405  46.648  74.430  1.00 64.65  ? 95  SER G N   1 
ATOM   10307 C CA  . SER G  1 94  ? 59.027  47.201  73.235  1.00 64.80  ? 95  SER G CA  1 
ATOM   10308 C C   . SER G  1 94  ? 58.709  48.685  73.013  1.00 64.64  ? 95  SER G C   1 
ATOM   10309 O O   . SER G  1 94  ? 58.159  49.052  71.971  1.00 65.78  ? 95  SER G O   1 
ATOM   10310 C CB  . SER G  1 94  ? 58.580  46.388  72.008  1.00 65.72  ? 95  SER G CB  1 
ATOM   10311 O OG  . SER G  1 94  ? 57.163  46.401  71.846  1.00 65.64  ? 95  SER G OG  1 
ATOM   10312 N N   . HIS G  1 95  ? 59.071  49.534  73.973  1.00 63.39  ? 96  HIS G N   1 
ATOM   10313 C CA  . HIS G  1 95  ? 58.808  50.971  73.888  1.00 62.65  ? 96  HIS G CA  1 
ATOM   10314 C C   . HIS G  1 95  ? 58.685  51.530  72.471  1.00 60.93  ? 96  HIS G C   1 
ATOM   10315 O O   . HIS G  1 95  ? 59.469  51.182  71.587  1.00 60.50  ? 96  HIS G O   1 
ATOM   10316 C CB  . HIS G  1 95  ? 59.883  51.738  74.650  1.00 65.88  ? 96  HIS G CB  1 
ATOM   10317 C CG  . HIS G  1 95  ? 59.827  51.535  76.132  1.00 69.96  ? 96  HIS G CG  1 
ATOM   10318 N ND1 . HIS G  1 95  ? 60.690  52.166  77.004  1.00 71.56  ? 96  HIS G ND1 1 
ATOM   10319 C CD2 . HIS G  1 95  ? 59.015  50.765  76.898  1.00 70.73  ? 96  HIS G CD2 1 
ATOM   10320 C CE1 . HIS G  1 95  ? 60.413  51.793  78.242  1.00 72.32  ? 96  HIS G CE1 1 
ATOM   10321 N NE2 . HIS G  1 95  ? 59.401  50.943  78.205  1.00 72.01  ? 96  HIS G NE2 1 
ATOM   10322 N N   . THR G  1 96  ? 57.692  52.398  72.262  1.00 58.72  ? 97  THR G N   1 
ATOM   10323 C CA  . THR G  1 96  ? 57.449  52.995  70.946  1.00 54.61  ? 97  THR G CA  1 
ATOM   10324 C C   . THR G  1 96  ? 56.801  54.361  71.042  1.00 51.15  ? 97  THR G C   1 
ATOM   10325 O O   . THR G  1 96  ? 55.923  54.577  71.872  1.00 49.88  ? 97  THR G O   1 
ATOM   10326 C CB  . THR G  1 96  ? 56.522  52.108  70.090  1.00 55.35  ? 97  THR G CB  1 
ATOM   10327 O OG1 . THR G  1 96  ? 57.130  50.825  69.881  1.00 55.78  ? 97  THR G OG1 1 
ATOM   10328 C CG2 . THR G  1 96  ? 56.250  52.768  68.745  1.00 55.26  ? 97  THR G CG2 1 
ATOM   10329 N N   . PHE G  1 97  ? 57.241  55.270  70.176  1.00 48.97  ? 98  PHE G N   1 
ATOM   10330 C CA  . PHE G  1 97  ? 56.713  56.642  70.106  1.00 47.10  ? 98  PHE G CA  1 
ATOM   10331 C C   . PHE G  1 97  ? 55.713  56.846  68.944  1.00 46.72  ? 98  PHE G C   1 
ATOM   10332 O O   . PHE G  1 97  ? 55.584  56.002  68.042  1.00 45.34  ? 98  PHE G O   1 
ATOM   10333 C CB  . PHE G  1 97  ? 57.826  57.667  69.854  1.00 43.02  ? 98  PHE G CB  1 
ATOM   10334 C CG  . PHE G  1 97  ? 58.778  57.855  70.974  1.00 39.09  ? 98  PHE G CG  1 
ATOM   10335 C CD1 . PHE G  1 97  ? 59.827  56.979  71.163  1.00 39.04  ? 98  PHE G CD1 1 
ATOM   10336 C CD2 . PHE G  1 97  ? 58.703  58.985  71.769  1.00 39.34  ? 98  PHE G CD2 1 
ATOM   10337 C CE1 . PHE G  1 97  ? 60.803  57.233  72.123  1.00 37.74  ? 98  PHE G CE1 1 
ATOM   10338 C CE2 . PHE G  1 97  ? 59.671  59.246  72.729  1.00 38.09  ? 98  PHE G CE2 1 
ATOM   10339 C CZ  . PHE G  1 97  ? 60.724  58.367  72.901  1.00 36.71  ? 98  PHE G CZ  1 
ATOM   10340 N N   . GLY G  1 98  ? 55.036  57.994  68.978  1.00 46.76  ? 99  GLY G N   1 
ATOM   10341 C CA  . GLY G  1 98  ? 54.114  58.376  67.925  1.00 47.04  ? 99  GLY G CA  1 
ATOM   10342 C C   . GLY G  1 98  ? 54.988  59.135  66.937  1.00 47.44  ? 99  GLY G C   1 
ATOM   10343 O O   . GLY G  1 98  ? 56.200  59.191  67.134  1.00 46.31  ? 99  GLY G O   1 
ATOM   10344 N N   . GLN G  1 99  ? 54.418  59.720  65.888  1.00 48.36  ? 100 GLN G N   1 
ATOM   10345 C CA  . GLN G  1 99  ? 55.238  60.454  64.923  1.00 49.03  ? 100 GLN G CA  1 
ATOM   10346 C C   . GLN G  1 99  ? 55.590  61.868  65.387  1.00 48.32  ? 100 GLN G C   1 
ATOM   10347 O O   . GLN G  1 99  ? 56.587  62.437  64.939  1.00 47.25  ? 100 GLN G O   1 
ATOM   10348 C CB  . GLN G  1 99  ? 54.538  60.529  63.567  1.00 52.02  ? 100 GLN G CB  1 
ATOM   10349 C CG  . GLN G  1 99  ? 53.334  61.465  63.510  1.00 56.21  ? 100 GLN G CG  1 
ATOM   10350 C CD  . GLN G  1 99  ? 52.676  61.482  62.133  1.00 58.52  ? 100 GLN G CD  1 
ATOM   10351 O OE1 . GLN G  1 99  ? 53.324  61.773  61.125  1.00 60.49  ? 100 GLN G OE1 1 
ATOM   10352 N NE2 . GLN G  1 99  ? 51.383  61.167  62.087  1.00 60.51  ? 100 GLN G NE2 1 
ATOM   10353 N N   . GLY G  1 100 ? 54.765  62.438  66.270  1.00 47.55  ? 101 GLY G N   1 
ATOM   10354 C CA  . GLY G  1 100 ? 55.028  63.775  66.788  1.00 45.26  ? 101 GLY G CA  1 
ATOM   10355 C C   . GLY G  1 100 ? 54.135  64.836  66.190  1.00 43.75  ? 101 GLY G C   1 
ATOM   10356 O O   . GLY G  1 100 ? 53.890  64.830  64.997  1.00 44.43  ? 101 GLY G O   1 
ATOM   10357 N N   . THR G  1 101 ? 53.636  65.749  67.012  1.00 42.82  ? 102 THR G N   1 
ATOM   10358 C CA  . THR G  1 101 ? 52.776  66.820  66.516  1.00 42.03  ? 102 THR G CA  1 
ATOM   10359 C C   . THR G  1 101 ? 53.408  68.179  66.764  1.00 41.62  ? 102 THR G C   1 
ATOM   10360 O O   . THR G  1 101 ? 53.734  68.513  67.892  1.00 43.13  ? 102 THR G O   1 
ATOM   10361 C CB  . THR G  1 101 ? 51.386  66.809  67.200  1.00 41.35  ? 102 THR G CB  1 
ATOM   10362 O OG1 . THR G  1 101 ? 50.530  65.872  66.537  1.00 43.70  ? 102 THR G OG1 1 
ATOM   10363 C CG2 . THR G  1 101 ? 50.751  68.184  67.134  1.00 39.32  ? 102 THR G CG2 1 
ATOM   10364 N N   . LYS G  1 102 ? 53.579  68.971  65.716  1.00 40.83  ? 103 LYS G N   1 
ATOM   10365 C CA  . LYS G  1 102 ? 54.161  70.287  65.889  1.00 39.62  ? 103 LYS G CA  1 
ATOM   10366 C C   . LYS G  1 102 ? 53.115  71.381  65.939  1.00 38.88  ? 103 LYS G C   1 
ATOM   10367 O O   . LYS G  1 102 ? 52.415  71.639  64.970  1.00 38.35  ? 103 LYS G O   1 
ATOM   10368 C CB  . LYS G  1 102 ? 55.163  70.598  64.772  1.00 40.35  ? 103 LYS G CB  1 
ATOM   10369 C CG  . LYS G  1 102 ? 55.691  72.037  64.796  1.00 40.68  ? 103 LYS G CG  1 
ATOM   10370 C CD  . LYS G  1 102 ? 56.905  72.232  63.884  1.00 40.84  ? 103 LYS G CD  1 
ATOM   10371 C CE  . LYS G  1 102 ? 57.558  73.602  64.099  1.00 41.60  ? 103 LYS G CE  1 
ATOM   10372 N NZ  . LYS G  1 102 ? 58.952  73.638  63.564  1.00 39.16  ? 103 LYS G NZ  1 
ATOM   10373 N N   . LEU G  1 103 ? 53.009  72.023  67.086  1.00 38.85  ? 104 LEU G N   1 
ATOM   10374 C CA  . LEU G  1 103 ? 52.088  73.120  67.236  1.00 41.23  ? 104 LEU G CA  1 
ATOM   10375 C C   . LEU G  1 103 ? 52.777  74.401  66.770  1.00 42.47  ? 104 LEU G C   1 
ATOM   10376 O O   . LEU G  1 103 ? 53.865  74.715  67.249  1.00 42.40  ? 104 LEU G O   1 
ATOM   10377 C CB  . LEU G  1 103 ? 51.696  73.254  68.697  1.00 42.86  ? 104 LEU G CB  1 
ATOM   10378 C CG  . LEU G  1 103 ? 50.477  72.423  69.084  1.00 45.16  ? 104 LEU G CG  1 
ATOM   10379 C CD1 . LEU G  1 103 ? 50.326  72.327  70.604  1.00 46.45  ? 104 LEU G CD1 1 
ATOM   10380 C CD2 . LEU G  1 103 ? 49.253  73.082  68.467  1.00 44.69  ? 104 LEU G CD2 1 
ATOM   10381 N N   . GLU G  1 104 ? 52.159  75.132  65.836  1.00 43.68  ? 105 GLU G N   1 
ATOM   10382 C CA  . GLU G  1 104 ? 52.733  76.391  65.353  1.00 44.62  ? 105 GLU G CA  1 
ATOM   10383 C C   . GLU G  1 104 ? 51.821  77.605  65.566  1.00 45.92  ? 105 GLU G C   1 
ATOM   10384 O O   . GLU G  1 104 ? 50.586  77.508  65.526  1.00 45.36  ? 105 GLU G O   1 
ATOM   10385 C CB  . GLU G  1 104 ? 53.081  76.315  63.881  1.00 43.25  ? 105 GLU G CB  1 
ATOM   10386 C CG  . GLU G  1 104 ? 51.969  76.789  62.992  1.00 45.63  ? 105 GLU G CG  1 
ATOM   10387 C CD  . GLU G  1 104 ? 52.487  77.219  61.651  1.00 48.28  ? 105 GLU G CD  1 
ATOM   10388 O OE1 . GLU G  1 104 ? 51.667  77.536  60.761  1.00 48.88  ? 105 GLU G OE1 1 
ATOM   10389 O OE2 . GLU G  1 104 ? 53.730  77.242  61.496  1.00 50.00  ? 105 GLU G OE2 1 
ATOM   10390 N N   . ILE G  1 105 ? 52.448  78.756  65.784  1.00 47.10  ? 106 ILE G N   1 
ATOM   10391 C CA  . ILE G  1 105 ? 51.718  79.984  66.020  1.00 48.33  ? 106 ILE G CA  1 
ATOM   10392 C C   . ILE G  1 105 ? 51.021  80.473  64.772  1.00 48.89  ? 106 ILE G C   1 
ATOM   10393 O O   . ILE G  1 105 ? 51.656  80.811  63.772  1.00 48.48  ? 106 ILE G O   1 
ATOM   10394 C CB  . ILE G  1 105 ? 52.629  81.116  66.525  1.00 50.18  ? 106 ILE G CB  1 
ATOM   10395 C CG1 . ILE G  1 105 ? 53.778  80.555  67.374  1.00 52.69  ? 106 ILE G CG1 1 
ATOM   10396 C CG2 . ILE G  1 105 ? 51.815  82.074  67.394  1.00 50.43  ? 106 ILE G CG2 1 
ATOM   10397 C CD1 . ILE G  1 105 ? 55.016  80.092  66.581  1.00 54.34  ? 106 ILE G CD1 1 
ATOM   10398 N N   . LYS G  1 106 ? 49.699  80.503  64.856  1.00 48.80  ? 107 LYS G N   1 
ATOM   10399 C CA  . LYS G  1 106 ? 48.838  80.953  63.777  1.00 49.24  ? 107 LYS G CA  1 
ATOM   10400 C C   . LYS G  1 106 ? 48.787  82.487  63.767  1.00 48.82  ? 107 LYS G C   1 
ATOM   10401 O O   . LYS G  1 106 ? 48.865  83.125  64.818  1.00 48.91  ? 107 LYS G O   1 
ATOM   10402 C CB  . LYS G  1 106 ? 47.439  80.395  64.020  1.00 50.34  ? 107 LYS G CB  1 
ATOM   10403 C CG  . LYS G  1 106 ? 46.412  80.688  62.952  1.00 53.66  ? 107 LYS G CG  1 
ATOM   10404 C CD  . LYS G  1 106 ? 44.999  80.657  63.544  1.00 56.81  ? 107 LYS G CD  1 
ATOM   10405 C CE  . LYS G  1 106 ? 44.829  79.545  64.600  1.00 59.65  ? 107 LYS G CE  1 
ATOM   10406 N NZ  . LYS G  1 106 ? 43.472  79.493  65.267  1.00 61.21  ? 107 LYS G NZ  1 
ATOM   10407 N N   . ARG G  1 107 ? 48.654  83.076  62.584  1.00 46.95  ? 108 ARG G N   1 
ATOM   10408 C CA  . ARG G  1 107 ? 48.557  84.522  62.460  1.00 45.86  ? 108 ARG G CA  1 
ATOM   10409 C C   . ARG G  1 107 ? 47.898  84.848  61.145  1.00 46.38  ? 108 ARG G C   1 
ATOM   10410 O O   . ARG G  1 107 ? 47.367  83.960  60.490  1.00 46.27  ? 108 ARG G O   1 
ATOM   10411 C CB  . ARG G  1 107 ? 49.926  85.162  62.519  1.00 45.21  ? 108 ARG G CB  1 
ATOM   10412 C CG  . ARG G  1 107 ? 51.020  84.305  61.953  1.00 46.84  ? 108 ARG G CG  1 
ATOM   10413 C CD  . ARG G  1 107 ? 52.125  85.177  61.431  1.00 48.08  ? 108 ARG G CD  1 
ATOM   10414 N NE  . ARG G  1 107 ? 51.620  85.976  60.324  1.00 50.23  ? 108 ARG G NE  1 
ATOM   10415 C CZ  . ARG G  1 107 ? 52.152  87.119  59.914  1.00 50.56  ? 108 ARG G CZ  1 
ATOM   10416 N NH1 . ARG G  1 107 ? 53.222  87.622  60.521  1.00 49.20  ? 108 ARG G NH1 1 
ATOM   10417 N NH2 . ARG G  1 107 ? 51.602  87.758  58.894  1.00 51.44  ? 108 ARG G NH2 1 
ATOM   10418 N N   . THR G  1 108 ? 47.917  86.116  60.753  1.00 47.66  ? 109 THR G N   1 
ATOM   10419 C CA  . THR G  1 108 ? 47.295  86.510  59.488  1.00 48.68  ? 109 THR G CA  1 
ATOM   10420 C C   . THR G  1 108 ? 48.280  86.319  58.343  1.00 50.24  ? 109 THR G C   1 
ATOM   10421 O O   . THR G  1 108 ? 49.499  86.441  58.537  1.00 51.23  ? 109 THR G O   1 
ATOM   10422 C CB  . THR G  1 108 ? 46.874  87.975  59.500  1.00 48.35  ? 109 THR G CB  1 
ATOM   10423 O OG1 . THR G  1 108 ? 48.020  88.786  59.783  1.00 48.53  ? 109 THR G OG1 1 
ATOM   10424 C CG2 . THR G  1 108 ? 45.784  88.215  60.536  1.00 48.41  ? 109 THR G CG2 1 
ATOM   10425 N N   . VAL G  1 109 ? 47.751  86.029  57.152  1.00 50.03  ? 110 VAL G N   1 
ATOM   10426 C CA  . VAL G  1 109 ? 48.572  85.800  55.957  1.00 49.31  ? 110 VAL G CA  1 
ATOM   10427 C C   . VAL G  1 109 ? 49.521  86.964  55.637  1.00 51.15  ? 110 VAL G C   1 
ATOM   10428 O O   . VAL G  1 109 ? 49.413  88.049  56.210  1.00 52.76  ? 110 VAL G O   1 
ATOM   10429 C CB  . VAL G  1 109 ? 47.658  85.482  54.735  1.00 46.74  ? 110 VAL G CB  1 
ATOM   10430 C CG1 . VAL G  1 109 ? 48.435  85.534  53.434  1.00 43.16  ? 110 VAL G CG1 1 
ATOM   10431 C CG2 . VAL G  1 109 ? 47.045  84.112  54.912  1.00 43.61  ? 110 VAL G CG2 1 
ATOM   10432 N N   . ALA G  1 110 ? 50.466  86.726  54.734  1.00 53.01  ? 111 ALA G N   1 
ATOM   10433 C CA  . ALA G  1 110 ? 51.437  87.744  54.342  1.00 54.42  ? 111 ALA G CA  1 
ATOM   10434 C C   . ALA G  1 110 ? 52.265  87.273  53.144  1.00 55.24  ? 111 ALA G C   1 
ATOM   10435 O O   . ALA G  1 110 ? 53.383  86.808  53.331  1.00 56.94  ? 111 ALA G O   1 
ATOM   10436 C CB  . ALA G  1 110 ? 52.361  88.063  55.532  1.00 52.45  ? 111 ALA G CB  1 
ATOM   10437 N N   . ALA G  1 111 ? 51.733  87.399  51.926  1.00 55.60  ? 112 ALA G N   1 
ATOM   10438 C CA  . ALA G  1 111 ? 52.454  86.956  50.725  1.00 57.29  ? 112 ALA G CA  1 
ATOM   10439 C C   . ALA G  1 111 ? 53.951  87.246  50.833  1.00 58.74  ? 112 ALA G C   1 
ATOM   10440 O O   . ALA G  1 111 ? 54.353  88.266  51.386  1.00 59.27  ? 112 ALA G O   1 
ATOM   10441 C CB  . ALA G  1 111 ? 51.877  87.621  49.485  1.00 56.09  ? 112 ALA G CB  1 
ATOM   10442 N N   . PRO G  1 112 ? 54.796  86.347  50.306  1.00 60.54  ? 113 PRO G N   1 
ATOM   10443 C CA  . PRO G  1 112 ? 56.257  86.502  50.350  1.00 62.03  ? 113 PRO G CA  1 
ATOM   10444 C C   . PRO G  1 112 ? 56.863  87.587  49.471  1.00 62.01  ? 113 PRO G C   1 
ATOM   10445 O O   . PRO G  1 112 ? 56.340  87.884  48.398  1.00 61.31  ? 113 PRO G O   1 
ATOM   10446 C CB  . PRO G  1 112 ? 56.765  85.109  49.954  1.00 62.58  ? 113 PRO G CB  1 
ATOM   10447 C CG  . PRO G  1 112 ? 55.729  84.636  48.998  1.00 62.69  ? 113 PRO G CG  1 
ATOM   10448 C CD  . PRO G  1 112 ? 54.431  85.057  49.694  1.00 62.03  ? 113 PRO G CD  1 
ATOM   10449 N N   . SER G  1 113 ? 57.965  88.173  49.951  1.00 62.82  ? 114 SER G N   1 
ATOM   10450 C CA  . SER G  1 113 ? 58.710  89.198  49.208  1.00 63.64  ? 114 SER G CA  1 
ATOM   10451 C C   . SER G  1 113 ? 59.752  88.417  48.416  1.00 62.36  ? 114 SER G C   1 
ATOM   10452 O O   . SER G  1 113 ? 60.621  87.782  48.990  1.00 61.42  ? 114 SER G O   1 
ATOM   10453 C CB  . SER G  1 113 ? 59.401  90.191  50.159  1.00 65.13  ? 114 SER G CB  1 
ATOM   10454 O OG  . SER G  1 113 ? 58.477  91.121  50.712  1.00 66.84  ? 114 SER G OG  1 
ATOM   10455 N N   . VAL G  1 114 ? 59.645  88.468  47.096  1.00 62.38  ? 115 VAL G N   1 
ATOM   10456 C CA  . VAL G  1 114 ? 60.528  87.720  46.213  1.00 63.40  ? 115 VAL G CA  1 
ATOM   10457 C C   . VAL G  1 114 ? 61.859  88.366  45.847  1.00 64.71  ? 115 VAL G C   1 
ATOM   10458 O O   . VAL G  1 114 ? 61.995  89.588  45.852  1.00 65.68  ? 115 VAL G O   1 
ATOM   10459 C CB  . VAL G  1 114 ? 59.796  87.377  44.906  1.00 62.24  ? 115 VAL G CB  1 
ATOM   10460 C CG1 . VAL G  1 114 ? 60.564  86.331  44.147  1.00 61.82  ? 115 VAL G CG1 1 
ATOM   10461 C CG2 . VAL G  1 114 ? 58.393  86.897  45.209  1.00 61.48  ? 115 VAL G CG2 1 
ATOM   10462 N N   . PHE G  1 115 ? 62.837  87.520  45.528  1.00 65.69  ? 116 PHE G N   1 
ATOM   10463 C CA  . PHE G  1 115 ? 64.173  87.950  45.128  1.00 67.24  ? 116 PHE G CA  1 
ATOM   10464 C C   . PHE G  1 115 ? 64.732  86.839  44.251  1.00 68.73  ? 116 PHE G C   1 
ATOM   10465 O O   . PHE G  1 115 ? 63.986  85.915  43.909  1.00 68.96  ? 116 PHE G O   1 
ATOM   10466 C CB  . PHE G  1 115 ? 65.047  88.174  46.355  1.00 66.94  ? 116 PHE G CB  1 
ATOM   10467 C CG  . PHE G  1 115 ? 64.422  89.081  47.361  1.00 68.45  ? 116 PHE G CG  1 
ATOM   10468 C CD1 . PHE G  1 115 ? 63.549  88.580  48.320  1.00 69.30  ? 116 PHE G CD1 1 
ATOM   10469 C CD2 . PHE G  1 115 ? 64.645  90.451  47.313  1.00 69.78  ? 116 PHE G CD2 1 
ATOM   10470 C CE1 . PHE G  1 115 ? 62.903  89.432  49.216  1.00 69.47  ? 116 PHE G CE1 1 
ATOM   10471 C CE2 . PHE G  1 115 ? 64.007  91.318  48.204  1.00 69.85  ? 116 PHE G CE2 1 
ATOM   10472 C CZ  . PHE G  1 115 ? 63.133  90.804  49.158  1.00 70.00  ? 116 PHE G CZ  1 
ATOM   10473 N N   . ILE G  1 116 ? 66.016  86.916  43.878  1.00 70.17  ? 117 ILE G N   1 
ATOM   10474 C CA  . ILE G  1 116 ? 66.630  85.888  43.010  1.00 70.70  ? 117 ILE G CA  1 
ATOM   10475 C C   . ILE G  1 116 ? 68.090  86.157  42.636  1.00 69.95  ? 117 ILE G C   1 
ATOM   10476 O O   . ILE G  1 116 ? 68.387  86.665  41.558  1.00 68.18  ? 117 ILE G O   1 
ATOM   10477 C CB  . ILE G  1 116 ? 65.823  85.721  41.696  1.00 71.21  ? 117 ILE G CB  1 
ATOM   10478 C CG1 . ILE G  1 116 ? 66.514  84.717  40.773  1.00 71.84  ? 117 ILE G CG1 1 
ATOM   10479 C CG2 . ILE G  1 116 ? 65.658  87.079  41.016  1.00 71.99  ? 117 ILE G CG2 1 
ATOM   10480 C CD1 . ILE G  1 116 ? 65.672  84.335  39.563  1.00 73.05  ? 117 ILE G CD1 1 
ATOM   10481 N N   . PHE G  1 117 ? 69.004  85.778  43.514  1.00 70.32  ? 118 PHE G N   1 
ATOM   10482 C CA  . PHE G  1 117 ? 70.405  86.025  43.251  1.00 71.49  ? 118 PHE G CA  1 
ATOM   10483 C C   . PHE G  1 117 ? 71.005  85.170  42.150  1.00 73.32  ? 118 PHE G C   1 
ATOM   10484 O O   . PHE G  1 117 ? 70.831  83.951  42.127  1.00 73.20  ? 118 PHE G O   1 
ATOM   10485 C CB  . PHE G  1 117 ? 71.225  85.834  44.521  1.00 70.90  ? 118 PHE G CB  1 
ATOM   10486 C CG  . PHE G  1 117 ? 70.735  86.633  45.684  1.00 70.84  ? 118 PHE G CG  1 
ATOM   10487 C CD1 . PHE G  1 117 ? 71.466  86.661  46.869  1.00 70.77  ? 118 PHE G CD1 1 
ATOM   10488 C CD2 . PHE G  1 117 ? 69.545  87.353  45.606  1.00 69.79  ? 118 PHE G CD2 1 
ATOM   10489 C CE1 . PHE G  1 117 ? 71.022  87.391  47.958  1.00 70.45  ? 118 PHE G CE1 1 
ATOM   10490 C CE2 . PHE G  1 117 ? 69.092  88.084  46.683  1.00 70.36  ? 118 PHE G CE2 1 
ATOM   10491 C CZ  . PHE G  1 117 ? 69.833  88.106  47.869  1.00 71.14  ? 118 PHE G CZ  1 
ATOM   10492 N N   . PRO G  1 118 ? 71.734  85.809  41.218  1.00 75.27  ? 119 PRO G N   1 
ATOM   10493 C CA  . PRO G  1 118 ? 72.386  85.122  40.102  1.00 76.10  ? 119 PRO G CA  1 
ATOM   10494 C C   . PRO G  1 118 ? 73.617  84.440  40.692  1.00 77.20  ? 119 PRO G C   1 
ATOM   10495 O O   . PRO G  1 118 ? 74.061  84.808  41.778  1.00 77.15  ? 119 PRO G O   1 
ATOM   10496 C CB  . PRO G  1 118 ? 72.745  86.268  39.168  1.00 76.11  ? 119 PRO G CB  1 
ATOM   10497 C CG  . PRO G  1 118 ? 73.095  87.363  40.131  1.00 75.63  ? 119 PRO G CG  1 
ATOM   10498 C CD  . PRO G  1 118 ? 71.986  87.263  41.155  1.00 75.77  ? 119 PRO G CD  1 
ATOM   10499 N N   . PRO G  1 119 ? 74.188  83.447  39.990  1.00 78.57  ? 120 PRO G N   1 
ATOM   10500 C CA  . PRO G  1 119 ? 75.370  82.734  40.487  1.00 79.47  ? 120 PRO G CA  1 
ATOM   10501 C C   . PRO G  1 119 ? 76.675  83.518  40.378  1.00 80.33  ? 120 PRO G C   1 
ATOM   10502 O O   . PRO G  1 119 ? 76.911  84.201  39.385  1.00 80.53  ? 120 PRO G O   1 
ATOM   10503 C CB  . PRO G  1 119 ? 75.387  81.484  39.627  1.00 78.72  ? 120 PRO G CB  1 
ATOM   10504 C CG  . PRO G  1 119 ? 74.946  82.028  38.303  1.00 79.25  ? 120 PRO G CG  1 
ATOM   10505 C CD  . PRO G  1 119 ? 73.773  82.913  38.680  1.00 79.30  ? 120 PRO G CD  1 
ATOM   10506 N N   . SER G  1 120 ? 77.513  83.406  41.407  1.00 81.25  ? 121 SER G N   1 
ATOM   10507 C CA  . SER G  1 120 ? 78.813  84.075  41.446  1.00 82.56  ? 121 SER G CA  1 
ATOM   10508 C C   . SER G  1 120 ? 79.805  83.366  40.511  1.00 83.61  ? 121 SER G C   1 
ATOM   10509 O O   . SER G  1 120 ? 79.901  82.135  40.504  1.00 84.31  ? 121 SER G O   1 
ATOM   10510 C CB  . SER G  1 120 ? 79.356  84.062  42.876  1.00 83.11  ? 121 SER G CB  1 
ATOM   10511 O OG  . SER G  1 120 ? 79.638  82.743  43.315  1.00 82.83  ? 121 SER G OG  1 
ATOM   10512 N N   . ASP G  1 121 ? 80.551  84.138  39.728  1.00 83.97  ? 122 ASP G N   1 
ATOM   10513 C CA  . ASP G  1 121 ? 81.496  83.549  38.789  1.00 84.40  ? 122 ASP G CA  1 
ATOM   10514 C C   . ASP G  1 121 ? 82.583  82.735  39.480  1.00 84.84  ? 122 ASP G C   1 
ATOM   10515 O O   . ASP G  1 121 ? 83.132  81.795  38.907  1.00 84.81  ? 122 ASP G O   1 
ATOM   10516 C CB  . ASP G  1 121 ? 82.099  84.641  37.897  1.00 84.02  ? 122 ASP G CB  1 
ATOM   10517 C CG  . ASP G  1 121 ? 81.057  85.277  36.967  1.00 83.85  ? 122 ASP G CG  1 
ATOM   10518 O OD1 . ASP G  1 121 ? 81.443  86.032  36.050  1.00 84.25  ? 122 ASP G OD1 1 
ATOM   10519 O OD2 . ASP G  1 121 ? 79.846  85.023  37.153  1.00 82.34  ? 122 ASP G OD2 1 
ATOM   10520 N N   . GLU G  1 122 ? 82.873  83.090  40.723  1.00 85.88  ? 123 GLU G N   1 
ATOM   10521 C CA  . GLU G  1 122 ? 83.871  82.392  41.530  1.00 86.67  ? 123 GLU G CA  1 
ATOM   10522 C C   . GLU G  1 122 ? 83.437  80.934  41.534  1.00 86.03  ? 123 GLU G C   1 
ATOM   10523 O O   . GLU G  1 122 ? 84.244  80.011  41.642  1.00 85.40  ? 123 GLU G O   1 
ATOM   10524 C CB  . GLU G  1 122 ? 83.854  82.943  42.958  1.00 88.47  ? 123 GLU G CB  1 
ATOM   10525 C CG  . GLU G  1 122 ? 83.927  84.468  43.040  1.00 91.62  ? 123 GLU G CG  1 
ATOM   10526 C CD  . GLU G  1 122 ? 83.019  85.166  42.027  1.00 93.64  ? 123 GLU G CD  1 
ATOM   10527 O OE1 . GLU G  1 122 ? 81.801  84.877  42.008  1.00 94.11  ? 123 GLU G OE1 1 
ATOM   10528 O OE2 . GLU G  1 122 ? 83.525  86.002  41.243  1.00 95.22  ? 123 GLU G OE2 1 
ATOM   10529 N N   . GLN G  1 123 ? 82.130  80.759  41.408  1.00 85.90  ? 124 GLN G N   1 
ATOM   10530 C CA  . GLN G  1 123 ? 81.515  79.454  41.373  1.00 85.74  ? 124 GLN G CA  1 
ATOM   10531 C C   . GLN G  1 123 ? 81.670  78.873  39.984  1.00 85.95  ? 124 GLN G C   1 
ATOM   10532 O O   . GLN G  1 123 ? 82.278  77.821  39.820  1.00 85.66  ? 124 GLN G O   1 
ATOM   10533 C CB  . GLN G  1 123 ? 80.041  79.578  41.717  1.00 85.67  ? 124 GLN G CB  1 
ATOM   10534 C CG  . GLN G  1 123 ? 79.245  78.342  41.428  1.00 86.27  ? 124 GLN G CG  1 
ATOM   10535 C CD  . GLN G  1 123 ? 77.845  78.448  41.958  1.00 86.09  ? 124 GLN G CD  1 
ATOM   10536 O OE1 . GLN G  1 123 ? 77.102  79.359  41.594  1.00 86.58  ? 124 GLN G OE1 1 
ATOM   10537 N NE2 . GLN G  1 123 ? 77.472  77.518  42.834  1.00 85.59  ? 124 GLN G NE2 1 
ATOM   10538 N N   . LEU G  1 124 ? 81.110  79.555  38.988  1.00 86.38  ? 125 LEU G N   1 
ATOM   10539 C CA  . LEU G  1 124 ? 81.209  79.094  37.603  1.00 87.14  ? 125 LEU G CA  1 
ATOM   10540 C C   . LEU G  1 124 ? 82.644  78.664  37.323  1.00 86.74  ? 125 LEU G C   1 
ATOM   10541 O O   . LEU G  1 124 ? 82.903  77.788  36.492  1.00 86.84  ? 125 LEU G O   1 
ATOM   10542 C CB  . LEU G  1 124 ? 80.809  80.202  36.619  1.00 88.72  ? 125 LEU G CB  1 
ATOM   10543 C CG  . LEU G  1 124 ? 79.319  80.488  36.403  1.00 89.79  ? 125 LEU G CG  1 
ATOM   10544 C CD1 . LEU G  1 124 ? 79.156  81.556  35.327  1.00 89.80  ? 125 LEU G CD1 1 
ATOM   10545 C CD2 . LEU G  1 124 ? 78.598  79.209  35.985  1.00 90.16  ? 125 LEU G CD2 1 
ATOM   10546 N N   . LYS G  1 125 ? 83.578  79.305  38.014  1.00 85.13  ? 126 LYS G N   1 
ATOM   10547 C CA  . LYS G  1 125 ? 84.977  78.966  37.871  1.00 83.22  ? 126 LYS G CA  1 
ATOM   10548 C C   . LYS G  1 125 ? 85.103  77.498  38.267  1.00 81.90  ? 126 LYS G C   1 
ATOM   10549 O O   . LYS G  1 125 ? 85.659  76.693  37.529  1.00 81.19  ? 126 LYS G O   1 
ATOM   10550 C CB  . LYS G  1 125 ? 85.814  79.856  38.788  1.00 83.63  ? 126 LYS G CB  1 
ATOM   10551 C CG  . LYS G  1 125 ? 86.341  81.112  38.115  1.00 84.55  ? 126 LYS G CG  1 
ATOM   10552 C CD  . LYS G  1 125 ? 85.316  81.748  37.190  1.00 85.64  ? 126 LYS G CD  1 
ATOM   10553 C CE  . LYS G  1 125 ? 85.906  82.961  36.480  1.00 86.83  ? 126 LYS G CE  1 
ATOM   10554 N NZ  . LYS G  1 125 ? 85.073  83.454  35.342  1.00 87.26  ? 126 LYS G NZ  1 
ATOM   10555 N N   . SER G  1 126 ? 84.555  77.154  39.428  1.00 80.63  ? 127 SER G N   1 
ATOM   10556 C CA  . SER G  1 126 ? 84.600  75.783  39.908  1.00 79.05  ? 127 SER G CA  1 
ATOM   10557 C C   . SER G  1 126 ? 83.711  74.861  39.073  1.00 78.59  ? 127 SER G C   1 
ATOM   10558 O O   . SER G  1 126 ? 83.514  73.702  39.429  1.00 79.20  ? 127 SER G O   1 
ATOM   10559 C CB  . SER G  1 126 ? 84.185  75.720  41.384  1.00 78.44  ? 127 SER G CB  1 
ATOM   10560 O OG  . SER G  1 126 ? 82.874  76.214  41.576  1.00 77.53  ? 127 SER G OG  1 
ATOM   10561 N N   . GLY G  1 127 ? 83.164  75.377  37.974  1.00 77.67  ? 128 GLY G N   1 
ATOM   10562 C CA  . GLY G  1 127 ? 82.330  74.557  37.100  1.00 76.69  ? 128 GLY G CA  1 
ATOM   10563 C C   . GLY G  1 127 ? 80.814  74.550  37.268  1.00 76.07  ? 128 GLY G C   1 
ATOM   10564 O O   . GLY G  1 127 ? 80.069  74.823  36.318  1.00 75.94  ? 128 GLY G O   1 
ATOM   10565 N N   . THR G  1 128 ? 80.352  74.222  38.471  1.00 74.55  ? 129 THR G N   1 
ATOM   10566 C CA  . THR G  1 128 ? 78.924  74.159  38.763  1.00 72.83  ? 129 THR G CA  1 
ATOM   10567 C C   . THR G  1 128 ? 78.270  75.542  38.727  1.00 71.82  ? 129 THR G C   1 
ATOM   10568 O O   . THR G  1 128 ? 78.952  76.549  38.510  1.00 71.64  ? 129 THR G O   1 
ATOM   10569 C CB  . THR G  1 128 ? 78.697  73.554  40.138  1.00 72.31  ? 129 THR G CB  1 
ATOM   10570 O OG1 . THR G  1 128 ? 78.972  74.541  41.134  1.00 73.65  ? 129 THR G OG1 1 
ATOM   10571 C CG2 . THR G  1 128 ? 79.635  72.375  40.353  1.00 72.22  ? 129 THR G CG2 1 
ATOM   10572 N N   . ALA G  1 129 ? 76.954  75.585  38.951  1.00 70.02  ? 130 ALA G N   1 
ATOM   10573 C CA  . ALA G  1 129 ? 76.201  76.844  38.936  1.00 68.66  ? 130 ALA G CA  1 
ATOM   10574 C C   . ALA G  1 129 ? 75.115  76.919  40.021  1.00 67.84  ? 130 ALA G C   1 
ATOM   10575 O O   . ALA G  1 129 ? 74.393  75.946  40.255  1.00 67.37  ? 130 ALA G O   1 
ATOM   10576 C CB  . ALA G  1 129 ? 75.574  77.053  37.556  1.00 68.33  ? 130 ALA G CB  1 
ATOM   10577 N N   . SER G  1 130 ? 74.994  78.087  40.662  1.00 66.69  ? 131 SER G N   1 
ATOM   10578 C CA  . SER G  1 130 ? 74.012  78.297  41.733  1.00 64.77  ? 131 SER G CA  1 
ATOM   10579 C C   . SER G  1 130 ? 72.951  79.384  41.509  1.00 63.56  ? 131 SER G C   1 
ATOM   10580 O O   . SER G  1 130 ? 73.216  80.586  41.604  1.00 62.80  ? 131 SER G O   1 
ATOM   10581 C CB  . SER G  1 130 ? 74.726  78.578  43.068  1.00 64.13  ? 131 SER G CB  1 
ATOM   10582 O OG  . SER G  1 130 ? 75.167  77.385  43.698  1.00 63.31  ? 131 SER G OG  1 
ATOM   10583 N N   . VAL G  1 131 ? 71.737  78.931  41.230  1.00 62.36  ? 132 VAL G N   1 
ATOM   10584 C CA  . VAL G  1 131 ? 70.609  79.819  41.030  1.00 59.94  ? 132 VAL G CA  1 
ATOM   10585 C C   . VAL G  1 131 ? 69.873  79.802  42.358  1.00 59.42  ? 132 VAL G C   1 
ATOM   10586 O O   . VAL G  1 131 ? 69.722  78.740  42.963  1.00 59.39  ? 132 VAL G O   1 
ATOM   10587 C CB  . VAL G  1 131 ? 69.668  79.287  39.942  1.00 58.76  ? 132 VAL G CB  1 
ATOM   10588 C CG1 . VAL G  1 131 ? 68.423  80.142  39.877  1.00 57.74  ? 132 VAL G CG1 1 
ATOM   10589 C CG2 . VAL G  1 131 ? 70.380  79.268  38.611  1.00 56.52  ? 132 VAL G CG2 1 
ATOM   10590 N N   . VAL G  1 132 ? 69.432  80.972  42.812  1.00 58.73  ? 133 VAL G N   1 
ATOM   10591 C CA  . VAL G  1 132 ? 68.706  81.110  44.082  1.00 56.49  ? 133 VAL G CA  1 
ATOM   10592 C C   . VAL G  1 132 ? 67.371  81.854  43.911  1.00 56.02  ? 133 VAL G C   1 
ATOM   10593 O O   . VAL G  1 132 ? 67.347  82.977  43.415  1.00 56.54  ? 133 VAL G O   1 
ATOM   10594 C CB  . VAL G  1 132 ? 69.562  81.883  45.118  1.00 54.67  ? 133 VAL G CB  1 
ATOM   10595 C CG1 . VAL G  1 132 ? 68.692  82.354  46.270  1.00 53.66  ? 133 VAL G CG1 1 
ATOM   10596 C CG2 . VAL G  1 132 ? 70.689  81.003  45.624  1.00 52.55  ? 133 VAL G CG2 1 
ATOM   10597 N N   . CYS G  1 133 ? 66.266  81.232  44.314  1.00 55.07  ? 134 CYS G N   1 
ATOM   10598 C CA  . CYS G  1 133 ? 64.956  81.876  44.214  1.00 54.14  ? 134 CYS G CA  1 
ATOM   10599 C C   . CYS G  1 133 ? 64.437  82.040  45.620  1.00 52.47  ? 134 CYS G C   1 
ATOM   10600 O O   . CYS G  1 133 ? 63.703  81.191  46.115  1.00 53.33  ? 134 CYS G O   1 
ATOM   10601 C CB  . CYS G  1 133 ? 63.973  81.021  43.410  1.00 56.44  ? 134 CYS G CB  1 
ATOM   10602 S SG  . CYS G  1 133 ? 62.332  81.754  43.053  1.00 60.26  ? 134 CYS G SG  1 
ATOM   10603 N N   . LEU G  1 134 ? 64.837  83.136  46.258  1.00 50.66  ? 135 LEU G N   1 
ATOM   10604 C CA  . LEU G  1 134 ? 64.436  83.465  47.626  1.00 48.01  ? 135 LEU G CA  1 
ATOM   10605 C C   . LEU G  1 134 ? 63.007  84.009  47.770  1.00 46.27  ? 135 LEU G C   1 
ATOM   10606 O O   . LEU G  1 134 ? 62.516  84.743  46.912  1.00 45.20  ? 135 LEU G O   1 
ATOM   10607 C CB  . LEU G  1 134 ? 65.404  84.487  48.209  1.00 46.96  ? 135 LEU G CB  1 
ATOM   10608 C CG  . LEU G  1 134 ? 64.924  85.039  49.541  1.00 47.58  ? 135 LEU G CG  1 
ATOM   10609 C CD1 . LEU G  1 134 ? 64.962  83.928  50.575  1.00 49.17  ? 135 LEU G CD1 1 
ATOM   10610 C CD2 . LEU G  1 134 ? 65.798  86.186  49.973  1.00 49.25  ? 135 LEU G CD2 1 
ATOM   10611 N N   . LEU G  1 135 ? 62.352  83.628  48.863  1.00 44.71  ? 136 LEU G N   1 
ATOM   10612 C CA  . LEU G  1 135 ? 60.992  84.066  49.178  1.00 44.56  ? 136 LEU G CA  1 
ATOM   10613 C C   . LEU G  1 135 ? 61.091  84.704  50.551  1.00 43.54  ? 136 LEU G C   1 
ATOM   10614 O O   . LEU G  1 135 ? 62.070  84.477  51.240  1.00 43.06  ? 136 LEU G O   1 
ATOM   10615 C CB  . LEU G  1 135 ? 60.032  82.872  49.201  1.00 44.58  ? 136 LEU G CB  1 
ATOM   10616 C CG  . LEU G  1 135 ? 59.231  82.608  47.914  1.00 44.71  ? 136 LEU G CG  1 
ATOM   10617 C CD1 . LEU G  1 135 ? 60.092  82.791  46.678  1.00 43.65  ? 136 LEU G CD1 1 
ATOM   10618 C CD2 . LEU G  1 135 ? 58.673  81.207  47.960  1.00 44.54  ? 136 LEU G CD2 1 
ATOM   10619 N N   . ASN G  1 136 ? 60.111  85.494  50.973  1.00 43.18  ? 137 ASN G N   1 
ATOM   10620 C CA  . ASN G  1 136 ? 60.286  86.112  52.279  1.00 44.57  ? 137 ASN G CA  1 
ATOM   10621 C C   . ASN G  1 136 ? 59.087  86.498  53.158  1.00 44.14  ? 137 ASN G C   1 
ATOM   10622 O O   . ASN G  1 136 ? 58.135  87.148  52.719  1.00 43.58  ? 137 ASN G O   1 
ATOM   10623 C CB  . ASN G  1 136 ? 61.209  87.330  52.126  1.00 45.17  ? 137 ASN G CB  1 
ATOM   10624 C CG  . ASN G  1 136 ? 62.140  87.510  53.311  1.00 45.91  ? 137 ASN G CG  1 
ATOM   10625 O OD1 . ASN G  1 136 ? 63.354  87.319  53.196  1.00 47.63  ? 137 ASN G OD1 1 
ATOM   10626 N ND2 . ASN G  1 136 ? 61.577  87.869  54.461  1.00 44.36  ? 137 ASN G ND2 1 
ATOM   10627 N N   . ASN G  1 137 ? 59.183  86.078  54.417  1.00 43.48  ? 138 ASN G N   1 
ATOM   10628 C CA  . ASN G  1 137 ? 58.205  86.351  55.453  1.00 44.05  ? 138 ASN G CA  1 
ATOM   10629 C C   . ASN G  1 137 ? 56.756  86.167  55.052  1.00 44.28  ? 138 ASN G C   1 
ATOM   10630 O O   . ASN G  1 137 ? 55.928  87.075  55.184  1.00 44.57  ? 138 ASN G O   1 
ATOM   10631 C CB  . ASN G  1 137 ? 58.450  87.755  55.973  1.00 45.23  ? 138 ASN G CB  1 
ATOM   10632 C CG  . ASN G  1 137 ? 59.867  87.938  56.428  1.00 46.64  ? 138 ASN G CG  1 
ATOM   10633 O OD1 . ASN G  1 137 ? 60.375  89.050  56.481  1.00 48.59  ? 138 ASN G OD1 1 
ATOM   10634 N ND2 . ASN G  1 137 ? 60.526  86.832  56.761  1.00 47.26  ? 138 ASN G ND2 1 
ATOM   10635 N N   . PHE G  1 138 ? 56.457  84.964  54.586  1.00 43.52  ? 139 PHE G N   1 
ATOM   10636 C CA  . PHE G  1 138 ? 55.122  84.609  54.152  1.00 42.77  ? 139 PHE G CA  1 
ATOM   10637 C C   .