data_1S0L
# 
_entry.id   1S0L 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1S0L         
RCSB  RCSB021215   
WWPDB D_1000021215 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1S0L 
_pdbx_database_status.recvd_initial_deposition_date   2003-12-31 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Adamek, D.H.'   1 
'Guerrero, L.'   2 
'Caspar, D.L.D.' 3 
# 
_citation.id                        primary 
_citation.title                     'Structural and energetic consequences of mutations in a solvated hydrophobic cavity.' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            346 
_citation.page_first                307 
_citation.page_last                 318 
_citation.year                      2005 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15663946 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2004.11.046 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Adamek, D.H.'   1 
primary 'Guerrero, L.'   2 
primary 'Blaber, M.'     3 
primary 'Caspar, D.L.D.' 4 
# 
_cell.entry_id           1S0L 
_cell.length_a           54.900 
_cell.length_b           54.900 
_cell.length_c           77.240 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1S0L 
_symmetry.space_group_name_H-M             'P 43' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                78 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Interleukin-1 beta' 17434.869 1  ? F42W 'Interleukin 1-b' ? 
2 water   nat water                18.015    77 ? ?    ?                 ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'IL-1 beta, Catabolin' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVWSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTL
QLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVWSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTL
QLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   PRO n 
1 3   VAL n 
1 4   ARG n 
1 5   SER n 
1 6   LEU n 
1 7   ASN n 
1 8   CYS n 
1 9   THR n 
1 10  LEU n 
1 11  ARG n 
1 12  ASP n 
1 13  SER n 
1 14  GLN n 
1 15  GLN n 
1 16  LYS n 
1 17  SER n 
1 18  LEU n 
1 19  VAL n 
1 20  MET n 
1 21  SER n 
1 22  GLY n 
1 23  PRO n 
1 24  TYR n 
1 25  GLU n 
1 26  LEU n 
1 27  LYS n 
1 28  ALA n 
1 29  LEU n 
1 30  HIS n 
1 31  LEU n 
1 32  GLN n 
1 33  GLY n 
1 34  GLN n 
1 35  ASP n 
1 36  MET n 
1 37  GLU n 
1 38  GLN n 
1 39  GLN n 
1 40  VAL n 
1 41  VAL n 
1 42  TRP n 
1 43  SER n 
1 44  MET n 
1 45  SER n 
1 46  PHE n 
1 47  VAL n 
1 48  GLN n 
1 49  GLY n 
1 50  GLU n 
1 51  GLU n 
1 52  SER n 
1 53  ASN n 
1 54  ASP n 
1 55  LYS n 
1 56  ILE n 
1 57  PRO n 
1 58  VAL n 
1 59  ALA n 
1 60  LEU n 
1 61  GLY n 
1 62  LEU n 
1 63  LYS n 
1 64  GLU n 
1 65  LYS n 
1 66  ASN n 
1 67  LEU n 
1 68  TYR n 
1 69  LEU n 
1 70  SER n 
1 71  CYS n 
1 72  VAL n 
1 73  LEU n 
1 74  LYS n 
1 75  ASP n 
1 76  ASP n 
1 77  LYS n 
1 78  PRO n 
1 79  THR n 
1 80  LEU n 
1 81  GLN n 
1 82  LEU n 
1 83  GLU n 
1 84  SER n 
1 85  VAL n 
1 86  ASP n 
1 87  PRO n 
1 88  LYS n 
1 89  ASN n 
1 90  TYR n 
1 91  PRO n 
1 92  LYS n 
1 93  LYS n 
1 94  LYS n 
1 95  MET n 
1 96  GLU n 
1 97  LYS n 
1 98  ARG n 
1 99  PHE n 
1 100 VAL n 
1 101 PHE n 
1 102 ASN n 
1 103 LYS n 
1 104 ILE n 
1 105 GLU n 
1 106 ILE n 
1 107 ASN n 
1 108 ASN n 
1 109 LYS n 
1 110 LEU n 
1 111 GLU n 
1 112 PHE n 
1 113 GLU n 
1 114 SER n 
1 115 ALA n 
1 116 GLN n 
1 117 PHE n 
1 118 PRO n 
1 119 ASN n 
1 120 TRP n 
1 121 TYR n 
1 122 ILE n 
1 123 SER n 
1 124 THR n 
1 125 SER n 
1 126 GLN n 
1 127 ALA n 
1 128 GLU n 
1 129 ASN n 
1 130 MET n 
1 131 PRO n 
1 132 VAL n 
1 133 PHE n 
1 134 LEU n 
1 135 GLY n 
1 136 GLY n 
1 137 THR n 
1 138 LYS n 
1 139 GLY n 
1 140 GLY n 
1 141 GLN n 
1 142 ASP n 
1 143 ILE n 
1 144 THR n 
1 145 ASP n 
1 146 PHE n 
1 147 THR n 
1 148 MET n 
1 149 GLN n 
1 150 PHE n 
1 151 VAL n 
1 152 SER n 
1 153 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 IL1B 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'Bl-21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'pET 21a(+)' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    IL1B_HUMAN 
_struct_ref.pdbx_db_accession          P01584 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTL
QLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
;
_struct_ref.pdbx_align_begin           117 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1S0L 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 153 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P01584 
_struct_ref_seq.db_align_beg                  117 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  269 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       153 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1S0L 
_struct_ref_seq_dif.mon_id                       TRP 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      42 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P01584 
_struct_ref_seq_dif.db_mon_id                    PHE 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          158 
_struct_ref_seq_dif.details                      ENGINEERED 
_struct_ref_seq_dif.pdbx_auth_seq_num            42 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1S0L 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   63.15 
_exptl_crystal.description           ? 
_exptl_crystal.density_Matthews      3.34 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.4 
_exptl_crystal_grow.pdbx_details    
'29% ammonium sulfate w/v, 100 mM Tris, pH 7.4, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           298 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS II' 
_diffrn_detector.pdbx_collection_date   2001-05-05 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        RIGAKU 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     1S0L 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            2.34 
_reflns.d_resolution_low             54.9 
_reflns.number_all                   9732 
_reflns.number_obs                   9723 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 1S0L 
_refine.ls_d_res_high                            2.34 
_refine.ls_d_res_low                             54.9 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     9732 
_refine.ls_number_reflns_obs                     9723 
_refine.ls_number_reflns_R_free                  506 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_all                          0.1924 
_refine.ls_R_factor_obs                          0.1924 
_refine.ls_R_factor_R_work                       0.1908 
_refine.ls_R_factor_R_free                       0.2219 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 5 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB ENTRY 9ilb' 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             Isotropic 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1222 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             77 
_refine_hist.number_atoms_total               1299 
_refine_hist.d_res_high                       2.34 
_refine_hist.d_res_low                        54.9 
# 
_struct.entry_id                  1S0L 
_struct.title                     'Interleukin 1 beta mutant F42W' 
_struct.pdbx_descriptor           'Interleukin-1 beta' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1S0L 
_struct_keywords.pdbx_keywords   'immune response' 
_struct_keywords.text            'cytokine, inflamatory response, pyrogen, immune response' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLN A 32 ? GLN A 39 ? GLN A 32 GLN A 39 5 ? 8 
HELX_P HELX_P2 2 GLU A 96 ? ARG A 98 ? GLU A 96 ARG A 98 5 ? 3 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          TYR 
_struct_mon_prot_cis.label_seq_id           90 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           TYR 
_struct_mon_prot_cis.auth_seq_id            90 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    91 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     91 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.17 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 3 ? 
C ? 2 ? 
D ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER A 5   ? ASP A 12  ? SER A 5   ASP A 12  
A 2 TRP A 42  ? PHE A 46  ? TRP A 42  PHE A 46  
A 3 LYS A 55  ? LEU A 62  ? LYS A 55  LEU A 62  
A 4 VAL A 100 ? GLU A 105 ? VAL A 100 GLU A 105 
A 5 LEU A 110 ? SER A 114 ? LEU A 110 SER A 114 
A 6 PHE A 146 ? PHE A 150 ? PHE A 146 PHE A 150 
A 7 SER A 5   ? ASP A 12  ? SER A 5   ASP A 12  
B 1 SER A 17  ? MET A 20  ? SER A 17  MET A 20  
B 2 LEU A 26  ? LEU A 29  ? LEU A 26  LEU A 29  
B 3 MET A 130 ? PRO A 131 ? MET A 130 PRO A 131 
C 1 LEU A 67  ? LEU A 73  ? LEU A 67  LEU A 73  
C 2 PRO A 78  ? SER A 84  ? PRO A 78  SER A 84  
D 1 TYR A 121 ? SER A 123 ? TYR A 121 SER A 123 
D 2 PHE A 133 ? GLY A 135 ? PHE A 133 GLY A 135 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N CYS A 8   ? N CYS A 8   O TRP A 42  ? O TRP A 42  
A 2 3 N SER A 43  ? N SER A 43  O GLY A 61  ? O GLY A 61  
A 3 4 N ILE A 56  ? N ILE A 56  O LYS A 103 ? O LYS A 103 
A 4 5 N ASN A 102 ? N ASN A 102 O GLU A 113 ? O GLU A 113 
A 5 6 N LEU A 110 ? N LEU A 110 O PHE A 146 ? O PHE A 146 
A 6 7 O GLN A 149 ? O GLN A 149 N THR A 9   ? N THR A 9   
B 1 2 N VAL A 19  ? N VAL A 19  O LYS A 27  ? O LYS A 27  
B 2 3 N ALA A 28  ? N ALA A 28  O MET A 130 ? O MET A 130 
C 1 2 N VAL A 72  ? N VAL A 72  O THR A 79  ? O THR A 79  
D 1 2 N SER A 123 ? N SER A 123 O PHE A 133 ? O PHE A 133 
# 
_database_PDB_matrix.entry_id          1S0L 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1S0L 
_atom_sites.fract_transf_matrix[1][1]   0.018215 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.018215 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012947 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ALA A 1 1   ? -19.331 20.819 -23.133 1.00 161.76 ? 1   ALA A N   1 
ATOM   2    C CA  . ALA A 1 1   ? -19.639 19.393 -22.821 1.00 161.98 ? 1   ALA A CA  1 
ATOM   3    C C   . ALA A 1 1   ? -20.897 19.291 -21.963 1.00 161.35 ? 1   ALA A C   1 
ATOM   4    O O   . ALA A 1 1   ? -21.213 20.208 -21.202 1.00 162.42 ? 1   ALA A O   1 
ATOM   5    C CB  . ALA A 1 1   ? -18.458 18.756 -22.093 1.00 100.16 ? 1   ALA A CB  1 
ATOM   6    N N   . PRO A 1 2   ? -21.636 18.174 -22.081 1.00 137.22 ? 2   PRO A N   1 
ATOM   7    C CA  . PRO A 1 2   ? -22.861 17.973 -21.300 1.00 134.43 ? 2   PRO A CA  1 
ATOM   8    C C   . PRO A 1 2   ? -22.599 18.286 -19.832 1.00 130.97 ? 2   PRO A C   1 
ATOM   9    O O   . PRO A 1 2   ? -22.976 19.350 -19.337 1.00 131.76 ? 2   PRO A O   1 
ATOM   10   C CB  . PRO A 1 2   ? -23.176 16.500 -21.535 1.00 113.53 ? 2   PRO A CB  1 
ATOM   11   C CG  . PRO A 1 2   ? -22.702 16.291 -22.936 1.00 114.91 ? 2   PRO A CG  1 
ATOM   12   C CD  . PRO A 1 2   ? -21.366 17.003 -22.935 1.00 115.37 ? 2   PRO A CD  1 
ATOM   13   N N   . VAL A 1 3   ? -21.950 17.353 -19.142 1.00 57.49  ? 3   VAL A N   1 
ATOM   14   C CA  . VAL A 1 3   ? -21.615 17.547 -17.737 1.00 52.26  ? 3   VAL A CA  1 
ATOM   15   C C   . VAL A 1 3   ? -20.188 18.078 -17.657 1.00 48.57  ? 3   VAL A C   1 
ATOM   16   O O   . VAL A 1 3   ? -19.267 17.489 -18.216 1.00 46.26  ? 3   VAL A O   1 
ATOM   17   C CB  . VAL A 1 3   ? -21.718 16.222 -16.934 1.00 52.18  ? 3   VAL A CB  1 
ATOM   18   C CG1 . VAL A 1 3   ? -20.978 15.114 -17.657 1.00 53.32  ? 3   VAL A CG1 1 
ATOM   19   C CG2 . VAL A 1 3   ? -21.140 16.411 -15.541 1.00 52.06  ? 3   VAL A CG2 1 
ATOM   20   N N   . ARG A 1 4   ? -20.009 19.205 -16.983 1.00 49.15  ? 4   ARG A N   1 
ATOM   21   C CA  . ARG A 1 4   ? -18.678 19.778 -16.851 1.00 47.23  ? 4   ARG A CA  1 
ATOM   22   C C   . ARG A 1 4   ? -17.985 19.297 -15.583 1.00 45.84  ? 4   ARG A C   1 
ATOM   23   O O   . ARG A 1 4   ? -18.586 19.243 -14.507 1.00 44.92  ? 4   ARG A O   1 
ATOM   24   C CB  . ARG A 1 4   ? -18.741 21.302 -16.865 1.00 56.68  ? 4   ARG A CB  1 
ATOM   25   C CG  . ARG A 1 4   ? -18.855 21.898 -18.264 1.00 58.29  ? 4   ARG A CG  1 
ATOM   26   C CD  . ARG A 1 4   ? -18.574 23.384 -18.213 1.00 56.95  ? 4   ARG A CD  1 
ATOM   27   N NE  . ARG A 1 4   ? -19.478 24.043 -17.278 1.00 56.33  ? 4   ARG A NE  1 
ATOM   28   C CZ  . ARG A 1 4   ? -19.298 25.268 -16.798 1.00 55.43  ? 4   ARG A CZ  1 
ATOM   29   N NH1 . ARG A 1 4   ? -18.237 25.981 -17.163 1.00 52.31  ? 4   ARG A NH1 1 
ATOM   30   N NH2 . ARG A 1 4   ? -20.181 25.775 -15.948 1.00 55.52  ? 4   ARG A NH2 1 
ATOM   31   N N   . SER A 1 5   ? -16.713 18.948 -15.722 1.00 50.88  ? 5   SER A N   1 
ATOM   32   C CA  . SER A 1 5   ? -15.940 18.457 -14.594 1.00 48.84  ? 5   SER A CA  1 
ATOM   33   C C   . SER A 1 5   ? -14.603 19.165 -14.497 1.00 46.84  ? 5   SER A C   1 
ATOM   34   O O   . SER A 1 5   ? -14.229 19.942 -15.374 1.00 46.25  ? 5   SER A O   1 
ATOM   35   C CB  . SER A 1 5   ? -15.694 16.956 -14.748 1.00 52.23  ? 5   SER A CB  1 
ATOM   36   O OG  . SER A 1 5   ? -16.904 16.260 -14.981 1.00 54.66  ? 5   SER A OG  1 
ATOM   37   N N   . LEU A 1 6   ? -13.897 18.896 -13.406 1.00 43.68  ? 6   LEU A N   1 
ATOM   38   C CA  . LEU A 1 6   ? -12.571 19.448 -13.188 1.00 40.20  ? 6   LEU A CA  1 
ATOM   39   C C   . LEU A 1 6   ? -11.851 18.451 -12.296 1.00 38.26  ? 6   LEU A C   1 
ATOM   40   O O   . LEU A 1 6   ? -12.454 17.851 -11.408 1.00 35.28  ? 6   LEU A O   1 
ATOM   41   C CB  . LEU A 1 6   ? -12.643 20.838 -12.543 1.00 42.58  ? 6   LEU A CB  1 
ATOM   42   C CG  . LEU A 1 6   ? -13.173 21.036 -11.128 1.00 43.33  ? 6   LEU A CG  1 
ATOM   43   C CD1 . LEU A 1 6   ? -12.145 20.552 -10.108 1.00 43.11  ? 6   LEU A CD1 1 
ATOM   44   C CD2 . LEU A 1 6   ? -13.461 22.517 -10.921 1.00 43.86  ? 6   LEU A CD2 1 
ATOM   45   N N   . ASN A 1 7   ? -10.567 18.247 -12.553 1.00 37.26  ? 7   ASN A N   1 
ATOM   46   C CA  . ASN A 1 7   ? -9.796  17.297 -11.779 1.00 36.03  ? 7   ASN A CA  1 
ATOM   47   C C   . ASN A 1 7   ? -9.120  17.961 -10.601 1.00 34.71  ? 7   ASN A C   1 
ATOM   48   O O   . ASN A 1 7   ? -8.633  19.092 -10.694 1.00 32.62  ? 7   ASN A O   1 
ATOM   49   C CB  . ASN A 1 7   ? -8.785  16.596 -12.683 1.00 47.39  ? 7   ASN A CB  1 
ATOM   50   C CG  . ASN A 1 7   ? -9.456  15.873 -13.837 1.00 52.81  ? 7   ASN A CG  1 
ATOM   51   O OD1 . ASN A 1 7   ? -10.482 15.216 -13.653 1.00 53.86  ? 7   ASN A OD1 1 
ATOM   52   N ND2 . ASN A 1 7   ? -8.882  15.987 -15.030 1.00 55.70  ? 7   ASN A ND2 1 
ATOM   53   N N   . CYS A 1 8   ? -9.101  17.252 -9.480  1.00 32.15  ? 8   CYS A N   1 
ATOM   54   C CA  . CYS A 1 8   ? -8.516  17.808 -8.280  1.00 31.14  ? 8   CYS A CA  1 
ATOM   55   C C   . CYS A 1 8   ? -8.144  16.748 -7.258  1.00 30.38  ? 8   CYS A C   1 
ATOM   56   O O   . CYS A 1 8   ? -8.441  15.561 -7.422  1.00 29.92  ? 8   CYS A O   1 
ATOM   57   C CB  . CYS A 1 8   ? -9.518  18.770 -7.634  1.00 33.34  ? 8   CYS A CB  1 
ATOM   58   S SG  . CYS A 1 8   ? -11.093 17.968 -7.102  1.00 33.65  ? 8   CYS A SG  1 
ATOM   59   N N   . THR A 1 9   ? -7.476  17.203 -6.205  1.00 26.40  ? 9   THR A N   1 
ATOM   60   C CA  . THR A 1 9   ? -7.109  16.351 -5.093  1.00 25.37  ? 9   THR A CA  1 
ATOM   61   C C   . THR A 1 9   ? -7.700  17.101 -3.911  1.00 26.06  ? 9   THR A C   1 
ATOM   62   O O   . THR A 1 9   ? -8.030  18.285 -4.019  1.00 24.49  ? 9   THR A O   1 
ATOM   63   C CB  . THR A 1 9   ? -5.597  16.228 -4.911  1.00 27.67  ? 9   THR A CB  1 
ATOM   64   O OG1 . THR A 1 9   ? -5.025  17.534 -4.781  1.00 27.49  ? 9   THR A OG1 1 
ATOM   65   C CG2 . THR A 1 9   ? -4.983  15.500 -6.094  1.00 26.01  ? 9   THR A CG2 1 
ATOM   66   N N   . LEU A 1 10  ? -7.859  16.409 -2.796  1.00 29.18  ? 10  LEU A N   1 
ATOM   67   C CA  . LEU A 1 10  ? -8.425  17.021 -1.618  1.00 29.78  ? 10  LEU A CA  1 
ATOM   68   C C   . LEU A 1 10  ? -7.627  16.623 -0.392  1.00 30.18  ? 10  LEU A C   1 
ATOM   69   O O   . LEU A 1 10  ? -7.157  15.487 -0.279  1.00 30.28  ? 10  LEU A O   1 
ATOM   70   C CB  . LEU A 1 10  ? -9.878  16.571 -1.440  1.00 31.32  ? 10  LEU A CB  1 
ATOM   71   C CG  . LEU A 1 10  ? -10.959 17.037 -2.421  1.00 32.88  ? 10  LEU A CG  1 
ATOM   72   C CD1 . LEU A 1 10  ? -12.256 16.286 -2.119  1.00 30.68  ? 10  LEU A CD1 1 
ATOM   73   C CD2 . LEU A 1 10  ? -11.180 18.538 -2.300  1.00 30.06  ? 10  LEU A CD2 1 
ATOM   74   N N   . ARG A 1 11  ? -7.462  17.573 0.516   1.00 29.75  ? 11  ARG A N   1 
ATOM   75   C CA  . ARG A 1 11  ? -6.759  17.322 1.756   1.00 31.14  ? 11  ARG A CA  1 
ATOM   76   C C   . ARG A 1 11  ? -7.599  17.928 2.861   1.00 30.12  ? 11  ARG A C   1 
ATOM   77   O O   . ARG A 1 11  ? -8.240  18.958 2.649   1.00 30.41  ? 11  ARG A O   1 
ATOM   78   C CB  . ARG A 1 11  ? -5.372  17.955 1.731   1.00 34.49  ? 11  ARG A CB  1 
ATOM   79   C CG  . ARG A 1 11  ? -4.329  17.068 1.087   1.00 39.60  ? 11  ARG A CG  1 
ATOM   80   C CD  . ARG A 1 11  ? -2.933  17.482 1.496   1.00 42.58  ? 11  ARG A CD  1 
ATOM   81   N NE  . ARG A 1 11  ? -2.486  18.675 0.788   1.00 44.33  ? 11  ARG A NE  1 
ATOM   82   C CZ  . ARG A 1 11  ? -2.179  18.696 -0.504  1.00 45.75  ? 11  ARG A CZ  1 
ATOM   83   N NH1 . ARG A 1 11  ? -2.271  17.585 -1.226  1.00 47.07  ? 11  ARG A NH1 1 
ATOM   84   N NH2 . ARG A 1 11  ? -1.778  19.824 -1.071  1.00 42.95  ? 11  ARG A NH2 1 
ATOM   85   N N   . ASP A 1 12  ? -7.627  17.287 4.027   1.00 27.16  ? 12  ASP A N   1 
ATOM   86   C CA  . ASP A 1 12  ? -8.410  17.841 5.119   1.00 26.13  ? 12  ASP A CA  1 
ATOM   87   C C   . ASP A 1 12  ? -7.629  18.995 5.718   1.00 27.24  ? 12  ASP A C   1 
ATOM   88   O O   . ASP A 1 12  ? -6.481  19.236 5.329   1.00 25.65  ? 12  ASP A O   1 
ATOM   89   C CB  . ASP A 1 12  ? -8.778  16.782 6.175   1.00 27.12  ? 12  ASP A CB  1 
ATOM   90   C CG  . ASP A 1 12  ? -7.579  16.210 6.925   1.00 30.21  ? 12  ASP A CG  1 
ATOM   91   O OD1 . ASP A 1 12  ? -6.503  16.847 7.003   1.00 28.54  ? 12  ASP A OD1 1 
ATOM   92   O OD2 . ASP A 1 12  ? -7.743  15.099 7.476   1.00 26.81  ? 12  ASP A OD2 1 
ATOM   93   N N   . SER A 1 13  ? -8.262  19.729 6.626   1.00 32.55  ? 13  SER A N   1 
ATOM   94   C CA  . SER A 1 13  ? -7.632  20.887 7.244   1.00 34.78  ? 13  SER A CA  1 
ATOM   95   C C   . SER A 1 13  ? -6.390  20.551 8.059   1.00 36.25  ? 13  SER A C   1 
ATOM   96   O O   . SER A 1 13  ? -5.660  21.450 8.462   1.00 36.11  ? 13  SER A O   1 
ATOM   97   C CB  . SER A 1 13  ? -8.647  21.632 8.113   1.00 32.65  ? 13  SER A CB  1 
ATOM   98   O OG  . SER A 1 13  ? -9.299  20.751 9.009   1.00 31.71  ? 13  SER A OG  1 
ATOM   99   N N   . GLN A 1 14  ? -6.157  19.262 8.302   1.00 32.18  ? 14  GLN A N   1 
ATOM   100  C CA  . GLN A 1 14  ? -4.979  18.820 9.047   1.00 31.73  ? 14  GLN A CA  1 
ATOM   101  C C   . GLN A 1 14  ? -3.936  18.334 8.061   1.00 31.30  ? 14  GLN A C   1 
ATOM   102  O O   . GLN A 1 14  ? -3.006  17.617 8.428   1.00 30.21  ? 14  GLN A O   1 
ATOM   103  C CB  . GLN A 1 14  ? -5.324  17.691 10.022  1.00 47.68  ? 14  GLN A CB  1 
ATOM   104  C CG  . GLN A 1 14  ? -5.938  18.158 11.328  1.00 52.40  ? 14  GLN A CG  1 
ATOM   105  C CD  . GLN A 1 14  ? -5.131  19.267 11.982  1.00 57.54  ? 14  GLN A CD  1 
ATOM   106  O OE1 . GLN A 1 14  ? -3.930  19.127 12.230  1.00 56.90  ? 14  GLN A OE1 1 
ATOM   107  N NE2 . GLN A 1 14  ? -5.792  20.382 12.263  1.00 61.06  ? 14  GLN A NE2 1 
ATOM   108  N N   . GLN A 1 15  ? -4.126  18.706 6.797   1.00 29.28  ? 15  GLN A N   1 
ATOM   109  C CA  . GLN A 1 15  ? -3.206  18.359 5.719   1.00 28.69  ? 15  GLN A CA  1 
ATOM   110  C C   . GLN A 1 15  ? -3.054  16.866 5.421   1.00 28.47  ? 15  GLN A C   1 
ATOM   111  O O   . GLN A 1 15  ? -2.019  16.437 4.910   1.00 27.26  ? 15  GLN A O   1 
ATOM   112  C CB  . GLN A 1 15  ? -1.831  18.967 6.007   1.00 41.91  ? 15  GLN A CB  1 
ATOM   113  C CG  . GLN A 1 15  ? -1.878  20.453 6.250   1.00 44.09  ? 15  GLN A CG  1 
ATOM   114  C CD  . GLN A 1 15  ? -2.189  21.238 4.993   1.00 49.36  ? 15  GLN A CD  1 
ATOM   115  O OE1 . GLN A 1 15  ? -2.785  20.716 4.043   1.00 52.27  ? 15  GLN A OE1 1 
ATOM   116  N NE2 . GLN A 1 15  ? -1.801  22.507 4.982   1.00 50.24  ? 15  GLN A NE2 1 
ATOM   117  N N   . LYS A 1 16  ? -4.072  16.073 5.734   1.00 32.04  ? 16  LYS A N   1 
ATOM   118  C CA  . LYS A 1 16  ? -3.989  14.654 5.435   1.00 30.93  ? 16  LYS A CA  1 
ATOM   119  C C   . LYS A 1 16  ? -4.530  14.410 4.026   1.00 30.63  ? 16  LYS A C   1 
ATOM   120  O O   . LYS A 1 16  ? -5.491  15.054 3.592   1.00 30.24  ? 16  LYS A O   1 
ATOM   121  C CB  . LYS A 1 16  ? -4.770  13.823 6.457   1.00 28.02  ? 16  LYS A CB  1 
ATOM   122  C CG  . LYS A 1 16  ? -4.223  13.916 7.884   1.00 27.52  ? 16  LYS A CG  1 
ATOM   123  C CD  . LYS A 1 16  ? -4.575  12.685 8.717   1.00 28.52  ? 16  LYS A CD  1 
ATOM   124  C CE  . LYS A 1 16  ? -6.076  12.521 8.889   1.00 26.85  ? 16  LYS A CE  1 
ATOM   125  N NZ  . LYS A 1 16  ? -6.680  13.727 9.508   1.00 25.69  ? 16  LYS A NZ  1 
ATOM   126  N N   . SER A 1 17  ? -3.892  13.492 3.311   1.00 26.38  ? 17  SER A N   1 
ATOM   127  C CA  . SER A 1 17  ? -4.299  13.145 1.956   1.00 26.53  ? 17  SER A CA  1 
ATOM   128  C C   . SER A 1 17  ? -5.236  11.945 1.963   1.00 25.91  ? 17  SER A C   1 
ATOM   129  O O   . SER A 1 17  ? -5.288  11.196 2.935   1.00 24.81  ? 17  SER A O   1 
ATOM   130  C CB  . SER A 1 17  ? -3.073  12.816 1.101   1.00 33.85  ? 17  SER A CB  1 
ATOM   131  O OG  . SER A 1 17  ? -2.281  13.967 0.890   1.00 39.09  ? 17  SER A OG  1 
ATOM   132  N N   . LEU A 1 18  ? -5.967  11.762 0.869   1.00 26.67  ? 18  LEU A N   1 
ATOM   133  C CA  . LEU A 1 18  ? -6.890  10.642 0.750   1.00 27.07  ? 18  LEU A CA  1 
ATOM   134  C C   . LEU A 1 18  ? -6.301  9.580  -0.183  1.00 27.14  ? 18  LEU A C   1 
ATOM   135  O O   . LEU A 1 18  ? -5.721  9.905  -1.217  1.00 27.78  ? 18  LEU A O   1 
ATOM   136  C CB  . LEU A 1 18  ? -8.247  11.123 0.207   1.00 25.96  ? 18  LEU A CB  1 
ATOM   137  C CG  . LEU A 1 18  ? -8.926  12.311 0.913   1.00 29.04  ? 18  LEU A CG  1 
ATOM   138  C CD1 . LEU A 1 18  ? -10.275 12.559 0.269   1.00 27.11  ? 18  LEU A CD1 1 
ATOM   139  C CD2 . LEU A 1 18  ? -9.096  12.053 2.414   1.00 27.01  ? 18  LEU A CD2 1 
ATOM   140  N N   . VAL A 1 19  ? -6.438  8.314  0.199   1.00 24.94  ? 19  VAL A N   1 
ATOM   141  C CA  . VAL A 1 19  ? -5.937  7.205  -0.606  1.00 29.39  ? 19  VAL A CA  1 
ATOM   142  C C   . VAL A 1 19  ? -6.928  6.037  -0.523  1.00 32.69  ? 19  VAL A C   1 
ATOM   143  O O   . VAL A 1 19  ? -7.594  5.844  0.501   1.00 31.97  ? 19  VAL A O   1 
ATOM   144  C CB  . VAL A 1 19  ? -4.518  6.714  -0.118  1.00 34.65  ? 19  VAL A CB  1 
ATOM   145  C CG1 . VAL A 1 19  ? -3.544  7.882  -0.061  1.00 32.78  ? 19  VAL A CG1 1 
ATOM   146  C CG2 . VAL A 1 19  ? -4.617  6.054  1.246   1.00 34.56  ? 19  VAL A CG2 1 
ATOM   147  N N   . MET A 1 20  ? -7.035  5.269  -1.602  1.00 36.45  ? 20  MET A N   1 
ATOM   148  C CA  . MET A 1 20  ? -7.933  4.118  -1.623  1.00 40.43  ? 20  MET A CA  1 
ATOM   149  C C   . MET A 1 20  ? -7.378  2.984  -0.764  1.00 42.20  ? 20  MET A C   1 
ATOM   150  O O   . MET A 1 20  ? -6.283  2.496  -1.011  1.00 41.96  ? 20  MET A O   1 
ATOM   151  C CB  . MET A 1 20  ? -8.114  3.600  -3.045  1.00 51.36  ? 20  MET A CB  1 
ATOM   152  C CG  . MET A 1 20  ? -9.373  4.066  -3.734  1.00 53.32  ? 20  MET A CG  1 
ATOM   153  S SD  . MET A 1 20  ? -10.006 2.739  -4.777  1.00 56.23  ? 20  MET A SD  1 
ATOM   154  C CE  . MET A 1 20  ? -8.821  2.785  -6.130  1.00 54.90  ? 20  MET A CE  1 
ATOM   155  N N   . SER A 1 21  ? -8.135  2.571  0.244   1.00 57.26  ? 21  SER A N   1 
ATOM   156  C CA  . SER A 1 21  ? -7.711  1.486  1.121   1.00 61.28  ? 21  SER A CA  1 
ATOM   157  C C   . SER A 1 21  ? -7.893  0.159  0.387   1.00 62.97  ? 21  SER A C   1 
ATOM   158  O O   . SER A 1 21  ? -6.930  -0.446 -0.088  1.00 63.00  ? 21  SER A O   1 
ATOM   159  C CB  . SER A 1 21  ? -8.548  1.492  2.405   1.00 70.93  ? 21  SER A CB  1 
ATOM   160  O OG  . SER A 1 21  ? -8.231  0.390  3.236   1.00 71.63  ? 21  SER A OG  1 
ATOM   161  N N   . GLY A 1 22  ? -9.142  -0.284 0.301   1.00 66.46  ? 22  GLY A N   1 
ATOM   162  C CA  . GLY A 1 22  ? -9.442  -1.523 -0.386  1.00 67.41  ? 22  GLY A CA  1 
ATOM   163  C C   . GLY A 1 22  ? -10.082 -1.195 -1.715  1.00 68.03  ? 22  GLY A C   1 
ATOM   164  O O   . GLY A 1 22  ? -9.737  -0.186 -2.327  1.00 68.99  ? 22  GLY A O   1 
ATOM   165  N N   . PRO A 1 23  ? -11.023 -2.022 -2.191  1.00 76.25  ? 23  PRO A N   1 
ATOM   166  C CA  . PRO A 1 23  ? -11.694 -1.781 -3.471  1.00 75.91  ? 23  PRO A CA  1 
ATOM   167  C C   . PRO A 1 23  ? -12.766 -0.695 -3.403  1.00 75.21  ? 23  PRO A C   1 
ATOM   168  O O   . PRO A 1 23  ? -12.996 0.027  -4.376  1.00 73.66  ? 23  PRO A O   1 
ATOM   169  C CB  . PRO A 1 23  ? -12.280 -3.147 -3.804  1.00 65.74  ? 23  PRO A CB  1 
ATOM   170  C CG  . PRO A 1 23  ? -12.650 -3.669 -2.450  1.00 65.77  ? 23  PRO A CG  1 
ATOM   171  C CD  . PRO A 1 23  ? -11.431 -3.320 -1.623  1.00 65.79  ? 23  PRO A CD  1 
ATOM   172  N N   . TYR A 1 24  ? -13.415 -0.580 -2.248  1.00 47.07  ? 24  TYR A N   1 
ATOM   173  C CA  . TYR A 1 24  ? -14.474 0.403  -2.070  1.00 46.43  ? 24  TYR A CA  1 
ATOM   174  C C   . TYR A 1 24  ? -14.312 1.209  -0.785  1.00 43.65  ? 24  TYR A C   1 
ATOM   175  O O   . TYR A 1 24  ? -15.301 1.603  -0.161  1.00 43.32  ? 24  TYR A O   1 
ATOM   176  C CB  . TYR A 1 24  ? -15.833 -0.306 -2.087  1.00 67.98  ? 24  TYR A CB  1 
ATOM   177  C CG  . TYR A 1 24  ? -16.073 -1.082 -3.364  1.00 72.06  ? 24  TYR A CG  1 
ATOM   178  C CD1 . TYR A 1 24  ? -16.220 -0.420 -4.586  1.00 72.03  ? 24  TYR A CD1 1 
ATOM   179  C CD2 . TYR A 1 24  ? -16.091 -2.479 -3.366  1.00 72.91  ? 24  TYR A CD2 1 
ATOM   180  C CE1 . TYR A 1 24  ? -16.372 -1.126 -5.777  1.00 73.74  ? 24  TYR A CE1 1 
ATOM   181  C CE2 . TYR A 1 24  ? -16.244 -3.198 -4.556  1.00 73.79  ? 24  TYR A CE2 1 
ATOM   182  C CZ  . TYR A 1 24  ? -16.381 -2.513 -5.757  1.00 74.48  ? 24  TYR A CZ  1 
ATOM   183  O OH  . TYR A 1 24  ? -16.507 -3.206 -6.939  1.00 74.35  ? 24  TYR A OH  1 
ATOM   184  N N   . GLU A 1 25  ? -13.066 1.463  -0.393  1.00 40.09  ? 25  GLU A N   1 
ATOM   185  C CA  . GLU A 1 25  ? -12.815 2.230  0.824   1.00 39.49  ? 25  GLU A CA  1 
ATOM   186  C C   . GLU A 1 25  ? -11.694 3.261  0.691   1.00 35.36  ? 25  GLU A C   1 
ATOM   187  O O   . GLU A 1 25  ? -10.713 3.044  -0.020  1.00 33.59  ? 25  GLU A O   1 
ATOM   188  C CB  . GLU A 1 25  ? -12.510 1.286  1.990   1.00 94.06  ? 25  GLU A CB  1 
ATOM   189  C CG  . GLU A 1 25  ? -12.390 1.995  3.329   1.00 100.64 ? 25  GLU A CG  1 
ATOM   190  C CD  . GLU A 1 25  ? -12.379 1.038  4.503   1.00 103.56 ? 25  GLU A CD  1 
ATOM   191  O OE1 . GLU A 1 25  ? -11.447 0.209  4.590   1.00 105.34 ? 25  GLU A OE1 1 
ATOM   192  O OE2 . GLU A 1 25  ? -13.306 1.117  5.338   1.00 102.85 ? 25  GLU A OE2 1 
ATOM   193  N N   . LEU A 1 26  ? -11.856 4.386  1.383   1.00 31.81  ? 26  LEU A N   1 
ATOM   194  C CA  . LEU A 1 26  ? -10.872 5.467  1.377   1.00 28.38  ? 26  LEU A CA  1 
ATOM   195  C C   . LEU A 1 26  ? -10.331 5.722  2.780   1.00 27.04  ? 26  LEU A C   1 
ATOM   196  O O   . LEU A 1 26  ? -11.065 5.637  3.764   1.00 26.51  ? 26  LEU A O   1 
ATOM   197  C CB  . LEU A 1 26  ? -11.508 6.763  0.877   1.00 41.64  ? 26  LEU A CB  1 
ATOM   198  C CG  . LEU A 1 26  ? -11.825 6.965  -0.600  1.00 42.27  ? 26  LEU A CG  1 
ATOM   199  C CD1 . LEU A 1 26  ? -12.760 8.153  -0.736  1.00 43.90  ? 26  LEU A CD1 1 
ATOM   200  C CD2 . LEU A 1 26  ? -10.544 7.194  -1.388  1.00 41.06  ? 26  LEU A CD2 1 
ATOM   201  N N   . LYS A 1 27  ? -9.051  6.057  2.872   1.00 25.77  ? 27  LYS A N   1 
ATOM   202  C CA  . LYS A 1 27  ? -8.451  6.362  4.163   1.00 26.22  ? 27  LYS A CA  1 
ATOM   203  C C   . LYS A 1 27  ? -7.709  7.681  4.056   1.00 25.56  ? 27  LYS A C   1 
ATOM   204  O O   . LYS A 1 27  ? -7.367  8.126  2.958   1.00 24.26  ? 27  LYS A O   1 
ATOM   205  C CB  . LYS A 1 27  ? -7.498  5.247  4.606   1.00 65.62  ? 27  LYS A CB  1 
ATOM   206  C CG  . LYS A 1 27  ? -8.208  3.944  4.950   1.00 70.88  ? 27  LYS A CG  1 
ATOM   207  C CD  . LYS A 1 27  ? -7.291  2.943  5.639   1.00 76.18  ? 27  LYS A CD  1 
ATOM   208  C CE  . LYS A 1 27  ? -6.134  2.526  4.744   1.00 78.74  ? 27  LYS A CE  1 
ATOM   209  N NZ  . LYS A 1 27  ? -5.305  1.450  5.363   1.00 81.21  ? 27  LYS A NZ  1 
ATOM   210  N N   . ALA A 1 28  ? -7.482  8.326  5.194   1.00 29.68  ? 28  ALA A N   1 
ATOM   211  C CA  . ALA A 1 28  ? -6.777  9.598  5.199   1.00 28.48  ? 28  ALA A CA  1 
ATOM   212  C C   . ALA A 1 28  ? -5.542  9.510  6.081   1.00 29.81  ? 28  ALA A C   1 
ATOM   213  O O   . ALA A 1 28  ? -5.590  8.995  7.202   1.00 27.34  ? 28  ALA A O   1 
ATOM   214  C CB  . ALA A 1 28  ? -7.697  10.705 5.690   1.00 24.98  ? 28  ALA A CB  1 
ATOM   215  N N   . LEU A 1 29  ? -4.428  10.012 5.570   1.00 29.41  ? 29  LEU A N   1 
ATOM   216  C CA  . LEU A 1 29  ? -3.198  9.982  6.335   1.00 31.36  ? 29  LEU A CA  1 
ATOM   217  C C   . LEU A 1 29  ? -2.256  11.069 5.852   1.00 31.23  ? 29  LEU A C   1 
ATOM   218  O O   . LEU A 1 29  ? -2.379  11.547 4.726   1.00 28.94  ? 29  LEU A O   1 
ATOM   219  C CB  . LEU A 1 29  ? -2.536  8.609  6.206   1.00 50.27  ? 29  LEU A CB  1 
ATOM   220  C CG  . LEU A 1 29  ? -2.160  8.111  4.810   1.00 52.72  ? 29  LEU A CG  1 
ATOM   221  C CD1 . LEU A 1 29  ? -0.984  8.912  4.268   1.00 54.64  ? 29  LEU A CD1 1 
ATOM   222  C CD2 . LEU A 1 29  ? -1.790  6.641  4.891   1.00 54.23  ? 29  LEU A CD2 1 
ATOM   223  N N   . HIS A 1 30  ? -1.338  11.474 6.725   1.00 32.83  ? 30  HIS A N   1 
ATOM   224  C CA  . HIS A 1 30  ? -0.347  12.479 6.386   1.00 34.49  ? 30  HIS A CA  1 
ATOM   225  C C   . HIS A 1 30  ? 0.629   11.839 5.414   1.00 36.54  ? 30  HIS A C   1 
ATOM   226  O O   . HIS A 1 30  ? 1.327   10.891 5.757   1.00 36.73  ? 30  HIS A O   1 
ATOM   227  C CB  . HIS A 1 30  ? 0.394   12.957 7.642   1.00 33.92  ? 30  HIS A CB  1 
ATOM   228  C CG  . HIS A 1 30  ? -0.435  13.829 8.532   1.00 31.84  ? 30  HIS A CG  1 
ATOM   229  N ND1 . HIS A 1 30  ? -1.177  13.334 9.583   1.00 30.94  ? 30  HIS A ND1 1 
ATOM   230  C CD2 . HIS A 1 30  ? -0.661  15.162 8.509   1.00 30.67  ? 30  HIS A CD2 1 
ATOM   231  C CE1 . HIS A 1 30  ? -1.822  14.325 10.171  1.00 32.18  ? 30  HIS A CE1 1 
ATOM   232  N NE2 . HIS A 1 30  ? -1.526  15.446 9.537   1.00 32.40  ? 30  HIS A NE2 1 
ATOM   233  N N   . LEU A 1 31  ? 0.662   12.365 4.196   1.00 34.57  ? 31  LEU A N   1 
ATOM   234  C CA  . LEU A 1 31  ? 1.525   11.854 3.140   1.00 37.99  ? 31  LEU A CA  1 
ATOM   235  C C   . LEU A 1 31  ? 2.412   12.995 2.624   1.00 39.61  ? 31  LEU A C   1 
ATOM   236  O O   . LEU A 1 31  ? 1.957   14.133 2.516   1.00 36.22  ? 31  LEU A O   1 
ATOM   237  C CB  . LEU A 1 31  ? 0.644   11.320 2.011   1.00 58.08  ? 31  LEU A CB  1 
ATOM   238  C CG  . LEU A 1 31  ? 1.064   10.108 1.188   1.00 60.42  ? 31  LEU A CG  1 
ATOM   239  C CD1 . LEU A 1 31  ? 1.417   8.941  2.103   1.00 62.11  ? 31  LEU A CD1 1 
ATOM   240  C CD2 . LEU A 1 31  ? -0.086  9.734  0.269   1.00 61.52  ? 31  LEU A CD2 1 
ATOM   241  N N   . GLN A 1 32  ? 3.670   12.691 2.309   1.00 47.74  ? 32  GLN A N   1 
ATOM   242  C CA  . GLN A 1 32  ? 4.592   13.706 1.799   1.00 51.94  ? 32  GLN A CA  1 
ATOM   243  C C   . GLN A 1 32  ? 5.647   13.112 0.870   1.00 53.53  ? 32  GLN A C   1 
ATOM   244  O O   . GLN A 1 32  ? 5.974   11.927 0.957   1.00 54.51  ? 32  GLN A O   1 
ATOM   245  C CB  . GLN A 1 32  ? 5.291   14.421 2.961   1.00 78.14  ? 32  GLN A CB  1 
ATOM   246  C CG  . GLN A 1 32  ? 6.060   15.671 2.551   1.00 80.72  ? 32  GLN A CG  1 
ATOM   247  C CD  . GLN A 1 32  ? 6.816   16.299 3.705   1.00 83.64  ? 32  GLN A CD  1 
ATOM   248  O OE1 . GLN A 1 32  ? 7.302   17.425 3.604   1.00 83.55  ? 32  GLN A OE1 1 
ATOM   249  N NE2 . GLN A 1 32  ? 6.926   15.570 4.809   1.00 83.84  ? 32  GLN A NE2 1 
ATOM   250  N N   . GLY A 1 33  ? 6.173   13.947 -0.022  1.00 57.70  ? 33  GLY A N   1 
ATOM   251  C CA  . GLY A 1 33  ? 7.201   13.503 -0.947  1.00 59.75  ? 33  GLY A CA  1 
ATOM   252  C C   . GLY A 1 33  ? 6.726   12.590 -2.062  1.00 61.72  ? 33  GLY A C   1 
ATOM   253  O O   . GLY A 1 33  ? 5.781   12.909 -2.784  1.00 61.07  ? 33  GLY A O   1 
ATOM   254  N N   . GLN A 1 34  ? 7.400   11.453 -2.202  1.00 73.90  ? 34  GLN A N   1 
ATOM   255  C CA  . GLN A 1 34  ? 7.076   10.468 -3.227  1.00 76.59  ? 34  GLN A CA  1 
ATOM   256  C C   . GLN A 1 34  ? 5.706   9.836  -2.999  1.00 76.81  ? 34  GLN A C   1 
ATOM   257  O O   . GLN A 1 34  ? 4.947   9.625  -3.945  1.00 76.71  ? 34  GLN A O   1 
ATOM   258  C CB  . GLN A 1 34  ? 8.147   9.372  -3.263  1.00 124.55 ? 34  GLN A CB  1 
ATOM   259  C CG  . GLN A 1 34  ? 8.392   8.693  -1.920  1.00 127.71 ? 34  GLN A CG  1 
ATOM   260  C CD  . GLN A 1 34  ? 9.139   9.577  -0.934  1.00 129.55 ? 34  GLN A CD  1 
ATOM   261  O OE1 . GLN A 1 34  ? 9.209   9.275  0.258   1.00 131.12 ? 34  GLN A OE1 1 
ATOM   262  N NE2 . GLN A 1 34  ? 9.712   10.670 -1.429  1.00 129.56 ? 34  GLN A NE2 1 
ATOM   263  N N   . ASP A 1 35  ? 5.397   9.535  -1.741  1.00 74.97  ? 35  ASP A N   1 
ATOM   264  C CA  . ASP A 1 35  ? 4.117   8.925  -1.384  1.00 75.27  ? 35  ASP A CA  1 
ATOM   265  C C   . ASP A 1 35  ? 2.930   9.722  -1.923  1.00 74.43  ? 35  ASP A C   1 
ATOM   266  O O   . ASP A 1 35  ? 1.855   9.171  -2.150  1.00 73.91  ? 35  ASP A O   1 
ATOM   267  C CB  . ASP A 1 35  ? 4.002   8.805  0.136   1.00 82.83  ? 35  ASP A CB  1 
ATOM   268  C CG  . ASP A 1 35  ? 5.005   7.839  0.720   1.00 83.54  ? 35  ASP A CG  1 
ATOM   269  O OD1 . ASP A 1 35  ? 6.208   7.981  0.419   1.00 84.59  ? 35  ASP A OD1 1 
ATOM   270  O OD2 . ASP A 1 35  ? 4.592   6.941  1.483   1.00 85.04  ? 35  ASP A OD2 1 
ATOM   271  N N   . MET A 1 36  ? 3.140   11.020 -2.122  1.00 70.54  ? 36  MET A N   1 
ATOM   272  C CA  . MET A 1 36  ? 2.107   11.915 -2.632  1.00 69.91  ? 36  MET A CA  1 
ATOM   273  C C   . MET A 1 36  ? 1.321   11.265 -3.774  1.00 68.97  ? 36  MET A C   1 
ATOM   274  O O   . MET A 1 36  ? 0.092   11.315 -3.801  1.00 69.86  ? 36  MET A O   1 
ATOM   275  C CB  . MET A 1 36  ? 2.755   13.211 -3.132  1.00 78.34  ? 36  MET A CB  1 
ATOM   276  C CG  . MET A 1 36  ? 1.835   14.423 -3.161  1.00 78.93  ? 36  MET A CG  1 
ATOM   277  S SD  . MET A 1 36  ? 1.682   15.214 -1.545  1.00 79.71  ? 36  MET A SD  1 
ATOM   278  C CE  . MET A 1 36  ? 0.325   14.291 -0.823  1.00 78.76  ? 36  MET A CE  1 
ATOM   279  N N   . GLU A 1 37  ? 2.043   10.652 -4.708  1.00 55.88  ? 37  GLU A N   1 
ATOM   280  C CA  . GLU A 1 37  ? 1.439   9.996  -5.870  1.00 54.19  ? 37  GLU A CA  1 
ATOM   281  C C   . GLU A 1 37  ? 0.352   8.976  -5.534  1.00 51.16  ? 37  GLU A C   1 
ATOM   282  O O   . GLU A 1 37  ? -0.486  8.659  -6.377  1.00 49.17  ? 37  GLU A O   1 
ATOM   283  C CB  . GLU A 1 37  ? 2.524   9.315  -6.712  1.00 124.91 ? 37  GLU A CB  1 
ATOM   284  C CG  . GLU A 1 37  ? 3.282   10.243 -7.655  1.00 130.05 ? 37  GLU A CG  1 
ATOM   285  C CD  . GLU A 1 37  ? 3.996   11.374 -6.940  1.00 132.90 ? 37  GLU A CD  1 
ATOM   286  O OE1 . GLU A 1 37  ? 3.311   12.240 -6.355  1.00 134.70 ? 37  GLU A OE1 1 
ATOM   287  O OE2 . GLU A 1 37  ? 5.245   11.397 -6.964  1.00 134.15 ? 37  GLU A OE2 1 
ATOM   288  N N   . GLN A 1 38  ? 0.370   8.455  -4.313  1.00 54.09  ? 38  GLN A N   1 
ATOM   289  C CA  . GLN A 1 38  ? -0.629  7.477  -3.890  1.00 50.50  ? 38  GLN A CA  1 
ATOM   290  C C   . GLN A 1 38  ? -2.019  8.097  -3.810  1.00 46.74  ? 38  GLN A C   1 
ATOM   291  O O   . GLN A 1 38  ? -3.013  7.448  -4.122  1.00 46.75  ? 38  GLN A O   1 
ATOM   292  C CB  . GLN A 1 38  ? -0.281  6.910  -2.512  1.00 84.47  ? 38  GLN A CB  1 
ATOM   293  C CG  . GLN A 1 38  ? 1.009   6.117  -2.445  1.00 89.82  ? 38  GLN A CG  1 
ATOM   294  C CD  . GLN A 1 38  ? 1.332   5.674  -1.031  1.00 91.44  ? 38  GLN A CD  1 
ATOM   295  O OE1 . GLN A 1 38  ? 0.532   4.998  -0.382  1.00 91.71  ? 38  GLN A OE1 1 
ATOM   296  N NE2 . GLN A 1 38  ? 2.507   6.057  -0.544  1.00 92.04  ? 38  GLN A NE2 1 
ATOM   297  N N   . GLN A 1 39  ? -2.082  9.355  -3.391  1.00 43.16  ? 39  GLN A N   1 
ATOM   298  C CA  . GLN A 1 39  ? -3.357  10.039 -3.230  1.00 40.40  ? 39  GLN A CA  1 
ATOM   299  C C   . GLN A 1 39  ? -4.300  9.929  -4.425  1.00 38.73  ? 39  GLN A C   1 
ATOM   300  O O   . GLN A 1 39  ? -3.877  9.837  -5.581  1.00 36.73  ? 39  GLN A O   1 
ATOM   301  C CB  . GLN A 1 39  ? -3.128  11.511 -2.888  1.00 35.27  ? 39  GLN A CB  1 
ATOM   302  C CG  . GLN A 1 39  ? -3.090  12.435 -4.083  1.00 33.73  ? 39  GLN A CG  1 
ATOM   303  C CD  . GLN A 1 39  ? -2.664  13.831 -3.700  1.00 32.44  ? 39  GLN A CD  1 
ATOM   304  O OE1 . GLN A 1 39  ? -3.142  14.395 -2.712  1.00 33.30  ? 39  GLN A OE1 1 
ATOM   305  N NE2 . GLN A 1 39  ? -1.769  14.402 -4.481  1.00 32.62  ? 39  GLN A NE2 1 
ATOM   306  N N   . VAL A 1 40  ? -5.591  9.937  -4.113  1.00 34.88  ? 40  VAL A N   1 
ATOM   307  C CA  . VAL A 1 40  ? -6.653  9.842  -5.102  1.00 33.67  ? 40  VAL A CA  1 
ATOM   308  C C   . VAL A 1 40  ? -6.862  11.148 -5.873  1.00 29.98  ? 40  VAL A C   1 
ATOM   309  O O   . VAL A 1 40  ? -6.871  12.232 -5.288  1.00 27.09  ? 40  VAL A O   1 
ATOM   310  C CB  . VAL A 1 40  ? -8.001  9.486  -4.423  1.00 34.09  ? 40  VAL A CB  1 
ATOM   311  C CG1 . VAL A 1 40  ? -9.123  9.527  -5.439  1.00 36.46  ? 40  VAL A CG1 1 
ATOM   312  C CG2 . VAL A 1 40  ? -7.919  8.121  -3.775  1.00 34.71  ? 40  VAL A CG2 1 
ATOM   313  N N   . VAL A 1 41  ? -7.030  11.026 -7.187  1.00 29.96  ? 41  VAL A N   1 
ATOM   314  C CA  . VAL A 1 41  ? -7.303  12.167 -8.049  1.00 29.12  ? 41  VAL A CA  1 
ATOM   315  C C   . VAL A 1 41  ? -8.794  12.096 -8.402  1.00 29.53  ? 41  VAL A C   1 
ATOM   316  O O   . VAL A 1 41  ? -9.271  11.092 -8.926  1.00 29.68  ? 41  VAL A O   1 
ATOM   317  C CB  . VAL A 1 41  ? -6.465  12.120 -9.330  1.00 31.62  ? 41  VAL A CB  1 
ATOM   318  C CG1 . VAL A 1 41  ? -6.875  13.267 -10.265 1.00 33.22  ? 41  VAL A CG1 1 
ATOM   319  C CG2 . VAL A 1 41  ? -4.988  12.242 -8.971  1.00 31.84  ? 41  VAL A CG2 1 
ATOM   320  N N   . TRP A 1 42  ? -9.527  13.162 -8.102  1.00 26.43  ? 42  TRP A N   1 
ATOM   321  C CA  . TRP A 1 42  ? -10.959 13.192 -8.356  1.00 26.70  ? 42  TRP A CA  1 
ATOM   322  C C   . TRP A 1 42  ? -11.381 13.925 -9.607  1.00 28.00  ? 42  TRP A C   1 
ATOM   323  O O   . TRP A 1 42  ? -10.684 14.805 -10.115 1.00 27.59  ? 42  TRP A O   1 
ATOM   324  C CB  . TRP A 1 42  ? -11.713 13.860 -7.194  1.00 27.87  ? 42  TRP A CB  1 
ATOM   325  C CG  . TRP A 1 42  ? -11.462 13.264 -5.850  1.00 27.16  ? 42  TRP A CG  1 
ATOM   326  C CD1 . TRP A 1 42  ? -10.465 13.593 -4.981  1.00 25.90  ? 42  TRP A CD1 1 
ATOM   327  C CD2 . TRP A 1 42  ? -12.201 12.205 -5.239  1.00 27.24  ? 42  TRP A CD2 1 
ATOM   328  N NE1 . TRP A 1 42  ? -10.536 12.802 -3.865  1.00 28.07  ? 42  TRP A NE1 1 
ATOM   329  C CE2 . TRP A 1 42  ? -11.593 11.938 -3.996  1.00 27.42  ? 42  TRP A CE2 1 
ATOM   330  C CE3 . TRP A 1 42  ? -13.320 11.451 -5.623  1.00 26.28  ? 42  TRP A CE3 1 
ATOM   331  C CZ2 . TRP A 1 42  ? -12.062 10.948 -3.129  1.00 27.45  ? 42  TRP A CZ2 1 
ATOM   332  C CZ3 . TRP A 1 42  ? -13.789 10.465 -4.763  1.00 27.54  ? 42  TRP A CZ3 1 
ATOM   333  C CH2 . TRP A 1 42  ? -13.157 10.224 -3.528  1.00 27.90  ? 42  TRP A CH2 1 
ATOM   334  N N   . SER A 1 43  ? -12.555 13.544 -10.085 1.00 25.67  ? 43  SER A N   1 
ATOM   335  C CA  . SER A 1 43  ? -13.178 14.194 -11.215 1.00 25.76  ? 43  SER A CA  1 
ATOM   336  C C   . SER A 1 43  ? -14.429 14.754 -10.547 1.00 27.34  ? 43  SER A C   1 
ATOM   337  O O   . SER A 1 43  ? -15.360 14.011 -10.212 1.00 28.77  ? 43  SER A O   1 
ATOM   338  C CB  . SER A 1 43  ? -13.564 13.187 -12.288 1.00 39.16  ? 43  SER A CB  1 
ATOM   339  O OG  . SER A 1 43  ? -14.200 13.854 -13.357 1.00 41.09  ? 43  SER A OG  1 
ATOM   340  N N   . MET A 1 44  ? -14.430 16.053 -10.289 1.00 27.84  ? 44  MET A N   1 
ATOM   341  C CA  . MET A 1 44  ? -15.571 16.674 -9.645  1.00 27.09  ? 44  MET A CA  1 
ATOM   342  C C   . MET A 1 44  ? -16.517 17.138 -10.731 1.00 28.48  ? 44  MET A C   1 
ATOM   343  O O   . MET A 1 44  ? -16.120 17.873 -11.638 1.00 31.18  ? 44  MET A O   1 
ATOM   344  C CB  . MET A 1 44  ? -15.119 17.853 -8.794  1.00 29.47  ? 44  MET A CB  1 
ATOM   345  C CG  . MET A 1 44  ? -16.208 18.455 -7.929  1.00 30.64  ? 44  MET A CG  1 
ATOM   346  S SD  . MET A 1 44  ? -15.610 19.905 -7.043  1.00 32.69  ? 44  MET A SD  1 
ATOM   347  C CE  . MET A 1 44  ? -14.568 19.143 -5.788  1.00 30.13  ? 44  MET A CE  1 
ATOM   348  N N   . SER A 1 45  ? -17.764 16.682 -10.651 1.00 32.65  ? 45  SER A N   1 
ATOM   349  C CA  . SER A 1 45  ? -18.771 17.050 -11.634 1.00 33.48  ? 45  SER A CA  1 
ATOM   350  C C   . SER A 1 45  ? -19.827 17.962 -11.043 1.00 34.97  ? 45  SER A C   1 
ATOM   351  O O   . SER A 1 45  ? -20.297 17.758 -9.920  1.00 33.48  ? 45  SER A O   1 
ATOM   352  C CB  . SER A 1 45  ? -19.464 15.803 -12.199 1.00 29.94  ? 45  SER A CB  1 
ATOM   353  O OG  . SER A 1 45  ? -18.552 14.972 -12.894 1.00 32.28  ? 45  SER A OG  1 
ATOM   354  N N   . PHE A 1 46  ? -20.205 18.964 -11.822 1.00 34.63  ? 46  PHE A N   1 
ATOM   355  C CA  . PHE A 1 46  ? -21.232 19.897 -11.412 1.00 35.68  ? 46  PHE A CA  1 
ATOM   356  C C   . PHE A 1 46  ? -22.545 19.412 -12.012 1.00 36.47  ? 46  PHE A C   1 
ATOM   357  O O   . PHE A 1 46  ? -22.792 19.540 -13.210 1.00 36.47  ? 46  PHE A O   1 
ATOM   358  C CB  . PHE A 1 46  ? -20.854 21.302 -11.881 1.00 31.36  ? 46  PHE A CB  1 
ATOM   359  C CG  . PHE A 1 46  ? -19.537 21.760 -11.332 1.00 29.40  ? 46  PHE A CG  1 
ATOM   360  C CD1 . PHE A 1 46  ? -18.349 21.317 -11.891 1.00 28.27  ? 46  PHE A CD1 1 
ATOM   361  C CD2 . PHE A 1 46  ? -19.486 22.547 -10.192 1.00 28.33  ? 46  PHE A CD2 1 
ATOM   362  C CE1 . PHE A 1 46  ? -17.128 21.646 -11.321 1.00 31.98  ? 46  PHE A CE1 1 
ATOM   363  C CE2 . PHE A 1 46  ? -18.265 22.886 -9.608  1.00 32.18  ? 46  PHE A CE2 1 
ATOM   364  C CZ  . PHE A 1 46  ? -17.085 22.434 -10.172 1.00 32.71  ? 46  PHE A CZ  1 
ATOM   365  N N   . VAL A 1 47  ? -23.372 18.832 -11.152 1.00 36.97  ? 47  VAL A N   1 
ATOM   366  C CA  . VAL A 1 47  ? -24.654 18.269 -11.549 1.00 39.80  ? 47  VAL A CA  1 
ATOM   367  C C   . VAL A 1 47  ? -25.859 19.134 -11.179 1.00 43.52  ? 47  VAL A C   1 
ATOM   368  O O   . VAL A 1 47  ? -25.714 20.196 -10.568 1.00 42.80  ? 47  VAL A O   1 
ATOM   369  C CB  . VAL A 1 47  ? -24.826 16.871 -10.916 1.00 33.07  ? 47  VAL A CB  1 
ATOM   370  C CG1 . VAL A 1 47  ? -23.696 15.946 -11.399 1.00 31.81  ? 47  VAL A CG1 1 
ATOM   371  C CG2 . VAL A 1 47  ? -24.802 16.984 -9.392  1.00 29.38  ? 47  VAL A CG2 1 
ATOM   372  N N   . GLN A 1 48  ? -27.046 18.669 -11.560 1.00 57.14  ? 48  GLN A N   1 
ATOM   373  C CA  . GLN A 1 48  ? -28.285 19.383 -11.278 1.00 62.45  ? 48  GLN A CA  1 
ATOM   374  C C   . GLN A 1 48  ? -28.702 19.239 -9.818  1.00 64.44  ? 48  GLN A C   1 
ATOM   375  O O   . GLN A 1 48  ? -28.417 18.228 -9.172  1.00 65.08  ? 48  GLN A O   1 
ATOM   376  C CB  . GLN A 1 48  ? -29.411 18.872 -12.181 1.00 111.89 ? 48  GLN A CB  1 
ATOM   377  C CG  . GLN A 1 48  ? -29.246 19.225 -13.647 1.00 117.77 ? 48  GLN A CG  1 
ATOM   378  C CD  . GLN A 1 48  ? -29.213 20.724 -13.885 1.00 121.51 ? 48  GLN A CD  1 
ATOM   379  O OE1 . GLN A 1 48  ? -30.136 21.446 -13.505 1.00 124.15 ? 48  GLN A OE1 1 
ATOM   380  N NE2 . GLN A 1 48  ? -28.147 21.199 -14.519 1.00 122.39 ? 48  GLN A NE2 1 
ATOM   381  N N   . GLY A 1 49  ? -29.386 20.260 -9.312  1.00 60.92  ? 49  GLY A N   1 
ATOM   382  C CA  . GLY A 1 49  ? -29.845 20.250 -7.936  1.00 62.28  ? 49  GLY A CA  1 
ATOM   383  C C   . GLY A 1 49  ? -30.053 21.667 -7.442  1.00 64.68  ? 49  GLY A C   1 
ATOM   384  O O   . GLY A 1 49  ? -29.788 22.626 -8.170  1.00 64.17  ? 49  GLY A O   1 
ATOM   385  N N   . GLU A 1 50  ? -30.528 21.804 -6.207  1.00 76.60  ? 50  GLU A N   1 
ATOM   386  C CA  . GLU A 1 50  ? -30.762 23.118 -5.621  1.00 79.99  ? 50  GLU A CA  1 
ATOM   387  C C   . GLU A 1 50  ? -29.418 23.823 -5.459  1.00 81.51  ? 50  GLU A C   1 
ATOM   388  O O   . GLU A 1 50  ? -28.607 23.437 -4.617  1.00 82.51  ? 50  GLU A O   1 
ATOM   389  C CB  . GLU A 1 50  ? -31.452 22.965 -4.260  1.00 142.83 ? 50  GLU A CB  1 
ATOM   390  C CG  . GLU A 1 50  ? -31.913 24.270 -3.624  1.00 146.79 ? 50  GLU A CG  1 
ATOM   391  C CD  . GLU A 1 50  ? -30.761 25.160 -3.200  1.00 148.85 ? 50  GLU A CD  1 
ATOM   392  O OE1 . GLU A 1 50  ? -29.935 24.712 -2.377  1.00 150.13 ? 50  GLU A OE1 1 
ATOM   393  O OE2 . GLU A 1 50  ? -30.681 26.306 -3.690  1.00 149.36 ? 50  GLU A OE2 1 
ATOM   394  N N   . GLU A 1 51  ? -29.185 24.856 -6.266  1.00 86.04  ? 51  GLU A N   1 
ATOM   395  C CA  . GLU A 1 51  ? -27.926 25.594 -6.208  1.00 86.84  ? 51  GLU A CA  1 
ATOM   396  C C   . GLU A 1 51  ? -28.037 26.983 -5.580  1.00 87.59  ? 51  GLU A C   1 
ATOM   397  O O   . GLU A 1 51  ? -29.057 27.662 -5.705  1.00 87.30  ? 51  GLU A O   1 
ATOM   398  C CB  . GLU A 1 51  ? -27.323 25.724 -7.609  1.00 92.22  ? 51  GLU A CB  1 
ATOM   399  C CG  . GLU A 1 51  ? -25.972 26.425 -7.624  1.00 93.11  ? 51  GLU A CG  1 
ATOM   400  C CD  . GLU A 1 51  ? -25.371 26.518 -9.011  1.00 94.55  ? 51  GLU A CD  1 
ATOM   401  O OE1 . GLU A 1 51  ? -25.206 25.462 -9.659  1.00 94.98  ? 51  GLU A OE1 1 
ATOM   402  O OE2 . GLU A 1 51  ? -25.059 27.646 -9.450  1.00 95.48  ? 51  GLU A OE2 1 
ATOM   403  N N   . SER A 1 52  ? -26.963 27.393 -4.910  1.00 80.51  ? 52  SER A N   1 
ATOM   404  C CA  . SER A 1 52  ? -26.890 28.692 -4.252  1.00 81.50  ? 52  SER A CA  1 
ATOM   405  C C   . SER A 1 52  ? -25.545 29.341 -4.585  1.00 82.61  ? 52  SER A C   1 
ATOM   406  O O   . SER A 1 52  ? -24.736 28.766 -5.315  1.00 82.40  ? 52  SER A O   1 
ATOM   407  C CB  . SER A 1 52  ? -27.030 28.517 -2.736  1.00 83.44  ? 52  SER A CB  1 
ATOM   408  O OG  . SER A 1 52  ? -27.046 29.764 -2.065  1.00 82.59  ? 52  SER A OG  1 
ATOM   409  N N   . ASN A 1 53  ? -25.305 30.534 -4.052  1.00 135.05 ? 53  ASN A N   1 
ATOM   410  C CA  . ASN A 1 53  ? -24.054 31.240 -4.309  1.00 135.05 ? 53  ASN A CA  1 
ATOM   411  C C   . ASN A 1 53  ? -22.901 30.715 -3.456  1.00 134.10 ? 53  ASN A C   1 
ATOM   412  O O   . ASN A 1 53  ? -21.747 31.093 -3.661  1.00 134.94 ? 53  ASN A O   1 
ATOM   413  C CB  . ASN A 1 53  ? -24.238 32.745 -4.075  1.00 147.00 ? 53  ASN A CB  1 
ATOM   414  C CG  . ASN A 1 53  ? -24.774 33.066 -2.689  1.00 149.07 ? 53  ASN A CG  1 
ATOM   415  O OD1 . ASN A 1 53  ? -24.991 34.230 -2.352  1.00 149.70 ? 53  ASN A OD1 1 
ATOM   416  N ND2 . ASN A 1 53  ? -24.990 32.035 -1.881  1.00 147.70 ? 53  ASN A ND2 1 
ATOM   417  N N   . ASP A 1 54  ? -23.218 29.841 -2.505  1.00 92.90  ? 54  ASP A N   1 
ATOM   418  C CA  . ASP A 1 54  ? -22.206 29.262 -1.625  1.00 90.30  ? 54  ASP A CA  1 
ATOM   419  C C   . ASP A 1 54  ? -22.430 27.763 -1.434  1.00 85.67  ? 54  ASP A C   1 
ATOM   420  O O   . ASP A 1 54  ? -21.690 27.106 -0.703  1.00 85.52  ? 54  ASP A O   1 
ATOM   421  C CB  . ASP A 1 54  ? -22.218 29.965 -0.264  1.00 147.12 ? 54  ASP A CB  1 
ATOM   422  C CG  . ASP A 1 54  ? -23.539 29.809 0.464   1.00 150.77 ? 54  ASP A CG  1 
ATOM   423  O OD1 . ASP A 1 54  ? -24.581 30.204 -0.098  1.00 151.77 ? 54  ASP A OD1 1 
ATOM   424  O OD2 . ASP A 1 54  ? -23.535 29.292 1.601   1.00 153.22 ? 54  ASP A OD2 1 
ATOM   425  N N   . LYS A 1 55  ? -23.457 27.236 -2.095  1.00 67.95  ? 55  LYS A N   1 
ATOM   426  C CA  . LYS A 1 55  ? -23.789 25.816 -2.023  1.00 62.80  ? 55  LYS A CA  1 
ATOM   427  C C   . LYS A 1 55  ? -23.991 25.261 -3.429  1.00 58.98  ? 55  LYS A C   1 
ATOM   428  O O   . LYS A 1 55  ? -25.048 25.441 -4.038  1.00 59.87  ? 55  LYS A O   1 
ATOM   429  C CB  . LYS A 1 55  ? -25.057 25.602 -1.195  1.00 50.29  ? 55  LYS A CB  1 
ATOM   430  C CG  . LYS A 1 55  ? -25.553 24.166 -1.210  1.00 49.97  ? 55  LYS A CG  1 
ATOM   431  C CD  . LYS A 1 55  ? -26.604 23.909 -0.140  1.00 51.32  ? 55  LYS A CD  1 
ATOM   432  C CE  . LYS A 1 55  ? -25.997 23.920 1.252   1.00 52.34  ? 55  LYS A CE  1 
ATOM   433  N NZ  . LYS A 1 55  ? -26.972 23.473 2.297   1.00 52.00  ? 55  LYS A NZ  1 
ATOM   434  N N   . ILE A 1 56  ? -22.967 24.580 -3.932  1.00 37.24  ? 56  ILE A N   1 
ATOM   435  C CA  . ILE A 1 56  ? -22.993 24.007 -5.273  1.00 33.09  ? 56  ILE A CA  1 
ATOM   436  C C   . ILE A 1 56  ? -23.057 22.471 -5.219  1.00 31.86  ? 56  ILE A C   1 
ATOM   437  O O   . ILE A 1 56  ? -22.224 21.832 -4.579  1.00 29.22  ? 56  ILE A O   1 
ATOM   438  C CB  . ILE A 1 56  ? -21.714 24.394 -6.053  1.00 36.52  ? 56  ILE A CB  1 
ATOM   439  C CG1 . ILE A 1 56  ? -21.396 25.883 -5.855  1.00 35.82  ? 56  ILE A CG1 1 
ATOM   440  C CG2 . ILE A 1 56  ? -21.873 24.038 -7.524  1.00 33.56  ? 56  ILE A CG2 1 
ATOM   441  C CD1 . ILE A 1 56  ? -22.384 26.836 -6.487  1.00 36.44  ? 56  ILE A CD1 1 
ATOM   442  N N   . PRO A 1 57  ? -24.054 21.863 -5.885  1.00 33.41  ? 57  PRO A N   1 
ATOM   443  C CA  . PRO A 1 57  ? -24.152 20.401 -5.868  1.00 30.37  ? 57  PRO A CA  1 
ATOM   444  C C   . PRO A 1 57  ? -23.119 19.777 -6.802  1.00 28.44  ? 57  PRO A C   1 
ATOM   445  O O   . PRO A 1 57  ? -22.953 20.221 -7.939  1.00 27.27  ? 57  PRO A O   1 
ATOM   446  C CB  . PRO A 1 57  ? -25.586 20.148 -6.332  1.00 38.57  ? 57  PRO A CB  1 
ATOM   447  C CG  . PRO A 1 57  ? -25.827 21.285 -7.279  1.00 41.10  ? 57  PRO A CG  1 
ATOM   448  C CD  . PRO A 1 57  ? -25.235 22.463 -6.533  1.00 39.81  ? 57  PRO A CD  1 
ATOM   449  N N   . VAL A 1 58  ? -22.415 18.757 -6.319  1.00 27.54  ? 58  VAL A N   1 
ATOM   450  C CA  . VAL A 1 58  ? -21.407 18.080 -7.133  1.00 24.68  ? 58  VAL A CA  1 
ATOM   451  C C   . VAL A 1 58  ? -21.447 16.578 -6.904  1.00 24.07  ? 58  VAL A C   1 
ATOM   452  O O   . VAL A 1 58  ? -22.077 16.098 -5.959  1.00 24.20  ? 58  VAL A O   1 
ATOM   453  C CB  . VAL A 1 58  ? -19.972 18.539 -6.781  1.00 22.99  ? 58  VAL A CB  1 
ATOM   454  C CG1 . VAL A 1 58  ? -19.851 20.060 -6.916  1.00 23.03  ? 58  VAL A CG1 1 
ATOM   455  C CG2 . VAL A 1 58  ? -19.614 18.084 -5.352  1.00 18.59  ? 58  VAL A CG2 1 
ATOM   456  N N   . ALA A 1 59  ? -20.768 15.851 -7.783  1.00 23.87  ? 59  ALA A N   1 
ATOM   457  C CA  . ALA A 1 59  ? -20.637 14.405 -7.677  1.00 23.65  ? 59  ALA A CA  1 
ATOM   458  C C   . ALA A 1 59  ? -19.127 14.201 -7.662  1.00 25.00  ? 59  ALA A C   1 
ATOM   459  O O   . ALA A 1 59  ? -18.384 14.957 -8.301  1.00 26.95  ? 59  ALA A O   1 
ATOM   460  C CB  . ALA A 1 59  ? -21.267 13.690 -8.888  1.00 17.31  ? 59  ALA A CB  1 
ATOM   461  N N   . LEU A 1 60  ? -18.675 13.196 -6.921  1.00 25.90  ? 60  LEU A N   1 
ATOM   462  C CA  . LEU A 1 60  ? -17.258 12.916 -6.796  1.00 25.78  ? 60  LEU A CA  1 
ATOM   463  C C   . LEU A 1 60  ? -16.935 11.492 -7.210  1.00 28.05  ? 60  LEU A C   1 
ATOM   464  O O   . LEU A 1 60  ? -17.408 10.533 -6.600  1.00 28.09  ? 60  LEU A O   1 
ATOM   465  C CB  . LEU A 1 60  ? -16.816 13.137 -5.346  1.00 32.21  ? 60  LEU A CB  1 
ATOM   466  C CG  . LEU A 1 60  ? -17.065 14.536 -4.770  1.00 34.21  ? 60  LEU A CG  1 
ATOM   467  C CD1 . LEU A 1 60  ? -16.821 14.542 -3.264  1.00 32.39  ? 60  LEU A CD1 1 
ATOM   468  C CD2 . LEU A 1 60  ? -16.153 15.534 -5.472  1.00 33.27  ? 60  LEU A CD2 1 
ATOM   469  N N   . GLY A 1 61  ? -16.133 11.366 -8.259  1.00 26.92  ? 61  GLY A N   1 
ATOM   470  C CA  . GLY A 1 61  ? -15.718 10.064 -8.733  1.00 29.65  ? 61  GLY A CA  1 
ATOM   471  C C   . GLY A 1 61  ? -14.210 10.087 -8.912  1.00 29.50  ? 61  GLY A C   1 
ATOM   472  O O   . GLY A 1 61  ? -13.602 11.154 -8.911  1.00 30.78  ? 61  GLY A O   1 
ATOM   473  N N   . LEU A 1 62  ? -13.593 8.922  -9.035  1.00 25.37  ? 62  LEU A N   1 
ATOM   474  C CA  . LEU A 1 62  ? -12.153 8.873  -9.243  1.00 27.31  ? 62  LEU A CA  1 
ATOM   475  C C   . LEU A 1 62  ? -11.896 9.152  -10.708 1.00 27.16  ? 62  LEU A C   1 
ATOM   476  O O   . LEU A 1 62  ? -12.689 8.751  -11.557 1.00 25.81  ? 62  LEU A O   1 
ATOM   477  C CB  . LEU A 1 62  ? -11.594 7.496  -8.868  1.00 31.53  ? 62  LEU A CB  1 
ATOM   478  C CG  . LEU A 1 62  ? -11.306 7.306  -7.379  1.00 33.71  ? 62  LEU A CG  1 
ATOM   479  C CD1 . LEU A 1 62  ? -12.604 7.367  -6.605  1.00 32.87  ? 62  LEU A CD1 1 
ATOM   480  C CD2 . LEU A 1 62  ? -10.607 5.980  -7.150  1.00 36.79  ? 62  LEU A CD2 1 
ATOM   481  N N   . LYS A 1 63  ? -10.803 9.840  -11.021 1.00 26.64  ? 63  LYS A N   1 
ATOM   482  C CA  . LYS A 1 63  ? -10.511 10.128 -12.423 1.00 30.63  ? 63  LYS A CA  1 
ATOM   483  C C   . LYS A 1 63  ? -10.214 8.844  -13.213 1.00 32.07  ? 63  LYS A C   1 
ATOM   484  O O   . LYS A 1 63  ? -9.393  8.026  -12.796 1.00 31.25  ? 63  LYS A O   1 
ATOM   485  C CB  . LYS A 1 63  ? -9.315  11.071 -12.540 1.00 45.25  ? 63  LYS A CB  1 
ATOM   486  C CG  . LYS A 1 63  ? -9.060  11.530 -13.968 1.00 48.75  ? 63  LYS A CG  1 
ATOM   487  C CD  . LYS A 1 63  ? -7.655  12.088 -14.151 1.00 55.17  ? 63  LYS A CD  1 
ATOM   488  C CE  . LYS A 1 63  ? -6.602  10.997 -14.005 1.00 57.32  ? 63  LYS A CE  1 
ATOM   489  N NZ  . LYS A 1 63  ? -5.226  11.511 -14.245 1.00 60.37  ? 63  LYS A NZ  1 
ATOM   490  N N   . GLU A 1 64  ? -10.885 8.665  -14.345 1.00 65.28  ? 64  GLU A N   1 
ATOM   491  C CA  . GLU A 1 64  ? -10.669 7.494  -15.202 1.00 70.94  ? 64  GLU A CA  1 
ATOM   492  C C   . GLU A 1 64  ? -11.243 6.167  -14.698 1.00 70.44  ? 64  GLU A C   1 
ATOM   493  O O   . GLU A 1 64  ? -11.241 5.180  -15.432 1.00 72.43  ? 64  GLU A O   1 
ATOM   494  C CB  . GLU A 1 64  ? -9.173  7.308  -15.478 1.00 109.40 ? 64  GLU A CB  1 
ATOM   495  C CG  . GLU A 1 64  ? -8.490  8.526  -16.073 1.00 115.61 ? 64  GLU A CG  1 
ATOM   496  C CD  . GLU A 1 64  ? -7.003  8.310  -16.281 1.00 119.68 ? 64  GLU A CD  1 
ATOM   497  O OE1 . GLU A 1 64  ? -6.315  7.932  -15.309 1.00 120.04 ? 64  GLU A OE1 1 
ATOM   498  O OE2 . GLU A 1 64  ? -6.521  8.523  -17.413 1.00 124.08 ? 64  GLU A OE2 1 
ATOM   499  N N   . LYS A 1 65  ? -11.712 6.135  -13.453 1.00 52.50  ? 65  LYS A N   1 
ATOM   500  C CA  . LYS A 1 65  ? -12.301 4.919  -12.888 1.00 49.03  ? 65  LYS A CA  1 
ATOM   501  C C   . LYS A 1 65  ? -13.794 5.117  -12.647 1.00 46.75  ? 65  LYS A C   1 
ATOM   502  O O   . LYS A 1 65  ? -14.216 6.171  -12.171 1.00 48.98  ? 65  LYS A O   1 
ATOM   503  C CB  . LYS A 1 65  ? -11.638 4.557  -11.563 1.00 38.56  ? 65  LYS A CB  1 
ATOM   504  C CG  . LYS A 1 65  ? -10.231 4.005  -11.666 1.00 40.49  ? 65  LYS A CG  1 
ATOM   505  C CD  . LYS A 1 65  ? -9.708  3.673  -10.278 1.00 44.61  ? 65  LYS A CD  1 
ATOM   506  C CE  . LYS A 1 65  ? -8.335  3.026  -10.305 1.00 47.61  ? 65  LYS A CE  1 
ATOM   507  N NZ  . LYS A 1 65  ? -8.373  1.629  -10.830 1.00 51.20  ? 65  LYS A NZ  1 
ATOM   508  N N   . ASN A 1 66  ? -14.594 4.108  -12.979 1.00 33.54  ? 66  ASN A N   1 
ATOM   509  C CA  . ASN A 1 66  ? -16.038 4.187  -12.779 1.00 29.10  ? 66  ASN A CA  1 
ATOM   510  C C   . ASN A 1 66  ? -16.415 3.880  -11.321 1.00 27.46  ? 66  ASN A C   1 
ATOM   511  O O   . ASN A 1 66  ? -17.067 2.869  -11.020 1.00 24.00  ? 66  ASN A O   1 
ATOM   512  C CB  . ASN A 1 66  ? -16.775 3.230  -13.729 1.00 38.65  ? 66  ASN A CB  1 
ATOM   513  C CG  . ASN A 1 66  ? -16.290 1.786  -13.616 1.00 38.51  ? 66  ASN A CG  1 
ATOM   514  O OD1 . ASN A 1 66  ? -17.091 0.851  -13.654 1.00 40.40  ? 66  ASN A OD1 1 
ATOM   515  N ND2 . ASN A 1 66  ? -14.979 1.601  -13.500 1.00 34.98  ? 66  ASN A ND2 1 
ATOM   516  N N   . LEU A 1 67  ? -15.985 4.770  -10.430 1.00 30.20  ? 67  LEU A N   1 
ATOM   517  C CA  . LEU A 1 67  ? -16.235 4.669  -8.999  1.00 29.16  ? 67  LEU A CA  1 
ATOM   518  C C   . LEU A 1 67  ? -16.594 6.056  -8.453  1.00 27.64  ? 67  LEU A C   1 
ATOM   519  O O   . LEU A 1 67  ? -15.862 7.035  -8.663  1.00 26.40  ? 67  LEU A O   1 
ATOM   520  C CB  . LEU A 1 67  ? -14.993 4.125  -8.292  1.00 25.01  ? 67  LEU A CB  1 
ATOM   521  C CG  . LEU A 1 67  ? -14.692 2.625  -8.435  1.00 26.00  ? 67  LEU A CG  1 
ATOM   522  C CD1 . LEU A 1 67  ? -13.299 2.318  -7.911  1.00 22.36  ? 67  LEU A CD1 1 
ATOM   523  C CD2 . LEU A 1 67  ? -15.732 1.825  -7.657  1.00 28.66  ? 67  LEU A CD2 1 
ATOM   524  N N   . TYR A 1 68  ? -17.726 6.132  -7.759  1.00 26.64  ? 68  TYR A N   1 
ATOM   525  C CA  . TYR A 1 68  ? -18.211 7.386  -7.199  1.00 29.29  ? 68  TYR A CA  1 
ATOM   526  C C   . TYR A 1 68  ? -18.533 7.246  -5.728  1.00 28.15  ? 68  TYR A C   1 
ATOM   527  O O   . TYR A 1 68  ? -18.891 6.158  -5.272  1.00 27.37  ? 68  TYR A O   1 
ATOM   528  C CB  . TYR A 1 68  ? -19.482 7.833  -7.928  1.00 29.37  ? 68  TYR A CB  1 
ATOM   529  C CG  . TYR A 1 68  ? -19.245 8.302  -9.336  1.00 30.84  ? 68  TYR A CG  1 
ATOM   530  C CD1 . TYR A 1 68  ? -19.143 9.660  -9.631  1.00 31.48  ? 68  TYR A CD1 1 
ATOM   531  C CD2 . TYR A 1 68  ? -19.089 7.388  -10.370 1.00 32.48  ? 68  TYR A CD2 1 
ATOM   532  C CE1 . TYR A 1 68  ? -18.888 10.093 -10.922 1.00 35.54  ? 68  TYR A CE1 1 
ATOM   533  C CE2 . TYR A 1 68  ? -18.832 7.808  -11.660 1.00 36.60  ? 68  TYR A CE2 1 
ATOM   534  C CZ  . TYR A 1 68  ? -18.732 9.158  -11.931 1.00 36.02  ? 68  TYR A CZ  1 
ATOM   535  O OH  . TYR A 1 68  ? -18.459 9.565  -13.213 1.00 38.45  ? 68  TYR A OH  1 
ATOM   536  N N   . LEU A 1 69  ? -18.405 8.345  -4.987  1.00 19.40  ? 69  LEU A N   1 
ATOM   537  C CA  . LEU A 1 69  ? -18.740 8.318  -3.572  1.00 19.61  ? 69  LEU A CA  1 
ATOM   538  C C   . LEU A 1 69  ? -20.258 8.298  -3.533  1.00 19.78  ? 69  LEU A C   1 
ATOM   539  O O   . LEU A 1 69  ? -20.918 9.019  -4.285  1.00 19.22  ? 69  LEU A O   1 
ATOM   540  C CB  . LEU A 1 69  ? -18.219 9.556  -2.836  1.00 26.32  ? 69  LEU A CB  1 
ATOM   541  C CG  . LEU A 1 69  ? -16.729 9.597  -2.509  1.00 27.89  ? 69  LEU A CG  1 
ATOM   542  C CD1 . LEU A 1 69  ? -16.434 10.902 -1.778  1.00 28.13  ? 69  LEU A CD1 1 
ATOM   543  C CD2 . LEU A 1 69  ? -16.334 8.399  -1.650  1.00 27.98  ? 69  LEU A CD2 1 
ATOM   544  N N   . SER A 1 70  ? -20.795 7.480  -2.641  1.00 26.46  ? 70  SER A N   1 
ATOM   545  C CA  . SER A 1 70  ? -22.231 7.320  -2.507  1.00 28.21  ? 70  SER A CA  1 
ATOM   546  C C   . SER A 1 70  ? -22.619 7.344  -1.025  1.00 28.52  ? 70  SER A C   1 
ATOM   547  O O   . SER A 1 70  ? -21.860 6.884  -0.172  1.00 26.28  ? 70  SER A O   1 
ATOM   548  C CB  . SER A 1 70  ? -22.631 5.976  -3.140  1.00 36.14  ? 70  SER A CB  1 
ATOM   549  O OG  . SER A 1 70  ? -24.013 5.713  -3.010  1.00 42.77  ? 70  SER A OG  1 
ATOM   550  N N   . CYS A 1 71  ? -23.795 7.890  -0.733  1.00 26.14  ? 71  CYS A N   1 
ATOM   551  C CA  . CYS A 1 71  ? -24.300 7.956  0.634   1.00 28.39  ? 71  CYS A CA  1 
ATOM   552  C C   . CYS A 1 71  ? -25.530 7.061  0.715   1.00 29.81  ? 71  CYS A C   1 
ATOM   553  O O   . CYS A 1 71  ? -26.507 7.281  0.002   1.00 28.31  ? 71  CYS A O   1 
ATOM   554  C CB  . CYS A 1 71  ? -24.685 9.395  1.003   1.00 28.34  ? 71  CYS A CB  1 
ATOM   555  S SG  . CYS A 1 71  ? -23.280 10.545 1.118   1.00 30.17  ? 71  CYS A SG  1 
ATOM   556  N N   . VAL A 1 72  ? -25.472 6.051  1.579   1.00 27.79  ? 72  VAL A N   1 
ATOM   557  C CA  . VAL A 1 72  ? -26.578 5.116  1.741   1.00 29.66  ? 72  VAL A CA  1 
ATOM   558  C C   . VAL A 1 72  ? -26.733 4.703  3.199   1.00 31.34  ? 72  VAL A C   1 
ATOM   559  O O   . VAL A 1 72  ? -25.855 4.952  4.026   1.00 26.53  ? 72  VAL A O   1 
ATOM   560  C CB  . VAL A 1 72  ? -26.356 3.810  0.913   1.00 33.14  ? 72  VAL A CB  1 
ATOM   561  C CG1 . VAL A 1 72  ? -26.311 4.117  -0.576  1.00 35.12  ? 72  VAL A CG1 1 
ATOM   562  C CG2 . VAL A 1 72  ? -25.065 3.139  1.342   1.00 33.41  ? 72  VAL A CG2 1 
ATOM   563  N N   . LEU A 1 73  ? -27.860 4.067  3.502   1.00 35.83  ? 73  LEU A N   1 
ATOM   564  C CA  . LEU A 1 73  ? -28.130 3.568  4.842   1.00 41.14  ? 73  LEU A CA  1 
ATOM   565  C C   . LEU A 1 73  ? -27.532 2.170  4.939   1.00 45.27  ? 73  LEU A C   1 
ATOM   566  O O   . LEU A 1 73  ? -27.815 1.313  4.107   1.00 45.56  ? 73  LEU A O   1 
ATOM   567  C CB  . LEU A 1 73  ? -29.639 3.489  5.088   1.00 42.26  ? 73  LEU A CB  1 
ATOM   568  C CG  . LEU A 1 73  ? -30.344 4.796  5.426   1.00 43.83  ? 73  LEU A CG  1 
ATOM   569  C CD1 . LEU A 1 73  ? -31.859 4.602  5.397   1.00 45.01  ? 73  LEU A CD1 1 
ATOM   570  C CD2 . LEU A 1 73  ? -29.875 5.258  6.800   1.00 43.51  ? 73  LEU A CD2 1 
ATOM   571  N N   . LYS A 1 74  ? -26.694 1.948  5.941   1.00 50.26  ? 74  LYS A N   1 
ATOM   572  C CA  . LYS A 1 74  ? -26.078 0.646  6.137   1.00 55.68  ? 74  LYS A CA  1 
ATOM   573  C C   . LYS A 1 74  ? -26.174 0.316  7.621   1.00 58.68  ? 74  LYS A C   1 
ATOM   574  O O   . LYS A 1 74  ? -25.420 0.849  8.438   1.00 57.85  ? 74  LYS A O   1 
ATOM   575  C CB  . LYS A 1 74  ? -24.612 0.665  5.695   1.00 107.97 ? 74  LYS A CB  1 
ATOM   576  C CG  . LYS A 1 74  ? -23.996 -0.723 5.556   1.00 111.66 ? 74  LYS A CG  1 
ATOM   577  C CD  . LYS A 1 74  ? -22.522 -0.663 5.180   1.00 114.08 ? 74  LYS A CD  1 
ATOM   578  C CE  . LYS A 1 74  ? -21.649 -0.273 6.368   1.00 116.07 ? 74  LYS A CE  1 
ATOM   579  N NZ  . LYS A 1 74  ? -21.986 1.065  6.930   1.00 116.89 ? 74  LYS A NZ  1 
ATOM   580  N N   . ASP A 1 75  ? -27.116 -0.560 7.958   1.00 75.94  ? 75  ASP A N   1 
ATOM   581  C CA  . ASP A 1 75  ? -27.346 -0.959 9.338   1.00 78.68  ? 75  ASP A CA  1 
ATOM   582  C C   . ASP A 1 75  ? -27.962 0.221  10.087  1.00 79.03  ? 75  ASP A C   1 
ATOM   583  O O   . ASP A 1 75  ? -27.511 0.596  11.168  1.00 79.55  ? 75  ASP A O   1 
ATOM   584  C CB  . ASP A 1 75  ? -26.029 -1.388 9.998   1.00 121.68 ? 75  ASP A CB  1 
ATOM   585  C CG  . ASP A 1 75  ? -26.240 -2.061 11.342  1.00 125.57 ? 75  ASP A CG  1 
ATOM   586  O OD1 . ASP A 1 75  ? -26.962 -3.080 11.390  1.00 127.64 ? 75  ASP A OD1 1 
ATOM   587  O OD2 . ASP A 1 75  ? -25.682 -1.573 12.347  1.00 126.58 ? 75  ASP A OD2 1 
ATOM   588  N N   . ASP A 1 76  ? -28.987 0.812  9.479   1.00 70.13  ? 76  ASP A N   1 
ATOM   589  C CA  . ASP A 1 76  ? -29.713 1.941  10.057  1.00 69.61  ? 76  ASP A CA  1 
ATOM   590  C C   . ASP A 1 76  ? -28.888 3.202  10.305  1.00 67.04  ? 76  ASP A C   1 
ATOM   591  O O   . ASP A 1 76  ? -29.158 3.940  11.249  1.00 68.68  ? 76  ASP A O   1 
ATOM   592  C CB  . ASP A 1 76  ? -30.378 1.509  11.365  1.00 126.53 ? 76  ASP A CB  1 
ATOM   593  C CG  . ASP A 1 76  ? -31.322 0.340  11.177  1.00 129.37 ? 76  ASP A CG  1 
ATOM   594  O OD1 . ASP A 1 76  ? -32.311 0.486  10.428  1.00 130.65 ? 76  ASP A OD1 1 
ATOM   595  O OD2 . ASP A 1 76  ? -31.073 -0.727 11.776  1.00 130.72 ? 76  ASP A OD2 1 
ATOM   596  N N   . LYS A 1 77  ? -27.895 3.462  9.463   1.00 54.50  ? 77  LYS A N   1 
ATOM   597  C CA  . LYS A 1 77  ? -27.068 4.651  9.642   1.00 49.88  ? 77  LYS A CA  1 
ATOM   598  C C   . LYS A 1 77  ? -26.496 5.188  8.335   1.00 44.52  ? 77  LYS A C   1 
ATOM   599  O O   . LYS A 1 77  ? -25.955 4.434  7.528   1.00 40.99  ? 77  LYS A O   1 
ATOM   600  C CB  . LYS A 1 77  ? -25.914 4.352  10.603  1.00 107.02 ? 77  LYS A CB  1 
ATOM   601  C CG  . LYS A 1 77  ? -24.938 5.507  10.769  1.00 109.99 ? 77  LYS A CG  1 
ATOM   602  C CD  . LYS A 1 77  ? -23.739 5.114  11.615  1.00 113.62 ? 77  LYS A CD  1 
ATOM   603  C CE  . LYS A 1 77  ? -22.751 6.265  11.735  1.00 114.45 ? 77  LYS A CE  1 
ATOM   604  N NZ  . LYS A 1 77  ? -21.565 5.896  12.556  1.00 115.69 ? 77  LYS A NZ  1 
ATOM   605  N N   . PRO A 1 78  ? -26.618 6.507  8.108   1.00 41.94  ? 78  PRO A N   1 
ATOM   606  C CA  . PRO A 1 78  ? -26.089 7.111  6.880   1.00 38.33  ? 78  PRO A CA  1 
ATOM   607  C C   . PRO A 1 78  ? -24.633 6.678  6.725   1.00 36.02  ? 78  PRO A C   1 
ATOM   608  O O   . PRO A 1 78  ? -23.838 6.792  7.659   1.00 35.21  ? 78  PRO A O   1 
ATOM   609  C CB  . PRO A 1 78  ? -26.235 8.601  7.148   1.00 44.81  ? 78  PRO A CB  1 
ATOM   610  C CG  . PRO A 1 78  ? -27.503 8.652  7.964   1.00 44.40  ? 78  PRO A CG  1 
ATOM   611  C CD  . PRO A 1 78  ? -27.306 7.512  8.938   1.00 45.91  ? 78  PRO A CD  1 
ATOM   612  N N   . THR A 1 79  ? -24.282 6.175  5.549   1.00 37.98  ? 79  THR A N   1 
ATOM   613  C CA  . THR A 1 79  ? -22.928 5.701  5.336   1.00 37.61  ? 79  THR A CA  1 
ATOM   614  C C   . THR A 1 79  ? -22.323 6.105  3.999   1.00 34.41  ? 79  THR A C   1 
ATOM   615  O O   . THR A 1 79  ? -23.017 6.195  2.983   1.00 35.65  ? 79  THR A O   1 
ATOM   616  C CB  . THR A 1 79  ? -22.883 4.167  5.477   1.00 48.60  ? 79  THR A CB  1 
ATOM   617  O OG1 . THR A 1 79  ? -23.241 3.814  6.817   1.00 53.16  ? 79  THR A OG1 1 
ATOM   618  C CG2 . THR A 1 79  ? -21.497 3.631  5.176   1.00 50.58  ? 79  THR A CG2 1 
ATOM   619  N N   . LEU A 1 80  ? -21.017 6.357  4.025   1.00 32.31  ? 80  LEU A N   1 
ATOM   620  C CA  . LEU A 1 80  ? -20.278 6.745  2.839   1.00 31.39  ? 80  LEU A CA  1 
ATOM   621  C C   . LEU A 1 80  ? -19.636 5.500  2.239   1.00 31.36  ? 80  LEU A C   1 
ATOM   622  O O   . LEU A 1 80  ? -19.048 4.687  2.955   1.00 31.46  ? 80  LEU A O   1 
ATOM   623  C CB  . LEU A 1 80  ? -19.181 7.752  3.199   1.00 30.28  ? 80  LEU A CB  1 
ATOM   624  C CG  . LEU A 1 80  ? -18.356 8.293  2.020   1.00 31.23  ? 80  LEU A CG  1 
ATOM   625  C CD1 . LEU A 1 80  ? -19.241 9.169  1.143   1.00 27.55  ? 80  LEU A CD1 1 
ATOM   626  C CD2 . LEU A 1 80  ? -17.177 9.099  2.527   1.00 28.79  ? 80  LEU A CD2 1 
ATOM   627  N N   . GLN A 1 81  ? -19.759 5.342  0.929   1.00 31.24  ? 81  GLN A N   1 
ATOM   628  C CA  . GLN A 1 81  ? -19.151 4.199  0.263   1.00 31.87  ? 81  GLN A CA  1 
ATOM   629  C C   . GLN A 1 81  ? -18.744 4.552  -1.156  1.00 30.35  ? 81  GLN A C   1 
ATOM   630  O O   . GLN A 1 81  ? -19.247 5.519  -1.731  1.00 30.44  ? 81  GLN A O   1 
ATOM   631  C CB  . GLN A 1 81  ? -20.131 3.026  0.200   1.00 40.05  ? 81  GLN A CB  1 
ATOM   632  C CG  . GLN A 1 81  ? -21.372 3.323  -0.624  1.00 43.63  ? 81  GLN A CG  1 
ATOM   633  C CD  . GLN A 1 81  ? -22.197 2.084  -0.929  1.00 47.83  ? 81  GLN A CD  1 
ATOM   634  O OE1 . GLN A 1 81  ? -22.321 1.186  -0.094  1.00 48.90  ? 81  GLN A OE1 1 
ATOM   635  N NE2 . GLN A 1 81  ? -22.782 2.038  -2.126  1.00 48.17  ? 81  GLN A NE2 1 
ATOM   636  N N   . LEU A 1 82  ? -17.814 3.774  -1.705  1.00 27.99  ? 82  LEU A N   1 
ATOM   637  C CA  . LEU A 1 82  ? -17.388 3.940  -3.091  1.00 27.47  ? 82  LEU A CA  1 
ATOM   638  C C   . LEU A 1 82  ? -18.277 2.962  -3.828  1.00 26.91  ? 82  LEU A C   1 
ATOM   639  O O   . LEU A 1 82  ? -18.357 1.796  -3.451  1.00 27.13  ? 82  LEU A O   1 
ATOM   640  C CB  . LEU A 1 82  ? -15.927 3.546  -3.278  1.00 35.78  ? 82  LEU A CB  1 
ATOM   641  C CG  . LEU A 1 82  ? -14.932 4.685  -3.115  1.00 35.80  ? 82  LEU A CG  1 
ATOM   642  C CD1 . LEU A 1 82  ? -15.276 5.776  -4.121  1.00 36.09  ? 82  LEU A CD1 1 
ATOM   643  C CD2 . LEU A 1 82  ? -14.980 5.222  -1.687  1.00 36.17  ? 82  LEU A CD2 1 
ATOM   644  N N   . GLU A 1 83  ? -18.941 3.430  -4.877  1.00 25.37  ? 83  GLU A N   1 
ATOM   645  C CA  . GLU A 1 83  ? -19.860 2.591  -5.632  1.00 25.14  ? 83  GLU A CA  1 
ATOM   646  C C   . GLU A 1 83  ? -19.498 2.498  -7.115  1.00 26.34  ? 83  GLU A C   1 
ATOM   647  O O   . GLU A 1 83  ? -19.115 3.493  -7.726  1.00 24.59  ? 83  GLU A O   1 
ATOM   648  C CB  . GLU A 1 83  ? -21.280 3.155  -5.489  1.00 35.17  ? 83  GLU A CB  1 
ATOM   649  C CG  . GLU A 1 83  ? -22.365 2.287  -6.093  1.00 41.21  ? 83  GLU A CG  1 
ATOM   650  C CD  . GLU A 1 83  ? -23.742 2.922  -6.026  1.00 41.83  ? 83  GLU A CD  1 
ATOM   651  O OE1 . GLU A 1 83  ? -24.107 3.481  -4.968  1.00 42.92  ? 83  GLU A OE1 1 
ATOM   652  O OE2 . GLU A 1 83  ? -24.466 2.847  -7.037  1.00 45.86  ? 83  GLU A OE2 1 
ATOM   653  N N   . SER A 1 84  ? -19.644 1.298  -7.681  1.00 27.46  ? 84  SER A N   1 
ATOM   654  C CA  . SER A 1 84  ? -19.365 1.038  -9.092  1.00 27.62  ? 84  SER A CA  1 
ATOM   655  C C   . SER A 1 84  ? -20.582 1.416  -9.925  1.00 27.94  ? 84  SER A C   1 
ATOM   656  O O   . SER A 1 84  ? -21.707 1.105  -9.555  1.00 27.50  ? 84  SER A O   1 
ATOM   657  C CB  . SER A 1 84  ? -19.076 -0.454 -9.328  1.00 37.92  ? 84  SER A CB  1 
ATOM   658  O OG  . SER A 1 84  ? -17.909 -0.893 -8.654  1.00 41.28  ? 84  SER A OG  1 
ATOM   659  N N   . VAL A 1 85  ? -20.356 2.083  -11.051 1.00 28.80  ? 85  VAL A N   1 
ATOM   660  C CA  . VAL A 1 85  ? -21.453 2.462  -11.932 1.00 30.49  ? 85  VAL A CA  1 
ATOM   661  C C   . VAL A 1 85  ? -21.132 2.002  -13.352 1.00 31.05  ? 85  VAL A C   1 
ATOM   662  O O   . VAL A 1 85  ? -19.986 1.670  -13.658 1.00 28.99  ? 85  VAL A O   1 
ATOM   663  C CB  . VAL A 1 85  ? -21.683 4.002  -11.935 1.00 26.75  ? 85  VAL A CB  1 
ATOM   664  C CG1 . VAL A 1 85  ? -21.965 4.490  -10.527 1.00 24.12  ? 85  VAL A CG1 1 
ATOM   665  C CG2 . VAL A 1 85  ? -20.482 4.716  -12.517 1.00 23.20  ? 85  VAL A CG2 1 
ATOM   666  N N   . ASP A 1 86  ? -22.146 1.959  -14.212 1.00 39.79  ? 86  ASP A N   1 
ATOM   667  C CA  . ASP A 1 86  ? -21.937 1.567  -15.603 1.00 41.83  ? 86  ASP A CA  1 
ATOM   668  C C   . ASP A 1 86  ? -21.055 2.666  -16.197 1.00 42.59  ? 86  ASP A C   1 
ATOM   669  O O   . ASP A 1 86  ? -21.452 3.828  -16.243 1.00 42.64  ? 86  ASP A O   1 
ATOM   670  C CB  . ASP A 1 86  ? -23.277 1.498  -16.339 1.00 57.11  ? 86  ASP A CB  1 
ATOM   671  C CG  . ASP A 1 86  ? -23.138 0.973  -17.751 1.00 60.18  ? 86  ASP A CG  1 
ATOM   672  O OD1 . ASP A 1 86  ? -22.394 1.589  -18.543 1.00 62.08  ? 86  ASP A OD1 1 
ATOM   673  O OD2 . ASP A 1 86  ? -23.771 -0.057 -18.065 1.00 62.17  ? 86  ASP A OD2 1 
ATOM   674  N N   . PRO A 1 87  ? -19.845 2.306  -16.662 1.00 36.16  ? 87  PRO A N   1 
ATOM   675  C CA  . PRO A 1 87  ? -18.887 3.250  -17.243 1.00 36.75  ? 87  PRO A CA  1 
ATOM   676  C C   . PRO A 1 87  ? -19.346 3.963  -18.511 1.00 39.06  ? 87  PRO A C   1 
ATOM   677  O O   . PRO A 1 87  ? -18.686 4.891  -18.980 1.00 37.88  ? 87  PRO A O   1 
ATOM   678  C CB  . PRO A 1 87  ? -17.655 2.381  -17.473 1.00 38.86  ? 87  PRO A CB  1 
ATOM   679  C CG  . PRO A 1 87  ? -18.260 1.067  -17.850 1.00 38.86  ? 87  PRO A CG  1 
ATOM   680  C CD  . PRO A 1 87  ? -19.374 0.916  -16.832 1.00 37.86  ? 87  PRO A CD  1 
ATOM   681  N N   . LYS A 1 88  ? -20.478 3.532  -19.053 1.00 45.01  ? 88  LYS A N   1 
ATOM   682  C CA  . LYS A 1 88  ? -21.024 4.126  -20.264 1.00 48.80  ? 88  LYS A CA  1 
ATOM   683  C C   . LYS A 1 88  ? -21.989 5.262  -19.957 1.00 49.66  ? 88  LYS A C   1 
ATOM   684  O O   . LYS A 1 88  ? -21.995 6.277  -20.649 1.00 51.52  ? 88  LYS A O   1 
ATOM   685  C CB  . LYS A 1 88  ? -21.749 3.061  -21.091 1.00 99.03  ? 88  LYS A CB  1 
ATOM   686  C CG  . LYS A 1 88  ? -20.872 1.911  -21.571 1.00 103.43 ? 88  LYS A CG  1 
ATOM   687  C CD  . LYS A 1 88  ? -20.026 2.289  -22.784 1.00 106.11 ? 88  LYS A CD  1 
ATOM   688  C CE  . LYS A 1 88  ? -18.922 3.279  -22.443 1.00 110.08 ? 88  LYS A CE  1 
ATOM   689  N NZ  . LYS A 1 88  ? -17.946 2.713  -21.471 1.00 112.41 ? 88  LYS A NZ  1 
ATOM   690  N N   . ASN A 1 89  ? -22.790 5.097  -18.907 1.00 50.14  ? 89  ASN A N   1 
ATOM   691  C CA  . ASN A 1 89  ? -23.786 6.098  -18.534 1.00 50.80  ? 89  ASN A CA  1 
ATOM   692  C C   . ASN A 1 89  ? -23.339 7.200  -17.572 1.00 50.18  ? 89  ASN A C   1 
ATOM   693  O O   . ASN A 1 89  ? -24.133 8.081  -17.220 1.00 50.71  ? 89  ASN A O   1 
ATOM   694  C CB  . ASN A 1 89  ? -25.008 5.392  -17.956 1.00 73.01  ? 89  ASN A CB  1 
ATOM   695  C CG  . ASN A 1 89  ? -25.526 4.306  -18.867 1.00 75.33  ? 89  ASN A CG  1 
ATOM   696  O OD1 . ASN A 1 89  ? -25.834 4.558  -20.031 1.00 76.55  ? 89  ASN A OD1 1 
ATOM   697  N ND2 . ASN A 1 89  ? -25.622 3.088  -18.346 1.00 77.16  ? 89  ASN A ND2 1 
ATOM   698  N N   . TYR A 1 90  ? -22.080 7.159  -17.148 1.00 45.78  ? 90  TYR A N   1 
ATOM   699  C CA  . TYR A 1 90  ? -21.567 8.161  -16.222 1.00 43.92  ? 90  TYR A CA  1 
ATOM   700  C C   . TYR A 1 90  ? -20.293 8.827  -16.697 1.00 43.02  ? 90  TYR A C   1 
ATOM   701  O O   . TYR A 1 90  ? -19.478 8.214  -17.381 1.00 44.50  ? 90  TYR A O   1 
ATOM   702  C CB  . TYR A 1 90  ? -21.329 7.542  -14.843 1.00 41.13  ? 90  TYR A CB  1 
ATOM   703  C CG  . TYR A 1 90  ? -22.604 7.166  -14.136 1.00 39.49  ? 90  TYR A CG  1 
ATOM   704  C CD1 . TYR A 1 90  ? -23.302 6.005  -14.479 1.00 38.70  ? 90  TYR A CD1 1 
ATOM   705  C CD2 . TYR A 1 90  ? -23.130 7.985  -13.140 1.00 38.14  ? 90  TYR A CD2 1 
ATOM   706  C CE1 . TYR A 1 90  ? -24.497 5.670  -13.840 1.00 38.66  ? 90  TYR A CE1 1 
ATOM   707  C CE2 . TYR A 1 90  ? -24.321 7.662  -12.498 1.00 38.37  ? 90  TYR A CE2 1 
ATOM   708  C CZ  . TYR A 1 90  ? -24.997 6.504  -12.850 1.00 39.16  ? 90  TYR A CZ  1 
ATOM   709  O OH  . TYR A 1 90  ? -26.166 6.184  -12.199 1.00 40.39  ? 90  TYR A OH  1 
ATOM   710  N N   . PRO A 1 91  ? -20.095 10.098 -16.317 1.00 47.36  ? 91  PRO A N   1 
ATOM   711  C CA  . PRO A 1 91  ? -21.021 10.870 -15.479 1.00 47.55  ? 91  PRO A CA  1 
ATOM   712  C C   . PRO A 1 91  ? -22.181 11.466 -16.271 1.00 48.06  ? 91  PRO A C   1 
ATOM   713  O O   . PRO A 1 91  ? -22.204 11.394 -17.496 1.00 49.91  ? 91  PRO A O   1 
ATOM   714  C CB  . PRO A 1 91  ? -20.118 11.945 -14.889 1.00 34.94  ? 91  PRO A CB  1 
ATOM   715  C CG  . PRO A 1 91  ? -19.221 12.261 -16.049 1.00 34.44  ? 91  PRO A CG  1 
ATOM   716  C CD  . PRO A 1 91  ? -18.874 10.876 -16.602 1.00 34.25  ? 91  PRO A CD  1 
ATOM   717  N N   . LYS A 1 92  ? -23.142 12.055 -15.568 1.00 45.71  ? 92  LYS A N   1 
ATOM   718  C CA  . LYS A 1 92  ? -24.288 12.674 -16.224 1.00 46.43  ? 92  LYS A CA  1 
ATOM   719  C C   . LYS A 1 92  ? -24.805 13.848 -15.400 1.00 46.63  ? 92  LYS A C   1 
ATOM   720  O O   . LYS A 1 92  ? -24.637 13.878 -14.181 1.00 44.47  ? 92  LYS A O   1 
ATOM   721  C CB  . LYS A 1 92  ? -25.401 11.642 -16.445 1.00 57.28  ? 92  LYS A CB  1 
ATOM   722  C CG  . LYS A 1 92  ? -25.931 10.989 -15.181 1.00 57.15  ? 92  LYS A CG  1 
ATOM   723  C CD  . LYS A 1 92  ? -26.906 9.867  -15.517 1.00 55.61  ? 92  LYS A CD  1 
ATOM   724  C CE  . LYS A 1 92  ? -27.511 9.268  -14.260 1.00 56.15  ? 92  LYS A CE  1 
ATOM   725  N NZ  . LYS A 1 92  ? -28.353 8.077  -14.553 1.00 56.69  ? 92  LYS A NZ  1 
ATOM   726  N N   . LYS A 1 93  ? -25.427 14.815 -16.072 1.00 49.30  ? 93  LYS A N   1 
ATOM   727  C CA  . LYS A 1 93  ? -25.954 16.002 -15.404 1.00 51.13  ? 93  LYS A CA  1 
ATOM   728  C C   . LYS A 1 93  ? -26.903 15.689 -14.256 1.00 50.28  ? 93  LYS A C   1 
ATOM   729  O O   . LYS A 1 93  ? -26.842 16.327 -13.204 1.00 49.64  ? 93  LYS A O   1 
ATOM   730  C CB  . LYS A 1 93  ? -26.667 16.911 -16.407 1.00 102.44 ? 93  LYS A CB  1 
ATOM   731  C CG  . LYS A 1 93  ? -25.735 17.657 -17.343 1.00 107.08 ? 93  LYS A CG  1 
ATOM   732  C CD  . LYS A 1 93  ? -26.487 18.695 -18.168 1.00 111.22 ? 93  LYS A CD  1 
ATOM   733  C CE  . LYS A 1 93  ? -27.189 19.719 -17.280 1.00 113.60 ? 93  LYS A CE  1 
ATOM   734  N NZ  . LYS A 1 93  ? -26.244 20.425 -16.366 1.00 114.00 ? 93  LYS A NZ  1 
ATOM   735  N N   . LYS A 1 94  ? -27.781 14.714 -14.465 1.00 44.17  ? 94  LYS A N   1 
ATOM   736  C CA  . LYS A 1 94  ? -28.749 14.323 -13.447 1.00 43.73  ? 94  LYS A CA  1 
ATOM   737  C C   . LYS A 1 94  ? -28.342 13.018 -12.765 1.00 41.74  ? 94  LYS A C   1 
ATOM   738  O O   . LYS A 1 94  ? -28.766 11.935 -13.167 1.00 40.20  ? 94  LYS A O   1 
ATOM   739  C CB  . LYS A 1 94  ? -30.137 14.168 -14.076 1.00 109.09 ? 94  LYS A CB  1 
ATOM   740  C CG  . LYS A 1 94  ? -31.232 13.767 -13.095 1.00 115.33 ? 94  LYS A CG  1 
ATOM   741  C CD  . LYS A 1 94  ? -31.457 14.820 -12.014 1.00 119.06 ? 94  LYS A CD  1 
ATOM   742  C CE  . LYS A 1 94  ? -32.099 16.089 -12.567 1.00 122.05 ? 94  LYS A CE  1 
ATOM   743  N NZ  . LYS A 1 94  ? -31.231 16.814 -13.535 1.00 121.71 ? 94  LYS A NZ  1 
ATOM   744  N N   . MET A 1 95  ? -27.512 13.133 -11.734 1.00 42.87  ? 95  MET A N   1 
ATOM   745  C CA  . MET A 1 95  ? -27.042 11.978 -10.983 1.00 39.88  ? 95  MET A CA  1 
ATOM   746  C C   . MET A 1 95  ? -28.073 11.639 -9.913  1.00 38.85  ? 95  MET A C   1 
ATOM   747  O O   . MET A 1 95  ? -28.799 12.515 -9.445  1.00 38.28  ? 95  MET A O   1 
ATOM   748  C CB  . MET A 1 95  ? -25.705 12.293 -10.300 1.00 42.76  ? 95  MET A CB  1 
ATOM   749  C CG  . MET A 1 95  ? -24.517 12.514 -11.228 1.00 41.82  ? 95  MET A CG  1 
ATOM   750  S SD  . MET A 1 95  ? -23.789 10.982 -11.841 1.00 42.19  ? 95  MET A SD  1 
ATOM   751  C CE  . MET A 1 95  ? -22.796 10.474 -10.424 1.00 38.76  ? 95  MET A CE  1 
ATOM   752  N N   . GLU A 1 96  ? -28.140 10.370 -9.528  1.00 36.84  ? 96  GLU A N   1 
ATOM   753  C CA  . GLU A 1 96  ? -29.067 9.957  -8.486  1.00 37.38  ? 96  GLU A CA  1 
ATOM   754  C C   . GLU A 1 96  ? -28.661 10.729 -7.230  1.00 35.73  ? 96  GLU A C   1 
ATOM   755  O O   . GLU A 1 96  ? -27.488 11.057 -7.052  1.00 35.99  ? 96  GLU A O   1 
ATOM   756  C CB  . GLU A 1 96  ? -28.963 8.448  -8.243  1.00 48.52  ? 96  GLU A CB  1 
ATOM   757  C CG  . GLU A 1 96  ? -29.355 7.571  -9.437  1.00 52.65  ? 96  GLU A CG  1 
ATOM   758  C CD  . GLU A 1 96  ? -28.426 7.727  -10.636 1.00 56.08  ? 96  GLU A CD  1 
ATOM   759  O OE1 . GLU A 1 96  ? -27.197 7.842  -10.438 1.00 59.30  ? 96  GLU A OE1 1 
ATOM   760  O OE2 . GLU A 1 96  ? -28.919 7.718  -11.782 1.00 59.19  ? 96  GLU A OE2 1 
ATOM   761  N N   . LYS A 1 97  ? -29.631 11.010 -6.365  1.00 34.40  ? 97  LYS A N   1 
ATOM   762  C CA  . LYS A 1 97  ? -29.420 11.777 -5.139  1.00 31.88  ? 97  LYS A CA  1 
ATOM   763  C C   . LYS A 1 97  ? -28.331 11.264 -4.189  1.00 30.30  ? 97  LYS A C   1 
ATOM   764  O O   . LYS A 1 97  ? -27.686 12.053 -3.495  1.00 28.02  ? 97  LYS A O   1 
ATOM   765  C CB  . LYS A 1 97  ? -30.746 11.878 -4.377  1.00 64.01  ? 97  LYS A CB  1 
ATOM   766  C CG  . LYS A 1 97  ? -30.709 12.741 -3.123  1.00 68.76  ? 97  LYS A CG  1 
ATOM   767  C CD  . LYS A 1 97  ? -31.271 14.133 -3.373  1.00 74.71  ? 97  LYS A CD  1 
ATOM   768  C CE  . LYS A 1 97  ? -31.336 14.935 -2.078  1.00 79.90  ? 97  LYS A CE  1 
ATOM   769  N NZ  . LYS A 1 97  ? -31.939 16.286 -2.264  1.00 84.13  ? 97  LYS A NZ  1 
ATOM   770  N N   . ARG A 1 98  ? -28.127 9.954  -4.143  1.00 27.62  ? 98  ARG A N   1 
ATOM   771  C CA  . ARG A 1 98  ? -27.126 9.402  -3.241  1.00 27.29  ? 98  ARG A CA  1 
ATOM   772  C C   . ARG A 1 98  ? -25.688 9.770  -3.617  1.00 25.43  ? 98  ARG A C   1 
ATOM   773  O O   . ARG A 1 98  ? -24.796 9.731  -2.768  1.00 23.49  ? 98  ARG A O   1 
ATOM   774  C CB  . ARG A 1 98  ? -27.278 7.877  -3.142  1.00 33.18  ? 98  ARG A CB  1 
ATOM   775  C CG  . ARG A 1 98  ? -27.112 7.100  -4.448  1.00 34.41  ? 98  ARG A CG  1 
ATOM   776  C CD  . ARG A 1 98  ? -27.114 5.605  -4.157  1.00 36.09  ? 98  ARG A CD  1 
ATOM   777  N NE  . ARG A 1 98  ? -26.731 4.804  -5.315  1.00 36.66  ? 98  ARG A NE  1 
ATOM   778  C CZ  . ARG A 1 98  ? -27.488 4.621  -6.392  1.00 36.27  ? 98  ARG A CZ  1 
ATOM   779  N NH1 . ARG A 1 98  ? -28.687 5.182  -6.471  1.00 36.36  ? 98  ARG A NH1 1 
ATOM   780  N NH2 . ARG A 1 98  ? -27.044 3.872  -7.392  1.00 33.76  ? 98  ARG A NH2 1 
ATOM   781  N N   . PHE A 1 99  ? -25.474 10.133 -4.882  1.00 25.87  ? 99  PHE A N   1 
ATOM   782  C CA  . PHE A 1 99  ? -24.154 10.520 -5.387  1.00 25.31  ? 99  PHE A CA  1 
ATOM   783  C C   . PHE A 1 99  ? -23.915 12.025 -5.237  1.00 25.30  ? 99  PHE A C   1 
ATOM   784  O O   . PHE A 1 99  ? -22.801 12.501 -5.464  1.00 23.39  ? 99  PHE A O   1 
ATOM   785  C CB  . PHE A 1 99  ? -24.028 10.205 -6.891  1.00 29.09  ? 99  PHE A CB  1 
ATOM   786  C CG  . PHE A 1 99  ? -24.023 8.736  -7.227  1.00 29.86  ? 99  PHE A CG  1 
ATOM   787  C CD1 . PHE A 1 99  ? -22.978 7.909  -6.805  1.00 27.93  ? 99  PHE A CD1 1 
ATOM   788  C CD2 . PHE A 1 99  ? -25.055 8.184  -7.987  1.00 27.35  ? 99  PHE A CD2 1 
ATOM   789  C CE1 . PHE A 1 99  ? -22.964 6.556  -7.135  1.00 28.45  ? 99  PHE A CE1 1 
ATOM   790  C CE2 . PHE A 1 99  ? -25.050 6.829  -8.324  1.00 29.14  ? 99  PHE A CE2 1 
ATOM   791  C CZ  . PHE A 1 99  ? -24.003 6.010  -7.898  1.00 27.36  ? 99  PHE A CZ  1 
ATOM   792  N N   . VAL A 1 100 ? -24.962 12.772 -4.881  1.00 25.34  ? 100 VAL A N   1 
ATOM   793  C CA  . VAL A 1 100 ? -24.864 14.230 -4.787  1.00 24.91  ? 100 VAL A CA  1 
ATOM   794  C C   . VAL A 1 100 ? -24.452 14.797 -3.442  1.00 23.92  ? 100 VAL A C   1 
ATOM   795  O O   . VAL A 1 100 ? -24.974 14.412 -2.389  1.00 24.02  ? 100 VAL A O   1 
ATOM   796  C CB  . VAL A 1 100 ? -26.216 14.900 -5.223  1.00 26.48  ? 100 VAL A CB  1 
ATOM   797  C CG1 . VAL A 1 100 ? -26.115 16.428 -5.175  1.00 25.24  ? 100 VAL A CG1 1 
ATOM   798  C CG2 . VAL A 1 100 ? -26.582 14.449 -6.628  1.00 22.80  ? 100 VAL A CG2 1 
ATOM   799  N N   . PHE A 1 101 ? -23.488 15.710 -3.491  1.00 23.92  ? 101 PHE A N   1 
ATOM   800  C CA  . PHE A 1 101 ? -22.997 16.393 -2.305  1.00 23.86  ? 101 PHE A CA  1 
ATOM   801  C C   . PHE A 1 101 ? -23.079 17.897 -2.561  1.00 25.48  ? 101 PHE A C   1 
ATOM   802  O O   . PHE A 1 101 ? -22.884 18.370 -3.688  1.00 25.39  ? 101 PHE A O   1 
ATOM   803  C CB  . PHE A 1 101 ? -21.531 16.045 -2.011  1.00 26.86  ? 101 PHE A CB  1 
ATOM   804  C CG  . PHE A 1 101 ? -21.309 14.618 -1.632  1.00 27.45  ? 101 PHE A CG  1 
ATOM   805  C CD1 . PHE A 1 101 ? -21.192 13.632 -2.610  1.00 24.14  ? 101 PHE A CD1 1 
ATOM   806  C CD2 . PHE A 1 101 ? -21.243 14.247 -0.290  1.00 23.93  ? 101 PHE A CD2 1 
ATOM   807  C CE1 . PHE A 1 101 ? -21.011 12.293 -2.246  1.00 26.84  ? 101 PHE A CE1 1 
ATOM   808  C CE2 . PHE A 1 101 ? -21.065 12.916 0.075   1.00 20.45  ? 101 PHE A CE2 1 
ATOM   809  C CZ  . PHE A 1 101 ? -20.948 11.938 -0.902  1.00 21.52  ? 101 PHE A CZ  1 
ATOM   810  N N   . ASN A 1 102 ? -23.364 18.648 -1.510  1.00 29.39  ? 102 ASN A N   1 
ATOM   811  C CA  . ASN A 1 102 ? -23.418 20.088 -1.626  1.00 29.32  ? 102 ASN A CA  1 
ATOM   812  C C   . ASN A 1 102 ? -22.048 20.618 -1.211  1.00 29.76  ? 102 ASN A C   1 
ATOM   813  O O   . ASN A 1 102 ? -21.654 20.498 -0.048  1.00 27.68  ? 102 ASN A O   1 
ATOM   814  C CB  . ASN A 1 102 ? -24.501 20.641 -0.707  1.00 27.83  ? 102 ASN A CB  1 
ATOM   815  C CG  . ASN A 1 102 ? -25.892 20.235 -1.144  1.00 29.86  ? 102 ASN A CG  1 
ATOM   816  O OD1 . ASN A 1 102 ? -26.769 20.001 -0.311  1.00 30.89  ? 102 ASN A OD1 1 
ATOM   817  N ND2 . ASN A 1 102 ? -26.107 20.158 -2.455  1.00 24.64  ? 102 ASN A ND2 1 
ATOM   818  N N   . LYS A 1 103 ? -21.311 21.170 -2.170  1.00 26.41  ? 103 LYS A N   1 
ATOM   819  C CA  . LYS A 1 103 ? -20.005 21.733 -1.879  1.00 28.75  ? 103 LYS A CA  1 
ATOM   820  C C   . LYS A 1 103 ? -20.252 23.107 -1.256  1.00 31.66  ? 103 LYS A C   1 
ATOM   821  O O   . LYS A 1 103 ? -20.876 23.979 -1.862  1.00 31.02  ? 103 LYS A O   1 
ATOM   822  C CB  . LYS A 1 103 ? -19.172 21.864 -3.158  1.00 28.72  ? 103 LYS A CB  1 
ATOM   823  C CG  . LYS A 1 103 ? -17.762 22.381 -2.917  1.00 25.29  ? 103 LYS A CG  1 
ATOM   824  C CD  . LYS A 1 103 ? -16.891 22.260 -4.161  1.00 29.61  ? 103 LYS A CD  1 
ATOM   825  C CE  . LYS A 1 103 ? -17.358 23.188 -5.299  1.00 28.25  ? 103 LYS A CE  1 
ATOM   826  N NZ  . LYS A 1 103 ? -17.152 24.627 -4.949  1.00 32.19  ? 103 LYS A NZ  1 
ATOM   827  N N   . ILE A 1 104 ? -19.763 23.281 -0.035  1.00 30.22  ? 104 ILE A N   1 
ATOM   828  C CA  . ILE A 1 104 ? -19.938 24.516 0.716   1.00 34.32  ? 104 ILE A CA  1 
ATOM   829  C C   . ILE A 1 104 ? -18.596 25.189 0.991   1.00 39.23  ? 104 ILE A C   1 
ATOM   830  O O   . ILE A 1 104 ? -17.613 24.521 1.324   1.00 38.24  ? 104 ILE A O   1 
ATOM   831  C CB  . ILE A 1 104 ? -20.629 24.216 2.066   1.00 37.52  ? 104 ILE A CB  1 
ATOM   832  C CG1 . ILE A 1 104 ? -21.963 23.504 1.813   1.00 36.15  ? 104 ILE A CG1 1 
ATOM   833  C CG2 . ILE A 1 104 ? -20.811 25.502 2.863   1.00 37.98  ? 104 ILE A CG2 1 
ATOM   834  C CD1 . ILE A 1 104 ? -22.640 22.989 3.066   1.00 38.57  ? 104 ILE A CD1 1 
ATOM   835  N N   . GLU A 1 105 ? -18.562 26.512 0.858   1.00 52.02  ? 105 GLU A N   1 
ATOM   836  C CA  . GLU A 1 105 ? -17.344 27.277 1.107   1.00 58.87  ? 105 GLU A CA  1 
ATOM   837  C C   . GLU A 1 105 ? -17.550 28.249 2.259   1.00 62.17  ? 105 GLU A C   1 
ATOM   838  O O   . GLU A 1 105 ? -18.381 29.153 2.179   1.00 62.75  ? 105 GLU A O   1 
ATOM   839  C CB  . GLU A 1 105 ? -16.936 28.056 -0.142  1.00 73.45  ? 105 GLU A CB  1 
ATOM   840  C CG  . GLU A 1 105 ? -16.757 27.188 -1.365  1.00 79.27  ? 105 GLU A CG  1 
ATOM   841  C CD  . GLU A 1 105 ? -16.203 27.954 -2.544  1.00 83.71  ? 105 GLU A CD  1 
ATOM   842  O OE1 . GLU A 1 105 ? -16.806 28.982 -2.923  1.00 85.00  ? 105 GLU A OE1 1 
ATOM   843  O OE2 . GLU A 1 105 ? -15.165 27.526 -3.094  1.00 85.95  ? 105 GLU A OE2 1 
ATOM   844  N N   . ILE A 1 106 ? -16.798 28.053 3.335   1.00 101.21 ? 106 ILE A N   1 
ATOM   845  C CA  . ILE A 1 106 ? -16.892 28.924 4.498   1.00 105.41 ? 106 ILE A CA  1 
ATOM   846  C C   . ILE A 1 106 ? -15.676 29.848 4.535   1.00 107.48 ? 106 ILE A C   1 
ATOM   847  O O   . ILE A 1 106 ? -15.590 30.791 3.747   1.00 108.77 ? 106 ILE A O   1 
ATOM   848  C CB  . ILE A 1 106 ? -16.992 28.093 5.804   1.00 128.47 ? 106 ILE A CB  1 
ATOM   849  C CG1 . ILE A 1 106 ? -16.006 26.921 5.763   1.00 129.90 ? 106 ILE A CG1 1 
ATOM   850  C CG2 . ILE A 1 106 ? -18.416 27.582 5.980   1.00 128.14 ? 106 ILE A CG2 1 
ATOM   851  C CD1 . ILE A 1 106 ? -16.087 25.998 6.965   1.00 131.81 ? 106 ILE A CD1 1 
ATOM   852  N N   . ASN A 1 107 ? -14.738 29.581 5.439   1.00 125.46 ? 107 ASN A N   1 
ATOM   853  C CA  . ASN A 1 107 ? -13.526 30.390 5.538   1.00 125.66 ? 107 ASN A CA  1 
ATOM   854  C C   . ASN A 1 107 ? -12.860 30.404 4.160   1.00 124.12 ? 107 ASN A C   1 
ATOM   855  O O   . ASN A 1 107 ? -13.122 31.283 3.339   1.00 125.51 ? 107 ASN A O   1 
ATOM   856  C CB  . ASN A 1 107 ? -12.579 29.780 6.578   1.00 137.25 ? 107 ASN A CB  1 
ATOM   857  C CG  . ASN A 1 107 ? -11.349 30.631 6.821   1.00 139.25 ? 107 ASN A CG  1 
ATOM   858  O OD1 . ASN A 1 107 ? -10.572 30.897 5.904   1.00 139.53 ? 107 ASN A OD1 1 
ATOM   859  N ND2 . ASN A 1 107 ? -11.164 31.061 8.065   1.00 138.82 ? 107 ASN A ND2 1 
ATOM   860  N N   . ASN A 1 108 ? -12.000 29.421 3.920   1.00 77.81  ? 108 ASN A N   1 
ATOM   861  C CA  . ASN A 1 108 ? -11.305 29.272 2.644   1.00 74.77  ? 108 ASN A CA  1 
ATOM   862  C C   . ASN A 1 108 ? -11.314 27.776 2.359   1.00 70.79  ? 108 ASN A C   1 
ATOM   863  O O   . ASN A 1 108 ? -10.754 27.299 1.371   1.00 70.71  ? 108 ASN A O   1 
ATOM   864  C CB  . ASN A 1 108 ? -9.864  29.777 2.751   1.00 159.41 ? 108 ASN A CB  1 
ATOM   865  C CG  . ASN A 1 108 ? -9.023  28.953 3.710   1.00 162.55 ? 108 ASN A CG  1 
ATOM   866  O OD1 . ASN A 1 108 ? -8.798  27.761 3.492   1.00 164.79 ? 108 ASN A OD1 1 
ATOM   867  N ND2 . ASN A 1 108 ? -8.554  29.585 4.779   1.00 163.59 ? 108 ASN A ND2 1 
ATOM   868  N N   . LYS A 1 109 ? -11.971 27.050 3.258   1.00 50.15  ? 109 LYS A N   1 
ATOM   869  C CA  . LYS A 1 109 ? -12.092 25.603 3.189   1.00 45.12  ? 109 LYS A CA  1 
ATOM   870  C C   . LYS A 1 109 ? -13.390 25.169 2.512   1.00 40.65  ? 109 LYS A C   1 
ATOM   871  O O   . LYS A 1 109 ? -14.278 25.981 2.228   1.00 38.94  ? 109 LYS A O   1 
ATOM   872  C CB  . LYS A 1 109 ? -12.056 25.015 4.601   1.00 64.47  ? 109 LYS A CB  1 
ATOM   873  C CG  . LYS A 1 109 ? -10.864 25.431 5.446   1.00 66.11  ? 109 LYS A CG  1 
ATOM   874  C CD  . LYS A 1 109 ? -9.604  24.672 5.072   1.00 69.23  ? 109 LYS A CD  1 
ATOM   875  C CE  . LYS A 1 109 ? -8.511  24.908 6.101   1.00 67.95  ? 109 LYS A CE  1 
ATOM   876  N NZ  . LYS A 1 109 ? -8.197  26.353 6.235   1.00 70.50  ? 109 LYS A NZ  1 
ATOM   877  N N   . LEU A 1 110 ? -13.500 23.867 2.283   1.00 40.20  ? 110 LEU A N   1 
ATOM   878  C CA  . LEU A 1 110 ? -14.674 23.298 1.649   1.00 35.40  ? 110 LEU A CA  1 
ATOM   879  C C   . LEU A 1 110 ? -15.295 22.255 2.561   1.00 33.48  ? 110 LEU A C   1 
ATOM   880  O O   . LEU A 1 110 ? -14.599 21.608 3.338   1.00 33.14  ? 110 LEU A O   1 
ATOM   881  C CB  . LEU A 1 110 ? -14.286 22.638 0.324   1.00 37.30  ? 110 LEU A CB  1 
ATOM   882  C CG  . LEU A 1 110 ? -13.674 23.524 -0.763  1.00 38.63  ? 110 LEU A CG  1 
ATOM   883  C CD1 . LEU A 1 110 ? -13.317 22.671 -1.966  1.00 37.55  ? 110 LEU A CD1 1 
ATOM   884  C CD2 . LEU A 1 110 ? -14.664 24.607 -1.158  1.00 39.55  ? 110 LEU A CD2 1 
ATOM   885  N N   . GLU A 1 111 ? -16.609 22.108 2.466   1.00 31.57  ? 111 GLU A N   1 
ATOM   886  C CA  . GLU A 1 111 ? -17.340 21.118 3.239   1.00 29.42  ? 111 GLU A CA  1 
ATOM   887  C C   . GLU A 1 111 ? -18.252 20.428 2.248   1.00 26.77  ? 111 GLU A C   1 
ATOM   888  O O   . GLU A 1 111 ? -18.789 21.062 1.338   1.00 25.14  ? 111 GLU A O   1 
ATOM   889  C CB  . GLU A 1 111 ? -18.188 21.766 4.339   1.00 32.05  ? 111 GLU A CB  1 
ATOM   890  C CG  . GLU A 1 111 ? -17.393 22.527 5.378   1.00 36.70  ? 111 GLU A CG  1 
ATOM   891  C CD  . GLU A 1 111 ? -18.258 23.025 6.527   1.00 37.78  ? 111 GLU A CD  1 
ATOM   892  O OE1 . GLU A 1 111 ? -19.385 23.496 6.265   1.00 38.09  ? 111 GLU A OE1 1 
ATOM   893  O OE2 . GLU A 1 111 ? -17.806 22.952 7.691   1.00 40.75  ? 111 GLU A OE2 1 
ATOM   894  N N   . PHE A 1 112 ? -18.412 19.125 2.410   1.00 31.68  ? 112 PHE A N   1 
ATOM   895  C CA  . PHE A 1 112 ? -19.267 18.371 1.516   1.00 30.25  ? 112 PHE A CA  1 
ATOM   896  C C   . PHE A 1 112 ? -20.400 17.783 2.313   1.00 31.32  ? 112 PHE A C   1 
ATOM   897  O O   . PHE A 1 112 ? -20.215 16.869 3.113   1.00 29.85  ? 112 PHE A O   1 
ATOM   898  C CB  . PHE A 1 112 ? -18.466 17.277 0.810   1.00 23.42  ? 112 PHE A CB  1 
ATOM   899  C CG  . PHE A 1 112 ? -17.401 17.822 -0.089  1.00 23.38  ? 112 PHE A CG  1 
ATOM   900  C CD1 . PHE A 1 112 ? -17.717 18.274 -1.370  1.00 23.32  ? 112 PHE A CD1 1 
ATOM   901  C CD2 . PHE A 1 112 ? -16.101 17.973 0.375   1.00 18.95  ? 112 PHE A CD2 1 
ATOM   902  C CE1 . PHE A 1 112 ? -16.748 18.875 -2.182  1.00 21.23  ? 112 PHE A CE1 1 
ATOM   903  C CE2 . PHE A 1 112 ? -15.131 18.570 -0.419  1.00 22.27  ? 112 PHE A CE2 1 
ATOM   904  C CZ  . PHE A 1 112 ? -15.456 19.026 -1.707  1.00 21.98  ? 112 PHE A CZ  1 
ATOM   905  N N   . GLU A 1 113 ? -21.578 18.354 2.112   1.00 29.25  ? 113 GLU A N   1 
ATOM   906  C CA  . GLU A 1 113 ? -22.751 17.883 2.802   1.00 28.94  ? 113 GLU A CA  1 
ATOM   907  C C   . GLU A 1 113 ? -23.488 16.936 1.881   1.00 27.69  ? 113 GLU A C   1 
ATOM   908  O O   . GLU A 1 113 ? -23.650 17.205 0.690   1.00 27.56  ? 113 GLU A O   1 
ATOM   909  C CB  . GLU A 1 113 ? -23.668 19.046 3.176   1.00 25.93  ? 113 GLU A CB  1 
ATOM   910  C CG  . GLU A 1 113 ? -24.997 18.565 3.725   1.00 29.65  ? 113 GLU A CG  1 
ATOM   911  C CD  . GLU A 1 113 ? -26.092 19.605 3.629   1.00 29.61  ? 113 GLU A CD  1 
ATOM   912  O OE1 . GLU A 1 113 ? -26.129 20.332 2.619   1.00 31.65  ? 113 GLU A OE1 1 
ATOM   913  O OE2 . GLU A 1 113 ? -26.926 19.678 4.553   1.00 25.54  ? 113 GLU A OE2 1 
ATOM   914  N N   . SER A 1 114 ? -23.911 15.811 2.431   1.00 26.09  ? 114 SER A N   1 
ATOM   915  C CA  . SER A 1 114 ? -24.658 14.835 1.659   1.00 26.47  ? 114 SER A CA  1 
ATOM   916  C C   . SER A 1 114 ? -26.018 15.437 1.321   1.00 27.79  ? 114 SER A C   1 
ATOM   917  O O   . SER A 1 114 ? -26.698 15.950 2.205   1.00 25.67  ? 114 SER A O   1 
ATOM   918  C CB  . SER A 1 114 ? -24.862 13.572 2.488   1.00 24.77  ? 114 SER A CB  1 
ATOM   919  O OG  . SER A 1 114 ? -25.895 12.788 1.936   1.00 25.18  ? 114 SER A OG  1 
ATOM   920  N N   . ALA A 1 115 ? -26.402 15.392 0.049   1.00 32.15  ? 115 ALA A N   1 
ATOM   921  C CA  . ALA A 1 115 ? -27.701 15.912 -0.370  1.00 34.76  ? 115 ALA A CA  1 
ATOM   922  C C   . ALA A 1 115 ? -28.797 14.978 0.144   1.00 36.01  ? 115 ALA A C   1 
ATOM   923  O O   . ALA A 1 115 ? -29.888 15.416 0.491   1.00 38.00  ? 115 ALA A O   1 
ATOM   924  C CB  . ALA A 1 115 ? -27.770 15.997 -1.882  1.00 30.93  ? 115 ALA A CB  1 
ATOM   925  N N   . GLN A 1 116 ? -28.483 13.688 0.195   1.00 36.56  ? 116 GLN A N   1 
ATOM   926  C CA  . GLN A 1 116 ? -29.415 12.663 0.651   1.00 38.71  ? 116 GLN A CA  1 
ATOM   927  C C   . GLN A 1 116 ? -29.707 12.794 2.150   1.00 39.79  ? 116 GLN A C   1 
ATOM   928  O O   . GLN A 1 116 ? -30.862 12.718 2.571   1.00 40.95  ? 116 GLN A O   1 
ATOM   929  C CB  . GLN A 1 116 ? -28.826 11.283 0.355   1.00 53.74  ? 116 GLN A CB  1 
ATOM   930  C CG  . GLN A 1 116 ? -29.811 10.136 0.438   1.00 59.30  ? 116 GLN A CG  1 
ATOM   931  C CD  . GLN A 1 116 ? -30.754 10.092 -0.746  1.00 61.77  ? 116 GLN A CD  1 
ATOM   932  O OE1 . GLN A 1 116 ? -31.580 10.983 -0.931  1.00 63.03  ? 116 GLN A OE1 1 
ATOM   933  N NE2 . GLN A 1 116 ? -30.632 9.049  -1.560  1.00 63.98  ? 116 GLN A NE2 1 
ATOM   934  N N   . PHE A 1 117 ? -28.657 12.990 2.949   1.00 37.82  ? 117 PHE A N   1 
ATOM   935  C CA  . PHE A 1 117 ? -28.790 13.137 4.398   1.00 35.81  ? 117 PHE A CA  1 
ATOM   936  C C   . PHE A 1 117 ? -28.323 14.519 4.840   1.00 36.16  ? 117 PHE A C   1 
ATOM   937  O O   . PHE A 1 117 ? -27.130 14.736 5.077   1.00 36.80  ? 117 PHE A O   1 
ATOM   938  C CB  . PHE A 1 117 ? -27.968 12.063 5.117   1.00 36.32  ? 117 PHE A CB  1 
ATOM   939  C CG  . PHE A 1 117 ? -28.290 10.667 4.675   1.00 37.22  ? 117 PHE A CG  1 
ATOM   940  C CD1 . PHE A 1 117 ? -29.505 10.079 5.010   1.00 37.41  ? 117 PHE A CD1 1 
ATOM   941  C CD2 . PHE A 1 117 ? -27.406 9.957  3.871   1.00 37.79  ? 117 PHE A CD2 1 
ATOM   942  C CE1 . PHE A 1 117 ? -29.835 8.807  4.547   1.00 38.28  ? 117 PHE A CE1 1 
ATOM   943  C CE2 . PHE A 1 117 ? -27.727 8.687  3.405   1.00 38.06  ? 117 PHE A CE2 1 
ATOM   944  C CZ  . PHE A 1 117 ? -28.946 8.112  3.744   1.00 38.96  ? 117 PHE A CZ  1 
ATOM   945  N N   . PRO A 1 118 ? -29.261 15.476 4.962   1.00 33.19  ? 118 PRO A N   1 
ATOM   946  C CA  . PRO A 1 118 ? -28.927 16.845 5.379   1.00 31.88  ? 118 PRO A CA  1 
ATOM   947  C C   . PRO A 1 118 ? -28.086 16.896 6.652   1.00 32.72  ? 118 PRO A C   1 
ATOM   948  O O   . PRO A 1 118 ? -28.273 16.091 7.570   1.00 33.49  ? 118 PRO A O   1 
ATOM   949  C CB  . PRO A 1 118 ? -30.298 17.493 5.559   1.00 35.46  ? 118 PRO A CB  1 
ATOM   950  C CG  . PRO A 1 118 ? -31.135 16.801 4.508   1.00 33.56  ? 118 PRO A CG  1 
ATOM   951  C CD  . PRO A 1 118 ? -30.705 15.348 4.685   1.00 36.30  ? 118 PRO A CD  1 
ATOM   952  N N   . ASN A 1 119 ? -27.156 17.845 6.695   1.00 32.90  ? 119 ASN A N   1 
ATOM   953  C CA  . ASN A 1 119 ? -26.270 18.030 7.839   1.00 33.57  ? 119 ASN A CA  1 
ATOM   954  C C   . ASN A 1 119 ? -25.331 16.864 8.147   1.00 32.09  ? 119 ASN A C   1 
ATOM   955  O O   . ASN A 1 119 ? -24.804 16.759 9.253   1.00 32.83  ? 119 ASN A O   1 
ATOM   956  C CB  . ASN A 1 119 ? -27.081 18.398 9.083   1.00 41.72  ? 119 ASN A CB  1 
ATOM   957  C CG  . ASN A 1 119 ? -27.814 19.716 8.918   1.00 44.15  ? 119 ASN A CG  1 
ATOM   958  O OD1 . ASN A 1 119 ? -29.042 19.759 8.868   1.00 47.09  ? 119 ASN A OD1 1 
ATOM   959  N ND2 . ASN A 1 119 ? -27.056 20.799 8.812   1.00 44.77  ? 119 ASN A ND2 1 
ATOM   960  N N   . TRP A 1 120 ? -25.144 15.984 7.170   1.00 31.05  ? 120 TRP A N   1 
ATOM   961  C CA  . TRP A 1 120 ? -24.212 14.870 7.296   1.00 30.25  ? 120 TRP A CA  1 
ATOM   962  C C   . TRP A 1 120 ? -23.102 15.216 6.308   1.00 29.43  ? 120 TRP A C   1 
ATOM   963  O O   . TRP A 1 120 ? -23.352 15.439 5.121   1.00 29.56  ? 120 TRP A O   1 
ATOM   964  C CB  . TRP A 1 120 ? -24.876 13.529 6.958   1.00 30.19  ? 120 TRP A CB  1 
ATOM   965  C CG  . TRP A 1 120 ? -25.606 12.964 8.138   1.00 33.24  ? 120 TRP A CG  1 
ATOM   966  C CD1 . TRP A 1 120 ? -26.816 13.378 8.634   1.00 31.43  ? 120 TRP A CD1 1 
ATOM   967  C CD2 . TRP A 1 120 ? -25.126 11.961 9.046   1.00 34.43  ? 120 TRP A CD2 1 
ATOM   968  N NE1 . TRP A 1 120 ? -27.110 12.701 9.793   1.00 33.10  ? 120 TRP A NE1 1 
ATOM   969  C CE2 . TRP A 1 120 ? -26.092 11.825 10.069  1.00 34.56  ? 120 TRP A CE2 1 
ATOM   970  C CE3 . TRP A 1 120 ? -23.972 11.167 9.096   1.00 35.29  ? 120 TRP A CE3 1 
ATOM   971  C CZ2 . TRP A 1 120 ? -25.938 10.924 11.132  1.00 35.06  ? 120 TRP A CZ2 1 
ATOM   972  C CZ3 . TRP A 1 120 ? -23.819 10.271 10.155  1.00 34.92  ? 120 TRP A CZ3 1 
ATOM   973  C CH2 . TRP A 1 120 ? -24.800 10.159 11.157  1.00 35.80  ? 120 TRP A CH2 1 
ATOM   974  N N   . TYR A 1 121 ? -21.879 15.276 6.818   1.00 30.89  ? 121 TYR A N   1 
ATOM   975  C CA  . TYR A 1 121 ? -20.727 15.668 6.024   1.00 29.83  ? 121 TYR A CA  1 
ATOM   976  C C   . TYR A 1 121 ? -19.661 14.601 5.871   1.00 29.26  ? 121 TYR A C   1 
ATOM   977  O O   . TYR A 1 121 ? -19.504 13.726 6.725   1.00 28.69  ? 121 TYR A O   1 
ATOM   978  C CB  . TYR A 1 121 ? -20.062 16.883 6.675   1.00 33.15  ? 121 TYR A CB  1 
ATOM   979  C CG  . TYR A 1 121 ? -20.957 18.084 6.833   1.00 36.41  ? 121 TYR A CG  1 
ATOM   980  C CD1 . TYR A 1 121 ? -20.960 19.098 5.878   1.00 35.75  ? 121 TYR A CD1 1 
ATOM   981  C CD2 . TYR A 1 121 ? -21.812 18.207 7.932   1.00 34.92  ? 121 TYR A CD2 1 
ATOM   982  C CE1 . TYR A 1 121 ? -21.788 20.208 6.008   1.00 38.53  ? 121 TYR A CE1 1 
ATOM   983  C CE2 . TYR A 1 121 ? -22.648 19.320 8.072   1.00 36.59  ? 121 TYR A CE2 1 
ATOM   984  C CZ  . TYR A 1 121 ? -22.625 20.314 7.104   1.00 37.49  ? 121 TYR A CZ  1 
ATOM   985  O OH  . TYR A 1 121 ? -23.415 21.432 7.227   1.00 40.45  ? 121 TYR A OH  1 
ATOM   986  N N   . ILE A 1 122 ? -18.922 14.692 4.772   1.00 24.89  ? 122 ILE A N   1 
ATOM   987  C CA  . ILE A 1 122 ? -17.805 13.789 4.550   1.00 25.02  ? 122 ILE A CA  1 
ATOM   988  C C   . ILE A 1 122 ? -16.803 14.212 5.625   1.00 23.62  ? 122 ILE A C   1 
ATOM   989  O O   . ILE A 1 122 ? -16.479 15.406 5.757   1.00 22.59  ? 122 ILE A O   1 
ATOM   990  C CB  . ILE A 1 122 ? -17.176 14.006 3.173   1.00 26.34  ? 122 ILE A CB  1 
ATOM   991  C CG1 . ILE A 1 122 ? -18.163 13.579 2.079   1.00 24.33  ? 122 ILE A CG1 1 
ATOM   992  C CG2 . ILE A 1 122 ? -15.869 13.237 3.086   1.00 24.02  ? 122 ILE A CG2 1 
ATOM   993  C CD1 . ILE A 1 122 ? -17.617 13.739 0.666   1.00 25.62  ? 122 ILE A CD1 1 
ATOM   994  N N   . SER A 1 123 ? -16.310 13.248 6.390   1.00 24.51  ? 123 SER A N   1 
ATOM   995  C CA  . SER A 1 123 ? -15.382 13.569 7.463   1.00 26.62  ? 123 SER A CA  1 
ATOM   996  C C   . SER A 1 123 ? -14.186 12.644 7.518   1.00 26.93  ? 123 SER A C   1 
ATOM   997  O O   . SER A 1 123 ? -14.208 11.551 6.944   1.00 28.42  ? 123 SER A O   1 
ATOM   998  C CB  . SER A 1 123 ? -16.110 13.500 8.810   1.00 28.27  ? 123 SER A CB  1 
ATOM   999  O OG  . SER A 1 123 ? -17.416 14.028 8.709   1.00 27.51  ? 123 SER A OG  1 
ATOM   1000 N N   . THR A 1 124 ? -13.139 13.108 8.199   1.00 27.21  ? 124 THR A N   1 
ATOM   1001 C CA  . THR A 1 124 ? -11.929 12.313 8.409   1.00 30.18  ? 124 THR A CA  1 
ATOM   1002 C C   . THR A 1 124 ? -11.684 12.326 9.911   1.00 29.98  ? 124 THR A C   1 
ATOM   1003 O O   . THR A 1 124 ? -12.190 13.189 10.621  1.00 30.74  ? 124 THR A O   1 
ATOM   1004 C CB  . THR A 1 124 ? -10.665 12.903 7.734   1.00 26.17  ? 124 THR A CB  1 
ATOM   1005 O OG1 . THR A 1 124 ? -10.379 14.186 8.295   1.00 27.00  ? 124 THR A OG1 1 
ATOM   1006 C CG2 . THR A 1 124 ? -10.847 13.014 6.222   1.00 25.51  ? 124 THR A CG2 1 
ATOM   1007 N N   . SER A 1 125 ? -10.909 11.367 10.389  1.00 32.88  ? 125 SER A N   1 
ATOM   1008 C CA  . SER A 1 125 ? -10.597 11.280 11.806  1.00 35.41  ? 125 SER A CA  1 
ATOM   1009 C C   . SER A 1 125 ? -9.313  12.041 12.093  1.00 35.76  ? 125 SER A C   1 
ATOM   1010 O O   . SER A 1 125 ? -8.509  12.275 11.188  1.00 35.55  ? 125 SER A O   1 
ATOM   1011 C CB  . SER A 1 125 ? -10.430 9.812  12.208  1.00 41.29  ? 125 SER A CB  1 
ATOM   1012 O OG  . SER A 1 125 ? -9.803  9.695  13.471  1.00 47.23  ? 125 SER A OG  1 
ATOM   1013 N N   . GLN A 1 126 ? -9.133  12.446 13.347  1.00 40.47  ? 126 GLN A N   1 
ATOM   1014 C CA  . GLN A 1 126 ? -7.916  13.145 13.752  1.00 41.06  ? 126 GLN A CA  1 
ATOM   1015 C C   . GLN A 1 126 ? -6.789  12.126 13.635  1.00 39.97  ? 126 GLN A C   1 
ATOM   1016 O O   . GLN A 1 126 ? -5.663  12.459 13.264  1.00 39.23  ? 126 GLN A O   1 
ATOM   1017 C CB  . GLN A 1 126 ? -8.014  13.611 15.206  1.00 64.25  ? 126 GLN A CB  1 
ATOM   1018 C CG  . GLN A 1 126 ? -8.884  14.831 15.449  1.00 72.00  ? 126 GLN A CG  1 
ATOM   1019 C CD  . GLN A 1 126 ? -8.244  16.113 14.955  1.00 76.63  ? 126 GLN A CD  1 
ATOM   1020 O OE1 . GLN A 1 126 ? -7.081  16.391 15.246  1.00 79.89  ? 126 GLN A OE1 1 
ATOM   1021 N NE2 . GLN A 1 126 ? -9.007  16.908 14.213  1.00 77.73  ? 126 GLN A NE2 1 
ATOM   1022 N N   . ALA A 1 127 ? -7.119  10.877 13.949  1.00 39.99  ? 127 ALA A N   1 
ATOM   1023 C CA  . ALA A 1 127 ? -6.165  9.778  13.906  1.00 40.50  ? 127 ALA A CA  1 
ATOM   1024 C C   . ALA A 1 127 ? -5.652  9.487  12.501  1.00 41.77  ? 127 ALA A C   1 
ATOM   1025 O O   . ALA A 1 127 ? -6.257  9.862  11.500  1.00 42.37  ? 127 ALA A O   1 
ATOM   1026 C CB  . ALA A 1 127 ? -6.788  8.514  14.511  1.00 33.55  ? 127 ALA A CB  1 
ATOM   1027 N N   . GLU A 1 128 ? -4.525  8.792  12.460  1.00 46.45  ? 128 GLU A N   1 
ATOM   1028 C CA  . GLU A 1 128 ? -3.842  8.426  11.232  1.00 46.09  ? 128 GLU A CA  1 
ATOM   1029 C C   . GLU A 1 128 ? -4.398  7.133  10.645  1.00 46.26  ? 128 GLU A C   1 
ATOM   1030 O O   . GLU A 1 128 ? -4.836  6.247  11.376  1.00 46.95  ? 128 GLU A O   1 
ATOM   1031 C CB  . GLU A 1 128 ? -2.352  8.245  11.547  1.00 42.60  ? 128 GLU A CB  1 
ATOM   1032 C CG  . GLU A 1 128 ? -1.414  8.301  10.369  1.00 43.89  ? 128 GLU A CG  1 
ATOM   1033 C CD  . GLU A 1 128 ? -1.315  9.691  9.774   1.00 43.65  ? 128 GLU A CD  1 
ATOM   1034 O OE1 . GLU A 1 128 ? -1.387  10.685 10.535  1.00 43.70  ? 128 GLU A OE1 1 
ATOM   1035 O OE2 . GLU A 1 128 ? -1.147  9.789  8.545   1.00 47.98  ? 128 GLU A OE2 1 
ATOM   1036 N N   . ASN A 1 129 ? -4.393  7.047  9.319   1.00 40.60  ? 129 ASN A N   1 
ATOM   1037 C CA  . ASN A 1 129 ? -4.834  5.853  8.597   1.00 41.62  ? 129 ASN A CA  1 
ATOM   1038 C C   . ASN A 1 129 ? -6.239  5.313  8.889   1.00 41.34  ? 129 ASN A C   1 
ATOM   1039 O O   . ASN A 1 129 ? -6.469  4.101  8.846   1.00 40.30  ? 129 ASN A O   1 
ATOM   1040 C CB  . ASN A 1 129 ? -3.808  4.739  8.823   1.00 65.70  ? 129 ASN A CB  1 
ATOM   1041 C CG  . ASN A 1 129 ? -3.736  3.773  7.666   1.00 70.09  ? 129 ASN A CG  1 
ATOM   1042 O OD1 . ASN A 1 129 ? -3.480  4.171  6.530   1.00 72.59  ? 129 ASN A OD1 1 
ATOM   1043 N ND2 . ASN A 1 129 ? -3.955  2.493  7.947   1.00 72.44  ? 129 ASN A ND2 1 
ATOM   1044 N N   . MET A 1 130 ? -7.184  6.199  9.171   1.00 38.39  ? 130 MET A N   1 
ATOM   1045 C CA  . MET A 1 130 ? -8.547  5.763  9.437   1.00 35.77  ? 130 MET A CA  1 
ATOM   1046 C C   . MET A 1 130 ? -9.407  5.992  8.198   1.00 34.13  ? 130 MET A C   1 
ATOM   1047 O O   . MET A 1 130 ? -9.078  6.824  7.350   1.00 34.52  ? 130 MET A O   1 
ATOM   1048 C CB  . MET A 1 130 ? -9.128  6.535  10.624  1.00 44.50  ? 130 MET A CB  1 
ATOM   1049 C CG  . MET A 1 130 ? -8.423  6.243  11.938  1.00 48.47  ? 130 MET A CG  1 
ATOM   1050 S SD  . MET A 1 130 ? -8.508  4.488  12.352  1.00 51.92  ? 130 MET A SD  1 
ATOM   1051 C CE  . MET A 1 130 ? -10.162 4.426  13.081  1.00 52.40  ? 130 MET A CE  1 
ATOM   1052 N N   . PRO A 1 131 ? -10.521 5.257  8.081   1.00 33.42  ? 131 PRO A N   1 
ATOM   1053 C CA  . PRO A 1 131 ? -11.454 5.357  6.949   1.00 32.17  ? 131 PRO A CA  1 
ATOM   1054 C C   . PRO A 1 131 ? -12.119 6.734  6.868   1.00 31.10  ? 131 PRO A C   1 
ATOM   1055 O O   . PRO A 1 131 ? -12.365 7.371  7.893   1.00 31.05  ? 131 PRO A O   1 
ATOM   1056 C CB  . PRO A 1 131 ? -12.494 4.269  7.252   1.00 37.57  ? 131 PRO A CB  1 
ATOM   1057 C CG  . PRO A 1 131 ? -11.784 3.324  8.200   1.00 36.45  ? 131 PRO A CG  1 
ATOM   1058 C CD  . PRO A 1 131 ? -10.990 4.258  9.061   1.00 38.51  ? 131 PRO A CD  1 
ATOM   1059 N N   . VAL A 1 132 ? -12.399 7.190  5.652   1.00 29.71  ? 132 VAL A N   1 
ATOM   1060 C CA  . VAL A 1 132 ? -13.079 8.469  5.455   1.00 29.16  ? 132 VAL A CA  1 
ATOM   1061 C C   . VAL A 1 132 ? -14.547 8.106  5.692   1.00 28.39  ? 132 VAL A C   1 
ATOM   1062 O O   . VAL A 1 132 ? -14.987 7.035  5.282   1.00 26.11  ? 132 VAL A O   1 
ATOM   1063 C CB  . VAL A 1 132 ? -12.870 8.993  4.003   1.00 24.51  ? 132 VAL A CB  1 
ATOM   1064 C CG1 . VAL A 1 132 ? -13.755 10.195 3.745   1.00 24.30  ? 132 VAL A CG1 1 
ATOM   1065 C CG2 . VAL A 1 132 ? -11.401 9.366  3.793   1.00 23.07  ? 132 VAL A CG2 1 
ATOM   1066 N N   . PHE A 1 133 ? -15.316 8.967  6.351   1.00 24.56  ? 133 PHE A N   1 
ATOM   1067 C CA  . PHE A 1 133 ? -16.701 8.606  6.625   1.00 24.67  ? 133 PHE A CA  1 
ATOM   1068 C C   . PHE A 1 133 ? -17.714 9.732  6.556   1.00 26.05  ? 133 PHE A C   1 
ATOM   1069 O O   . PHE A 1 133 ? -17.377 10.890 6.316   1.00 25.77  ? 133 PHE A O   1 
ATOM   1070 C CB  . PHE A 1 133 ? -16.800 7.949  8.006   1.00 28.18  ? 133 PHE A CB  1 
ATOM   1071 C CG  . PHE A 1 133 ? -16.296 8.817  9.128   1.00 30.12  ? 133 PHE A CG  1 
ATOM   1072 C CD1 . PHE A 1 133 ? -14.925 8.996  9.329   1.00 28.81  ? 133 PHE A CD1 1 
ATOM   1073 C CD2 . PHE A 1 133 ? -17.189 9.492  9.956   1.00 29.65  ? 133 PHE A CD2 1 
ATOM   1074 C CE1 . PHE A 1 133 ? -14.451 9.832  10.330  1.00 30.38  ? 133 PHE A CE1 1 
ATOM   1075 C CE2 . PHE A 1 133 ? -16.728 10.335 10.962  1.00 31.43  ? 133 PHE A CE2 1 
ATOM   1076 C CZ  . PHE A 1 133 ? -15.351 10.508 11.151  1.00 31.23  ? 133 PHE A CZ  1 
ATOM   1077 N N   . LEU A 1 134 ? -18.973 9.364  6.763   1.00 25.28  ? 134 LEU A N   1 
ATOM   1078 C CA  . LEU A 1 134 ? -20.061 10.320 6.770   1.00 28.82  ? 134 LEU A CA  1 
ATOM   1079 C C   . LEU A 1 134 ? -20.347 10.613 8.243   1.00 30.88  ? 134 LEU A C   1 
ATOM   1080 O O   . LEU A 1 134 ? -20.654 9.704  9.012   1.00 33.04  ? 134 LEU A O   1 
ATOM   1081 C CB  . LEU A 1 134 ? -21.290 9.719  6.091   1.00 31.39  ? 134 LEU A CB  1 
ATOM   1082 C CG  . LEU A 1 134 ? -22.269 10.754 5.544   1.00 32.95  ? 134 LEU A CG  1 
ATOM   1083 C CD1 . LEU A 1 134 ? -21.566 11.590 4.466   1.00 30.73  ? 134 LEU A CD1 1 
ATOM   1084 C CD2 . LEU A 1 134 ? -23.506 10.053 4.985   1.00 33.14  ? 134 LEU A CD2 1 
ATOM   1085 N N   . GLY A 1 135 ? -20.218 11.877 8.636   1.00 32.16  ? 135 GLY A N   1 
ATOM   1086 C CA  . GLY A 1 135 ? -20.452 12.252 10.019  1.00 35.70  ? 135 GLY A CA  1 
ATOM   1087 C C   . GLY A 1 135 ? -21.560 13.276 10.176  1.00 39.98  ? 135 GLY A C   1 
ATOM   1088 O O   . GLY A 1 135 ? -21.670 14.215 9.379   1.00 37.19  ? 135 GLY A O   1 
ATOM   1089 N N   . GLY A 1 136 ? -22.373 13.103 11.220  1.00 53.13  ? 136 GLY A N   1 
ATOM   1090 C CA  . GLY A 1 136 ? -23.487 14.003 11.463  1.00 58.56  ? 136 GLY A CA  1 
ATOM   1091 C C   . GLY A 1 136 ? -23.213 15.146 12.421  1.00 62.87  ? 136 GLY A C   1 
ATOM   1092 O O   . GLY A 1 136 ? -24.094 15.966 12.683  1.00 63.08  ? 136 GLY A O   1 
ATOM   1093 N N   . THR A 1 137 ? -21.997 15.207 12.951  1.00 79.85  ? 137 THR A N   1 
ATOM   1094 C CA  . THR A 1 137 ? -21.634 16.275 13.874  1.00 84.35  ? 137 THR A CA  1 
ATOM   1095 C C   . THR A 1 137 ? -20.524 17.120 13.264  1.00 86.48  ? 137 THR A C   1 
ATOM   1096 O O   . THR A 1 137 ? -19.449 16.612 12.943  1.00 87.31  ? 137 THR A O   1 
ATOM   1097 C CB  . THR A 1 137 ? -21.147 15.711 15.229  1.00 93.13  ? 137 THR A CB  1 
ATOM   1098 O OG1 . THR A 1 137 ? -19.949 14.950 15.033  1.00 94.25  ? 137 THR A OG1 1 
ATOM   1099 C CG2 . THR A 1 137 ? -22.212 14.815 15.844  1.00 93.36  ? 137 THR A CG2 1 
ATOM   1100 N N   . LYS A 1 138 ? -20.789 18.411 13.094  1.00 97.82  ? 138 LYS A N   1 
ATOM   1101 C CA  . LYS A 1 138 ? -19.797 19.309 12.521  1.00 99.91  ? 138 LYS A CA  1 
ATOM   1102 C C   . LYS A 1 138 ? -19.183 20.178 13.612  1.00 101.14 ? 138 LYS A C   1 
ATOM   1103 O O   . LYS A 1 138 ? -19.864 20.577 14.557  1.00 101.62 ? 138 LYS A O   1 
ATOM   1104 C CB  . LYS A 1 138 ? -20.436 20.193 11.445  1.00 72.21  ? 138 LYS A CB  1 
ATOM   1105 C CG  . LYS A 1 138 ? -19.425 20.963 10.611  1.00 72.27  ? 138 LYS A CG  1 
ATOM   1106 C CD  . LYS A 1 138 ? -20.098 21.823 9.552   1.00 73.54  ? 138 LYS A CD  1 
ATOM   1107 C CE  . LYS A 1 138 ? -20.906 22.955 10.176  1.00 74.19  ? 138 LYS A CE  1 
ATOM   1108 N NZ  . LYS A 1 138 ? -21.526 23.833 9.142   1.00 74.56  ? 138 LYS A NZ  1 
ATOM   1109 N N   . GLY A 1 139 ? -17.891 20.462 13.479  1.00 143.18 ? 139 GLY A N   1 
ATOM   1110 C CA  . GLY A 1 139 ? -17.209 21.280 14.464  1.00 143.99 ? 139 GLY A CA  1 
ATOM   1111 C C   . GLY A 1 139 ? -17.053 20.566 15.792  1.00 144.15 ? 139 GLY A C   1 
ATOM   1112 O O   . GLY A 1 139 ? -17.438 21.090 16.837  1.00 145.57 ? 139 GLY A O   1 
ATOM   1113 N N   . GLY A 1 140 ? -16.489 19.364 15.751  1.00 93.74  ? 140 GLY A N   1 
ATOM   1114 C CA  . GLY A 1 140 ? -16.293 18.596 16.966  1.00 91.94  ? 140 GLY A CA  1 
ATOM   1115 C C   . GLY A 1 140 ? -14.927 17.940 17.020  1.00 90.22  ? 140 GLY A C   1 
ATOM   1116 O O   . GLY A 1 140 ? -13.903 18.602 16.842  1.00 90.62  ? 140 GLY A O   1 
ATOM   1117 N N   . GLN A 1 141 ? -14.910 16.633 17.261  1.00 67.14  ? 141 GLN A N   1 
ATOM   1118 C CA  . GLN A 1 141 ? -13.660 15.882 17.340  1.00 64.97  ? 141 GLN A CA  1 
ATOM   1119 C C   . GLN A 1 141 ? -13.174 15.467 15.950  1.00 60.50  ? 141 GLN A C   1 
ATOM   1120 O O   . GLN A 1 141 ? -11.990 15.199 15.752  1.00 60.36  ? 141 GLN A O   1 
ATOM   1121 C CB  . GLN A 1 141 ? -13.845 14.627 18.202  1.00 136.93 ? 141 GLN A CB  1 
ATOM   1122 C CG  . GLN A 1 141 ? -14.425 14.880 19.588  1.00 142.11 ? 141 GLN A CG  1 
ATOM   1123 C CD  . GLN A 1 141 ? -15.877 15.322 19.546  1.00 145.03 ? 141 GLN A CD  1 
ATOM   1124 O OE1 . GLN A 1 141 ? -16.737 14.620 19.012  1.00 147.20 ? 141 GLN A OE1 1 
ATOM   1125 N NE2 . GLN A 1 141 ? -16.156 16.491 20.113  1.00 146.93 ? 141 GLN A NE2 1 
ATOM   1126 N N   . ASP A 1 142 ? -14.092 15.418 14.991  1.00 56.84  ? 142 ASP A N   1 
ATOM   1127 C CA  . ASP A 1 142 ? -13.746 15.020 13.633  1.00 50.61  ? 142 ASP A CA  1 
ATOM   1128 C C   . ASP A 1 142 ? -13.625 16.188 12.656  1.00 46.01  ? 142 ASP A C   1 
ATOM   1129 O O   . ASP A 1 142 ? -14.212 17.250 12.858  1.00 44.41  ? 142 ASP A O   1 
ATOM   1130 C CB  . ASP A 1 142 ? -14.769 14.010 13.123  1.00 49.82  ? 142 ASP A CB  1 
ATOM   1131 C CG  . ASP A 1 142 ? -14.872 12.796 14.022  1.00 48.54  ? 142 ASP A CG  1 
ATOM   1132 O OD1 . ASP A 1 142 ? -13.815 12.227 14.376  1.00 45.54  ? 142 ASP A OD1 1 
ATOM   1133 O OD2 . ASP A 1 142 ? -16.006 12.411 14.370  1.00 46.76  ? 142 ASP A OD2 1 
ATOM   1134 N N   . ILE A 1 143 ? -12.866 15.970 11.586  1.00 35.54  ? 143 ILE A N   1 
ATOM   1135 C CA  . ILE A 1 143 ? -12.625 17.000 10.582  1.00 31.96  ? 143 ILE A CA  1 
ATOM   1136 C C   . ILE A 1 143 ? -13.617 16.936 9.416   1.00 29.85  ? 143 ILE A C   1 
ATOM   1137 O O   . ILE A 1 143 ? -13.846 15.870 8.840   1.00 28.71  ? 143 ILE A O   1 
ATOM   1138 C CB  . ILE A 1 143 ? -11.179 16.880 10.059  1.00 37.65  ? 143 ILE A CB  1 
ATOM   1139 C CG1 . ILE A 1 143 ? -10.213 16.903 11.251  1.00 39.09  ? 143 ILE A CG1 1 
ATOM   1140 C CG2 . ILE A 1 143 ? -10.865 18.015 9.091   1.00 35.45  ? 143 ILE A CG2 1 
ATOM   1141 C CD1 . ILE A 1 143 ? -8.830  16.319 10.960  1.00 36.26  ? 143 ILE A CD1 1 
ATOM   1142 N N   . THR A 1 144 ? -14.201 18.085 9.075   1.00 34.04  ? 144 THR A N   1 
ATOM   1143 C CA  . THR A 1 144 ? -15.175 18.164 7.990   1.00 32.04  ? 144 THR A CA  1 
ATOM   1144 C C   . THR A 1 144 ? -14.865 19.247 6.953   1.00 30.93  ? 144 THR A C   1 
ATOM   1145 O O   . THR A 1 144 ? -15.687 19.525 6.080   1.00 30.17  ? 144 THR A O   1 
ATOM   1146 C CB  . THR A 1 144 ? -16.607 18.409 8.528   1.00 33.48  ? 144 THR A CB  1 
ATOM   1147 O OG1 . THR A 1 144 ? -16.658 19.673 9.201   1.00 37.34  ? 144 THR A OG1 1 
ATOM   1148 C CG2 . THR A 1 144 ? -17.013 17.304 9.499   1.00 32.79  ? 144 THR A CG2 1 
ATOM   1149 N N   . ASP A 1 145 ? -13.696 19.871 7.047   1.00 22.38  ? 145 ASP A N   1 
ATOM   1150 C CA  . ASP A 1 145 ? -13.328 20.881 6.058   1.00 24.69  ? 145 ASP A CA  1 
ATOM   1151 C C   . ASP A 1 145 ? -12.091 20.475 5.265   1.00 21.77  ? 145 ASP A C   1 
ATOM   1152 O O   . ASP A 1 145 ? -11.168 19.848 5.783   1.00 21.92  ? 145 ASP A O   1 
ATOM   1153 C CB  . ASP A 1 145 ? -13.123 22.257 6.706   1.00 69.89  ? 145 ASP A CB  1 
ATOM   1154 C CG  . ASP A 1 145 ? -12.941 22.178 8.198   1.00 74.69  ? 145 ASP A CG  1 
ATOM   1155 O OD1 . ASP A 1 145 ? -11.890 21.673 8.644   1.00 78.22  ? 145 ASP A OD1 1 
ATOM   1156 O OD2 . ASP A 1 145 ? -13.858 22.620 8.922   1.00 76.05  ? 145 ASP A OD2 1 
ATOM   1157 N N   . PHE A 1 146 ? -12.077 20.836 3.992   1.00 29.48  ? 146 PHE A N   1 
ATOM   1158 C CA  . PHE A 1 146 ? -10.970 20.472 3.126   1.00 28.65  ? 146 PHE A CA  1 
ATOM   1159 C C   . PHE A 1 146 ? -10.562 21.648 2.255   1.00 27.77  ? 146 PHE A C   1 
ATOM   1160 O O   . PHE A 1 146 ? -11.229 22.674 2.231   1.00 27.75  ? 146 PHE A O   1 
ATOM   1161 C CB  . PHE A 1 146 ? -11.391 19.317 2.197   1.00 26.12  ? 146 PHE A CB  1 
ATOM   1162 C CG  . PHE A 1 146 ? -11.927 18.112 2.913   1.00 25.18  ? 146 PHE A CG  1 
ATOM   1163 C CD1 . PHE A 1 146 ? -13.169 18.147 3.539   1.00 27.94  ? 146 PHE A CD1 1 
ATOM   1164 C CD2 . PHE A 1 146 ? -11.193 16.934 2.950   1.00 25.60  ? 146 PHE A CD2 1 
ATOM   1165 C CE1 . PHE A 1 146 ? -13.672 17.020 4.195   1.00 27.95  ? 146 PHE A CE1 1 
ATOM   1166 C CE2 . PHE A 1 146 ? -11.680 15.798 3.597   1.00 25.41  ? 146 PHE A CE2 1 
ATOM   1167 C CZ  . PHE A 1 146 ? -12.921 15.837 4.223   1.00 29.10  ? 146 PHE A CZ  1 
ATOM   1168 N N   . THR A 1 147 ? -9.439  21.496 1.565   1.00 23.89  ? 147 THR A N   1 
ATOM   1169 C CA  . THR A 1 147 ? -9.003  22.499 0.608   1.00 24.37  ? 147 THR A CA  1 
ATOM   1170 C C   . THR A 1 147 ? -8.922  21.669 -0.663  1.00 25.25  ? 147 THR A C   1 
ATOM   1171 O O   . THR A 1 147 ? -8.835  20.444 -0.600  1.00 23.28  ? 147 THR A O   1 
ATOM   1172 C CB  . THR A 1 147 ? -7.616  23.118 0.936   1.00 35.18  ? 147 THR A CB  1 
ATOM   1173 O OG1 . THR A 1 147 ? -6.666  22.084 1.197   1.00 35.59  ? 147 THR A OG1 1 
ATOM   1174 C CG2 . THR A 1 147 ? -7.720  24.048 2.136   1.00 35.70  ? 147 THR A CG2 1 
ATOM   1175 N N   . MET A 1 148 ? -8.977  22.325 -1.810  1.00 31.16  ? 148 MET A N   1 
ATOM   1176 C CA  . MET A 1 148 ? -8.927  21.632 -3.082  1.00 32.22  ? 148 MET A CA  1 
ATOM   1177 C C   . MET A 1 148 ? -7.719  22.067 -3.895  1.00 33.69  ? 148 MET A C   1 
ATOM   1178 O O   . MET A 1 148 ? -7.368  23.245 -3.912  1.00 34.59  ? 148 MET A O   1 
ATOM   1179 C CB  . MET A 1 148 ? -10.218 21.924 -3.843  1.00 39.10  ? 148 MET A CB  1 
ATOM   1180 C CG  . MET A 1 148 ? -10.156 21.733 -5.335  1.00 42.28  ? 148 MET A CG  1 
ATOM   1181 S SD  . MET A 1 148 ? -11.787 21.992 -6.052  1.00 47.50  ? 148 MET A SD  1 
ATOM   1182 C CE  . MET A 1 148 ? -12.233 23.560 -5.308  1.00 48.20  ? 148 MET A CE  1 
ATOM   1183 N N   . GLN A 1 149 ? -7.070  21.111 -4.550  1.00 38.49  ? 149 GLN A N   1 
ATOM   1184 C CA  . GLN A 1 149 ? -5.920  21.414 -5.397  1.00 39.39  ? 149 GLN A CA  1 
ATOM   1185 C C   . GLN A 1 149 ? -6.254  20.977 -6.818  1.00 41.00  ? 149 GLN A C   1 
ATOM   1186 O O   . GLN A 1 149 ? -6.689  19.846 -7.042  1.00 42.73  ? 149 GLN A O   1 
ATOM   1187 C CB  . GLN A 1 149 ? -4.658  20.675 -4.920  1.00 32.41  ? 149 GLN A CB  1 
ATOM   1188 C CG  . GLN A 1 149 ? -4.185  21.060 -3.512  1.00 33.09  ? 149 GLN A CG  1 
ATOM   1189 C CD  . GLN A 1 149 ? -4.956  20.346 -2.409  1.00 34.80  ? 149 GLN A CD  1 
ATOM   1190 O OE1 . GLN A 1 149 ? -5.216  20.917 -1.337  1.00 34.13  ? 149 GLN A OE1 1 
ATOM   1191 N NE2 . GLN A 1 149 ? -5.310  19.081 -2.658  1.00 29.62  ? 149 GLN A NE2 1 
ATOM   1192 N N   . PHE A 1 150 ? -6.072  21.875 -7.776  1.00 33.82  ? 150 PHE A N   1 
ATOM   1193 C CA  . PHE A 1 150 ? -6.337  21.545 -9.173  1.00 37.92  ? 150 PHE A CA  1 
ATOM   1194 C C   . PHE A 1 150 ? -5.154  20.766 -9.748  1.00 40.31  ? 150 PHE A C   1 
ATOM   1195 O O   . PHE A 1 150 ? -4.005  21.021 -9.384  1.00 40.19  ? 150 PHE A O   1 
ATOM   1196 C CB  . PHE A 1 150 ? -6.537  22.813 -10.002 1.00 42.31  ? 150 PHE A CB  1 
ATOM   1197 C CG  . PHE A 1 150 ? -7.631  23.705 -9.499  1.00 42.24  ? 150 PHE A CG  1 
ATOM   1198 C CD1 . PHE A 1 150 ? -7.428  24.520 -8.391  1.00 41.53  ? 150 PHE A CD1 1 
ATOM   1199 C CD2 . PHE A 1 150 ? -8.870  23.731 -10.133 1.00 43.36  ? 150 PHE A CD2 1 
ATOM   1200 C CE1 . PHE A 1 150 ? -8.440  25.349 -7.921  1.00 39.61  ? 150 PHE A CE1 1 
ATOM   1201 C CE2 . PHE A 1 150 ? -9.889  24.559 -9.670  1.00 42.19  ? 150 PHE A CE2 1 
ATOM   1202 C CZ  . PHE A 1 150 ? -9.670  25.369 -8.559  1.00 41.45  ? 150 PHE A CZ  1 
ATOM   1203 N N   . VAL A 1 151 ? -5.437  19.810 -10.630 1.00 36.14  ? 151 VAL A N   1 
ATOM   1204 C CA  . VAL A 1 151 ? -4.382  19.025 -11.270 1.00 41.38  ? 151 VAL A CA  1 
ATOM   1205 C C   . VAL A 1 151 ? -4.465  19.293 -12.770 1.00 46.52  ? 151 VAL A C   1 
ATOM   1206 O O   . VAL A 1 151 ? -5.555  19.513 -13.305 1.00 46.63  ? 151 VAL A O   1 
ATOM   1207 C CB  . VAL A 1 151 ? -4.542  17.494 -11.026 1.00 44.37  ? 151 VAL A CB  1 
ATOM   1208 C CG1 . VAL A 1 151 ? -4.549  17.193 -9.540  1.00 42.77  ? 151 VAL A CG1 1 
ATOM   1209 C CG2 . VAL A 1 151 ? -5.815  16.990 -11.682 1.00 43.08  ? 151 VAL A CG2 1 
ATOM   1210 N N   . SER A 1 152 ? -3.316  19.263 -13.440 1.00 112.44 ? 152 SER A N   1 
ATOM   1211 C CA  . SER A 1 152 ? -3.231  19.523 -14.876 1.00 117.39 ? 152 SER A CA  1 
ATOM   1212 C C   . SER A 1 152 ? -4.098  18.625 -15.755 1.00 121.24 ? 152 SER A C   1 
ATOM   1213 O O   . SER A 1 152 ? -3.992  18.672 -16.982 1.00 122.27 ? 152 SER A O   1 
ATOM   1214 C CB  . SER A 1 152 ? -1.779  19.405 -15.336 1.00 77.36  ? 152 SER A CB  1 
ATOM   1215 O OG  . SER A 1 152 ? -1.317  18.075 -15.184 1.00 78.37  ? 152 SER A OG  1 
ATOM   1216 N N   . SER A 1 153 ? -4.947  17.809 -15.139 1.00 114.09 ? 153 SER A N   1 
ATOM   1217 C CA  . SER A 1 153 ? -5.824  16.912 -15.886 1.00 117.29 ? 153 SER A CA  1 
ATOM   1218 C C   . SER A 1 153 ? -5.027  15.902 -16.708 1.00 118.69 ? 153 SER A C   1 
ATOM   1219 O O   . SER A 1 153 ? -3.779  15.949 -16.657 1.00 120.17 ? 153 SER A O   1 
ATOM   1220 C CB  . SER A 1 153 ? -6.740  17.721 -16.813 1.00 126.31 ? 153 SER A CB  1 
ATOM   1221 O OG  . SER A 1 153 ? -7.578  16.874 -17.581 1.00 127.42 ? 153 SER A OG  1 
ATOM   1222 O OXT . SER A 1 153 ? -5.662  15.073 -17.394 1.00 127.68 ? 153 SER A OXT 1 
HETATM 1223 O O   . HOH B 2 .   ? -7.701  13.416 -3.045  1.00 24.04  ? 154 HOH A O   1 
HETATM 1224 O O   . HOH B 2 .   ? -17.141 17.947 4.583   1.00 22.90  ? 155 HOH A O   1 
HETATM 1225 O O   . HOH B 2 .   ? -25.963 12.257 -1.152  1.00 27.13  ? 156 HOH A O   1 
HETATM 1226 O O   . HOH B 2 .   ? -10.121 9.374  8.688   1.00 29.35  ? 157 HOH A O   1 
HETATM 1227 O O   . HOH B 2 .   ? -20.469 11.306 -5.775  1.00 23.19  ? 158 HOH A O   1 
HETATM 1228 O O   . HOH B 2 .   ? -7.198  8.899  9.114   1.00 32.05  ? 159 HOH A O   1 
HETATM 1229 O O   . HOH B 2 .   ? -2.678  11.790 12.559  1.00 43.67  ? 160 HOH A O   1 
HETATM 1230 O O   . HOH B 2 .   ? -19.488 6.262  6.655   1.00 34.10  ? 161 HOH A O   1 
HETATM 1231 O O   . HOH B 2 .   ? -14.203 27.850 3.791   1.00 66.43  ? 162 HOH A O   1 
HETATM 1232 O O   . HOH B 2 .   ? -19.347 25.857 -3.297  1.00 45.25  ? 163 HOH A O   1 
HETATM 1233 O O   . HOH B 2 .   ? -5.220  14.710 11.777  1.00 43.91  ? 164 HOH A O   1 
HETATM 1234 O O   . HOH B 2 .   ? -5.255  13.774 -1.410  1.00 31.84  ? 165 HOH A O   1 
HETATM 1235 O O   . HOH B 2 .   ? -24.678 1.784  -13.053 1.00 32.80  ? 166 HOH A O   1 
HETATM 1236 O O   . HOH B 2 .   ? -5.711  21.402 3.574   1.00 36.58  ? 167 HOH A O   1 
HETATM 1237 O O   . HOH B 2 .   ? -0.703  14.740 3.019   1.00 32.50  ? 168 HOH A O   1 
HETATM 1238 O O   . HOH B 2 .   ? -11.216 -1.418 2.339   1.00 87.86  ? 169 HOH A O   1 
HETATM 1239 O O   . HOH B 2 .   ? -30.101 7.271  -5.104  1.00 40.84  ? 170 HOH A O   1 
HETATM 1240 O O   . HOH B 2 .   ? -23.565 22.117 -10.009 1.00 28.41  ? 171 HOH A O   1 
HETATM 1241 O O   . HOH B 2 .   ? -29.256 6.770  -0.329  1.00 32.97  ? 172 HOH A O   1 
HETATM 1242 O O   . HOH B 2 .   ? -20.611 -0.966 -6.164  1.00 40.21  ? 173 HOH A O   1 
HETATM 1243 O O   . HOH B 2 .   ? -9.758  24.857 -1.541  1.00 36.14  ? 174 HOH A O   1 
HETATM 1244 O O   . HOH B 2 .   ? -17.483 13.166 -11.378 1.00 29.65  ? 175 HOH A O   1 
HETATM 1245 O O   . HOH B 2 .   ? -31.261 1.114  14.577  1.00 49.48  ? 176 HOH A O   1 
HETATM 1246 O O   . HOH B 2 .   ? -14.835 9.165  -12.394 1.00 46.64  ? 177 HOH A O   1 
HETATM 1247 O O   . HOH B 2 .   ? -1.985  10.443 -7.582  1.00 46.97  ? 178 HOH A O   1 
HETATM 1248 O O   . HOH B 2 .   ? -24.377 7.644  -4.443  1.00 88.16  ? 179 HOH A O   1 
HETATM 1249 O O   . HOH B 2 .   ? -27.106 2.695  12.768  1.00 91.15  ? 180 HOH A O   1 
HETATM 1250 O O   . HOH B 2 .   ? -21.144 6.838  8.753   1.00 47.25  ? 181 HOH A O   1 
HETATM 1251 O O   . HOH B 2 .   ? -16.417 5.719  -19.936 1.00 52.14  ? 182 HOH A O   1 
HETATM 1252 O O   . HOH B 2 .   ? -28.359 21.309 6.469   1.00 59.69  ? 183 HOH A O   1 
HETATM 1253 O O   . HOH B 2 .   ? -18.143 13.008 13.099  1.00 50.05  ? 184 HOH A O   1 
HETATM 1254 O O   . HOH B 2 .   ? -26.158 28.303 0.541   1.00 69.66  ? 185 HOH A O   1 
HETATM 1255 O O   . HOH B 2 .   ? -10.785 26.311 8.163   1.00 77.18  ? 186 HOH A O   1 
HETATM 1256 O O   . HOH B 2 .   ? -19.386 28.548 -3.371  1.00 89.76  ? 187 HOH A O   1 
HETATM 1257 O O   . HOH B 2 .   ? -23.573 18.254 11.296  1.00 53.47  ? 188 HOH A O   1 
HETATM 1258 O O   . HOH B 2 .   ? -6.493  4.033  2.188   1.00 87.99  ? 189 HOH A O   1 
HETATM 1259 O O   . HOH B 2 .   ? -16.654 13.690 -15.172 1.00 93.15  ? 190 HOH A O   1 
HETATM 1260 O O   . HOH B 2 .   ? -22.142 20.282 -15.651 1.00 43.79  ? 191 HOH A O   1 
HETATM 1261 O O   . HOH B 2 .   ? -16.701 4.649  5.755   1.00 49.32  ? 192 HOH A O   1 
HETATM 1262 O O   . HOH B 2 .   ? -19.792 -0.224 -2.828  1.00 52.83  ? 193 HOH A O   1 
HETATM 1263 O O   . HOH B 2 .   ? -1.108  3.103  -2.014  1.00 61.40  ? 194 HOH A O   1 
HETATM 1264 O O   . HOH B 2 .   ? -14.521 21.734 -17.395 1.00 58.31  ? 195 HOH A O   1 
HETATM 1265 O O   . HOH B 2 .   ? -27.993 20.073 -4.181  1.00 65.37  ? 196 HOH A O   1 
HETATM 1266 O O   . HOH B 2 .   ? -2.255  21.099 1.149   1.00 77.93  ? 197 HOH A O   1 
HETATM 1267 O O   . HOH B 2 .   ? -5.024  5.845  -3.421  1.00 57.47  ? 198 HOH A O   1 
HETATM 1268 O O   . HOH B 2 .   ? -17.972 25.020 3.934   1.00 76.82  ? 199 HOH A O   1 
HETATM 1269 O O   . HOH B 2 .   ? -30.610 22.205 4.685   1.00 72.77  ? 200 HOH A O   1 
HETATM 1270 O O   . HOH B 2 .   ? -18.851 14.567 11.184  1.00 62.29  ? 201 HOH A O   1 
HETATM 1271 O O   . HOH B 2 .   ? -11.279 12.239 15.556  1.00 62.31  ? 202 HOH A O   1 
HETATM 1272 O O   . HOH B 2 .   ? -30.752 3.988  13.142  1.00 64.02  ? 203 HOH A O   1 
HETATM 1273 O O   . HOH B 2 .   ? -13.487 -1.850 0.358   1.00 76.45  ? 204 HOH A O   1 
HETATM 1274 O O   . HOH B 2 .   ? -12.182 10.730 -15.463 1.00 59.77  ? 205 HOH A O   1 
HETATM 1275 O O   . HOH B 2 .   ? -14.167 5.144  2.884   1.00 53.05  ? 206 HOH A O   1 
HETATM 1276 O O   . HOH B 2 .   ? -29.766 28.428 -1.832  1.00 83.76  ? 207 HOH A O   1 
HETATM 1277 O O   . HOH B 2 .   ? -13.255 26.695 7.231   1.00 90.07  ? 208 HOH A O   1 
HETATM 1278 O O   . HOH B 2 .   ? -31.667 27.175 -7.109  1.00 66.56  ? 209 HOH A O   1 
HETATM 1279 O O   . HOH B 2 .   ? -7.862  21.603 -13.062 1.00 71.25  ? 210 HOH A O   1 
HETATM 1280 O O   . HOH B 2 .   ? -16.331 11.125 -12.936 1.00 74.42  ? 211 HOH A O   1 
HETATM 1281 O O   . HOH B 2 .   ? -11.199 26.190 -4.145  1.00 84.97  ? 212 HOH A O   1 
HETATM 1282 O O   . HOH B 2 .   ? -26.681 2.942  -15.668 1.00 70.20  ? 213 HOH A O   1 
HETATM 1283 O O   . HOH B 2 .   ? -28.586 15.730 -10.387 1.00 66.11  ? 214 HOH A O   1 
HETATM 1284 O O   . HOH B 2 .   ? -29.810 18.301 -4.111  1.00 62.11  ? 215 HOH A O   1 
HETATM 1285 O O   . HOH B 2 .   ? -30.397 4.382  1.540   1.00 59.53  ? 216 HOH A O   1 
HETATM 1286 O O   . HOH B 2 .   ? -18.956 7.930  -20.392 1.00 67.96  ? 217 HOH A O   1 
HETATM 1287 O O   . HOH B 2 .   ? -25.462 2.366  15.099  1.00 82.21  ? 218 HOH A O   1 
HETATM 1288 O O   . HOH B 2 .   ? -32.024 22.513 2.503   1.00 84.53  ? 219 HOH A O   1 
HETATM 1289 O O   . HOH B 2 .   ? -1.108  13.227 -7.380  1.00 70.63  ? 220 HOH A O   1 
HETATM 1290 O O   . HOH B 2 .   ? -3.845  3.447  -2.767  1.00 82.88  ? 221 HOH A O   1 
HETATM 1291 O O   . HOH B 2 .   ? -24.245 0.804  -9.029  1.00 62.35  ? 222 HOH A O   1 
HETATM 1292 O O   . HOH B 2 .   ? -8.941  29.515 8.549   1.00 85.27  ? 223 HOH A O   1 
HETATM 1293 O O   . HOH B 2 .   ? -24.791 1.529  12.407  1.00 81.10  ? 224 HOH A O   1 
HETATM 1294 O O   . HOH B 2 .   ? -8.276  19.625 -14.665 1.00 80.09  ? 225 HOH A O   1 
HETATM 1295 O O   . HOH B 2 .   ? -20.561 11.228 13.379  1.00 68.59  ? 226 HOH A O   1 
HETATM 1296 O O   . HOH B 2 .   ? -3.439  3.182  3.502   1.00 91.23  ? 227 HOH A O   1 
HETATM 1297 O O   . HOH B 2 .   ? -29.740 4.201  -1.732  1.00 71.65  ? 228 HOH A O   1 
HETATM 1298 O O   . HOH B 2 .   ? -4.011  10.040 -11.962 1.00 60.50  ? 229 HOH A O   1 
HETATM 1299 O O   . HOH B 2 .   ? -2.757  17.605 -6.223  1.00 73.54  ? 230 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   1   1   ALA ALA A . n 
A 1 2   PRO 2   2   2   PRO PRO A . n 
A 1 3   VAL 3   3   3   VAL VAL A . n 
A 1 4   ARG 4   4   4   ARG ARG A . n 
A 1 5   SER 5   5   5   SER SER A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   ASN 7   7   7   ASN ASN A . n 
A 1 8   CYS 8   8   8   CYS CYS A . n 
A 1 9   THR 9   9   9   THR THR A . n 
A 1 10  LEU 10  10  10  LEU LEU A . n 
A 1 11  ARG 11  11  11  ARG ARG A . n 
A 1 12  ASP 12  12  12  ASP ASP A . n 
A 1 13  SER 13  13  13  SER SER A . n 
A 1 14  GLN 14  14  14  GLN GLN A . n 
A 1 15  GLN 15  15  15  GLN GLN A . n 
A 1 16  LYS 16  16  16  LYS LYS A . n 
A 1 17  SER 17  17  17  SER SER A . n 
A 1 18  LEU 18  18  18  LEU LEU A . n 
A 1 19  VAL 19  19  19  VAL VAL A . n 
A 1 20  MET 20  20  20  MET MET A . n 
A 1 21  SER 21  21  21  SER SER A . n 
A 1 22  GLY 22  22  22  GLY GLY A . n 
A 1 23  PRO 23  23  23  PRO PRO A . n 
A 1 24  TYR 24  24  24  TYR TYR A . n 
A 1 25  GLU 25  25  25  GLU GLU A . n 
A 1 26  LEU 26  26  26  LEU LEU A . n 
A 1 27  LYS 27  27  27  LYS LYS A . n 
A 1 28  ALA 28  28  28  ALA ALA A . n 
A 1 29  LEU 29  29  29  LEU LEU A . n 
A 1 30  HIS 30  30  30  HIS HIS A . n 
A 1 31  LEU 31  31  31  LEU LEU A . n 
A 1 32  GLN 32  32  32  GLN GLN A . n 
A 1 33  GLY 33  33  33  GLY GLY A . n 
A 1 34  GLN 34  34  34  GLN GLN A . n 
A 1 35  ASP 35  35  35  ASP ASP A . n 
A 1 36  MET 36  36  36  MET MET A . n 
A 1 37  GLU 37  37  37  GLU GLU A . n 
A 1 38  GLN 38  38  38  GLN GLN A . n 
A 1 39  GLN 39  39  39  GLN GLN A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  VAL 41  41  41  VAL VAL A . n 
A 1 42  TRP 42  42  42  TRP TRP A . n 
A 1 43  SER 43  43  43  SER SER A . n 
A 1 44  MET 44  44  44  MET MET A . n 
A 1 45  SER 45  45  45  SER SER A . n 
A 1 46  PHE 46  46  46  PHE PHE A . n 
A 1 47  VAL 47  47  47  VAL VAL A . n 
A 1 48  GLN 48  48  48  GLN GLN A . n 
A 1 49  GLY 49  49  49  GLY GLY A . n 
A 1 50  GLU 50  50  50  GLU GLU A . n 
A 1 51  GLU 51  51  51  GLU GLU A . n 
A 1 52  SER 52  52  52  SER SER A . n 
A 1 53  ASN 53  53  53  ASN ASN A . n 
A 1 54  ASP 54  54  54  ASP ASP A . n 
A 1 55  LYS 55  55  55  LYS LYS A . n 
A 1 56  ILE 56  56  56  ILE ILE A . n 
A 1 57  PRO 57  57  57  PRO PRO A . n 
A 1 58  VAL 58  58  58  VAL VAL A . n 
A 1 59  ALA 59  59  59  ALA ALA A . n 
A 1 60  LEU 60  60  60  LEU LEU A . n 
A 1 61  GLY 61  61  61  GLY GLY A . n 
A 1 62  LEU 62  62  62  LEU LEU A . n 
A 1 63  LYS 63  63  63  LYS LYS A . n 
A 1 64  GLU 64  64  64  GLU GLU A . n 
A 1 65  LYS 65  65  65  LYS LYS A . n 
A 1 66  ASN 66  66  66  ASN ASN A . n 
A 1 67  LEU 67  67  67  LEU LEU A . n 
A 1 68  TYR 68  68  68  TYR TYR A . n 
A 1 69  LEU 69  69  69  LEU LEU A . n 
A 1 70  SER 70  70  70  SER SER A . n 
A 1 71  CYS 71  71  71  CYS CYS A . n 
A 1 72  VAL 72  72  72  VAL VAL A . n 
A 1 73  LEU 73  73  73  LEU LEU A . n 
A 1 74  LYS 74  74  74  LYS LYS A . n 
A 1 75  ASP 75  75  75  ASP ASP A . n 
A 1 76  ASP 76  76  76  ASP ASP A . n 
A 1 77  LYS 77  77  77  LYS LYS A . n 
A 1 78  PRO 78  78  78  PRO PRO A . n 
A 1 79  THR 79  79  79  THR THR A . n 
A 1 80  LEU 80  80  80  LEU LEU A . n 
A 1 81  GLN 81  81  81  GLN GLN A . n 
A 1 82  LEU 82  82  82  LEU LEU A . n 
A 1 83  GLU 83  83  83  GLU GLU A . n 
A 1 84  SER 84  84  84  SER SER A . n 
A 1 85  VAL 85  85  85  VAL VAL A . n 
A 1 86  ASP 86  86  86  ASP ASP A . n 
A 1 87  PRO 87  87  87  PRO PRO A . n 
A 1 88  LYS 88  88  88  LYS LYS A . n 
A 1 89  ASN 89  89  89  ASN ASN A . n 
A 1 90  TYR 90  90  90  TYR TYR A . n 
A 1 91  PRO 91  91  91  PRO PRO A . n 
A 1 92  LYS 92  92  92  LYS LYS A . n 
A 1 93  LYS 93  93  93  LYS LYS A . n 
A 1 94  LYS 94  94  94  LYS LYS A . n 
A 1 95  MET 95  95  95  MET MET A . n 
A 1 96  GLU 96  96  96  GLU GLU A . n 
A 1 97  LYS 97  97  97  LYS LYS A . n 
A 1 98  ARG 98  98  98  ARG ARG A . n 
A 1 99  PHE 99  99  99  PHE PHE A . n 
A 1 100 VAL 100 100 100 VAL VAL A . n 
A 1 101 PHE 101 101 101 PHE PHE A . n 
A 1 102 ASN 102 102 102 ASN ASN A . n 
A 1 103 LYS 103 103 103 LYS LYS A . n 
A 1 104 ILE 104 104 104 ILE ILE A . n 
A 1 105 GLU 105 105 105 GLU GLU A . n 
A 1 106 ILE 106 106 106 ILE ILE A . n 
A 1 107 ASN 107 107 107 ASN ASN A . n 
A 1 108 ASN 108 108 108 ASN ASN A . n 
A 1 109 LYS 109 109 109 LYS LYS A . n 
A 1 110 LEU 110 110 110 LEU LEU A . n 
A 1 111 GLU 111 111 111 GLU GLU A . n 
A 1 112 PHE 112 112 112 PHE PHE A . n 
A 1 113 GLU 113 113 113 GLU GLU A . n 
A 1 114 SER 114 114 114 SER SER A . n 
A 1 115 ALA 115 115 115 ALA ALA A . n 
A 1 116 GLN 116 116 116 GLN GLN A . n 
A 1 117 PHE 117 117 117 PHE PHE A . n 
A 1 118 PRO 118 118 118 PRO PRO A . n 
A 1 119 ASN 119 119 119 ASN ASN A . n 
A 1 120 TRP 120 120 120 TRP TRP A . n 
A 1 121 TYR 121 121 121 TYR TYR A . n 
A 1 122 ILE 122 122 122 ILE ILE A . n 
A 1 123 SER 123 123 123 SER SER A . n 
A 1 124 THR 124 124 124 THR THR A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 GLN 126 126 126 GLN GLN A . n 
A 1 127 ALA 127 127 127 ALA ALA A . n 
A 1 128 GLU 128 128 128 GLU GLU A . n 
A 1 129 ASN 129 129 129 ASN ASN A . n 
A 1 130 MET 130 130 130 MET MET A . n 
A 1 131 PRO 131 131 131 PRO PRO A . n 
A 1 132 VAL 132 132 132 VAL VAL A . n 
A 1 133 PHE 133 133 133 PHE PHE A . n 
A 1 134 LEU 134 134 134 LEU LEU A . n 
A 1 135 GLY 135 135 135 GLY GLY A . n 
A 1 136 GLY 136 136 136 GLY GLY A . n 
A 1 137 THR 137 137 137 THR THR A . n 
A 1 138 LYS 138 138 138 LYS LYS A . n 
A 1 139 GLY 139 139 139 GLY GLY A . n 
A 1 140 GLY 140 140 140 GLY GLY A . n 
A 1 141 GLN 141 141 141 GLN GLN A . n 
A 1 142 ASP 142 142 142 ASP ASP A . n 
A 1 143 ILE 143 143 143 ILE ILE A . n 
A 1 144 THR 144 144 144 THR THR A . n 
A 1 145 ASP 145 145 145 ASP ASP A . n 
A 1 146 PHE 146 146 146 PHE PHE A . n 
A 1 147 THR 147 147 147 THR THR A . n 
A 1 148 MET 148 148 148 MET MET A . n 
A 1 149 GLN 149 149 149 GLN GLN A . n 
A 1 150 PHE 150 150 150 PHE PHE A . n 
A 1 151 VAL 151 151 151 VAL VAL A . n 
A 1 152 SER 152 152 152 SER SER A . n 
A 1 153 SER 153 153 153 SER SER A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-03-30 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' . ? 1 
SCALEPACK 'data scaling'   . ? 2 
CNS       refinement       . ? 3 
CNS       phasing          . ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 PRO A 2   ? ? -48.53  -77.32  
2 1 SER A 21  ? ? -75.98  -76.17  
3 1 GLU A 64  ? ? 73.92   -9.59   
4 1 ASP A 75  ? ? 70.49   48.28   
5 1 ILE A 106 ? ? -105.05 -105.67 
6 1 ASN A 107 ? ? -55.07  -88.77  
7 1 SER A 152 ? ? -56.58  7.32    
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1  154 1  HOH TIP A . 
B 2 HOH 2  155 2  HOH TIP A . 
B 2 HOH 3  156 3  HOH TIP A . 
B 2 HOH 4  157 4  HOH TIP A . 
B 2 HOH 5  158 5  HOH TIP A . 
B 2 HOH 6  159 6  HOH TIP A . 
B 2 HOH 7  160 7  HOH TIP A . 
B 2 HOH 8  161 8  HOH TIP A . 
B 2 HOH 9  162 9  HOH TIP A . 
B 2 HOH 10 163 10 HOH TIP A . 
B 2 HOH 11 164 11 HOH TIP A . 
B 2 HOH 12 165 12 HOH TIP A . 
B 2 HOH 13 166 13 HOH TIP A . 
B 2 HOH 14 167 14 HOH TIP A . 
B 2 HOH 15 168 15 HOH TIP A . 
B 2 HOH 16 169 16 HOH TIP A . 
B 2 HOH 17 170 17 HOH TIP A . 
B 2 HOH 18 171 18 HOH TIP A . 
B 2 HOH 19 172 19 HOH TIP A . 
B 2 HOH 20 173 20 HOH TIP A . 
B 2 HOH 21 174 21 HOH TIP A . 
B 2 HOH 22 175 22 HOH TIP A . 
B 2 HOH 23 176 23 HOH TIP A . 
B 2 HOH 24 177 24 HOH TIP A . 
B 2 HOH 25 178 25 HOH TIP A . 
B 2 HOH 26 179 26 HOH TIP A . 
B 2 HOH 27 180 27 HOH TIP A . 
B 2 HOH 28 181 28 HOH TIP A . 
B 2 HOH 29 182 29 HOH TIP A . 
B 2 HOH 30 183 30 HOH TIP A . 
B 2 HOH 31 184 31 HOH TIP A . 
B 2 HOH 32 185 32 HOH TIP A . 
B 2 HOH 33 186 33 HOH TIP A . 
B 2 HOH 34 187 34 HOH TIP A . 
B 2 HOH 35 188 35 HOH TIP A . 
B 2 HOH 36 189 36 HOH TIP A . 
B 2 HOH 37 190 37 HOH TIP A . 
B 2 HOH 38 191 38 HOH TIP A . 
B 2 HOH 39 192 39 HOH TIP A . 
B 2 HOH 40 193 40 HOH TIP A . 
B 2 HOH 41 194 41 HOH TIP A . 
B 2 HOH 42 195 42 HOH TIP A . 
B 2 HOH 43 196 43 HOH TIP A . 
B 2 HOH 44 197 44 HOH TIP A . 
B 2 HOH 45 198 45 HOH TIP A . 
B 2 HOH 46 199 46 HOH TIP A . 
B 2 HOH 47 200 47 HOH TIP A . 
B 2 HOH 48 201 48 HOH TIP A . 
B 2 HOH 49 202 49 HOH TIP A . 
B 2 HOH 50 203 50 HOH TIP A . 
B 2 HOH 51 204 51 HOH TIP A . 
B 2 HOH 52 205 52 HOH TIP A . 
B 2 HOH 53 206 53 HOH TIP A . 
B 2 HOH 54 207 54 HOH TIP A . 
B 2 HOH 55 208 55 HOH TIP A . 
B 2 HOH 56 209 56 HOH TIP A . 
B 2 HOH 57 210 57 HOH TIP A . 
B 2 HOH 58 211 58 HOH TIP A . 
B 2 HOH 59 212 59 HOH TIP A . 
B 2 HOH 60 213 60 HOH TIP A . 
B 2 HOH 61 214 61 HOH TIP A . 
B 2 HOH 62 215 62 HOH TIP A . 
B 2 HOH 63 216 63 HOH TIP A . 
B 2 HOH 64 217 64 HOH TIP A . 
B 2 HOH 65 218 65 HOH TIP A . 
B 2 HOH 66 219 66 HOH TIP A . 
B 2 HOH 67 220 67 HOH TIP A . 
B 2 HOH 68 221 68 HOH TIP A . 
B 2 HOH 69 222 69 HOH TIP A . 
B 2 HOH 70 223 70 HOH TIP A . 
B 2 HOH 71 224 71 HOH TIP A . 
B 2 HOH 72 225 72 HOH TIP A . 
B 2 HOH 73 226 73 HOH TIP A . 
B 2 HOH 74 227 74 HOH TIP A . 
B 2 HOH 75 228 75 HOH TIP A . 
B 2 HOH 76 229 76 HOH TIP A . 
B 2 HOH 77 230 77 HOH TIP A . 
#