data_1S0N
# 
_entry.id   1S0N 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.292 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1S0N         
NDB   PD0509       
RCSB  RCSB021217   
WWPDB D_1000021217 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1JX4 . unspecified 
PDB 1RYR . unspecified 
PDB 1RYS . unspecified 
PDB 1S0M . unspecified 
PDB 1S0O . unspecified 
PDB 1S10 . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1S0N 
_pdbx_database_status.recvd_initial_deposition_date   2003-12-31 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ling, H.'     1 
'Boudsocq, F.' 2 
'Woodgate, R.' 3 
'Yang, W.'     4 
# 
_citation.id                        primary 
_citation.title                     
'Snapshots of Replication through an Abasic Lesion; Structural Basis for Base Substitutions and Frameshifts.' 
_citation.journal_abbrev            Mol.Cell 
_citation.journal_volume            13 
_citation.page_first                751 
_citation.page_last                 762 
_citation.year                      2004 
_citation.journal_id_ASTM           MOCEFL 
_citation.country                   US 
_citation.journal_id_ISSN           1097-2765 
_citation.journal_id_CSD            2168 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15023344 
_citation.pdbx_database_id_DOI      '10.1016/S1097-2765(04)00101-7' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Ling, H.'     1 
primary 'Boudsocq, F.' 2 
primary 'Woodgate, R.' 3 
primary 'Yang, W.'     4 
# 
_cell.entry_id           1S0N 
_cell.length_a           99.112 
_cell.length_b           102.660 
_cell.length_c           53.176 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1S0N 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn "5'-D(*GP*GP*CP*AP*CP*TP*GP*AP*TP*CP*AP*CP*G)-3'"                3976.599  1  ?       ? ? ? 
2 polymer     syn "5'-D(*TP*AP*CP*GP*AP*CP*GP*TP*GP*AP*TP*CP*AP*GP*TP*GP*CP*C)-3'" 5516.579  1  ?       ? ? ? 
3 polymer     man 'DNA polymerase IV'                                              40257.879 1  2.7.7.7 ? ? ? 
4 non-polymer syn 'CALCIUM ION'                                                    40.078    3  ?       ? ? ? 
5 non-polymer syn "2'-DEOXYCYTIDINE-5'-TRIPHOSPHATE"                               467.157   1  ?       ? ? ? 
6 water       nat water                                                            18.015    23 ?       ? ? ? 
# 
_entity_name_com.entity_id   3 
_entity_name_com.name        'Pol IV' 
# 
_entity_name_sys.entity_id   3 
_entity_name_sys.name        2.7.7.7 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DG)(DG)(DC)(DA)(DC)(DT)(DG)(DA)(DT)(DC)(DA)(DC)(DG)' GGCACTGATCACG P ? 
2 polydeoxyribonucleotide no no '(DT)(DA)(DC)(DG)(DA)(DC)(DG)(DT)(DG)(DA)(DT)(DC)(DA)(DG)(DT)(DG)(DC)(DC)' TACGACGTGATCAGTGCC T ? 
3 'polypeptide(L)'        no no 
;MIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEARKFGVKAGIPIVEAKKILPNAVYLPMRKEV
YQQVSSRIMNLLREYSEKIEIASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVFAKIAADMAKP
NGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGINKLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTR
VRKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSESVKLLQ
KILEEDERKIRRIGVRFSKFIEAIGLDKFFDT
;
;MIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEARKFGVKAGIPIVEAKKILPNAVYLPMRKEV
YQQVSSRIMNLLREYSEKIEIASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVFAKIAADMAKP
NGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGINKLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTR
VRKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSESVKLLQ
KILEEDERKIRRIGVRFSKFIEAIGLDKFFDT
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DG  n 
1 2   DG  n 
1 3   DC  n 
1 4   DA  n 
1 5   DC  n 
1 6   DT  n 
1 7   DG  n 
1 8   DA  n 
1 9   DT  n 
1 10  DC  n 
1 11  DA  n 
1 12  DC  n 
1 13  DG  n 
2 1   DT  n 
2 2   DA  n 
2 3   DC  n 
2 4   DG  n 
2 5   DA  n 
2 6   DC  n 
2 7   DG  n 
2 8   DT  n 
2 9   DG  n 
2 10  DA  n 
2 11  DT  n 
2 12  DC  n 
2 13  DA  n 
2 14  DG  n 
2 15  DT  n 
2 16  DG  n 
2 17  DC  n 
2 18  DC  n 
3 1   MET n 
3 2   ILE n 
3 3   VAL n 
3 4   LEU n 
3 5   PHE n 
3 6   VAL n 
3 7   ASP n 
3 8   PHE n 
3 9   ASP n 
3 10  TYR n 
3 11  PHE n 
3 12  TYR n 
3 13  ALA n 
3 14  GLN n 
3 15  VAL n 
3 16  GLU n 
3 17  GLU n 
3 18  VAL n 
3 19  LEU n 
3 20  ASN n 
3 21  PRO n 
3 22  SER n 
3 23  LEU n 
3 24  LYS n 
3 25  GLY n 
3 26  LYS n 
3 27  PRO n 
3 28  VAL n 
3 29  VAL n 
3 30  VAL n 
3 31  CYS n 
3 32  VAL n 
3 33  PHE n 
3 34  SER n 
3 35  GLY n 
3 36  ARG n 
3 37  PHE n 
3 38  GLU n 
3 39  ASP n 
3 40  SER n 
3 41  GLY n 
3 42  ALA n 
3 43  VAL n 
3 44  ALA n 
3 45  THR n 
3 46  ALA n 
3 47  ASN n 
3 48  TYR n 
3 49  GLU n 
3 50  ALA n 
3 51  ARG n 
3 52  LYS n 
3 53  PHE n 
3 54  GLY n 
3 55  VAL n 
3 56  LYS n 
3 57  ALA n 
3 58  GLY n 
3 59  ILE n 
3 60  PRO n 
3 61  ILE n 
3 62  VAL n 
3 63  GLU n 
3 64  ALA n 
3 65  LYS n 
3 66  LYS n 
3 67  ILE n 
3 68  LEU n 
3 69  PRO n 
3 70  ASN n 
3 71  ALA n 
3 72  VAL n 
3 73  TYR n 
3 74  LEU n 
3 75  PRO n 
3 76  MET n 
3 77  ARG n 
3 78  LYS n 
3 79  GLU n 
3 80  VAL n 
3 81  TYR n 
3 82  GLN n 
3 83  GLN n 
3 84  VAL n 
3 85  SER n 
3 86  SER n 
3 87  ARG n 
3 88  ILE n 
3 89  MET n 
3 90  ASN n 
3 91  LEU n 
3 92  LEU n 
3 93  ARG n 
3 94  GLU n 
3 95  TYR n 
3 96  SER n 
3 97  GLU n 
3 98  LYS n 
3 99  ILE n 
3 100 GLU n 
3 101 ILE n 
3 102 ALA n 
3 103 SER n 
3 104 ILE n 
3 105 ASP n 
3 106 GLU n 
3 107 ALA n 
3 108 TYR n 
3 109 LEU n 
3 110 ASP n 
3 111 ILE n 
3 112 SER n 
3 113 ASP n 
3 114 LYS n 
3 115 VAL n 
3 116 ARG n 
3 117 ASP n 
3 118 TYR n 
3 119 ARG n 
3 120 GLU n 
3 121 ALA n 
3 122 TYR n 
3 123 ASN n 
3 124 LEU n 
3 125 GLY n 
3 126 LEU n 
3 127 GLU n 
3 128 ILE n 
3 129 LYS n 
3 130 ASN n 
3 131 LYS n 
3 132 ILE n 
3 133 LEU n 
3 134 GLU n 
3 135 LYS n 
3 136 GLU n 
3 137 LYS n 
3 138 ILE n 
3 139 THR n 
3 140 VAL n 
3 141 THR n 
3 142 VAL n 
3 143 GLY n 
3 144 ILE n 
3 145 SER n 
3 146 LYS n 
3 147 ASN n 
3 148 LYS n 
3 149 VAL n 
3 150 PHE n 
3 151 ALA n 
3 152 LYS n 
3 153 ILE n 
3 154 ALA n 
3 155 ALA n 
3 156 ASP n 
3 157 MET n 
3 158 ALA n 
3 159 LYS n 
3 160 PRO n 
3 161 ASN n 
3 162 GLY n 
3 163 ILE n 
3 164 LYS n 
3 165 VAL n 
3 166 ILE n 
3 167 ASP n 
3 168 ASP n 
3 169 GLU n 
3 170 GLU n 
3 171 VAL n 
3 172 LYS n 
3 173 ARG n 
3 174 LEU n 
3 175 ILE n 
3 176 ARG n 
3 177 GLU n 
3 178 LEU n 
3 179 ASP n 
3 180 ILE n 
3 181 ALA n 
3 182 ASP n 
3 183 VAL n 
3 184 PRO n 
3 185 GLY n 
3 186 ILE n 
3 187 GLY n 
3 188 ASN n 
3 189 ILE n 
3 190 THR n 
3 191 ALA n 
3 192 GLU n 
3 193 LYS n 
3 194 LEU n 
3 195 LYS n 
3 196 LYS n 
3 197 LEU n 
3 198 GLY n 
3 199 ILE n 
3 200 ASN n 
3 201 LYS n 
3 202 LEU n 
3 203 VAL n 
3 204 ASP n 
3 205 THR n 
3 206 LEU n 
3 207 SER n 
3 208 ILE n 
3 209 GLU n 
3 210 PHE n 
3 211 ASP n 
3 212 LYS n 
3 213 LEU n 
3 214 LYS n 
3 215 GLY n 
3 216 MET n 
3 217 ILE n 
3 218 GLY n 
3 219 GLU n 
3 220 ALA n 
3 221 LYS n 
3 222 ALA n 
3 223 LYS n 
3 224 TYR n 
3 225 LEU n 
3 226 ILE n 
3 227 SER n 
3 228 LEU n 
3 229 ALA n 
3 230 ARG n 
3 231 ASP n 
3 232 GLU n 
3 233 TYR n 
3 234 ASN n 
3 235 GLU n 
3 236 PRO n 
3 237 ILE n 
3 238 ARG n 
3 239 THR n 
3 240 ARG n 
3 241 VAL n 
3 242 ARG n 
3 243 LYS n 
3 244 SER n 
3 245 ILE n 
3 246 GLY n 
3 247 ARG n 
3 248 ILE n 
3 249 VAL n 
3 250 THR n 
3 251 MET n 
3 252 LYS n 
3 253 ARG n 
3 254 ASN n 
3 255 SER n 
3 256 ARG n 
3 257 ASN n 
3 258 LEU n 
3 259 GLU n 
3 260 GLU n 
3 261 ILE n 
3 262 LYS n 
3 263 PRO n 
3 264 TYR n 
3 265 LEU n 
3 266 PHE n 
3 267 ARG n 
3 268 ALA n 
3 269 ILE n 
3 270 GLU n 
3 271 GLU n 
3 272 SER n 
3 273 TYR n 
3 274 TYR n 
3 275 LYS n 
3 276 LEU n 
3 277 ASP n 
3 278 LYS n 
3 279 ARG n 
3 280 ILE n 
3 281 PRO n 
3 282 LYS n 
3 283 ALA n 
3 284 ILE n 
3 285 HIS n 
3 286 VAL n 
3 287 VAL n 
3 288 ALA n 
3 289 VAL n 
3 290 THR n 
3 291 GLU n 
3 292 ASP n 
3 293 LEU n 
3 294 ASP n 
3 295 ILE n 
3 296 VAL n 
3 297 SER n 
3 298 ARG n 
3 299 GLY n 
3 300 ARG n 
3 301 THR n 
3 302 PHE n 
3 303 PRO n 
3 304 HIS n 
3 305 GLY n 
3 306 ILE n 
3 307 SER n 
3 308 LYS n 
3 309 GLU n 
3 310 THR n 
3 311 ALA n 
3 312 TYR n 
3 313 SER n 
3 314 GLU n 
3 315 SER n 
3 316 VAL n 
3 317 LYS n 
3 318 LEU n 
3 319 LEU n 
3 320 GLN n 
3 321 LYS n 
3 322 ILE n 
3 323 LEU n 
3 324 GLU n 
3 325 GLU n 
3 326 ASP n 
3 327 GLU n 
3 328 ARG n 
3 329 LYS n 
3 330 ILE n 
3 331 ARG n 
3 332 ARG n 
3 333 ILE n 
3 334 GLY n 
3 335 VAL n 
3 336 ARG n 
3 337 PHE n 
3 338 SER n 
3 339 LYS n 
3 340 PHE n 
3 341 ILE n 
3 342 GLU n 
3 343 ALA n 
3 344 ILE n 
3 345 GLY n 
3 346 LEU n 
3 347 ASP n 
3 348 LYS n 
3 349 PHE n 
3 350 PHE n 
3 351 ASP n 
3 352 THR n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Sulfolobus 
_entity_src_gen.pdbx_gene_src_gene                 DPO4 
_entity_src_gen.gene_src_species                   'Sulfolobus solfataricus' 
_entity_src_gen.gene_src_strain                    P2 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Sulfolobus solfataricus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     273057 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET22B 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DPO42_SULSO Q97W02 3 
;MIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEARKFGVKAGIPIVEAKKILPNAVYLPMRKEV
YQQVSSRIMNLLREYSEKIEIASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVFAKIAADMAKP
NGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGINKLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTR
VRKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSESVKLLQ
KILEEDERKIRRIGVRFSKFIEAIGLDKFFDT
;
1 ? 
2 PDB 1S0N        1S0N   1 ? ? ? 
3 PDB 1S0N        1S0N   2 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1S0N A 1 ? 352 ? Q97W02 1 ? 352 ? 1 352 
2 2 1S0N P 1 ? 13  ? 1S0N   1 ? 13  ? 1 13  
3 3 1S0N T 1 ? 18  ? 1S0N   1 ? 18  ? 1 18  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'       133.103 
CA  non-polymer         . 'CALCIUM ION'                        ? 'Ca 2'             40.078  
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'     121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P'  331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'   307.197 
DCP non-polymer         . "2'-DEOXYCYTIDINE-5'-TRIPHOSPHATE"   ? 'C9 H16 N3 O13 P3' 467.157 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P'  347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P'  322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                                ? 'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'       119.119 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          1S0N 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   56.45 
_exptl_crystal.description           ? 
_exptl_crystal.density_Matthews      2.85 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_details    'PEG3350, CA(AC)2, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 295K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 PEG3350   ? ? ? 
1 2 1 'CA(AC)2' ? ? ? 
1 3 1 H2O       ? ? ? 
1 4 2 PEG3350   ? ? ? 
1 5 2 'CA(AC)2' ? ? ? 
1 6 2 H2O       ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2003-09-10 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    MIRRORS 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_refine.entry_id                                 1S0N 
_refine.ls_number_reflns_obs                     12345 
_refine.ls_number_reflns_all                     13915 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30 
_refine.ls_d_res_high                            2.8 
_refine.ls_percent_reflns_obs                    88.7 
_refine.ls_R_factor_obs                          0.238 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.238 
_refine.ls_R_factor_R_free                       0.275 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  838 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            -2.850 
_refine.aniso_B[2][2]                            6.199 
_refine.aniso_B[3][3]                            -3.349 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB entry 1JX4' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'ENGH & HUBER' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2743 
_refine_hist.pdbx_number_atoms_nucleic_acid   620 
_refine_hist.pdbx_number_atoms_ligand         31 
_refine_hist.number_atoms_solvent             23 
_refine_hist.number_atoms_total               3417 
_refine_hist.d_res_high                       2.8 
_refine_hist.d_res_low                        30 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_mcbond_it  1.478 1.5 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it 2.626 2.0 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it  1.865 2.0 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it 3.105 2.5 ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param ? 'X-RAY DIFFRACTION' 
2 dna-rna_rep.param ? 'X-RAY DIFFRACTION' 
3 dcp_comb.param    ? 'X-RAY DIFFRACTION' 
4 ion.param         ? 'X-RAY DIFFRACTION' 
5 water_rep.param   ? 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1S0N 
_struct.title                     
'Snapshots of replication through an abasic lesion: structural basis for base substitution and frameshift' 
_struct.pdbx_descriptor           'DNA polymerase IV (E.C.2.7.7.7)/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1S0N 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
_struct_keywords.text            'abasic lesion, LESION BYPASS, POLYMERASE, TRANSFERASE-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 4 ? 
G N N 5 ? 
H N N 6 ? 
I N N 6 ? 
J N N 6 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  TYR C 10  ? ASN C 20  ? TYR A 10  ASN A 20  1 ? 11 
HELX_P HELX_P2  2  PRO C 21  ? LYS C 24  ? PRO A 21  LYS A 24  5 ? 4  
HELX_P HELX_P3  3  ASN C 47  ? LYS C 52  ? ASN A 47  LYS A 52  1 ? 6  
HELX_P HELX_P4  4  PRO C 60  ? LEU C 68  ? PRO A 60  LEU A 68  1 ? 9  
HELX_P HELX_P5  5  ARG C 77  ? ARG C 93  ? ARG A 77  ARG A 93  1 ? 17 
HELX_P HELX_P6  6  ASP C 117 ? LYS C 137 ? ASP A 117 LYS A 137 1 ? 21 
HELX_P HELX_P7  7  ASN C 147 ? LYS C 159 ? ASN A 147 LYS A 159 1 ? 13 
HELX_P HELX_P8  8  ASP C 167 ? LEU C 178 ? ASP A 167 LEU A 178 1 ? 12 
HELX_P HELX_P9  9  ASP C 179 ? VAL C 183 ? ASP A 179 VAL A 183 5 ? 5  
HELX_P HELX_P10 10 GLY C 187 ? LYS C 196 ? GLY A 187 LYS A 196 1 ? 10 
HELX_P HELX_P11 11 LYS C 201 ? LEU C 206 ? LYS A 201 LEU A 206 5 ? 6  
HELX_P HELX_P12 12 GLU C 209 ? GLY C 218 ? GLU A 209 GLY A 218 1 ? 10 
HELX_P HELX_P13 13 GLY C 218 ? ARG C 230 ? GLY A 218 ARG A 230 1 ? 13 
HELX_P HELX_P14 14 ASN C 257 ? ASP C 277 ? ASN A 257 ASP A 277 1 ? 21 
HELX_P HELX_P15 15 SER C 307 ? GLU C 324 ? SER A 307 GLU A 324 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? D CA .  CA ? ? ? 1_555 G DCP .   O1A ? ? A CA 403 A DCP 804 1_555 ? ? ? ? ? ? ?            2.152 ? 
metalc2  metalc ? ? D CA .  CA ? ? ? 1_555 J HOH .   O   ? ? A CA 403 A HOH 813 1_555 ? ? ? ? ? ? ?            2.118 ? 
metalc3  metalc ? ? D CA .  CA ? ? ? 1_555 C ASP 7   OD1 ? ? A CA 403 A ASP 7   1_555 ? ? ? ? ? ? ?            3.322 ? 
metalc4  metalc ? ? D CA .  CA ? ? ? 1_555 C ASP 7   OD2 ? ? A CA 403 A ASP 7   1_555 ? ? ? ? ? ? ?            2.849 ? 
metalc5  metalc ? ? D CA .  CA ? ? ? 1_555 J HOH .   O   ? ? A CA 403 A HOH 805 1_555 ? ? ? ? ? ? ?            2.570 ? 
metalc6  metalc ? ? D CA .  CA ? ? ? 1_555 C GLU 106 OE2 ? ? A CA 403 A GLU 106 1_555 ? ? ? ? ? ? ?            2.377 ? 
metalc7  metalc ? ? E CA .  CA ? ? ? 1_555 G DCP .   O1G ? ? A CA 404 A DCP 804 1_555 ? ? ? ? ? ? ?            2.225 ? 
metalc8  metalc ? ? E CA .  CA ? ? ? 1_555 C ASP 105 OD2 ? ? A CA 404 A ASP 105 1_555 ? ? ? ? ? ? ?            2.488 ? 
metalc9  metalc ? ? E CA .  CA ? ? ? 1_555 G DCP .   O2B ? ? A CA 404 A DCP 804 1_555 ? ? ? ? ? ? ?            2.494 ? 
metalc10 metalc ? ? E CA .  CA ? ? ? 1_555 G DCP .   O1A ? ? A CA 404 A DCP 804 1_555 ? ? ? ? ? ? ?            2.474 ? 
metalc11 metalc ? ? E CA .  CA ? ? ? 1_555 C ASP 7   OD1 ? ? A CA 404 A ASP 7   1_555 ? ? ? ? ? ? ?            2.231 ? 
metalc12 metalc ? ? E CA .  CA ? ? ? 1_555 C PHE 8   O   ? ? A CA 404 A PHE 8   1_555 ? ? ? ? ? ? ?            2.253 ? 
metalc13 metalc ? ? F CA .  CA ? ? ? 1_555 C ALA 181 O   ? ? A CA 405 A ALA 181 1_555 ? ? ? ? ? ? ?            2.565 ? 
metalc14 metalc ? ? F CA .  CA ? ? ? 1_555 C ILE 186 O   ? ? A CA 405 A ILE 186 1_555 ? ? ? ? ? ? ?            2.667 ? 
metalc15 metalc ? ? F CA .  CA ? ? ? 1_555 J HOH .   O   ? ? A CA 405 A HOH 816 1_555 ? ? ? ? ? ? ?            2.553 ? 
hydrog1  hydrog ? ? A DG 1  N1 ? ? ? 1_555 B DC  18  N3  ? ? P DG 1   T DC  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? A DG 1  N2 ? ? ? 1_555 B DC  18  O2  ? ? P DG 1   T DC  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? A DG 1  O6 ? ? ? 1_555 B DC  18  N4  ? ? P DG 1   T DC  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? A DG 2  N1 ? ? ? 1_555 B DC  17  N3  ? ? P DG 2   T DC  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? A DG 2  N2 ? ? ? 1_555 B DC  17  O2  ? ? P DG 2   T DC  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? A DG 2  O6 ? ? ? 1_555 B DC  17  N4  ? ? P DG 2   T DC  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? A DC 3  N3 ? ? ? 1_555 B DG  16  N1  ? ? P DC 3   T DG  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? A DC 3  N4 ? ? ? 1_555 B DG  16  O6  ? ? P DC 3   T DG  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? A DC 3  O2 ? ? ? 1_555 B DG  16  N2  ? ? P DC 3   T DG  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? A DA 4  N1 ? ? ? 1_555 B DT  15  N3  ? ? P DA 4   T DT  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? A DA 4  N6 ? ? ? 1_555 B DT  15  O4  ? ? P DA 4   T DT  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? A DC 5  N3 ? ? ? 1_555 B DG  14  N1  ? ? P DC 5   T DG  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? A DC 5  N4 ? ? ? 1_555 B DG  14  O6  ? ? P DC 5   T DG  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? A DC 5  O2 ? ? ? 1_555 B DG  14  N2  ? ? P DC 5   T DG  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? A DT 6  N3 ? ? ? 1_555 B DA  13  N1  ? ? P DT 6   T DA  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? A DT 6  O4 ? ? ? 1_555 B DA  13  N6  ? ? P DT 6   T DA  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? A DG 7  N1 ? ? ? 1_555 B DC  12  N3  ? ? P DG 7   T DC  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? A DG 7  N2 ? ? ? 1_555 B DC  12  O2  ? ? P DG 7   T DC  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? A DG 7  O6 ? ? ? 1_555 B DC  12  N4  ? ? P DG 7   T DC  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? A DA 8  N1 ? ? ? 1_555 B DT  11  N3  ? ? P DA 8   T DT  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? A DA 8  N6 ? ? ? 1_555 B DT  11  O4  ? ? P DA 8   T DT  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? A DT 9  N3 ? ? ? 1_555 B DA  10  N1  ? ? P DT 9   T DA  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? A DT 9  O4 ? ? ? 1_555 B DA  10  N6  ? ? P DT 9   T DA  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? A DC 10 N3 ? ? ? 1_555 B DG  9   N1  ? ? P DC 10  T DG  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? A DC 10 N4 ? ? ? 1_555 B DG  9   O6  ? ? P DC 10  T DG  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? A DC 10 O2 ? ? ? 1_555 B DG  9   N2  ? ? P DC 10  T DG  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? A DA 11 N1 ? ? ? 1_555 B DT  8   N3  ? ? P DA 11  T DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? A DA 11 N6 ? ? ? 1_555 B DT  8   O4  ? ? P DA 11  T DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? A DC 12 N3 ? ? ? 1_555 B DG  7   N1  ? ? P DC 12  T DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? A DC 12 N4 ? ? ? 1_555 B DG  7   O6  ? ? P DC 12  T DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? A DC 12 O2 ? ? ? 1_555 B DG  7   N2  ? ? P DC 12  T DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? A DG 13 N1 ? ? ? 1_555 B DC  6   N3  ? ? P DG 13  T DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? A DG 13 N2 ? ? ? 1_555 B DC  6   O2  ? ? P DG 13  T DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? A DG 13 O6 ? ? ? 1_555 B DC  6   N4  ? ? P DG 13  T DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          LYS 
_struct_mon_prot_cis.label_seq_id           159 
_struct_mon_prot_cis.label_asym_id          C 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           LYS 
_struct_mon_prot_cis.auth_seq_id            159 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    160 
_struct_mon_prot_cis.pdbx_label_asym_id_2   C 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     160 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -0.05 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 3 ? 
C ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE C 99  ? SER C 103 ? ILE A 99  SER A 103 
A 2 GLU C 106 ? ASP C 110 ? GLU A 106 ASP A 110 
A 3 VAL C 3   ? PHE C 8   ? VAL A 3   PHE A 8   
A 4 VAL C 140 ? SER C 145 ? VAL A 140 SER A 145 
A 5 ILE C 163 ? ILE C 166 ? ILE A 163 ILE A 166 
B 1 GLY C 41  ? ALA C 46  ? GLY A 41  ALA A 46  
B 2 VAL C 28  ? PHE C 33  ? VAL A 28  PHE A 33  
B 3 VAL C 72  ? PRO C 75  ? VAL A 72  PRO A 75  
C 1 SER C 244 ? SER C 255 ? SER A 244 SER A 255 
C 2 ILE C 330 ? PHE C 340 ? ILE A 330 PHE A 340 
C 3 PRO C 281 ? THR C 290 ? PRO A 281 THR A 290 
C 4 ILE C 295 ? THR C 301 ? ILE A 295 THR A 301 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU C 100 ? N GLU A 100 O TYR C 108 ? O TYR A 108 
A 2 3 O LEU C 109 ? O LEU A 109 N LEU C 4   ? N LEU A 4   
A 3 4 N PHE C 5   ? N PHE A 5   O GLY C 143 ? O GLY A 143 
A 4 5 N ILE C 144 ? N ILE A 144 O LYS C 164 ? O LYS A 164 
B 1 2 O ALA C 42  ? O ALA A 42  N VAL C 32  ? N VAL A 32  
B 2 3 N CYS C 31  ? N CYS A 31  O LEU C 74  ? O LEU A 74  
C 1 2 N VAL C 249 ? N VAL A 249 O ILE C 333 ? O ILE A 333 
C 2 3 O ARG C 336 ? O ARG A 336 N HIS C 285 ? N HIS A 285 
C 3 4 N ALA C 288 ? N ALA A 288 O VAL C 296 ? O VAL A 296 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE CA A 403'  
AC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CA A 404'  
AC3 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CA A 405'  
AC4 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE DCP A 804' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 7  ASP C 7   ? ASP A 7   . ? 1_555 ? 
2  AC1 7  GLU C 106 ? GLU A 106 . ? 1_555 ? 
3  AC1 7  CA  E .   ? CA  A 404 . ? 1_555 ? 
4  AC1 7  DCP G .   ? DCP A 804 . ? 1_555 ? 
5  AC1 7  HOH J .   ? HOH A 805 . ? 1_555 ? 
6  AC1 7  HOH J .   ? HOH A 813 . ? 1_555 ? 
7  AC1 7  DG  A 13  ? DG  P 13  . ? 1_555 ? 
8  AC2 5  ASP C 7   ? ASP A 7   . ? 1_555 ? 
9  AC2 5  PHE C 8   ? PHE A 8   . ? 1_555 ? 
10 AC2 5  ASP C 105 ? ASP A 105 . ? 1_555 ? 
11 AC2 5  CA  D .   ? CA  A 403 . ? 1_555 ? 
12 AC2 5  DCP G .   ? DCP A 804 . ? 1_555 ? 
13 AC3 3  ALA C 181 ? ALA A 181 . ? 1_555 ? 
14 AC3 3  ILE C 186 ? ILE A 186 . ? 1_555 ? 
15 AC3 3  HOH J .   ? HOH A 816 . ? 1_555 ? 
16 AC4 17 ASP C 7   ? ASP A 7   . ? 1_555 ? 
17 AC4 17 PHE C 8   ? PHE A 8   . ? 1_555 ? 
18 AC4 17 TYR C 10  ? TYR A 10  . ? 1_555 ? 
19 AC4 17 PHE C 11  ? PHE A 11  . ? 1_555 ? 
20 AC4 17 TYR C 12  ? TYR A 12  . ? 1_555 ? 
21 AC4 17 ALA C 44  ? ALA A 44  . ? 1_555 ? 
22 AC4 17 THR C 45  ? THR A 45  . ? 1_555 ? 
23 AC4 17 TYR C 48  ? TYR A 48  . ? 1_555 ? 
24 AC4 17 ARG C 51  ? ARG A 51  . ? 1_555 ? 
25 AC4 17 MET C 76  ? MET A 76  . ? 1_555 ? 
26 AC4 17 ASP C 105 ? ASP A 105 . ? 1_555 ? 
27 AC4 17 LYS C 159 ? LYS A 159 . ? 1_555 ? 
28 AC4 17 CA  D .   ? CA  A 403 . ? 1_555 ? 
29 AC4 17 CA  E .   ? CA  A 404 . ? 1_555 ? 
30 AC4 17 HOH J .   ? HOH A 813 . ? 1_555 ? 
31 AC4 17 DG  A 13  ? DG  P 13  . ? 1_555 ? 
32 AC4 17 DG  B 4   ? DG  T 4   . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1S0N 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1S0N 
_atom_sites.fract_transf_matrix[1][1]   0.010090 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009741 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.018805 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O  "O5'" . DG  A 1 1   ? 31.885  48.866 32.948  1.00 82.26  ? 1   DG  P "O5'" 1 
ATOM   2    C  "C5'" . DG  A 1 1   ? 31.219  48.695 34.206  1.00 81.80  ? 1   DG  P "C5'" 1 
ATOM   3    C  "C4'" . DG  A 1 1   ? 31.737  47.447 34.878  1.00 80.94  ? 1   DG  P "C4'" 1 
ATOM   4    O  "O4'" . DG  A 1 1   ? 30.963  47.162 36.065  1.00 80.18  ? 1   DG  P "O4'" 1 
ATOM   5    C  "C3'" . DG  A 1 1   ? 31.615  46.209 33.999  1.00 81.66  ? 1   DG  P "C3'" 1 
ATOM   6    O  "O3'" . DG  A 1 1   ? 32.742  45.370 34.203  1.00 84.10  ? 1   DG  P "O3'" 1 
ATOM   7    C  "C2'" . DG  A 1 1   ? 30.362  45.529 34.511  1.00 80.00  ? 1   DG  P "C2'" 1 
ATOM   8    C  "C1'" . DG  A 1 1   ? 30.430  45.847 35.985  1.00 78.63  ? 1   DG  P "C1'" 1 
ATOM   9    N  N9    . DG  A 1 1   ? 29.145  45.839 36.681  1.00 76.44  ? 1   DG  P N9    1 
ATOM   10   C  C8    . DG  A 1 1   ? 27.979  46.436 36.279  1.00 75.39  ? 1   DG  P C8    1 
ATOM   11   N  N7    . DG  A 1 1   ? 27.013  46.309 37.146  1.00 74.96  ? 1   DG  P N7    1 
ATOM   12   C  C5    . DG  A 1 1   ? 27.572  45.573 38.177  1.00 75.01  ? 1   DG  P C5    1 
ATOM   13   C  C6    . DG  A 1 1   ? 27.012  45.149 39.401  1.00 75.84  ? 1   DG  P C6    1 
ATOM   14   O  O6    . DG  A 1 1   ? 25.872  45.357 39.834  1.00 75.55  ? 1   DG  P O6    1 
ATOM   15   N  N1    . DG  A 1 1   ? 27.928  44.418 40.159  1.00 76.42  ? 1   DG  P N1    1 
ATOM   16   C  C2    . DG  A 1 1   ? 29.223  44.140 39.780  1.00 76.34  ? 1   DG  P C2    1 
ATOM   17   N  N2    . DG  A 1 1   ? 29.960  43.420 40.641  1.00 74.94  ? 1   DG  P N2    1 
ATOM   18   N  N3    . DG  A 1 1   ? 29.757  44.542 38.639  1.00 76.41  ? 1   DG  P N3    1 
ATOM   19   C  C4    . DG  A 1 1   ? 28.882  45.252 37.893  1.00 75.88  ? 1   DG  P C4    1 
ATOM   20   P  P     . DG  A 1 2   ? 32.987  44.134 33.217  1.00 85.45  ? 2   DG  P P     1 
ATOM   21   O  OP1   . DG  A 1 2   ? 34.452  44.019 32.996  1.00 84.57  ? 2   DG  P OP1   1 
ATOM   22   O  OP2   . DG  A 1 2   ? 32.082  44.318 32.056  1.00 84.23  ? 2   DG  P OP2   1 
ATOM   23   O  "O5'" . DG  A 1 2   ? 32.471  42.898 34.075  1.00 85.63  ? 2   DG  P "O5'" 1 
ATOM   24   C  "C5'" . DG  A 1 2   ? 33.069  42.585 35.328  1.00 87.04  ? 2   DG  P "C5'" 1 
ATOM   25   C  "C4'" . DG  A 1 2   ? 32.360  41.411 35.956  1.00 89.62  ? 2   DG  P "C4'" 1 
ATOM   26   O  "O4'" . DG  A 1 2   ? 31.091  41.827 36.517  1.00 90.04  ? 2   DG  P "O4'" 1 
ATOM   27   C  "C3'" . DG  A 1 2   ? 32.036  40.275 34.980  1.00 91.58  ? 2   DG  P "C3'" 1 
ATOM   28   O  "O3'" . DG  A 1 2   ? 32.183  39.021 35.658  1.00 94.17  ? 2   DG  P "O3'" 1 
ATOM   29   C  "C2'" . DG  A 1 2   ? 30.569  40.506 34.670  1.00 90.88  ? 2   DG  P "C2'" 1 
ATOM   30   C  "C1'" . DG  A 1 2   ? 30.076  40.963 36.028  1.00 89.77  ? 2   DG  P "C1'" 1 
ATOM   31   N  N9    . DG  A 1 2   ? 28.801  41.682 36.039  1.00 88.51  ? 2   DG  P N9    1 
ATOM   32   C  C8    . DG  A 1 2   ? 28.273  42.463 35.037  1.00 88.33  ? 2   DG  P C8    1 
ATOM   33   N  N7    . DG  A 1 2   ? 27.104  42.960 35.341  1.00 88.50  ? 2   DG  P N7    1 
ATOM   34   C  C5    . DG  A 1 2   ? 26.843  42.484 36.622  1.00 87.78  ? 2   DG  P C5    1 
ATOM   35   C  C6    . DG  A 1 2   ? 25.718  42.683 37.476  1.00 86.61  ? 2   DG  P C6    1 
ATOM   36   O  O6    . DG  A 1 2   ? 24.702  43.365 37.274  1.00 84.02  ? 2   DG  P O6    1 
ATOM   37   N  N1    . DG  A 1 2   ? 25.859  41.991 38.677  1.00 86.44  ? 2   DG  P N1    1 
ATOM   38   C  C2    . DG  A 1 2   ? 26.938  41.215 39.022  1.00 86.02  ? 2   DG  P C2    1 
ATOM   39   N  N2    . DG  A 1 2   ? 26.878  40.619 40.222  1.00 84.05  ? 2   DG  P N2    1 
ATOM   40   N  N3    . DG  A 1 2   ? 27.996  41.036 38.247  1.00 87.33  ? 2   DG  P N3    1 
ATOM   41   C  C4    . DG  A 1 2   ? 27.883  41.690 37.066  1.00 87.91  ? 2   DG  P C4    1 
ATOM   42   P  P     . DC  A 1 3   ? 32.428  37.666 34.824  1.00 93.34  ? 3   DC  P P     1 
ATOM   43   O  OP1   . DC  A 1 3   ? 33.890  37.425 34.737  1.00 91.37  ? 3   DC  P OP1   1 
ATOM   44   O  OP2   . DC  A 1 3   ? 31.614  37.707 33.584  1.00 93.85  ? 3   DC  P OP2   1 
ATOM   45   O  "O5'" . DC  A 1 3   ? 31.795  36.572 35.786  1.00 95.19  ? 3   DC  P "O5'" 1 
ATOM   46   C  "C5'" . DC  A 1 3   ? 32.166  36.532 37.159  1.00 98.64  ? 3   DC  P "C5'" 1 
ATOM   47   C  "C4'" . DC  A 1 3   ? 31.138  35.765 37.954  1.00 101.26 ? 3   DC  P "C4'" 1 
ATOM   48   O  "O4'" . DC  A 1 3   ? 29.991  36.598 38.256  1.00 101.48 ? 3   DC  P "O4'" 1 
ATOM   49   C  "C3'" . DC  A 1 3   ? 30.604  34.526 37.236  1.00 102.11 ? 3   DC  P "C3'" 1 
ATOM   50   O  "O3'" . DC  A 1 3   ? 30.532  33.430 38.145  1.00 103.54 ? 3   DC  P "O3'" 1 
ATOM   51   C  "C2'" . DC  A 1 3   ? 29.216  34.944 36.789  1.00 102.34 ? 3   DC  P "C2'" 1 
ATOM   52   C  "C1'" . DC  A 1 3   ? 28.803  35.922 37.881  1.00 103.15 ? 3   DC  P "C1'" 1 
ATOM   53   N  N1    . DC  A 1 3   ? 27.838  36.929 37.424  1.00 104.22 ? 3   DC  P N1    1 
ATOM   54   C  C2    . DC  A 1 3   ? 26.577  37.012 38.046  1.00 104.31 ? 3   DC  P C2    1 
ATOM   55   O  O2    . DC  A 1 3   ? 26.311  36.242 38.993  1.00 103.67 ? 3   DC  P O2    1 
ATOM   56   N  N3    . DC  A 1 3   ? 25.684  37.927 37.596  1.00 104.43 ? 3   DC  P N3    1 
ATOM   57   C  C4    . DC  A 1 3   ? 26.005  38.728 36.571  1.00 103.91 ? 3   DC  P C4    1 
ATOM   58   N  N4    . DC  A 1 3   ? 25.091  39.599 36.144  1.00 102.99 ? 3   DC  P N4    1 
ATOM   59   C  C5    . DC  A 1 3   ? 27.278  38.670 35.936  1.00 103.52 ? 3   DC  P C5    1 
ATOM   60   C  C6    . DC  A 1 3   ? 28.155  37.770 36.392  1.00 104.15 ? 3   DC  P C6    1 
ATOM   61   P  P     . DA  A 1 4   ? 30.095  31.986 37.612  1.00 103.89 ? 4   DA  P P     1 
ATOM   62   O  OP1   . DA  A 1 4   ? 30.776  30.977 38.460  1.00 103.73 ? 4   DA  P OP1   1 
ATOM   63   O  OP2   . DA  A 1 4   ? 30.299  31.971 36.142  1.00 102.61 ? 4   DA  P OP2   1 
ATOM   64   O  "O5'" . DA  A 1 4   ? 28.531  31.947 37.916  1.00 104.14 ? 4   DA  P "O5'" 1 
ATOM   65   C  "C5'" . DA  A 1 4   ? 28.040  32.197 39.232  1.00 105.10 ? 4   DA  P "C5'" 1 
ATOM   66   C  "C4'" . DA  A 1 4   ? 26.531  32.135 39.241  1.00 107.05 ? 4   DA  P "C4'" 1 
ATOM   67   O  "O4'" . DA  A 1 4   ? 25.952  33.336 38.667  1.00 107.47 ? 4   DA  P "O4'" 1 
ATOM   68   C  "C3'" . DA  A 1 4   ? 25.966  30.963 38.439  1.00 108.19 ? 4   DA  P "C3'" 1 
ATOM   69   O  "O3'" . DA  A 1 4   ? 24.865  30.389 39.139  1.00 109.43 ? 4   DA  P "O3'" 1 
ATOM   70   C  "C2'" . DA  A 1 4   ? 25.471  31.615 37.160  1.00 108.27 ? 4   DA  P "C2'" 1 
ATOM   71   C  "C1'" . DA  A 1 4   ? 25.023  32.981 37.650  1.00 107.71 ? 4   DA  P "C1'" 1 
ATOM   72   N  N9    . DA  A 1 4   ? 25.051  34.020 36.625  1.00 107.16 ? 4   DA  P N9    1 
ATOM   73   C  C8    . DA  A 1 4   ? 26.105  34.370 35.815  1.00 106.71 ? 4   DA  P C8    1 
ATOM   74   N  N7    . DA  A 1 4   ? 25.839  35.350 34.990  1.00 106.60 ? 4   DA  P N7    1 
ATOM   75   C  C5    . DA  A 1 4   ? 24.518  35.675 35.274  1.00 106.32 ? 4   DA  P C5    1 
ATOM   76   C  C6    . DA  A 1 4   ? 23.656  36.649 34.747  1.00 106.05 ? 4   DA  P C6    1 
ATOM   77   N  N6    . DA  A 1 4   ? 24.015  37.525 33.807  1.00 104.90 ? 4   DA  P N6    1 
ATOM   78   N  N1    . DA  A 1 4   ? 22.397  36.701 35.236  1.00 106.35 ? 4   DA  P N1    1 
ATOM   79   C  C2    . DA  A 1 4   ? 22.048  35.837 36.201  1.00 106.78 ? 4   DA  P C2    1 
ATOM   80   N  N3    . DA  A 1 4   ? 22.777  34.888 36.789  1.00 106.68 ? 4   DA  P N3    1 
ATOM   81   C  C4    . DA  A 1 4   ? 24.022  34.858 36.271  1.00 106.53 ? 4   DA  P C4    1 
ATOM   82   P  P     . DC  A 1 5   ? 24.491  28.850 38.906  1.00 108.35 ? 5   DC  P P     1 
ATOM   83   O  OP1   . DC  A 1 5   ? 25.071  28.068 40.031  1.00 107.48 ? 5   DC  P OP1   1 
ATOM   84   O  OP2   . DC  A 1 5   ? 24.859  28.513 37.500  1.00 106.64 ? 5   DC  P OP2   1 
ATOM   85   O  "O5'" . DC  A 1 5   ? 22.907  28.849 39.050  1.00 106.12 ? 5   DC  P "O5'" 1 
ATOM   86   C  "C5'" . DC  A 1 5   ? 22.082  28.371 38.000  1.00 105.06 ? 5   DC  P "C5'" 1 
ATOM   87   C  "C4'" . DC  A 1 5   ? 20.909  29.297 37.804  1.00 103.91 ? 5   DC  P "C4'" 1 
ATOM   88   O  "O4'" . DC  A 1 5   ? 21.359  30.537 37.192  1.00 103.47 ? 5   DC  P "O4'" 1 
ATOM   89   C  "C3'" . DC  A 1 5   ? 19.844  28.727 36.869  1.00 103.14 ? 5   DC  P "C3'" 1 
ATOM   90   O  "O3'" . DC  A 1 5   ? 18.545  29.001 37.377  1.00 102.84 ? 5   DC  P "O3'" 1 
ATOM   91   C  "C2'" . DC  A 1 5   ? 20.050  29.492 35.578  1.00 104.00 ? 5   DC  P "C2'" 1 
ATOM   92   C  "C1'" . DC  A 1 5   ? 20.518  30.837 36.089  1.00 103.64 ? 5   DC  P "C1'" 1 
ATOM   93   N  N1    . DC  A 1 5   ? 21.280  31.620 35.106  1.00 102.88 ? 5   DC  P N1    1 
ATOM   94   C  C2    . DC  A 1 5   ? 20.601  32.580 34.337  1.00 102.46 ? 5   DC  P C2    1 
ATOM   95   O  O2    . DC  A 1 5   ? 19.390  32.750 34.518  1.00 101.13 ? 5   DC  P O2    1 
ATOM   96   N  N3    . DC  A 1 5   ? 21.279  33.298 33.422  1.00 102.64 ? 5   DC  P N3    1 
ATOM   97   C  C4    . DC  A 1 5   ? 22.588  33.105 33.264  1.00 102.79 ? 5   DC  P C4    1 
ATOM   98   N  N4    . DC  A 1 5   ? 23.221  33.856 32.358  1.00 103.30 ? 5   DC  P N4    1 
ATOM   99   C  C5    . DC  A 1 5   ? 23.308  32.138 34.031  1.00 102.69 ? 5   DC  P C5    1 
ATOM   100  C  C6    . DC  A 1 5   ? 22.621  31.425 34.932  1.00 102.61 ? 5   DC  P C6    1 
ATOM   101  P  P     . DT  A 1 6   ? 17.324  28.077 36.924  1.00 103.92 ? 6   DT  P P     1 
ATOM   102  O  OP1   . DT  A 1 6   ? 16.344  28.007 38.040  1.00 103.68 ? 6   DT  P OP1   1 
ATOM   103  O  OP2   . DT  A 1 6   ? 17.974  26.833 36.439  1.00 104.41 ? 6   DT  P OP2   1 
ATOM   104  O  "O5'" . DT  A 1 6   ? 16.664  28.859 35.692  1.00 102.21 ? 6   DT  P "O5'" 1 
ATOM   105  C  "C5'" . DT  A 1 6   ? 15.642  29.838 35.914  1.00 100.01 ? 6   DT  P "C5'" 1 
ATOM   106  C  "C4'" . DT  A 1 6   ? 15.020  30.303 34.613  1.00 97.46  ? 6   DT  P "C4'" 1 
ATOM   107  O  "O4'" . DT  A 1 6   ? 15.930  31.099 33.818  1.00 96.19  ? 6   DT  P "O4'" 1 
ATOM   108  C  "C3'" . DT  A 1 6   ? 14.454  29.248 33.666  1.00 96.32  ? 6   DT  P "C3'" 1 
ATOM   109  O  "O3'" . DT  A 1 6   ? 13.252  29.775 33.117  1.00 96.48  ? 6   DT  P "O3'" 1 
ATOM   110  C  "C2'" . DT  A 1 6   ? 15.492  29.182 32.558  1.00 95.10  ? 6   DT  P "C2'" 1 
ATOM   111  C  "C1'" . DT  A 1 6   ? 15.922  30.635 32.474  1.00 93.17  ? 6   DT  P "C1'" 1 
ATOM   112  N  N1    . DT  A 1 6   ? 17.260  30.883 31.917  1.00 89.32  ? 6   DT  P N1    1 
ATOM   113  C  C2    . DT  A 1 6   ? 17.387  31.844 30.939  1.00 87.12  ? 6   DT  P C2    1 
ATOM   114  O  O2    . DT  A 1 6   ? 16.440  32.471 30.490  1.00 85.19  ? 6   DT  P O2    1 
ATOM   115  N  N3    . DT  A 1 6   ? 18.672  32.049 30.506  1.00 86.02  ? 6   DT  P N3    1 
ATOM   116  C  C4    . DT  A 1 6   ? 19.818  31.400 30.938  1.00 87.18  ? 6   DT  P C4    1 
ATOM   117  O  O4    . DT  A 1 6   ? 20.916  31.703 30.463  1.00 85.60  ? 6   DT  P O4    1 
ATOM   118  C  C5    . DT  A 1 6   ? 19.604  30.389 31.952  1.00 87.75  ? 6   DT  P C5    1 
ATOM   119  C  C7    . DT  A 1 6   ? 20.778  29.620 32.471  1.00 87.58  ? 6   DT  P C7    1 
ATOM   120  C  C6    . DT  A 1 6   ? 18.352  30.183 32.380  1.00 88.22  ? 6   DT  P C6    1 
ATOM   121  P  P     . DG  A 1 7   ? 12.048  28.791 32.769  1.00 97.30  ? 7   DG  P P     1 
ATOM   122  O  OP1   . DG  A 1 7   ? 10.954  29.067 33.743  1.00 95.97  ? 7   DG  P OP1   1 
ATOM   123  O  OP2   . DG  A 1 7   ? 12.683  27.447 32.726  1.00 96.58  ? 7   DG  P OP2   1 
ATOM   124  O  "O5'" . DG  A 1 7   ? 11.592  29.221 31.291  1.00 95.92  ? 7   DG  P "O5'" 1 
ATOM   125  C  "C5'" . DG  A 1 7   ? 10.909  30.464 31.045  1.00 92.21  ? 7   DG  P "C5'" 1 
ATOM   126  C  "C4'" . DG  A 1 7   ? 11.131  30.937 29.621  1.00 90.25  ? 7   DG  P "C4'" 1 
ATOM   127  O  "O4'" . DG  A 1 7   ? 12.550  31.117 29.383  1.00 89.15  ? 7   DG  P "O4'" 1 
ATOM   128  C  "C3'" . DG  A 1 7   ? 10.636  30.041 28.478  1.00 89.36  ? 7   DG  P "C3'" 1 
ATOM   129  O  "O3'" . DG  A 1 7   ? 10.088  30.860 27.428  1.00 86.78  ? 7   DG  P "O3'" 1 
ATOM   130  C  "C2'" . DG  A 1 7   ? 11.904  29.356 27.995  1.00 88.40  ? 7   DG  P "C2'" 1 
ATOM   131  C  "C1'" . DG  A 1 7   ? 12.922  30.457 28.183  1.00 87.39  ? 7   DG  P "C1'" 1 
ATOM   132  N  N9    . DG  A 1 7   ? 14.302  30.005 28.330  1.00 86.31  ? 7   DG  P N9    1 
ATOM   133  C  C8    . DG  A 1 7   ? 14.761  28.944 29.074  1.00 86.55  ? 7   DG  P C8    1 
ATOM   134  N  N7    . DG  A 1 7   ? 16.058  28.801 29.012  1.00 85.40  ? 7   DG  P N7    1 
ATOM   135  C  C5    . DG  A 1 7   ? 16.478  29.827 28.172  1.00 84.32  ? 7   DG  P C5    1 
ATOM   136  C  C6    . DG  A 1 7   ? 17.779  30.188 27.736  1.00 83.54  ? 7   DG  P C6    1 
ATOM   137  O  O6    . DG  A 1 7   ? 18.859  29.646 27.990  1.00 83.12  ? 7   DG  P O6    1 
ATOM   138  N  N1    . DG  A 1 7   ? 17.748  31.309 26.922  1.00 82.43  ? 7   DG  P N1    1 
ATOM   139  C  C2    . DG  A 1 7   ? 16.618  31.988 26.559  1.00 84.28  ? 7   DG  P C2    1 
ATOM   140  N  N2    . DG  A 1 7   ? 16.803  33.054 25.770  1.00 86.88  ? 7   DG  P N2    1 
ATOM   141  N  N3    . DG  A 1 7   ? 15.401  31.658 26.944  1.00 84.29  ? 7   DG  P N3    1 
ATOM   142  C  C4    . DG  A 1 7   ? 15.403  30.576 27.746  1.00 84.98  ? 7   DG  P C4    1 
ATOM   143  P  P     . DA  A 1 8   ? 9.733   30.208 25.993  1.00 84.63  ? 8   DA  P P     1 
ATOM   144  O  OP1   . DA  A 1 8   ? 8.447   30.791 25.520  1.00 83.84  ? 8   DA  P OP1   1 
ATOM   145  O  OP2   . DA  A 1 8   ? 9.887   28.730 26.073  1.00 84.57  ? 8   DA  P OP2   1 
ATOM   146  O  "O5'" . DA  A 1 8   ? 10.890  30.744 25.043  1.00 83.81  ? 8   DA  P "O5'" 1 
ATOM   147  C  "C5'" . DA  A 1 8   ? 11.080  32.143 24.864  1.00 81.20  ? 8   DA  P "C5'" 1 
ATOM   148  C  "C4'" . DA  A 1 8   ? 12.062  32.411 23.748  1.00 78.92  ? 8   DA  P "C4'" 1 
ATOM   149  O  "O4'" . DA  A 1 8   ? 13.386  31.963 24.126  1.00 78.29  ? 8   DA  P "O4'" 1 
ATOM   150  C  "C3'" . DA  A 1 8   ? 11.753  31.757 22.400  1.00 78.22  ? 8   DA  P "C3'" 1 
ATOM   151  O  "O3'" . DA  A 1 8   ? 11.941  32.733 21.371  1.00 77.06  ? 8   DA  P "O3'" 1 
ATOM   152  C  "C2'" . DA  A 1 8   ? 12.763  30.622 22.310  1.00 77.05  ? 8   DA  P "C2'" 1 
ATOM   153  C  "C1'" . DA  A 1 8   ? 13.945  31.162 23.093  1.00 76.54  ? 8   DA  P "C1'" 1 
ATOM   154  N  N9    . DA  A 1 8   ? 14.773  30.140 23.731  1.00 74.93  ? 8   DA  P N9    1 
ATOM   155  C  C8    . DA  A 1 8   ? 14.354  29.100 24.524  1.00 74.40  ? 8   DA  P C8    1 
ATOM   156  N  N7    . DA  A 1 8   ? 15.331  28.353 24.981  1.00 72.90  ? 8   DA  P N7    1 
ATOM   157  C  C5    . DA  A 1 8   ? 16.471  28.931 24.445  1.00 71.88  ? 8   DA  P C5    1 
ATOM   158  C  C6    . DA  A 1 8   ? 17.828  28.593 24.544  1.00 71.52  ? 8   DA  P C6    1 
ATOM   159  N  N6    . DA  A 1 8   ? 18.276  27.548 25.245  1.00 69.65  ? 8   DA  P N6    1 
ATOM   160  N  N1    . DA  A 1 8   ? 18.722  29.373 23.887  1.00 71.76  ? 8   DA  P N1    1 
ATOM   161  C  C2    . DA  A 1 8   ? 18.261  30.421 23.181  1.00 72.72  ? 8   DA  P C2    1 
ATOM   162  N  N3    . DA  A 1 8   ? 16.999  30.836 23.009  1.00 72.68  ? 8   DA  P N3    1 
ATOM   163  C  C4    . DA  A 1 8   ? 16.143  30.035 23.675  1.00 73.12  ? 8   DA  P C4    1 
ATOM   164  P  P     . DT  A 1 9   ? 11.908  32.300 19.824  1.00 77.43  ? 9   DT  P P     1 
ATOM   165  O  OP1   . DT  A 1 9   ? 11.600  33.537 19.066  1.00 78.70  ? 9   DT  P OP1   1 
ATOM   166  O  OP2   . DT  A 1 9   ? 11.041  31.100 19.650  1.00 76.52  ? 9   DT  P OP2   1 
ATOM   167  O  "O5'" . DT  A 1 9   ? 13.433  31.954 19.526  1.00 73.88  ? 9   DT  P "O5'" 1 
ATOM   168  C  "C5'" . DT  A 1 9   ? 14.430  32.943 19.766  1.00 70.39  ? 9   DT  P "C5'" 1 
ATOM   169  C  "C4'" . DT  A 1 9   ? 15.708  32.612 19.033  1.00 67.94  ? 9   DT  P "C4'" 1 
ATOM   170  O  "O4'" . DT  A 1 9   ? 16.456  31.623 19.781  1.00 67.49  ? 9   DT  P "O4'" 1 
ATOM   171  C  "C3'" . DT  A 1 9   ? 15.553  32.074 17.605  1.00 66.07  ? 9   DT  P "C3'" 1 
ATOM   172  O  "O3'" . DT  A 1 9   ? 16.518  32.736 16.752  1.00 62.42  ? 9   DT  P "O3'" 1 
ATOM   173  C  "C2'" . DT  A 1 9   ? 15.806  30.577 17.774  1.00 64.34  ? 9   DT  P "C2'" 1 
ATOM   174  C  "C1'" . DT  A 1 9   ? 16.796  30.530 18.946  1.00 63.81  ? 9   DT  P "C1'" 1 
ATOM   175  N  N1    . DT  A 1 9   ? 16.811  29.316 19.799  1.00 61.67  ? 9   DT  P N1    1 
ATOM   176  C  C2    . DT  A 1 9   ? 18.037  28.856 20.260  1.00 61.59  ? 9   DT  P C2    1 
ATOM   177  O  O2    . DT  A 1 9   ? 19.101  29.379 19.983  1.00 62.52  ? 9   DT  P O2    1 
ATOM   178  N  N3    . DT  A 1 9   ? 17.970  27.751 21.070  1.00 60.20  ? 9   DT  P N3    1 
ATOM   179  C  C4    . DT  A 1 9   ? 16.837  27.076 21.470  1.00 60.07  ? 9   DT  P C4    1 
ATOM   180  O  O4    . DT  A 1 9   ? 16.937  26.112 22.218  1.00 58.62  ? 9   DT  P O4    1 
ATOM   181  C  C5    . DT  A 1 9   ? 15.590  27.600 20.951  1.00 60.63  ? 9   DT  P C5    1 
ATOM   182  C  C7    . DT  A 1 9   ? 14.308  26.934 21.345  1.00 61.25  ? 9   DT  P C7    1 
ATOM   183  C  C6    . DT  A 1 9   ? 15.639  28.675 20.144  1.00 61.34  ? 9   DT  P C6    1 
ATOM   184  P  P     . DC  A 1 10  ? 16.465  32.544 15.154  0.50 59.66  ? 10  DC  P P     1 
ATOM   185  O  OP1   . DC  A 1 10  ? 16.386  33.866 14.500  0.50 60.94  ? 10  DC  P OP1   1 
ATOM   186  O  OP2   . DC  A 1 10  ? 15.464  31.499 14.829  0.50 57.42  ? 10  DC  P OP2   1 
ATOM   187  O  "O5'" . DC  A 1 10  ? 17.907  31.962 14.863  0.50 59.10  ? 10  DC  P "O5'" 1 
ATOM   188  C  "C5'" . DC  A 1 10  ? 18.495  31.105 15.822  0.50 60.30  ? 10  DC  P "C5'" 1 
ATOM   189  C  "C4'" . DC  A 1 10  ? 19.742  30.464 15.275  1.00 60.13  ? 10  DC  P "C4'" 1 
ATOM   190  O  "O4'" . DC  A 1 10  ? 20.051  29.400 16.207  1.00 61.52  ? 10  DC  P "O4'" 1 
ATOM   191  C  "C3'" . DC  A 1 10  ? 19.577  29.794 13.908  1.00 59.97  ? 10  DC  P "C3'" 1 
ATOM   192  O  "O3'" . DC  A 1 10  ? 20.823  29.901 13.178  1.00 59.61  ? 10  DC  P "O3'" 1 
ATOM   193  C  "C2'" . DC  A 1 10  ? 19.193  28.365 14.267  1.00 59.51  ? 10  DC  P "C2'" 1 
ATOM   194  C  "C1'" . DC  A 1 10  ? 19.930  28.128 15.584  1.00 59.94  ? 10  DC  P "C1'" 1 
ATOM   195  N  N1    . DC  A 1 10  ? 19.278  27.220 16.553  1.00 59.11  ? 10  DC  P N1    1 
ATOM   196  C  C2    . DC  A 1 10  ? 20.089  26.455 17.434  1.00 59.72  ? 10  DC  P C2    1 
ATOM   197  O  O2    . DC  A 1 10  ? 21.325  26.593 17.397  1.00 60.30  ? 10  DC  P O2    1 
ATOM   198  N  N3    . DC  A 1 10  ? 19.497  25.609 18.314  1.00 56.56  ? 10  DC  P N3    1 
ATOM   199  C  C4    . DC  A 1 10  ? 18.165  25.515 18.352  1.00 57.49  ? 10  DC  P C4    1 
ATOM   200  N  N4    . DC  A 1 10  ? 17.626  24.682 19.241  1.00 58.63  ? 10  DC  P N4    1 
ATOM   201  C  C5    . DC  A 1 10  ? 17.324  26.278 17.484  1.00 56.71  ? 10  DC  P C5    1 
ATOM   202  C  C6    . DC  A 1 10  ? 17.918  27.104 16.602  1.00 58.41  ? 10  DC  P C6    1 
ATOM   203  P  P     . DA  A 1 11  ? 20.986  29.211 11.725  1.00 61.27  ? 11  DA  P P     1 
ATOM   204  O  OP1   . DA  A 1 11  ? 21.963  29.995 10.938  1.00 62.43  ? 11  DA  P OP1   1 
ATOM   205  O  OP2   . DA  A 1 11  ? 19.655  28.904 11.143  1.00 60.61  ? 11  DA  P OP2   1 
ATOM   206  O  "O5'" . DA  A 1 11  ? 21.679  27.826 12.055  1.00 60.68  ? 11  DA  P "O5'" 1 
ATOM   207  C  "C5'" . DA  A 1 11  ? 22.892  27.792 12.785  1.00 60.32  ? 11  DA  P "C5'" 1 
ATOM   208  C  "C4'" . DA  A 1 11  ? 23.311  26.359 13.011  1.00 61.21  ? 11  DA  P "C4'" 1 
ATOM   209  O  "O4'" . DA  A 1 11  ? 22.551  25.751 14.080  1.00 61.67  ? 11  DA  P "O4'" 1 
ATOM   210  C  "C3'" . DA  A 1 11  ? 23.127  25.460 11.795  1.00 60.62  ? 11  DA  P "C3'" 1 
ATOM   211  O  "O3'" . DA  A 1 11  ? 24.292  24.683 11.636  1.00 61.91  ? 11  DA  P "O3'" 1 
ATOM   212  C  "C2'" . DA  A 1 11  ? 21.952  24.572 12.160  1.00 58.80  ? 11  DA  P "C2'" 1 
ATOM   213  C  "C1'" . DA  A 1 11  ? 22.058  24.494 13.665  1.00 59.09  ? 11  DA  P "C1'" 1 
ATOM   214  N  N9    . DA  A 1 11  ? 20.782  24.269 14.338  1.00 59.75  ? 11  DA  P N9    1 
ATOM   215  C  C8    . DA  A 1 11  ? 19.578  24.853 14.050  1.00 60.58  ? 11  DA  P C8    1 
ATOM   216  N  N7    . DA  A 1 11  ? 18.583  24.402 14.773  1.00 60.94  ? 11  DA  P N7    1 
ATOM   217  C  C5    . DA  A 1 11  ? 19.175  23.471 15.611  1.00 59.53  ? 11  DA  P C5    1 
ATOM   218  C  C6    . DA  A 1 11  ? 18.648  22.629 16.599  1.00 60.86  ? 11  DA  P C6    1 
ATOM   219  N  N6    . DA  A 1 11  ? 17.350  22.595 16.927  1.00 58.71  ? 11  DA  P N6    1 
ATOM   220  N  N1    . DA  A 1 11  ? 19.509  21.806 17.248  1.00 62.99  ? 11  DA  P N1    1 
ATOM   221  C  C2    . DA  A 1 11  ? 20.810  21.849 16.914  1.00 60.94  ? 11  DA  P C2    1 
ATOM   222  N  N3    . DA  A 1 11  ? 21.420  22.600 15.999  1.00 59.33  ? 11  DA  P N3    1 
ATOM   223  C  C4    . DA  A 1 11  ? 20.533  23.395 15.370  1.00 59.46  ? 11  DA  P C4    1 
ATOM   224  P  P     . DC  A 1 12  ? 24.550  23.924 10.257  1.00 62.92  ? 12  DC  P P     1 
ATOM   225  O  OP1   . DC  A 1 12  ? 25.950  24.218 9.867   1.00 65.37  ? 12  DC  P OP1   1 
ATOM   226  O  OP2   . DC  A 1 12  ? 23.448  24.198 9.310   1.00 61.68  ? 12  DC  P OP2   1 
ATOM   227  O  "O5'" . DC  A 1 12  ? 24.426  22.402 10.684  1.00 63.14  ? 12  DC  P "O5'" 1 
ATOM   228  C  "C5'" . DC  A 1 12  ? 24.975  21.981 11.921  1.00 63.48  ? 12  DC  P "C5'" 1 
ATOM   229  C  "C4'" . DC  A 1 12  ? 24.454  20.618 12.306  1.00 66.21  ? 12  DC  P "C4'" 1 
ATOM   230  O  "O4'" . DC  A 1 12  ? 23.246  20.727 13.089  1.00 66.57  ? 12  DC  P "O4'" 1 
ATOM   231  C  "C3'" . DC  A 1 12  ? 24.109  19.714 11.129  1.00 68.22  ? 12  DC  P "C3'" 1 
ATOM   232  O  "O3'" . DC  A 1 12  ? 24.596  18.411 11.351  1.00 74.44  ? 12  DC  P "O3'" 1 
ATOM   233  C  "C2'" . DC  A 1 12  ? 22.592  19.684 11.122  1.00 68.38  ? 12  DC  P "C2'" 1 
ATOM   234  C  "C1'" . DC  A 1 12  ? 22.322  19.768 12.609  1.00 66.24  ? 12  DC  P "C1'" 1 
ATOM   235  N  N1    . DC  A 1 12  ? 20.962  20.160 13.030  1.00 63.11  ? 12  DC  P N1    1 
ATOM   236  C  C2    . DC  A 1 12  ? 20.304  19.382 14.014  1.00 63.11  ? 12  DC  P C2    1 
ATOM   237  O  O2    . DC  A 1 12  ? 20.898  18.436 14.545  1.00 63.83  ? 12  DC  P O2    1 
ATOM   238  N  N3    . DC  A 1 12  ? 19.045  19.690 14.366  1.00 62.47  ? 12  DC  P N3    1 
ATOM   239  C  C4    . DC  A 1 12  ? 18.428  20.720 13.796  1.00 62.86  ? 12  DC  P C4    1 
ATOM   240  N  N4    . DC  A 1 12  ? 17.173  20.965 14.177  1.00 60.96  ? 12  DC  P N4    1 
ATOM   241  C  C5    . DC  A 1 12  ? 19.073  21.545 12.815  1.00 62.59  ? 12  DC  P C5    1 
ATOM   242  C  C6    . DC  A 1 12  ? 20.327  21.229 12.466  1.00 61.81  ? 12  DC  P C6    1 
ATOM   243  P  P     . DG  A 1 13  ? 24.989  17.512 10.091  1.00 78.79  ? 13  DG  P P     1 
ATOM   244  O  OP1   . DG  A 1 13  ? 26.379  17.797 9.635   1.00 78.80  ? 13  DG  P OP1   1 
ATOM   245  O  OP2   . DG  A 1 13  ? 23.844  17.572 9.146   1.00 79.17  ? 13  DG  P OP2   1 
ATOM   246  O  "O5'" . DG  A 1 13  ? 25.055  16.075 10.730  1.00 78.65  ? 13  DG  P "O5'" 1 
ATOM   247  C  "C5'" . DG  A 1 13  ? 25.181  15.982 12.128  1.00 76.71  ? 13  DG  P "C5'" 1 
ATOM   248  C  "C4'" . DG  A 1 13  ? 24.143  15.019 12.663  1.00 76.03  ? 13  DG  P "C4'" 1 
ATOM   249  O  "O4'" . DG  A 1 13  ? 22.935  15.733 13.039  1.00 75.78  ? 13  DG  P "O4'" 1 
ATOM   250  C  "C3'" . DG  A 1 13  ? 23.740  13.912 11.689  1.00 75.82  ? 13  DG  P "C3'" 1 
ATOM   251  O  "O3'" . DG  A 1 13  ? 23.485  12.655 12.345  1.00 74.05  ? 13  DG  P "O3'" 1 
ATOM   252  C  "C2'" . DG  A 1 13  ? 22.379  14.386 11.218  1.00 76.53  ? 13  DG  P "C2'" 1 
ATOM   253  C  "C1'" . DG  A 1 13  ? 21.845  15.014 12.496  1.00 76.37  ? 13  DG  P "C1'" 1 
ATOM   254  N  N9    . DG  A 1 13  ? 20.688  15.889 12.328  1.00 76.15  ? 13  DG  P N9    1 
ATOM   255  C  C8    . DG  A 1 13  ? 20.570  17.030 11.560  1.00 75.64  ? 13  DG  P C8    1 
ATOM   256  N  N7    . DG  A 1 13  ? 19.353  17.524 11.549  1.00 74.54  ? 13  DG  P N7    1 
ATOM   257  C  C5    . DG  A 1 13  ? 18.631  16.668 12.365  1.00 75.99  ? 13  DG  P C5    1 
ATOM   258  C  C6    . DG  A 1 13  ? 17.246  16.678 12.727  1.00 77.10  ? 13  DG  P C6    1 
ATOM   259  O  O6    . DG  A 1 13  ? 16.356  17.479 12.372  1.00 78.56  ? 13  DG  P O6    1 
ATOM   260  N  N1    . DG  A 1 13  ? 16.938  15.621 13.589  1.00 77.19  ? 13  DG  P N1    1 
ATOM   261  C  C2    . DG  A 1 13  ? 17.835  14.678 14.043  1.00 76.87  ? 13  DG  P C2    1 
ATOM   262  N  N2    . DG  A 1 13  ? 17.351  13.708 14.862  1.00 75.82  ? 13  DG  P N2    1 
ATOM   263  N  N3    . DG  A 1 13  ? 19.119  14.668 13.717  1.00 75.46  ? 13  DG  P N3    1 
ATOM   264  C  C4    . DG  A 1 13  ? 19.436  15.676 12.883  1.00 75.41  ? 13  DG  P C4    1 
ATOM   265  O  "O5'" . DT  B 2 1   ? -3.302  20.436 7.502   1.00 148.74 ? 1   DT  T "O5'" 1 
ATOM   266  C  "C5'" . DT  B 2 1   ? -3.045  20.473 6.092   1.00 149.57 ? 1   DT  T "C5'" 1 
ATOM   267  C  "C4'" . DT  B 2 1   ? -2.031  19.421 5.703   1.00 150.40 ? 1   DT  T "C4'" 1 
ATOM   268  O  "O4'" . DT  B 2 1   ? -2.445  18.124 6.176   1.00 150.63 ? 1   DT  T "O4'" 1 
ATOM   269  C  "C3'" . DT  B 2 1   ? -1.793  19.248 4.203   1.00 150.83 ? 1   DT  T "C3'" 1 
ATOM   270  O  "O3'" . DT  B 2 1   ? -0.465  18.741 3.999   1.00 151.37 ? 1   DT  T "O3'" 1 
ATOM   271  C  "C2'" . DT  B 2 1   ? -2.786  18.152 3.850   1.00 151.23 ? 1   DT  T "C2'" 1 
ATOM   272  C  "C1'" . DT  B 2 1   ? -2.658  17.255 5.072   1.00 150.91 ? 1   DT  T "C1'" 1 
ATOM   273  N  N1    . DT  B 2 1   ? -3.801  16.401 5.421   1.00 151.14 ? 1   DT  T N1    1 
ATOM   274  C  C2    . DT  B 2 1   ? -3.985  15.209 4.760   1.00 151.16 ? 1   DT  T C2    1 
ATOM   275  O  O2    . DT  B 2 1   ? -3.313  14.864 3.802   1.00 151.12 ? 1   DT  T O2    1 
ATOM   276  N  N3    . DT  B 2 1   ? -4.999  14.430 5.268   1.00 151.65 ? 1   DT  T N3    1 
ATOM   277  C  C4    . DT  B 2 1   ? -5.844  14.740 6.325   1.00 152.01 ? 1   DT  T C4    1 
ATOM   278  O  O4    . DT  B 2 1   ? -6.681  13.923 6.705   1.00 151.90 ? 1   DT  T O4    1 
ATOM   279  C  C5    . DT  B 2 1   ? -5.637  16.040 6.918   1.00 152.04 ? 1   DT  T C5    1 
ATOM   280  C  C7    . DT  B 2 1   ? -6.535  16.485 8.029   1.00 152.09 ? 1   DT  T C7    1 
ATOM   281  C  C6    . DT  B 2 1   ? -4.644  16.795 6.438   1.00 151.40 ? 1   DT  T C6    1 
ATOM   282  P  P     . DA  B 2 2   ? 0.524   18.551 5.260   1.00 151.87 ? 2   DA  T P     1 
ATOM   283  O  OP1   . DA  B 2 2   ? 0.177   17.256 5.912   1.00 152.14 ? 2   DA  T OP1   1 
ATOM   284  O  OP2   . DA  B 2 2   ? 0.517   19.805 6.069   1.00 151.69 ? 2   DA  T OP2   1 
ATOM   285  O  "O5'" . DA  B 2 2   ? 1.976   18.410 4.617   1.00 151.29 ? 2   DA  T "O5'" 1 
ATOM   286  C  "C5'" . DA  B 2 2   ? 3.135   18.664 5.412   1.00 150.93 ? 2   DA  T "C5'" 1 
ATOM   287  C  "C4'" . DA  B 2 2   ? 4.087   19.595 4.694   1.00 150.28 ? 2   DA  T "C4'" 1 
ATOM   288  O  "O4'" . DA  B 2 2   ? 3.454   20.130 3.503   1.00 150.80 ? 2   DA  T "O4'" 1 
ATOM   289  C  "C3'" . DA  B 2 2   ? 4.492   20.795 5.551   1.00 149.41 ? 2   DA  T "C3'" 1 
ATOM   290  O  "O3'" . DA  B 2 2   ? 5.879   21.108 5.457   1.00 147.53 ? 2   DA  T "O3'" 1 
ATOM   291  C  "C2'" . DA  B 2 2   ? 3.674   21.940 4.994   1.00 150.07 ? 2   DA  T "C2'" 1 
ATOM   292  C  "C1'" . DA  B 2 2   ? 3.417   21.553 3.547   1.00 150.69 ? 2   DA  T "C1'" 1 
ATOM   293  N  N9    . DA  B 2 2   ? 2.068   21.978 3.166   1.00 151.62 ? 2   DA  T N9    1 
ATOM   294  C  C8    . DA  B 2 2   ? 1.081   21.306 2.491   1.00 151.80 ? 2   DA  T C8    1 
ATOM   295  N  N7    . DA  B 2 2   ? -0.054  21.969 2.424   1.00 152.26 ? 2   DA  T N7    1 
ATOM   296  C  C5    . DA  B 2 2   ? 0.217   23.158 3.075   1.00 152.36 ? 2   DA  T C5    1 
ATOM   297  C  C6    . DA  B 2 2   ? -0.574  24.296 3.366   1.00 152.23 ? 2   DA  T C6    1 
ATOM   298  N  N6    . DA  B 2 2   ? -1.864  24.409 3.019   1.00 151.27 ? 2   DA  T N6    1 
ATOM   299  N  N1    . DA  B 2 2   ? 0.009   25.318 4.033   1.00 152.15 ? 2   DA  T N1    1 
ATOM   300  C  C2    . DA  B 2 2   ? 1.300   25.205 4.382   1.00 152.21 ? 2   DA  T C2    1 
ATOM   301  N  N3    . DA  B 2 2   ? 2.142   24.196 4.172   1.00 152.35 ? 2   DA  T N3    1 
ATOM   302  C  C4    . DA  B 2 2   ? 1.533   23.201 3.516   1.00 152.29 ? 2   DA  T C4    1 
ATOM   303  P  P     . DC  B 2 3   ? 6.623   21.754 6.727   1.00 146.24 ? 3   DC  T P     1 
ATOM   304  O  OP1   . DC  B 2 3   ? 5.617   21.886 7.815   1.00 145.68 ? 3   DC  T OP1   1 
ATOM   305  O  OP2   . DC  B 2 3   ? 7.377   22.960 6.274   1.00 145.98 ? 3   DC  T OP2   1 
ATOM   306  O  "O5'" . DC  B 2 3   ? 7.652   20.614 7.148   1.00 143.41 ? 3   DC  T "O5'" 1 
ATOM   307  C  "C5'" . DC  B 2 3   ? 7.283   19.232 7.099   1.00 138.96 ? 3   DC  T "C5'" 1 
ATOM   308  C  "C4'" . DC  B 2 3   ? 7.829   18.518 8.314   1.00 135.42 ? 3   DC  T "C4'" 1 
ATOM   309  O  "O4'" . DC  B 2 3   ? 9.277   18.531 8.246   1.00 136.01 ? 3   DC  T "O4'" 1 
ATOM   310  C  "C3'" . DC  B 2 3   ? 7.467   19.208 9.633   1.00 131.70 ? 3   DC  T "C3'" 1 
ATOM   311  O  "O3'" . DC  B 2 3   ? 7.413   18.257 10.714  1.00 124.59 ? 3   DC  T "O3'" 1 
ATOM   312  C  "C2'" . DC  B 2 3   ? 8.658   20.127 9.855   1.00 133.15 ? 3   DC  T "C2'" 1 
ATOM   313  C  "C1'" . DC  B 2 3   ? 9.810   19.279 9.333   1.00 135.95 ? 3   DC  T "C1'" 1 
ATOM   314  N  N1    . DC  B 2 3   ? 11.034  19.963 8.850   1.00 137.66 ? 3   DC  T N1    1 
ATOM   315  C  C2    . DC  B 2 3   ? 11.146  21.381 8.888   1.00 138.21 ? 3   DC  T C2    1 
ATOM   316  O  O2    . DC  B 2 3   ? 10.205  22.063 9.326   1.00 138.23 ? 3   DC  T O2    1 
ATOM   317  N  N3    . DC  B 2 3   ? 12.288  21.960 8.438   1.00 138.62 ? 3   DC  T N3    1 
ATOM   318  C  C4    . DC  B 2 3   ? 13.290  21.198 7.976   1.00 139.20 ? 3   DC  T C4    1 
ATOM   319  N  N4    . DC  B 2 3   ? 14.399  21.806 7.539   1.00 139.10 ? 3   DC  T N4    1 
ATOM   320  C  C5    . DC  B 2 3   ? 13.201  19.775 7.934   1.00 138.89 ? 3   DC  T C5    1 
ATOM   321  C  C6    . DC  B 2 3   ? 12.071  19.209 8.370   1.00 138.57 ? 3   DC  T C6    1 
ATOM   322  P  P     . DG  B 2 4   ? 6.131   17.287 10.913  1.00 118.85 ? 4   DG  T P     1 
ATOM   323  O  OP1   . DG  B 2 4   ? 5.411   17.038 9.618   1.00 118.48 ? 4   DG  T OP1   1 
ATOM   324  O  OP2   . DG  B 2 4   ? 5.384   17.799 12.089  1.00 119.06 ? 4   DG  T OP2   1 
ATOM   325  O  "O5'" . DG  B 2 4   ? 6.820   15.954 11.442  1.00 113.06 ? 4   DG  T "O5'" 1 
ATOM   326  C  "C5'" . DG  B 2 4   ? 6.135   14.713 11.499  1.00 102.14 ? 4   DG  T "C5'" 1 
ATOM   327  C  "C4'" . DG  B 2 4   ? 7.036   13.690 12.147  1.00 95.03  ? 4   DG  T "C4'" 1 
ATOM   328  O  "O4'" . DG  B 2 4   ? 8.281   13.619 11.404  1.00 90.29  ? 4   DG  T "O4'" 1 
ATOM   329  C  "C3'" . DG  B 2 4   ? 7.439   14.084 13.565  1.00 92.21  ? 4   DG  T "C3'" 1 
ATOM   330  O  "O3'" . DG  B 2 4   ? 7.650   12.909 14.337  1.00 93.63  ? 4   DG  T "O3'" 1 
ATOM   331  C  "C2'" . DG  B 2 4   ? 8.759   14.797 13.361  1.00 88.12  ? 4   DG  T "C2'" 1 
ATOM   332  C  "C1'" . DG  B 2 4   ? 9.359   13.942 12.268  1.00 84.15  ? 4   DG  T "C1'" 1 
ATOM   333  N  N9    . DG  B 2 4   ? 10.406  14.588 11.486  1.00 77.41  ? 4   DG  T N9    1 
ATOM   334  C  C8    . DG  B 2 4   ? 10.318  15.763 10.783  1.00 74.76  ? 4   DG  T C8    1 
ATOM   335  N  N7    . DG  B 2 4   ? 11.437  16.097 10.202  1.00 72.59  ? 4   DG  T N7    1 
ATOM   336  C  C5    . DG  B 2 4   ? 12.318  15.077 10.539  1.00 73.43  ? 4   DG  T C5    1 
ATOM   337  C  C6    . DG  B 2 4   ? 13.694  14.894 10.212  1.00 73.08  ? 4   DG  T C6    1 
ATOM   338  O  O6    . DG  B 2 4   ? 14.435  15.624 9.542   1.00 71.10  ? 4   DG  T O6    1 
ATOM   339  N  N1    . DG  B 2 4   ? 14.201  13.723 10.768  1.00 72.51  ? 4   DG  T N1    1 
ATOM   340  C  C2    . DG  B 2 4   ? 13.493  12.847 11.546  1.00 72.06  ? 4   DG  T C2    1 
ATOM   341  N  N2    . DG  B 2 4   ? 14.179  11.788 12.013  1.00 71.41  ? 4   DG  T N2    1 
ATOM   342  N  N3    . DG  B 2 4   ? 12.211  13.002 11.856  1.00 73.14  ? 4   DG  T N3    1 
ATOM   343  C  C4    . DG  B 2 4   ? 11.692  14.133 11.325  1.00 74.57  ? 4   DG  T C4    1 
ATOM   344  P  P     . DA  B 2 5   ? 6.887   12.738 15.729  1.00 96.59  ? 5   DA  T P     1 
ATOM   345  O  OP1   . DA  B 2 5   ? 5.991   13.905 15.915  1.00 97.77  ? 5   DA  T OP1   1 
ATOM   346  O  OP2   . DA  B 2 5   ? 7.929   12.428 16.743  1.00 95.80  ? 5   DA  T OP2   1 
ATOM   347  O  "O5'" . DA  B 2 5   ? 5.978   11.458 15.503  1.00 99.30  ? 5   DA  T "O5'" 1 
ATOM   348  C  "C5'" . DA  B 2 5   ? 6.496   10.352 14.796  1.00 104.61 ? 5   DA  T "C5'" 1 
ATOM   349  C  "C4'" . DA  B 2 5   ? 6.986   9.311  15.769  1.00 108.32 ? 5   DA  T "C4'" 1 
ATOM   350  O  "O4'" . DA  B 2 5   ? 5.839   8.693  16.395  1.00 109.75 ? 5   DA  T "O4'" 1 
ATOM   351  C  "C3'" . DA  B 2 5   ? 7.767   8.184  15.096  1.00 111.10 ? 5   DA  T "C3'" 1 
ATOM   352  O  "O3'" . DA  B 2 5   ? 8.790   7.669  15.968  1.00 113.54 ? 5   DA  T "O3'" 1 
ATOM   353  C  "C2'" . DA  B 2 5   ? 6.699   7.132  14.855  1.00 111.20 ? 5   DA  T "C2'" 1 
ATOM   354  C  "C1'" . DA  B 2 5   ? 5.784   7.313  16.058  1.00 110.80 ? 5   DA  T "C1'" 1 
ATOM   355  P  P     . DC  B 2 6   ? 9.534   8.649  17.015  1.00 115.62 ? 6   DC  T P     1 
ATOM   356  O  OP1   . DC  B 2 6   ? 10.979  8.265  17.106  1.00 115.35 ? 6   DC  T OP1   1 
ATOM   357  O  OP2   . DC  B 2 6   ? 8.688   8.635  18.241  1.00 115.40 ? 6   DC  T OP2   1 
ATOM   358  O  "O5'" . DC  B 2 6   ? 9.411   10.113 16.384  1.00 113.06 ? 6   DC  T "O5'" 1 
ATOM   359  C  "C5'" . DC  B 2 6   ? 10.506  10.735 15.706  1.00 108.48 ? 6   DC  T "C5'" 1 
ATOM   360  C  "C4'" . DC  B 2 6   ? 11.489  11.278 16.716  1.00 104.11 ? 6   DC  T "C4'" 1 
ATOM   361  O  "O4'" . DC  B 2 6   ? 12.514  12.054 16.042  1.00 105.13 ? 6   DC  T "O4'" 1 
ATOM   362  C  "C3'" . DC  B 2 6   ? 10.884  12.201 17.775  1.00 100.17 ? 6   DC  T "C3'" 1 
ATOM   363  O  "O3'" . DC  B 2 6   ? 11.370  11.795 19.053  1.00 92.63  ? 6   DC  T "O3'" 1 
ATOM   364  C  "C2'" . DC  B 2 6   ? 11.373  13.584 17.388  1.00 101.77 ? 6   DC  T "C2'" 1 
ATOM   365  C  "C1'" . DC  B 2 6   ? 12.698  13.294 16.715  1.00 104.66 ? 6   DC  T "C1'" 1 
ATOM   366  N  N1    . DC  B 2 6   ? 13.089  14.318 15.723  1.00 105.37 ? 6   DC  T N1    1 
ATOM   367  C  C2    . DC  B 2 6   ? 14.318  14.186 15.028  1.00 105.66 ? 6   DC  T C2    1 
ATOM   368  O  O2    . DC  B 2 6   ? 15.036  13.176 15.214  1.00 103.64 ? 6   DC  T O2    1 
ATOM   369  N  N3    . DC  B 2 6   ? 14.680  15.160 14.164  1.00 105.64 ? 6   DC  T N3    1 
ATOM   370  C  C4    . DC  B 2 6   ? 13.882  16.217 13.964  1.00 105.53 ? 6   DC  T C4    1 
ATOM   371  N  N4    . DC  B 2 6   ? 14.289  17.152 13.113  1.00 106.08 ? 6   DC  T N4    1 
ATOM   372  C  C5    . DC  B 2 6   ? 12.633  16.361 14.630  1.00 105.66 ? 6   DC  T C5    1 
ATOM   373  C  C6    . DC  B 2 6   ? 12.280  15.402 15.494  1.00 105.70 ? 6   DC  T C6    1 
ATOM   374  P  P     . DG  B 2 7   ? 12.025  12.864 20.050  1.00 86.15  ? 7   DG  T P     1 
ATOM   375  O  OP1   . DG  B 2 7   ? 12.077  12.171 21.354  1.00 89.45  ? 7   DG  T OP1   1 
ATOM   376  O  OP2   . DG  B 2 7   ? 11.389  14.199 19.950  1.00 88.71  ? 7   DG  T OP2   1 
ATOM   377  O  "O5'" . DG  B 2 7   ? 13.519  12.989 19.543  1.00 80.10  ? 7   DG  T "O5'" 1 
ATOM   378  C  "C5'" . DG  B 2 7   ? 14.362  11.854 19.555  1.00 70.30  ? 7   DG  T "C5'" 1 
ATOM   379  C  "C4'" . DG  B 2 7   ? 15.793  12.284 19.732  1.00 64.99  ? 7   DG  T "C4'" 1 
ATOM   380  O  "O4'" . DG  B 2 7   ? 16.101  13.243 18.693  1.00 63.03  ? 7   DG  T "O4'" 1 
ATOM   381  C  "C3'" . DG  B 2 7   ? 16.096  12.986 21.051  1.00 61.65  ? 7   DG  T "C3'" 1 
ATOM   382  O  "O3'" . DG  B 2 7   ? 17.397  12.601 21.487  1.00 59.02  ? 7   DG  T "O3'" 1 
ATOM   383  C  "C2'" . DG  B 2 7   ? 16.077  14.457 20.680  1.00 61.95  ? 7   DG  T "C2'" 1 
ATOM   384  C  "C1'" . DG  B 2 7   ? 16.613  14.429 19.261  1.00 60.63  ? 7   DG  T "C1'" 1 
ATOM   385  N  N9    . DG  B 2 7   ? 16.177  15.538 18.427  1.00 58.42  ? 7   DG  T N9    1 
ATOM   386  C  C8    . DG  B 2 7   ? 14.898  16.010 18.297  1.00 59.24  ? 7   DG  T C8    1 
ATOM   387  N  N7    . DG  B 2 7   ? 14.807  17.031 17.488  1.00 58.64  ? 7   DG  T N7    1 
ATOM   388  C  C5    . DG  B 2 7   ? 16.102  17.243 17.058  1.00 56.54  ? 7   DG  T C5    1 
ATOM   389  C  C6    . DG  B 2 7   ? 16.612  18.214 16.177  1.00 57.94  ? 7   DG  T C6    1 
ATOM   390  O  O6    . DG  B 2 7   ? 15.993  19.113 15.585  1.00 58.55  ? 7   DG  T O6    1 
ATOM   391  N  N1    . DG  B 2 7   ? 17.991  18.080 16.003  1.00 58.50  ? 7   DG  T N1    1 
ATOM   392  C  C2    . DG  B 2 7   ? 18.777  17.129 16.613  1.00 57.91  ? 7   DG  T C2    1 
ATOM   393  N  N2    . DG  B 2 7   ? 20.092  17.179 16.326  1.00 53.96  ? 7   DG  T N2    1 
ATOM   394  N  N3    . DG  B 2 7   ? 18.301  16.204 17.447  1.00 56.92  ? 7   DG  T N3    1 
ATOM   395  C  C4    . DG  B 2 7   ? 16.965  16.327 17.620  1.00 56.86  ? 7   DG  T C4    1 
ATOM   396  P  P     . DT  B 2 8   ? 17.813  12.809 23.021  1.00 57.27  ? 8   DT  T P     1 
ATOM   397  O  OP1   . DT  B 2 8   ? 18.497  11.579 23.493  1.00 59.71  ? 8   DT  T OP1   1 
ATOM   398  O  OP2   . DT  B 2 8   ? 16.613  13.299 23.737  1.00 59.33  ? 8   DT  T OP2   1 
ATOM   399  O  "O5'" . DT  B 2 8   ? 18.884  13.980 22.967  1.00 54.88  ? 8   DT  T "O5'" 1 
ATOM   400  C  "C5'" . DT  B 2 8   ? 20.164  13.743 22.421  1.00 53.91  ? 8   DT  T "C5'" 1 
ATOM   401  C  "C4'" . DT  B 2 8   ? 20.865  15.047 22.133  1.00 54.13  ? 8   DT  T "C4'" 1 
ATOM   402  O  "O4'" . DT  B 2 8   ? 20.170  15.816 21.117  1.00 55.96  ? 8   DT  T "O4'" 1 
ATOM   403  C  "C3'" . DT  B 2 8   ? 20.996  15.980 23.330  1.00 54.75  ? 8   DT  T "C3'" 1 
ATOM   404  O  "O3'" . DT  B 2 8   ? 22.304  16.511 23.349  1.00 59.36  ? 8   DT  T "O3'" 1 
ATOM   405  C  "C2'" . DT  B 2 8   ? 20.053  17.119 23.002  1.00 54.26  ? 8   DT  T "C2'" 1 
ATOM   406  C  "C1'" . DT  B 2 8   ? 20.256  17.167 21.515  1.00 53.92  ? 8   DT  T "C1'" 1 
ATOM   407  N  N1    . DT  B 2 8   ? 19.321  17.996 20.725  1.00 51.88  ? 8   DT  T N1    1 
ATOM   408  C  C2    . DT  B 2 8   ? 19.892  18.865 19.805  1.00 55.05  ? 8   DT  T C2    1 
ATOM   409  O  O2    . DT  B 2 8   ? 21.097  18.892 19.552  1.00 58.29  ? 8   DT  T O2    1 
ATOM   410  N  N3    . DT  B 2 8   ? 19.004  19.701 19.178  1.00 54.18  ? 8   DT  T N3    1 
ATOM   411  C  C4    . DT  B 2 8   ? 17.639  19.737 19.340  1.00 52.35  ? 8   DT  T C4    1 
ATOM   412  O  O4    . DT  B 2 8   ? 16.979  20.556 18.700  1.00 52.83  ? 8   DT  T O4    1 
ATOM   413  C  C5    . DT  B 2 8   ? 17.102  18.766 20.284  1.00 49.96  ? 8   DT  T C5    1 
ATOM   414  C  C7    . DT  B 2 8   ? 15.625  18.720 20.518  1.00 49.10  ? 8   DT  T C7    1 
ATOM   415  C  C6    . DT  B 2 8   ? 17.960  17.951 20.912  1.00 48.80  ? 8   DT  T C6    1 
ATOM   416  P  P     . DG  B 2 9   ? 22.909  17.040 24.731  1.00 65.93  ? 9   DG  T P     1 
ATOM   417  O  OP1   . DG  B 2 9   ? 23.322  15.849 25.526  1.00 65.51  ? 9   DG  T OP1   1 
ATOM   418  O  OP2   . DG  B 2 9   ? 21.947  18.037 25.304  1.00 60.76  ? 9   DG  T OP2   1 
ATOM   419  O  "O5'" . DG  B 2 9   ? 24.248  17.781 24.322  1.00 63.85  ? 9   DG  T "O5'" 1 
ATOM   420  C  "C5'" . DG  B 2 9   ? 24.913  17.483 23.111  1.00 63.83  ? 9   DG  T "C5'" 1 
ATOM   421  C  "C4'" . DG  B 2 9   ? 25.339  18.776 22.472  1.00 64.21  ? 9   DG  T "C4'" 1 
ATOM   422  O  "O4'" . DG  B 2 9   ? 24.204  19.371 21.797  1.00 63.97  ? 9   DG  T "O4'" 1 
ATOM   423  C  "C3'" . DG  B 2 9   ? 25.752  19.770 23.551  1.00 65.61  ? 9   DG  T "C3'" 1 
ATOM   424  O  "O3'" . DG  B 2 9   ? 26.933  20.466 23.216  1.00 66.95  ? 9   DG  T "O3'" 1 
ATOM   425  C  "C2'" . DG  B 2 9   ? 24.584  20.736 23.641  1.00 65.87  ? 9   DG  T "C2'" 1 
ATOM   426  C  "C1'" . DG  B 2 9   ? 24.051  20.709 22.230  1.00 64.53  ? 9   DG  T "C1'" 1 
ATOM   427  N  N9    . DG  B 2 9   ? 22.642  21.069 22.083  1.00 62.83  ? 9   DG  T N9    1 
ATOM   428  C  C8    . DG  B 2 9   ? 21.554  20.446 22.644  1.00 62.44  ? 9   DG  T C8    1 
ATOM   429  N  N7    . DG  B 2 9   ? 20.419  20.971 22.269  1.00 61.64  ? 9   DG  T N7    1 
ATOM   430  C  C5    . DG  B 2 9   ? 20.783  22.003 21.417  1.00 60.75  ? 9   DG  T C5    1 
ATOM   431  C  C6    . DG  B 2 9   ? 19.982  22.903 20.681  1.00 62.21  ? 9   DG  T C6    1 
ATOM   432  O  O6    . DG  B 2 9   ? 18.739  22.965 20.629  1.00 61.21  ? 9   DG  T O6    1 
ATOM   433  N  N1    . DG  B 2 9   ? 20.765  23.795 19.947  1.00 63.87  ? 9   DG  T N1    1 
ATOM   434  C  C2    . DG  B 2 9   ? 22.154  23.803 19.930  1.00 64.99  ? 9   DG  T C2    1 
ATOM   435  N  N2    . DG  B 2 9   ? 22.755  24.745 19.167  1.00 66.67  ? 9   DG  T N2    1 
ATOM   436  N  N3    . DG  B 2 9   ? 22.900  22.957 20.614  1.00 61.21  ? 9   DG  T N3    1 
ATOM   437  C  C4    . DG  B 2 9   ? 22.158  22.089 21.320  1.00 60.49  ? 9   DG  T C4    1 
ATOM   438  P  P     . DA  B 2 10  ? 27.465  21.593 24.216  1.00 68.51  ? 10  DA  T P     1 
ATOM   439  O  OP1   . DA  B 2 10  ? 28.951  21.524 24.261  1.00 68.63  ? 10  DA  T OP1   1 
ATOM   440  O  OP2   . DA  B 2 10  ? 26.680  21.486 25.472  1.00 66.80  ? 10  DA  T OP2   1 
ATOM   441  O  "O5'" . DA  B 2 10  ? 27.007  22.922 23.483  1.00 67.50  ? 10  DA  T "O5'" 1 
ATOM   442  C  "C5'" . DA  B 2 10  ? 27.418  23.173 22.153  1.00 64.61  ? 10  DA  T "C5'" 1 
ATOM   443  C  "C4'" . DA  B 2 10  ? 27.122  24.603 21.797  1.00 63.77  ? 10  DA  T "C4'" 1 
ATOM   444  O  "O4'" . DA  B 2 10  ? 25.694  24.739 21.609  1.00 61.62  ? 10  DA  T "O4'" 1 
ATOM   445  C  "C3'" . DA  B 2 10  ? 27.511  25.589 22.900  1.00 65.04  ? 10  DA  T "C3'" 1 
ATOM   446  O  "O3'" . DA  B 2 10  ? 28.170  26.730 22.323  1.00 70.99  ? 10  DA  T "O3'" 1 
ATOM   447  C  "C2'" . DA  B 2 10  ? 26.181  25.937 23.553  1.00 60.31  ? 10  DA  T "C2'" 1 
ATOM   448  C  "C1'" . DA  B 2 10  ? 25.208  25.805 22.397  1.00 57.05  ? 10  DA  T "C1'" 1 
ATOM   449  N  N9    . DA  B 2 10  ? 23.813  25.509 22.733  1.00 52.73  ? 10  DA  T N9    1 
ATOM   450  C  C8    . DA  B 2 10  ? 23.319  24.596 23.631  1.00 51.48  ? 10  DA  T C8    1 
ATOM   451  N  N7    . DA  B 2 10  ? 22.006  24.549 23.667  1.00 48.89  ? 10  DA  T N7    1 
ATOM   452  C  C5    . DA  B 2 10  ? 21.611  25.504 22.741  1.00 47.57  ? 10  DA  T C5    1 
ATOM   453  C  C6    . DA  B 2 10  ? 20.341  25.935 22.303  1.00 47.59  ? 10  DA  T C6    1 
ATOM   454  N  N6    . DA  B 2 10  ? 19.192  25.446 22.767  1.00 45.98  ? 10  DA  T N6    1 
ATOM   455  N  N1    . DA  B 2 10  ? 20.295  26.900 21.359  1.00 47.58  ? 10  DA  T N1    1 
ATOM   456  C  C2    . DA  B 2 10  ? 21.452  27.396 20.895  1.00 49.42  ? 10  DA  T C2    1 
ATOM   457  N  N3    . DA  B 2 10  ? 22.704  27.075 21.229  1.00 48.34  ? 10  DA  T N3    1 
ATOM   458  C  C4    . DA  B 2 10  ? 22.713  26.110 22.164  1.00 48.96  ? 10  DA  T C4    1 
ATOM   459  P  P     . DT  B 2 11  ? 28.729  27.909 23.273  1.00 72.89  ? 11  DT  T P     1 
ATOM   460  O  OP1   . DT  B 2 11  ? 30.145  28.200 22.902  1.00 67.05  ? 11  DT  T OP1   1 
ATOM   461  O  OP2   . DT  B 2 11  ? 28.380  27.576 24.688  1.00 71.06  ? 11  DT  T OP2   1 
ATOM   462  O  "O5'" . DT  B 2 11  ? 27.836  29.144 22.819  1.00 70.35  ? 11  DT  T "O5'" 1 
ATOM   463  C  "C5'" . DT  B 2 11  ? 27.522  29.322 21.447  1.00 68.34  ? 11  DT  T "C5'" 1 
ATOM   464  C  "C4'" . DT  B 2 11  ? 26.430  30.353 21.297  1.00 68.04  ? 11  DT  T "C4'" 1 
ATOM   465  O  "O4'" . DT  B 2 11  ? 25.118  29.800 21.578  1.00 67.03  ? 11  DT  T "O4'" 1 
ATOM   466  C  "C3'" . DT  B 2 11  ? 26.590  31.566 22.209  1.00 67.68  ? 11  DT  T "C3'" 1 
ATOM   467  O  "O3'" . DT  B 2 11  ? 26.241  32.720 21.444  1.00 71.43  ? 11  DT  T "O3'" 1 
ATOM   468  C  "C2'" . DT  B 2 11  ? 25.570  31.302 23.303  1.00 65.67  ? 11  DT  T "C2'" 1 
ATOM   469  C  "C1'" . DT  B 2 11  ? 24.457  30.631 22.518  1.00 63.38  ? 11  DT  T "C1'" 1 
ATOM   470  N  N1    . DT  B 2 11  ? 23.508  29.801 23.301  1.00 60.52  ? 11  DT  T N1    1 
ATOM   471  C  C2    . DT  B 2 11  ? 22.169  29.979 23.048  1.00 60.65  ? 11  DT  T C2    1 
ATOM   472  O  O2    . DT  B 2 11  ? 21.746  30.792 22.244  1.00 62.64  ? 11  DT  T O2    1 
ATOM   473  N  N3    . DT  B 2 11  ? 21.336  29.187 23.789  1.00 57.98  ? 11  DT  T N3    1 
ATOM   474  C  C4    . DT  B 2 11  ? 21.696  28.284 24.761  1.00 57.41  ? 11  DT  T C4    1 
ATOM   475  O  O4    . DT  B 2 11  ? 20.835  27.665 25.372  1.00 60.19  ? 11  DT  T O4    1 
ATOM   476  C  C5    . DT  B 2 11  ? 23.098  28.152 24.992  1.00 56.98  ? 11  DT  T C5    1 
ATOM   477  C  C7    . DT  B 2 11  ? 23.556  27.199 26.056  1.00 57.31  ? 11  DT  T C7    1 
ATOM   478  C  C6    . DT  B 2 11  ? 23.935  28.896 24.250  1.00 57.85  ? 11  DT  T C6    1 
ATOM   479  P  P     . DC  B 2 12  ? 26.441  34.191 22.052  1.00 72.08  ? 12  DC  T P     1 
ATOM   480  O  OP1   . DC  B 2 12  ? 27.087  34.966 20.960  1.00 71.51  ? 12  DC  T OP1   1 
ATOM   481  O  OP2   . DC  B 2 12  ? 27.105  34.095 23.376  1.00 69.93  ? 12  DC  T OP2   1 
ATOM   482  O  "O5'" . DC  B 2 12  ? 24.935  34.686 22.231  1.00 70.78  ? 12  DC  T "O5'" 1 
ATOM   483  C  "C5'" . DC  B 2 12  ? 23.992  34.504 21.171  1.00 73.48  ? 12  DC  T "C5'" 1 
ATOM   484  C  "C4'" . DC  B 2 12  ? 22.652  35.078 21.564  1.00 77.67  ? 12  DC  T "C4'" 1 
ATOM   485  O  "O4'" . DC  B 2 12  ? 21.861  34.095 22.280  1.00 77.17  ? 12  DC  T "O4'" 1 
ATOM   486  C  "C3'" . DC  B 2 12  ? 22.801  36.275 22.498  1.00 81.42  ? 12  DC  T "C3'" 1 
ATOM   487  O  "O3'" . DC  B 2 12  ? 21.885  37.324 22.185  1.00 86.46  ? 12  DC  T "O3'" 1 
ATOM   488  C  "C2'" . DC  B 2 12  ? 22.482  35.698 23.864  1.00 79.09  ? 12  DC  T "C2'" 1 
ATOM   489  C  "C1'" . DC  B 2 12  ? 21.465  34.621 23.539  1.00 75.34  ? 12  DC  T "C1'" 1 
ATOM   490  N  N1    . DC  B 2 12  ? 21.475  33.522 24.520  1.00 71.64  ? 12  DC  T N1    1 
ATOM   491  C  C2    . DC  B 2 12  ? 20.258  33.031 24.998  1.00 68.58  ? 12  DC  T C2    1 
ATOM   492  O  O2    . DC  B 2 12  ? 19.202  33.510 24.551  1.00 65.01  ? 12  DC  T O2    1 
ATOM   493  N  N3    . DC  B 2 12  ? 20.270  32.041 25.929  1.00 67.52  ? 12  DC  T N3    1 
ATOM   494  C  C4    . DC  B 2 12  ? 21.438  31.542 26.366  1.00 66.86  ? 12  DC  T C4    1 
ATOM   495  N  N4    . DC  B 2 12  ? 21.410  30.560 27.263  1.00 66.18  ? 12  DC  T N4    1 
ATOM   496  C  C5    . DC  B 2 12  ? 22.686  32.024 25.891  1.00 66.61  ? 12  DC  T C5    1 
ATOM   497  C  C6    . DC  B 2 12  ? 22.660  33.004 24.977  1.00 70.77  ? 12  DC  T C6    1 
ATOM   498  P  P     . DA  B 2 13  ? 22.246  38.834 22.613  1.00 90.83  ? 13  DA  T P     1 
ATOM   499  O  OP1   . DA  B 2 13  ? 22.710  39.527 21.379  1.00 92.74  ? 13  DA  T OP1   1 
ATOM   500  O  OP2   . DA  B 2 13  ? 23.123  38.819 23.822  1.00 87.20  ? 13  DA  T OP2   1 
ATOM   501  O  "O5'" . DA  B 2 13  ? 20.841  39.443 23.045  1.00 90.01  ? 13  DA  T "O5'" 1 
ATOM   502  C  "C5'" . DA  B 2 13  ? 19.610  38.900 22.559  1.00 89.92  ? 13  DA  T "C5'" 1 
ATOM   503  C  "C4'" . DA  B 2 13  ? 18.585  38.911 23.667  1.00 89.66  ? 13  DA  T "C4'" 1 
ATOM   504  O  "O4'" . DA  B 2 13  ? 18.749  37.752 24.525  1.00 87.44  ? 13  DA  T "O4'" 1 
ATOM   505  C  "C3'" . DA  B 2 13  ? 18.741  40.129 24.578  1.00 90.55  ? 13  DA  T "C3'" 1 
ATOM   506  O  "O3'" . DA  B 2 13  ? 17.481  40.632 24.996  1.00 92.56  ? 13  DA  T "O3'" 1 
ATOM   507  C  "C2'" . DA  B 2 13  ? 19.488  39.583 25.780  1.00 87.80  ? 13  DA  T "C2'" 1 
ATOM   508  C  "C1'" . DA  B 2 13  ? 18.950  38.173 25.865  1.00 84.62  ? 13  DA  T "C1'" 1 
ATOM   509  N  N9    . DA  B 2 13  ? 19.875  37.239 26.489  1.00 81.16  ? 13  DA  T N9    1 
ATOM   510  C  C8    . DA  B 2 13  ? 21.246  37.229 26.438  1.00 79.53  ? 13  DA  T C8    1 
ATOM   511  N  N7    . DA  B 2 13  ? 21.794  36.253 27.120  1.00 78.46  ? 13  DA  T N7    1 
ATOM   512  C  C5    . DA  B 2 13  ? 20.708  35.575 27.655  1.00 79.07  ? 13  DA  T C5    1 
ATOM   513  C  C6    . DA  B 2 13  ? 20.609  34.439 28.479  1.00 79.33  ? 13  DA  T C6    1 
ATOM   514  N  N6    . DA  B 2 13  ? 21.663  33.757 28.945  1.00 77.79  ? 13  DA  T N6    1 
ATOM   515  N  N1    . DA  B 2 13  ? 19.367  34.022 28.817  1.00 81.54  ? 13  DA  T N1    1 
ATOM   516  C  C2    . DA  B 2 13  ? 18.304  34.712 28.360  1.00 81.24  ? 13  DA  T C2    1 
ATOM   517  N  N3    . DA  B 2 13  ? 18.273  35.791 27.589  1.00 78.82  ? 13  DA  T N3    1 
ATOM   518  C  C4    . DA  B 2 13  ? 19.520  36.173 27.269  1.00 79.60  ? 13  DA  T C4    1 
ATOM   519  P  P     . DG  B 2 14  ? 17.423  41.994 25.836  1.00 95.23  ? 14  DG  T P     1 
ATOM   520  O  OP1   . DG  B 2 14  ? 16.536  42.909 25.068  1.00 95.70  ? 14  DG  T OP1   1 
ATOM   521  O  OP2   . DG  B 2 14  ? 18.812  42.413 26.165  1.00 94.18  ? 14  DG  T OP2   1 
ATOM   522  O  "O5'" . DG  B 2 14  ? 16.709  41.558 27.193  1.00 94.29  ? 14  DG  T "O5'" 1 
ATOM   523  C  "C5'" . DG  B 2 14  ? 15.481  40.837 27.153  1.00 91.96  ? 14  DG  T "C5'" 1 
ATOM   524  C  "C4'" . DG  B 2 14  ? 15.182  40.214 28.495  1.00 90.09  ? 14  DG  T "C4'" 1 
ATOM   525  O  "O4'" . DG  B 2 14  ? 16.100  39.132 28.787  1.00 89.43  ? 14  DG  T "O4'" 1 
ATOM   526  C  "C3'" . DG  B 2 14  ? 15.248  41.165 29.685  1.00 89.34  ? 14  DG  T "C3'" 1 
ATOM   527  O  "O3'" . DG  B 2 14  ? 14.115  40.915 30.516  1.00 89.13  ? 14  DG  T "O3'" 1 
ATOM   528  C  "C2'" . DG  B 2 14  ? 16.548  40.780 30.374  1.00 89.07  ? 14  DG  T "C2'" 1 
ATOM   529  C  "C1'" . DG  B 2 14  ? 16.639  39.293 30.086  1.00 88.30  ? 14  DG  T "C1'" 1 
ATOM   530  N  N9    . DG  B 2 14  ? 17.990  38.734 30.082  1.00 87.82  ? 14  DG  T N9    1 
ATOM   531  C  C8    . DG  B 2 14  ? 19.055  39.142 29.313  1.00 86.88  ? 14  DG  T C8    1 
ATOM   532  N  N7    . DG  B 2 14  ? 20.143  38.449 29.532  1.00 86.06  ? 14  DG  T N7    1 
ATOM   533  C  C5    . DG  B 2 14  ? 19.775  37.523 30.503  1.00 85.59  ? 14  DG  T C5    1 
ATOM   534  C  C6    . DG  B 2 14  ? 20.539  36.498 31.145  1.00 84.57  ? 14  DG  T C6    1 
ATOM   535  O  O6    . DG  B 2 14  ? 21.729  36.194 30.978  1.00 84.57  ? 14  DG  T O6    1 
ATOM   536  N  N1    . DG  B 2 14  ? 19.776  35.796 32.064  1.00 83.89  ? 14  DG  T N1    1 
ATOM   537  C  C2    . DG  B 2 14  ? 18.454  36.038 32.341  1.00 85.94  ? 14  DG  T C2    1 
ATOM   538  N  N2    . DG  B 2 14  ? 17.896  35.248 33.265  1.00 87.11  ? 14  DG  T N2    1 
ATOM   539  N  N3    . DG  B 2 14  ? 17.730  36.982 31.757  1.00 86.53  ? 14  DG  T N3    1 
ATOM   540  C  C4    . DG  B 2 14  ? 18.451  37.683 30.854  1.00 86.77  ? 14  DG  T C4    1 
ATOM   541  P  P     . DT  B 2 15  ? 13.955  41.690 31.903  1.00 88.40  ? 15  DT  T P     1 
ATOM   542  O  OP1   . DT  B 2 15  ? 12.515  41.680 32.245  1.00 88.25  ? 15  DT  T OP1   1 
ATOM   543  O  OP2   . DT  B 2 15  ? 14.671  42.979 31.780  1.00 88.18  ? 15  DT  T OP2   1 
ATOM   544  O  "O5'" . DT  B 2 15  ? 14.730  40.755 32.939  1.00 90.68  ? 15  DT  T "O5'" 1 
ATOM   545  C  "C5'" . DT  B 2 15  ? 14.040  39.781 33.723  1.00 92.40  ? 15  DT  T "C5'" 1 
ATOM   546  C  "C4'" . DT  B 2 15  ? 14.764  39.583 35.032  1.00 96.33  ? 15  DT  T "C4'" 1 
ATOM   547  O  "O4'" . DT  B 2 15  ? 16.017  38.902 34.763  1.00 96.54  ? 15  DT  T "O4'" 1 
ATOM   548  C  "C3'" . DT  B 2 15  ? 15.124  40.928 35.682  1.00 99.18  ? 15  DT  T "C3'" 1 
ATOM   549  O  "O3'" . DT  B 2 15  ? 15.097  40.947 37.124  1.00 103.04 ? 15  DT  T "O3'" 1 
ATOM   550  C  "C2'" . DT  B 2 15  ? 16.576  41.102 35.285  1.00 98.46  ? 15  DT  T "C2'" 1 
ATOM   551  C  "C1'" . DT  B 2 15  ? 17.060  39.662 35.334  1.00 98.08  ? 15  DT  T "C1'" 1 
ATOM   552  N  N1    . DT  B 2 15  ? 18.310  39.406 34.593  1.00 97.64  ? 15  DT  T N1    1 
ATOM   553  C  C2    . DT  B 2 15  ? 19.088  38.325 34.958  1.00 97.27  ? 15  DT  T C2    1 
ATOM   554  O  O2    . DT  B 2 15  ? 18.732  37.478 35.766  1.00 96.88  ? 15  DT  T O2    1 
ATOM   555  N  N3    . DT  B 2 15  ? 20.306  38.268 34.329  1.00 96.97  ? 15  DT  T N3    1 
ATOM   556  C  C4    . DT  B 2 15  ? 20.801  39.148 33.381  1.00 97.27  ? 15  DT  T C4    1 
ATOM   557  O  O4    . DT  B 2 15  ? 21.944  39.009 32.953  1.00 99.54  ? 15  DT  T O4    1 
ATOM   558  C  C5    . DT  B 2 15  ? 19.895  40.204 32.984  1.00 96.12  ? 15  DT  T C5    1 
ATOM   559  C  C7    . DT  B 2 15  ? 20.315  41.165 31.916  1.00 93.14  ? 15  DT  T C7    1 
ATOM   560  C  C6    . DT  B 2 15  ? 18.711  40.274 33.600  1.00 96.84  ? 15  DT  T C6    1 
ATOM   561  P  P     . DG  B 2 16  ? 14.168  39.931 37.955  1.00 105.56 ? 16  DG  T P     1 
ATOM   562  O  OP1   . DG  B 2 16  ? 13.180  39.277 37.056  1.00 105.22 ? 16  DG  T OP1   1 
ATOM   563  O  OP2   . DG  B 2 16  ? 13.684  40.660 39.156  1.00 105.30 ? 16  DG  T OP2   1 
ATOM   564  O  "O5'" . DG  B 2 16  ? 15.235  38.859 38.461  1.00 105.50 ? 16  DG  T "O5'" 1 
ATOM   565  C  "C5'" . DG  B 2 16  ? 14.858  37.780 39.302  1.00 108.05 ? 16  DG  T "C5'" 1 
ATOM   566  C  "C4'" . DG  B 2 16  ? 16.027  37.362 40.161  1.00 109.70 ? 16  DG  T "C4'" 1 
ATOM   567  O  "O4'" . DG  B 2 16  ? 17.232  37.421 39.349  1.00 110.36 ? 16  DG  T "O4'" 1 
ATOM   568  C  "C3'" . DG  B 2 16  ? 16.312  38.241 41.386  1.00 109.85 ? 16  DG  T "C3'" 1 
ATOM   569  O  "O3'" . DG  B 2 16  ? 16.729  37.406 42.479  1.00 110.05 ? 16  DG  T "O3'" 1 
ATOM   570  C  "C2'" . DG  B 2 16  ? 17.474  39.102 40.932  1.00 110.21 ? 16  DG  T "C2'" 1 
ATOM   571  C  "C1'" . DG  B 2 16  ? 18.233  38.120 40.068  1.00 110.27 ? 16  DG  T "C1'" 1 
ATOM   572  N  N9    . DG  B 2 16  ? 19.139  38.743 39.118  1.00 110.23 ? 16  DG  T N9    1 
ATOM   573  C  C8    . DG  B 2 16  ? 18.860  39.785 38.269  1.00 109.93 ? 16  DG  T C8    1 
ATOM   574  N  N7    . DG  B 2 16  ? 19.891  40.166 37.564  1.00 110.01 ? 16  DG  T N7    1 
ATOM   575  C  C5    . DG  B 2 16  ? 20.912  39.318 37.966  1.00 111.13 ? 16  DG  T C5    1 
ATOM   576  C  C6    . DG  B 2 16  ? 22.267  39.258 37.553  1.00 111.45 ? 16  DG  T C6    1 
ATOM   577  O  O6    . DG  B 2 16  ? 22.848  39.973 36.734  1.00 111.54 ? 16  DG  T O6    1 
ATOM   578  N  N1    . DG  B 2 16  ? 22.960  38.238 38.202  1.00 112.02 ? 16  DG  T N1    1 
ATOM   579  C  C2    . DG  B 2 16  ? 22.421  37.381 39.130  1.00 112.70 ? 16  DG  T C2    1 
ATOM   580  N  N2    . DG  B 2 16  ? 23.257  36.443 39.627  1.00 112.67 ? 16  DG  T N2    1 
ATOM   581  N  N3    . DG  B 2 16  ? 21.155  37.435 39.537  1.00 112.75 ? 16  DG  T N3    1 
ATOM   582  C  C4    . DG  B 2 16  ? 20.467  38.422 38.913  1.00 111.45 ? 16  DG  T C4    1 
ATOM   583  P  P     . DC  B 2 17  ? 17.464  38.053 43.760  1.00 110.16 ? 17  DC  T P     1 
ATOM   584  O  OP1   . DC  B 2 17  ? 17.436  37.043 44.846  1.00 111.22 ? 17  DC  T OP1   1 
ATOM   585  O  OP2   . DC  B 2 17  ? 16.870  39.392 43.993  1.00 110.65 ? 17  DC  T OP2   1 
ATOM   586  O  "O5'" . DC  B 2 17  ? 18.989  38.232 43.318  1.00 109.96 ? 17  DC  T "O5'" 1 
ATOM   587  C  "C5'" . DC  B 2 17  ? 19.898  37.130 43.376  1.00 110.05 ? 17  DC  T "C5'" 1 
ATOM   588  C  "C4'" . DC  B 2 17  ? 21.309  37.604 43.653  1.00 110.55 ? 17  DC  T "C4'" 1 
ATOM   589  O  "O4'" . DC  B 2 17  ? 21.818  38.338 42.512  1.00 110.23 ? 17  DC  T "O4'" 1 
ATOM   590  C  "C3'" . DC  B 2 17  ? 21.497  38.521 44.869  1.00 111.65 ? 17  DC  T "C3'" 1 
ATOM   591  O  "O3'" . DC  B 2 17  ? 22.708  38.189 45.572  1.00 112.28 ? 17  DC  T "O3'" 1 
ATOM   592  C  "C2'" . DC  B 2 17  ? 21.649  39.896 44.242  1.00 111.55 ? 17  DC  T "C2'" 1 
ATOM   593  C  "C1'" . DC  B 2 17  ? 22.381  39.564 42.955  1.00 110.15 ? 17  DC  T "C1'" 1 
ATOM   594  N  N1    . DC  B 2 17  ? 22.217  40.563 41.883  1.00 109.37 ? 17  DC  T N1    1 
ATOM   595  C  C2    . DC  B 2 17  ? 23.347  40.968 41.167  1.00 108.44 ? 17  DC  T C2    1 
ATOM   596  O  O2    . DC  B 2 17  ? 24.448  40.466 41.447  1.00 107.67 ? 17  DC  T O2    1 
ATOM   597  N  N3    . DC  B 2 17  ? 23.212  41.894 40.187  1.00 107.75 ? 17  DC  T N3    1 
ATOM   598  C  C4    . DC  B 2 17  ? 22.010  42.406 39.914  1.00 107.37 ? 17  DC  T C4    1 
ATOM   599  N  N4    . DC  B 2 17  ? 21.922  43.314 38.940  1.00 106.51 ? 17  DC  T N4    1 
ATOM   600  C  C5    . DC  B 2 17  ? 20.842  42.009 40.627  1.00 108.28 ? 17  DC  T C5    1 
ATOM   601  C  C6    . DC  B 2 17  ? 20.989  41.091 41.595  1.00 109.13 ? 17  DC  T C6    1 
ATOM   602  P  P     . DC  B 2 18  ? 22.979  38.792 47.046  1.00 112.05 ? 18  DC  T P     1 
ATOM   603  O  OP1   . DC  B 2 18  ? 22.826  37.692 48.035  1.00 112.27 ? 18  DC  T OP1   1 
ATOM   604  O  OP2   . DC  B 2 18  ? 22.167  40.026 47.194  1.00 111.38 ? 18  DC  T OP2   1 
ATOM   605  O  "O5'" . DC  B 2 18  ? 24.517  39.211 47.010  1.00 110.03 ? 18  DC  T "O5'" 1 
ATOM   606  C  "C5'" . DC  B 2 18  ? 25.526  38.235 46.771  1.00 108.17 ? 18  DC  T "C5'" 1 
ATOM   607  C  "C4'" . DC  B 2 18  ? 26.819  38.888 46.343  1.00 107.97 ? 18  DC  T "C4'" 1 
ATOM   608  O  "O4'" . DC  B 2 18  ? 26.629  39.582 45.081  1.00 107.20 ? 18  DC  T "O4'" 1 
ATOM   609  C  "C3'" . DC  B 2 18  ? 27.417  39.915 47.313  1.00 107.81 ? 18  DC  T "C3'" 1 
ATOM   610  O  "O3'" . DC  B 2 18  ? 28.847  39.831 47.364  1.00 106.88 ? 18  DC  T "O3'" 1 
ATOM   611  C  "C2'" . DC  B 2 18  ? 27.126  41.243 46.639  1.00 107.46 ? 18  DC  T "C2'" 1 
ATOM   612  C  "C1'" . DC  B 2 18  ? 27.209  40.872 45.168  1.00 106.30 ? 18  DC  T "C1'" 1 
ATOM   613  N  N1    . DC  B 2 18  ? 26.465  41.776 44.274  1.00 104.70 ? 18  DC  T N1    1 
ATOM   614  C  C2    . DC  B 2 18  ? 27.106  42.274 43.138  1.00 103.56 ? 18  DC  T C2    1 
ATOM   615  O  O2    . DC  B 2 18  ? 28.258  41.897 42.886  1.00 102.13 ? 18  DC  T O2    1 
ATOM   616  N  N3    . DC  B 2 18  ? 26.448  43.154 42.344  1.00 103.46 ? 18  DC  T N3    1 
ATOM   617  C  C4    . DC  B 2 18  ? 25.198  43.524 42.648  1.00 103.87 ? 18  DC  T C4    1 
ATOM   618  N  N4    . DC  B 2 18  ? 24.590  44.413 41.858  1.00 103.48 ? 18  DC  T N4    1 
ATOM   619  C  C5    . DC  B 2 18  ? 24.516  43.005 43.781  1.00 104.34 ? 18  DC  T C5    1 
ATOM   620  C  C6    . DC  B 2 18  ? 25.179  42.139 44.559  1.00 105.09 ? 18  DC  T C6    1 
ATOM   621  N  N     . MET C 3 1   ? 48.230  20.180 14.630  0.50 58.45  ? 1   MET A N     1 
ATOM   622  C  CA    . MET C 3 1   ? 47.298  19.083 15.020  0.50 58.01  ? 1   MET A CA    1 
ATOM   623  C  C     . MET C 3 1   ? 46.712  18.445 13.773  0.50 58.95  ? 1   MET A C     1 
ATOM   624  O  O     . MET C 3 1   ? 46.472  19.122 12.773  0.50 57.48  ? 1   MET A O     1 
ATOM   625  C  CB    . MET C 3 1   ? 46.173  19.637 15.903  0.50 55.93  ? 1   MET A CB    1 
ATOM   626  C  CG    . MET C 3 1   ? 45.067  18.644 16.223  0.50 53.42  ? 1   MET A CG    1 
ATOM   627  S  SD    . MET C 3 1   ? 43.759  19.366 17.251  0.50 51.79  ? 1   MET A SD    1 
ATOM   628  C  CE    . MET C 3 1   ? 43.157  20.685 16.155  0.50 52.24  ? 1   MET A CE    1 
ATOM   629  N  N     . ILE C 3 2   ? 46.506  17.135 13.829  1.00 60.85  ? 2   ILE A N     1 
ATOM   630  C  CA    . ILE C 3 2   ? 45.928  16.410 12.702  1.00 64.43  ? 2   ILE A CA    1 
ATOM   631  C  C     . ILE C 3 2   ? 44.623  15.740 13.135  1.00 63.17  ? 2   ILE A C     1 
ATOM   632  O  O     . ILE C 3 2   ? 44.613  14.923 14.066  1.00 63.15  ? 2   ILE A O     1 
ATOM   633  C  CB    . ILE C 3 2   ? 46.884  15.337 12.162  1.00 67.35  ? 2   ILE A CB    1 
ATOM   634  C  CG1   . ILE C 3 2   ? 48.193  15.987 11.711  1.00 68.21  ? 2   ILE A CG1   1 
ATOM   635  C  CG2   . ILE C 3 2   ? 46.224  14.615 10.986  1.00 69.31  ? 2   ILE A CG2   1 
ATOM   636  C  CD1   . ILE C 3 2   ? 49.183  15.011 11.097  1.00 69.67  ? 2   ILE A CD1   1 
ATOM   637  N  N     . VAL C 3 3   ? 43.527  16.081 12.457  1.00 61.52  ? 3   VAL A N     1 
ATOM   638  C  CA    . VAL C 3 3   ? 42.235  15.530 12.831  1.00 60.45  ? 3   VAL A CA    1 
ATOM   639  C  C     . VAL C 3 3   ? 41.609  14.686 11.758  1.00 59.05  ? 3   VAL A C     1 
ATOM   640  O  O     . VAL C 3 3   ? 41.562  15.068 10.594  1.00 60.11  ? 3   VAL A O     1 
ATOM   641  C  CB    . VAL C 3 3   ? 41.239  16.631 13.219  1.00 60.89  ? 3   VAL A CB    1 
ATOM   642  C  CG1   . VAL C 3 3   ? 39.928  16.015 13.649  1.00 61.40  ? 3   VAL A CG1   1 
ATOM   643  C  CG2   . VAL C 3 3   ? 41.797  17.451 14.356  1.00 63.36  ? 3   VAL A CG2   1 
ATOM   644  N  N     . LEU C 3 4   ? 41.120  13.526 12.165  1.00 57.96  ? 4   LEU A N     1 
ATOM   645  C  CA    . LEU C 3 4   ? 40.491  12.607 11.237  1.00 59.10  ? 4   LEU A CA    1 
ATOM   646  C  C     . LEU C 3 4   ? 39.015  12.497 11.581  1.00 57.47  ? 4   LEU A C     1 
ATOM   647  O  O     . LEU C 3 4   ? 38.634  12.165 12.714  1.00 56.82  ? 4   LEU A O     1 
ATOM   648  C  CB    . LEU C 3 4   ? 41.181  11.233 11.301  1.00 62.07  ? 4   LEU A CB    1 
ATOM   649  C  CG    . LEU C 3 4   ? 40.766  10.216 10.232  1.00 64.06  ? 4   LEU A CG    1 
ATOM   650  C  CD1   . LEU C 3 4   ? 41.893  9.218  9.957   1.00 64.45  ? 4   LEU A CD1   1 
ATOM   651  C  CD2   . LEU C 3 4   ? 39.497  9.517  10.696  1.00 64.67  ? 4   LEU A CD2   1 
ATOM   652  N  N     . PHE C 3 5   ? 38.190  12.777 10.583  1.00 54.81  ? 5   PHE A N     1 
ATOM   653  C  CA    . PHE C 3 5   ? 36.748  12.757 10.750  1.00 54.07  ? 5   PHE A CA    1 
ATOM   654  C  C     . PHE C 3 5   ? 36.090  11.612 9.971   1.00 53.23  ? 5   PHE A C     1 
ATOM   655  O  O     . PHE C 3 5   ? 36.323  11.442 8.761   1.00 51.09  ? 5   PHE A O     1 
ATOM   656  C  CB    . PHE C 3 5   ? 36.196  14.106 10.296  1.00 52.35  ? 5   PHE A CB    1 
ATOM   657  C  CG    . PHE C 3 5   ? 34.709  14.240 10.428  1.00 50.04  ? 5   PHE A CG    1 
ATOM   658  C  CD1   . PHE C 3 5   ? 34.105  14.246 11.682  1.00 49.09  ? 5   PHE A CD1   1 
ATOM   659  C  CD2   . PHE C 3 5   ? 33.916  14.422 9.295   1.00 48.81  ? 5   PHE A CD2   1 
ATOM   660  C  CE1   . PHE C 3 5   ? 32.729  14.438 11.808  1.00 47.72  ? 5   PHE A CE1   1 
ATOM   661  C  CE2   . PHE C 3 5   ? 32.534  14.615 9.403   1.00 48.44  ? 5   PHE A CE2   1 
ATOM   662  C  CZ    . PHE C 3 5   ? 31.937  14.625 10.660  1.00 47.44  ? 5   PHE A CZ    1 
ATOM   663  N  N     . VAL C 3 6   ? 35.284  10.821 10.679  1.00 51.92  ? 6   VAL A N     1 
ATOM   664  C  CA    . VAL C 3 6   ? 34.587  9.697  10.062  1.00 51.28  ? 6   VAL A CA    1 
ATOM   665  C  C     . VAL C 3 6   ? 33.091  9.987  10.078  1.00 48.87  ? 6   VAL A C     1 
ATOM   666  O  O     . VAL C 3 6   ? 32.528  10.302 11.118  1.00 47.51  ? 6   VAL A O     1 
ATOM   667  C  CB    . VAL C 3 6   ? 34.864  8.368  10.798  1.00 51.46  ? 6   VAL A CB    1 
ATOM   668  C  CG1   . VAL C 3 6   ? 33.950  7.279  10.264  1.00 52.18  ? 6   VAL A CG1   1 
ATOM   669  C  CG2   . VAL C 3 6   ? 36.296  7.938  10.578  1.00 51.74  ? 6   VAL A CG2   1 
ATOM   670  N  N     . ASP C 3 7   ? 32.462  9.838  8.916   1.00 47.92  ? 7   ASP A N     1 
ATOM   671  C  CA    . ASP C 3 7   ? 31.048  10.122 8.726   1.00 47.26  ? 7   ASP A CA    1 
ATOM   672  C  C     . ASP C 3 7   ? 30.362  9.034  7.902   1.00 47.26  ? 7   ASP A C     1 
ATOM   673  O  O     . ASP C 3 7   ? 30.370  9.098  6.669   1.00 47.15  ? 7   ASP A O     1 
ATOM   674  C  CB    . ASP C 3 7   ? 30.883  11.463 7.994   1.00 47.94  ? 7   ASP A CB    1 
ATOM   675  C  CG    . ASP C 3 7   ? 29.407  11.919 7.906   1.00 49.35  ? 7   ASP A CG    1 
ATOM   676  O  OD1   . ASP C 3 7   ? 28.462  11.081 7.970   1.00 48.78  ? 7   ASP A OD1   1 
ATOM   677  O  OD2   . ASP C 3 7   ? 29.188  13.142 7.751   1.00 50.81  ? 7   ASP A OD2   1 
ATOM   678  N  N     . PHE C 3 8   ? 29.770  8.042  8.575   1.00 46.89  ? 8   PHE A N     1 
ATOM   679  C  CA    . PHE C 3 8   ? 29.051  6.947  7.903   1.00 43.76  ? 8   PHE A CA    1 
ATOM   680  C  C     . PHE C 3 8   ? 28.135  7.484  6.783   1.00 44.36  ? 8   PHE A C     1 
ATOM   681  O  O     . PHE C 3 8   ? 27.436  8.480  6.951   1.00 42.05  ? 8   PHE A O     1 
ATOM   682  C  CB    . PHE C 3 8   ? 28.210  6.174  8.916   1.00 40.85  ? 8   PHE A CB    1 
ATOM   683  C  CG    . PHE C 3 8   ? 28.871  5.997  10.233  1.00 37.60  ? 8   PHE A CG    1 
ATOM   684  C  CD1   . PHE C 3 8   ? 30.248  6.017  10.343  1.00 37.41  ? 8   PHE A CD1   1 
ATOM   685  C  CD2   . PHE C 3 8   ? 28.114  5.766  11.367  1.00 38.36  ? 8   PHE A CD2   1 
ATOM   686  C  CE1   . PHE C 3 8   ? 30.861  5.807  11.562  1.00 37.92  ? 8   PHE A CE1   1 
ATOM   687  C  CE2   . PHE C 3 8   ? 28.717  5.551  12.596  1.00 38.59  ? 8   PHE A CE2   1 
ATOM   688  C  CZ    . PHE C 3 8   ? 30.096  5.570  12.693  1.00 39.30  ? 8   PHE A CZ    1 
ATOM   689  N  N     . ASP C 3 9   ? 28.154  6.795  5.647   1.00 45.60  ? 9   ASP A N     1 
ATOM   690  C  CA    . ASP C 3 9   ? 27.387  7.165  4.466   1.00 48.68  ? 9   ASP A CA    1 
ATOM   691  C  C     . ASP C 3 9   ? 25.925  6.823  4.597   1.00 49.21  ? 9   ASP A C     1 
ATOM   692  O  O     . ASP C 3 9   ? 25.593  5.748  5.103   1.00 49.10  ? 9   ASP A O     1 
ATOM   693  C  CB    . ASP C 3 9   ? 27.968  6.463  3.241   1.00 51.31  ? 9   ASP A CB    1 
ATOM   694  C  CG    . ASP C 3 9   ? 29.390  6.863  2.979   1.00 54.16  ? 9   ASP A CG    1 
ATOM   695  O  OD1   . ASP C 3 9   ? 29.608  8.052  2.634   1.00 55.95  ? 9   ASP A OD1   1 
ATOM   696  O  OD2   . ASP C 3 9   ? 30.283  5.997  3.138   1.00 57.20  ? 9   ASP A OD2   1 
ATOM   697  N  N     . TYR C 3 10  ? 25.068  7.738  4.135   1.00 48.11  ? 10  TYR A N     1 
ATOM   698  C  CA    . TYR C 3 10  ? 23.615  7.576  4.213   1.00 51.52  ? 10  TYR A CA    1 
ATOM   699  C  C     . TYR C 3 10  ? 23.250  6.457  5.226   1.00 51.21  ? 10  TYR A C     1 
ATOM   700  O  O     . TYR C 3 10  ? 22.546  5.497  4.919   1.00 52.18  ? 10  TYR A O     1 
ATOM   701  C  CB    . TYR C 3 10  ? 23.083  7.289  2.812   1.00 56.22  ? 10  TYR A CB    1 
ATOM   702  C  CG    . TYR C 3 10  ? 23.631  6.013  2.223   1.00 64.24  ? 10  TYR A CG    1 
ATOM   703  C  CD1   . TYR C 3 10  ? 22.958  4.802  2.399   1.00 66.67  ? 10  TYR A CD1   1 
ATOM   704  C  CD2   . TYR C 3 10  ? 24.837  5.998  1.514   1.00 66.27  ? 10  TYR A CD2   1 
ATOM   705  C  CE1   . TYR C 3 10  ? 23.460  3.606  1.886   1.00 69.41  ? 10  TYR A CE1   1 
ATOM   706  C  CE2   . TYR C 3 10  ? 25.353  4.798  0.992   1.00 68.83  ? 10  TYR A CE2   1 
ATOM   707  C  CZ    . TYR C 3 10  ? 24.651  3.606  1.185   1.00 69.51  ? 10  TYR A CZ    1 
ATOM   708  O  OH    . TYR C 3 10  ? 25.106  2.413  0.668   1.00 70.83  ? 10  TYR A OH    1 
ATOM   709  N  N     . PHE C 3 11  ? 23.724  6.625  6.456   1.00 49.62  ? 11  PHE A N     1 
ATOM   710  C  CA    . PHE C 3 11  ? 23.571  5.653  7.534   1.00 48.91  ? 11  PHE A CA    1 
ATOM   711  C  C     . PHE C 3 11  ? 22.307  4.812  7.722   1.00 48.74  ? 11  PHE A C     1 
ATOM   712  O  O     . PHE C 3 11  ? 22.340  3.608  7.509   1.00 48.57  ? 11  PHE A O     1 
ATOM   713  C  CB    . PHE C 3 11  ? 23.918  6.319  8.859   1.00 48.81  ? 11  PHE A CB    1 
ATOM   714  C  CG    . PHE C 3 11  ? 24.324  5.347  9.918   1.00 47.28  ? 11  PHE A CG    1 
ATOM   715  C  CD1   . PHE C 3 11  ? 25.323  4.424  9.673   1.00 44.67  ? 11  PHE A CD1   1 
ATOM   716  C  CD2   . PHE C 3 11  ? 23.693  5.337  11.152  1.00 48.91  ? 11  PHE A CD2   1 
ATOM   717  C  CE1   . PHE C 3 11  ? 25.678  3.500  10.629  1.00 45.42  ? 11  PHE A CE1   1 
ATOM   718  C  CE2   . PHE C 3 11  ? 24.050  4.404  12.123  1.00 47.92  ? 11  PHE A CE2   1 
ATOM   719  C  CZ    . PHE C 3 11  ? 25.043  3.490  11.857  1.00 45.66  ? 11  PHE A CZ    1 
ATOM   720  N  N     . TYR C 3 12  ? 21.202  5.415  8.140   1.00 49.00  ? 12  TYR A N     1 
ATOM   721  C  CA    . TYR C 3 12  ? 19.978  4.638  8.358   1.00 48.92  ? 12  TYR A CA    1 
ATOM   722  C  C     . TYR C 3 12  ? 19.597  3.769  7.157   1.00 49.46  ? 12  TYR A C     1 
ATOM   723  O  O     . TYR C 3 12  ? 19.053  2.677  7.319   1.00 49.14  ? 12  TYR A O     1 
ATOM   724  C  CB    . TYR C 3 12  ? 18.806  5.558  8.724   1.00 48.59  ? 12  TYR A CB    1 
ATOM   725  C  CG    . TYR C 3 12  ? 18.954  6.276  10.055  1.00 46.61  ? 12  TYR A CG    1 
ATOM   726  C  CD1   . TYR C 3 12  ? 20.181  6.328  10.720  1.00 45.87  ? 12  TYR A CD1   1 
ATOM   727  C  CD2   . TYR C 3 12  ? 17.878  6.952  10.618  1.00 45.19  ? 12  TYR A CD2   1 
ATOM   728  C  CE1   . TYR C 3 12  ? 20.327  7.035  11.897  1.00 44.62  ? 12  TYR A CE1   1 
ATOM   729  C  CE2   . TYR C 3 12  ? 18.017  7.660  11.793  1.00 45.62  ? 12  TYR A CE2   1 
ATOM   730  C  CZ    . TYR C 3 12  ? 19.245  7.699  12.423  1.00 45.57  ? 12  TYR A CZ    1 
ATOM   731  O  OH    . TYR C 3 12  ? 19.386  8.426  13.577  1.00 50.08  ? 12  TYR A OH    1 
ATOM   732  N  N     . ALA C 3 13  ? 19.881  4.247  5.952   1.00 49.55  ? 13  ALA A N     1 
ATOM   733  C  CA    . ALA C 3 13  ? 19.563  3.471  4.768   1.00 50.00  ? 13  ALA A CA    1 
ATOM   734  C  C     . ALA C 3 13  ? 20.545  2.296  4.690   1.00 52.57  ? 13  ALA A C     1 
ATOM   735  O  O     . ALA C 3 13  ? 20.148  1.119  4.618   1.00 52.23  ? 13  ALA A O     1 
ATOM   736  C  CB    . ALA C 3 13  ? 19.667  4.342  3.532   1.00 45.60  ? 13  ALA A CB    1 
ATOM   737  N  N     . GLN C 3 14  ? 21.834  2.614  4.733   1.00 53.54  ? 14  GLN A N     1 
ATOM   738  C  CA    . GLN C 3 14  ? 22.850  1.581  4.647   1.00 54.20  ? 14  GLN A CA    1 
ATOM   739  C  C     . GLN C 3 14  ? 22.644  0.442  5.650   1.00 54.81  ? 14  GLN A C     1 
ATOM   740  O  O     . GLN C 3 14  ? 22.676  -0.730 5.274   1.00 56.07  ? 14  GLN A O     1 
ATOM   741  C  CB    . GLN C 3 14  ? 24.243  2.182  4.830   1.00 53.88  ? 14  GLN A CB    1 
ATOM   742  C  CG    . GLN C 3 14  ? 25.277  1.517  3.950   1.00 57.73  ? 14  GLN A CG    1 
ATOM   743  C  CD    . GLN C 3 14  ? 26.707  1.835  4.347   1.00 60.18  ? 14  GLN A CD    1 
ATOM   744  O  OE1   . GLN C 3 14  ? 27.009  2.948  4.773   1.00 63.22  ? 14  GLN A OE1   1 
ATOM   745  N  NE2   . GLN C 3 14  ? 27.601  0.856  4.191   1.00 59.22  ? 14  GLN A NE2   1 
ATOM   746  N  N     . VAL C 3 15  ? 22.429  0.768  6.921   1.00 54.40  ? 15  VAL A N     1 
ATOM   747  C  CA    . VAL C 3 15  ? 22.249  -0.282 7.910   1.00 53.94  ? 15  VAL A CA    1 
ATOM   748  C  C     . VAL C 3 15  ? 21.056  -1.160 7.569   1.00 56.73  ? 15  VAL A C     1 
ATOM   749  O  O     . VAL C 3 15  ? 21.068  -2.356 7.847   1.00 57.46  ? 15  VAL A O     1 
ATOM   750  C  CB    . VAL C 3 15  ? 22.098  0.297  9.297   1.00 50.42  ? 15  VAL A CB    1 
ATOM   751  C  CG1   . VAL C 3 15  ? 21.952  -0.818 10.315  1.00 48.68  ? 15  VAL A CG1   1 
ATOM   752  C  CG2   . VAL C 3 15  ? 23.310  1.130  9.607   1.00 50.08  ? 15  VAL A CG2   1 
ATOM   753  N  N     . GLU C 3 16  ? 20.026  -0.574 6.966   1.00 58.52  ? 16  GLU A N     1 
ATOM   754  C  CA    . GLU C 3 16  ? 18.873  -1.359 6.549   1.00 61.26  ? 16  GLU A CA    1 
ATOM   755  C  C     . GLU C 3 16  ? 19.359  -2.362 5.464   1.00 64.64  ? 16  GLU A C     1 
ATOM   756  O  O     . GLU C 3 16  ? 19.153  -3.589 5.567   1.00 64.06  ? 16  GLU A O     1 
ATOM   757  C  CB    . GLU C 3 16  ? 17.784  -0.438 5.981   1.00 59.20  ? 16  GLU A CB    1 
ATOM   758  C  CG    . GLU C 3 16  ? 16.977  0.302  7.032   1.00 59.51  ? 16  GLU A CG    1 
ATOM   759  C  CD    . GLU C 3 16  ? 16.260  -0.650 7.987   1.00 61.71  ? 16  GLU A CD    1 
ATOM   760  O  OE1   . GLU C 3 16  ? 16.340  -1.881 7.768   1.00 60.75  ? 16  GLU A OE1   1 
ATOM   761  O  OE2   . GLU C 3 16  ? 15.616  -0.172 8.955   1.00 61.33  ? 16  GLU A OE2   1 
ATOM   762  N  N     . GLU C 3 17  ? 20.024  -1.825 4.438   1.00 65.56  ? 17  GLU A N     1 
ATOM   763  C  CA    . GLU C 3 17  ? 20.542  -2.631 3.346   1.00 65.94  ? 17  GLU A CA    1 
ATOM   764  C  C     . GLU C 3 17  ? 21.422  -3.747 3.892   1.00 66.02  ? 17  GLU A C     1 
ATOM   765  O  O     . GLU C 3 17  ? 21.342  -4.881 3.433   1.00 67.42  ? 17  GLU A O     1 
ATOM   766  C  CB    . GLU C 3 17  ? 21.333  -1.754 2.369   1.00 67.12  ? 17  GLU A CB    1 
ATOM   767  C  CG    . GLU C 3 17  ? 20.480  -0.695 1.665   1.00 72.18  ? 17  GLU A CG    1 
ATOM   768  C  CD    . GLU C 3 17  ? 21.300  0.219  0.758   1.00 75.58  ? 17  GLU A CD    1 
ATOM   769  O  OE1   . GLU C 3 17  ? 22.545  0.055  0.719   1.00 77.58  ? 17  GLU A OE1   1 
ATOM   770  O  OE2   . GLU C 3 17  ? 20.702  1.102  0.089   1.00 75.81  ? 17  GLU A OE2   1 
ATOM   771  N  N     . VAL C 3 18  ? 22.254  -3.443 4.878   1.00 65.48  ? 18  VAL A N     1 
ATOM   772  C  CA    . VAL C 3 18  ? 23.123  -4.470 5.436   1.00 65.47  ? 18  VAL A CA    1 
ATOM   773  C  C     . VAL C 3 18  ? 22.331  -5.570 6.134   1.00 66.50  ? 18  VAL A C     1 
ATOM   774  O  O     . VAL C 3 18  ? 22.784  -6.713 6.212   1.00 66.89  ? 18  VAL A O     1 
ATOM   775  C  CB    . VAL C 3 18  ? 24.149  -3.872 6.427   1.00 65.93  ? 18  VAL A CB    1 
ATOM   776  C  CG1   . VAL C 3 18  ? 24.701  -4.965 7.341   1.00 66.29  ? 18  VAL A CG1   1 
ATOM   777  C  CG2   . VAL C 3 18  ? 25.295  -3.240 5.662   1.00 64.29  ? 18  VAL A CG2   1 
ATOM   778  N  N     . LEU C 3 19  ? 21.148  -5.237 6.636   1.00 66.66  ? 19  LEU A N     1 
ATOM   779  C  CA    . LEU C 3 19  ? 20.339  -6.238 7.314   1.00 67.00  ? 19  LEU A CA    1 
ATOM   780  C  C     . LEU C 3 19  ? 19.510  -7.052 6.326   1.00 67.22  ? 19  LEU A C     1 
ATOM   781  O  O     . LEU C 3 19  ? 19.061  -8.156 6.645   1.00 68.75  ? 19  LEU A O     1 
ATOM   782  C  CB    . LEU C 3 19  ? 19.433  -5.573 8.359   1.00 67.05  ? 19  LEU A CB    1 
ATOM   783  C  CG    . LEU C 3 19  ? 19.948  -5.643 9.810   1.00 68.08  ? 19  LEU A CG    1 
ATOM   784  C  CD1   . LEU C 3 19  ? 21.381  -5.113 9.906   1.00 66.06  ? 19  LEU A CD1   1 
ATOM   785  C  CD2   . LEU C 3 19  ? 19.005  -4.860 10.723  1.00 66.80  ? 19  LEU A CD2   1 
ATOM   786  N  N     . ASN C 3 20  ? 19.335  -6.504 5.127   1.00 65.42  ? 20  ASN A N     1 
ATOM   787  C  CA    . ASN C 3 20  ? 18.560  -7.133 4.071   1.00 63.11  ? 20  ASN A CA    1 
ATOM   788  C  C     . ASN C 3 20  ? 19.190  -6.715 2.735   1.00 63.71  ? 20  ASN A C     1 
ATOM   789  O  O     . ASN C 3 20  ? 18.712  -5.789 2.071   1.00 63.89  ? 20  ASN A O     1 
ATOM   790  C  CB    . ASN C 3 20  ? 17.109  -6.656 4.195   1.00 61.57  ? 20  ASN A CB    1 
ATOM   791  C  CG    . ASN C 3 20  ? 16.269  -6.969 2.974   1.00 60.41  ? 20  ASN A CG    1 
ATOM   792  O  OD1   . ASN C 3 20  ? 16.733  -7.586 2.018   1.00 61.89  ? 20  ASN A OD1   1 
ATOM   793  N  ND2   . ASN C 3 20  ? 15.016  -6.537 3.003   1.00 58.74  ? 20  ASN A ND2   1 
ATOM   794  N  N     . PRO C 3 21  ? 20.278  -7.402 2.331   1.00 64.07  ? 21  PRO A N     1 
ATOM   795  C  CA    . PRO C 3 21  ? 21.088  -7.223 1.114   1.00 64.37  ? 21  PRO A CA    1 
ATOM   796  C  C     . PRO C 3 21  ? 20.337  -7.025 -0.191  1.00 64.30  ? 21  PRO A C     1 
ATOM   797  O  O     . PRO C 3 21  ? 20.803  -6.300 -1.074  1.00 63.91  ? 21  PRO A O     1 
ATOM   798  C  CB    . PRO C 3 21  ? 21.945  -8.481 1.086   1.00 64.81  ? 21  PRO A CB    1 
ATOM   799  C  CG    . PRO C 3 21  ? 22.172  -8.751 2.525   1.00 65.70  ? 21  PRO A CG    1 
ATOM   800  C  CD    . PRO C 3 21  ? 20.787  -8.543 3.110   1.00 65.30  ? 21  PRO A CD    1 
ATOM   801  N  N     . SER C 3 22  ? 19.184  -7.677 -0.307  1.00 65.23  ? 22  SER A N     1 
ATOM   802  C  CA    . SER C 3 22  ? 18.351  -7.585 -1.500  1.00 67.21  ? 22  SER A CA    1 
ATOM   803  C  C     . SER C 3 22  ? 17.927  -6.152 -1.772  1.00 68.55  ? 22  SER A C     1 
ATOM   804  O  O     . SER C 3 22  ? 17.412  -5.839 -2.845  1.00 70.86  ? 22  SER A O     1 
ATOM   805  C  CB    . SER C 3 22  ? 17.092  -8.425 -1.324  1.00 68.18  ? 22  SER A CB    1 
ATOM   806  O  OG    . SER C 3 22  ? 16.159  -7.769 -0.474  1.00 67.17  ? 22  SER A OG    1 
ATOM   807  N  N     . LEU C 3 23  ? 18.132  -5.285 -0.792  1.00 68.64  ? 23  LEU A N     1 
ATOM   808  C  CA    . LEU C 3 23  ? 17.745  -3.900 -0.928  1.00 69.58  ? 23  LEU A CA    1 
ATOM   809  C  C     . LEU C 3 23  ? 18.745  -3.081 -1.710  1.00 70.63  ? 23  LEU A C     1 
ATOM   810  O  O     . LEU C 3 23  ? 18.416  -2.000 -2.198  1.00 70.08  ? 23  LEU A O     1 
ATOM   811  C  CB    . LEU C 3 23  ? 17.547  -3.290 0.453   1.00 70.21  ? 23  LEU A CB    1 
ATOM   812  C  CG    . LEU C 3 23  ? 16.309  -3.751 1.215   1.00 68.86  ? 23  LEU A CG    1 
ATOM   813  C  CD1   . LEU C 3 23  ? 16.324  -3.153 2.613   1.00 69.54  ? 23  LEU A CD1   1 
ATOM   814  C  CD2   . LEU C 3 23  ? 15.071  -3.303 0.464   1.00 67.69  ? 23  LEU A CD2   1 
ATOM   815  N  N     . LYS C 3 24  ? 19.969  -3.591 -1.818  1.00 72.88  ? 24  LYS A N     1 
ATOM   816  C  CA    . LYS C 3 24  ? 21.029  -2.890 -2.540  1.00 75.06  ? 24  LYS A CA    1 
ATOM   817  C  C     . LYS C 3 24  ? 20.663  -2.661 -4.001  1.00 75.00  ? 24  LYS A C     1 
ATOM   818  O  O     . LYS C 3 24  ? 20.121  -3.549 -4.655  1.00 75.94  ? 24  LYS A O     1 
ATOM   819  C  CB    . LYS C 3 24  ? 22.346  -3.674 -2.436  1.00 76.72  ? 24  LYS A CB    1 
ATOM   820  C  CG    . LYS C 3 24  ? 23.203  -3.250 -1.231  1.00 81.19  ? 24  LYS A CG    1 
ATOM   821  C  CD    . LYS C 3 24  ? 24.528  -4.015 -1.100  1.00 83.64  ? 24  LYS A CD    1 
ATOM   822  C  CE    . LYS C 3 24  ? 24.337  -5.444 -0.570  1.00 84.91  ? 24  LYS A CE    1 
ATOM   823  N  NZ    . LYS C 3 24  ? 25.640  -6.128 -0.299  1.00 83.61  ? 24  LYS A NZ    1 
ATOM   824  N  N     . GLY C 3 25  ? 20.944  -1.466 -4.509  1.00 73.71  ? 25  GLY A N     1 
ATOM   825  C  CA    . GLY C 3 25  ? 20.629  -1.185 -5.896  1.00 73.63  ? 25  GLY A CA    1 
ATOM   826  C  C     . GLY C 3 25  ? 19.269  -0.549 -6.083  1.00 74.07  ? 25  GLY A C     1 
ATOM   827  O  O     . GLY C 3 25  ? 19.027  0.137  -7.076  1.00 75.36  ? 25  GLY A O     1 
ATOM   828  N  N     . LYS C 3 26  ? 18.368  -0.774 -5.136  1.00 73.34  ? 26  LYS A N     1 
ATOM   829  C  CA    . LYS C 3 26  ? 17.040  -0.181 -5.225  1.00 72.35  ? 26  LYS A CA    1 
ATOM   830  C  C     . LYS C 3 26  ? 17.010  1.074  -4.354  1.00 71.37  ? 26  LYS A C     1 
ATOM   831  O  O     . LYS C 3 26  ? 17.724  1.163  -3.356  1.00 71.14  ? 26  LYS A O     1 
ATOM   832  C  CB    . LYS C 3 26  ? 15.986  -1.154 -4.713  1.00 72.08  ? 26  LYS A CB    1 
ATOM   833  C  CG    . LYS C 3 26  ? 16.165  -2.586 -5.163  1.00 74.04  ? 26  LYS A CG    1 
ATOM   834  C  CD    . LYS C 3 26  ? 15.121  -3.458 -4.500  1.00 75.61  ? 26  LYS A CD    1 
ATOM   835  C  CE    . LYS C 3 26  ? 15.144  -4.880 -5.025  1.00 77.72  ? 26  LYS A CE    1 
ATOM   836  N  NZ    . LYS C 3 26  ? 13.965  -5.668 -4.536  1.00 79.27  ? 26  LYS A NZ    1 
ATOM   837  N  N     . PRO C 3 27  ? 16.199  2.072  -4.730  1.00 69.58  ? 27  PRO A N     1 
ATOM   838  C  CA    . PRO C 3 27  ? 16.142  3.280  -3.907  1.00 68.11  ? 27  PRO A CA    1 
ATOM   839  C  C     . PRO C 3 27  ? 15.471  2.936  -2.571  1.00 67.32  ? 27  PRO A C     1 
ATOM   840  O  O     . PRO C 3 27  ? 14.421  2.274  -2.542  1.00 66.83  ? 27  PRO A O     1 
ATOM   841  C  CB    . PRO C 3 27  ? 15.294  4.225  -4.751  1.00 68.31  ? 27  PRO A CB    1 
ATOM   842  C  CG    . PRO C 3 27  ? 14.348  3.283  -5.427  1.00 67.52  ? 27  PRO A CG    1 
ATOM   843  C  CD    . PRO C 3 27  ? 15.275  2.171  -5.870  1.00 68.75  ? 27  PRO A CD    1 
ATOM   844  N  N     . VAL C 3 28  ? 16.090  3.352  -1.470  1.00 65.02  ? 28  VAL A N     1 
ATOM   845  C  CA    . VAL C 3 28  ? 15.527  3.098  -0.143  1.00 63.14  ? 28  VAL A CA    1 
ATOM   846  C  C     . VAL C 3 28  ? 15.253  4.402  0.615   1.00 61.42  ? 28  VAL A C     1 
ATOM   847  O  O     . VAL C 3 28  ? 16.075  5.329  0.610   1.00 60.97  ? 28  VAL A O     1 
ATOM   848  C  CB    . VAL C 3 28  ? 16.447  2.201  0.694   1.00 62.90  ? 28  VAL A CB    1 
ATOM   849  C  CG1   . VAL C 3 28  ? 15.858  2.002  2.073   1.00 64.27  ? 28  VAL A CG1   1 
ATOM   850  C  CG2   . VAL C 3 28  ? 16.607  0.856  0.009   1.00 64.08  ? 28  VAL A CG2   1 
ATOM   851  N  N     . VAL C 3 29  ? 14.083  4.465  1.252   1.00 58.68  ? 29  VAL A N     1 
ATOM   852  C  CA    . VAL C 3 29  ? 13.665  5.648  1.997   1.00 55.78  ? 29  VAL A CA    1 
ATOM   853  C  C     . VAL C 3 29  ? 13.227  5.310  3.413   1.00 55.81  ? 29  VAL A C     1 
ATOM   854  O  O     . VAL C 3 29  ? 12.144  4.751  3.605   1.00 57.37  ? 29  VAL A O     1 
ATOM   855  C  CB    . VAL C 3 29  ? 12.483  6.318  1.312   1.00 53.51  ? 29  VAL A CB    1 
ATOM   856  C  CG1   . VAL C 3 29  ? 12.192  7.622  1.966   1.00 53.56  ? 29  VAL A CG1   1 
ATOM   857  C  CG2   . VAL C 3 29  ? 12.769  6.496  -0.142  1.00 53.54  ? 29  VAL A CG2   1 
ATOM   858  N  N     . VAL C 3 30  ? 14.064  5.645  4.392   1.00 54.77  ? 30  VAL A N     1 
ATOM   859  C  CA    . VAL C 3 30  ? 13.772  5.406  5.801   1.00 52.94  ? 30  VAL A CA    1 
ATOM   860  C  C     . VAL C 3 30  ? 12.867  6.540  6.263   1.00 53.48  ? 30  VAL A C     1 
ATOM   861  O  O     . VAL C 3 30  ? 13.255  7.695  6.217   1.00 53.46  ? 30  VAL A O     1 
ATOM   862  C  CB    . VAL C 3 30  ? 15.051  5.447  6.641   1.00 52.54  ? 30  VAL A CB    1 
ATOM   863  C  CG1   . VAL C 3 30  ? 14.778  4.918  8.023   1.00 52.65  ? 30  VAL A CG1   1 
ATOM   864  C  CG2   . VAL C 3 30  ? 16.130  4.650  5.973   1.00 51.35  ? 30  VAL A CG2   1 
ATOM   865  N  N     . CYS C 3 31  ? 11.667  6.217  6.726   1.00 56.17  ? 31  CYS A N     1 
ATOM   866  C  CA    . CYS C 3 31  ? 10.730  7.255  7.153   1.00 58.02  ? 31  CYS A CA    1 
ATOM   867  C  C     . CYS C 3 31  ? 10.277  7.227  8.611   1.00 58.31  ? 31  CYS A C     1 
ATOM   868  O  O     . CYS C 3 31  ? 10.424  6.226  9.338   1.00 58.24  ? 31  CYS A O     1 
ATOM   869  C  CB    . CYS C 3 31  ? 9.472   7.212  6.285   1.00 59.58  ? 31  CYS A CB    1 
ATOM   870  S  SG    . CYS C 3 31  ? 9.647   6.376  4.704   1.00 63.30  ? 31  CYS A SG    1 
ATOM   871  N  N     . VAL C 3 32  ? 9.700   8.355  9.007   1.00 58.30  ? 32  VAL A N     1 
ATOM   872  C  CA    . VAL C 3 32  ? 9.155   8.552  10.338  1.00 58.67  ? 32  VAL A CA    1 
ATOM   873  C  C     . VAL C 3 32  ? 7.645   8.765  10.174  1.00 60.35  ? 32  VAL A C     1 
ATOM   874  O  O     . VAL C 3 32  ? 7.176   9.875  9.910   1.00 58.17  ? 32  VAL A O     1 
ATOM   875  C  CB    . VAL C 3 32  ? 9.813   9.781  11.031  1.00 57.36  ? 32  VAL A CB    1 
ATOM   876  C  CG1   . VAL C 3 32  ? 9.058   10.151 12.284  1.00 54.41  ? 32  VAL A CG1   1 
ATOM   877  C  CG2   . VAL C 3 32  ? 11.254  9.465  11.384  1.00 55.45  ? 32  VAL A CG2   1 
ATOM   878  N  N     . PHE C 3 33  ? 6.900   7.669  10.299  1.00 64.36  ? 33  PHE A N     1 
ATOM   879  C  CA    . PHE C 3 33  ? 5.435   7.677  10.187  1.00 69.16  ? 33  PHE A CA    1 
ATOM   880  C  C     . PHE C 3 33  ? 4.824   8.296  11.449  1.00 72.62  ? 33  PHE A C     1 
ATOM   881  O  O     . PHE C 3 33  ? 4.875   7.691  12.524  1.00 71.96  ? 33  PHE A O     1 
ATOM   882  C  CB    . PHE C 3 33  ? 4.906   6.246  10.041  1.00 68.29  ? 33  PHE A CB    1 
ATOM   883  C  CG    . PHE C 3 33  ? 5.300   5.572  8.764   1.00 68.11  ? 33  PHE A CG    1 
ATOM   884  C  CD1   . PHE C 3 33  ? 4.809   6.026  7.545   1.00 67.99  ? 33  PHE A CD1   1 
ATOM   885  C  CD2   . PHE C 3 33  ? 6.139   4.463  8.776   1.00 68.64  ? 33  PHE A CD2   1 
ATOM   886  C  CE1   . PHE C 3 33  ? 5.144   5.384  6.352   1.00 67.14  ? 33  PHE A CE1   1 
ATOM   887  C  CE2   . PHE C 3 33  ? 6.482   3.813  7.579   1.00 69.32  ? 33  PHE A CE2   1 
ATOM   888  C  CZ    . PHE C 3 33  ? 5.980   4.278  6.368   1.00 67.40  ? 33  PHE A CZ    1 
ATOM   889  N  N     . SER C 3 34  ? 4.237   9.486  11.317  1.00 76.54  ? 34  SER A N     1 
ATOM   890  C  CA    . SER C 3 34  ? 3.645   10.179 12.465  1.00 80.07  ? 34  SER A CA    1 
ATOM   891  C  C     . SER C 3 34  ? 2.390   9.511  13.060  1.00 83.18  ? 34  SER A C     1 
ATOM   892  O  O     . SER C 3 34  ? 2.150   9.587  14.270  1.00 83.40  ? 34  SER A O     1 
ATOM   893  C  CB    . SER C 3 34  ? 3.369   11.650 12.107  1.00 78.44  ? 34  SER A CB    1 
ATOM   894  O  OG    . SER C 3 34  ? 2.669   11.784 10.888  1.00 76.65  ? 34  SER A OG    1 
ATOM   895  N  N     . GLY C 3 35  ? 1.600   8.845  12.225  1.00 86.48  ? 35  GLY A N     1 
ATOM   896  C  CA    . GLY C 3 35  ? 0.420   8.169  12.738  1.00 89.73  ? 35  GLY A CA    1 
ATOM   897  C  C     . GLY C 3 35  ? -0.893  8.885  12.495  1.00 92.22  ? 35  GLY A C     1 
ATOM   898  O  O     . GLY C 3 35  ? -1.958  8.267  12.557  1.00 92.64  ? 35  GLY A O     1 
ATOM   899  N  N     . ARG C 3 36  ? -0.834  10.184 12.219  1.00 93.75  ? 36  ARG A N     1 
ATOM   900  C  CA    . ARG C 3 36  ? -2.056  10.937 11.972  1.00 95.29  ? 36  ARG A CA    1 
ATOM   901  C  C     . ARG C 3 36  ? -2.877  10.306 10.853  1.00 96.92  ? 36  ARG A C     1 
ATOM   902  O  O     . ARG C 3 36  ? -4.018  9.898  11.068  1.00 97.30  ? 36  ARG A O     1 
ATOM   903  C  CB    . ARG C 3 36  ? -1.727  12.393 11.642  1.00 94.57  ? 36  ARG A CB    1 
ATOM   904  C  CG    . ARG C 3 36  ? -1.163  13.150 12.829  1.00 93.91  ? 36  ARG A CG    1 
ATOM   905  C  CD    . ARG C 3 36  ? -1.163  14.634 12.573  1.00 94.57  ? 36  ARG A CD    1 
ATOM   906  N  NE    . ARG C 3 36  ? -1.483  15.378 13.787  1.00 94.70  ? 36  ARG A NE    1 
ATOM   907  C  CZ    . ARG C 3 36  ? -1.690  16.691 13.827  1.00 94.29  ? 36  ARG A CZ    1 
ATOM   908  N  NH1   . ARG C 3 36  ? -1.608  17.415 12.718  1.00 93.08  ? 36  ARG A NH1   1 
ATOM   909  N  NH2   . ARG C 3 36  ? -1.993  17.281 14.974  1.00 94.54  ? 36  ARG A NH2   1 
ATOM   910  N  N     . PHE C 3 37  ? -2.288  10.203 9.668   1.00 98.86  ? 37  PHE A N     1 
ATOM   911  C  CA    . PHE C 3 37  ? -2.983  9.614  8.535   1.00 100.45 ? 37  PHE A CA    1 
ATOM   912  C  C     . PHE C 3 37  ? -2.089  8.712  7.680   1.00 100.83 ? 37  PHE A C     1 
ATOM   913  O  O     . PHE C 3 37  ? -0.935  8.444  8.023   1.00 101.07 ? 37  PHE A O     1 
ATOM   914  C  CB    . PHE C 3 37  ? -3.598  10.726 7.677   1.00 102.26 ? 37  PHE A CB    1 
ATOM   915  C  CG    . PHE C 3 37  ? -2.595  11.711 7.132   1.00 105.17 ? 37  PHE A CG    1 
ATOM   916  C  CD1   . PHE C 3 37  ? -1.805  11.389 6.026   1.00 105.88 ? 37  PHE A CD1   1 
ATOM   917  C  CD2   . PHE C 3 37  ? -2.450  12.973 7.719   1.00 106.23 ? 37  PHE A CD2   1 
ATOM   918  C  CE1   . PHE C 3 37  ? -0.881  12.311 5.511   1.00 106.93 ? 37  PHE A CE1   1 
ATOM   919  C  CE2   . PHE C 3 37  ? -1.526  13.908 7.213   1.00 106.47 ? 37  PHE A CE2   1 
ATOM   920  C  CZ    . PHE C 3 37  ? -0.742  13.575 6.106   1.00 107.02 ? 37  PHE A CZ    1 
ATOM   921  N  N     . GLU C 3 38  ? -2.638  8.243  6.564   1.00 101.50 ? 38  GLU A N     1 
ATOM   922  C  CA    . GLU C 3 38  ? -1.913  7.373  5.640   1.00 101.01 ? 38  GLU A CA    1 
ATOM   923  C  C     . GLU C 3 38  ? -0.697  8.108  5.089   1.00 98.54  ? 38  GLU A C     1 
ATOM   924  O  O     . GLU C 3 38  ? -0.827  9.116  4.385   1.00 98.40  ? 38  GLU A O     1 
ATOM   925  C  CB    . GLU C 3 38  ? -2.832  6.945  4.478   1.00 103.72 ? 38  GLU A CB    1 
ATOM   926  C  CG    . GLU C 3 38  ? -2.228  5.923  3.499   1.00 106.89 ? 38  GLU A CG    1 
ATOM   927  C  CD    . GLU C 3 38  ? -2.147  4.504  4.068   1.00 108.95 ? 38  GLU A CD    1 
ATOM   928  O  OE1   . GLU C 3 38  ? -1.624  4.332  5.196   1.00 110.11 ? 38  GLU A OE1   1 
ATOM   929  O  OE2   . GLU C 3 38  ? -2.603  3.562  3.377   1.00 108.73 ? 38  GLU A OE2   1 
ATOM   930  N  N     . ASP C 3 39  ? 0.484   7.606  5.426   1.00 95.41  ? 39  ASP A N     1 
ATOM   931  C  CA    . ASP C 3 39  ? 1.723   8.201  4.955   1.00 92.28  ? 39  ASP A CA    1 
ATOM   932  C  C     . ASP C 3 39  ? 2.040   9.603  5.491   1.00 90.12  ? 39  ASP A C     1 
ATOM   933  O  O     . ASP C 3 39  ? 2.691   10.388 4.802   1.00 90.45  ? 39  ASP A O     1 
ATOM   934  C  CB    . ASP C 3 39  ? 1.740   8.242  3.419   1.00 92.17  ? 39  ASP A CB    1 
ATOM   935  C  CG    . ASP C 3 39  ? 1.685   6.856  2.788   1.00 91.43  ? 39  ASP A CG    1 
ATOM   936  O  OD1   . ASP C 3 39  ? 2.328   5.922  3.317   1.00 89.97  ? 39  ASP A OD1   1 
ATOM   937  O  OD2   . ASP C 3 39  ? 1.009   6.708  1.746   1.00 90.75  ? 39  ASP A OD2   1 
ATOM   938  N  N     . SER C 3 40  ? 1.582   9.940  6.693   1.00 87.04  ? 40  SER A N     1 
ATOM   939  C  CA    . SER C 3 40  ? 1.914   11.251 7.247   1.00 83.54  ? 40  SER A CA    1 
ATOM   940  C  C     . SER C 3 40  ? 3.260   11.043 7.938   1.00 80.73  ? 40  SER A C     1 
ATOM   941  O  O     . SER C 3 40  ? 3.575   9.927  8.368   1.00 80.50  ? 40  SER A O     1 
ATOM   942  C  CB    . SER C 3 40  ? 0.873   11.712 8.271   1.00 84.06  ? 40  SER A CB    1 
ATOM   943  O  OG    . SER C 3 40  ? 0.928   10.929 9.451   1.00 85.73  ? 40  SER A OG    1 
ATOM   944  N  N     . GLY C 3 41  ? 4.052   12.105 8.041   1.00 76.93  ? 41  GLY A N     1 
ATOM   945  C  CA    . GLY C 3 41  ? 5.358   11.992 8.668   1.00 72.77  ? 41  GLY A CA    1 
ATOM   946  C  C     . GLY C 3 41  ? 6.431   12.514 7.733   1.00 69.63  ? 41  GLY A C     1 
ATOM   947  O  O     . GLY C 3 41  ? 6.127   13.023 6.657   1.00 69.87  ? 41  GLY A O     1 
ATOM   948  N  N     . ALA C 3 42  ? 7.691   12.379 8.122   1.00 65.72  ? 42  ALA A N     1 
ATOM   949  C  CA    . ALA C 3 42  ? 8.772   12.876 7.292   1.00 62.70  ? 42  ALA A CA    1 
ATOM   950  C  C     . ALA C 3 42  ? 9.781   11.790 6.965   1.00 61.10  ? 42  ALA A C     1 
ATOM   951  O  O     . ALA C 3 42  ? 9.717   10.688 7.516   1.00 61.73  ? 42  ALA A O     1 
ATOM   952  C  CB    . ALA C 3 42  ? 9.461   14.027 7.990   1.00 60.23  ? 42  ALA A CB    1 
ATOM   953  N  N     . VAL C 3 43  ? 10.708  12.105 6.062   1.00 58.46  ? 43  VAL A N     1 
ATOM   954  C  CA    . VAL C 3 43  ? 11.752  11.163 5.667   1.00 56.14  ? 43  VAL A CA    1 
ATOM   955  C  C     . VAL C 3 43  ? 13.019  11.458 6.479   1.00 54.26  ? 43  VAL A C     1 
ATOM   956  O  O     . VAL C 3 43  ? 13.467  12.599 6.557   1.00 54.37  ? 43  VAL A O     1 
ATOM   957  C  CB    . VAL C 3 43  ? 12.085  11.287 4.148   1.00 57.49  ? 43  VAL A CB    1 
ATOM   958  C  CG1   . VAL C 3 43  ? 13.236  10.356 3.786   1.00 56.46  ? 43  VAL A CG1   1 
ATOM   959  C  CG2   . VAL C 3 43  ? 10.860  10.952 3.307   1.00 57.34  ? 43  VAL A CG2   1 
ATOM   960  N  N     . ALA C 3 44  ? 13.593  10.432 7.090   1.00 50.99  ? 44  ALA A N     1 
ATOM   961  C  CA    . ALA C 3 44  ? 14.799  10.611 7.875   1.00 50.11  ? 44  ALA A CA    1 
ATOM   962  C  C     . ALA C 3 44  ? 16.034  10.642 6.955   1.00 51.92  ? 44  ALA A C     1 
ATOM   963  O  O     . ALA C 3 44  ? 16.918  11.501 7.087   1.00 50.86  ? 44  ALA A O     1 
ATOM   964  C  CB    . ALA C 3 44  ? 14.914  9.490  8.860   1.00 49.45  ? 44  ALA A CB    1 
ATOM   965  N  N     . THR C 3 45  ? 16.092  9.701  6.020   1.00 52.07  ? 45  THR A N     1 
ATOM   966  C  CA    . THR C 3 45  ? 17.204  9.644  5.092   1.00 51.91  ? 45  THR A CA    1 
ATOM   967  C  C     . THR C 3 45  ? 16.853  8.701  3.965   1.00 53.35  ? 45  THR A C     1 
ATOM   968  O  O     . THR C 3 45  ? 16.009  7.818  4.121   1.00 52.71  ? 45  THR A O     1 
ATOM   969  C  CB    . THR C 3 45  ? 18.483  9.143  5.777   1.00 51.89  ? 45  THR A CB    1 
ATOM   970  O  OG1   . THR C 3 45  ? 19.567  9.195  4.854   1.00 50.75  ? 45  THR A OG1   1 
ATOM   971  C  CG2   . THR C 3 45  ? 18.335  7.715  6.228   1.00 51.35  ? 45  THR A CG2   1 
ATOM   972  N  N     . ALA C 3 46  ? 17.493  8.913  2.821   1.00 54.35  ? 46  ALA A N     1 
ATOM   973  C  CA    . ALA C 3 46  ? 17.281  8.086  1.647   1.00 55.31  ? 46  ALA A CA    1 
ATOM   974  C  C     . ALA C 3 46  ? 18.672  7.726  1.119   1.00 56.01  ? 46  ALA A C     1 
ATOM   975  O  O     . ALA C 3 46  ? 19.572  8.580  1.153   1.00 55.09  ? 46  ALA A O     1 
ATOM   976  C  CB    . ALA C 3 46  ? 16.497  8.874  0.599   1.00 51.88  ? 46  ALA A CB    1 
ATOM   977  N  N     . ASN C 3 47  ? 18.868  6.485  0.651   1.00 55.49  ? 47  ASN A N     1 
ATOM   978  C  CA    . ASN C 3 47  ? 20.175  6.121  0.101   1.00 54.88  ? 47  ASN A CA    1 
ATOM   979  C  C     . ASN C 3 47  ? 20.393  6.919  -1.179  1.00 55.71  ? 47  ASN A C     1 
ATOM   980  O  O     . ASN C 3 47  ? 19.540  7.712  -1.576  1.00 54.01  ? 47  ASN A O     1 
ATOM   981  C  CB    . ASN C 3 47  ? 20.280  4.626  -0.178  1.00 52.81  ? 47  ASN A CB    1 
ATOM   982  C  CG    . ASN C 3 47  ? 19.249  4.142  -1.150  1.00 51.98  ? 47  ASN A CG    1 
ATOM   983  O  OD1   . ASN C 3 47  ? 18.616  4.936  -1.848  1.00 51.91  ? 47  ASN A OD1   1 
ATOM   984  N  ND2   . ASN C 3 47  ? 19.079  2.821  -1.220  1.00 48.82  ? 47  ASN A ND2   1 
ATOM   985  N  N     . TYR C 3 48  ? 21.522  6.721  -1.844  1.00 58.82  ? 48  TYR A N     1 
ATOM   986  C  CA    . TYR C 3 48  ? 21.764  7.525  -3.029  1.00 62.70  ? 48  TYR A CA    1 
ATOM   987  C  C     . TYR C 3 48  ? 20.894  7.228  -4.247  1.00 63.44  ? 48  TYR A C     1 
ATOM   988  O  O     . TYR C 3 48  ? 20.528  8.156  -4.980  1.00 61.70  ? 48  TYR A O     1 
ATOM   989  C  CB    . TYR C 3 48  ? 23.255  7.519  -3.369  1.00 64.94  ? 48  TYR A CB    1 
ATOM   990  C  CG    . TYR C 3 48  ? 24.065  8.393  -2.415  1.00 69.30  ? 48  TYR A CG    1 
ATOM   991  C  CD1   . TYR C 3 48  ? 24.750  7.839  -1.325  1.00 70.12  ? 48  TYR A CD1   1 
ATOM   992  C  CD2   . TYR C 3 48  ? 24.125  9.782  -2.593  1.00 69.79  ? 48  TYR A CD2   1 
ATOM   993  C  CE1   . TYR C 3 48  ? 25.474  8.646  -0.447  1.00 71.65  ? 48  TYR A CE1   1 
ATOM   994  C  CE2   . TYR C 3 48  ? 24.840  10.592 -1.722  1.00 70.76  ? 48  TYR A CE2   1 
ATOM   995  C  CZ    . TYR C 3 48  ? 25.516  10.023 -0.653  1.00 72.75  ? 48  TYR A CZ    1 
ATOM   996  O  OH    . TYR C 3 48  ? 26.244  10.833 0.200   1.00 74.35  ? 48  TYR A OH    1 
ATOM   997  N  N     . GLU C 3 49  ? 20.534  5.968  -4.466  1.00 64.51  ? 49  GLU A N     1 
ATOM   998  C  CA    . GLU C 3 49  ? 19.669  5.684  -5.598  1.00 68.11  ? 49  GLU A CA    1 
ATOM   999  C  C     . GLU C 3 49  ? 18.411  6.557  -5.458  1.00 68.59  ? 49  GLU A C     1 
ATOM   1000 O  O     . GLU C 3 49  ? 17.921  7.122  -6.437  1.00 69.82  ? 49  GLU A O     1 
ATOM   1001 C  CB    . GLU C 3 49  ? 19.271  4.203  -5.647  1.00 73.06  ? 49  GLU A CB    1 
ATOM   1002 C  CG    . GLU C 3 49  ? 20.288  3.259  -6.310  1.00 80.05  ? 49  GLU A CG    1 
ATOM   1003 C  CD    . GLU C 3 49  ? 21.505  2.958  -5.421  1.00 86.09  ? 49  GLU A CD    1 
ATOM   1004 O  OE1   . GLU C 3 49  ? 21.313  2.431  -4.291  1.00 86.78  ? 49  GLU A OE1   1 
ATOM   1005 O  OE2   . GLU C 3 49  ? 22.653  3.248  -5.858  1.00 87.17  ? 49  GLU A OE2   1 
ATOM   1006 N  N     . ALA C 3 50  ? 17.904  6.692  -4.235  1.00 67.49  ? 50  ALA A N     1 
ATOM   1007 C  CA    . ALA C 3 50  ? 16.704  7.492  -4.001  1.00 65.21  ? 50  ALA A CA    1 
ATOM   1008 C  C     . ALA C 3 50  ? 16.962  8.996  -3.955  1.00 64.24  ? 50  ALA A C     1 
ATOM   1009 O  O     . ALA C 3 50  ? 16.087  9.778  -4.299  1.00 63.71  ? 50  ALA A O     1 
ATOM   1010 C  CB    . ALA C 3 50  ? 16.020  7.038  -2.718  1.00 66.89  ? 50  ALA A CB    1 
ATOM   1011 N  N     . ARG C 3 51  ? 18.154  9.407  -3.537  1.00 64.53  ? 51  ARG A N     1 
ATOM   1012 C  CA    . ARG C 3 51  ? 18.468  10.834 -3.476  1.00 65.97  ? 51  ARG A CA    1 
ATOM   1013 C  C     . ARG C 3 51  ? 18.658  11.466 -4.844  1.00 65.83  ? 51  ARG A C     1 
ATOM   1014 O  O     . ARG C 3 51  ? 18.427  12.665 -5.012  1.00 65.37  ? 51  ARG A O     1 
ATOM   1015 C  CB    . ARG C 3 51  ? 19.734  11.090 -2.666  1.00 67.83  ? 51  ARG A CB    1 
ATOM   1016 C  CG    . ARG C 3 51  ? 19.540  11.097 -1.181  1.00 67.43  ? 51  ARG A CG    1 
ATOM   1017 C  CD    . ARG C 3 51  ? 20.774  11.654 -0.523  1.00 66.00  ? 51  ARG A CD    1 
ATOM   1018 N  NE    . ARG C 3 51  ? 20.963  11.072 0.795   1.00 66.33  ? 51  ARG A NE    1 
ATOM   1019 C  CZ    . ARG C 3 51  ? 22.078  11.176 1.505   1.00 66.35  ? 51  ARG A CZ    1 
ATOM   1020 N  NH1   . ARG C 3 51  ? 23.123  11.845 1.031   1.00 65.45  ? 51  ARG A NH1   1 
ATOM   1021 N  NH2   . ARG C 3 51  ? 22.142  10.598 2.690   1.00 67.21  ? 51  ARG A NH2   1 
ATOM   1022 N  N     . LYS C 3 52  ? 19.110  10.668 -5.806  1.00 65.33  ? 52  LYS A N     1 
ATOM   1023 C  CA    . LYS C 3 52  ? 19.320  11.155 -7.164  1.00 65.59  ? 52  LYS A CA    1 
ATOM   1024 C  C     . LYS C 3 52  ? 18.102  11.911 -7.664  1.00 63.92  ? 52  LYS A C     1 
ATOM   1025 O  O     . LYS C 3 52  ? 18.221  12.843 -8.458  1.00 62.54  ? 52  LYS A O     1 
ATOM   1026 C  CB    . LYS C 3 52  ? 19.550  9.993  -8.132  1.00 68.87  ? 52  LYS A CB    1 
ATOM   1027 C  CG    . LYS C 3 52  ? 20.933  9.373  -8.119  1.00 71.99  ? 52  LYS A CG    1 
ATOM   1028 C  CD    . LYS C 3 52  ? 21.049  8.277  -9.191  1.00 72.69  ? 52  LYS A CD    1 
ATOM   1029 C  CE    . LYS C 3 52  ? 19.959  7.221  -9.024  1.00 73.59  ? 52  LYS A CE    1 
ATOM   1030 N  NZ    . LYS C 3 52  ? 20.251  5.969  -9.779  1.00 74.22  ? 52  LYS A NZ    1 
ATOM   1031 N  N     . PHE C 3 53  ? 16.928  11.500 -7.194  1.00 62.42  ? 53  PHE A N     1 
ATOM   1032 C  CA    . PHE C 3 53  ? 15.688  12.103 -7.641  1.00 60.87  ? 53  PHE A CA    1 
ATOM   1033 C  C     . PHE C 3 53  ? 14.994  13.123 -6.735  1.00 60.89  ? 53  PHE A C     1 
ATOM   1034 O  O     . PHE C 3 53  ? 13.824  13.441 -6.936  1.00 58.83  ? 53  PHE A O     1 
ATOM   1035 C  CB    . PHE C 3 53  ? 14.730  10.980 -8.008  1.00 60.89  ? 53  PHE A CB    1 
ATOM   1036 C  CG    . PHE C 3 53  ? 15.278  10.034 -9.046  1.00 59.59  ? 53  PHE A CG    1 
ATOM   1037 C  CD1   . PHE C 3 53  ? 15.540  10.479 -10.336 1.00 57.99  ? 53  PHE A CD1   1 
ATOM   1038 C  CD2   . PHE C 3 53  ? 15.499  8.690  -8.740  1.00 59.70  ? 53  PHE A CD2   1 
ATOM   1039 C  CE1   . PHE C 3 53  ? 16.008  9.607  -11.307 1.00 58.98  ? 53  PHE A CE1   1 
ATOM   1040 C  CE2   . PHE C 3 53  ? 15.967  7.800  -9.704  1.00 59.53  ? 53  PHE A CE2   1 
ATOM   1041 C  CZ    . PHE C 3 53  ? 16.222  8.260  -10.991 1.00 60.63  ? 53  PHE A CZ    1 
ATOM   1042 N  N     . GLY C 3 54  ? 15.707  13.645 -5.745  1.00 62.03  ? 54  GLY A N     1 
ATOM   1043 C  CA    . GLY C 3 54  ? 15.114  14.645 -4.875  1.00 63.76  ? 54  GLY A CA    1 
ATOM   1044 C  C     . GLY C 3 54  ? 14.487  14.148 -3.585  1.00 65.64  ? 54  GLY A C     1 
ATOM   1045 O  O     . GLY C 3 54  ? 13.874  14.936 -2.858  1.00 65.58  ? 54  GLY A O     1 
ATOM   1046 N  N     . VAL C 3 55  ? 14.627  12.852 -3.301  1.00 67.01  ? 55  VAL A N     1 
ATOM   1047 C  CA    . VAL C 3 55  ? 14.085  12.251 -2.075  1.00 67.60  ? 55  VAL A CA    1 
ATOM   1048 C  C     . VAL C 3 55  ? 15.122  12.333 -0.963  1.00 67.74  ? 55  VAL A C     1 
ATOM   1049 O  O     . VAL C 3 55  ? 15.978  11.456 -0.825  1.00 67.45  ? 55  VAL A O     1 
ATOM   1050 C  CB    . VAL C 3 55  ? 13.721  10.753 -2.266  1.00 67.77  ? 55  VAL A CB    1 
ATOM   1051 C  CG1   . VAL C 3 55  ? 13.157  10.186 -0.964  1.00 65.61  ? 55  VAL A CG1   1 
ATOM   1052 C  CG2   . VAL C 3 55  ? 12.726  10.597 -3.407  1.00 68.25  ? 55  VAL A CG2   1 
ATOM   1053 N  N     . LYS C 3 56  ? 15.037  13.388 -0.165  1.00 68.70  ? 56  LYS A N     1 
ATOM   1054 C  CA    . LYS C 3 56  ? 15.985  13.580 0.921   1.00 69.14  ? 56  LYS A CA    1 
ATOM   1055 C  C     . LYS C 3 56  ? 15.361  13.742 2.300   1.00 68.49  ? 56  LYS A C     1 
ATOM   1056 O  O     . LYS C 3 56  ? 14.142  13.897 2.444   1.00 68.47  ? 56  LYS A O     1 
ATOM   1057 C  CB    . LYS C 3 56  ? 16.840  14.795 0.621   1.00 70.57  ? 56  LYS A CB    1 
ATOM   1058 C  CG    . LYS C 3 56  ? 16.037  16.047 0.409   1.00 71.89  ? 56  LYS A CG    1 
ATOM   1059 C  CD    . LYS C 3 56  ? 16.964  17.197 0.078   1.00 75.99  ? 56  LYS A CD    1 
ATOM   1060 C  CE    . LYS C 3 56  ? 16.204  18.514 -0.089  1.00 78.71  ? 56  LYS A CE    1 
ATOM   1061 N  NZ    . LYS C 3 56  ? 17.120  19.617 -0.505  1.00 79.84  ? 56  LYS A NZ    1 
ATOM   1062 N  N     . ALA C 3 57  ? 16.219  13.720 3.314   1.00 67.26  ? 57  ALA A N     1 
ATOM   1063 C  CA    . ALA C 3 57  ? 15.780  13.874 4.693   1.00 66.37  ? 57  ALA A CA    1 
ATOM   1064 C  C     . ALA C 3 57  ? 14.990  15.170 4.879   1.00 66.80  ? 57  ALA A C     1 
ATOM   1065 O  O     . ALA C 3 57  ? 15.413  16.241 4.426   1.00 65.80  ? 57  ALA A O     1 
ATOM   1066 C  CB    . ALA C 3 57  ? 16.977  13.864 5.616   1.00 64.66  ? 57  ALA A CB    1 
ATOM   1067 N  N     . GLY C 3 58  ? 13.831  15.064 5.524   1.00 66.26  ? 58  GLY A N     1 
ATOM   1068 C  CA    . GLY C 3 58  ? 13.028  16.240 5.765   1.00 66.81  ? 58  GLY A CA    1 
ATOM   1069 C  C     . GLY C 3 58  ? 11.747  16.361 4.977   1.00 68.17  ? 58  GLY A C     1 
ATOM   1070 O  O     . GLY C 3 58  ? 10.764  16.883 5.494   1.00 68.67  ? 58  GLY A O     1 
ATOM   1071 N  N     . ILE C 3 59  ? 11.730  15.900 3.733   1.00 69.75  ? 59  ILE A N     1 
ATOM   1072 C  CA    . ILE C 3 59  ? 10.503  16.031 2.949   1.00 70.03  ? 59  ILE A CA    1 
ATOM   1073 C  C     . ILE C 3 59  ? 9.450   15.049 3.406   1.00 69.83  ? 59  ILE A C     1 
ATOM   1074 O  O     . ILE C 3 59  ? 9.761   13.946 3.863   1.00 68.33  ? 59  ILE A O     1 
ATOM   1075 C  CB    . ILE C 3 59  ? 10.712  15.811 1.419   1.00 71.44  ? 59  ILE A CB    1 
ATOM   1076 C  CG1   . ILE C 3 59  ? 11.078  14.350 1.143   1.00 71.68  ? 59  ILE A CG1   1 
ATOM   1077 C  CG2   . ILE C 3 59  ? 11.770  16.782 0.883   1.00 71.32  ? 59  ILE A CG2   1 
ATOM   1078 C  CD1   . ILE C 3 59  ? 11.163  14.008 -0.341  1.00 70.74  ? 59  ILE A CD1   1 
ATOM   1079 N  N     . PRO C 3 60  ? 8.178   15.455 3.298   1.00 70.20  ? 60  PRO A N     1 
ATOM   1080 C  CA    . PRO C 3 60  ? 7.001   14.666 3.675   1.00 70.03  ? 60  PRO A CA    1 
ATOM   1081 C  C     . PRO C 3 60  ? 6.970   13.336 2.928   1.00 70.74  ? 60  PRO A C     1 
ATOM   1082 O  O     . PRO C 3 60  ? 7.237   13.285 1.727   1.00 70.75  ? 60  PRO A O     1 
ATOM   1083 C  CB    . PRO C 3 60  ? 5.845   15.581 3.282   1.00 70.32  ? 60  PRO A CB    1 
ATOM   1084 C  CG    . PRO C 3 60  ? 6.417   16.958 3.536   1.00 69.61  ? 60  PRO A CG    1 
ATOM   1085 C  CD    . PRO C 3 60  ? 7.799   16.837 2.947   1.00 69.52  ? 60  PRO A CD    1 
ATOM   1086 N  N     . ILE C 3 61  ? 6.640   12.264 3.637   1.00 71.17  ? 61  ILE A N     1 
ATOM   1087 C  CA    . ILE C 3 61  ? 6.589   10.943 3.027   1.00 72.04  ? 61  ILE A CA    1 
ATOM   1088 C  C     . ILE C 3 61  ? 5.698   10.893 1.788   1.00 73.56  ? 61  ILE A C     1 
ATOM   1089 O  O     . ILE C 3 61  ? 5.944   10.117 0.865   1.00 73.54  ? 61  ILE A O     1 
ATOM   1090 C  CB    . ILE C 3 61  ? 6.089   9.899  4.027   1.00 71.27  ? 61  ILE A CB    1 
ATOM   1091 C  CG1   . ILE C 3 61  ? 7.012   9.886  5.245   1.00 71.39  ? 61  ILE A CG1   1 
ATOM   1092 C  CG2   . ILE C 3 61  ? 6.035   8.517  3.368   1.00 70.61  ? 61  ILE A CG2   1 
ATOM   1093 C  CD1   . ILE C 3 61  ? 6.537   8.984  6.375   1.00 71.60  ? 61  ILE A CD1   1 
ATOM   1094 N  N     . VAL C 3 62  ? 4.660   11.719 1.768   1.00 75.47  ? 62  VAL A N     1 
ATOM   1095 C  CA    . VAL C 3 62  ? 3.757   11.731 0.631   1.00 77.23  ? 62  VAL A CA    1 
ATOM   1096 C  C     . VAL C 3 62  ? 4.422   12.369 -0.582  1.00 77.37  ? 62  VAL A C     1 
ATOM   1097 O  O     . VAL C 3 62  ? 4.169   11.955 -1.719  1.00 78.15  ? 62  VAL A O     1 
ATOM   1098 C  CB    . VAL C 3 62  ? 2.417   12.431 0.995   1.00 78.38  ? 62  VAL A CB    1 
ATOM   1099 C  CG1   . VAL C 3 62  ? 1.733   12.999 -0.248  1.00 80.12  ? 62  VAL A CG1   1 
ATOM   1100 C  CG2   . VAL C 3 62  ? 1.486   11.398 1.655   1.00 78.81  ? 62  VAL A CG2   1 
ATOM   1101 N  N     . GLU C 3 63  ? 5.283   13.356 -0.348  1.00 76.26  ? 63  GLU A N     1 
ATOM   1102 C  CA    . GLU C 3 63  ? 5.998   14.002 -1.446  1.00 75.14  ? 63  GLU A CA    1 
ATOM   1103 C  C     . GLU C 3 63  ? 7.018   13.038 -2.053  1.00 72.89  ? 63  GLU A C     1 
ATOM   1104 O  O     . GLU C 3 63  ? 7.292   13.074 -3.249  1.00 71.34  ? 63  GLU A O     1 
ATOM   1105 C  CB    . GLU C 3 63  ? 6.719   15.257 -0.955  1.00 77.66  ? 63  GLU A CB    1 
ATOM   1106 C  CG    . GLU C 3 63  ? 5.785   16.325 -0.482  1.00 82.40  ? 63  GLU A CG    1 
ATOM   1107 C  CD    . GLU C 3 63  ? 4.581   16.458 -1.392  1.00 86.77  ? 63  GLU A CD    1 
ATOM   1108 O  OE1   . GLU C 3 63  ? 4.756   16.781 -2.595  1.00 88.06  ? 63  GLU A OE1   1 
ATOM   1109 O  OE2   . GLU C 3 63  ? 3.455   16.226 -0.898  1.00 89.31  ? 63  GLU A OE2   1 
ATOM   1110 N  N     . ALA C 3 64  ? 7.574   12.172 -1.217  1.00 71.24  ? 64  ALA A N     1 
ATOM   1111 C  CA    . ALA C 3 64  ? 8.560   11.209 -1.669  1.00 70.94  ? 64  ALA A CA    1 
ATOM   1112 C  C     . ALA C 3 64  ? 7.920   10.123 -2.510  1.00 70.99  ? 64  ALA A C     1 
ATOM   1113 O  O     . ALA C 3 64  ? 8.555   9.563  -3.403  1.00 71.39  ? 64  ALA A O     1 
ATOM   1114 C  CB    . ALA C 3 64  ? 9.258   10.589 -0.485  1.00 70.70  ? 64  ALA A CB    1 
ATOM   1115 N  N     . LYS C 3 65  ? 6.662   9.817  -2.230  1.00 70.97  ? 65  LYS A N     1 
ATOM   1116 C  CA    . LYS C 3 65  ? 5.983   8.779  -2.987  1.00 70.53  ? 65  LYS A CA    1 
ATOM   1117 C  C     . LYS C 3 65  ? 5.593   9.276  -4.379  1.00 70.02  ? 65  LYS A C     1 
ATOM   1118 O  O     . LYS C 3 65  ? 5.576   8.501  -5.342  1.00 68.27  ? 65  LYS A O     1 
ATOM   1119 C  CB    . LYS C 3 65  ? 4.778   8.248  -2.191  1.00 70.89  ? 65  LYS A CB    1 
ATOM   1120 C  CG    . LYS C 3 65  ? 5.229   7.460  -0.962  1.00 70.70  ? 65  LYS A CG    1 
ATOM   1121 C  CD    . LYS C 3 65  ? 4.152   6.599  -0.333  1.00 72.11  ? 65  LYS A CD    1 
ATOM   1122 C  CE    . LYS C 3 65  ? 4.800   5.587  0.625   1.00 74.34  ? 65  LYS A CE    1 
ATOM   1123 N  NZ    . LYS C 3 65  ? 3.865   4.700  1.392   1.00 74.56  ? 65  LYS A NZ    1 
ATOM   1124 N  N     . LYS C 3 66  ? 5.306   10.572 -4.486  1.00 69.78  ? 66  LYS A N     1 
ATOM   1125 C  CA    . LYS C 3 66  ? 4.963   11.170 -5.774  1.00 70.28  ? 66  LYS A CA    1 
ATOM   1126 C  C     . LYS C 3 66  ? 6.184   11.052 -6.701  1.00 69.90  ? 66  LYS A C     1 
ATOM   1127 O  O     . LYS C 3 66  ? 6.067   10.906 -7.921  1.00 70.20  ? 66  LYS A O     1 
ATOM   1128 C  CB    . LYS C 3 66  ? 4.607   12.658 -5.606  1.00 71.15  ? 66  LYS A CB    1 
ATOM   1129 C  CG    . LYS C 3 66  ? 3.317   12.917 -4.850  1.00 76.08  ? 66  LYS A CG    1 
ATOM   1130 C  CD    . LYS C 3 66  ? 3.001   14.422 -4.732  1.00 79.76  ? 66  LYS A CD    1 
ATOM   1131 C  CE    . LYS C 3 66  ? 1.613   14.673 -4.088  1.00 81.50  ? 66  LYS A CE    1 
ATOM   1132 N  NZ    . LYS C 3 66  ? 1.262   16.121 -3.878  1.00 81.48  ? 66  LYS A NZ    1 
ATOM   1133 N  N     . ILE C 3 67  ? 7.366   11.097 -6.104  1.00 68.19  ? 67  ILE A N     1 
ATOM   1134 C  CA    . ILE C 3 67  ? 8.591   11.047 -6.873  1.00 65.59  ? 67  ILE A CA    1 
ATOM   1135 C  C     . ILE C 3 67  ? 9.090   9.642  -7.148  1.00 65.59  ? 67  ILE A C     1 
ATOM   1136 O  O     . ILE C 3 67  ? 9.612   9.371  -8.225  1.00 65.39  ? 67  ILE A O     1 
ATOM   1137 C  CB    . ILE C 3 67  ? 9.687   11.856 -6.161  1.00 64.49  ? 67  ILE A CB    1 
ATOM   1138 C  CG1   . ILE C 3 67  ? 9.203   13.303 -5.963  1.00 62.85  ? 67  ILE A CG1   1 
ATOM   1139 C  CG2   . ILE C 3 67  ? 10.974  11.809 -6.970  1.00 65.41  ? 67  ILE A CG2   1 
ATOM   1140 C  CD1   . ILE C 3 67  ? 10.005  14.123 -4.978  1.00 59.05  ? 67  ILE A CD1   1 
ATOM   1141 N  N     . LEU C 3 68  ? 8.942   8.754  -6.173  1.00 65.28  ? 68  LEU A N     1 
ATOM   1142 C  CA    . LEU C 3 68  ? 9.390   7.371  -6.322  1.00 65.35  ? 68  LEU A CA    1 
ATOM   1143 C  C     . LEU C 3 68  ? 8.363   6.437  -5.716  1.00 66.16  ? 68  LEU A C     1 
ATOM   1144 O  O     . LEU C 3 68  ? 8.658   5.726  -4.756  1.00 69.41  ? 68  LEU A O     1 
ATOM   1145 C  CB    . LEU C 3 68  ? 10.732  7.151  -5.612  1.00 63.72  ? 68  LEU A CB    1 
ATOM   1146 C  CG    . LEU C 3 68  ? 12.046  7.605  -6.248  1.00 64.67  ? 68  LEU A CG    1 
ATOM   1147 C  CD1   . LEU C 3 68  ? 13.217  7.014  -5.457  1.00 62.44  ? 68  LEU A CD1   1 
ATOM   1148 C  CD2   . LEU C 3 68  ? 12.104  7.141  -7.706  1.00 63.56  ? 68  LEU A CD2   1 
ATOM   1149 N  N     . PRO C 3 69  ? 7.150   6.394  -6.285  1.00 65.07  ? 69  PRO A N     1 
ATOM   1150 C  CA    . PRO C 3 69  ? 6.074   5.535  -5.773  1.00 62.97  ? 69  PRO A CA    1 
ATOM   1151 C  C     . PRO C 3 69  ? 6.447   4.079  -5.506  1.00 61.73  ? 69  PRO A C     1 
ATOM   1152 O  O     . PRO C 3 69  ? 5.807   3.405  -4.704  1.00 59.66  ? 69  PRO A O     1 
ATOM   1153 C  CB    . PRO C 3 69  ? 5.011   5.655  -6.848  1.00 61.99  ? 69  PRO A CB    1 
ATOM   1154 C  CG    . PRO C 3 69  ? 5.830   5.767  -8.062  1.00 64.23  ? 69  PRO A CG    1 
ATOM   1155 C  CD    . PRO C 3 69  ? 6.857   6.799  -7.666  1.00 64.49  ? 69  PRO A CD    1 
ATOM   1156 N  N     . ASN C 3 70  ? 7.499   3.595  -6.149  1.00 61.80  ? 70  ASN A N     1 
ATOM   1157 C  CA    . ASN C 3 70  ? 7.857   2.202  -5.959  1.00 61.48  ? 70  ASN A CA    1 
ATOM   1158 C  C     . ASN C 3 70  ? 9.178   1.955  -5.265  1.00 59.71  ? 70  ASN A C     1 
ATOM   1159 O  O     . ASN C 3 70  ? 9.806   0.894  -5.439  1.00 57.28  ? 70  ASN A O     1 
ATOM   1160 C  CB    . ASN C 3 70  ? 7.789   1.488  -7.307  1.00 63.60  ? 70  ASN A CB    1 
ATOM   1161 C  CG    . ASN C 3 70  ? 6.439   1.679  -7.976  1.00 65.37  ? 70  ASN A CG    1 
ATOM   1162 O  OD1   . ASN C 3 70  ? 5.391   1.429  -7.364  1.00 65.59  ? 70  ASN A OD1   1 
ATOM   1163 N  ND2   . ASN C 3 70  ? 6.451   2.140  -9.225  1.00 67.09  ? 70  ASN A ND2   1 
ATOM   1164 N  N     . ALA C 3 71  ? 9.586   2.936  -4.466  1.00 57.44  ? 71  ALA A N     1 
ATOM   1165 C  CA    . ALA C 3 71  ? 10.814  2.821  -3.698  1.00 56.48  ? 71  ALA A CA    1 
ATOM   1166 C  C     . ALA C 3 71  ? 10.465  1.969  -2.489  1.00 56.53  ? 71  ALA A C     1 
ATOM   1167 O  O     . ALA C 3 71  ? 9.284   1.789  -2.166  1.00 55.83  ? 71  ALA A O     1 
ATOM   1168 C  CB    . ALA C 3 71  ? 11.281  4.185  -3.242  1.00 55.05  ? 71  ALA A CB    1 
ATOM   1169 N  N     . VAL C 3 72  ? 11.478  1.425  -1.830  1.00 56.03  ? 72  VAL A N     1 
ATOM   1170 C  CA    . VAL C 3 72  ? 11.218  0.642  -0.636  1.00 56.97  ? 72  VAL A CA    1 
ATOM   1171 C  C     . VAL C 3 72  ? 11.204  1.608  0.556   1.00 58.81  ? 72  VAL A C     1 
ATOM   1172 O  O     . VAL C 3 72  ? 12.240  2.198  0.893   1.00 58.71  ? 72  VAL A O     1 
ATOM   1173 C  CB    . VAL C 3 72  ? 12.298  -0.414 -0.394  1.00 56.52  ? 72  VAL A CB    1 
ATOM   1174 C  CG1   . VAL C 3 72  ? 11.930  -1.237 0.839   1.00 55.25  ? 72  VAL A CG1   1 
ATOM   1175 C  CG2   . VAL C 3 72  ? 12.438  -1.314 -1.617  1.00 54.77  ? 72  VAL A CG2   1 
ATOM   1176 N  N     . TYR C 3 73  ? 10.027  1.789  1.166   1.00 59.09  ? 73  TYR A N     1 
ATOM   1177 C  CA    . TYR C 3 73  ? 9.863   2.686  2.320   1.00 58.29  ? 73  TYR A CA    1 
ATOM   1178 C  C     . TYR C 3 73  ? 9.870   1.900  3.618   1.00 57.95  ? 73  TYR A C     1 
ATOM   1179 O  O     . TYR C 3 73  ? 9.016   1.044  3.846   1.00 58.54  ? 73  TYR A O     1 
ATOM   1180 C  CB    . TYR C 3 73  ? 8.561   3.469  2.208   1.00 56.92  ? 73  TYR A CB    1 
ATOM   1181 C  CG    . TYR C 3 73  ? 8.564   4.431  1.051   1.00 58.69  ? 73  TYR A CG    1 
ATOM   1182 C  CD1   . TYR C 3 73  ? 8.632   5.811  1.264   1.00 57.45  ? 73  TYR A CD1   1 
ATOM   1183 C  CD2   . TYR C 3 73  ? 8.511   3.963  -0.268  1.00 59.54  ? 73  TYR A CD2   1 
ATOM   1184 C  CE1   . TYR C 3 73  ? 8.639   6.708  0.194   1.00 57.84  ? 73  TYR A CE1   1 
ATOM   1185 C  CE2   . TYR C 3 73  ? 8.520   4.850  -1.348  1.00 59.94  ? 73  TYR A CE2   1 
ATOM   1186 C  CZ    . TYR C 3 73  ? 8.587   6.222  -1.109  1.00 60.10  ? 73  TYR A CZ    1 
ATOM   1187 O  OH    . TYR C 3 73  ? 8.598   7.103  -2.168  1.00 59.37  ? 73  TYR A OH    1 
ATOM   1188 N  N     . LEU C 3 74  ? 10.835  2.185  4.475   1.00 55.30  ? 74  LEU A N     1 
ATOM   1189 C  CA    . LEU C 3 74  ? 10.912  1.456  5.715   1.00 53.50  ? 74  LEU A CA    1 
ATOM   1190 C  C     . LEU C 3 74  ? 10.710  2.356  6.929   1.00 52.98  ? 74  LEU A C     1 
ATOM   1191 O  O     . LEU C 3 74  ? 10.939  3.561  6.872   1.00 53.29  ? 74  LEU A O     1 
ATOM   1192 C  CB    . LEU C 3 74  ? 12.257  0.736  5.771   1.00 54.52  ? 74  LEU A CB    1 
ATOM   1193 C  CG    . LEU C 3 74  ? 12.532  -0.269 4.636   1.00 54.79  ? 74  LEU A CG    1 
ATOM   1194 C  CD1   . LEU C 3 74  ? 13.947  -0.843 4.783   1.00 54.47  ? 74  LEU A CD1   1 
ATOM   1195 C  CD2   . LEU C 3 74  ? 11.493  -1.390 4.663   1.00 51.04  ? 74  LEU A CD2   1 
ATOM   1196 N  N     . PRO C 3 75  ? 10.254  1.786  8.049   1.00 52.40  ? 75  PRO A N     1 
ATOM   1197 C  CA    . PRO C 3 75  ? 10.049  2.622  9.240   1.00 50.46  ? 75  PRO A CA    1 
ATOM   1198 C  C     . PRO C 3 75  ? 11.371  2.767  9.983   1.00 48.44  ? 75  PRO A C     1 
ATOM   1199 O  O     . PRO C 3 75  ? 12.126  1.794  10.132  1.00 47.25  ? 75  PRO A O     1 
ATOM   1200 C  CB    . PRO C 3 75  ? 9.024   1.829  10.039  1.00 49.67  ? 75  PRO A CB    1 
ATOM   1201 C  CG    . PRO C 3 75  ? 9.489   0.432  9.799   1.00 51.97  ? 75  PRO A CG    1 
ATOM   1202 C  CD    . PRO C 3 75  ? 9.855   0.395  8.308   1.00 51.35  ? 75  PRO A CD    1 
ATOM   1203 N  N     . MET C 3 76  ? 11.656  3.977  10.438  0.50 44.49  ? 76  MET A N     1 
ATOM   1204 C  CA    . MET C 3 76  ? 12.893  4.207  11.146  0.50 40.98  ? 76  MET A CA    1 
ATOM   1205 C  C     . MET C 3 76  ? 13.001  3.274  12.343  0.50 41.39  ? 76  MET A C     1 
ATOM   1206 O  O     . MET C 3 76  ? 12.069  3.122  13.118  0.50 41.01  ? 76  MET A O     1 
ATOM   1207 C  CB    . MET C 3 76  ? 12.965  5.656  11.595  0.50 36.58  ? 76  MET A CB    1 
ATOM   1208 C  CG    . MET C 3 76  ? 14.265  6.024  12.247  0.50 33.02  ? 76  MET A CG    1 
ATOM   1209 S  SD    . MET C 3 76  ? 14.100  7.630  12.997  0.50 30.97  ? 76  MET A SD    1 
ATOM   1210 C  CE    . MET C 3 76  ? 15.041  8.628  11.908  0.50 32.09  ? 76  MET A CE    1 
ATOM   1211 N  N     . ARG C 3 77  ? 14.147  2.625  12.458  1.00 43.62  ? 77  ARG A N     1 
ATOM   1212 C  CA    . ARG C 3 77  ? 14.446  1.701  13.565  1.00 45.56  ? 77  ARG A CA    1 
ATOM   1213 C  C     . ARG C 3 77  ? 15.701  2.268  14.269  1.00 44.98  ? 77  ARG A C     1 
ATOM   1214 O  O     . ARG C 3 77  ? 16.808  1.722  14.210  1.00 41.40  ? 77  ARG A O     1 
ATOM   1215 C  CB    . ARG C 3 77  ? 14.681  0.278  13.017  1.00 46.76  ? 77  ARG A CB    1 
ATOM   1216 C  CG    . ARG C 3 77  ? 13.549  -0.170 12.074  1.00 50.19  ? 77  ARG A CG    1 
ATOM   1217 C  CD    . ARG C 3 77  ? 13.531  -1.660 11.814  1.00 52.41  ? 77  ARG A CD    1 
ATOM   1218 N  NE    . ARG C 3 77  ? 14.601  -2.101 10.925  1.00 57.57  ? 77  ARG A NE    1 
ATOM   1219 C  CZ    . ARG C 3 77  ? 15.161  -3.305 10.993  1.00 58.61  ? 77  ARG A CZ    1 
ATOM   1220 N  NH1   . ARG C 3 77  ? 14.747  -4.177 11.910  1.00 60.13  ? 77  ARG A NH1   1 
ATOM   1221 N  NH2   . ARG C 3 77  ? 16.137  -3.636 10.159  1.00 58.18  ? 77  ARG A NH2   1 
ATOM   1222 N  N     . LYS C 3 78  ? 15.489  3.409  14.916  1.00 45.91  ? 78  LYS A N     1 
ATOM   1223 C  CA    . LYS C 3 78  ? 16.543  4.130  15.602  1.00 46.40  ? 78  LYS A CA    1 
ATOM   1224 C  C     . LYS C 3 78  ? 17.348  3.265  16.560  1.00 46.72  ? 78  LYS A C     1 
ATOM   1225 O  O     . LYS C 3 78  ? 18.564  3.398  16.617  1.00 45.68  ? 78  LYS A O     1 
ATOM   1226 C  CB    . LYS C 3 78  ? 15.930  5.331  16.320  1.00 46.58  ? 78  LYS A CB    1 
ATOM   1227 C  CG    . LYS C 3 78  ? 16.892  6.221  17.066  1.00 47.08  ? 78  LYS A CG    1 
ATOM   1228 C  CD    . LYS C 3 78  ? 17.751  7.022  16.131  1.00 51.12  ? 78  LYS A CD    1 
ATOM   1229 C  CE    . LYS C 3 78  ? 18.537  8.106  16.873  1.00 49.74  ? 78  LYS A CE    1 
ATOM   1230 N  NZ    . LYS C 3 78  ? 17.656  9.211  17.324  1.00 49.54  ? 78  LYS A NZ    1 
ATOM   1231 N  N     . GLU C 3 79  ? 16.693  2.367  17.290  1.00 47.75  ? 79  GLU A N     1 
ATOM   1232 C  CA    . GLU C 3 79  ? 17.416  1.515  18.233  1.00 50.89  ? 79  GLU A CA    1 
ATOM   1233 C  C     . GLU C 3 79  ? 18.421  0.632  17.492  1.00 51.82  ? 79  GLU A C     1 
ATOM   1234 O  O     . GLU C 3 79  ? 19.538  0.403  17.970  1.00 51.53  ? 79  GLU A O     1 
ATOM   1235 C  CB    . GLU C 3 79  ? 16.451  0.631  19.019  1.00 54.95  ? 79  GLU A CB    1 
ATOM   1236 C  CG    . GLU C 3 79  ? 15.046  1.187  19.177  1.00 62.55  ? 79  GLU A CG    1 
ATOM   1237 C  CD    . GLU C 3 79  ? 14.312  1.343  17.837  1.00 66.99  ? 79  GLU A CD    1 
ATOM   1238 O  OE1   . GLU C 3 79  ? 14.198  0.348  17.081  1.00 69.26  ? 79  GLU A OE1   1 
ATOM   1239 O  OE2   . GLU C 3 79  ? 13.842  2.465  17.541  1.00 68.93  ? 79  GLU A OE2   1 
ATOM   1240 N  N     . VAL C 3 80  ? 18.019  0.136  16.322  1.00 52.20  ? 80  VAL A N     1 
ATOM   1241 C  CA    . VAL C 3 80  ? 18.884  -0.714 15.503  1.00 51.50  ? 80  VAL A CA    1 
ATOM   1242 C  C     . VAL C 3 80  ? 20.114  0.064  15.050  1.00 50.86  ? 80  VAL A C     1 
ATOM   1243 O  O     . VAL C 3 80  ? 21.261  -0.315 15.351  1.00 50.70  ? 80  VAL A O     1 
ATOM   1244 C  CB    . VAL C 3 80  ? 18.165  -1.232 14.225  1.00 52.01  ? 80  VAL A CB    1 
ATOM   1245 C  CG1   . VAL C 3 80  ? 19.120  -2.090 13.418  1.00 50.38  ? 80  VAL A CG1   1 
ATOM   1246 C  CG2   . VAL C 3 80  ? 16.907  -2.025 14.599  1.00 51.99  ? 80  VAL A CG2   1 
ATOM   1247 N  N     . TYR C 3 81  ? 19.885  1.152  14.325  1.00 48.15  ? 81  TYR A N     1 
ATOM   1248 C  CA    . TYR C 3 81  ? 21.019  1.923  13.851  1.00 49.04  ? 81  TYR A CA    1 
ATOM   1249 C  C     . TYR C 3 81  ? 21.958  2.264  15.024  1.00 50.56  ? 81  TYR A C     1 
ATOM   1250 O  O     . TYR C 3 81  ? 23.181  2.152  14.909  1.00 49.81  ? 81  TYR A O     1 
ATOM   1251 C  CB    . TYR C 3 81  ? 20.537  3.190  13.154  1.00 47.71  ? 81  TYR A CB    1 
ATOM   1252 C  CG    . TYR C 3 81  ? 19.299  2.995  12.315  1.00 45.70  ? 81  TYR A CG    1 
ATOM   1253 C  CD1   . TYR C 3 81  ? 19.150  1.879  11.500  1.00 45.40  ? 81  TYR A CD1   1 
ATOM   1254 C  CD2   . TYR C 3 81  ? 18.287  3.944  12.312  1.00 44.74  ? 81  TYR A CD2   1 
ATOM   1255 C  CE1   . TYR C 3 81  ? 18.022  1.721  10.696  1.00 44.43  ? 81  TYR A CE1   1 
ATOM   1256 C  CE2   . TYR C 3 81  ? 17.164  3.796  11.511  1.00 44.00  ? 81  TYR A CE2   1 
ATOM   1257 C  CZ    . TYR C 3 81  ? 17.033  2.684  10.712  1.00 44.22  ? 81  TYR A CZ    1 
ATOM   1258 O  OH    . TYR C 3 81  ? 15.906  2.529  9.935   1.00 43.47  ? 81  TYR A OH    1 
ATOM   1259 N  N     . GLN C 3 82  ? 21.378  2.654  16.157  1.00 51.04  ? 82  GLN A N     1 
ATOM   1260 C  CA    . GLN C 3 82  ? 22.160  2.998  17.332  1.00 52.71  ? 82  GLN A CA    1 
ATOM   1261 C  C     . GLN C 3 82  ? 23.149  1.896  17.744  1.00 54.74  ? 82  GLN A C     1 
ATOM   1262 O  O     . GLN C 3 82  ? 24.328  2.181  18.020  1.00 53.79  ? 82  GLN A O     1 
ATOM   1263 C  CB    . GLN C 3 82  ? 21.241  3.324  18.506  1.00 51.93  ? 82  GLN A CB    1 
ATOM   1264 C  CG    . GLN C 3 82  ? 22.003  3.783  19.736  1.00 52.01  ? 82  GLN A CG    1 
ATOM   1265 C  CD    . GLN C 3 82  ? 22.889  4.975  19.446  1.00 51.42  ? 82  GLN A CD    1 
ATOM   1266 O  OE1   . GLN C 3 82  ? 22.398  6.079  19.191  1.00 52.84  ? 82  GLN A OE1   1 
ATOM   1267 N  NE2   . GLN C 3 82  ? 24.203  4.760  19.470  1.00 49.63  ? 82  GLN A NE2   1 
ATOM   1268 N  N     . GLN C 3 83  ? 22.681  0.648  17.794  1.00 56.18  ? 83  GLN A N     1 
ATOM   1269 C  CA    . GLN C 3 83  ? 23.564  -0.454 18.165  1.00 57.06  ? 83  GLN A CA    1 
ATOM   1270 C  C     . GLN C 3 83  ? 24.647  -0.676 17.117  1.00 55.25  ? 83  GLN A C     1 
ATOM   1271 O  O     . GLN C 3 83  ? 25.824  -0.893 17.462  1.00 54.63  ? 83  GLN A O     1 
ATOM   1272 C  CB    . GLN C 3 83  ? 22.763  -1.727 18.402  1.00 59.63  ? 83  GLN A CB    1 
ATOM   1273 C  CG    . GLN C 3 83  ? 22.419  -1.910 19.876  1.00 66.75  ? 83  GLN A CG    1 
ATOM   1274 C  CD    . GLN C 3 83  ? 21.334  -2.938 20.095  1.00 70.09  ? 83  GLN A CD    1 
ATOM   1275 O  OE1   . GLN C 3 83  ? 21.208  -3.889 19.329  1.00 73.78  ? 83  GLN A OE1   1 
ATOM   1276 N  NE2   . GLN C 3 83  ? 20.547  -2.760 21.150  1.00 71.27  ? 83  GLN A NE2   1 
ATOM   1277 N  N     . VAL C 3 84  ? 24.274  -0.609 15.842  1.00 53.13  ? 84  VAL A N     1 
ATOM   1278 C  CA    . VAL C 3 84  ? 25.285  -0.771 14.807  1.00 51.77  ? 84  VAL A CA    1 
ATOM   1279 C  C     . VAL C 3 84  ? 26.328  0.339  15.057  1.00 52.04  ? 84  VAL A C     1 
ATOM   1280 O  O     . VAL C 3 84  ? 27.529  0.064  15.123  1.00 52.83  ? 84  VAL A O     1 
ATOM   1281 C  CB    . VAL C 3 84  ? 24.711  -0.598 13.376  1.00 50.13  ? 84  VAL A CB    1 
ATOM   1282 C  CG1   . VAL C 3 84  ? 25.802  -0.875 12.362  1.00 47.80  ? 84  VAL A CG1   1 
ATOM   1283 C  CG2   . VAL C 3 84  ? 23.535  -1.528 13.151  1.00 46.32  ? 84  VAL A CG2   1 
ATOM   1284 N  N     . SER C 3 85  ? 25.864  1.583  15.214  1.00 50.28  ? 85  SER A N     1 
ATOM   1285 C  CA    . SER C 3 85  ? 26.755  2.723  15.470  1.00 49.35  ? 85  SER A CA    1 
ATOM   1286 C  C     . SER C 3 85  ? 27.737  2.490  16.628  1.00 48.81  ? 85  SER A C     1 
ATOM   1287 O  O     . SER C 3 85  ? 28.951  2.660  16.473  1.00 45.15  ? 85  SER A O     1 
ATOM   1288 C  CB    . SER C 3 85  ? 25.940  3.980  15.766  1.00 50.29  ? 85  SER A CB    1 
ATOM   1289 O  OG    . SER C 3 85  ? 26.790  5.059  16.135  1.00 51.10  ? 85  SER A OG    1 
ATOM   1290 N  N     . SER C 3 86  ? 27.210  2.120  17.792  1.00 48.88  ? 86  SER A N     1 
ATOM   1291 C  CA    . SER C 3 86  ? 28.063  1.860  18.938  1.00 50.43  ? 86  SER A CA    1 
ATOM   1292 C  C     . SER C 3 86  ? 29.128  0.832  18.596  1.00 53.31  ? 86  SER A C     1 
ATOM   1293 O  O     . SER C 3 86  ? 30.260  0.926  19.067  1.00 55.15  ? 86  SER A O     1 
ATOM   1294 C  CB    . SER C 3 86  ? 27.244  1.367  20.113  1.00 49.77  ? 86  SER A CB    1 
ATOM   1295 O  OG    . SER C 3 86  ? 26.452  2.418  20.628  1.00 50.58  ? 86  SER A OG    1 
ATOM   1296 N  N     . ARG C 3 87  ? 28.791  -0.157 17.779  1.00 54.26  ? 87  ARG A N     1 
ATOM   1297 C  CA    . ARG C 3 87  ? 29.806  -1.135 17.439  1.00 55.50  ? 87  ARG A CA    1 
ATOM   1298 C  C     . ARG C 3 87  ? 30.857  -0.515 16.522  1.00 56.23  ? 87  ARG A C     1 
ATOM   1299 O  O     . ARG C 3 87  ? 32.045  -0.793 16.676  1.00 58.10  ? 87  ARG A O     1 
ATOM   1300 C  CB    . ARG C 3 87  ? 29.179  -2.386 16.808  1.00 55.23  ? 87  ARG A CB    1 
ATOM   1301 C  CG    . ARG C 3 87  ? 28.224  -3.123 17.746  1.00 54.63  ? 87  ARG A CG    1 
ATOM   1302 C  CD    . ARG C 3 87  ? 28.116  -4.574 17.357  1.00 54.18  ? 87  ARG A CD    1 
ATOM   1303 N  NE    . ARG C 3 87  ? 27.757  -4.725 15.952  1.00 54.71  ? 87  ARG A NE    1 
ATOM   1304 C  CZ    . ARG C 3 87  ? 26.509  -4.814 15.513  1.00 55.29  ? 87  ARG A CZ    1 
ATOM   1305 N  NH1   . ARG C 3 87  ? 25.503  -4.774 16.373  1.00 55.52  ? 87  ARG A NH1   1 
ATOM   1306 N  NH2   . ARG C 3 87  ? 26.266  -4.938 14.217  1.00 55.50  ? 87  ARG A NH2   1 
ATOM   1307 N  N     . ILE C 3 88  ? 30.449  0.329  15.578  1.00 56.25  ? 88  ILE A N     1 
ATOM   1308 C  CA    . ILE C 3 88  ? 31.447  0.949  14.706  1.00 56.64  ? 88  ILE A CA    1 
ATOM   1309 C  C     . ILE C 3 88  ? 32.321  1.917  15.513  1.00 58.73  ? 88  ILE A C     1 
ATOM   1310 O  O     . ILE C 3 88  ? 33.535  1.982  15.299  1.00 58.50  ? 88  ILE A O     1 
ATOM   1311 C  CB    . ILE C 3 88  ? 30.826  1.775  13.552  1.00 56.16  ? 88  ILE A CB    1 
ATOM   1312 C  CG1   . ILE C 3 88  ? 29.886  0.914  12.711  1.00 54.55  ? 88  ILE A CG1   1 
ATOM   1313 C  CG2   . ILE C 3 88  ? 31.940  2.361  12.678  1.00 52.54  ? 88  ILE A CG2   1 
ATOM   1314 C  CD1   . ILE C 3 88  ? 29.239  1.682  11.544  1.00 51.35  ? 88  ILE A CD1   1 
ATOM   1315 N  N     . MET C 3 89  ? 31.711  2.680  16.428  1.00 59.25  ? 89  MET A N     1 
ATOM   1316 C  CA    . MET C 3 89  ? 32.495  3.628  17.210  1.00 59.49  ? 89  MET A CA    1 
ATOM   1317 C  C     . MET C 3 89  ? 33.556  2.839  17.941  1.00 61.87  ? 89  MET A C     1 
ATOM   1318 O  O     . MET C 3 89  ? 34.743  3.078  17.722  1.00 62.54  ? 89  MET A O     1 
ATOM   1319 C  CB    . MET C 3 89  ? 31.641  4.443  18.195  1.00 56.64  ? 89  MET A CB    1 
ATOM   1320 C  CG    . MET C 3 89  ? 30.703  5.496  17.546  1.00 54.59  ? 89  MET A CG    1 
ATOM   1321 S  SD    . MET C 3 89  ? 31.418  6.709  16.346  1.00 52.79  ? 89  MET A SD    1 
ATOM   1322 C  CE    . MET C 3 89  ? 29.940  7.370  15.610  1.00 48.95  ? 89  MET A CE    1 
ATOM   1323 N  N     . ASN C 3 90  ? 33.149  1.879  18.773  1.00 63.76  ? 90  ASN A N     1 
ATOM   1324 C  CA    . ASN C 3 90  ? 34.127  1.062  19.491  1.00 65.44  ? 90  ASN A CA    1 
ATOM   1325 C  C     . ASN C 3 90  ? 35.338  0.722  18.597  1.00 67.02  ? 90  ASN A C     1 
ATOM   1326 O  O     . ASN C 3 90  ? 36.485  0.825  19.041  1.00 68.20  ? 90  ASN A O     1 
ATOM   1327 C  CB    . ASN C 3 90  ? 33.492  -0.232 20.020  1.00 64.68  ? 90  ASN A CB    1 
ATOM   1328 C  CG    . ASN C 3 90  ? 32.570  0.004  21.217  1.00 64.51  ? 90  ASN A CG    1 
ATOM   1329 O  OD1   . ASN C 3 90  ? 32.863  0.813  22.095  1.00 64.26  ? 90  ASN A OD1   1 
ATOM   1330 N  ND2   . ASN C 3 90  ? 31.459  -0.724 21.261  1.00 64.07  ? 90  ASN A ND2   1 
ATOM   1331 N  N     . LEU C 3 91  ? 35.099  0.334  17.345  1.00 67.34  ? 91  LEU A N     1 
ATOM   1332 C  CA    . LEU C 3 91  ? 36.208  0.021  16.448  1.00 68.96  ? 91  LEU A CA    1 
ATOM   1333 C  C     . LEU C 3 91  ? 37.195  1.182  16.378  1.00 71.60  ? 91  LEU A C     1 
ATOM   1334 O  O     . LEU C 3 91  ? 38.403  0.977  16.482  1.00 72.44  ? 91  LEU A O     1 
ATOM   1335 C  CB    . LEU C 3 91  ? 35.727  -0.273 15.021  1.00 68.22  ? 91  LEU A CB    1 
ATOM   1336 C  CG    . LEU C 3 91  ? 34.948  -1.546 14.691  1.00 68.25  ? 91  LEU A CG    1 
ATOM   1337 C  CD1   . LEU C 3 91  ? 34.925  -1.732 13.171  1.00 66.40  ? 91  LEU A CD1   1 
ATOM   1338 C  CD2   . LEU C 3 91  ? 35.610  -2.742 15.352  1.00 68.35  ? 91  LEU A CD2   1 
ATOM   1339 N  N     . LEU C 3 92  ? 36.678  2.399  16.191  1.00 73.88  ? 92  LEU A N     1 
ATOM   1340 C  CA    . LEU C 3 92  ? 37.518  3.598  16.080  1.00 75.08  ? 92  LEU A CA    1 
ATOM   1341 C  C     . LEU C 3 92  ? 38.353  3.901  17.324  1.00 77.52  ? 92  LEU A C     1 
ATOM   1342 O  O     . LEU C 3 92  ? 39.346  4.625  17.240  1.00 77.38  ? 92  LEU A O     1 
ATOM   1343 C  CB    . LEU C 3 92  ? 36.665  4.822  15.754  1.00 73.11  ? 92  LEU A CB    1 
ATOM   1344 C  CG    . LEU C 3 92  ? 35.894  4.815  14.437  1.00 71.77  ? 92  LEU A CG    1 
ATOM   1345 C  CD1   . LEU C 3 92  ? 34.998  6.038  14.374  1.00 72.69  ? 92  LEU A CD1   1 
ATOM   1346 C  CD2   . LEU C 3 92  ? 36.849  4.815  13.277  1.00 70.74  ? 92  LEU A CD2   1 
ATOM   1347 N  N     . ARG C 3 93  ? 37.959  3.354  18.471  1.00 79.93  ? 93  ARG A N     1 
ATOM   1348 C  CA    . ARG C 3 93  ? 38.696  3.584  19.713  1.00 82.79  ? 93  ARG A CA    1 
ATOM   1349 C  C     . ARG C 3 93  ? 40.048  2.880  19.723  1.00 84.70  ? 93  ARG A C     1 
ATOM   1350 O  O     . ARG C 3 93  ? 40.829  3.036  20.664  1.00 84.98  ? 93  ARG A O     1 
ATOM   1351 C  CB    . ARG C 3 93  ? 37.888  3.104  20.910  1.00 83.51  ? 93  ARG A CB    1 
ATOM   1352 C  CG    . ARG C 3 93  ? 36.570  3.795  21.082  1.00 84.85  ? 93  ARG A CG    1 
ATOM   1353 C  CD    . ARG C 3 93  ? 35.824  3.188  22.240  1.00 87.27  ? 93  ARG A CD    1 
ATOM   1354 N  NE    . ARG C 3 93  ? 34.437  3.627  22.246  1.00 91.14  ? 93  ARG A NE    1 
ATOM   1355 C  CZ    . ARG C 3 93  ? 34.056  4.890  22.407  1.00 92.14  ? 93  ARG A CZ    1 
ATOM   1356 N  NH1   . ARG C 3 93  ? 34.962  5.847  22.583  1.00 92.25  ? 93  ARG A NH1   1 
ATOM   1357 N  NH2   . ARG C 3 93  ? 32.766  5.198  22.382  1.00 92.09  ? 93  ARG A NH2   1 
ATOM   1358 N  N     . GLU C 3 94  ? 40.313  2.091  18.687  1.00 86.69  ? 94  GLU A N     1 
ATOM   1359 C  CA    . GLU C 3 94  ? 41.580  1.371  18.570  1.00 88.38  ? 94  GLU A CA    1 
ATOM   1360 C  C     . GLU C 3 94  ? 42.579  2.250  17.814  1.00 88.38  ? 94  GLU A C     1 
ATOM   1361 O  O     . GLU C 3 94  ? 43.758  1.899  17.687  1.00 89.09  ? 94  GLU A O     1 
ATOM   1362 C  CB    . GLU C 3 94  ? 41.388  0.045  17.800  1.00 90.11  ? 94  GLU A CB    1 
ATOM   1363 C  CG    . GLU C 3 94  ? 40.371  -0.939 18.406  1.00 92.72  ? 94  GLU A CG    1 
ATOM   1364 C  CD    . GLU C 3 94  ? 40.777  -1.451 19.787  1.00 94.09  ? 94  GLU A CD    1 
ATOM   1365 O  OE1   . GLU C 3 94  ? 41.794  -2.177 19.874  1.00 93.84  ? 94  GLU A OE1   1 
ATOM   1366 O  OE2   . GLU C 3 94  ? 40.079  -1.128 20.780  1.00 93.97  ? 94  GLU A OE2   1 
ATOM   1367 N  N     . TYR C 3 95  ? 42.101  3.396  17.330  1.00 87.60  ? 95  TYR A N     1 
ATOM   1368 C  CA    . TYR C 3 95  ? 42.931  4.308  16.554  1.00 87.11  ? 95  TYR A CA    1 
ATOM   1369 C  C     . TYR C 3 95  ? 43.265  5.654  17.224  1.00 85.87  ? 95  TYR A C     1 
ATOM   1370 O  O     . TYR C 3 95  ? 43.902  6.518  16.613  1.00 85.53  ? 95  TYR A O     1 
ATOM   1371 C  CB    . TYR C 3 95  ? 42.267  4.537  15.191  1.00 88.43  ? 95  TYR A CB    1 
ATOM   1372 C  CG    . TYR C 3 95  ? 42.022  3.261  14.398  1.00 89.71  ? 95  TYR A CG    1 
ATOM   1373 C  CD1   . TYR C 3 95  ? 43.023  2.701  13.613  1.00 89.32  ? 95  TYR A CD1   1 
ATOM   1374 C  CD2   . TYR C 3 95  ? 40.792  2.604  14.455  1.00 90.49  ? 95  TYR A CD2   1 
ATOM   1375 C  CE1   . TYR C 3 95  ? 42.807  1.525  12.899  1.00 90.36  ? 95  TYR A CE1   1 
ATOM   1376 C  CE2   . TYR C 3 95  ? 40.568  1.421  13.744  1.00 90.07  ? 95  TYR A CE2   1 
ATOM   1377 C  CZ    . TYR C 3 95  ? 41.583  0.888  12.972  1.00 90.01  ? 95  TYR A CZ    1 
ATOM   1378 O  OH    . TYR C 3 95  ? 41.385  -0.286 12.278  1.00 90.63  ? 95  TYR A OH    1 
ATOM   1379 N  N     . SER C 3 96  ? 42.835  5.831  18.471  1.00 84.17  ? 96  SER A N     1 
ATOM   1380 C  CA    . SER C 3 96  ? 43.119  7.051  19.233  1.00 83.18  ? 96  SER A CA    1 
ATOM   1381 C  C     . SER C 3 96  ? 42.301  7.112  20.507  1.00 83.55  ? 96  SER A C     1 
ATOM   1382 O  O     . SER C 3 96  ? 41.111  6.825  20.502  1.00 83.63  ? 96  SER A O     1 
ATOM   1383 C  CB    . SER C 3 96  ? 42.842  8.308  18.411  1.00 82.63  ? 96  SER A CB    1 
ATOM   1384 O  OG    . SER C 3 96  ? 43.068  9.471  19.193  1.00 79.70  ? 96  SER A OG    1 
ATOM   1385 N  N     . GLU C 3 97  ? 42.946  7.486  21.602  1.00 84.88  ? 97  GLU A N     1 
ATOM   1386 C  CA    . GLU C 3 97  ? 42.262  7.573  22.887  1.00 86.69  ? 97  GLU A CA    1 
ATOM   1387 C  C     . GLU C 3 97  ? 41.408  8.834  22.878  1.00 85.83  ? 97  GLU A C     1 
ATOM   1388 O  O     . GLU C 3 97  ? 40.362  8.893  23.527  1.00 86.04  ? 97  GLU A O     1 
ATOM   1389 C  CB    . GLU C 3 97  ? 43.276  7.640  24.042  1.00 89.64  ? 97  GLU A CB    1 
ATOM   1390 C  CG    . GLU C 3 97  ? 44.319  6.508  24.089  1.00 95.04  ? 97  GLU A CG    1 
ATOM   1391 C  CD    . GLU C 3 97  ? 45.299  6.518  22.902  1.00 99.12  ? 97  GLU A CD    1 
ATOM   1392 O  OE1   . GLU C 3 97  ? 45.788  7.615  22.540  1.00 100.02 ? 97  GLU A OE1   1 
ATOM   1393 O  OE2   . GLU C 3 97  ? 45.591  5.431  22.337  1.00 100.47 ? 97  GLU A OE2   1 
ATOM   1394 N  N     . LYS C 3 98  ? 41.870  9.839  22.133  1.00 84.82  ? 98  LYS A N     1 
ATOM   1395 C  CA    . LYS C 3 98  ? 41.178  11.127 22.001  1.00 82.90  ? 98  LYS A CA    1 
ATOM   1396 C  C     . LYS C 3 98  ? 40.189  11.040 20.840  1.00 79.71  ? 98  LYS A C     1 
ATOM   1397 O  O     . LYS C 3 98  ? 40.558  11.243 19.677  1.00 79.73  ? 98  LYS A O     1 
ATOM   1398 C  CB    . LYS C 3 98  ? 42.183  12.252 21.709  1.00 84.81  ? 98  LYS A CB    1 
ATOM   1399 C  CG    . LYS C 3 98  ? 43.340  12.338 22.686  1.00 86.37  ? 98  LYS A CG    1 
ATOM   1400 C  CD    . LYS C 3 98  ? 44.391  13.331 22.218  1.00 87.08  ? 98  LYS A CD    1 
ATOM   1401 C  CE    . LYS C 3 98  ? 45.576  13.319 23.174  1.00 88.20  ? 98  LYS A CE    1 
ATOM   1402 N  NZ    . LYS C 3 98  ? 46.660  14.263 22.774  1.00 89.13  ? 98  LYS A NZ    1 
ATOM   1403 N  N     . ILE C 3 99  ? 38.936  10.737 21.161  1.00 75.52  ? 99  ILE A N     1 
ATOM   1404 C  CA    . ILE C 3 99  ? 37.896  10.611 20.153  1.00 71.05  ? 99  ILE A CA    1 
ATOM   1405 C  C     . ILE C 3 99  ? 36.620  11.317 20.639  1.00 68.61  ? 99  ILE A C     1 
ATOM   1406 O  O     . ILE C 3 99  ? 36.191  11.150 21.785  1.00 67.14  ? 99  ILE A O     1 
ATOM   1407 C  CB    . ILE C 3 99  ? 37.629  9.110  19.845  1.00 70.55  ? 99  ILE A CB    1 
ATOM   1408 C  CG1   . ILE C 3 99  ? 36.616  8.964  18.722  1.00 70.70  ? 99  ILE A CG1   1 
ATOM   1409 C  CG2   . ILE C 3 99  ? 37.086  8.406  21.069  1.00 71.52  ? 99  ILE A CG2   1 
ATOM   1410 C  CD1   . ILE C 3 99  ? 36.228  7.520  18.471  1.00 71.50  ? 99  ILE A CD1   1 
ATOM   1411 N  N     . GLU C 3 100 ? 36.039  12.131 19.760  1.00 65.54  ? 100 GLU A N     1 
ATOM   1412 C  CA    . GLU C 3 100 ? 34.827  12.888 20.063  1.00 62.54  ? 100 GLU A CA    1 
ATOM   1413 C  C     . GLU C 3 100 ? 33.693  12.372 19.186  1.00 60.27  ? 100 GLU A C     1 
ATOM   1414 O  O     . GLU C 3 100 ? 33.717  12.560 17.974  1.00 61.26  ? 100 GLU A O     1 
ATOM   1415 C  CB    . GLU C 3 100 ? 35.061  14.375 19.777  1.00 62.09  ? 100 GLU A CB    1 
ATOM   1416 C  CG    . GLU C 3 100 ? 33.935  15.290 20.218  1.00 63.72  ? 100 GLU A CG    1 
ATOM   1417 C  CD    . GLU C 3 100 ? 34.195  16.775 19.917  1.00 64.55  ? 100 GLU A CD    1 
ATOM   1418 O  OE1   . GLU C 3 100 ? 35.230  17.328 20.359  1.00 64.21  ? 100 GLU A OE1   1 
ATOM   1419 O  OE2   . GLU C 3 100 ? 33.347  17.395 19.239  1.00 65.51  ? 100 GLU A OE2   1 
ATOM   1420 N  N     . ILE C 3 101 ? 32.710  11.706 19.786  1.00 56.94  ? 101 ILE A N     1 
ATOM   1421 C  CA    . ILE C 3 101 ? 31.579  11.185 19.015  1.00 53.42  ? 101 ILE A CA    1 
ATOM   1422 C  C     . ILE C 3 101 ? 30.538  12.297 18.842  1.00 51.28  ? 101 ILE A C     1 
ATOM   1423 O  O     . ILE C 3 101 ? 29.684  12.518 19.711  1.00 49.98  ? 101 ILE A O     1 
ATOM   1424 C  CB    . ILE C 3 101 ? 30.915  9.975  19.715  1.00 52.87  ? 101 ILE A CB    1 
ATOM   1425 C  CG1   . ILE C 3 101 ? 31.934  8.864  19.940  1.00 51.86  ? 101 ILE A CG1   1 
ATOM   1426 C  CG2   . ILE C 3 101 ? 29.829  9.401  18.841  1.00 53.13  ? 101 ILE A CG2   1 
ATOM   1427 C  CD1   . ILE C 3 101 ? 31.390  7.724  20.757  1.00 49.98  ? 101 ILE A CD1   1 
ATOM   1428 N  N     . ALA C 3 102 ? 30.624  12.981 17.702  1.00 48.58  ? 102 ALA A N     1 
ATOM   1429 C  CA    . ALA C 3 102 ? 29.747  14.101 17.346  1.00 45.98  ? 102 ALA A CA    1 
ATOM   1430 C  C     . ALA C 3 102 ? 28.251  13.819 17.295  1.00 44.81  ? 102 ALA A C     1 
ATOM   1431 O  O     . ALA C 3 102 ? 27.454  14.619 17.761  1.00 43.50  ? 102 ALA A O     1 
ATOM   1432 C  CB    . ALA C 3 102 ? 30.182  14.671 16.012  1.00 45.66  ? 102 ALA A CB    1 
ATOM   1433 N  N     . SER C 3 103 ? 27.871  12.698 16.693  1.00 45.42  ? 103 SER A N     1 
ATOM   1434 C  CA    . SER C 3 103 ? 26.460  12.341 16.561  1.00 44.70  ? 103 SER A CA    1 
ATOM   1435 C  C     . SER C 3 103 ? 26.326  10.852 16.398  1.00 44.05  ? 103 SER A C     1 
ATOM   1436 O  O     . SER C 3 103 ? 27.258  10.101 16.678  1.00 45.57  ? 103 SER A O     1 
ATOM   1437 C  CB    . SER C 3 103 ? 25.838  13.005 15.337  1.00 43.70  ? 103 SER A CB    1 
ATOM   1438 O  OG    . SER C 3 103 ? 26.491  12.566 14.161  1.00 44.59  ? 103 SER A OG    1 
ATOM   1439 N  N     . ILE C 3 104 ? 25.180  10.418 15.909  1.00 41.88  ? 104 ILE A N     1 
ATOM   1440 C  CA    . ILE C 3 104 ? 24.982  8.996  15.759  1.00 41.32  ? 104 ILE A CA    1 
ATOM   1441 C  C     . ILE C 3 104 ? 25.823  8.358  14.681  1.00 42.91  ? 104 ILE A C     1 
ATOM   1442 O  O     . ILE C 3 104 ? 25.923  7.127  14.628  1.00 42.25  ? 104 ILE A O     1 
ATOM   1443 C  CB    . ILE C 3 104 ? 23.473  8.673  15.518  1.00 41.59  ? 104 ILE A CB    1 
ATOM   1444 C  CG1   . ILE C 3 104 ? 23.257  7.169  15.571  1.00 43.20  ? 104 ILE A CG1   1 
ATOM   1445 C  CG2   . ILE C 3 104 ? 22.985  9.203  14.181  1.00 38.40  ? 104 ILE A CG2   1 
ATOM   1446 C  CD1   . ILE C 3 104 ? 21.797  6.768  15.708  1.00 47.33  ? 104 ILE A CD1   1 
ATOM   1447 N  N     . ASP C 3 105 ? 26.480  9.185  13.866  1.00 43.47  ? 105 ASP A N     1 
ATOM   1448 C  CA    . ASP C 3 105 ? 27.234  8.649  12.722  1.00 45.27  ? 105 ASP A CA    1 
ATOM   1449 C  C     . ASP C 3 105 ? 28.499  9.493  12.370  1.00 45.16  ? 105 ASP A C     1 
ATOM   1450 O  O     . ASP C 3 105 ? 29.033  9.453  11.268  1.00 44.23  ? 105 ASP A O     1 
ATOM   1451 C  CB    . ASP C 3 105 ? 26.292  8.547  11.491  1.00 46.27  ? 105 ASP A CB    1 
ATOM   1452 C  CG    . ASP C 3 105 ? 26.123  9.898  10.794  1.00 48.73  ? 105 ASP A CG    1 
ATOM   1453 O  OD1   . ASP C 3 105 ? 26.127  10.940 11.530  1.00 53.32  ? 105 ASP A OD1   1 
ATOM   1454 O  OD2   . ASP C 3 105 ? 26.051  9.924  9.539   1.00 49.38  ? 105 ASP A OD2   1 
ATOM   1455 N  N     . GLU C 3 106 ? 29.070  10.136 13.367  1.00 46.60  ? 106 GLU A N     1 
ATOM   1456 C  CA    . GLU C 3 106 ? 30.227  10.955 13.122  1.00 46.58  ? 106 GLU A CA    1 
ATOM   1457 C  C     . GLU C 3 106 ? 31.135  10.935 14.307  1.00 46.72  ? 106 GLU A C     1 
ATOM   1458 O  O     . GLU C 3 106 ? 30.681  11.091 15.435  1.00 45.53  ? 106 GLU A O     1 
ATOM   1459 C  CB    . GLU C 3 106 ? 29.792  12.407 12.828  1.00 50.14  ? 106 GLU A CB    1 
ATOM   1460 C  CG    . GLU C 3 106 ? 28.977  12.645 11.561  1.00 54.65  ? 106 GLU A CG    1 
ATOM   1461 C  CD    . GLU C 3 106 ? 28.580  14.146 11.348  1.00 55.50  ? 106 GLU A CD    1 
ATOM   1462 O  OE1   . GLU C 3 106 ? 28.949  15.043 12.162  1.00 54.04  ? 106 GLU A OE1   1 
ATOM   1463 O  OE2   . GLU C 3 106 ? 27.882  14.427 10.342  1.00 55.61  ? 106 GLU A OE2   1 
ATOM   1464 N  N     . ALA C 3 107 ? 32.426  10.825 14.035  1.00 47.10  ? 107 ALA A N     1 
ATOM   1465 C  CA    . ALA C 3 107 ? 33.403  10.811 15.102  1.00 48.66  ? 107 ALA A CA    1 
ATOM   1466 C  C     . ALA C 3 107 ? 34.650  11.576 14.673  1.00 50.22  ? 107 ALA A C     1 
ATOM   1467 O  O     . ALA C 3 107 ? 35.036  11.558 13.496  1.00 51.20  ? 107 ALA A O     1 
ATOM   1468 C  CB    . ALA C 3 107 ? 33.762  9.377  15.450  1.00 49.84  ? 107 ALA A CB    1 
ATOM   1469 N  N     . TYR C 3 108 ? 35.278  12.249 15.627  1.00 51.20  ? 108 TYR A N     1 
ATOM   1470 C  CA    . TYR C 3 108 ? 36.492  12.993 15.347  1.00 53.35  ? 108 TYR A CA    1 
ATOM   1471 C  C     . TYR C 3 108 ? 37.609  12.278 16.086  1.00 56.05  ? 108 TYR A C     1 
ATOM   1472 O  O     . TYR C 3 108 ? 37.458  11.919 17.253  1.00 55.49  ? 108 TYR A O     1 
ATOM   1473 C  CB    . TYR C 3 108 ? 36.391  14.415 15.878  1.00 50.90  ? 108 TYR A CB    1 
ATOM   1474 C  CG    . TYR C 3 108 ? 35.470  15.309 15.128  1.00 49.54  ? 108 TYR A CG    1 
ATOM   1475 C  CD1   . TYR C 3 108 ? 35.908  16.011 14.006  1.00 50.85  ? 108 TYR A CD1   1 
ATOM   1476 C  CD2   . TYR C 3 108 ? 34.164  15.496 15.557  1.00 50.63  ? 108 TYR A CD2   1 
ATOM   1477 C  CE1   . TYR C 3 108 ? 35.054  16.892 13.322  1.00 49.83  ? 108 TYR A CE1   1 
ATOM   1478 C  CE2   . TYR C 3 108 ? 33.301  16.365 14.887  1.00 52.10  ? 108 TYR A CE2   1 
ATOM   1479 C  CZ    . TYR C 3 108 ? 33.757  17.058 13.775  1.00 50.74  ? 108 TYR A CZ    1 
ATOM   1480 O  OH    . TYR C 3 108 ? 32.904  17.898 13.113  1.00 52.11  ? 108 TYR A OH    1 
ATOM   1481 N  N     . LEU C 3 109 ? 38.724  12.058 15.403  1.00 59.03  ? 109 LEU A N     1 
ATOM   1482 C  CA    . LEU C 3 109 ? 39.872  11.410 16.024  1.00 61.38  ? 109 LEU A CA    1 
ATOM   1483 C  C     . LEU C 3 109 ? 41.086  12.313 15.919  1.00 63.23  ? 109 LEU A C     1 
ATOM   1484 O  O     . LEU C 3 109 ? 41.420  12.776 14.825  1.00 63.57  ? 109 LEU A O     1 
ATOM   1485 C  CB    . LEU C 3 109 ? 40.202  10.082 15.337  1.00 62.01  ? 109 LEU A CB    1 
ATOM   1486 C  CG    . LEU C 3 109 ? 39.335  8.873  15.671  1.00 63.11  ? 109 LEU A CG    1 
ATOM   1487 C  CD1   . LEU C 3 109 ? 37.980  9.058  15.041  1.00 64.61  ? 109 LEU A CD1   1 
ATOM   1488 C  CD2   . LEU C 3 109 ? 39.973  7.606  15.146  1.00 63.28  ? 109 LEU A CD2   1 
ATOM   1489 N  N     . ASP C 3 110 ? 41.737  12.573 17.052  1.00 64.62  ? 110 ASP A N     1 
ATOM   1490 C  CA    . ASP C 3 110 ? 42.946  13.390 17.059  1.00 65.72  ? 110 ASP A CA    1 
ATOM   1491 C  C     . ASP C 3 110 ? 44.097  12.422 16.869  1.00 66.65  ? 110 ASP A C     1 
ATOM   1492 O  O     . ASP C 3 110 ? 44.529  11.779 17.823  1.00 68.18  ? 110 ASP A O     1 
ATOM   1493 C  CB    . ASP C 3 110 ? 43.143  14.102 18.394  1.00 64.97  ? 110 ASP A CB    1 
ATOM   1494 C  CG    . ASP C 3 110 ? 44.326  15.046 18.358  1.00 64.50  ? 110 ASP A CG    1 
ATOM   1495 O  OD1   . ASP C 3 110 ? 45.178  14.872 17.448  1.00 62.26  ? 110 ASP A OD1   1 
ATOM   1496 O  OD2   . ASP C 3 110 ? 44.402  15.954 19.219  1.00 63.85  ? 110 ASP A OD2   1 
ATOM   1497 N  N     . ILE C 3 111 ? 44.591  12.307 15.644  1.00 67.27  ? 111 ILE A N     1 
ATOM   1498 C  CA    . ILE C 3 111 ? 45.680  11.379 15.367  1.00 68.38  ? 111 ILE A CA    1 
ATOM   1499 C  C     . ILE C 3 111 ? 47.052  12.042 15.340  1.00 71.12  ? 111 ILE A C     1 
ATOM   1500 O  O     . ILE C 3 111 ? 47.978  11.544 14.694  1.00 70.62  ? 111 ILE A O     1 
ATOM   1501 C  CB    . ILE C 3 111 ? 45.450  10.650 14.035  1.00 65.05  ? 111 ILE A CB    1 
ATOM   1502 C  CG1   . ILE C 3 111 ? 45.099  11.665 12.942  1.00 63.05  ? 111 ILE A CG1   1 
ATOM   1503 C  CG2   . ILE C 3 111 ? 44.375  9.601  14.222  1.00 63.31  ? 111 ILE A CG2   1 
ATOM   1504 C  CD1   . ILE C 3 111 ? 44.972  11.080 11.548  1.00 61.51  ? 111 ILE A CD1   1 
ATOM   1505 N  N     . SER C 3 112 ? 47.174  13.164 16.049  1.00 74.64  ? 112 SER A N     1 
ATOM   1506 C  CA    . SER C 3 112 ? 48.438  13.897 16.121  1.00 76.94  ? 112 SER A CA    1 
ATOM   1507 C  C     . SER C 3 112 ? 49.560  13.007 16.679  1.00 78.35  ? 112 SER A C     1 
ATOM   1508 O  O     . SER C 3 112 ? 50.727  13.164 16.301  1.00 78.47  ? 112 SER A O     1 
ATOM   1509 C  CB    . SER C 3 112 ? 48.271  15.164 16.981  1.00 75.67  ? 112 SER A CB    1 
ATOM   1510 O  OG    . SER C 3 112 ? 47.325  16.050 16.404  1.00 73.87  ? 112 SER A OG    1 
ATOM   1511 N  N     . ASP C 3 113 ? 49.201  12.071 17.561  1.00 79.10  ? 113 ASP A N     1 
ATOM   1512 C  CA    . ASP C 3 113 ? 50.176  11.151 18.152  1.00 80.00  ? 113 ASP A CA    1 
ATOM   1513 C  C     . ASP C 3 113 ? 50.097  9.727  17.611  1.00 80.41  ? 113 ASP A C     1 
ATOM   1514 O  O     . ASP C 3 113 ? 50.322  8.779  18.367  1.00 80.39  ? 113 ASP A O     1 
ATOM   1515 C  CB    . ASP C 3 113 ? 50.007  11.062 19.663  1.00 80.57  ? 113 ASP A CB    1 
ATOM   1516 C  CG    . ASP C 3 113 ? 50.021  12.400 20.321  1.00 82.71  ? 113 ASP A CG    1 
ATOM   1517 O  OD1   . ASP C 3 113 ? 50.850  13.255 19.923  1.00 81.15  ? 113 ASP A OD1   1 
ATOM   1518 O  OD2   . ASP C 3 113 ? 49.198  12.583 21.246  1.00 84.91  ? 113 ASP A OD2   1 
ATOM   1519 N  N     . LYS C 3 114 ? 49.772  9.564  16.329  1.00 80.77  ? 114 LYS A N     1 
ATOM   1520 C  CA    . LYS C 3 114 ? 49.688  8.229  15.734  1.00 81.26  ? 114 LYS A CA    1 
ATOM   1521 C  C     . LYS C 3 114 ? 50.263  8.277  14.327  1.00 82.41  ? 114 LYS A C     1 
ATOM   1522 O  O     . LYS C 3 114 ? 50.545  7.245  13.727  1.00 81.73  ? 114 LYS A O     1 
ATOM   1523 C  CB    . LYS C 3 114 ? 48.240  7.725  15.676  1.00 80.25  ? 114 LYS A CB    1 
ATOM   1524 C  CG    . LYS C 3 114 ? 47.437  7.869  16.968  1.00 81.58  ? 114 LYS A CG    1 
ATOM   1525 C  CD    . LYS C 3 114 ? 47.966  7.010  18.116  1.00 83.41  ? 114 LYS A CD    1 
ATOM   1526 C  CE    . LYS C 3 114 ? 47.103  7.176  19.384  1.00 83.23  ? 114 LYS A CE    1 
ATOM   1527 N  NZ    . LYS C 3 114 ? 47.529  6.311  20.531  1.00 82.51  ? 114 LYS A NZ    1 
ATOM   1528 N  N     . VAL C 3 115 ? 50.421  9.487  13.803  1.00 85.10  ? 115 VAL A N     1 
ATOM   1529 C  CA    . VAL C 3 115 ? 50.984  9.688  12.472  1.00 88.78  ? 115 VAL A CA    1 
ATOM   1530 C  C     . VAL C 3 115 ? 51.750  11.010 12.427  1.00 91.15  ? 115 VAL A C     1 
ATOM   1531 O  O     . VAL C 3 115 ? 51.374  11.985 13.081  1.00 91.88  ? 115 VAL A O     1 
ATOM   1532 C  CB    . VAL C 3 115 ? 49.897  9.704  11.390  1.00 88.60  ? 115 VAL A CB    1 
ATOM   1533 C  CG1   . VAL C 3 115 ? 49.075  8.430  11.464  1.00 88.99  ? 115 VAL A CG1   1 
ATOM   1534 C  CG2   . VAL C 3 115 ? 49.021  10.924 11.556  1.00 90.02  ? 115 VAL A CG2   1 
ATOM   1535 N  N     . ARG C 3 116 ? 52.825  11.036 11.646  1.00 93.97  ? 116 ARG A N     1 
ATOM   1536 C  CA    . ARG C 3 116 ? 53.676  12.214 11.540  1.00 96.21  ? 116 ARG A CA    1 
ATOM   1537 C  C     . ARG C 3 116 ? 53.253  13.217 10.472  1.00 95.68  ? 116 ARG A C     1 
ATOM   1538 O  O     . ARG C 3 116 ? 53.564  14.400 10.578  1.00 95.22  ? 116 ARG A O     1 
ATOM   1539 C  CB    . ARG C 3 116 ? 55.124  11.765 11.304  1.00 99.41  ? 116 ARG A CB    1 
ATOM   1540 C  CG    . ARG C 3 116 ? 55.658  10.856 12.419  1.00 104.75 ? 116 ARG A CG    1 
ATOM   1541 C  CD    . ARG C 3 116 ? 57.047  10.303 12.108  1.00 110.45 ? 116 ARG A CD    1 
ATOM   1542 N  NE    . ARG C 3 116 ? 57.015  9.025  11.390  1.00 115.11 ? 116 ARG A NE    1 
ATOM   1543 C  CZ    . ARG C 3 116 ? 58.096  8.416  10.903  1.00 117.99 ? 116 ARG A CZ    1 
ATOM   1544 N  NH1   . ARG C 3 116 ? 59.298  8.970  11.053  1.00 119.33 ? 116 ARG A NH1   1 
ATOM   1545 N  NH2   . ARG C 3 116 ? 57.981  7.252  10.268  1.00 119.07 ? 116 ARG A NH2   1 
ATOM   1546 N  N     . ASP C 3 117 ? 52.531  12.755 9.457   1.00 95.70  ? 117 ASP A N     1 
ATOM   1547 C  CA    . ASP C 3 117 ? 52.093  13.639 8.376   1.00 95.86  ? 117 ASP A CA    1 
ATOM   1548 C  C     . ASP C 3 117 ? 50.792  13.177 7.718   1.00 95.24  ? 117 ASP A C     1 
ATOM   1549 O  O     . ASP C 3 117 ? 50.277  12.109 8.031   1.00 95.62  ? 117 ASP A O     1 
ATOM   1550 C  CB    . ASP C 3 117 ? 53.182  13.718 7.316   1.00 97.08  ? 117 ASP A CB    1 
ATOM   1551 C  CG    . ASP C 3 117 ? 53.648  12.348 6.880   1.00 99.55  ? 117 ASP A CG    1 
ATOM   1552 O  OD1   . ASP C 3 117 ? 52.784  11.538 6.470   1.00 100.02 ? 117 ASP A OD1   1 
ATOM   1553 O  OD2   . ASP C 3 117 ? 54.871  12.080 6.953   1.00 100.66 ? 117 ASP A OD2   1 
ATOM   1554 N  N     . TYR C 3 118 ? 50.278  13.978 6.789   1.00 94.56  ? 118 TYR A N     1 
ATOM   1555 C  CA    . TYR C 3 118 ? 49.038  13.654 6.090   1.00 94.18  ? 118 TYR A CA    1 
ATOM   1556 C  C     . TYR C 3 118 ? 49.114  12.387 5.246   1.00 95.32  ? 118 TYR A C     1 
ATOM   1557 O  O     . TYR C 3 118 ? 48.088  11.751 4.988   1.00 95.77  ? 118 TYR A O     1 
ATOM   1558 C  CB    . TYR C 3 118 ? 48.590  14.822 5.201   1.00 92.33  ? 118 TYR A CB    1 
ATOM   1559 C  CG    . TYR C 3 118 ? 48.065  16.039 5.951   1.00 90.38  ? 118 TYR A CG    1 
ATOM   1560 C  CD1   . TYR C 3 118 ? 47.391  15.906 7.170   1.00 88.72  ? 118 TYR A CD1   1 
ATOM   1561 C  CD2   . TYR C 3 118 ? 48.204  17.318 5.415   1.00 89.14  ? 118 TYR A CD2   1 
ATOM   1562 C  CE1   . TYR C 3 118 ? 46.866  17.015 7.827   1.00 87.63  ? 118 TYR A CE1   1 
ATOM   1563 C  CE2   . TYR C 3 118 ? 47.682  18.427 6.060   1.00 88.76  ? 118 TYR A CE2   1 
ATOM   1564 C  CZ    . TYR C 3 118 ? 47.016  18.274 7.262   1.00 87.94  ? 118 TYR A CZ    1 
ATOM   1565 O  OH    . TYR C 3 118 ? 46.486  19.387 7.872   1.00 87.01  ? 118 TYR A OH    1 
ATOM   1566 N  N     . ARG C 3 119 ? 50.315  12.030 4.795   1.00 96.77  ? 119 ARG A N     1 
ATOM   1567 C  CA    . ARG C 3 119 ? 50.485  10.817 3.999   1.00 97.08  ? 119 ARG A CA    1 
ATOM   1568 C  C     . ARG C 3 119 ? 50.165  9.642  4.930   1.00 95.97  ? 119 ARG A C     1 
ATOM   1569 O  O     . ARG C 3 119 ? 49.386  8.755  4.581   1.00 94.70  ? 119 ARG A O     1 
ATOM   1570 C  CB    . ARG C 3 119 ? 51.926  10.710 3.472   1.00 98.71  ? 119 ARG A CB    1 
ATOM   1571 C  CG    . ARG C 3 119 ? 52.165  9.536  2.511   1.00 102.12 ? 119 ARG A CG    1 
ATOM   1572 C  CD    . ARG C 3 119 ? 53.658  9.335  2.199   1.00 104.22 ? 119 ARG A CD    1 
ATOM   1573 N  NE    . ARG C 3 119 ? 54.430  8.955  3.386   1.00 107.94 ? 119 ARG A NE    1 
ATOM   1574 C  CZ    . ARG C 3 119 ? 54.465  7.732  3.921   1.00 109.37 ? 119 ARG A CZ    1 
ATOM   1575 N  NH1   . ARG C 3 119 ? 53.774  6.736  3.375   1.00 110.19 ? 119 ARG A NH1   1 
ATOM   1576 N  NH2   . ARG C 3 119 ? 55.181  7.510  5.020   1.00 108.99 ? 119 ARG A NH2   1 
ATOM   1577 N  N     . GLU C 3 120 ? 50.760  9.658  6.122   1.00 95.78  ? 120 GLU A N     1 
ATOM   1578 C  CA    . GLU C 3 120 ? 50.532  8.613  7.120   1.00 95.83  ? 120 GLU A CA    1 
ATOM   1579 C  C     . GLU C 3 120 ? 49.115  8.694  7.656   1.00 94.33  ? 120 GLU A C     1 
ATOM   1580 O  O     . GLU C 3 120 ? 48.551  7.690  8.083   1.00 94.52  ? 120 GLU A O     1 
ATOM   1581 C  CB    . GLU C 3 120 ? 51.509  8.748  8.291   1.00 97.75  ? 120 GLU A CB    1 
ATOM   1582 C  CG    . GLU C 3 120 ? 52.856  8.063  8.087   1.00 100.44 ? 120 GLU A CG    1 
ATOM   1583 C  CD    . GLU C 3 120 ? 53.826  8.326  9.231   1.00 101.14 ? 120 GLU A CD    1 
ATOM   1584 O  OE1   . GLU C 3 120 ? 53.491  8.008  10.396  1.00 100.87 ? 120 GLU A OE1   1 
ATOM   1585 O  OE2   . GLU C 3 120 ? 54.929  8.851  8.959   1.00 101.78 ? 120 GLU A OE2   1 
ATOM   1586 N  N     . ALA C 3 121 ? 48.553  9.898  7.653   1.00 92.78  ? 121 ALA A N     1 
ATOM   1587 C  CA    . ALA C 3 121 ? 47.186  10.105 8.119   1.00 90.66  ? 121 ALA A CA    1 
ATOM   1588 C  C     . ALA C 3 121 ? 46.249  9.465  7.100   1.00 88.99  ? 121 ALA A C     1 
ATOM   1589 O  O     . ALA C 3 121 ? 45.426  8.615  7.440   1.00 88.96  ? 121 ALA A O     1 
ATOM   1590 C  CB    . ALA C 3 121 ? 46.889  11.595 8.240   1.00 91.25  ? 121 ALA A CB    1 
ATOM   1591 N  N     . TYR C 3 122 ? 46.393  9.876  5.846   1.00 85.88  ? 122 TYR A N     1 
ATOM   1592 C  CA    . TYR C 3 122 ? 45.580  9.352  4.760   1.00 82.46  ? 122 TYR A CA    1 
ATOM   1593 C  C     . TYR C 3 122 ? 45.626  7.822  4.718   1.00 81.67  ? 122 TYR A C     1 
ATOM   1594 O  O     . TYR C 3 122 ? 44.646  7.175  4.350   1.00 81.80  ? 122 TYR A O     1 
ATOM   1595 C  CB    . TYR C 3 122 ? 46.081  9.928  3.444   1.00 79.54  ? 122 TYR A CB    1 
ATOM   1596 C  CG    . TYR C 3 122 ? 45.266  9.571  2.225   1.00 77.43  ? 122 TYR A CG    1 
ATOM   1597 C  CD1   . TYR C 3 122 ? 44.522  10.546 1.564   1.00 77.13  ? 122 TYR A CD1   1 
ATOM   1598 C  CD2   . TYR C 3 122 ? 45.306  8.289  1.677   1.00 75.39  ? 122 TYR A CD2   1 
ATOM   1599 C  CE1   . TYR C 3 122 ? 43.856  10.266 0.384   1.00 76.25  ? 122 TYR A CE1   1 
ATOM   1600 C  CE2   . TYR C 3 122 ? 44.639  7.995  0.496   1.00 74.28  ? 122 TYR A CE2   1 
ATOM   1601 C  CZ    . TYR C 3 122 ? 43.917  8.993  -0.147  1.00 76.25  ? 122 TYR A CZ    1 
ATOM   1602 O  OH    . TYR C 3 122 ? 43.269  8.751  -1.338  1.00 76.30  ? 122 TYR A OH    1 
ATOM   1603 N  N     . ASN C 3 123 ? 46.764  7.245  5.093   1.00 81.02  ? 123 ASN A N     1 
ATOM   1604 C  CA    . ASN C 3 123 ? 46.895  5.789  5.089   1.00 80.50  ? 123 ASN A CA    1 
ATOM   1605 C  C     . ASN C 3 123 ? 46.187  5.187  6.305   1.00 79.50  ? 123 ASN A C     1 
ATOM   1606 O  O     . ASN C 3 123 ? 45.717  4.045  6.261   1.00 80.22  ? 123 ASN A O     1 
ATOM   1607 C  CB    . ASN C 3 123 ? 48.377  5.363  5.077   1.00 80.21  ? 123 ASN A CB    1 
ATOM   1608 C  CG    . ASN C 3 123 ? 49.119  5.814  3.813   1.00 80.86  ? 123 ASN A CG    1 
ATOM   1609 O  OD1   . ASN C 3 123 ? 48.511  6.032  2.754   1.00 78.45  ? 123 ASN A OD1   1 
ATOM   1610 N  ND2   . ASN C 3 123 ? 50.446  5.938  3.920   1.00 80.67  ? 123 ASN A ND2   1 
ATOM   1611 N  N     . LEU C 3 124 ? 46.113  5.954  7.390   1.00 77.38  ? 124 LEU A N     1 
ATOM   1612 C  CA    . LEU C 3 124 ? 45.446  5.479  8.591   1.00 75.66  ? 124 LEU A CA    1 
ATOM   1613 C  C     . LEU C 3 124 ? 43.958  5.481  8.316   1.00 75.69  ? 124 LEU A C     1 
ATOM   1614 O  O     . LEU C 3 124 ? 43.221  4.634  8.813   1.00 76.41  ? 124 LEU A O     1 
ATOM   1615 C  CB    . LEU C 3 124 ? 45.747  6.384  9.785   1.00 74.42  ? 124 LEU A CB    1 
ATOM   1616 C  CG    . LEU C 3 124 ? 44.955  6.018  11.048  1.00 73.62  ? 124 LEU A CG    1 
ATOM   1617 C  CD1   . LEU C 3 124 ? 45.272  4.596  11.472  1.00 72.70  ? 124 LEU A CD1   1 
ATOM   1618 C  CD2   . LEU C 3 124 ? 45.285  6.985  12.159  1.00 73.26  ? 124 LEU A CD2   1 
ATOM   1619 N  N     . GLY C 3 125 ? 43.523  6.447  7.517   1.00 75.37  ? 125 GLY A N     1 
ATOM   1620 C  CA    . GLY C 3 125 ? 42.119  6.542  7.166   1.00 76.03  ? 125 GLY A CA    1 
ATOM   1621 C  C     . GLY C 3 125 ? 41.700  5.302  6.402   1.00 76.08  ? 125 GLY A C     1 
ATOM   1622 O  O     . GLY C 3 125 ? 40.749  4.610  6.788   1.00 75.96  ? 125 GLY A O     1 
ATOM   1623 N  N     . LEU C 3 126 ? 42.417  5.024  5.314   1.00 75.53  ? 126 LEU A N     1 
ATOM   1624 C  CA    . LEU C 3 126 ? 42.156  3.849  4.490   1.00 74.58  ? 126 LEU A CA    1 
ATOM   1625 C  C     . LEU C 3 126 ? 42.019  2.624  5.379   1.00 73.69  ? 126 LEU A C     1 
ATOM   1626 O  O     . LEU C 3 126 ? 41.054  1.860  5.276   1.00 72.47  ? 126 LEU A O     1 
ATOM   1627 C  CB    . LEU C 3 126 ? 43.308  3.641  3.516   1.00 74.30  ? 126 LEU A CB    1 
ATOM   1628 C  CG    . LEU C 3 126 ? 43.327  4.624  2.355   1.00 74.81  ? 126 LEU A CG    1 
ATOM   1629 C  CD1   . LEU C 3 126 ? 44.663  4.565  1.635   1.00 74.38  ? 126 LEU A CD1   1 
ATOM   1630 C  CD2   . LEU C 3 126 ? 42.174  4.289  1.421   1.00 74.88  ? 126 LEU A CD2   1 
ATOM   1631 N  N     . GLU C 3 127 ? 42.998  2.447  6.255   1.00 73.31  ? 127 GLU A N     1 
ATOM   1632 C  CA    . GLU C 3 127 ? 43.001  1.323  7.172   1.00 74.50  ? 127 GLU A CA    1 
ATOM   1633 C  C     . GLU C 3 127 ? 41.714  1.320  7.998   1.00 73.98  ? 127 GLU A C     1 
ATOM   1634 O  O     . GLU C 3 127 ? 41.166  0.258  8.310   1.00 73.47  ? 127 GLU A O     1 
ATOM   1635 C  CB    . GLU C 3 127 ? 44.214  1.417  8.094   1.00 76.21  ? 127 GLU A CB    1 
ATOM   1636 C  CG    . GLU C 3 127 ? 44.419  0.213  8.995   1.00 79.50  ? 127 GLU A CG    1 
ATOM   1637 C  CD    . GLU C 3 127 ? 45.458  0.483  10.065  1.00 82.37  ? 127 GLU A CD    1 
ATOM   1638 O  OE1   . GLU C 3 127 ? 46.542  1.017  9.713   1.00 84.31  ? 127 GLU A OE1   1 
ATOM   1639 O  OE2   . GLU C 3 127 ? 45.194  0.165  11.251  1.00 81.92  ? 127 GLU A OE2   1 
ATOM   1640 N  N     . ILE C 3 128 ? 41.235  2.512  8.346   1.00 73.42  ? 128 ILE A N     1 
ATOM   1641 C  CA    . ILE C 3 128 ? 40.019  2.632  9.133   1.00 72.41  ? 128 ILE A CA    1 
ATOM   1642 C  C     . ILE C 3 128 ? 38.763  2.417  8.302   1.00 71.20  ? 128 ILE A C     1 
ATOM   1643 O  O     . ILE C 3 128 ? 37.779  1.874  8.799   1.00 70.79  ? 128 ILE A O     1 
ATOM   1644 C  CB    . ILE C 3 128 ? 39.944  3.987  9.855   1.00 73.50  ? 128 ILE A CB    1 
ATOM   1645 C  CG1   . ILE C 3 128 ? 41.062  4.048  10.906  1.00 74.85  ? 128 ILE A CG1   1 
ATOM   1646 C  CG2   . ILE C 3 128 ? 38.547  4.171  10.485  1.00 71.66  ? 128 ILE A CG2   1 
ATOM   1647 C  CD1   . ILE C 3 128 ? 41.103  5.330  11.726  1.00 75.55  ? 128 ILE A CD1   1 
ATOM   1648 N  N     . LYS C 3 129 ? 38.770  2.842  7.047   1.00 69.40  ? 129 LYS A N     1 
ATOM   1649 C  CA    . LYS C 3 129 ? 37.597  2.592  6.232   1.00 69.23  ? 129 LYS A CA    1 
ATOM   1650 C  C     . LYS C 3 129 ? 37.467  1.072  6.104   1.00 70.85  ? 129 LYS A C     1 
ATOM   1651 O  O     . LYS C 3 129 ? 36.386  0.507  6.275   1.00 71.09  ? 129 LYS A O     1 
ATOM   1652 C  CB    . LYS C 3 129 ? 37.751  3.218  4.854   1.00 66.47  ? 129 LYS A CB    1 
ATOM   1653 C  CG    . LYS C 3 129 ? 37.525  4.706  4.835   1.00 63.72  ? 129 LYS A CG    1 
ATOM   1654 C  CD    . LYS C 3 129 ? 37.907  5.293  3.491   1.00 60.84  ? 129 LYS A CD    1 
ATOM   1655 C  CE    . LYS C 3 129 ? 37.161  4.632  2.359   1.00 58.07  ? 129 LYS A CE    1 
ATOM   1656 N  NZ    . LYS C 3 129 ? 35.783  5.113  2.242   1.00 55.82  ? 129 LYS A NZ    1 
ATOM   1657 N  N     . ASN C 3 130 ? 38.584  0.413  5.820   1.00 72.92  ? 130 ASN A N     1 
ATOM   1658 C  CA    . ASN C 3 130 ? 38.588  -1.034 5.672   1.00 74.45  ? 130 ASN A CA    1 
ATOM   1659 C  C     . ASN C 3 130 ? 38.136  -1.741 6.938   1.00 73.83  ? 130 ASN A C     1 
ATOM   1660 O  O     . ASN C 3 130 ? 37.186  -2.513 6.916   1.00 73.28  ? 130 ASN A O     1 
ATOM   1661 C  CB    . ASN C 3 130 ? 39.983  -1.532 5.284   1.00 77.79  ? 130 ASN A CB    1 
ATOM   1662 C  CG    . ASN C 3 130 ? 40.395  -1.095 3.887   1.00 80.43  ? 130 ASN A CG    1 
ATOM   1663 O  OD1   . ASN C 3 130 ? 39.589  -1.118 2.947   1.00 81.87  ? 130 ASN A OD1   1 
ATOM   1664 N  ND2   . ASN C 3 130 ? 41.661  -0.711 3.738   1.00 80.60  ? 130 ASN A ND2   1 
ATOM   1665 N  N     . LYS C 3 131 ? 38.810  -1.478 8.046   1.00 74.30  ? 131 LYS A N     1 
ATOM   1666 C  CA    . LYS C 3 131 ? 38.443  -2.130 9.296   1.00 76.51  ? 131 LYS A CA    1 
ATOM   1667 C  C     . LYS C 3 131 ? 36.943  -2.114 9.573   1.00 77.75  ? 131 LYS A C     1 
ATOM   1668 O  O     . LYS C 3 131 ? 36.417  -3.037 10.200  1.00 78.55  ? 131 LYS A O     1 
ATOM   1669 C  CB    . LYS C 3 131 ? 39.166  -1.485 10.476  1.00 76.91  ? 131 LYS A CB    1 
ATOM   1670 C  CG    . LYS C 3 131 ? 38.796  -2.090 11.832  1.00 77.32  ? 131 LYS A CG    1 
ATOM   1671 C  CD    . LYS C 3 131 ? 39.230  -3.544 11.939  1.00 78.65  ? 131 LYS A CD    1 
ATOM   1672 C  CE    . LYS C 3 131 ? 40.742  -3.688 11.769  1.00 78.80  ? 131 LYS A CE    1 
ATOM   1673 N  NZ    . LYS C 3 131 ? 41.206  -5.092 11.913  1.00 77.02  ? 131 LYS A NZ    1 
ATOM   1674 N  N     . ILE C 3 132 ? 36.264  -1.061 9.116   1.00 78.50  ? 132 ILE A N     1 
ATOM   1675 C  CA    . ILE C 3 132 ? 34.818  -0.904 9.316   1.00 78.10  ? 132 ILE A CA    1 
ATOM   1676 C  C     . ILE C 3 132 ? 34.035  -1.714 8.286   1.00 78.14  ? 132 ILE A C     1 
ATOM   1677 O  O     . ILE C 3 132 ? 32.989  -2.302 8.591   1.00 77.62  ? 132 ILE A O     1 
ATOM   1678 C  CB    . ILE C 3 132 ? 34.407  0.591  9.237   1.00 76.89  ? 132 ILE A CB    1 
ATOM   1679 C  CG1   . ILE C 3 132 ? 34.915  1.326  10.480  1.00 75.91  ? 132 ILE A CG1   1 
ATOM   1680 C  CG2   . ILE C 3 132 ? 32.901  0.722  9.129   1.00 77.04  ? 132 ILE A CG2   1 
ATOM   1681 C  CD1   . ILE C 3 132 ? 34.708  2.818  10.446  1.00 74.81  ? 132 ILE A CD1   1 
ATOM   1682 N  N     . LEU C 3 133 ? 34.548  -1.751 7.066   1.00 78.14  ? 133 LEU A N     1 
ATOM   1683 C  CA    . LEU C 3 133 ? 33.896  -2.521 6.028   1.00 78.26  ? 133 LEU A CA    1 
ATOM   1684 C  C     . LEU C 3 133 ? 33.995  -3.994 6.422   1.00 78.68  ? 133 LEU A C     1 
ATOM   1685 O  O     . LEU C 3 133 ? 33.020  -4.734 6.317   1.00 78.47  ? 133 LEU A O     1 
ATOM   1686 C  CB    . LEU C 3 133 ? 34.582  -2.286 4.691   1.00 76.61  ? 133 LEU A CB    1 
ATOM   1687 C  CG    . LEU C 3 133 ? 33.795  -2.819 3.511   1.00 75.79  ? 133 LEU A CG    1 
ATOM   1688 C  CD1   . LEU C 3 133 ? 32.403  -2.213 3.518   1.00 75.77  ? 133 LEU A CD1   1 
ATOM   1689 C  CD2   . LEU C 3 133 ? 34.527  -2.475 2.229   1.00 77.58  ? 133 LEU A CD2   1 
ATOM   1690 N  N     . GLU C 3 134 ? 35.173  -4.408 6.891   1.00 79.67  ? 134 GLU A N     1 
ATOM   1691 C  CA    . GLU C 3 134 ? 35.389  -5.797 7.309   1.00 80.94  ? 134 GLU A CA    1 
ATOM   1692 C  C     . GLU C 3 134 ? 34.371  -6.171 8.367   1.00 78.72  ? 134 GLU A C     1 
ATOM   1693 O  O     . GLU C 3 134 ? 33.423  -6.906 8.094   1.00 77.82  ? 134 GLU A O     1 
ATOM   1694 C  CB    . GLU C 3 134 ? 36.802  -6.010 7.895   1.00 84.03  ? 134 GLU A CB    1 
ATOM   1695 C  CG    . GLU C 3 134 ? 37.974  -5.696 6.945   1.00 89.49  ? 134 GLU A CG    1 
ATOM   1696 C  CD    . GLU C 3 134 ? 39.357  -5.996 7.557   1.00 92.37  ? 134 GLU A CD    1 
ATOM   1697 O  OE1   . GLU C 3 134 ? 39.522  -5.845 8.790   1.00 93.16  ? 134 GLU A OE1   1 
ATOM   1698 O  OE2   . GLU C 3 134 ? 40.287  -6.361 6.800   1.00 93.40  ? 134 GLU A OE2   1 
ATOM   1699 N  N     . LYS C 3 135 ? 34.567  -5.643 9.574   1.00 77.69  ? 135 LYS A N     1 
ATOM   1700 C  CA    . LYS C 3 135 ? 33.682  -5.940 10.698  1.00 77.62  ? 135 LYS A CA    1 
ATOM   1701 C  C     . LYS C 3 135 ? 32.199  -5.691 10.479  1.00 77.20  ? 135 LYS A C     1 
ATOM   1702 O  O     . LYS C 3 135 ? 31.391  -6.573 10.763  1.00 78.22  ? 135 LYS A O     1 
ATOM   1703 C  CB    . LYS C 3 135 ? 34.101  -5.169 11.957  1.00 77.43  ? 135 LYS A CB    1 
ATOM   1704 C  CG    . LYS C 3 135 ? 35.526  -5.410 12.430  1.00 78.78  ? 135 LYS A CG    1 
ATOM   1705 C  CD    . LYS C 3 135 ? 35.734  -6.786 13.038  1.00 79.23  ? 135 LYS A CD    1 
ATOM   1706 C  CE    . LYS C 3 135 ? 37.210  -6.981 13.416  1.00 81.44  ? 135 LYS A CE    1 
ATOM   1707 N  NZ    . LYS C 3 135 ? 37.526  -8.299 14.068  1.00 83.35  ? 135 LYS A NZ    1 
ATOM   1708 N  N     . GLU C 3 136 ? 31.831  -4.517 9.965   1.00 75.74  ? 136 GLU A N     1 
ATOM   1709 C  CA    . GLU C 3 136 ? 30.414  -4.199 9.800   1.00 73.57  ? 136 GLU A CA    1 
ATOM   1710 C  C     . GLU C 3 136 ? 29.876  -3.951 8.406   1.00 73.08  ? 136 GLU A C     1 
ATOM   1711 O  O     . GLU C 3 136 ? 28.726  -3.551 8.268   1.00 73.17  ? 136 GLU A O     1 
ATOM   1712 C  CB    . GLU C 3 136 ? 30.058  -2.996 10.675  1.00 72.47  ? 136 GLU A CB    1 
ATOM   1713 C  CG    . GLU C 3 136 ? 30.336  -3.192 12.169  1.00 72.66  ? 136 GLU A CG    1 
ATOM   1714 C  CD    . GLU C 3 136 ? 29.281  -4.043 12.867  1.00 73.06  ? 136 GLU A CD    1 
ATOM   1715 O  OE1   . GLU C 3 136 ? 28.344  -4.508 12.176  1.00 73.33  ? 136 GLU A OE1   1 
ATOM   1716 O  OE2   . GLU C 3 136 ? 29.386  -4.244 14.102  1.00 70.45  ? 136 GLU A OE2   1 
ATOM   1717 N  N     . LYS C 3 137 ? 30.680  -4.181 7.375   1.00 73.17  ? 137 LYS A N     1 
ATOM   1718 C  CA    . LYS C 3 137 ? 30.221  -3.958 6.000   1.00 73.14  ? 137 LYS A CA    1 
ATOM   1719 C  C     . LYS C 3 137 ? 29.451  -2.644 5.820   1.00 71.28  ? 137 LYS A C     1 
ATOM   1720 O  O     . LYS C 3 137 ? 28.364  -2.612 5.237   1.00 70.50  ? 137 LYS A O     1 
ATOM   1721 C  CB    . LYS C 3 137 ? 29.351  -5.131 5.540   1.00 75.32  ? 137 LYS A CB    1 
ATOM   1722 C  CG    . LYS C 3 137 ? 30.116  -6.434 5.434   1.00 78.30  ? 137 LYS A CG    1 
ATOM   1723 C  CD    . LYS C 3 137 ? 31.117  -6.390 4.273   1.00 81.83  ? 137 LYS A CD    1 
ATOM   1724 C  CE    . LYS C 3 137 ? 32.412  -7.114 4.627   1.00 82.73  ? 137 LYS A CE    1 
ATOM   1725 N  NZ    . LYS C 3 137 ? 32.149  -8.408 5.325   1.00 84.41  ? 137 LYS A NZ    1 
ATOM   1726 N  N     . ILE C 3 138 ? 30.031  -1.563 6.332   1.00 69.22  ? 138 ILE A N     1 
ATOM   1727 C  CA    . ILE C 3 138 ? 29.446  -0.228 6.224   1.00 68.29  ? 138 ILE A CA    1 
ATOM   1728 C  C     . ILE C 3 138 ? 30.521  0.698  5.653   1.00 67.18  ? 138 ILE A C     1 
ATOM   1729 O  O     . ILE C 3 138 ? 31.659  0.698  6.131   1.00 67.60  ? 138 ILE A O     1 
ATOM   1730 C  CB    . ILE C 3 138 ? 29.014  0.358  7.621   1.00 68.98  ? 138 ILE A CB    1 
ATOM   1731 C  CG1   . ILE C 3 138 ? 27.836  -0.424 8.215   1.00 67.83  ? 138 ILE A CG1   1 
ATOM   1732 C  CG2   . ILE C 3 138 ? 28.642  1.845  7.473   1.00 68.26  ? 138 ILE A CG2   1 
ATOM   1733 C  CD1   . ILE C 3 138 ? 26.524  -0.160 7.541   1.00 66.92  ? 138 ILE A CD1   1 
ATOM   1734 N  N     . THR C 3 139 ? 30.166  1.471  4.632   1.00 64.20  ? 139 THR A N     1 
ATOM   1735 C  CA    . THR C 3 139 ? 31.103  2.412  4.037   1.00 62.16  ? 139 THR A CA    1 
ATOM   1736 C  C     . THR C 3 139 ? 30.995  3.745  4.767   1.00 60.80  ? 139 THR A C     1 
ATOM   1737 O  O     . THR C 3 139 ? 29.923  4.107  5.235   1.00 60.91  ? 139 THR A O     1 
ATOM   1738 C  CB    . THR C 3 139 ? 30.806  2.658  2.532   1.00 63.46  ? 139 THR A CB    1 
ATOM   1739 O  OG1   . THR C 3 139 ? 29.513  3.256  2.375   1.00 62.89  ? 139 THR A OG1   1 
ATOM   1740 C  CG2   . THR C 3 139 ? 30.851  1.352  1.764   1.00 64.02  ? 139 THR A CG2   1 
ATOM   1741 N  N     . VAL C 3 140 ? 32.099  4.472  4.874   1.00 58.36  ? 140 VAL A N     1 
ATOM   1742 C  CA    . VAL C 3 140 ? 32.068  5.760  5.543   1.00 55.42  ? 140 VAL A CA    1 
ATOM   1743 C  C     . VAL C 3 140 ? 33.102  6.647  4.905   1.00 54.58  ? 140 VAL A C     1 
ATOM   1744 O  O     . VAL C 3 140 ? 34.165  6.172  4.539   1.00 53.45  ? 140 VAL A O     1 
ATOM   1745 C  CB    . VAL C 3 140 ? 32.413  5.644  7.043   1.00 55.98  ? 140 VAL A CB    1 
ATOM   1746 C  CG1   . VAL C 3 140 ? 31.628  4.524  7.670   1.00 57.33  ? 140 VAL A CG1   1 
ATOM   1747 C  CG2   . VAL C 3 140 ? 33.892  5.402  7.230   1.00 54.82  ? 140 VAL A CG2   1 
ATOM   1748 N  N     . THR C 3 141 ? 32.786  7.932  4.772   1.00 55.30  ? 141 THR A N     1 
ATOM   1749 C  CA    . THR C 3 141 ? 33.713  8.911  4.202   1.00 55.75  ? 141 THR A CA    1 
ATOM   1750 C  C     . THR C 3 141 ? 34.655  9.418  5.298   1.00 57.51  ? 141 THR A C     1 
ATOM   1751 O  O     . THR C 3 141 ? 34.233  9.614  6.440   1.00 56.28  ? 141 THR A O     1 
ATOM   1752 C  CB    . THR C 3 141 ? 32.958  10.106 3.627   1.00 55.37  ? 141 THR A CB    1 
ATOM   1753 O  OG1   . THR C 3 141 ? 32.254  9.695  2.450   1.00 56.15  ? 141 THR A OG1   1 
ATOM   1754 C  CG2   . THR C 3 141 ? 33.904  11.232 3.297   1.00 55.65  ? 141 THR A CG2   1 
ATOM   1755 N  N     . VAL C 3 142 ? 35.931  9.618  4.964   1.00 59.17  ? 142 VAL A N     1 
ATOM   1756 C  CA    . VAL C 3 142 ? 36.906  10.103 5.952   1.00 60.76  ? 142 VAL A CA    1 
ATOM   1757 C  C     . VAL C 3 142 ? 37.439  11.471 5.557   1.00 61.84  ? 142 VAL A C     1 
ATOM   1758 O  O     . VAL C 3 142 ? 37.896  11.658 4.435   1.00 62.29  ? 142 VAL A O     1 
ATOM   1759 C  CB    . VAL C 3 142 ? 38.119  9.112  6.124   1.00 60.48  ? 142 VAL A CB    1 
ATOM   1760 C  CG1   . VAL C 3 142 ? 39.247  9.772  6.913   1.00 57.47  ? 142 VAL A CG1   1 
ATOM   1761 C  CG2   . VAL C 3 142 ? 37.665  7.845  6.852   1.00 58.32  ? 142 VAL A CG2   1 
ATOM   1762 N  N     . GLY C 3 143 ? 37.359  12.426 6.480   1.00 61.97  ? 143 GLY A N     1 
ATOM   1763 C  CA    . GLY C 3 143 ? 37.862  13.763 6.211   1.00 62.38  ? 143 GLY A CA    1 
ATOM   1764 C  C     . GLY C 3 143 ? 39.091  14.037 7.064   1.00 62.82  ? 143 GLY A C     1 
ATOM   1765 O  O     . GLY C 3 143 ? 39.101  13.706 8.252   1.00 63.63  ? 143 GLY A O     1 
ATOM   1766 N  N     . ILE C 3 144 ? 40.133  14.626 6.481   1.00 63.37  ? 144 ILE A N     1 
ATOM   1767 C  CA    . ILE C 3 144 ? 41.346  14.914 7.245   1.00 63.25  ? 144 ILE A CA    1 
ATOM   1768 C  C     . ILE C 3 144 ? 41.954  16.302 7.009   1.00 62.36  ? 144 ILE A C     1 
ATOM   1769 O  O     . ILE C 3 144 ? 42.013  16.792 5.872   1.00 61.65  ? 144 ILE A O     1 
ATOM   1770 C  CB    . ILE C 3 144 ? 42.436  13.863 6.966   1.00 64.65  ? 144 ILE A CB    1 
ATOM   1771 C  CG1   . ILE C 3 144 ? 41.935  12.468 7.359   1.00 65.57  ? 144 ILE A CG1   1 
ATOM   1772 C  CG2   . ILE C 3 144 ? 43.690  14.199 7.762   1.00 65.84  ? 144 ILE A CG2   1 
ATOM   1773 C  CD1   . ILE C 3 144 ? 42.957  11.355 7.148   1.00 63.42  ? 144 ILE A CD1   1 
ATOM   1774 N  N     . SER C 3 145 ? 42.393  16.927 8.104   1.00 60.50  ? 145 SER A N     1 
ATOM   1775 C  CA    . SER C 3 145 ? 43.033  18.242 8.070   1.00 58.90  ? 145 SER A CA    1 
ATOM   1776 C  C     . SER C 3 145 ? 43.537  18.645 9.464   1.00 58.43  ? 145 SER A C     1 
ATOM   1777 O  O     . SER C 3 145 ? 43.595  17.807 10.376  1.00 57.61  ? 145 SER A O     1 
ATOM   1778 C  CB    . SER C 3 145 ? 42.073  19.297 7.515   1.00 58.36  ? 145 SER A CB    1 
ATOM   1779 O  OG    . SER C 3 145 ? 42.772  20.473 7.141   1.00 58.14  ? 145 SER A OG    1 
ATOM   1780 N  N     . LYS C 3 146 ? 43.897  19.922 9.618   1.00 59.24  ? 146 LYS A N     1 
ATOM   1781 C  CA    . LYS C 3 146 ? 44.444  20.455 10.879  1.00 59.70  ? 146 LYS A CA    1 
ATOM   1782 C  C     . LYS C 3 146 ? 43.482  20.624 12.044  1.00 57.97  ? 146 LYS A C     1 
ATOM   1783 O  O     . LYS C 3 146 ? 43.887  20.544 13.205  1.00 57.88  ? 146 LYS A O     1 
ATOM   1784 C  CB    . LYS C 3 146 ? 45.184  21.782 10.631  1.00 60.33  ? 146 LYS A CB    1 
ATOM   1785 C  CG    . LYS C 3 146 ? 44.452  22.769 9.757   1.00 61.58  ? 146 LYS A CG    1 
ATOM   1786 C  CD    . LYS C 3 146 ? 45.402  23.792 9.170   1.00 62.75  ? 146 LYS A CD    1 
ATOM   1787 C  CE    . LYS C 3 146 ? 45.975  24.706 10.240  1.00 65.11  ? 146 LYS A CE    1 
ATOM   1788 N  NZ    . LYS C 3 146 ? 46.750  25.833 9.627   1.00 66.83  ? 146 LYS A NZ    1 
ATOM   1789 N  N     . ASN C 3 147 ? 42.215  20.867 11.754  1.00 57.30  ? 147 ASN A N     1 
ATOM   1790 C  CA    . ASN C 3 147 ? 41.250  21.000 12.838  1.00 56.86  ? 147 ASN A CA    1 
ATOM   1791 C  C     . ASN C 3 147 ? 39.940  20.277 12.528  1.00 53.87  ? 147 ASN A C     1 
ATOM   1792 O  O     . ASN C 3 147 ? 39.753  19.736 11.434  1.00 53.08  ? 147 ASN A O     1 
ATOM   1793 C  CB    . ASN C 3 147 ? 40.989  22.486 13.179  1.00 57.48  ? 147 ASN A CB    1 
ATOM   1794 C  CG    . ASN C 3 147 ? 40.527  23.306 11.981  1.00 59.25  ? 147 ASN A CG    1 
ATOM   1795 O  OD1   . ASN C 3 147 ? 39.644  22.885 11.220  1.00 60.14  ? 147 ASN A OD1   1 
ATOM   1796 N  ND2   . ASN C 3 147 ? 41.109  24.495 11.819  1.00 58.63  ? 147 ASN A ND2   1 
ATOM   1797 N  N     . LYS C 3 148 ? 39.052  20.253 13.513  1.00 51.00  ? 148 LYS A N     1 
ATOM   1798 C  CA    . LYS C 3 148 ? 37.759  19.616 13.360  1.00 48.99  ? 148 LYS A CA    1 
ATOM   1799 C  C     . LYS C 3 148 ? 36.916  20.219 12.223  1.00 48.59  ? 148 LYS A C     1 
ATOM   1800 O  O     . LYS C 3 148 ? 36.384  19.480 11.376  1.00 47.51  ? 148 LYS A O     1 
ATOM   1801 C  CB    . LYS C 3 148 ? 37.004  19.692 14.680  1.00 47.65  ? 148 LYS A CB    1 
ATOM   1802 C  CG    . LYS C 3 148 ? 37.690  18.918 15.781  1.00 47.79  ? 148 LYS A CG    1 
ATOM   1803 C  CD    . LYS C 3 148 ? 36.760  18.696 16.964  1.00 48.10  ? 148 LYS A CD    1 
ATOM   1804 C  CE    . LYS C 3 148 ? 36.424  19.998 17.667  1.00 46.76  ? 148 LYS A CE    1 
ATOM   1805 N  NZ    . LYS C 3 148 ? 35.222  19.831 18.520  1.00 45.17  ? 148 LYS A NZ    1 
ATOM   1806 N  N     . VAL C 3 149 ? 36.805  21.548 12.195  1.00 46.39  ? 149 VAL A N     1 
ATOM   1807 C  CA    . VAL C 3 149 ? 36.036  22.221 11.154  1.00 45.91  ? 149 VAL A CA    1 
ATOM   1808 C  C     . VAL C 3 149 ? 36.474  21.851 9.743   1.00 46.73  ? 149 VAL A C     1 
ATOM   1809 O  O     . VAL C 3 149 ? 35.643  21.454 8.931   1.00 46.48  ? 149 VAL A O     1 
ATOM   1810 C  CB    . VAL C 3 149 ? 36.097  23.761 11.265  1.00 45.22  ? 149 VAL A CB    1 
ATOM   1811 C  CG1   . VAL C 3 149 ? 35.322  24.383 10.146  1.00 43.62  ? 149 VAL A CG1   1 
ATOM   1812 C  CG2   . VAL C 3 149 ? 35.498  24.217 12.572  1.00 45.95  ? 149 VAL A CG2   1 
ATOM   1813 N  N     . PHE C 3 150 ? 37.755  21.969 9.425   1.00 48.25  ? 150 PHE A N     1 
ATOM   1814 C  CA    . PHE C 3 150 ? 38.156  21.627 8.060   1.00 50.49  ? 150 PHE A CA    1 
ATOM   1815 C  C     . PHE C 3 150 ? 38.186  20.151 7.789   1.00 51.30  ? 150 PHE A C     1 
ATOM   1816 O  O     . PHE C 3 150 ? 38.165  19.725 6.633   1.00 50.93  ? 150 PHE A O     1 
ATOM   1817 C  CB    . PHE C 3 150 ? 39.490  22.265 7.691   1.00 50.95  ? 150 PHE A CB    1 
ATOM   1818 C  CG    . PHE C 3 150 ? 39.373  23.715 7.348   1.00 50.40  ? 150 PHE A CG    1 
ATOM   1819 C  CD1   . PHE C 3 150 ? 38.734  24.107 6.186   1.00 51.41  ? 150 PHE A CD1   1 
ATOM   1820 C  CD2   . PHE C 3 150 ? 39.787  24.687 8.243   1.00 49.91  ? 150 PHE A CD2   1 
ATOM   1821 C  CE1   . PHE C 3 150 ? 38.519  25.450 5.914   1.00 51.02  ? 150 PHE A CE1   1 
ATOM   1822 C  CE2   . PHE C 3 150 ? 39.576  26.024 7.978   1.00 50.11  ? 150 PHE A CE2   1 
ATOM   1823 C  CZ    . PHE C 3 150 ? 38.931  26.405 6.818   1.00 49.81  ? 150 PHE A CZ    1 
ATOM   1824 N  N     . ALA C 3 151 ? 38.220  19.364 8.853   1.00 53.24  ? 151 ALA A N     1 
ATOM   1825 C  CA    . ALA C 3 151 ? 38.208  17.922 8.683   1.00 55.17  ? 151 ALA A CA    1 
ATOM   1826 C  C     . ALA C 3 151 ? 36.789  17.574 8.218   1.00 56.11  ? 151 ALA A C     1 
ATOM   1827 O  O     . ALA C 3 151 ? 36.594  16.736 7.332   1.00 55.78  ? 151 ALA A O     1 
ATOM   1828 C  CB    . ALA C 3 151 ? 38.526  17.234 10.005  1.00 54.67  ? 151 ALA A CB    1 
ATOM   1829 N  N     . LYS C 3 152 ? 35.807  18.255 8.813   1.00 55.39  ? 152 LYS A N     1 
ATOM   1830 C  CA    . LYS C 3 152 ? 34.410  18.029 8.487   1.00 53.91  ? 152 LYS A CA    1 
ATOM   1831 C  C     . LYS C 3 152 ? 34.145  18.484 7.073   1.00 53.79  ? 152 LYS A C     1 
ATOM   1832 O  O     . LYS C 3 152 ? 33.501  17.783 6.308   1.00 54.69  ? 152 LYS A O     1 
ATOM   1833 C  CB    . LYS C 3 152 ? 33.508  18.778 9.469   1.00 53.38  ? 152 LYS A CB    1 
ATOM   1834 C  CG    . LYS C 3 152 ? 32.015  18.591 9.252   1.00 52.49  ? 152 LYS A CG    1 
ATOM   1835 C  CD    . LYS C 3 152 ? 31.274  18.778 10.580  1.00 54.94  ? 152 LYS A CD    1 
ATOM   1836 C  CE    . LYS C 3 152 ? 29.766  18.898 10.403  1.00 56.78  ? 152 LYS A CE    1 
ATOM   1837 N  NZ    . LYS C 3 152 ? 29.222  17.794 9.555   1.00 59.78  ? 152 LYS A NZ    1 
ATOM   1838 N  N     . ILE C 3 153 ? 34.650  19.659 6.720   1.00 54.53  ? 153 ILE A N     1 
ATOM   1839 C  CA    . ILE C 3 153 ? 34.463  20.180 5.371   1.00 53.71  ? 153 ILE A CA    1 
ATOM   1840 C  C     . ILE C 3 153 ? 35.180  19.244 4.406   1.00 54.93  ? 153 ILE A C     1 
ATOM   1841 O  O     . ILE C 3 153 ? 34.788  19.098 3.252   1.00 54.07  ? 153 ILE A O     1 
ATOM   1842 C  CB    . ILE C 3 153 ? 35.026  21.600 5.252   1.00 51.93  ? 153 ILE A CB    1 
ATOM   1843 C  CG1   . ILE C 3 153 ? 34.216  22.534 6.147   1.00 54.59  ? 153 ILE A CG1   1 
ATOM   1844 C  CG2   . ILE C 3 153 ? 34.979  22.069 3.828   1.00 50.49  ? 153 ILE A CG2   1 
ATOM   1845 C  CD1   . ILE C 3 153 ? 34.790  23.942 6.270   1.00 55.45  ? 153 ILE A CD1   1 
ATOM   1846 N  N     . ALA C 3 154 ? 36.235  18.604 4.889   1.00 56.23  ? 154 ALA A N     1 
ATOM   1847 C  CA    . ALA C 3 154 ? 36.959  17.667 4.060   1.00 58.03  ? 154 ALA A CA    1 
ATOM   1848 C  C     . ALA C 3 154 ? 35.958  16.596 3.640   1.00 59.12  ? 154 ALA A C     1 
ATOM   1849 O  O     . ALA C 3 154 ? 35.623  16.455 2.459   1.00 59.08  ? 154 ALA A O     1 
ATOM   1850 C  CB    . ALA C 3 154 ? 38.089  17.047 4.857   1.00 58.56  ? 154 ALA A CB    1 
ATOM   1851 N  N     . ALA C 3 155 ? 35.467  15.868 4.638   1.00 59.50  ? 155 ALA A N     1 
ATOM   1852 C  CA    . ALA C 3 155 ? 34.514  14.790 4.441   1.00 59.83  ? 155 ALA A CA    1 
ATOM   1853 C  C     . ALA C 3 155 ? 33.327  15.194 3.583   1.00 60.51  ? 155 ALA A C     1 
ATOM   1854 O  O     . ALA C 3 155 ? 32.912  14.437 2.713   1.00 60.36  ? 155 ALA A O     1 
ATOM   1855 C  CB    . ALA C 3 155 ? 34.040  14.290 5.778   1.00 58.80  ? 155 ALA A CB    1 
ATOM   1856 N  N     . ASP C 3 156 ? 32.777  16.379 3.826   1.00 62.59  ? 156 ASP A N     1 
ATOM   1857 C  CA    . ASP C 3 156 ? 31.636  16.841 3.045   1.00 64.62  ? 156 ASP A CA    1 
ATOM   1858 C  C     . ASP C 3 156 ? 31.918  16.796 1.563   1.00 65.94  ? 156 ASP A C     1 
ATOM   1859 O  O     . ASP C 3 156 ? 31.017  16.556 0.760   1.00 67.81  ? 156 ASP A O     1 
ATOM   1860 C  CB    . ASP C 3 156 ? 31.239  18.268 3.416   1.00 61.92  ? 156 ASP A CB    1 
ATOM   1861 C  CG    . ASP C 3 156 ? 30.548  18.344 4.757   1.00 62.71  ? 156 ASP A CG    1 
ATOM   1862 O  OD1   . ASP C 3 156 ? 30.062  17.290 5.237   1.00 61.98  ? 156 ASP A OD1   1 
ATOM   1863 O  OD2   . ASP C 3 156 ? 30.483  19.457 5.324   1.00 62.82  ? 156 ASP A OD2   1 
ATOM   1864 N  N     . MET C 3 157 ? 33.172  17.024 1.202   1.00 67.69  ? 157 MET A N     1 
ATOM   1865 C  CA    . MET C 3 157 ? 33.562  17.028 -0.199  1.00 69.71  ? 157 MET A CA    1 
ATOM   1866 C  C     . MET C 3 157 ? 33.799  15.623 -0.758  1.00 70.27  ? 157 MET A C     1 
ATOM   1867 O  O     . MET C 3 157 ? 33.492  15.352 -1.917  1.00 71.61  ? 157 MET A O     1 
ATOM   1868 C  CB    . MET C 3 157 ? 34.814  17.891 -0.378  1.00 69.48  ? 157 MET A CB    1 
ATOM   1869 C  CG    . MET C 3 157 ? 34.647  19.308 0.137   1.00 71.69  ? 157 MET A CG    1 
ATOM   1870 S  SD    . MET C 3 157 ? 36.168  20.261 0.024   1.00 73.82  ? 157 MET A SD    1 
ATOM   1871 C  CE    . MET C 3 157 ? 37.133  19.390 1.209   1.00 75.64  ? 157 MET A CE    1 
ATOM   1872 N  N     . ALA C 3 158 ? 34.324  14.728 0.070   1.00 69.84  ? 158 ALA A N     1 
ATOM   1873 C  CA    . ALA C 3 158 ? 34.614  13.371 -0.370  1.00 69.45  ? 158 ALA A CA    1 
ATOM   1874 C  C     . ALA C 3 158 ? 33.431  12.424 -0.473  1.00 69.74  ? 158 ALA A C     1 
ATOM   1875 O  O     . ALA C 3 158 ? 33.355  11.640 -1.417  1.00 70.45  ? 158 ALA A O     1 
ATOM   1876 C  CB    . ALA C 3 158 ? 35.667  12.753 0.527   1.00 70.39  ? 158 ALA A CB    1 
ATOM   1877 N  N     . LYS C 3 159 ? 32.514  12.469 0.488   1.00 69.50  ? 159 LYS A N     1 
ATOM   1878 C  CA    . LYS C 3 159 ? 31.376  11.553 0.443   1.00 68.05  ? 159 LYS A CA    1 
ATOM   1879 C  C     . LYS C 3 159 ? 30.678  11.526 -0.924  1.00 67.20  ? 159 LYS A C     1 
ATOM   1880 O  O     . LYS C 3 159 ? 30.675  12.521 -1.654  1.00 66.83  ? 159 LYS A O     1 
ATOM   1881 C  CB    . LYS C 3 159 ? 30.363  11.874 1.549   1.00 67.49  ? 159 LYS A CB    1 
ATOM   1882 C  CG    . LYS C 3 159 ? 29.753  13.264 1.520   1.00 65.93  ? 159 LYS A CG    1 
ATOM   1883 C  CD    . LYS C 3 159 ? 28.643  13.366 2.575   1.00 64.28  ? 159 LYS A CD    1 
ATOM   1884 C  CE    . LYS C 3 159 ? 29.130  12.860 3.932   1.00 63.01  ? 159 LYS A CE    1 
ATOM   1885 N  NZ    . LYS C 3 159 ? 28.155  13.042 5.039   1.00 61.96  ? 159 LYS A NZ    1 
ATOM   1886 N  N     . PRO C 3 160 ? 30.094  10.371 -1.289  1.00 65.87  ? 160 PRO A N     1 
ATOM   1887 C  CA    . PRO C 3 160 ? 30.080  9.149  -0.479  1.00 65.29  ? 160 PRO A CA    1 
ATOM   1888 C  C     . PRO C 3 160 ? 31.315  8.272  -0.619  1.00 64.41  ? 160 PRO A C     1 
ATOM   1889 O  O     . PRO C 3 160 ? 32.130  8.480  -1.508  1.00 62.52  ? 160 PRO A O     1 
ATOM   1890 C  CB    . PRO C 3 160 ? 28.826  8.446  -0.960  1.00 65.70  ? 160 PRO A CB    1 
ATOM   1891 C  CG    . PRO C 3 160 ? 28.813  8.787  -2.386  1.00 65.85  ? 160 PRO A CG    1 
ATOM   1892 C  CD    . PRO C 3 160 ? 29.116  10.263 -2.380  1.00 65.59  ? 160 PRO A CD    1 
ATOM   1893 N  N     . ASN C 3 161 ? 31.424  7.293  0.276   1.00 66.27  ? 161 ASN A N     1 
ATOM   1894 C  CA    . ASN C 3 161 ? 32.533  6.339  0.323   1.00 69.00  ? 161 ASN A CA    1 
ATOM   1895 C  C     . ASN C 3 161 ? 33.819  6.930  -0.210  1.00 70.96  ? 161 ASN A C     1 
ATOM   1896 O  O     . ASN C 3 161 ? 34.430  6.358  -1.102  1.00 73.00  ? 161 ASN A O     1 
ATOM   1897 C  CB    . ASN C 3 161 ? 32.210  5.084  -0.489  1.00 68.30  ? 161 ASN A CB    1 
ATOM   1898 C  CG    . ASN C 3 161 ? 33.148  3.926  -0.180  1.00 68.16  ? 161 ASN A CG    1 
ATOM   1899 O  OD1   . ASN C 3 161 ? 34.066  4.041  0.629   1.00 67.60  ? 161 ASN A OD1   1 
ATOM   1900 N  ND2   . ASN C 3 161 ? 32.907  2.794  -0.824  1.00 70.57  ? 161 ASN A ND2   1 
ATOM   1901 N  N     . GLY C 3 162 ? 34.226  8.072  0.334   1.00 72.53  ? 162 GLY A N     1 
ATOM   1902 C  CA    . GLY C 3 162 ? 35.445  8.713  -0.121  1.00 72.43  ? 162 GLY A CA    1 
ATOM   1903 C  C     . GLY C 3 162 ? 36.393  9.009  1.018   1.00 72.98  ? 162 GLY A C     1 
ATOM   1904 O  O     . GLY C 3 162 ? 36.162  8.605  2.161   1.00 74.03  ? 162 GLY A O     1 
ATOM   1905 N  N     . ILE C 3 163 ? 37.480  9.702  0.697   1.00 72.38  ? 163 ILE A N     1 
ATOM   1906 C  CA    . ILE C 3 163 ? 38.484  10.090 1.684   1.00 71.40  ? 163 ILE A CA    1 
ATOM   1907 C  C     . ILE C 3 163 ? 39.200  11.319 1.139   1.00 70.45  ? 163 ILE A C     1 
ATOM   1908 O  O     . ILE C 3 163 ? 39.395  11.447 -0.065  1.00 70.74  ? 163 ILE A O     1 
ATOM   1909 C  CB    . ILE C 3 163 ? 39.498  8.951  1.959   1.00 69.97  ? 163 ILE A CB    1 
ATOM   1910 C  CG1   . ILE C 3 163 ? 40.600  9.456  2.896   1.00 68.78  ? 163 ILE A CG1   1 
ATOM   1911 C  CG2   . ILE C 3 163 ? 40.056  8.425  0.651   1.00 69.65  ? 163 ILE A CG2   1 
ATOM   1912 C  CD1   . ILE C 3 163 ? 41.535  8.369  3.405   1.00 69.33  ? 163 ILE A CD1   1 
ATOM   1913 N  N     . LYS C 3 164 ? 39.561  12.241 2.015   1.00 69.07  ? 164 LYS A N     1 
ATOM   1914 C  CA    . LYS C 3 164 ? 40.222  13.427 1.540   1.00 69.46  ? 164 LYS A CA    1 
ATOM   1915 C  C     . LYS C 3 164 ? 40.972  14.228 2.593   1.00 70.81  ? 164 LYS A C     1 
ATOM   1916 O  O     . LYS C 3 164 ? 40.633  14.235 3.785   1.00 70.80  ? 164 LYS A O     1 
ATOM   1917 C  CB    . LYS C 3 164 ? 39.221  14.328 0.822   1.00 69.37  ? 164 LYS A CB    1 
ATOM   1918 C  CG    . LYS C 3 164 ? 39.760  15.731 0.602   1.00 71.78  ? 164 LYS A CG    1 
ATOM   1919 C  CD    . LYS C 3 164 ? 38.938  16.538 -0.375  1.00 72.76  ? 164 LYS A CD    1 
ATOM   1920 C  CE    . LYS C 3 164 ? 39.597  17.888 -0.614  1.00 74.45  ? 164 LYS A CE    1 
ATOM   1921 N  NZ    . LYS C 3 164 ? 41.026  17.740 -1.023  1.00 76.33  ? 164 LYS A NZ    1 
ATOM   1922 N  N     . VAL C 3 165 ? 42.017  14.898 2.117   1.00 71.25  ? 165 VAL A N     1 
ATOM   1923 C  CA    . VAL C 3 165 ? 42.858  15.724 2.949   1.00 69.95  ? 165 VAL A CA    1 
ATOM   1924 C  C     . VAL C 3 165 ? 42.771  17.155 2.447   1.00 70.24  ? 165 VAL A C     1 
ATOM   1925 O  O     . VAL C 3 165 ? 42.558  17.405 1.261   1.00 68.10  ? 165 VAL A O     1 
ATOM   1926 C  CB    . VAL C 3 165 ? 44.333  15.259 2.898   1.00 69.26  ? 165 VAL A CB    1 
ATOM   1927 C  CG1   . VAL C 3 165 ? 45.181  16.152 3.777   1.00 70.21  ? 165 VAL A CG1   1 
ATOM   1928 C  CG2   . VAL C 3 165 ? 44.449  13.821 3.363   1.00 68.39  ? 165 VAL A CG2   1 
ATOM   1929 N  N     . ILE C 3 166 ? 42.906  18.087 3.382   1.00 71.85  ? 166 ILE A N     1 
ATOM   1930 C  CA    . ILE C 3 166 ? 42.881  19.516 3.096   1.00 71.83  ? 166 ILE A CA    1 
ATOM   1931 C  C     . ILE C 3 166 ? 44.087  20.073 3.833   1.00 73.22  ? 166 ILE A C     1 
ATOM   1932 O  O     . ILE C 3 166 ? 43.985  20.461 5.000   1.00 73.17  ? 166 ILE A O     1 
ATOM   1933 C  CB    . ILE C 3 166 ? 41.620  20.194 3.651   1.00 69.46  ? 166 ILE A CB    1 
ATOM   1934 C  CG1   . ILE C 3 166 ? 40.411  19.838 2.791   1.00 69.20  ? 166 ILE A CG1   1 
ATOM   1935 C  CG2   . ILE C 3 166 ? 41.808  21.683 3.684   1.00 68.10  ? 166 ILE A CG2   1 
ATOM   1936 C  CD1   . ILE C 3 166 ? 39.103  20.410 3.327   1.00 69.06  ? 166 ILE A CD1   1 
ATOM   1937 N  N     . ASP C 3 167 ? 45.229  20.081 3.149   1.00 74.23  ? 167 ASP A N     1 
ATOM   1938 C  CA    . ASP C 3 167 ? 46.475  20.575 3.723   1.00 73.80  ? 167 ASP A CA    1 
ATOM   1939 C  C     . ASP C 3 167 ? 46.424  22.074 3.992   1.00 74.51  ? 167 ASP A C     1 
ATOM   1940 O  O     . ASP C 3 167 ? 45.576  22.798 3.454   1.00 72.84  ? 167 ASP A O     1 
ATOM   1941 C  CB    . ASP C 3 167 ? 47.659  20.245 2.804   1.00 72.16  ? 167 ASP A CB    1 
ATOM   1942 C  CG    . ASP C 3 167 ? 47.507  20.845 1.414   1.00 71.13  ? 167 ASP A CG    1 
ATOM   1943 O  OD1   . ASP C 3 167 ? 47.373  22.082 1.320   1.00 70.43  ? 167 ASP A OD1   1 
ATOM   1944 O  OD2   . ASP C 3 167 ? 47.525  20.083 0.417   1.00 70.98  ? 167 ASP A OD2   1 
ATOM   1945 N  N     . ASP C 3 168 ? 47.345  22.513 4.842   1.00 75.63  ? 168 ASP A N     1 
ATOM   1946 C  CA    . ASP C 3 168 ? 47.473  23.901 5.259   1.00 77.24  ? 168 ASP A CA    1 
ATOM   1947 C  C     . ASP C 3 168 ? 47.331  24.901 4.118   1.00 78.09  ? 168 ASP A C     1 
ATOM   1948 O  O     . ASP C 3 168 ? 46.795  26.000 4.290   1.00 77.43  ? 168 ASP A O     1 
ATOM   1949 C  CB    . ASP C 3 168 ? 48.820  24.075 5.948   1.00 78.37  ? 168 ASP A CB    1 
ATOM   1950 C  CG    . ASP C 3 168 ? 48.901  23.310 7.260   1.00 80.46  ? 168 ASP A CG    1 
ATOM   1951 O  OD1   . ASP C 3 168 ? 48.251  22.247 7.379   1.00 82.80  ? 168 ASP A OD1   1 
ATOM   1952 O  OD2   . ASP C 3 168 ? 49.617  23.764 8.176   1.00 81.51  ? 168 ASP A OD2   1 
ATOM   1953 N  N     . GLU C 3 169 ? 47.804  24.499 2.949   1.00 79.32  ? 169 GLU A N     1 
ATOM   1954 C  CA    . GLU C 3 169 ? 47.760  25.330 1.758   1.00 81.38  ? 169 GLU A CA    1 
ATOM   1955 C  C     . GLU C 3 169 ? 46.363  25.460 1.133   1.00 81.28  ? 169 GLU A C     1 
ATOM   1956 O  O     . GLU C 3 169 ? 45.999  26.514 0.606   1.00 80.72  ? 169 GLU A O     1 
ATOM   1957 C  CB    . GLU C 3 169 ? 48.732  24.753 0.755   1.00 83.53  ? 169 GLU A CB    1 
ATOM   1958 C  CG    . GLU C 3 169 ? 48.922  25.574 -0.456  1.00 88.03  ? 169 GLU A CG    1 
ATOM   1959 C  CD    . GLU C 3 169 ? 50.109  25.078 -1.230  1.00 91.69  ? 169 GLU A CD    1 
ATOM   1960 O  OE1   . GLU C 3 169 ? 50.070  23.903 -1.674  1.00 92.38  ? 169 GLU A OE1   1 
ATOM   1961 O  OE2   . GLU C 3 169 ? 51.084  25.855 -1.376  1.00 93.51  ? 169 GLU A OE2   1 
ATOM   1962 N  N     . GLU C 3 170 ? 45.588  24.381 1.182   1.00 81.62  ? 170 GLU A N     1 
ATOM   1963 C  CA    . GLU C 3 170 ? 44.232  24.396 0.647   1.00 81.30  ? 170 GLU A CA    1 
ATOM   1964 C  C     . GLU C 3 170 ? 43.316  25.090 1.650   1.00 79.85  ? 170 GLU A C     1 
ATOM   1965 O  O     . GLU C 3 170 ? 42.317  25.703 1.269   1.00 78.73  ? 170 GLU A O     1 
ATOM   1966 C  CB    . GLU C 3 170 ? 43.741  22.976 0.385   1.00 82.41  ? 170 GLU A CB    1 
ATOM   1967 C  CG    . GLU C 3 170 ? 42.323  22.922 -0.131  1.00 84.18  ? 170 GLU A CG    1 
ATOM   1968 C  CD    . GLU C 3 170 ? 42.022  21.602 -0.782  1.00 85.74  ? 170 GLU A CD    1 
ATOM   1969 O  OE1   . GLU C 3 170 ? 42.646  20.594 -0.379  1.00 87.34  ? 170 GLU A OE1   1 
ATOM   1970 O  OE2   . GLU C 3 170 ? 41.163  21.567 -1.688  1.00 85.95  ? 170 GLU A OE2   1 
ATOM   1971 N  N     . VAL C 3 171 ? 43.657  24.977 2.931   1.00 77.89  ? 171 VAL A N     1 
ATOM   1972 C  CA    . VAL C 3 171 ? 42.889  25.640 3.969   1.00 77.23  ? 171 VAL A CA    1 
ATOM   1973 C  C     . VAL C 3 171 ? 42.948  27.134 3.654   1.00 78.68  ? 171 VAL A C     1 
ATOM   1974 O  O     . VAL C 3 171 ? 41.931  27.834 3.700   1.00 78.55  ? 171 VAL A O     1 
ATOM   1975 C  CB    . VAL C 3 171 ? 43.491  25.387 5.362   1.00 75.15  ? 171 VAL A CB    1 
ATOM   1976 C  CG1   . VAL C 3 171 ? 42.878  26.337 6.371   1.00 73.76  ? 171 VAL A CG1   1 
ATOM   1977 C  CG2   . VAL C 3 171 ? 43.237  23.960 5.775   1.00 74.03  ? 171 VAL A CG2   1 
ATOM   1978 N  N     . LYS C 3 172 ? 44.144  27.617 3.323   1.00 80.16  ? 172 LYS A N     1 
ATOM   1979 C  CA    . LYS C 3 172 ? 44.311  29.023 2.989   1.00 81.62  ? 172 LYS A CA    1 
ATOM   1980 C  C     . LYS C 3 172 ? 43.481  29.351 1.754   1.00 81.00  ? 172 LYS A C     1 
ATOM   1981 O  O     . LYS C 3 172 ? 42.840  30.392 1.703   1.00 80.88  ? 172 LYS A O     1 
ATOM   1982 C  CB    . LYS C 3 172 ? 45.791  29.362 2.747   1.00 83.37  ? 172 LYS A CB    1 
ATOM   1983 C  CG    . LYS C 3 172 ? 46.688  29.186 3.984   1.00 86.16  ? 172 LYS A CG    1 
ATOM   1984 C  CD    . LYS C 3 172 ? 48.073  29.831 3.819   1.00 87.30  ? 172 LYS A CD    1 
ATOM   1985 C  CE    . LYS C 3 172 ? 47.999  31.359 3.944   1.00 90.25  ? 172 LYS A CE    1 
ATOM   1986 N  NZ    . LYS C 3 172 ? 49.331  32.049 3.887   1.00 90.51  ? 172 LYS A NZ    1 
ATOM   1987 N  N     . ARG C 3 173 ? 43.474  28.461 0.766   1.00 81.38  ? 173 ARG A N     1 
ATOM   1988 C  CA    . ARG C 3 173 ? 42.690  28.698 -0.445  1.00 82.24  ? 173 ARG A CA    1 
ATOM   1989 C  C     . ARG C 3 173 ? 41.201  28.800 -0.092  1.00 82.11  ? 173 ARG A C     1 
ATOM   1990 O  O     . ARG C 3 173 ? 40.488  29.678 -0.596  1.00 82.87  ? 173 ARG A O     1 
ATOM   1991 C  CB    . ARG C 3 173 ? 42.905  27.566 -1.457  1.00 83.76  ? 173 ARG A CB    1 
ATOM   1992 C  CG    . ARG C 3 173 ? 42.169  27.765 -2.793  1.00 85.68  ? 173 ARG A CG    1 
ATOM   1993 C  CD    . ARG C 3 173 ? 42.438  26.611 -3.777  1.00 87.70  ? 173 ARG A CD    1 
ATOM   1994 N  NE    . ARG C 3 173 ? 41.849  25.351 -3.326  1.00 89.87  ? 173 ARG A NE    1 
ATOM   1995 C  CZ    . ARG C 3 173 ? 40.539  25.108 -3.304  1.00 91.09  ? 173 ARG A CZ    1 
ATOM   1996 N  NH1   . ARG C 3 173 ? 39.680  26.037 -3.717  1.00 89.92  ? 173 ARG A NH1   1 
ATOM   1997 N  NH2   . ARG C 3 173 ? 40.084  23.946 -2.845  1.00 90.95  ? 173 ARG A NH2   1 
ATOM   1998 N  N     . LEU C 3 174 ? 40.743  27.905 0.786   1.00 80.44  ? 174 LEU A N     1 
ATOM   1999 C  CA    . LEU C 3 174 ? 39.346  27.869 1.222   1.00 76.79  ? 174 LEU A CA    1 
ATOM   2000 C  C     . LEU C 3 174 ? 38.966  29.065 2.077   1.00 74.97  ? 174 LEU A C     1 
ATOM   2001 O  O     . LEU C 3 174 ? 37.859  29.586 1.960   1.00 75.35  ? 174 LEU A O     1 
ATOM   2002 C  CB    . LEU C 3 174 ? 39.067  26.577 1.992   1.00 75.59  ? 174 LEU A CB    1 
ATOM   2003 C  CG    . LEU C 3 174 ? 39.074  25.331 1.104   1.00 75.18  ? 174 LEU A CG    1 
ATOM   2004 C  CD1   . LEU C 3 174 ? 38.925  24.075 1.943   1.00 73.74  ? 174 LEU A CD1   1 
ATOM   2005 C  CD2   . LEU C 3 174 ? 37.952  25.455 0.084   1.00 74.79  ? 174 LEU A CD2   1 
ATOM   2006 N  N     . ILE C 3 175 ? 39.873  29.509 2.936   1.00 72.91  ? 175 ILE A N     1 
ATOM   2007 C  CA    . ILE C 3 175 ? 39.559  30.653 3.769   1.00 71.59  ? 175 ILE A CA    1 
ATOM   2008 C  C     . ILE C 3 175 ? 39.197  31.815 2.858   1.00 72.09  ? 175 ILE A C     1 
ATOM   2009 O  O     . ILE C 3 175 ? 38.513  32.757 3.270   1.00 72.59  ? 175 ILE A O     1 
ATOM   2010 C  CB    . ILE C 3 175 ? 40.743  31.018 4.681   1.00 70.51  ? 175 ILE A CB    1 
ATOM   2011 C  CG1   . ILE C 3 175 ? 40.948  29.891 5.694   1.00 70.62  ? 175 ILE A CG1   1 
ATOM   2012 C  CG2   . ILE C 3 175 ? 40.463  32.314 5.426   1.00 69.78  ? 175 ILE A CG2   1 
ATOM   2013 C  CD1   . ILE C 3 175 ? 42.008  30.152 6.715   1.00 69.87  ? 175 ILE A CD1   1 
ATOM   2014 N  N     . ARG C 3 176 ? 39.629  31.716 1.601   1.00 72.72  ? 176 ARG A N     1 
ATOM   2015 C  CA    . ARG C 3 176 ? 39.362  32.745 0.602   1.00 73.52  ? 176 ARG A CA    1 
ATOM   2016 C  C     . ARG C 3 176 ? 38.191  32.424 -0.324  1.00 73.98  ? 176 ARG A C     1 
ATOM   2017 O  O     . ARG C 3 176 ? 37.275  33.231 -0.492  1.00 73.39  ? 176 ARG A O     1 
ATOM   2018 C  CB    . ARG C 3 176 ? 40.614  32.989 -0.252  1.00 73.21  ? 176 ARG A CB    1 
ATOM   2019 C  CG    . ARG C 3 176 ? 41.454  34.189 0.185   1.00 72.80  ? 176 ARG A CG    1 
ATOM   2020 C  CD    . ARG C 3 176 ? 42.650  34.453 -0.743  1.00 72.33  ? 176 ARG A CD    1 
ATOM   2021 N  NE    . ARG C 3 176 ? 43.720  33.465 -0.601  1.00 72.92  ? 176 ARG A NE    1 
ATOM   2022 C  CZ    . ARG C 3 176 ? 43.986  32.501 -1.480  1.00 73.80  ? 176 ARG A CZ    1 
ATOM   2023 N  NH1   . ARG C 3 176 ? 43.257  32.385 -2.587  1.00 72.20  ? 176 ARG A NH1   1 
ATOM   2024 N  NH2   . ARG C 3 176 ? 44.984  31.647 -1.246  1.00 73.09  ? 176 ARG A NH2   1 
ATOM   2025 N  N     . GLU C 3 177 ? 38.210  31.233 -0.905  1.00 74.50  ? 177 GLU A N     1 
ATOM   2026 C  CA    . GLU C 3 177 ? 37.176  30.852 -1.856  1.00 75.62  ? 177 GLU A CA    1 
ATOM   2027 C  C     . GLU C 3 177 ? 35.925  30.106 -1.375  1.00 75.23  ? 177 GLU A C     1 
ATOM   2028 O  O     . GLU C 3 177 ? 34.867  30.249 -1.984  1.00 74.88  ? 177 GLU A O     1 
ATOM   2029 C  CB    . GLU C 3 177 ? 37.846  30.083 -2.991  1.00 76.80  ? 177 GLU A CB    1 
ATOM   2030 C  CG    . GLU C 3 177 ? 39.140  30.752 -3.423  1.00 80.30  ? 177 GLU A CG    1 
ATOM   2031 C  CD    . GLU C 3 177 ? 39.868  30.017 -4.534  1.00 82.59  ? 177 GLU A CD    1 
ATOM   2032 O  OE1   . GLU C 3 177 ? 39.802  28.764 -4.578  1.00 82.76  ? 177 GLU A OE1   1 
ATOM   2033 O  OE2   . GLU C 3 177 ? 40.527  30.704 -5.352  1.00 82.21  ? 177 GLU A OE2   1 
ATOM   2034 N  N     . LEU C 3 178 ? 36.029  29.327 -0.298  1.00 74.64  ? 178 LEU A N     1 
ATOM   2035 C  CA    . LEU C 3 178 ? 34.883  28.570 0.221   1.00 72.71  ? 178 LEU A CA    1 
ATOM   2036 C  C     . LEU C 3 178 ? 33.702  29.437 0.610   1.00 71.45  ? 178 LEU A C     1 
ATOM   2037 O  O     . LEU C 3 178 ? 33.837  30.345 1.438   1.00 70.57  ? 178 LEU A O     1 
ATOM   2038 C  CB    . LEU C 3 178 ? 35.287  27.743 1.442   1.00 73.65  ? 178 LEU A CB    1 
ATOM   2039 C  CG    . LEU C 3 178 ? 34.157  26.971 2.141   1.00 74.23  ? 178 LEU A CG    1 
ATOM   2040 C  CD1   . LEU C 3 178 ? 33.581  25.900 1.209   1.00 73.66  ? 178 LEU A CD1   1 
ATOM   2041 C  CD2   . LEU C 3 178 ? 34.695  26.328 3.402   1.00 73.74  ? 178 LEU A CD2   1 
ATOM   2042 N  N     . ASP C 3 179 ? 32.546  29.144 0.012   1.00 70.97  ? 179 ASP A N     1 
ATOM   2043 C  CA    . ASP C 3 179 ? 31.313  29.878 0.296   1.00 71.10  ? 179 ASP A CA    1 
ATOM   2044 C  C     . ASP C 3 179 ? 31.141  29.785 1.809   1.00 69.51  ? 179 ASP A C     1 
ATOM   2045 O  O     . ASP C 3 179 ? 31.243  28.696 2.376   1.00 68.75  ? 179 ASP A O     1 
ATOM   2046 C  CB    . ASP C 3 179 ? 30.116  29.223 -0.416  1.00 72.87  ? 179 ASP A CB    1 
ATOM   2047 C  CG    . ASP C 3 179 ? 28.830  30.066 -0.330  1.00 74.81  ? 179 ASP A CG    1 
ATOM   2048 O  OD1   . ASP C 3 179 ? 28.710  30.950 0.557   1.00 74.70  ? 179 ASP A OD1   1 
ATOM   2049 O  OD2   . ASP C 3 179 ? 27.924  29.827 -1.157  1.00 76.62  ? 179 ASP A OD2   1 
ATOM   2050 N  N     . ILE C 3 180 ? 30.874  30.913 2.461   1.00 67.32  ? 180 ILE A N     1 
ATOM   2051 C  CA    . ILE C 3 180 ? 30.750  30.907 3.908   1.00 66.26  ? 180 ILE A CA    1 
ATOM   2052 C  C     . ILE C 3 180 ? 29.574  30.115 4.453   1.00 66.41  ? 180 ILE A C     1 
ATOM   2053 O  O     . ILE C 3 180 ? 29.557  29.770 5.636   1.00 67.03  ? 180 ILE A O     1 
ATOM   2054 C  CB    . ILE C 3 180 ? 30.694  32.328 4.477   1.00 64.92  ? 180 ILE A CB    1 
ATOM   2055 C  CG1   . ILE C 3 180 ? 31.191  32.307 5.924   1.00 64.86  ? 180 ILE A CG1   1 
ATOM   2056 C  CG2   . ILE C 3 180 ? 29.291  32.862 4.409   1.00 63.84  ? 180 ILE A CG2   1 
ATOM   2057 C  CD1   . ILE C 3 180 ? 31.334  33.671 6.544   1.00 64.59  ? 180 ILE A CD1   1 
ATOM   2058 N  N     . ALA C 3 181 ? 28.603  29.814 3.599   1.00 65.58  ? 181 ALA A N     1 
ATOM   2059 C  CA    . ALA C 3 181 ? 27.431  29.057 4.025   1.00 65.69  ? 181 ALA A CA    1 
ATOM   2060 C  C     . ALA C 3 181 ? 27.722  27.564 4.142   1.00 65.71  ? 181 ALA A C     1 
ATOM   2061 O  O     . ALA C 3 181 ? 26.914  26.803 4.681   1.00 67.36  ? 181 ALA A O     1 
ATOM   2062 C  CB    . ALA C 3 181 ? 26.280  29.289 3.062   1.00 65.22  ? 181 ALA A CB    1 
ATOM   2063 N  N     . ASP C 3 182 ? 28.870  27.136 3.638   1.00 64.50  ? 182 ASP A N     1 
ATOM   2064 C  CA    . ASP C 3 182 ? 29.221  25.726 3.713   1.00 62.77  ? 182 ASP A CA    1 
ATOM   2065 C  C     . ASP C 3 182 ? 30.168  25.494 4.873   1.00 61.35  ? 182 ASP A C     1 
ATOM   2066 O  O     . ASP C 3 182 ? 30.878  24.491 4.935   1.00 60.95  ? 182 ASP A O     1 
ATOM   2067 C  CB    . ASP C 3 182 ? 29.857  25.261 2.400   1.00 65.74  ? 182 ASP A CB    1 
ATOM   2068 C  CG    . ASP C 3 182 ? 28.875  25.284 1.245   1.00 67.98  ? 182 ASP A CG    1 
ATOM   2069 O  OD1   . ASP C 3 182 ? 27.653  25.329 1.526   1.00 68.96  ? 182 ASP A OD1   1 
ATOM   2070 O  OD2   . ASP C 3 182 ? 29.318  25.240 0.070   1.00 67.97  ? 182 ASP A OD2   1 
ATOM   2071 N  N     . VAL C 3 183 ? 30.174  26.448 5.793   1.00 60.45  ? 183 VAL A N     1 
ATOM   2072 C  CA    . VAL C 3 183 ? 31.001  26.369 6.983   1.00 59.58  ? 183 VAL A CA    1 
ATOM   2073 C  C     . VAL C 3 183 ? 30.167  25.835 8.129   1.00 57.80  ? 183 VAL A C     1 
ATOM   2074 O  O     . VAL C 3 183 ? 29.196  26.477 8.538   1.00 58.37  ? 183 VAL A O     1 
ATOM   2075 C  CB    . VAL C 3 183 ? 31.517  27.742 7.388   1.00 60.54  ? 183 VAL A CB    1 
ATOM   2076 C  CG1   . VAL C 3 183 ? 32.119  27.681 8.801   1.00 61.09  ? 183 VAL A CG1   1 
ATOM   2077 C  CG2   . VAL C 3 183 ? 32.545  28.208 6.369   1.00 61.70  ? 183 VAL A CG2   1 
ATOM   2078 N  N     . PRO C 3 184 ? 30.533  24.653 8.663   1.00 57.25  ? 184 PRO A N     1 
ATOM   2079 C  CA    . PRO C 3 184 ? 29.812  24.029 9.775   1.00 54.67  ? 184 PRO A CA    1 
ATOM   2080 C  C     . PRO C 3 184 ? 29.426  25.050 10.830  1.00 54.07  ? 184 PRO A C     1 
ATOM   2081 O  O     . PRO C 3 184 ? 30.278  25.768 11.354  1.00 52.59  ? 184 PRO A O     1 
ATOM   2082 C  CB    . PRO C 3 184 ? 30.807  23.004 10.288  1.00 54.75  ? 184 PRO A CB    1 
ATOM   2083 C  CG    . PRO C 3 184 ? 31.438  22.519 9.014   1.00 56.04  ? 184 PRO A CG    1 
ATOM   2084 C  CD    . PRO C 3 184 ? 31.686  23.824 8.262   1.00 57.63  ? 184 PRO A CD    1 
ATOM   2085 N  N     . GLY C 3 185 ? 28.131  25.135 11.108  1.00 53.40  ? 185 GLY A N     1 
ATOM   2086 C  CA    . GLY C 3 185 ? 27.661  26.070 12.102  1.00 55.28  ? 185 GLY A CA    1 
ATOM   2087 C  C     . GLY C 3 185 ? 26.926  27.250 11.515  1.00 57.09  ? 185 GLY A C     1 
ATOM   2088 O  O     . GLY C 3 185 ? 26.343  28.057 12.247  1.00 57.16  ? 185 GLY A O     1 
ATOM   2089 N  N     . ILE C 3 186 ? 26.946  27.361 10.194  1.00 58.51  ? 186 ILE A N     1 
ATOM   2090 C  CA    . ILE C 3 186 ? 26.271  28.473 9.546   1.00 60.91  ? 186 ILE A CA    1 
ATOM   2091 C  C     . ILE C 3 186 ? 24.964  28.061 8.880   1.00 63.35  ? 186 ILE A C     1 
ATOM   2092 O  O     . ILE C 3 186 ? 24.930  27.619 7.724   1.00 64.25  ? 186 ILE A O     1 
ATOM   2093 C  CB    . ILE C 3 186 ? 27.201  29.146 8.535   1.00 58.99  ? 186 ILE A CB    1 
ATOM   2094 C  CG1   . ILE C 3 186 ? 28.522  29.483 9.228   1.00 58.67  ? 186 ILE A CG1   1 
ATOM   2095 C  CG2   . ILE C 3 186 ? 26.566  30.407 8.005   1.00 56.66  ? 186 ILE A CG2   1 
ATOM   2096 C  CD1   . ILE C 3 186 ? 28.351  30.309 10.504  1.00 56.40  ? 186 ILE A CD1   1 
ATOM   2097 N  N     . GLY C 3 187 ? 23.884  28.216 9.637   1.00 65.22  ? 187 GLY A N     1 
ATOM   2098 C  CA    . GLY C 3 187 ? 22.573  27.851 9.148   1.00 67.54  ? 187 GLY A CA    1 
ATOM   2099 C  C     . GLY C 3 187 ? 22.030  28.869 8.182   1.00 69.81  ? 187 GLY A C     1 
ATOM   2100 O  O     . GLY C 3 187 ? 22.682  29.872 7.880   1.00 69.17  ? 187 GLY A O     1 
ATOM   2101 N  N     . ASN C 3 188 ? 20.823  28.605 7.696   1.00 71.82  ? 188 ASN A N     1 
ATOM   2102 C  CA    . ASN C 3 188 ? 20.183  29.498 6.751   1.00 72.18  ? 188 ASN A CA    1 
ATOM   2103 C  C     . ASN C 3 188 ? 20.031  30.894 7.325   1.00 71.44  ? 188 ASN A C     1 
ATOM   2104 O  O     . ASN C 3 188 ? 20.477  31.867 6.722   1.00 71.71  ? 188 ASN A O     1 
ATOM   2105 C  CB    . ASN C 3 188 ? 18.826  28.937 6.341   1.00 73.52  ? 188 ASN A CB    1 
ATOM   2106 C  CG    . ASN C 3 188 ? 18.928  27.973 5.173   1.00 75.82  ? 188 ASN A CG    1 
ATOM   2107 O  OD1   . ASN C 3 188 ? 17.913  27.523 4.638   1.00 77.52  ? 188 ASN A OD1   1 
ATOM   2108 N  ND2   . ASN C 3 188 ? 20.155  27.659 4.761   1.00 75.18  ? 188 ASN A ND2   1 
ATOM   2109 N  N     . ILE C 3 189 ? 19.421  30.989 8.499   1.00 70.22  ? 189 ILE A N     1 
ATOM   2110 C  CA    . ILE C 3 189 ? 19.214  32.278 9.133   1.00 70.26  ? 189 ILE A CA    1 
ATOM   2111 C  C     . ILE C 3 189 ? 20.488  33.101 9.279   1.00 71.42  ? 189 ILE A C     1 
ATOM   2112 O  O     . ILE C 3 189 ? 20.458  34.324 9.149   1.00 71.98  ? 189 ILE A O     1 
ATOM   2113 C  CB    . ILE C 3 189 ? 18.554  32.115 10.512  1.00 68.53  ? 189 ILE A CB    1 
ATOM   2114 C  CG1   . ILE C 3 189 ? 17.132  31.589 10.329  1.00 68.68  ? 189 ILE A CG1   1 
ATOM   2115 C  CG2   . ILE C 3 189 ? 18.505  33.440 11.240  1.00 65.72  ? 189 ILE A CG2   1 
ATOM   2116 C  CD1   . ILE C 3 189 ? 16.366  31.457 11.619  1.00 70.38  ? 189 ILE A CD1   1 
ATOM   2117 N  N     . THR C 3 190 ? 21.609  32.447 9.553   1.00 72.56  ? 190 THR A N     1 
ATOM   2118 C  CA    . THR C 3 190 ? 22.861  33.180 9.707   1.00 72.76  ? 190 THR A CA    1 
ATOM   2119 C  C     . THR C 3 190 ? 23.473  33.481 8.342   1.00 73.04  ? 190 THR A C     1 
ATOM   2120 O  O     . THR C 3 190 ? 23.912  34.603 8.096   1.00 72.53  ? 190 THR A O     1 
ATOM   2121 C  CB    . THR C 3 190 ? 23.875  32.391 10.580  1.00 72.84  ? 190 THR A CB    1 
ATOM   2122 O  OG1   . THR C 3 190 ? 23.322  32.189 11.887  1.00 71.67  ? 190 THR A OG1   1 
ATOM   2123 C  CG2   . THR C 3 190 ? 25.195  33.156 10.706  1.00 72.61  ? 190 THR A CG2   1 
ATOM   2124 N  N     . ALA C 3 191 ? 23.487  32.482 7.459   1.00 73.81  ? 191 ALA A N     1 
ATOM   2125 C  CA    . ALA C 3 191 ? 24.041  32.634 6.116   1.00 75.31  ? 191 ALA A CA    1 
ATOM   2126 C  C     . ALA C 3 191 ? 23.483  33.899 5.481   1.00 77.97  ? 191 ALA A C     1 
ATOM   2127 O  O     . ALA C 3 191 ? 24.190  34.624 4.775   1.00 78.21  ? 191 ALA A O     1 
ATOM   2128 C  CB    . ALA C 3 191 ? 23.677  31.428 5.264   1.00 74.19  ? 191 ALA A CB    1 
ATOM   2129 N  N     . GLU C 3 192 ? 22.203  34.153 5.748   1.00 80.53  ? 192 GLU A N     1 
ATOM   2130 C  CA    . GLU C 3 192 ? 21.512  35.320 5.219   1.00 81.76  ? 192 GLU A CA    1 
ATOM   2131 C  C     . GLU C 3 192 ? 22.061  36.573 5.862   1.00 82.07  ? 192 GLU A C     1 
ATOM   2132 O  O     . GLU C 3 192 ? 22.487  37.495 5.172   1.00 84.41  ? 192 GLU A O     1 
ATOM   2133 C  CB    . GLU C 3 192 ? 20.011  35.234 5.495   1.00 82.53  ? 192 GLU A CB    1 
ATOM   2134 C  CG    . GLU C 3 192 ? 19.209  36.334 4.824   1.00 83.99  ? 192 GLU A CG    1 
ATOM   2135 C  CD    . GLU C 3 192 ? 19.495  36.440 3.332   1.00 85.64  ? 192 GLU A CD    1 
ATOM   2136 O  OE1   . GLU C 3 192 ? 19.386  35.415 2.619   1.00 84.90  ? 192 GLU A OE1   1 
ATOM   2137 O  OE2   . GLU C 3 192 ? 19.827  37.557 2.875   1.00 86.80  ? 192 GLU A OE2   1 
ATOM   2138 N  N     . LYS C 3 193 ? 22.055  36.612 7.185   1.00 82.02  ? 193 LYS A N     1 
ATOM   2139 C  CA    . LYS C 3 193 ? 22.566  37.777 7.876   1.00 83.14  ? 193 LYS A CA    1 
ATOM   2140 C  C     . LYS C 3 193 ? 23.961  38.134 7.357   1.00 84.74  ? 193 LYS A C     1 
ATOM   2141 O  O     . LYS C 3 193 ? 24.354  39.309 7.359   1.00 84.82  ? 193 LYS A O     1 
ATOM   2142 C  CB    . LYS C 3 193 ? 22.606  37.520 9.384   1.00 81.99  ? 193 LYS A CB    1 
ATOM   2143 C  CG    . LYS C 3 193 ? 21.236  37.414 10.045  1.00 80.30  ? 193 LYS A CG    1 
ATOM   2144 C  CD    . LYS C 3 193 ? 21.380  37.136 11.540  1.00 80.48  ? 193 LYS A CD    1 
ATOM   2145 C  CE    . LYS C 3 193 ? 20.040  37.160 12.279  1.00 79.41  ? 193 LYS A CE    1 
ATOM   2146 N  NZ    . LYS C 3 193 ? 20.174  36.757 13.716  1.00 75.91  ? 193 LYS A NZ    1 
ATOM   2147 N  N     . LEU C 3 194 ? 24.707  37.126 6.906   1.00 85.10  ? 194 LEU A N     1 
ATOM   2148 C  CA    . LEU C 3 194 ? 26.047  37.378 6.392   1.00 86.68  ? 194 LEU A CA    1 
ATOM   2149 C  C     . LEU C 3 194 ? 25.986  37.939 4.978   1.00 88.75  ? 194 LEU A C     1 
ATOM   2150 O  O     . LEU C 3 194 ? 26.657  38.925 4.676   1.00 88.97  ? 194 LEU A O     1 
ATOM   2151 C  CB    . LEU C 3 194 ? 26.905  36.106 6.428   1.00 85.05  ? 194 LEU A CB    1 
ATOM   2152 C  CG    . LEU C 3 194 ? 27.331  35.585 7.813   1.00 84.03  ? 194 LEU A CG    1 
ATOM   2153 C  CD1   . LEU C 3 194 ? 28.274  34.414 7.619   1.00 83.25  ? 194 LEU A CD1   1 
ATOM   2154 C  CD2   . LEU C 3 194 ? 28.012  36.672 8.637   1.00 81.60  ? 194 LEU A CD2   1 
ATOM   2155 N  N     . LYS C 3 195 ? 25.177  37.321 4.119   1.00 90.54  ? 195 LYS A N     1 
ATOM   2156 C  CA    . LYS C 3 195 ? 25.017  37.788 2.739   1.00 91.62  ? 195 LYS A CA    1 
ATOM   2157 C  C     . LYS C 3 195 ? 24.502  39.234 2.774   1.00 92.05  ? 195 LYS A C     1 
ATOM   2158 O  O     . LYS C 3 195 ? 24.717  40.017 1.837   1.00 91.78  ? 195 LYS A O     1 
ATOM   2159 C  CB    . LYS C 3 195 ? 24.014  36.896 1.993   1.00 92.63  ? 195 LYS A CB    1 
ATOM   2160 C  CG    . LYS C 3 195 ? 23.757  37.292 0.541   1.00 94.75  ? 195 LYS A CG    1 
ATOM   2161 C  CD    . LYS C 3 195 ? 22.806  36.304 -0.148  1.00 96.44  ? 195 LYS A CD    1 
ATOM   2162 C  CE    . LYS C 3 195 ? 22.649  36.594 -1.646  1.00 97.34  ? 195 LYS A CE    1 
ATOM   2163 N  NZ    . LYS C 3 195 ? 21.851  35.553 -2.376  1.00 97.32  ? 195 LYS A NZ    1 
ATOM   2164 N  N     . LYS C 3 196 ? 23.836  39.571 3.878   1.00 91.41  ? 196 LYS A N     1 
ATOM   2165 C  CA    . LYS C 3 196 ? 23.258  40.894 4.091   1.00 90.41  ? 196 LYS A CA    1 
ATOM   2166 C  C     . LYS C 3 196 ? 24.294  41.848 4.668   1.00 89.06  ? 196 LYS A C     1 
ATOM   2167 O  O     . LYS C 3 196 ? 23.960  42.917 5.182   1.00 87.82  ? 196 LYS A O     1 
ATOM   2168 C  CB    . LYS C 3 196 ? 22.061  40.781 5.039   1.00 91.32  ? 196 LYS A CB    1 
ATOM   2169 C  CG    . LYS C 3 196 ? 20.955  41.785 4.778   1.00 92.54  ? 196 LYS A CG    1 
ATOM   2170 C  CD    . LYS C 3 196 ? 19.647  41.315 5.390   1.00 93.03  ? 196 LYS A CD    1 
ATOM   2171 C  CE    . LYS C 3 196 ? 18.483  41.563 4.442   1.00 93.99  ? 196 LYS A CE    1 
ATOM   2172 N  NZ    . LYS C 3 196 ? 17.220  40.966 4.959   1.00 95.31  ? 196 LYS A NZ    1 
ATOM   2173 N  N     . LEU C 3 197 ? 25.553  41.435 4.579   1.00 88.25  ? 197 LEU A N     1 
ATOM   2174 C  CA    . LEU C 3 197 ? 26.681  42.217 5.064   1.00 87.33  ? 197 LEU A CA    1 
ATOM   2175 C  C     . LEU C 3 197 ? 27.789  42.051 4.040   1.00 85.33  ? 197 LEU A C     1 
ATOM   2176 O  O     . LEU C 3 197 ? 28.921  42.480 4.244   1.00 83.61  ? 197 LEU A O     1 
ATOM   2177 C  CB    . LEU C 3 197 ? 27.143  41.699 6.430   1.00 90.19  ? 197 LEU A CB    1 
ATOM   2178 C  CG    . LEU C 3 197 ? 26.190  41.845 7.624   1.00 92.48  ? 197 LEU A CG    1 
ATOM   2179 C  CD1   . LEU C 3 197 ? 26.851  41.280 8.880   1.00 94.17  ? 197 LEU A CD1   1 
ATOM   2180 C  CD2   . LEU C 3 197 ? 25.846  43.318 7.833   1.00 93.30  ? 197 LEU A CD2   1 
ATOM   2181 N  N     . GLY C 3 198 ? 27.434  41.403 2.936   1.00 84.24  ? 198 GLY A N     1 
ATOM   2182 C  CA    . GLY C 3 198 ? 28.376  41.166 1.859   1.00 83.51  ? 198 GLY A CA    1 
ATOM   2183 C  C     . GLY C 3 198 ? 29.450  40.155 2.198   1.00 82.73  ? 198 GLY A C     1 
ATOM   2184 O  O     . GLY C 3 198 ? 30.502  40.112 1.557   1.00 83.17  ? 198 GLY A O     1 
ATOM   2185 N  N     . ILE C 3 199 ? 29.191  39.342 3.215   1.00 81.88  ? 199 ILE A N     1 
ATOM   2186 C  CA    . ILE C 3 199 ? 30.142  38.329 3.632   1.00 79.39  ? 199 ILE A CA    1 
ATOM   2187 C  C     . ILE C 3 199 ? 29.736  37.019 2.993   1.00 78.96  ? 199 ILE A C     1 
ATOM   2188 O  O     . ILE C 3 199 ? 28.658  36.501 3.258   1.00 79.21  ? 199 ILE A O     1 
ATOM   2189 C  CB    . ILE C 3 199 ? 30.159  38.198 5.156   1.00 77.96  ? 199 ILE A CB    1 
ATOM   2190 C  CG1   . ILE C 3 199 ? 30.604  39.530 5.769   1.00 77.45  ? 199 ILE A CG1   1 
ATOM   2191 C  CG2   . ILE C 3 199 ? 31.089  37.087 5.567   1.00 79.18  ? 199 ILE A CG2   1 
ATOM   2192 C  CD1   . ILE C 3 199 ? 30.772  39.518 7.276   1.00 75.88  ? 199 ILE A CD1   1 
ATOM   2193 N  N     . ASN C 3 200 ? 30.604  36.504 2.132   1.00 79.64  ? 200 ASN A N     1 
ATOM   2194 C  CA    . ASN C 3 200 ? 30.356  35.257 1.418   1.00 81.51  ? 200 ASN A CA    1 
ATOM   2195 C  C     . ASN C 3 200 ? 31.545  34.309 1.604   1.00 82.38  ? 200 ASN A C     1 
ATOM   2196 O  O     . ASN C 3 200 ? 31.444  33.109 1.332   1.00 84.18  ? 200 ASN A O     1 
ATOM   2197 C  CB    . ASN C 3 200 ? 30.166  35.526 -0.083  1.00 83.98  ? 200 ASN A CB    1 
ATOM   2198 C  CG    . ASN C 3 200 ? 29.194  36.674 -0.367  1.00 86.83  ? 200 ASN A CG    1 
ATOM   2199 O  OD1   . ASN C 3 200 ? 27.985  36.556 -0.139  1.00 88.63  ? 200 ASN A OD1   1 
ATOM   2200 N  ND2   . ASN C 3 200 ? 29.725  37.794 -0.871  1.00 85.96  ? 200 ASN A ND2   1 
ATOM   2201 N  N     . LYS C 3 201 ? 32.674  34.847 2.056   1.00 81.07  ? 201 LYS A N     1 
ATOM   2202 C  CA    . LYS C 3 201 ? 33.866  34.038 2.272   1.00 79.15  ? 201 LYS A CA    1 
ATOM   2203 C  C     . LYS C 3 201 ? 34.371  34.279 3.680   1.00 78.50  ? 201 LYS A C     1 
ATOM   2204 O  O     . LYS C 3 201 ? 34.182  35.351 4.240   1.00 78.67  ? 201 LYS A O     1 
ATOM   2205 C  CB    . LYS C 3 201 ? 34.944  34.432 1.282   1.00 80.95  ? 201 LYS A CB    1 
ATOM   2206 C  CG    . LYS C 3 201 ? 34.449  34.496 -0.142  1.00 82.37  ? 201 LYS A CG    1 
ATOM   2207 C  CD    . LYS C 3 201 ? 34.121  33.121 -0.696  1.00 83.13  ? 201 LYS A CD    1 
ATOM   2208 C  CE    . LYS C 3 201 ? 33.554  33.233 -2.098  1.00 82.44  ? 201 LYS A CE    1 
ATOM   2209 N  NZ    . LYS C 3 201 ? 33.272  31.895 -2.681  1.00 83.60  ? 201 LYS A NZ    1 
ATOM   2210 N  N     . LEU C 3 202 ? 35.030  33.284 4.253   1.00 77.19  ? 202 LEU A N     1 
ATOM   2211 C  CA    . LEU C 3 202 ? 35.536  33.416 5.610   1.00 75.75  ? 202 LEU A CA    1 
ATOM   2212 C  C     . LEU C 3 202 ? 36.375  34.667 5.803   1.00 75.73  ? 202 LEU A C     1 
ATOM   2213 O  O     . LEU C 3 202 ? 36.203  35.398 6.779   1.00 73.62  ? 202 LEU A O     1 
ATOM   2214 C  CB    . LEU C 3 202 ? 36.337  32.169 5.984   1.00 74.39  ? 202 LEU A CB    1 
ATOM   2215 C  CG    . LEU C 3 202 ? 35.476  31.144 6.724   1.00 72.74  ? 202 LEU A CG    1 
ATOM   2216 C  CD1   . LEU C 3 202 ? 36.132  29.788 6.723   1.00 71.40  ? 202 LEU A CD1   1 
ATOM   2217 C  CD2   . LEU C 3 202 ? 35.243  31.638 8.139   1.00 72.33  ? 202 LEU A CD2   1 
ATOM   2218 N  N     . VAL C 3 203 ? 37.267  34.914 4.850   1.00 76.83  ? 203 VAL A N     1 
ATOM   2219 C  CA    . VAL C 3 203 ? 38.155  36.069 4.897   1.00 77.61  ? 203 VAL A CA    1 
ATOM   2220 C  C     . VAL C 3 203 ? 37.398  37.387 5.063   1.00 77.14  ? 203 VAL A C     1 
ATOM   2221 O  O     . VAL C 3 203 ? 37.827  38.267 5.808   1.00 76.37  ? 203 VAL A O     1 
ATOM   2222 C  CB    . VAL C 3 203 ? 39.040  36.125 3.618   1.00 78.97  ? 203 VAL A CB    1 
ATOM   2223 C  CG1   . VAL C 3 203 ? 38.163  36.204 2.366   1.00 78.48  ? 203 VAL A CG1   1 
ATOM   2224 C  CG2   . VAL C 3 203 ? 40.001  37.294 3.703   1.00 78.20  ? 203 VAL A CG2   1 
ATOM   2225 N  N     . ASP C 3 204 ? 36.264  37.515 4.384   1.00 77.32  ? 204 ASP A N     1 
ATOM   2226 C  CA    . ASP C 3 204 ? 35.481  38.741 4.468   1.00 78.24  ? 204 ASP A CA    1 
ATOM   2227 C  C     . ASP C 3 204 ? 35.138  39.156 5.895   1.00 77.35  ? 204 ASP A C     1 
ATOM   2228 O  O     . ASP C 3 204 ? 34.713  40.285 6.111   1.00 77.20  ? 204 ASP A O     1 
ATOM   2229 C  CB    . ASP C 3 204 ? 34.179  38.625 3.663   1.00 80.39  ? 204 ASP A CB    1 
ATOM   2230 C  CG    . ASP C 3 204 ? 34.415  38.283 2.198   1.00 82.94  ? 204 ASP A CG    1 
ATOM   2231 O  OD1   . ASP C 3 204 ? 35.368  38.819 1.588   1.00 84.65  ? 204 ASP A OD1   1 
ATOM   2232 O  OD2   . ASP C 3 204 ? 33.632  37.483 1.644   1.00 84.78  ? 204 ASP A OD2   1 
ATOM   2233 N  N     . THR C 3 205 ? 35.319  38.263 6.867   1.00 77.20  ? 205 THR A N     1 
ATOM   2234 C  CA    . THR C 3 205 ? 34.990  38.602 8.256   1.00 76.84  ? 205 THR A CA    1 
ATOM   2235 C  C     . THR C 3 205 ? 36.089  39.381 8.970   1.00 76.70  ? 205 THR A C     1 
ATOM   2236 O  O     . THR C 3 205 ? 35.882  39.884 10.075  1.00 75.82  ? 205 THR A O     1 
ATOM   2237 C  CB    . THR C 3 205 ? 34.646  37.340 9.127   1.00 76.80  ? 205 THR A CB    1 
ATOM   2238 O  OG1   . THR C 3 205 ? 35.760  36.443 9.152   1.00 77.79  ? 205 THR A OG1   1 
ATOM   2239 C  CG2   . THR C 3 205 ? 33.426  36.608 8.580   1.00 75.57  ? 205 THR A CG2   1 
ATOM   2240 N  N     . LEU C 3 206 ? 37.252  39.486 8.337   1.00 77.44  ? 206 LEU A N     1 
ATOM   2241 C  CA    . LEU C 3 206 ? 38.385  40.202 8.921   1.00 78.38  ? 206 LEU A CA    1 
ATOM   2242 C  C     . LEU C 3 206 ? 38.431  41.676 8.527   1.00 79.80  ? 206 LEU A C     1 
ATOM   2243 O  O     . LEU C 3 206 ? 39.119  42.467 9.163   1.00 79.13  ? 206 LEU A O     1 
ATOM   2244 C  CB    . LEU C 3 206 ? 39.688  39.538 8.493   1.00 77.41  ? 206 LEU A CB    1 
ATOM   2245 C  CG    . LEU C 3 206 ? 39.832  38.073 8.888   1.00 77.35  ? 206 LEU A CG    1 
ATOM   2246 C  CD1   . LEU C 3 206 ? 41.007  37.446 8.145   1.00 76.82  ? 206 LEU A CD1   1 
ATOM   2247 C  CD2   . LEU C 3 206 ? 40.008  37.982 10.393  1.00 76.70  ? 206 LEU A CD2   1 
ATOM   2248 N  N     . SER C 3 207 ? 37.694  42.033 7.477   1.00 81.81  ? 207 SER A N     1 
ATOM   2249 C  CA    . SER C 3 207 ? 37.662  43.405 6.974   1.00 82.68  ? 207 SER A CA    1 
ATOM   2250 C  C     . SER C 3 207 ? 36.510  44.220 7.528   1.00 82.66  ? 207 SER A C     1 
ATOM   2251 O  O     . SER C 3 207 ? 36.479  45.435 7.360   1.00 82.54  ? 207 SER A O     1 
ATOM   2252 C  CB    . SER C 3 207 ? 37.576  43.406 5.439   1.00 84.19  ? 207 SER A CB    1 
ATOM   2253 O  OG    . SER C 3 207 ? 36.379  42.791 4.980   1.00 83.59  ? 207 SER A OG    1 
ATOM   2254 N  N     . ILE C 3 208 ? 35.565  43.547 8.177   1.00 83.14  ? 208 ILE A N     1 
ATOM   2255 C  CA    . ILE C 3 208 ? 34.393  44.207 8.756   1.00 82.72  ? 208 ILE A CA    1 
ATOM   2256 C  C     . ILE C 3 208 ? 34.675  44.583 10.200  1.00 83.31  ? 208 ILE A C     1 
ATOM   2257 O  O     . ILE C 3 208 ? 35.541  43.992 10.837  1.00 82.43  ? 208 ILE A O     1 
ATOM   2258 C  CB    . ILE C 3 208 ? 33.156  43.276 8.713   1.00 81.40  ? 208 ILE A CB    1 
ATOM   2259 C  CG1   . ILE C 3 208 ? 31.925  43.996 9.247   1.00 80.00  ? 208 ILE A CG1   1 
ATOM   2260 C  CG2   . ILE C 3 208 ? 33.405  42.043 9.550   1.00 81.74  ? 208 ILE A CG2   1 
ATOM   2261 C  CD1   . ILE C 3 208 ? 30.652  43.193 9.091   1.00 79.38  ? 208 ILE A CD1   1 
ATOM   2262 N  N     . GLU C 3 209 ? 33.967  45.581 10.711  1.00 85.92  ? 209 GLU A N     1 
ATOM   2263 C  CA    . GLU C 3 209 ? 34.164  45.980 12.100  1.00 89.00  ? 209 GLU A CA    1 
ATOM   2264 C  C     . GLU C 3 209 ? 33.629  44.817 12.943  1.00 89.07  ? 209 GLU A C     1 
ATOM   2265 O  O     . GLU C 3 209 ? 32.598  44.218 12.614  1.00 87.78  ? 209 GLU A O     1 
ATOM   2266 C  CB    . GLU C 3 209 ? 33.399  47.280 12.412  1.00 91.61  ? 209 GLU A CB    1 
ATOM   2267 C  CG    . GLU C 3 209 ? 33.425  47.690 13.898  1.00 95.71  ? 209 GLU A CG    1 
ATOM   2268 C  CD    . GLU C 3 209 ? 32.552  48.914 14.218  1.00 97.88  ? 209 GLU A CD    1 
ATOM   2269 O  OE1   . GLU C 3 209 ? 31.379  48.964 13.768  1.00 97.79  ? 209 GLU A OE1   1 
ATOM   2270 O  OE2   . GLU C 3 209 ? 33.043  49.819 14.934  1.00 98.04  ? 209 GLU A OE2   1 
ATOM   2271 N  N     . PHE C 3 210 ? 34.332  44.493 14.022  1.00 89.28  ? 210 PHE A N     1 
ATOM   2272 C  CA    . PHE C 3 210 ? 33.923  43.382 14.866  1.00 89.38  ? 210 PHE A CA    1 
ATOM   2273 C  C     . PHE C 3 210 ? 32.524  43.505 15.443  1.00 89.58  ? 210 PHE A C     1 
ATOM   2274 O  O     . PHE C 3 210 ? 31.751  42.543 15.413  1.00 90.08  ? 210 PHE A O     1 
ATOM   2275 C  CB    . PHE C 3 210 ? 34.904  43.185 16.014  1.00 88.84  ? 210 PHE A CB    1 
ATOM   2276 C  CG    . PHE C 3 210 ? 34.549  42.032 16.906  1.00 88.94  ? 210 PHE A CG    1 
ATOM   2277 C  CD1   . PHE C 3 210 ? 34.624  40.726 16.435  1.00 87.67  ? 210 PHE A CD1   1 
ATOM   2278 C  CD2   . PHE C 3 210 ? 34.104  42.253 18.204  1.00 89.01  ? 210 PHE A CD2   1 
ATOM   2279 C  CE1   . PHE C 3 210 ? 34.262  39.661 17.238  1.00 86.88  ? 210 PHE A CE1   1 
ATOM   2280 C  CE2   . PHE C 3 210 ? 33.737  41.187 19.017  1.00 88.31  ? 210 PHE A CE2   1 
ATOM   2281 C  CZ    . PHE C 3 210 ? 33.817  39.892 18.531  1.00 87.52  ? 210 PHE A CZ    1 
ATOM   2282 N  N     . ASP C 3 211 ? 32.200  44.680 15.972  1.00 89.51  ? 211 ASP A N     1 
ATOM   2283 C  CA    . ASP C 3 211 ? 30.892  44.902 16.580  1.00 90.17  ? 211 ASP A CA    1 
ATOM   2284 C  C     . ASP C 3 211 ? 29.745  44.815 15.590  1.00 89.86  ? 211 ASP A C     1 
ATOM   2285 O  O     . ASP C 3 211 ? 28.635  44.425 15.947  1.00 89.06  ? 211 ASP A O     1 
ATOM   2286 C  CB    . ASP C 3 211 ? 30.870  46.253 17.281  1.00 91.28  ? 211 ASP A CB    1 
ATOM   2287 C  CG    . ASP C 3 211 ? 32.003  46.400 18.269  1.00 93.02  ? 211 ASP A CG    1 
ATOM   2288 O  OD1   . ASP C 3 211 ? 32.094  45.566 19.201  1.00 92.44  ? 211 ASP A OD1   1 
ATOM   2289 O  OD2   . ASP C 3 211 ? 32.807  47.344 18.101  1.00 94.50  ? 211 ASP A OD2   1 
ATOM   2290 N  N     . LYS C 3 212 ? 30.014  45.177 14.341  1.00 90.25  ? 212 LYS A N     1 
ATOM   2291 C  CA    . LYS C 3 212 ? 28.994  45.121 13.304  1.00 89.60  ? 212 LYS A CA    1 
ATOM   2292 C  C     . LYS C 3 212 ? 28.676  43.659 13.012  1.00 88.21  ? 212 LYS A C     1 
ATOM   2293 O  O     . LYS C 3 212 ? 27.532  43.311 12.728  1.00 88.04  ? 212 LYS A O     1 
ATOM   2294 C  CB    . LYS C 3 212 ? 29.490  45.817 12.033  1.00 90.70  ? 212 LYS A CB    1 
ATOM   2295 C  CG    . LYS C 3 212 ? 28.448  45.893 10.938  1.00 92.48  ? 212 LYS A CG    1 
ATOM   2296 C  CD    . LYS C 3 212 ? 29.029  46.384 9.618   1.00 92.37  ? 212 LYS A CD    1 
ATOM   2297 C  CE    . LYS C 3 212 ? 27.977  46.284 8.524   1.00 92.86  ? 212 LYS A CE    1 
ATOM   2298 N  NZ    . LYS C 3 212 ? 28.545  46.520 7.180   1.00 92.77  ? 212 LYS A NZ    1 
ATOM   2299 N  N     . LEU C 3 213 ? 29.704  42.815 13.084  1.00 87.30  ? 213 LEU A N     1 
ATOM   2300 C  CA    . LEU C 3 213 ? 29.561  41.378 12.851  1.00 86.50  ? 213 LEU A CA    1 
ATOM   2301 C  C     . LEU C 3 213 ? 28.906  40.775 14.092  1.00 85.77  ? 213 LEU A C     1 
ATOM   2302 O  O     . LEU C 3 213 ? 27.934  40.017 14.001  1.00 85.41  ? 213 LEU A O     1 
ATOM   2303 C  CB    . LEU C 3 213 ? 30.936  40.734 12.616  1.00 85.48  ? 213 LEU A CB    1 
ATOM   2304 C  CG    . LEU C 3 213 ? 31.009  39.233 12.296  1.00 84.76  ? 213 LEU A CG    1 
ATOM   2305 C  CD1   . LEU C 3 213 ? 30.084  38.892 11.131  1.00 83.44  ? 213 LEU A CD1   1 
ATOM   2306 C  CD2   . LEU C 3 213 ? 32.453  38.858 11.968  1.00 82.82  ? 213 LEU A CD2   1 
ATOM   2307 N  N     . LYS C 3 214 ? 29.441  41.128 15.256  1.00 84.45  ? 214 LYS A N     1 
ATOM   2308 C  CA    . LYS C 3 214 ? 28.897  40.639 16.515  1.00 83.14  ? 214 LYS A CA    1 
ATOM   2309 C  C     . LYS C 3 214 ? 27.402  40.922 16.575  1.00 83.09  ? 214 LYS A C     1 
ATOM   2310 O  O     . LYS C 3 214 ? 26.581  40.002 16.648  1.00 83.50  ? 214 LYS A O     1 
ATOM   2311 C  CB    . LYS C 3 214 ? 29.593  41.328 17.683  1.00 81.72  ? 214 LYS A CB    1 
ATOM   2312 C  CG    . LYS C 3 214 ? 28.968  41.069 19.033  1.00 80.69  ? 214 LYS A CG    1 
ATOM   2313 C  CD    . LYS C 3 214 ? 29.806  41.727 20.113  1.00 82.09  ? 214 LYS A CD    1 
ATOM   2314 C  CE    . LYS C 3 214 ? 29.106  41.713 21.456  1.00 82.95  ? 214 LYS A CE    1 
ATOM   2315 N  NZ    . LYS C 3 214 ? 29.910  42.428 22.486  1.00 83.23  ? 214 LYS A NZ    1 
ATOM   2316 N  N     . GLY C 3 215 ? 27.063  42.207 16.520  1.00 82.43  ? 215 GLY A N     1 
ATOM   2317 C  CA    . GLY C 3 215 ? 25.674  42.629 16.588  1.00 79.95  ? 215 GLY A CA    1 
ATOM   2318 C  C     . GLY C 3 215 ? 24.702  41.903 15.678  1.00 78.28  ? 215 GLY A C     1 
ATOM   2319 O  O     . GLY C 3 215 ? 23.525  41.764 16.015  1.00 77.90  ? 215 GLY A O     1 
ATOM   2320 N  N     . MET C 3 216 ? 25.183  41.430 14.536  0.50 76.12  ? 216 MET A N     1 
ATOM   2321 C  CA    . MET C 3 216 ? 24.308  40.760 13.587  0.50 74.13  ? 216 MET A CA    1 
ATOM   2322 C  C     . MET C 3 216 ? 24.149  39.259 13.774  0.50 73.05  ? 216 MET A C     1 
ATOM   2323 O  O     . MET C 3 216 ? 23.053  38.730 13.609  0.50 72.55  ? 216 MET A O     1 
ATOM   2324 C  CB    . MET C 3 216 ? 24.783  41.049 12.159  0.50 74.10  ? 216 MET A CB    1 
ATOM   2325 C  CG    . MET C 3 216 ? 23.831  40.591 11.063  0.50 73.80  ? 216 MET A CG    1 
ATOM   2326 S  SD    . MET C 3 216 ? 22.314  41.580 10.863  0.50 72.80  ? 216 MET A SD    1 
ATOM   2327 C  CE    . MET C 3 216 ? 22.398  42.745 12.236  0.50 71.60  ? 216 MET A CE    1 
ATOM   2328 N  N     . ILE C 3 217 ? 25.228  38.565 14.122  1.00 72.20  ? 217 ILE A N     1 
ATOM   2329 C  CA    . ILE C 3 217 ? 25.140  37.115 14.284  1.00 70.39  ? 217 ILE A CA    1 
ATOM   2330 C  C     . ILE C 3 217 ? 25.418  36.612 15.685  1.00 67.59  ? 217 ILE A C     1 
ATOM   2331 O  O     . ILE C 3 217 ? 25.111  35.464 15.998  1.00 65.97  ? 217 ILE A O     1 
ATOM   2332 C  CB    . ILE C 3 217 ? 26.098  36.386 13.330  1.00 72.09  ? 217 ILE A CB    1 
ATOM   2333 C  CG1   . ILE C 3 217 ? 27.535  36.853 13.580  1.00 74.12  ? 217 ILE A CG1   1 
ATOM   2334 C  CG2   . ILE C 3 217 ? 25.685  36.639 11.891  1.00 73.25  ? 217 ILE A CG2   1 
ATOM   2335 C  CD1   . ILE C 3 217 ? 28.604  36.078 12.802  1.00 74.91  ? 217 ILE A CD1   1 
ATOM   2336 N  N     . GLY C 3 218 ? 25.995  37.467 16.523  1.00 65.20  ? 218 GLY A N     1 
ATOM   2337 C  CA    . GLY C 3 218 ? 26.305  37.072 17.882  1.00 62.74  ? 218 GLY A CA    1 
ATOM   2338 C  C     . GLY C 3 218 ? 27.798  37.020 18.132  1.00 62.67  ? 218 GLY A C     1 
ATOM   2339 O  O     . GLY C 3 218 ? 28.591  36.662 17.253  1.00 61.56  ? 218 GLY A O     1 
ATOM   2340 N  N     . GLU C 3 219 ? 28.190  37.382 19.345  1.00 61.61  ? 219 GLU A N     1 
ATOM   2341 C  CA    . GLU C 3 219 ? 29.595  37.379 19.711  1.00 60.64  ? 219 GLU A CA    1 
ATOM   2342 C  C     . GLU C 3 219 ? 30.247  35.994 19.538  1.00 60.00  ? 219 GLU A C     1 
ATOM   2343 O  O     . GLU C 3 219 ? 31.388  35.888 19.093  1.00 60.89  ? 219 GLU A O     1 
ATOM   2344 C  CB    . GLU C 3 219 ? 29.728  37.879 21.152  1.00 61.33  ? 219 GLU A CB    1 
ATOM   2345 C  CG    . GLU C 3 219 ? 31.086  37.684 21.813  1.00 65.40  ? 219 GLU A CG    1 
ATOM   2346 C  CD    . GLU C 3 219 ? 31.066  38.082 23.295  1.00 68.09  ? 219 GLU A CD    1 
ATOM   2347 O  OE1   . GLU C 3 219 ? 30.191  37.576 24.044  1.00 68.05  ? 219 GLU A OE1   1 
ATOM   2348 O  OE2   . GLU C 3 219 ? 31.922  38.900 23.711  1.00 68.96  ? 219 GLU A OE2   1 
ATOM   2349 N  N     . ALA C 3 220 ? 29.529  34.925 19.859  1.00 58.32  ? 220 ALA A N     1 
ATOM   2350 C  CA    . ALA C 3 220 ? 30.126  33.599 19.735  1.00 56.64  ? 220 ALA A CA    1 
ATOM   2351 C  C     . ALA C 3 220 ? 30.347  33.194 18.295  1.00 54.65  ? 220 ALA A C     1 
ATOM   2352 O  O     . ALA C 3 220 ? 31.394  32.647 17.968  1.00 52.63  ? 220 ALA A O     1 
ATOM   2353 C  CB    . ALA C 3 220 ? 29.270  32.552 20.450  1.00 55.97  ? 220 ALA A CB    1 
ATOM   2354 N  N     . LYS C 3 221 ? 29.365  33.458 17.436  1.00 54.92  ? 221 LYS A N     1 
ATOM   2355 C  CA    . LYS C 3 221 ? 29.498  33.090 16.026  1.00 56.30  ? 221 LYS A CA    1 
ATOM   2356 C  C     . LYS C 3 221 ? 30.542  33.932 15.305  1.00 55.89  ? 221 LYS A C     1 
ATOM   2357 O  O     . LYS C 3 221 ? 31.183  33.466 14.358  1.00 55.37  ? 221 LYS A O     1 
ATOM   2358 C  CB    . LYS C 3 221 ? 28.162  33.217 15.294  1.00 54.26  ? 221 LYS A CB    1 
ATOM   2359 C  CG    . LYS C 3 221 ? 27.860  32.031 14.396  1.00 52.80  ? 221 LYS A CG    1 
ATOM   2360 C  CD    . LYS C 3 221 ? 26.558  31.404 14.828  1.00 53.66  ? 221 LYS A CD    1 
ATOM   2361 C  CE    . LYS C 3 221 ? 26.536  29.930 14.524  1.00 56.42  ? 221 LYS A CE    1 
ATOM   2362 N  NZ    . LYS C 3 221 ? 25.305  29.343 15.116  1.00 60.66  ? 221 LYS A NZ    1 
ATOM   2363 N  N     . ALA C 3 222 ? 30.709  35.169 15.762  1.00 55.46  ? 222 ALA A N     1 
ATOM   2364 C  CA    . ALA C 3 222 ? 31.678  36.071 15.164  1.00 55.38  ? 222 ALA A CA    1 
ATOM   2365 C  C     . ALA C 3 222 ? 33.073  35.605 15.516  1.00 54.67  ? 222 ALA A C     1 
ATOM   2366 O  O     . ALA C 3 222 ? 33.915  35.426 14.641  1.00 56.09  ? 222 ALA A O     1 
ATOM   2367 C  CB    . ALA C 3 222 ? 31.458  37.492 15.655  1.00 58.10  ? 222 ALA A CB    1 
ATOM   2368 N  N     . LYS C 3 223 ? 33.328  35.398 16.797  1.00 53.12  ? 223 LYS A N     1 
ATOM   2369 C  CA    . LYS C 3 223 ? 34.641  34.929 17.187  1.00 53.32  ? 223 LYS A CA    1 
ATOM   2370 C  C     . LYS C 3 223 ? 34.943  33.639 16.405  1.00 53.06  ? 223 LYS A C     1 
ATOM   2371 O  O     . LYS C 3 223 ? 36.003  33.514 15.774  1.00 55.39  ? 223 LYS A O     1 
ATOM   2372 C  CB    . LYS C 3 223 ? 34.680  34.690 18.694  1.00 52.87  ? 223 LYS A CB    1 
ATOM   2373 C  CG    . LYS C 3 223 ? 34.318  35.923 19.463  1.00 55.92  ? 223 LYS A CG    1 
ATOM   2374 C  CD    . LYS C 3 223 ? 34.613  35.789 20.941  1.00 60.84  ? 223 LYS A CD    1 
ATOM   2375 C  CE    . LYS C 3 223 ? 34.462  37.147 21.626  1.00 64.11  ? 223 LYS A CE    1 
ATOM   2376 N  NZ    . LYS C 3 223 ? 34.893  37.126 23.056  1.00 68.49  ? 223 LYS A NZ    1 
ATOM   2377 N  N     . TYR C 3 224 ? 33.999  32.700 16.427  1.00 50.52  ? 224 TYR A N     1 
ATOM   2378 C  CA    . TYR C 3 224 ? 34.143  31.431 15.724  1.00 47.30  ? 224 TYR A CA    1 
ATOM   2379 C  C     . TYR C 3 224 ? 34.616  31.690 14.317  1.00 47.23  ? 224 TYR A C     1 
ATOM   2380 O  O     . TYR C 3 224 ? 35.687  31.237 13.933  1.00 47.45  ? 224 TYR A O     1 
ATOM   2381 C  CB    . TYR C 3 224 ? 32.799  30.700 15.666  1.00 45.49  ? 224 TYR A CB    1 
ATOM   2382 C  CG    . TYR C 3 224 ? 32.771  29.463 14.782  1.00 42.56  ? 224 TYR A CG    1 
ATOM   2383 C  CD1   . TYR C 3 224 ? 33.450  28.309 15.139  1.00 41.49  ? 224 TYR A CD1   1 
ATOM   2384 C  CD2   . TYR C 3 224 ? 32.023  29.441 13.610  1.00 40.45  ? 224 TYR A CD2   1 
ATOM   2385 C  CE1   . TYR C 3 224 ? 33.382  27.159 14.346  1.00 41.73  ? 224 TYR A CE1   1 
ATOM   2386 C  CE2   . TYR C 3 224 ? 31.957  28.307 12.820  1.00 40.59  ? 224 TYR A CE2   1 
ATOM   2387 C  CZ    . TYR C 3 224 ? 32.636  27.167 13.192  1.00 39.83  ? 224 TYR A CZ    1 
ATOM   2388 O  OH    . TYR C 3 224 ? 32.594  26.053 12.389  1.00 38.51  ? 224 TYR A OH    1 
ATOM   2389 N  N     . LEU C 3 225 ? 33.806  32.422 13.553  1.00 48.14  ? 225 LEU A N     1 
ATOM   2390 C  CA    . LEU C 3 225 ? 34.125  32.736 12.167  1.00 49.06  ? 225 LEU A CA    1 
ATOM   2391 C  C     . LEU C 3 225 ? 35.441  33.479 11.990  1.00 50.28  ? 225 LEU A C     1 
ATOM   2392 O  O     . LEU C 3 225 ? 36.136  33.276 11.001  1.00 50.23  ? 225 LEU A O     1 
ATOM   2393 C  CB    . LEU C 3 225 ? 32.998  33.542 11.530  1.00 49.75  ? 225 LEU A CB    1 
ATOM   2394 C  CG    . LEU C 3 225 ? 31.734  32.808 11.045  1.00 52.33  ? 225 LEU A CG    1 
ATOM   2395 C  CD1   . LEU C 3 225 ? 30.754  33.840 10.491  1.00 50.09  ? 225 LEU A CD1   1 
ATOM   2396 C  CD2   . LEU C 3 225 ? 32.075  31.761 9.965   1.00 51.05  ? 225 LEU A CD2   1 
ATOM   2397 N  N     . ILE C 3 226 ? 35.789  34.341 12.938  1.00 51.19  ? 226 ILE A N     1 
ATOM   2398 C  CA    . ILE C 3 226 ? 37.039  35.077 12.825  1.00 51.92  ? 226 ILE A CA    1 
ATOM   2399 C  C     . ILE C 3 226 ? 38.264  34.171 13.014  1.00 53.55  ? 226 ILE A C     1 
ATOM   2400 O  O     . ILE C 3 226 ? 39.197  34.223 12.204  1.00 51.86  ? 226 ILE A O     1 
ATOM   2401 C  CB    . ILE C 3 226 ? 37.093  36.264 13.834  1.00 51.68  ? 226 ILE A CB    1 
ATOM   2402 C  CG1   . ILE C 3 226 ? 36.086  37.345 13.431  1.00 50.49  ? 226 ILE A CG1   1 
ATOM   2403 C  CG2   . ILE C 3 226 ? 38.476  36.901 13.840  1.00 50.58  ? 226 ILE A CG2   1 
ATOM   2404 C  CD1   . ILE C 3 226 ? 35.973  38.464 14.441  1.00 48.21  ? 226 ILE A CD1   1 
ATOM   2405 N  N     . SER C 3 227 ? 38.259  33.329 14.054  1.00 54.89  ? 227 SER A N     1 
ATOM   2406 C  CA    . SER C 3 227 ? 39.406  32.444 14.299  1.00 56.49  ? 227 SER A CA    1 
ATOM   2407 C  C     . SER C 3 227 ? 39.692  31.544 13.100  1.00 57.37  ? 227 SER A C     1 
ATOM   2408 O  O     . SER C 3 227 ? 40.855  31.308 12.755  1.00 55.89  ? 227 SER A O     1 
ATOM   2409 C  CB    . SER C 3 227 ? 39.196  31.587 15.550  1.00 56.69  ? 227 SER A CB    1 
ATOM   2410 O  OG    . SER C 3 227 ? 38.351  30.487 15.294  1.00 57.67  ? 227 SER A OG    1 
ATOM   2411 N  N     . LEU C 3 228 ? 38.631  31.048 12.468  1.00 58.11  ? 228 LEU A N     1 
ATOM   2412 C  CA    . LEU C 3 228 ? 38.778  30.205 11.289  1.00 60.17  ? 228 LEU A CA    1 
ATOM   2413 C  C     . LEU C 3 228 ? 39.406  31.021 10.167  1.00 61.10  ? 228 LEU A C     1 
ATOM   2414 O  O     . LEU C 3 228 ? 40.198  30.510 9.382   1.00 61.47  ? 228 LEU A O     1 
ATOM   2415 C  CB    . LEU C 3 228 ? 37.417  29.705 10.815  1.00 61.36  ? 228 LEU A CB    1 
ATOM   2416 C  CG    . LEU C 3 228 ? 36.794  28.518 11.540  1.00 64.40  ? 228 LEU A CG    1 
ATOM   2417 C  CD1   . LEU C 3 228 ? 35.326  28.404 11.141  1.00 65.87  ? 228 LEU A CD1   1 
ATOM   2418 C  CD2   . LEU C 3 228 ? 37.544  27.240 11.192  1.00 64.14  ? 228 LEU A CD2   1 
ATOM   2419 N  N     . ALA C 3 229 ? 39.028  32.294 10.094  1.00 62.19  ? 229 ALA A N     1 
ATOM   2420 C  CA    . ALA C 3 229 ? 39.517  33.200 9.065   1.00 62.77  ? 229 ALA A CA    1 
ATOM   2421 C  C     . ALA C 3 229 ? 40.994  33.478 9.265   1.00 63.45  ? 229 ALA A C     1 
ATOM   2422 O  O     . ALA C 3 229 ? 41.762  33.472 8.310   1.00 64.00  ? 229 ALA A O     1 
ATOM   2423 C  CB    . ALA C 3 229 ? 38.717  34.501 9.098   1.00 61.63  ? 229 ALA A CB    1 
ATOM   2424 N  N     . ARG C 3 230 ? 41.387  33.726 10.508  1.00 63.92  ? 230 ARG A N     1 
ATOM   2425 C  CA    . ARG C 3 230 ? 42.786  33.979 10.819  1.00 64.79  ? 230 ARG A CA    1 
ATOM   2426 C  C     . ARG C 3 230 ? 43.523  32.657 10.790  1.00 65.05  ? 230 ARG A C     1 
ATOM   2427 O  O     . ARG C 3 230 ? 44.719  32.608 11.035  1.00 66.37  ? 230 ARG A O     1 
ATOM   2428 C  CB    . ARG C 3 230 ? 42.945  34.575 12.218  1.00 65.78  ? 230 ARG A CB    1 
ATOM   2429 C  CG    . ARG C 3 230 ? 42.453  35.972 12.374  1.00 66.46  ? 230 ARG A CG    1 
ATOM   2430 C  CD    . ARG C 3 230 ? 42.587  36.409 13.803  1.00 68.83  ? 230 ARG A CD    1 
ATOM   2431 N  NE    . ARG C 3 230 ? 42.087  37.767 13.954  1.00 73.90  ? 230 ARG A NE    1 
ATOM   2432 C  CZ    . ARG C 3 230 ? 41.630  38.278 15.092  1.00 75.79  ? 230 ARG A CZ    1 
ATOM   2433 N  NH1   . ARG C 3 230 ? 41.612  37.541 16.200  1.00 76.71  ? 230 ARG A NH1   1 
ATOM   2434 N  NH2   . ARG C 3 230 ? 41.154  39.519 15.112  1.00 76.57  ? 230 ARG A NH2   1 
ATOM   2435 N  N     . ASP C 3 231 ? 42.797  31.581 10.520  1.00 65.49  ? 231 ASP A N     1 
ATOM   2436 C  CA    . ASP C 3 231 ? 43.386  30.252 10.473  1.00 66.26  ? 231 ASP A CA    1 
ATOM   2437 C  C     . ASP C 3 231 ? 43.979  29.874 11.828  1.00 66.00  ? 231 ASP A C     1 
ATOM   2438 O  O     . ASP C 3 231 ? 45.008  29.211 11.902  1.00 65.82  ? 231 ASP A O     1 
ATOM   2439 C  CB    . ASP C 3 231 ? 44.458  30.194 9.380   1.00 66.82  ? 231 ASP A CB    1 
ATOM   2440 C  CG    . ASP C 3 231 ? 45.041  28.792 9.195   1.00 70.43  ? 231 ASP A CG    1 
ATOM   2441 O  OD1   . ASP C 3 231 ? 44.500  27.824 9.786   1.00 69.79  ? 231 ASP A OD1   1 
ATOM   2442 O  OD2   . ASP C 3 231 ? 46.042  28.658 8.448   1.00 72.80  ? 231 ASP A OD2   1 
ATOM   2443 N  N     . GLU C 3 232 ? 43.323  30.303 12.901  1.00 66.25  ? 232 GLU A N     1 
ATOM   2444 C  CA    . GLU C 3 232 ? 43.791  29.998 14.250  1.00 65.59  ? 232 GLU A CA    1 
ATOM   2445 C  C     . GLU C 3 232 ? 42.732  29.210 14.993  1.00 64.94  ? 232 GLU A C     1 
ATOM   2446 O  O     . GLU C 3 232 ? 42.675  29.251 16.217  1.00 63.33  ? 232 GLU A O     1 
ATOM   2447 C  CB    . GLU C 3 232 ? 44.064  31.272 15.050  1.00 66.05  ? 232 GLU A CB    1 
ATOM   2448 C  CG    . GLU C 3 232 ? 44.965  32.292 14.400  1.00 65.93  ? 232 GLU A CG    1 
ATOM   2449 C  CD    . GLU C 3 232 ? 45.184  33.501 15.313  1.00 67.90  ? 232 GLU A CD    1 
ATOM   2450 O  OE1   . GLU C 3 232 ? 44.387  33.686 16.276  1.00 65.52  ? 232 GLU A OE1   1 
ATOM   2451 O  OE2   . GLU C 3 232 ? 46.146  34.269 15.060  1.00 67.13  ? 232 GLU A OE2   1 
ATOM   2452 N  N     . TYR C 3 233 ? 41.879  28.501 14.266  1.00 65.89  ? 233 TYR A N     1 
ATOM   2453 C  CA    . TYR C 3 233 ? 40.837  27.734 14.938  1.00 65.94  ? 233 TYR A CA    1 
ATOM   2454 C  C     . TYR C 3 233 ? 41.453  26.572 15.673  1.00 67.52  ? 233 TYR A C     1 
ATOM   2455 O  O     . TYR C 3 233 ? 42.018  25.669 15.057  1.00 68.66  ? 233 TYR A O     1 
ATOM   2456 C  CB    . TYR C 3 233 ? 39.808  27.186 13.953  1.00 60.90  ? 233 TYR A CB    1 
ATOM   2457 C  CG    . TYR C 3 233 ? 38.766  26.311 14.615  1.00 57.57  ? 233 TYR A CG    1 
ATOM   2458 C  CD1   . TYR C 3 233 ? 37.753  26.868 15.407  1.00 55.01  ? 233 TYR A CD1   1 
ATOM   2459 C  CD2   . TYR C 3 233 ? 38.782  24.923 14.443  1.00 55.11  ? 233 TYR A CD2   1 
ATOM   2460 C  CE1   . TYR C 3 233 ? 36.779  26.069 16.008  1.00 52.91  ? 233 TYR A CE1   1 
ATOM   2461 C  CE2   . TYR C 3 233 ? 37.813  24.112 15.037  1.00 54.56  ? 233 TYR A CE2   1 
ATOM   2462 C  CZ    . TYR C 3 233 ? 36.811  24.688 15.816  1.00 55.64  ? 233 TYR A CZ    1 
ATOM   2463 O  OH    . TYR C 3 233 ? 35.836  23.883 16.385  1.00 55.07  ? 233 TYR A OH    1 
ATOM   2464 N  N     . ASN C 3 234 ? 41.370  26.599 16.992  1.00 69.30  ? 234 ASN A N     1 
ATOM   2465 C  CA    . ASN C 3 234 ? 41.899  25.495 17.759  1.00 72.11  ? 234 ASN A CA    1 
ATOM   2466 C  C     . ASN C 3 234 ? 40.817  25.093 18.753  1.00 72.23  ? 234 ASN A C     1 
ATOM   2467 O  O     . ASN C 3 234 ? 40.332  25.896 19.574  1.00 71.85  ? 234 ASN A O     1 
ATOM   2468 C  CB    . ASN C 3 234 ? 43.252  25.875 18.416  1.00 76.02  ? 234 ASN A CB    1 
ATOM   2469 C  CG    . ASN C 3 234 ? 43.153  26.210 19.921  1.00 79.75  ? 234 ASN A CG    1 
ATOM   2470 O  OD1   . ASN C 3 234 ? 42.416  27.121 20.343  1.00 80.58  ? 234 ASN A OD1   1 
ATOM   2471 N  ND2   . ASN C 3 234 ? 43.931  25.481 20.732  1.00 80.19  ? 234 ASN A ND2   1 
ATOM   2472 N  N     . GLU C 3 235 ? 40.385  23.850 18.583  1.00 71.33  ? 235 GLU A N     1 
ATOM   2473 C  CA    . GLU C 3 235 ? 39.367  23.225 19.411  1.00 70.13  ? 235 GLU A CA    1 
ATOM   2474 C  C     . GLU C 3 235 ? 39.788  21.780 19.457  1.00 67.36  ? 235 GLU A C     1 
ATOM   2475 O  O     . GLU C 3 235 ? 39.749  21.069 18.451  1.00 64.70  ? 235 GLU A O     1 
ATOM   2476 C  CB    . GLU C 3 235 ? 37.977  23.348 18.787  1.00 72.08  ? 235 GLU A CB    1 
ATOM   2477 C  CG    . GLU C 3 235 ? 37.274  24.636 19.163  1.00 76.70  ? 235 GLU A CG    1 
ATOM   2478 C  CD    . GLU C 3 235 ? 37.192  24.811 20.667  1.00 79.33  ? 235 GLU A CD    1 
ATOM   2479 O  OE1   . GLU C 3 235 ? 36.749  23.843 21.325  1.00 82.19  ? 235 GLU A OE1   1 
ATOM   2480 O  OE2   . GLU C 3 235 ? 37.560  25.895 21.185  1.00 77.65  ? 235 GLU A OE2   1 
ATOM   2481 N  N     . PRO C 3 236 ? 40.224  21.334 20.633  1.00 65.32  ? 236 PRO A N     1 
ATOM   2482 C  CA    . PRO C 3 236 ? 40.678  19.965 20.855  1.00 64.14  ? 236 PRO A CA    1 
ATOM   2483 C  C     . PRO C 3 236 ? 39.517  18.982 20.835  1.00 62.33  ? 236 PRO A C     1 
ATOM   2484 O  O     . PRO C 3 236 ? 38.359  19.353 21.031  1.00 61.91  ? 236 PRO A O     1 
ATOM   2485 C  CB    . PRO C 3 236 ? 41.333  20.061 22.216  1.00 63.12  ? 236 PRO A CB    1 
ATOM   2486 C  CG    . PRO C 3 236 ? 40.387  20.999 22.919  1.00 63.33  ? 236 PRO A CG    1 
ATOM   2487 C  CD    . PRO C 3 236 ? 40.185  22.087 21.898  1.00 63.48  ? 236 PRO A CD    1 
ATOM   2488 N  N     . ILE C 3 237 ? 39.839  17.725 20.585  1.00 61.18  ? 237 ILE A N     1 
ATOM   2489 C  CA    . ILE C 3 237 ? 38.834  16.687 20.559  1.00 60.93  ? 237 ILE A CA    1 
ATOM   2490 C  C     . ILE C 3 237 ? 38.548  16.339 22.017  1.00 63.62  ? 237 ILE A C     1 
ATOM   2491 O  O     . ILE C 3 237 ? 39.471  16.030 22.771  1.00 62.27  ? 237 ILE A O     1 
ATOM   2492 C  CB    . ILE C 3 237 ? 39.364  15.466 19.805  1.00 56.43  ? 237 ILE A CB    1 
ATOM   2493 C  CG1   . ILE C 3 237 ? 39.172  15.677 18.309  1.00 52.60  ? 237 ILE A CG1   1 
ATOM   2494 C  CG2   . ILE C 3 237 ? 38.711  14.213 20.319  1.00 55.37  ? 237 ILE A CG2   1 
ATOM   2495 C  CD1   . ILE C 3 237 ? 39.961  16.805 17.754  1.00 47.76  ? 237 ILE A CD1   1 
ATOM   2496 N  N     . ARG C 3 238 ? 37.279  16.416 22.413  1.00 67.23  ? 238 ARG A N     1 
ATOM   2497 C  CA    . ARG C 3 238 ? 36.893  16.123 23.784  1.00 71.75  ? 238 ARG A CA    1 
ATOM   2498 C  C     . ARG C 3 238 ? 35.755  15.120 23.855  1.00 72.94  ? 238 ARG A C     1 
ATOM   2499 O  O     . ARG C 3 238 ? 34.794  15.203 23.098  1.00 72.77  ? 238 ARG A O     1 
ATOM   2500 C  CB    . ARG C 3 238 ? 36.482  17.408 24.515  1.00 75.39  ? 238 ARG A CB    1 
ATOM   2501 C  CG    . ARG C 3 238 ? 35.196  18.050 23.995  1.00 82.62  ? 238 ARG A CG    1 
ATOM   2502 C  CD    . ARG C 3 238 ? 34.714  19.233 24.866  1.00 87.57  ? 238 ARG A CD    1 
ATOM   2503 N  NE    . ARG C 3 238 ? 35.683  20.333 24.959  1.00 93.31  ? 238 ARG A NE    1 
ATOM   2504 C  CZ    . ARG C 3 238 ? 36.621  20.439 25.902  1.00 95.71  ? 238 ARG A CZ    1 
ATOM   2505 N  NH1   . ARG C 3 238 ? 37.455  21.474 25.895  1.00 94.91  ? 238 ARG A NH1   1 
ATOM   2506 N  NH2   . ARG C 3 238 ? 36.717  19.520 26.863  1.00 96.76  ? 238 ARG A NH2   1 
ATOM   2507 N  N     . THR C 3 239 ? 35.883  14.167 24.776  1.00 74.80  ? 239 THR A N     1 
ATOM   2508 C  CA    . THR C 3 239 ? 34.876  13.128 24.983  1.00 75.66  ? 239 THR A CA    1 
ATOM   2509 C  C     . THR C 3 239 ? 33.582  13.840 25.328  1.00 74.62  ? 239 THR A C     1 
ATOM   2510 O  O     . THR C 3 239 ? 33.577  14.696 26.204  1.00 74.22  ? 239 THR A O     1 
ATOM   2511 C  CB    . THR C 3 239 ? 35.277  12.199 26.159  1.00 76.12  ? 239 THR A CB    1 
ATOM   2512 O  OG1   . THR C 3 239 ? 36.577  11.651 25.907  1.00 77.89  ? 239 THR A OG1   1 
ATOM   2513 C  CG2   . THR C 3 239 ? 34.281  11.060 26.317  1.00 75.45  ? 239 THR A CG2   1 
ATOM   2514 N  N     . ARG C 3 240 ? 32.491  13.491 24.651  1.00 74.19  ? 240 ARG A N     1 
ATOM   2515 C  CA    . ARG C 3 240 ? 31.215  14.150 24.905  1.00 75.08  ? 240 ARG A CA    1 
ATOM   2516 C  C     . ARG C 3 240 ? 30.336  13.418 25.902  1.00 74.38  ? 240 ARG A C     1 
ATOM   2517 O  O     . ARG C 3 240 ? 30.182  12.201 25.829  1.00 74.50  ? 240 ARG A O     1 
ATOM   2518 C  CB    . ARG C 3 240 ? 30.445  14.343 23.599  1.00 77.18  ? 240 ARG A CB    1 
ATOM   2519 C  CG    . ARG C 3 240 ? 29.907  15.759 23.440  1.00 79.52  ? 240 ARG A CG    1 
ATOM   2520 C  CD    . ARG C 3 240 ? 29.265  15.994 22.077  1.00 81.14  ? 240 ARG A CD    1 
ATOM   2521 N  NE    . ARG C 3 240 ? 30.232  16.214 21.000  1.00 83.10  ? 240 ARG A NE    1 
ATOM   2522 C  CZ    . ARG C 3 240 ? 29.946  16.895 19.890  1.00 84.66  ? 240 ARG A CZ    1 
ATOM   2523 N  NH1   . ARG C 3 240 ? 28.730  17.405 19.735  1.00 85.97  ? 240 ARG A NH1   1 
ATOM   2524 N  NH2   . ARG C 3 240 ? 30.858  17.080 18.939  1.00 83.31  ? 240 ARG A NH2   1 
ATOM   2525 N  N     . VAL C 3 241 ? 29.762  14.179 26.831  1.00 73.06  ? 241 VAL A N     1 
ATOM   2526 C  CA    . VAL C 3 241 ? 28.880  13.638 27.863  1.00 71.88  ? 241 VAL A CA    1 
ATOM   2527 C  C     . VAL C 3 241 ? 27.463  14.122 27.585  1.00 70.15  ? 241 VAL A C     1 
ATOM   2528 O  O     . VAL C 3 241 ? 27.203  15.320 27.616  1.00 69.57  ? 241 VAL A O     1 
ATOM   2529 C  CB    . VAL C 3 241 ? 29.295  14.130 29.276  1.00 72.49  ? 241 VAL A CB    1 
ATOM   2530 C  CG1   . VAL C 3 241 ? 28.458  13.417 30.347  1.00 71.80  ? 241 VAL A CG1   1 
ATOM   2531 C  CG2   . VAL C 3 241 ? 30.790  13.893 29.497  1.00 72.18  ? 241 VAL A CG2   1 
ATOM   2532 N  N     . ARG C 3 242 ? 26.545  13.201 27.315  1.00 68.98  ? 242 ARG A N     1 
ATOM   2533 C  CA    . ARG C 3 242 ? 25.178  13.603 27.030  1.00 69.03  ? 242 ARG A CA    1 
ATOM   2534 C  C     . ARG C 3 242 ? 24.619  14.406 28.207  1.00 66.97  ? 242 ARG A C     1 
ATOM   2535 O  O     . ARG C 3 242 ? 24.539  13.897 29.321  1.00 68.42  ? 242 ARG A O     1 
ATOM   2536 C  CB    . ARG C 3 242 ? 24.307  12.376 26.742  1.00 71.41  ? 242 ARG A CB    1 
ATOM   2537 C  CG    . ARG C 3 242 ? 22.926  12.751 26.236  1.00 77.13  ? 242 ARG A CG    1 
ATOM   2538 C  CD    . ARG C 3 242 ? 22.230  11.632 25.449  1.00 82.84  ? 242 ARG A CD    1 
ATOM   2539 N  NE    . ARG C 3 242 ? 22.887  11.301 24.179  1.00 87.27  ? 242 ARG A NE    1 
ATOM   2540 C  CZ    . ARG C 3 242 ? 23.318  12.192 23.281  1.00 90.13  ? 242 ARG A CZ    1 
ATOM   2541 N  NH1   . ARG C 3 242 ? 23.177  13.497 23.495  1.00 90.75  ? 242 ARG A NH1   1 
ATOM   2542 N  NH2   . ARG C 3 242 ? 23.889  11.778 22.152  1.00 90.25  ? 242 ARG A NH2   1 
ATOM   2543 N  N     . LYS C 3 243 ? 24.246  15.660 27.953  1.00 62.96  ? 243 LYS A N     1 
ATOM   2544 C  CA    . LYS C 3 243 ? 23.713  16.542 28.987  1.00 59.81  ? 243 LYS A CA    1 
ATOM   2545 C  C     . LYS C 3 243 ? 22.205  16.419 29.231  1.00 57.56  ? 243 LYS A C     1 
ATOM   2546 O  O     . LYS C 3 243 ? 21.744  16.637 30.344  1.00 58.53  ? 243 LYS A O     1 
ATOM   2547 C  CB    . LYS C 3 243 ? 24.074  18.002 28.675  1.00 59.80  ? 243 LYS A CB    1 
ATOM   2548 C  CG    . LYS C 3 243 ? 25.581  18.283 28.689  1.00 61.68  ? 243 LYS A CG    1 
ATOM   2549 C  CD    . LYS C 3 243 ? 25.901  19.764 28.457  1.00 63.47  ? 243 LYS A CD    1 
ATOM   2550 C  CE    . LYS C 3 243 ? 27.354  20.125 28.837  1.00 64.33  ? 243 LYS A CE    1 
ATOM   2551 N  NZ    . LYS C 3 243 ? 28.291  20.289 27.680  1.00 63.01  ? 243 LYS A NZ    1 
ATOM   2552 N  N     . SER C 3 244 ? 21.422  16.096 28.213  1.00 54.00  ? 244 SER A N     1 
ATOM   2553 C  CA    . SER C 3 244 ? 19.994  15.941 28.448  1.00 52.72  ? 244 SER A CA    1 
ATOM   2554 C  C     . SER C 3 244 ? 19.403  14.779 27.642  1.00 51.71  ? 244 SER A C     1 
ATOM   2555 O  O     . SER C 3 244 ? 20.019  14.278 26.701  1.00 50.91  ? 244 SER A O     1 
ATOM   2556 C  CB    . SER C 3 244 ? 19.247  17.237 28.149  1.00 52.78  ? 244 SER A CB    1 
ATOM   2557 O  OG    . SER C 3 244 ? 18.950  17.354 26.776  1.00 55.73  ? 244 SER A OG    1 
ATOM   2558 N  N     . ILE C 3 245 ? 18.213  14.349 28.040  1.00 50.02  ? 245 ILE A N     1 
ATOM   2559 C  CA    . ILE C 3 245 ? 17.523  13.231 27.415  1.00 50.68  ? 245 ILE A CA    1 
ATOM   2560 C  C     . ILE C 3 245 ? 16.030  13.505 27.481  1.00 50.33  ? 245 ILE A C     1 
ATOM   2561 O  O     . ILE C 3 245 ? 15.466  13.586 28.561  1.00 51.19  ? 245 ILE A O     1 
ATOM   2562 C  CB    . ILE C 3 245 ? 17.827  11.914 28.186  1.00 51.86  ? 245 ILE A CB    1 
ATOM   2563 C  CG1   . ILE C 3 245 ? 19.185  11.360 27.759  1.00 54.07  ? 245 ILE A CG1   1 
ATOM   2564 C  CG2   . ILE C 3 245 ? 16.733  10.883 27.968  1.00 49.91  ? 245 ILE A CG2   1 
ATOM   2565 C  CD1   . ILE C 3 245 ? 19.556  10.076 28.476  1.00 56.49  ? 245 ILE A CD1   1 
ATOM   2566 N  N     . GLY C 3 246 ? 15.384  13.654 26.335  1.00 50.34  ? 246 GLY A N     1 
ATOM   2567 C  CA    . GLY C 3 246 ? 13.964  13.926 26.359  1.00 50.14  ? 246 GLY A CA    1 
ATOM   2568 C  C     . GLY C 3 246 ? 13.193  13.136 25.333  1.00 50.80  ? 246 GLY A C     1 
ATOM   2569 O  O     . GLY C 3 246 ? 13.715  12.220 24.711  1.00 50.53  ? 246 GLY A O     1 
ATOM   2570 N  N     . ARG C 3 247 ? 11.940  13.514 25.142  1.00 52.17  ? 247 ARG A N     1 
ATOM   2571 C  CA    . ARG C 3 247 ? 11.083  12.841 24.195  1.00 55.13  ? 247 ARG A CA    1 
ATOM   2572 C  C     . ARG C 3 247 ? 9.882   13.739 23.959  1.00 56.28  ? 247 ARG A C     1 
ATOM   2573 O  O     . ARG C 3 247 ? 9.350   14.337 24.881  1.00 56.45  ? 247 ARG A O     1 
ATOM   2574 C  CB    . ARG C 3 247 ? 10.667  11.490 24.772  1.00 57.52  ? 247 ARG A CB    1 
ATOM   2575 C  CG    . ARG C 3 247 ? 9.556   10.791 24.052  1.00 61.55  ? 247 ARG A CG    1 
ATOM   2576 C  CD    . ARG C 3 247 ? 10.016  10.053 22.825  1.00 67.49  ? 247 ARG A CD    1 
ATOM   2577 N  NE    . ARG C 3 247 ? 8.915   9.252  22.295  1.00 73.81  ? 247 ARG A NE    1 
ATOM   2578 C  CZ    . ARG C 3 247 ? 8.962   8.550  21.168  1.00 76.01  ? 247 ARG A CZ    1 
ATOM   2579 N  NH1   . ARG C 3 247 ? 10.071  8.551  20.438  1.00 78.70  ? 247 ARG A NH1   1 
ATOM   2580 N  NH2   . ARG C 3 247 ? 7.903   7.841  20.777  1.00 76.87  ? 247 ARG A NH2   1 
ATOM   2581 N  N     . ILE C 3 248 ? 9.466   13.848 22.711  1.00 58.96  ? 248 ILE A N     1 
ATOM   2582 C  CA    . ILE C 3 248 ? 8.342   14.692 22.368  1.00 61.73  ? 248 ILE A CA    1 
ATOM   2583 C  C     . ILE C 3 248 ? 7.443   13.901 21.401  1.00 64.64  ? 248 ILE A C     1 
ATOM   2584 O  O     . ILE C 3 248 ? 7.906   13.398 20.384  1.00 66.02  ? 248 ILE A O     1 
ATOM   2585 C  CB    . ILE C 3 248 ? 8.884   16.014 21.757  0.50 60.66  ? 248 ILE A CB    1 
ATOM   2586 C  CG1   . ILE C 3 248 ? 7.914   17.150 22.020  0.50 60.98  ? 248 ILE A CG1   1 
ATOM   2587 C  CG2   . ILE C 3 248 ? 9.101   15.871 20.275  0.50 61.59  ? 248 ILE A CG2   1 
ATOM   2588 C  CD1   . ILE C 3 248 ? 6.619   16.997 21.298  0.50 61.48  ? 248 ILE A CD1   1 
ATOM   2589 N  N     . VAL C 3 249 ? 6.165   13.756 21.738  1.00 68.00  ? 249 VAL A N     1 
ATOM   2590 C  CA    . VAL C 3 249 ? 5.230   13.003 20.890  1.00 71.35  ? 249 VAL A CA    1 
ATOM   2591 C  C     . VAL C 3 249 ? 4.133   13.877 20.272  1.00 74.84  ? 249 VAL A C     1 
ATOM   2592 O  O     . VAL C 3 249 ? 3.669   14.840 20.884  1.00 74.36  ? 249 VAL A O     1 
ATOM   2593 C  CB    . VAL C 3 249 ? 4.546   11.849 21.687  1.00 70.71  ? 249 VAL A CB    1 
ATOM   2594 C  CG1   . VAL C 3 249 ? 5.606   10.965 22.342  1.00 69.90  ? 249 VAL A CG1   1 
ATOM   2595 C  CG2   . VAL C 3 249 ? 3.596   12.409 22.733  1.00 67.77  ? 249 VAL A CG2   1 
ATOM   2596 N  N     . THR C 3 250 ? 3.731   13.548 19.048  1.00 78.68  ? 250 THR A N     1 
ATOM   2597 C  CA    . THR C 3 250 ? 2.677   14.299 18.372  1.00 83.59  ? 250 THR A CA    1 
ATOM   2598 C  C     . THR C 3 250 ? 1.355   13.715 18.822  1.00 86.58  ? 250 THR A C     1 
ATOM   2599 O  O     . THR C 3 250 ? 1.211   12.495 18.897  1.00 88.18  ? 250 THR A O     1 
ATOM   2600 C  CB    . THR C 3 250 ? 2.757   14.172 16.836  1.00 84.99  ? 250 THR A CB    1 
ATOM   2601 O  OG1   . THR C 3 250 ? 3.893   14.898 16.352  1.00 86.04  ? 250 THR A OG1   1 
ATOM   2602 C  CG2   . THR C 3 250 ? 1.486   14.733 16.184  1.00 86.27  ? 250 THR A CG2   1 
ATOM   2603 N  N     . MET C 3 251 ? 0.390   14.576 19.122  1.00 89.21  ? 251 MET A N     1 
ATOM   2604 C  CA    . MET C 3 251 ? -0.910  14.110 19.571  1.00 91.75  ? 251 MET A CA    1 
ATOM   2605 C  C     . MET C 3 251 ? -1.800  13.845 18.366  1.00 93.12  ? 251 MET A C     1 
ATOM   2606 O  O     . MET C 3 251 ? -1.577  14.402 17.288  1.00 91.98  ? 251 MET A O     1 
ATOM   2607 C  CB    . MET C 3 251 ? -1.542  15.144 20.506  1.00 92.91  ? 251 MET A CB    1 
ATOM   2608 C  CG    . MET C 3 251 ? -0.608  15.585 21.633  1.00 93.77  ? 251 MET A CG    1 
ATOM   2609 S  SD    . MET C 3 251 ? -1.390  16.607 22.910  1.00 96.08  ? 251 MET A SD    1 
ATOM   2610 C  CE    . MET C 3 251 ? -1.482  18.175 22.093  1.00 97.04  ? 251 MET A CE    1 
ATOM   2611 N  N     . LYS C 3 252 ? -2.792  12.978 18.555  1.00 95.98  ? 252 LYS A N     1 
ATOM   2612 C  CA    . LYS C 3 252 ? -3.732  12.594 17.496  1.00 98.58  ? 252 LYS A CA    1 
ATOM   2613 C  C     . LYS C 3 252 ? -4.434  13.795 16.872  1.00 98.93  ? 252 LYS A C     1 
ATOM   2614 O  O     . LYS C 3 252 ? -4.713  13.815 15.667  1.00 98.20  ? 252 LYS A O     1 
ATOM   2615 C  CB    . LYS C 3 252 ? -4.783  11.628 18.057  1.00 100.64 ? 252 LYS A CB    1 
ATOM   2616 C  CG    . LYS C 3 252 ? -5.766  11.089 17.019  1.00 102.99 ? 252 LYS A CG    1 
ATOM   2617 C  CD    . LYS C 3 252 ? -5.069  10.190 16.000  1.00 104.33 ? 252 LYS A CD    1 
ATOM   2618 C  CE    . LYS C 3 252 ? -6.061  9.532  15.054  1.00 103.97 ? 252 LYS A CE    1 
ATOM   2619 N  NZ    . LYS C 3 252 ? -5.375  8.553  14.165  1.00 105.02 ? 252 LYS A NZ    1 
ATOM   2620 N  N     . ARG C 3 253 ? -4.737  14.779 17.714  1.00 98.66  ? 253 ARG A N     1 
ATOM   2621 C  CA    . ARG C 3 253 ? -5.393  16.006 17.290  1.00 98.56  ? 253 ARG A CA    1 
ATOM   2622 C  C     . ARG C 3 253 ? -4.988  17.064 18.307  1.00 97.29  ? 253 ARG A C     1 
ATOM   2623 O  O     . ARG C 3 253 ? -4.883  16.775 19.499  1.00 96.86  ? 253 ARG A O     1 
ATOM   2624 C  CB    . ARG C 3 253 ? -6.921  15.841 17.281  1.00 100.99 ? 253 ARG A CB    1 
ATOM   2625 C  CG    . ARG C 3 253 ? -7.587  15.970 18.653  1.00 103.20 ? 253 ARG A CG    1 
ATOM   2626 C  CD    . ARG C 3 253 ? -9.116  15.887 18.581  1.00 104.67 ? 253 ARG A CD    1 
ATOM   2627 N  NE    . ARG C 3 253 ? -9.744  16.626 19.680  1.00 105.20 ? 253 ARG A NE    1 
ATOM   2628 C  CZ    . ARG C 3 253 ? -10.724 16.155 20.446  1.00 104.55 ? 253 ARG A CZ    1 
ATOM   2629 N  NH1   . ARG C 3 253 ? -11.205 14.932 20.249  1.00 104.06 ? 253 ARG A NH1   1 
ATOM   2630 N  NH2   . ARG C 3 253 ? -11.228 16.910 21.410  1.00 103.40 ? 253 ARG A NH2   1 
ATOM   2631 N  N     . ASN C 3 254 ? -4.754  18.284 17.838  1.00 95.67  ? 254 ASN A N     1 
ATOM   2632 C  CA    . ASN C 3 254 ? -4.347  19.364 18.726  1.00 94.34  ? 254 ASN A CA    1 
ATOM   2633 C  C     . ASN C 3 254 ? -5.360  19.530 19.843  1.00 93.39  ? 254 ASN A C     1 
ATOM   2634 O  O     . ASN C 3 254 ? -6.389  18.856 19.845  1.00 92.82  ? 254 ASN A O     1 
ATOM   2635 C  CB    . ASN C 3 254 ? -4.208  20.661 17.937  1.00 95.17  ? 254 ASN A CB    1 
ATOM   2636 C  CG    . ASN C 3 254 ? -3.276  20.514 16.749  1.00 95.58  ? 254 ASN A CG    1 
ATOM   2637 O  OD1   . ASN C 3 254 ? -2.535  19.537 16.648  1.00 95.31  ? 254 ASN A OD1   1 
ATOM   2638 N  ND2   . ASN C 3 254 ? -3.300  21.491 15.847  1.00 96.65  ? 254 ASN A ND2   1 
ATOM   2639 N  N     . SER C 3 255 ? -5.063  20.420 20.788  1.00 92.41  ? 255 SER A N     1 
ATOM   2640 C  CA    . SER C 3 255 ? -5.945  20.673 21.928  1.00 92.11  ? 255 SER A CA    1 
ATOM   2641 C  C     . SER C 3 255 ? -5.211  21.303 23.096  1.00 91.07  ? 255 SER A C     1 
ATOM   2642 O  O     . SER C 3 255 ? -3.979  21.265 23.160  1.00 91.03  ? 255 SER A O     1 
ATOM   2643 C  CB    . SER C 3 255 ? -6.564  19.375 22.436  1.00 93.53  ? 255 SER A CB    1 
ATOM   2644 O  OG    . SER C 3 255 ? -7.010  19.539 23.772  1.00 96.90  ? 255 SER A OG    1 
ATOM   2645 N  N     . ARG C 3 256 ? -5.973  21.875 24.024  1.00 89.40  ? 256 ARG A N     1 
ATOM   2646 C  CA    . ARG C 3 256 ? -5.381  22.468 25.213  1.00 88.97  ? 256 ARG A CA    1 
ATOM   2647 C  C     . ARG C 3 256 ? -6.115  21.985 26.471  1.00 88.14  ? 256 ARG A C     1 
ATOM   2648 O  O     . ARG C 3 256 ? -6.102  22.637 27.526  1.00 86.70  ? 256 ARG A O     1 
ATOM   2649 C  CB    . ARG C 3 256 ? -5.379  23.998 25.118  1.00 89.29  ? 256 ARG A CB    1 
ATOM   2650 C  CG    . ARG C 3 256 ? -6.265  24.591 24.037  1.00 89.69  ? 256 ARG A CG    1 
ATOM   2651 C  CD    . ARG C 3 256 ? -6.019  26.102 23.951  1.00 90.43  ? 256 ARG A CD    1 
ATOM   2652 N  NE    . ARG C 3 256 ? -6.095  26.768 25.262  1.00 91.48  ? 256 ARG A NE    1 
ATOM   2653 C  CZ    . ARG C 3 256 ? -5.084  27.399 25.867  1.00 91.26  ? 256 ARG A CZ    1 
ATOM   2654 N  NH1   . ARG C 3 256 ? -3.893  27.460 25.291  1.00 91.92  ? 256 ARG A NH1   1 
ATOM   2655 N  NH2   . ARG C 3 256 ? -5.265  27.984 27.047  1.00 90.90  ? 256 ARG A NH2   1 
ATOM   2656 N  N     . ASN C 3 257 ? -6.740  20.817 26.343  1.00 87.30  ? 257 ASN A N     1 
ATOM   2657 C  CA    . ASN C 3 257 ? -7.473  20.190 27.438  1.00 87.23  ? 257 ASN A CA    1 
ATOM   2658 C  C     . ASN C 3 257 ? -6.518  19.337 28.278  1.00 86.55  ? 257 ASN A C     1 
ATOM   2659 O  O     . ASN C 3 257 ? -6.209  18.202 27.915  1.00 87.04  ? 257 ASN A O     1 
ATOM   2660 C  CB    . ASN C 3 257 ? -8.597  19.313 26.869  1.00 88.21  ? 257 ASN A CB    1 
ATOM   2661 C  CG    . ASN C 3 257 ? -9.297  18.480 27.939  1.00 89.14  ? 257 ASN A CG    1 
ATOM   2662 O  OD1   . ASN C 3 257 ? -8.722  17.534 28.495  1.00 87.74  ? 257 ASN A OD1   1 
ATOM   2663 N  ND2   . ASN C 3 257 ? -10.548 18.834 28.235  1.00 88.86  ? 257 ASN A ND2   1 
ATOM   2664 N  N     . LEU C 3 258 ? -6.056  19.876 29.400  1.00 85.03  ? 258 LEU A N     1 
ATOM   2665 C  CA    . LEU C 3 258 ? -5.121  19.149 30.248  1.00 83.92  ? 258 LEU A CA    1 
ATOM   2666 C  C     . LEU C 3 258 ? -5.343  17.645 30.290  1.00 84.50  ? 258 LEU A C     1 
ATOM   2667 O  O     . LEU C 3 258 ? -4.420  16.871 30.046  1.00 84.93  ? 258 LEU A O     1 
ATOM   2668 C  CB    . LEU C 3 258 ? -5.159  19.686 31.674  1.00 82.82  ? 258 LEU A CB    1 
ATOM   2669 C  CG    . LEU C 3 258 ? -4.347  18.853 32.666  1.00 82.22  ? 258 LEU A CG    1 
ATOM   2670 C  CD1   . LEU C 3 258 ? -2.907  18.834 32.219  1.00 83.52  ? 258 LEU A CD1   1 
ATOM   2671 C  CD2   . LEU C 3 258 ? -4.449  19.425 34.070  1.00 81.92  ? 258 LEU A CD2   1 
ATOM   2672 N  N     . GLU C 3 259 ? -6.566  17.228 30.597  1.00 85.61  ? 259 GLU A N     1 
ATOM   2673 C  CA    . GLU C 3 259 ? -6.870  15.800 30.693  1.00 86.09  ? 259 GLU A CA    1 
ATOM   2674 C  C     . GLU C 3 259 ? -6.672  14.997 29.416  1.00 84.89  ? 259 GLU A C     1 
ATOM   2675 O  O     . GLU C 3 259 ? -6.412  13.799 29.479  1.00 85.34  ? 259 GLU A O     1 
ATOM   2676 C  CB    . GLU C 3 259 ? -8.296  15.586 31.216  1.00 87.20  ? 259 GLU A CB    1 
ATOM   2677 C  CG    . GLU C 3 259 ? -8.446  15.856 32.703  1.00 88.21  ? 259 GLU A CG    1 
ATOM   2678 C  CD    . GLU C 3 259 ? -7.448  15.067 33.536  1.00 90.58  ? 259 GLU A CD    1 
ATOM   2679 O  OE1   . GLU C 3 259 ? -7.398  13.822 33.404  1.00 91.31  ? 259 GLU A OE1   1 
ATOM   2680 O  OE2   . GLU C 3 259 ? -6.711  15.698 34.328  1.00 92.16  ? 259 GLU A OE2   1 
ATOM   2681 N  N     . GLU C 3 260 ? -6.799  15.644 28.264  1.00 83.30  ? 260 GLU A N     1 
ATOM   2682 C  CA    . GLU C 3 260 ? -6.618  14.944 27.002  1.00 82.77  ? 260 GLU A CA    1 
ATOM   2683 C  C     . GLU C 3 260 ? -5.130  14.959 26.609  1.00 82.55  ? 260 GLU A C     1 
ATOM   2684 O  O     . GLU C 3 260 ? -4.679  14.205 25.739  1.00 81.49  ? 260 GLU A O     1 
ATOM   2685 C  CB    . GLU C 3 260 ? -7.498  15.592 25.927  1.00 81.70  ? 260 GLU A CB    1 
ATOM   2686 C  CG    . GLU C 3 260 ? -7.209  15.128 24.506  1.00 82.08  ? 260 GLU A CG    1 
ATOM   2687 C  CD    . GLU C 3 260 ? -8.100  15.799 23.476  1.00 82.24  ? 260 GLU A CD    1 
ATOM   2688 O  OE1   . GLU C 3 260 ? -8.479  16.977 23.677  1.00 82.23  ? 260 GLU A OE1   1 
ATOM   2689 O  OE2   . GLU C 3 260 ? -8.409  15.147 22.456  1.00 81.03  ? 260 GLU A OE2   1 
ATOM   2690 N  N     . ILE C 3 261 ? -4.364  15.805 27.282  1.00 82.46  ? 261 ILE A N     1 
ATOM   2691 C  CA    . ILE C 3 261 ? -2.940  15.909 27.014  1.00 83.03  ? 261 ILE A CA    1 
ATOM   2692 C  C     . ILE C 3 261 ? -2.116  15.008 27.945  1.00 83.32  ? 261 ILE A C     1 
ATOM   2693 O  O     . ILE C 3 261 ? -1.094  14.451 27.536  1.00 83.86  ? 261 ILE A O     1 
ATOM   2694 C  CB    . ILE C 3 261 ? -2.471  17.376 27.157  1.00 82.87  ? 261 ILE A CB    1 
ATOM   2695 C  CG1   . ILE C 3 261 ? -2.890  18.175 25.925  1.00 82.98  ? 261 ILE A CG1   1 
ATOM   2696 C  CG2   . ILE C 3 261 ? -0.968  17.438 27.320  1.00 83.59  ? 261 ILE A CG2   1 
ATOM   2697 C  CD1   . ILE C 3 261 ? -2.532  19.639 26.006  1.00 83.74  ? 261 ILE A CD1   1 
ATOM   2698 N  N     . LYS C 3 262 ? -2.568  14.858 29.188  1.00 82.41  ? 262 LYS A N     1 
ATOM   2699 C  CA    . LYS C 3 262 ? -1.863  14.044 30.174  1.00 82.37  ? 262 LYS A CA    1 
ATOM   2700 C  C     . LYS C 3 262 ? -1.266  12.730 29.676  1.00 82.59  ? 262 LYS A C     1 
ATOM   2701 O  O     . LYS C 3 262 ? -0.074  12.486 29.861  1.00 83.50  ? 262 LYS A O     1 
ATOM   2702 C  CB    . LYS C 3 262 ? -2.766  13.755 31.373  1.00 82.84  ? 262 LYS A CB    1 
ATOM   2703 C  CG    . LYS C 3 262 ? -2.866  14.892 32.366  1.00 83.32  ? 262 LYS A CG    1 
ATOM   2704 C  CD    . LYS C 3 262 ? -3.552  14.430 33.648  1.00 83.23  ? 262 LYS A CD    1 
ATOM   2705 C  CE    . LYS C 3 262 ? -3.444  15.477 34.740  1.00 81.98  ? 262 LYS A CE    1 
ATOM   2706 N  NZ    . LYS C 3 262 ? -4.195  15.070 35.948  1.00 82.02  ? 262 LYS A NZ    1 
ATOM   2707 N  N     . PRO C 3 263 ? -2.084  11.857 29.055  1.00 82.09  ? 263 PRO A N     1 
ATOM   2708 C  CA    . PRO C 3 263 ? -1.580  10.572 28.550  1.00 80.79  ? 263 PRO A CA    1 
ATOM   2709 C  C     . PRO C 3 263 ? -0.301  10.696 27.724  1.00 78.62  ? 263 PRO A C     1 
ATOM   2710 O  O     . PRO C 3 263 ? 0.644   9.916  27.901  1.00 78.09  ? 263 PRO A O     1 
ATOM   2711 C  CB    . PRO C 3 263 ? -2.758  10.044 27.737  1.00 81.67  ? 263 PRO A CB    1 
ATOM   2712 C  CG    . PRO C 3 263 ? -3.926  10.507 28.560  1.00 82.82  ? 263 PRO A CG    1 
ATOM   2713 C  CD    . PRO C 3 263 ? -3.543  11.953 28.856  1.00 82.80  ? 263 PRO A CD    1 
ATOM   2714 N  N     . TYR C 3 264 ? -0.277  11.681 26.831  1.00 76.01  ? 264 TYR A N     1 
ATOM   2715 C  CA    . TYR C 3 264 ? 0.883   11.925 25.987  1.00 73.25  ? 264 TYR A CA    1 
ATOM   2716 C  C     . TYR C 3 264 ? 2.090   12.362 26.812  1.00 70.47  ? 264 TYR A C     1 
ATOM   2717 O  O     . TYR C 3 264 ? 3.219   11.952 26.548  1.00 69.17  ? 264 TYR A O     1 
ATOM   2718 C  CB    . TYR C 3 264 ? 0.550   12.992 24.958  1.00 73.89  ? 264 TYR A CB    1 
ATOM   2719 C  CG    . TYR C 3 264 ? -0.419  12.523 23.903  1.00 77.23  ? 264 TYR A CG    1 
ATOM   2720 C  CD1   . TYR C 3 264 ? -0.067  11.509 23.010  1.00 78.81  ? 264 TYR A CD1   1 
ATOM   2721 C  CD2   . TYR C 3 264 ? -1.675  13.112 23.765  1.00 78.87  ? 264 TYR A CD2   1 
ATOM   2722 C  CE1   . TYR C 3 264 ? -0.937  11.102 21.992  1.00 80.45  ? 264 TYR A CE1   1 
ATOM   2723 C  CE2   . TYR C 3 264 ? -2.555  12.712 22.752  1.00 79.89  ? 264 TYR A CE2   1 
ATOM   2724 C  CZ    . TYR C 3 264 ? -2.179  11.707 21.870  1.00 81.09  ? 264 TYR A CZ    1 
ATOM   2725 O  OH    . TYR C 3 264 ? -3.027  11.321 20.852  1.00 82.06  ? 264 TYR A OH    1 
ATOM   2726 N  N     . LEU C 3 265 ? 1.845   13.191 27.818  1.00 68.22  ? 265 LEU A N     1 
ATOM   2727 C  CA    . LEU C 3 265 ? 2.917   13.671 28.671  1.00 66.69  ? 265 LEU A CA    1 
ATOM   2728 C  C     . LEU C 3 265 ? 3.506   12.519 29.479  1.00 65.92  ? 265 LEU A C     1 
ATOM   2729 O  O     . LEU C 3 265 ? 4.726   12.343 29.542  1.00 63.59  ? 265 LEU A O     1 
ATOM   2730 C  CB    . LEU C 3 265 ? 2.402   14.748 29.626  1.00 67.19  ? 265 LEU A CB    1 
ATOM   2731 C  CG    . LEU C 3 265 ? 3.503   15.372 30.486  1.00 67.50  ? 265 LEU A CG    1 
ATOM   2732 C  CD1   . LEU C 3 265 ? 4.294   16.332 29.629  1.00 68.49  ? 265 LEU A CD1   1 
ATOM   2733 C  CD2   . LEU C 3 265 ? 2.918   16.116 31.661  1.00 68.17  ? 265 LEU A CD2   1 
ATOM   2734 N  N     . PHE C 3 266 ? 2.637   11.735 30.108  1.00 65.22  ? 266 PHE A N     1 
ATOM   2735 C  CA    . PHE C 3 266 ? 3.109   10.617 30.904  1.00 65.09  ? 266 PHE A CA    1 
ATOM   2736 C  C     . PHE C 3 266 ? 3.786   9.589  30.006  1.00 65.24  ? 266 PHE A C     1 
ATOM   2737 O  O     . PHE C 3 266 ? 4.788   8.983  30.394  1.00 64.11  ? 266 PHE A O     1 
ATOM   2738 C  CB    . PHE C 3 266 ? 1.960   9.988  31.687  1.00 66.35  ? 266 PHE A CB    1 
ATOM   2739 C  CG    . PHE C 3 266 ? 1.302   10.931 32.661  1.00 68.82  ? 266 PHE A CG    1 
ATOM   2740 C  CD1   . PHE C 3 266 ? 2.029   11.958 33.262  1.00 69.56  ? 266 PHE A CD1   1 
ATOM   2741 C  CD2   . PHE C 3 266 ? -0.033  10.773 33.012  1.00 69.27  ? 266 PHE A CD2   1 
ATOM   2742 C  CE1   . PHE C 3 266 ? 1.436   12.810 34.198  1.00 68.37  ? 266 PHE A CE1   1 
ATOM   2743 C  CE2   . PHE C 3 266 ? -0.630  11.620 33.944  1.00 69.17  ? 266 PHE A CE2   1 
ATOM   2744 C  CZ    . PHE C 3 266 ? 0.107   12.638 34.537  1.00 67.95  ? 266 PHE A CZ    1 
ATOM   2745 N  N     . ARG C 3 267 ? 3.250   9.386  28.804  1.00 65.41  ? 267 ARG A N     1 
ATOM   2746 C  CA    . ARG C 3 267 ? 3.882   8.451  27.880  1.00 64.88  ? 267 ARG A CA    1 
ATOM   2747 C  C     . ARG C 3 267 ? 5.306   8.954  27.647  1.00 64.07  ? 267 ARG A C     1 
ATOM   2748 O  O     . ARG C 3 267 ? 6.276   8.218  27.852  1.00 63.88  ? 267 ARG A O     1 
ATOM   2749 C  CB    . ARG C 3 267 ? 3.114   8.376  26.556  0.50 64.98  ? 267 ARG A CB    1 
ATOM   2750 C  CG    . ARG C 3 267 ? 2.193   7.168  26.454  0.50 65.94  ? 267 ARG A CG    1 
ATOM   2751 C  CD    . ARG C 3 267 ? 1.375   7.178  25.171  0.50 66.18  ? 267 ARG A CD    1 
ATOM   2752 N  NE    . ARG C 3 267 ? 0.134   7.936  25.304  0.50 67.58  ? 267 ARG A NE    1 
ATOM   2753 C  CZ    . ARG C 3 267 ? -0.698  8.177  24.299  0.50 68.19  ? 267 ARG A CZ    1 
ATOM   2754 N  NH1   . ARG C 3 267 ? -0.416  7.718  23.089  0.50 68.57  ? 267 ARG A NH1   1 
ATOM   2755 N  NH2   . ARG C 3 267 ? -1.809  8.873  24.501  0.50 69.54  ? 267 ARG A NH2   1 
ATOM   2756 N  N     . ALA C 3 268 ? 5.429   10.218 27.249  1.00 61.89  ? 268 ALA A N     1 
ATOM   2757 C  CA    . ALA C 3 268 ? 6.740   10.792 27.009  1.00 59.88  ? 268 ALA A CA    1 
ATOM   2758 C  C     . ALA C 3 268 ? 7.632   10.628 28.232  1.00 60.13  ? 268 ALA A C     1 
ATOM   2759 O  O     . ALA C 3 268 ? 8.820   10.347 28.097  1.00 59.36  ? 268 ALA A O     1 
ATOM   2760 C  CB    . ALA C 3 268 ? 6.611   12.239 26.654  1.00 58.52  ? 268 ALA A CB    1 
ATOM   2761 N  N     . ILE C 3 269 ? 7.070   10.792 29.426  1.00 60.91  ? 269 ILE A N     1 
ATOM   2762 C  CA    . ILE C 3 269 ? 7.881   10.655 30.629  1.00 62.74  ? 269 ILE A CA    1 
ATOM   2763 C  C     . ILE C 3 269 ? 8.380   9.223  30.778  1.00 64.17  ? 269 ILE A C     1 
ATOM   2764 O  O     . ILE C 3 269 ? 9.552   8.997  31.107  1.00 65.45  ? 269 ILE A O     1 
ATOM   2765 C  CB    . ILE C 3 269 ? 7.107   11.061 31.903  1.00 62.22  ? 269 ILE A CB    1 
ATOM   2766 C  CG1   . ILE C 3 269 ? 6.801   12.555 31.875  1.00 62.94  ? 269 ILE A CG1   1 
ATOM   2767 C  CG2   . ILE C 3 269 ? 7.932   10.766 33.134  1.00 61.97  ? 269 ILE A CG2   1 
ATOM   2768 C  CD1   . ILE C 3 269 ? 6.062   13.051 33.119  1.00 64.59  ? 269 ILE A CD1   1 
ATOM   2769 N  N     . GLU C 3 270 ? 7.498   8.258  30.533  1.00 64.71  ? 270 GLU A N     1 
ATOM   2770 C  CA    . GLU C 3 270 ? 7.867   6.845  30.631  1.00 65.16  ? 270 GLU A CA    1 
ATOM   2771 C  C     . GLU C 3 270 ? 9.078   6.515  29.773  1.00 64.08  ? 270 GLU A C     1 
ATOM   2772 O  O     . GLU C 3 270 ? 10.102  6.031  30.269  1.00 62.76  ? 270 GLU A O     1 
ATOM   2773 C  CB    . GLU C 3 270 ? 6.697   5.961  30.205  1.00 67.87  ? 270 GLU A CB    1 
ATOM   2774 C  CG    . GLU C 3 270 ? 5.664   5.807  31.288  1.00 72.38  ? 270 GLU A CG    1 
ATOM   2775 C  CD    . GLU C 3 270 ? 6.301   5.413  32.608  1.00 75.86  ? 270 GLU A CD    1 
ATOM   2776 O  OE1   . GLU C 3 270 ? 7.112   4.457  32.607  1.00 77.62  ? 270 GLU A OE1   1 
ATOM   2777 O  OE2   . GLU C 3 270 ? 5.994   6.055  33.640  1.00 76.46  ? 270 GLU A OE2   1 
ATOM   2778 N  N     . GLU C 3 271 ? 8.955   6.779  28.479  1.00 63.54  ? 271 GLU A N     1 
ATOM   2779 C  CA    . GLU C 3 271 ? 10.039  6.510  27.562  1.00 64.13  ? 271 GLU A CA    1 
ATOM   2780 C  C     . GLU C 3 271 ? 11.311  7.222  27.984  1.00 63.48  ? 271 GLU A C     1 
ATOM   2781 O  O     . GLU C 3 271 ? 12.392  6.641  27.925  1.00 63.45  ? 271 GLU A O     1 
ATOM   2782 C  CB    . GLU C 3 271 ? 9.624   6.914  26.158  1.00 67.09  ? 271 GLU A CB    1 
ATOM   2783 C  CG    . GLU C 3 271 ? 8.565   5.974  25.602  1.00 74.32  ? 271 GLU A CG    1 
ATOM   2784 C  CD    . GLU C 3 271 ? 7.891   6.482  24.329  1.00 78.10  ? 271 GLU A CD    1 
ATOM   2785 O  OE1   . GLU C 3 271 ? 8.619   6.966  23.420  1.00 78.46  ? 271 GLU A OE1   1 
ATOM   2786 O  OE2   . GLU C 3 271 ? 6.636   6.377  24.242  1.00 78.21  ? 271 GLU A OE2   1 
ATOM   2787 N  N     . SER C 3 272 ? 11.179  8.471  28.435  1.00 62.91  ? 272 SER A N     1 
ATOM   2788 C  CA    . SER C 3 272 ? 12.328  9.264  28.868  1.00 60.76  ? 272 SER A CA    1 
ATOM   2789 C  C     . SER C 3 272 ? 13.050  8.615  30.032  1.00 61.05  ? 272 SER A C     1 
ATOM   2790 O  O     . SER C 3 272 ? 14.279  8.546  30.063  1.00 58.04  ? 272 SER A O     1 
ATOM   2791 C  CB    . SER C 3 272 ? 11.874  10.650 29.268  1.00 59.30  ? 272 SER A CB    1 
ATOM   2792 O  OG    . SER C 3 272 ? 11.178  11.254 28.200  1.00 59.13  ? 272 SER A OG    1 
ATOM   2793 N  N     . TYR C 3 273 ? 12.280  8.132  30.997  1.00 63.65  ? 273 TYR A N     1 
ATOM   2794 C  CA    . TYR C 3 273 ? 12.883  7.485  32.144  1.00 65.81  ? 273 TYR A CA    1 
ATOM   2795 C  C     . TYR C 3 273 ? 13.563  6.184  31.759  1.00 67.94  ? 273 TYR A C     1 
ATOM   2796 O  O     . TYR C 3 273 ? 14.569  5.800  32.351  1.00 68.06  ? 273 TYR A O     1 
ATOM   2797 C  CB    . TYR C 3 273 ? 11.833  7.263  33.208  1.00 65.34  ? 273 TYR A CB    1 
ATOM   2798 C  CG    . TYR C 3 273 ? 11.991  8.263  34.302  1.00 65.97  ? 273 TYR A CG    1 
ATOM   2799 C  CD1   . TYR C 3 273 ? 12.752  7.970  35.431  1.00 65.57  ? 273 TYR A CD1   1 
ATOM   2800 C  CD2   . TYR C 3 273 ? 11.451  9.536  34.175  1.00 66.98  ? 273 TYR A CD2   1 
ATOM   2801 C  CE1   . TYR C 3 273 ? 12.978  8.922  36.404  1.00 67.93  ? 273 TYR A CE1   1 
ATOM   2802 C  CE2   . TYR C 3 273 ? 11.672  10.500 35.136  1.00 69.17  ? 273 TYR A CE2   1 
ATOM   2803 C  CZ    . TYR C 3 273 ? 12.434  10.186 36.251  1.00 69.26  ? 273 TYR A CZ    1 
ATOM   2804 O  OH    . TYR C 3 273 ? 12.643  11.141 37.215  1.00 71.27  ? 273 TYR A OH    1 
ATOM   2805 N  N     . TYR C 3 274 ? 13.008  5.510  30.760  1.00 69.32  ? 274 TYR A N     1 
ATOM   2806 C  CA    . TYR C 3 274 ? 13.594  4.285  30.280  1.00 70.46  ? 274 TYR A CA    1 
ATOM   2807 C  C     . TYR C 3 274 ? 14.961  4.679  29.728  1.00 70.05  ? 274 TYR A C     1 
ATOM   2808 O  O     . TYR C 3 274 ? 15.965  4.132  30.150  1.00 70.95  ? 274 TYR A O     1 
ATOM   2809 C  CB    . TYR C 3 274 ? 12.712  3.686  29.186  1.00 74.65  ? 274 TYR A CB    1 
ATOM   2810 C  CG    . TYR C 3 274 ? 13.338  2.538  28.423  1.00 80.16  ? 274 TYR A CG    1 
ATOM   2811 C  CD1   . TYR C 3 274 ? 13.572  1.302  29.034  1.00 81.44  ? 274 TYR A CD1   1 
ATOM   2812 C  CD2   . TYR C 3 274 ? 13.701  2.691  27.075  1.00 83.17  ? 274 TYR A CD2   1 
ATOM   2813 C  CE1   . TYR C 3 274 ? 14.151  0.239  28.316  1.00 84.35  ? 274 TYR A CE1   1 
ATOM   2814 C  CE2   . TYR C 3 274 ? 14.281  1.640  26.349  1.00 85.33  ? 274 TYR A CE2   1 
ATOM   2815 C  CZ    . TYR C 3 274 ? 14.504  0.417  26.975  1.00 85.92  ? 274 TYR A CZ    1 
ATOM   2816 O  OH    . TYR C 3 274 ? 15.073  -0.616 26.258  1.00 86.80  ? 274 TYR A OH    1 
ATOM   2817 N  N     . LYS C 3 275 ? 15.000  5.645  28.810  1.00 69.22  ? 275 LYS A N     1 
ATOM   2818 C  CA    . LYS C 3 275 ? 16.258  6.098  28.216  1.00 69.07  ? 275 LYS A CA    1 
ATOM   2819 C  C     . LYS C 3 275 ? 17.256  6.665  29.236  1.00 71.20  ? 275 LYS A C     1 
ATOM   2820 O  O     . LYS C 3 275 ? 18.464  6.656  28.996  1.00 70.37  ? 275 LYS A O     1 
ATOM   2821 C  CB    . LYS C 3 275 ? 16.019  7.186  27.180  1.00 68.57  ? 275 LYS A CB    1 
ATOM   2822 C  CG    . LYS C 3 275 ? 15.100  6.873  26.011  1.00 70.13  ? 275 LYS A CG    1 
ATOM   2823 C  CD    . LYS C 3 275 ? 15.127  8.123  25.090  1.00 71.48  ? 275 LYS A CD    1 
ATOM   2824 C  CE    . LYS C 3 275 ? 14.100  8.153  23.965  1.00 69.11  ? 275 LYS A CE    1 
ATOM   2825 N  NZ    . LYS C 3 275 ? 14.194  9.460  23.254  1.00 62.48  ? 275 LYS A NZ    1 
ATOM   2826 N  N     . LEU C 3 276 ? 16.763  7.192  30.357  1.00 73.56  ? 276 LEU A N     1 
ATOM   2827 C  CA    . LEU C 3 276 ? 17.662  7.751  31.374  1.00 75.00  ? 276 LEU A CA    1 
ATOM   2828 C  C     . LEU C 3 276 ? 18.602  6.689  31.934  1.00 76.63  ? 276 LEU A C     1 
ATOM   2829 O  O     . LEU C 3 276 ? 19.797  6.930  32.090  1.00 77.28  ? 276 LEU A O     1 
ATOM   2830 C  CB    . LEU C 3 276 ? 16.871  8.383  32.521  1.00 73.52  ? 276 LEU A CB    1 
ATOM   2831 C  CG    . LEU C 3 276 ? 16.423  9.841  32.403  1.00 71.97  ? 276 LEU A CG    1 
ATOM   2832 C  CD1   . LEU C 3 276 ? 15.754  10.250 33.702  1.00 71.01  ? 276 LEU A CD1   1 
ATOM   2833 C  CD2   . LEU C 3 276 ? 17.615  10.737 32.133  1.00 70.51  ? 276 LEU A CD2   1 
ATOM   2834 N  N     . ASP C 3 277 ? 18.040  5.520  32.235  1.00 79.07  ? 277 ASP A N     1 
ATOM   2835 C  CA    . ASP C 3 277 ? 18.781  4.378  32.763  1.00 80.76  ? 277 ASP A CA    1 
ATOM   2836 C  C     . ASP C 3 277 ? 20.013  4.710  33.595  1.00 80.38  ? 277 ASP A C     1 
ATOM   2837 O  O     . ASP C 3 277 ? 21.116  4.889  33.064  1.00 79.98  ? 277 ASP A O     1 
ATOM   2838 C  CB    . ASP C 3 277 ? 19.191  3.444  31.619  1.00 83.79  ? 277 ASP A CB    1 
ATOM   2839 C  CG    . ASP C 3 277 ? 20.130  2.335  32.078  1.00 87.11  ? 277 ASP A CG    1 
ATOM   2840 O  OD1   . ASP C 3 277 ? 19.747  1.568  32.996  1.00 85.95  ? 277 ASP A OD1   1 
ATOM   2841 O  OD2   . ASP C 3 277 ? 21.251  2.238  31.516  1.00 89.28  ? 277 ASP A OD2   1 
ATOM   2842 N  N     . LYS C 3 278 ? 19.805  4.781  34.906  1.00 79.76  ? 278 LYS A N     1 
ATOM   2843 C  CA    . LYS C 3 278 ? 20.866  5.048  35.870  1.00 79.24  ? 278 LYS A CA    1 
ATOM   2844 C  C     . LYS C 3 278 ? 21.249  6.513  36.040  1.00 77.26  ? 278 LYS A C     1 
ATOM   2845 O  O     . LYS C 3 278 ? 21.888  6.870  37.023  1.00 77.16  ? 278 LYS A O     1 
ATOM   2846 C  CB    . LYS C 3 278 ? 22.116  4.215  35.535  1.00 81.57  ? 278 LYS A CB    1 
ATOM   2847 C  CG    . LYS C 3 278 ? 21.858  2.701  35.409  1.00 84.03  ? 278 LYS A CG    1 
ATOM   2848 C  CD    . LYS C 3 278 ? 21.134  2.150  36.633  1.00 87.45  ? 278 LYS A CD    1 
ATOM   2849 C  CE    . LYS C 3 278 ? 20.610  0.740  36.399  1.00 89.44  ? 278 LYS A CE    1 
ATOM   2850 N  NZ    . LYS C 3 278 ? 19.654  0.347  37.481  1.00 91.04  ? 278 LYS A NZ    1 
ATOM   2851 N  N     . ARG C 3 279 ? 20.874  7.363  35.094  1.00 75.42  ? 279 ARG A N     1 
ATOM   2852 C  CA    . ARG C 3 279 ? 21.180  8.788  35.216  1.00 73.08  ? 279 ARG A CA    1 
ATOM   2853 C  C     . ARG C 3 279 ? 20.049  9.501  35.953  1.00 70.94  ? 279 ARG A C     1 
ATOM   2854 O  O     . ARG C 3 279 ? 18.873  9.382  35.595  1.00 71.04  ? 279 ARG A O     1 
ATOM   2855 C  CB    . ARG C 3 279 ? 21.403  9.411  33.836  1.00 74.11  ? 279 ARG A CB    1 
ATOM   2856 C  CG    . ARG C 3 279 ? 22.815  9.205  33.301  1.00 74.58  ? 279 ARG A CG    1 
ATOM   2857 C  CD    . ARG C 3 279 ? 22.902  9.570  31.842  1.00 74.53  ? 279 ARG A CD    1 
ATOM   2858 N  NE    . ARG C 3 279 ? 21.894  8.838  31.092  1.00 75.74  ? 279 ARG A NE    1 
ATOM   2859 C  CZ    . ARG C 3 279 ? 22.039  8.444  29.832  1.00 77.44  ? 279 ARG A CZ    1 
ATOM   2860 N  NH1   . ARG C 3 279 ? 23.165  8.716  29.174  1.00 77.59  ? 279 ARG A NH1   1 
ATOM   2861 N  NH2   . ARG C 3 279 ? 21.063  7.760  29.237  1.00 77.64  ? 279 ARG A NH2   1 
ATOM   2862 N  N     . ILE C 3 280 ? 20.407  10.245 36.989  1.00 68.80  ? 280 ILE A N     1 
ATOM   2863 C  CA    . ILE C 3 280 ? 19.399  10.931 37.779  1.00 67.02  ? 280 ILE A CA    1 
ATOM   2864 C  C     . ILE C 3 280 ? 19.373  12.403 37.448  1.00 64.87  ? 280 ILE A C     1 
ATOM   2865 O  O     . ILE C 3 280 ? 20.376  13.097 37.599  1.00 64.35  ? 280 ILE A O     1 
ATOM   2866 C  CB    . ILE C 3 280 ? 19.661  10.776 39.302  1.00 68.55  ? 280 ILE A CB    1 
ATOM   2867 C  CG1   . ILE C 3 280 ? 19.987  9.315  39.644  1.00 69.37  ? 280 ILE A CG1   1 
ATOM   2868 C  CG2   . ILE C 3 280 ? 18.430  11.234 40.090  1.00 68.46  ? 280 ILE A CG2   1 
ATOM   2869 C  CD1   . ILE C 3 280 ? 18.867  8.329  39.348  1.00 70.97  ? 280 ILE A CD1   1 
ATOM   2870 N  N     . PRO C 3 281 ? 18.222  12.901 36.983  1.00 63.27  ? 281 PRO A N     1 
ATOM   2871 C  CA    . PRO C 3 281 ? 18.093  14.311 36.634  1.00 63.49  ? 281 PRO A CA    1 
ATOM   2872 C  C     . PRO C 3 281 ? 17.637  15.154 37.829  1.00 64.13  ? 281 PRO A C     1 
ATOM   2873 O  O     . PRO C 3 281 ? 16.944  14.654 38.713  1.00 65.35  ? 281 PRO A O     1 
ATOM   2874 C  CB    . PRO C 3 281 ? 17.054  14.278 35.526  1.00 61.73  ? 281 PRO A CB    1 
ATOM   2875 C  CG    . PRO C 3 281 ? 16.121  13.239 36.010  1.00 60.14  ? 281 PRO A CG    1 
ATOM   2876 C  CD    . PRO C 3 281 ? 17.055  12.142 36.495  1.00 62.21  ? 281 PRO A CD    1 
ATOM   2877 N  N     . LYS C 3 282 ? 18.041  16.428 37.848  1.00 63.57  ? 282 LYS A N     1 
ATOM   2878 C  CA    . LYS C 3 282 ? 17.659  17.369 38.905  1.00 60.70  ? 282 LYS A CA    1 
ATOM   2879 C  C     . LYS C 3 282 ? 16.813  18.474 38.276  1.00 58.22  ? 282 LYS A C     1 
ATOM   2880 O  O     . LYS C 3 282 ? 16.336  19.362 38.971  1.00 57.82  ? 282 LYS A O     1 
ATOM   2881 C  CB    . LYS C 3 282 ? 18.895  18.006 39.554  1.00 62.04  ? 282 LYS A CB    1 
ATOM   2882 C  CG    . LYS C 3 282 ? 19.881  17.020 40.161  1.00 65.27  ? 282 LYS A CG    1 
ATOM   2883 C  CD    . LYS C 3 282 ? 20.871  17.724 41.083  1.00 67.75  ? 282 LYS A CD    1 
ATOM   2884 C  CE    . LYS C 3 282 ? 21.698  18.785 40.362  1.00 69.10  ? 282 LYS A CE    1 
ATOM   2885 N  NZ    . LYS C 3 282 ? 22.690  18.181 39.438  1.00 71.01  ? 282 LYS A NZ    1 
ATOM   2886 N  N     . ALA C 3 283 ? 16.637  18.421 36.957  1.00 55.60  ? 283 ALA A N     1 
ATOM   2887 C  CA    . ALA C 3 283 ? 15.861  19.431 36.235  1.00 53.99  ? 283 ALA A CA    1 
ATOM   2888 C  C     . ALA C 3 283 ? 14.941  18.793 35.210  1.00 53.34  ? 283 ALA A C     1 
ATOM   2889 O  O     . ALA C 3 283 ? 15.363  17.940 34.435  1.00 53.13  ? 283 ALA A O     1 
ATOM   2890 C  CB    . ALA C 3 283 ? 16.805  20.407 35.533  1.00 54.80  ? 283 ALA A CB    1 
ATOM   2891 N  N     . ILE C 3 284 ? 13.690  19.226 35.188  1.00 52.66  ? 284 ILE A N     1 
ATOM   2892 C  CA    . ILE C 3 284 ? 12.718  18.673 34.260  1.00 54.10  ? 284 ILE A CA    1 
ATOM   2893 C  C     . ILE C 3 284 ? 12.041  19.787 33.481  1.00 54.36  ? 284 ILE A C     1 
ATOM   2894 O  O     . ILE C 3 284 ? 11.574  20.749 34.067  1.00 55.60  ? 284 ILE A O     1 
ATOM   2895 C  CB    . ILE C 3 284 ? 11.657  17.827 35.034  1.00 53.70  ? 284 ILE A CB    1 
ATOM   2896 C  CG1   . ILE C 3 284 ? 10.481  17.450 34.121  1.00 54.50  ? 284 ILE A CG1   1 
ATOM   2897 C  CG2   . ILE C 3 284 ? 11.193  18.586 36.257  1.00 52.93  ? 284 ILE A CG2   1 
ATOM   2898 C  CD1   . ILE C 3 284 ? 9.391   16.619 34.800  1.00 51.96  ? 284 ILE A CD1   1 
ATOM   2899 N  N     . HIS C 3 285 ? 11.996  19.662 32.159  1.00 54.89  ? 285 HIS A N     1 
ATOM   2900 C  CA    . HIS C 3 285 ? 11.369  20.676 31.310  1.00 55.65  ? 285 HIS A CA    1 
ATOM   2901 C  C     . HIS C 3 285 ? 10.254  20.083 30.473  1.00 56.73  ? 285 HIS A C     1 
ATOM   2902 O  O     . HIS C 3 285 ? 10.470  19.073 29.796  1.00 58.89  ? 285 HIS A O     1 
ATOM   2903 C  CB    . HIS C 3 285 ? 12.391  21.259 30.349  1.00 55.53  ? 285 HIS A CB    1 
ATOM   2904 C  CG    . HIS C 3 285 ? 13.313  22.257 30.966  1.00 58.07  ? 285 HIS A CG    1 
ATOM   2905 N  ND1   . HIS C 3 285 ? 13.117  23.612 30.861  1.00 56.62  ? 285 HIS A ND1   1 
ATOM   2906 C  CD2   . HIS C 3 285 ? 14.490  22.095 31.629  1.00 60.36  ? 285 HIS A CD2   1 
ATOM   2907 C  CE1   . HIS C 3 285 ? 14.133  24.252 31.418  1.00 59.17  ? 285 HIS A CE1   1 
ATOM   2908 N  NE2   . HIS C 3 285 ? 14.978  23.351 31.889  1.00 60.80  ? 285 HIS A NE2   1 
ATOM   2909 N  N     . VAL C 3 286 ? 9.076   20.698 30.499  1.00 55.72  ? 286 VAL A N     1 
ATOM   2910 C  CA    . VAL C 3 286 ? 7.966   20.206 29.686  1.00 57.15  ? 286 VAL A CA    1 
ATOM   2911 C  C     . VAL C 3 286 ? 7.972   21.017 28.415  1.00 58.71  ? 286 VAL A C     1 
ATOM   2912 O  O     . VAL C 3 286 ? 7.856   22.234 28.456  1.00 61.25  ? 286 VAL A O     1 
ATOM   2913 C  CB    . VAL C 3 286 ? 6.601   20.409 30.352  1.00 55.73  ? 286 VAL A CB    1 
ATOM   2914 C  CG1   . VAL C 3 286 ? 5.507   20.060 29.370  1.00 56.08  ? 286 VAL A CG1   1 
ATOM   2915 C  CG2   . VAL C 3 286 ? 6.480   19.543 31.588  1.00 55.76  ? 286 VAL A CG2   1 
ATOM   2916 N  N     . VAL C 3 287 ? 8.105   20.352 27.279  1.00 62.17  ? 287 VAL A N     1 
ATOM   2917 C  CA    . VAL C 3 287 ? 8.148   21.061 26.000  1.00 64.04  ? 287 VAL A CA    1 
ATOM   2918 C  C     . VAL C 3 287 ? 6.868   20.895 25.190  1.00 66.12  ? 287 VAL A C     1 
ATOM   2919 O  O     . VAL C 3 287 ? 6.275   19.816 25.139  1.00 66.94  ? 287 VAL A O     1 
ATOM   2920 C  CB    . VAL C 3 287 ? 9.347   20.589 25.120  1.00 61.42  ? 287 VAL A CB    1 
ATOM   2921 C  CG1   . VAL C 3 287 ? 9.441   21.439 23.887  1.00 61.04  ? 287 VAL A CG1   1 
ATOM   2922 C  CG2   . VAL C 3 287 ? 10.651  20.679 25.895  1.00 60.58  ? 287 VAL A CG2   1 
ATOM   2923 N  N     . ALA C 3 288 ? 6.455   21.980 24.548  1.00 69.07  ? 288 ALA A N     1 
ATOM   2924 C  CA    . ALA C 3 288 ? 5.261   21.963 23.725  1.00 70.65  ? 288 ALA A CA    1 
ATOM   2925 C  C     . ALA C 3 288 ? 5.517   22.587 22.357  1.00 72.01  ? 288 ALA A C     1 
ATOM   2926 O  O     . ALA C 3 288 ? 6.242   23.576 22.220  1.00 69.84  ? 288 ALA A O     1 
ATOM   2927 C  CB    . ALA C 3 288 ? 4.122   22.698 24.442  1.00 70.91  ? 288 ALA A CB    1 
ATOM   2928 N  N     . VAL C 3 289 ? 4.915   21.977 21.346  1.00 75.14  ? 289 VAL A N     1 
ATOM   2929 C  CA    . VAL C 3 289 ? 5.015   22.444 19.976  1.00 79.16  ? 289 VAL A CA    1 
ATOM   2930 C  C     . VAL C 3 289 ? 3.610   22.879 19.587  1.00 81.47  ? 289 VAL A C     1 
ATOM   2931 O  O     . VAL C 3 289 ? 2.803   22.074 19.115  1.00 82.07  ? 289 VAL A O     1 
ATOM   2932 C  CB    . VAL C 3 289 ? 5.482   21.317 19.026  1.00 80.60  ? 289 VAL A CB    1 
ATOM   2933 C  CG1   . VAL C 3 289 ? 5.390   21.771 17.580  1.00 81.52  ? 289 VAL A CG1   1 
ATOM   2934 C  CG2   . VAL C 3 289 ? 6.906   20.922 19.356  1.00 81.45  ? 289 VAL A CG2   1 
ATOM   2935 N  N     . THR C 3 290 ? 3.325   24.158 19.813  1.00 83.28  ? 290 THR A N     1 
ATOM   2936 C  CA    . THR C 3 290 ? 2.029   24.752 19.507  1.00 83.73  ? 290 THR A CA    1 
ATOM   2937 C  C     . THR C 3 290 ? 1.542   24.419 18.093  1.00 84.96  ? 290 THR A C     1 
ATOM   2938 O  O     . THR C 3 290 ? 2.325   24.028 17.224  1.00 83.73  ? 290 THR A O     1 
ATOM   2939 C  CB    . THR C 3 290 ? 2.101   26.275 19.671  1.00 83.35  ? 290 THR A CB    1 
ATOM   2940 O  OG1   . THR C 3 290 ? 2.894   26.834 18.617  1.00 83.93  ? 290 THR A OG1   1 
ATOM   2941 C  CG2   . THR C 3 290 ? 2.747   26.629 21.001  1.00 82.29  ? 290 THR A CG2   1 
ATOM   2942 N  N     . GLU C 3 291 ? 0.240   24.570 17.878  1.00 87.32  ? 291 GLU A N     1 
ATOM   2943 C  CA    . GLU C 3 291 ? -0.374  24.286 16.585  1.00 90.13  ? 291 GLU A CA    1 
ATOM   2944 C  C     . GLU C 3 291 ? 0.360   25.003 15.456  1.00 91.29  ? 291 GLU A C     1 
ATOM   2945 O  O     . GLU C 3 291 ? 0.546   24.434 14.376  1.00 91.95  ? 291 GLU A O     1 
ATOM   2946 C  CB    . GLU C 3 291 ? -1.853  24.695 16.612  1.00 90.48  ? 291 GLU A CB    1 
ATOM   2947 C  CG    . GLU C 3 291 ? -2.064  26.100 17.153  1.00 92.91  ? 291 GLU A CG    1 
ATOM   2948 C  CD    . GLU C 3 291 ? -3.507  26.412 17.471  1.00 92.97  ? 291 GLU A CD    1 
ATOM   2949 O  OE1   . GLU C 3 291 ? -3.745  27.501 18.045  1.00 93.87  ? 291 GLU A OE1   1 
ATOM   2950 O  OE2   . GLU C 3 291 ? -4.391  25.580 17.149  1.00 91.80  ? 291 GLU A OE2   1 
ATOM   2951 N  N     . ASP C 3 292 ? 0.785   26.243 15.714  1.00 92.30  ? 292 ASP A N     1 
ATOM   2952 C  CA    . ASP C 3 292 ? 1.500   27.031 14.714  1.00 92.74  ? 292 ASP A CA    1 
ATOM   2953 C  C     . ASP C 3 292 ? 3.001   26.740 14.687  1.00 92.37  ? 292 ASP A C     1 
ATOM   2954 O  O     . ASP C 3 292 ? 3.791   27.539 14.186  1.00 93.30  ? 292 ASP A O     1 
ATOM   2955 C  CB    . ASP C 3 292 ? 1.245   28.533 14.913  1.00 93.86  ? 292 ASP A CB    1 
ATOM   2956 C  CG    . ASP C 3 292 ? 1.611   29.018 16.300  1.00 96.81  ? 292 ASP A CG    1 
ATOM   2957 O  OD1   . ASP C 3 292 ? 1.019   28.517 17.280  1.00 98.61  ? 292 ASP A OD1   1 
ATOM   2958 O  OD2   . ASP C 3 292 ? 2.485   29.909 16.412  1.00 97.50  ? 292 ASP A OD2   1 
ATOM   2959 N  N     . LEU C 3 293 ? 3.377   25.591 15.248  1.00 91.80  ? 293 LEU A N     1 
ATOM   2960 C  CA    . LEU C 3 293 ? 4.758   25.096 15.263  1.00 90.34  ? 293 LEU A CA    1 
ATOM   2961 C  C     . LEU C 3 293 ? 5.836   25.799 16.091  1.00 88.97  ? 293 LEU A C     1 
ATOM   2962 O  O     . LEU C 3 293 ? 7.006   25.429 16.014  1.00 87.89  ? 293 LEU A O     1 
ATOM   2963 C  CB    . LEU C 3 293 ? 5.247   24.937 13.817  1.00 90.19  ? 293 LEU A CB    1 
ATOM   2964 C  CG    . LEU C 3 293 ? 4.310   24.113 12.920  1.00 90.37  ? 293 LEU A CG    1 
ATOM   2965 C  CD1   . LEU C 3 293 ? 4.938   23.916 11.542  1.00 91.03  ? 293 LEU A CD1   1 
ATOM   2966 C  CD2   . LEU C 3 293 ? 4.025   22.764 13.564  1.00 89.35  ? 293 LEU A CD2   1 
ATOM   2967 N  N     . ASP C 3 294 ? 5.457   26.801 16.875  1.00 89.12  ? 294 ASP A N     1 
ATOM   2968 C  CA    . ASP C 3 294 ? 6.420   27.503 17.736  1.00 88.90  ? 294 ASP A CA    1 
ATOM   2969 C  C     . ASP C 3 294 ? 6.785   26.511 18.845  1.00 86.60  ? 294 ASP A C     1 
ATOM   2970 O  O     . ASP C 3 294 ? 6.074   25.529 19.054  1.00 88.10  ? 294 ASP A O     1 
ATOM   2971 C  CB    . ASP C 3 294 ? 5.769   28.754 18.364  1.00 91.00  ? 294 ASP A CB    1 
ATOM   2972 C  CG    . ASP C 3 294 ? 6.345   30.073 17.825  1.00 93.39  ? 294 ASP A CG    1 
ATOM   2973 O  OD1   . ASP C 3 294 ? 6.390   30.250 16.580  1.00 95.12  ? 294 ASP A OD1   1 
ATOM   2974 O  OD2   . ASP C 3 294 ? 6.741   30.934 18.654  1.00 92.36  ? 294 ASP A OD2   1 
ATOM   2975 N  N     . ILE C 3 295 ? 7.882   26.737 19.552  1.00 82.89  ? 295 ILE A N     1 
ATOM   2976 C  CA    . ILE C 3 295 ? 8.228   25.818 20.628  1.00 80.57  ? 295 ILE A CA    1 
ATOM   2977 C  C     . ILE C 3 295 ? 8.146   26.514 21.983  1.00 81.01  ? 295 ILE A C     1 
ATOM   2978 O  O     . ILE C 3 295 ? 8.859   27.490 22.230  1.00 82.42  ? 295 ILE A O     1 
ATOM   2979 C  CB    . ILE C 3 295 ? 9.649   25.252 20.483  1.00 77.92  ? 295 ILE A CB    1 
ATOM   2980 C  CG1   . ILE C 3 295 ? 9.815   24.538 19.150  1.00 76.45  ? 295 ILE A CG1   1 
ATOM   2981 C  CG2   . ILE C 3 295 ? 9.905   24.241 21.571  1.00 77.58  ? 295 ILE A CG2   1 
ATOM   2982 C  CD1   . ILE C 3 295 ? 11.218  24.004 18.963  1.00 73.33  ? 295 ILE A CD1   1 
ATOM   2983 N  N     . VAL C 3 296 ? 7.285   26.017 22.866  1.00 79.62  ? 296 VAL A N     1 
ATOM   2984 C  CA    . VAL C 3 296 ? 7.159   26.620 24.186  1.00 78.08  ? 296 VAL A CA    1 
ATOM   2985 C  C     . VAL C 3 296 ? 7.593   25.617 25.244  1.00 77.42  ? 296 VAL A C     1 
ATOM   2986 O  O     . VAL C 3 296 ? 7.393   24.416 25.074  1.00 77.57  ? 296 VAL A O     1 
ATOM   2987 C  CB    . VAL C 3 296 ? 5.718   27.065 24.451  1.00 77.90  ? 296 VAL A CB    1 
ATOM   2988 C  CG1   . VAL C 3 296 ? 5.653   27.861 25.750  1.00 77.92  ? 296 VAL A CG1   1 
ATOM   2989 C  CG2   . VAL C 3 296 ? 5.219   27.905 23.281  1.00 76.63  ? 296 VAL A CG2   1 
ATOM   2990 N  N     . SER C 3 297 ? 8.178   26.103 26.339  1.00 76.73  ? 297 SER A N     1 
ATOM   2991 C  CA    . SER C 3 297 ? 8.661   25.212 27.396  1.00 75.82  ? 297 SER A CA    1 
ATOM   2992 C  C     . SER C 3 297 ? 8.721   25.850 28.788  1.00 75.23  ? 297 SER A C     1 
ATOM   2993 O  O     . SER C 3 297 ? 8.874   27.065 28.907  1.00 76.06  ? 297 SER A O     1 
ATOM   2994 C  CB    . SER C 3 297 ? 10.062  24.722 27.034  1.00 75.89  ? 297 SER A CB    1 
ATOM   2995 O  OG    . SER C 3 297 ? 10.996  25.783 27.144  1.00 73.53  ? 297 SER A OG    1 
ATOM   2996 N  N     . ARG C 3 298 ? 8.622   25.024 29.831  1.00 73.63  ? 298 ARG A N     1 
ATOM   2997 C  CA    . ARG C 3 298 ? 8.695   25.492 31.218  1.00 72.39  ? 298 ARG A CA    1 
ATOM   2998 C  C     . ARG C 3 298 ? 9.408   24.421 32.049  1.00 70.87  ? 298 ARG A C     1 
ATOM   2999 O  O     . ARG C 3 298 ? 9.116   23.232 31.919  1.00 71.31  ? 298 ARG A O     1 
ATOM   3000 C  CB    . ARG C 3 298 ? 7.287   25.756 31.768  1.00 74.03  ? 298 ARG A CB    1 
ATOM   3001 C  CG    . ARG C 3 298 ? 6.500   26.832 31.009  1.00 77.14  ? 298 ARG A CG    1 
ATOM   3002 C  CD    . ARG C 3 298 ? 7.189   28.190 31.096  1.00 81.01  ? 298 ARG A CD    1 
ATOM   3003 N  NE    . ARG C 3 298 ? 6.470   29.295 30.455  1.00 85.71  ? 298 ARG A NE    1 
ATOM   3004 C  CZ    . ARG C 3 298 ? 6.361   29.483 29.137  1.00 88.62  ? 298 ARG A CZ    1 
ATOM   3005 N  NH1   . ARG C 3 298 ? 6.927   28.640 28.283  1.00 90.28  ? 298 ARG A NH1   1 
ATOM   3006 N  NH2   . ARG C 3 298 ? 5.679   30.523 28.665  1.00 88.02  ? 298 ARG A NH2   1 
ATOM   3007 N  N     . GLY C 3 299 ? 10.337  24.831 32.907  1.00 69.42  ? 299 GLY A N     1 
ATOM   3008 C  CA    . GLY C 3 299 ? 11.082  23.853 33.691  1.00 68.73  ? 299 GLY A CA    1 
ATOM   3009 C  C     . GLY C 3 299 ? 11.210  24.077 35.186  1.00 68.03  ? 299 GLY A C     1 
ATOM   3010 O  O     . GLY C 3 299 ? 10.519  24.912 35.753  1.00 68.36  ? 299 GLY A O     1 
ATOM   3011 N  N     . ARG C 3 300 ? 12.089  23.309 35.822  1.00 67.63  ? 300 ARG A N     1 
ATOM   3012 C  CA    . ARG C 3 300 ? 12.319  23.409 37.257  1.00 69.30  ? 300 ARG A CA    1 
ATOM   3013 C  C     . ARG C 3 300 ? 13.513  22.605 37.716  1.00 69.30  ? 300 ARG A C     1 
ATOM   3014 O  O     . ARG C 3 300 ? 13.668  21.445 37.343  1.00 68.79  ? 300 ARG A O     1 
ATOM   3015 C  CB    . ARG C 3 300 ? 11.115  22.922 38.066  1.00 71.55  ? 300 ARG A CB    1 
ATOM   3016 C  CG    . ARG C 3 300 ? 11.457  22.706 39.546  1.00 73.91  ? 300 ARG A CG    1 
ATOM   3017 C  CD    . ARG C 3 300 ? 10.227  22.678 40.426  1.00 78.57  ? 300 ARG A CD    1 
ATOM   3018 N  NE    . ARG C 3 300 ? 10.570  22.614 41.847  1.00 82.81  ? 300 ARG A NE    1 
ATOM   3019 C  CZ    . ARG C 3 300 ? 9.692   22.749 42.844  1.00 85.56  ? 300 ARG A CZ    1 
ATOM   3020 N  NH1   . ARG C 3 300 ? 8.400   22.959 42.582  1.00 86.22  ? 300 ARG A NH1   1 
ATOM   3021 N  NH2   . ARG C 3 300 ? 10.104  22.667 44.107  1.00 85.02  ? 300 ARG A NH2   1 
ATOM   3022 N  N     . THR C 3 301 ? 14.345  23.218 38.550  1.00 70.06  ? 301 THR A N     1 
ATOM   3023 C  CA    . THR C 3 301 ? 15.513  22.529 39.074  1.00 71.01  ? 301 THR A CA    1 
ATOM   3024 C  C     . THR C 3 301 ? 15.322  22.191 40.551  1.00 71.88  ? 301 THR A C     1 
ATOM   3025 O  O     . THR C 3 301 ? 14.882  23.025 41.334  1.00 73.14  ? 301 THR A O     1 
ATOM   3026 C  CB    . THR C 3 301 ? 16.781  23.369 38.888  1.00 69.31  ? 301 THR A CB    1 
ATOM   3027 O  OG1   . THR C 3 301 ? 16.947  23.659 37.494  1.00 68.58  ? 301 THR A OG1   1 
ATOM   3028 C  CG2   . THR C 3 301 ? 17.996  22.603 39.391  1.00 67.51  ? 301 THR A CG2   1 
ATOM   3029 N  N     . PHE C 3 302 ? 15.627  20.953 40.920  1.00 72.84  ? 302 PHE A N     1 
ATOM   3030 C  CA    . PHE C 3 302 ? 15.485  20.523 42.304  1.00 73.88  ? 302 PHE A CA    1 
ATOM   3031 C  C     . PHE C 3 302 ? 16.864  20.365 42.917  1.00 73.76  ? 302 PHE A C     1 
ATOM   3032 O  O     . PHE C 3 302 ? 17.843  20.102 42.222  1.00 74.81  ? 302 PHE A O     1 
ATOM   3033 C  CB    . PHE C 3 302 ? 14.725  19.185 42.403  1.00 73.56  ? 302 PHE A CB    1 
ATOM   3034 C  CG    . PHE C 3 302 ? 13.255  19.287 42.070  1.00 74.24  ? 302 PHE A CG    1 
ATOM   3035 C  CD1   . PHE C 3 302 ? 12.830  19.509 40.757  1.00 74.69  ? 302 PHE A CD1   1 
ATOM   3036 C  CD2   . PHE C 3 302 ? 12.288  19.175 43.075  1.00 73.88  ? 302 PHE A CD2   1 
ATOM   3037 C  CE1   . PHE C 3 302 ? 11.457  19.618 40.446  1.00 75.03  ? 302 PHE A CE1   1 
ATOM   3038 C  CE2   . PHE C 3 302 ? 10.913  19.283 42.781  1.00 72.71  ? 302 PHE A CE2   1 
ATOM   3039 C  CZ    . PHE C 3 302 ? 10.497  19.506 41.462  1.00 73.95  ? 302 PHE A CZ    1 
ATOM   3040 N  N     . PRO C 3 303 ? 16.966  20.558 44.230  1.00 72.99  ? 303 PRO A N     1 
ATOM   3041 C  CA    . PRO C 3 303 ? 18.258  20.416 44.892  1.00 72.57  ? 303 PRO A CA    1 
ATOM   3042 C  C     . PRO C 3 303 ? 18.596  18.937 45.014  1.00 73.09  ? 303 PRO A C     1 
ATOM   3043 O  O     . PRO C 3 303 ? 19.604  18.563 45.618  1.00 73.84  ? 303 PRO A O     1 
ATOM   3044 C  CB    . PRO C 3 303 ? 18.016  21.065 46.242  1.00 72.76  ? 303 PRO A CB    1 
ATOM   3045 C  CG    . PRO C 3 303 ? 16.562  20.744 46.496  1.00 72.95  ? 303 PRO A CG    1 
ATOM   3046 C  CD    . PRO C 3 303 ? 15.944  21.061 45.159  1.00 72.22  ? 303 PRO A CD    1 
ATOM   3047 N  N     . HIS C 3 304 ? 17.741  18.100 44.432  1.00 72.64  ? 304 HIS A N     1 
ATOM   3048 C  CA    . HIS C 3 304 ? 17.921  16.652 44.476  1.00 72.56  ? 304 HIS A CA    1 
ATOM   3049 C  C     . HIS C 3 304 ? 17.509  16.016 43.159  1.00 71.92  ? 304 HIS A C     1 
ATOM   3050 O  O     . HIS C 3 304 ? 16.967  16.687 42.271  1.00 73.07  ? 304 HIS A O     1 
ATOM   3051 C  CB    . HIS C 3 304 ? 17.063  16.054 45.583  1.00 74.30  ? 304 HIS A CB    1 
ATOM   3052 C  CG    . HIS C 3 304 ? 15.620  16.473 45.516  1.00 77.07  ? 304 HIS A CG    1 
ATOM   3053 N  ND1   . HIS C 3 304 ? 15.151  17.631 46.090  1.00 77.39  ? 304 HIS A ND1   1 
ATOM   3054 C  CD2   . HIS C 3 304 ? 14.555  15.892 44.910  1.00 77.37  ? 304 HIS A CD2   1 
ATOM   3055 C  CE1   . HIS C 3 304 ? 13.855  17.751 45.845  1.00 76.92  ? 304 HIS A CE1   1 
ATOM   3056 N  NE2   . HIS C 3 304 ? 13.473  16.712 45.133  1.00 77.37  ? 304 HIS A NE2   1 
ATOM   3057 N  N     . GLY C 3 305 ? 17.757  14.712 43.052  1.00 69.85  ? 305 GLY A N     1 
ATOM   3058 C  CA    . GLY C 3 305 ? 17.397  13.969 41.857  1.00 66.90  ? 305 GLY A CA    1 
ATOM   3059 C  C     . GLY C 3 305 ? 15.889  13.863 41.779  1.00 64.49  ? 305 GLY A C     1 
ATOM   3060 O  O     . GLY C 3 305 ? 15.219  14.004 42.803  1.00 63.39  ? 305 GLY A O     1 
ATOM   3061 N  N     . ILE C 3 306 ? 15.355  13.622 40.583  1.00 63.06  ? 306 ILE A N     1 
ATOM   3062 C  CA    . ILE C 3 306 ? 13.907  13.524 40.405  1.00 63.30  ? 306 ILE A CA    1 
ATOM   3063 C  C     . ILE C 3 306 ? 13.423  12.086 40.225  1.00 64.88  ? 306 ILE A C     1 
ATOM   3064 O  O     . ILE C 3 306 ? 13.833  11.384 39.281  1.00 66.22  ? 306 ILE A O     1 
ATOM   3065 C  CB    . ILE C 3 306 ? 13.407  14.335 39.175  1.00 60.47  ? 306 ILE A CB    1 
ATOM   3066 C  CG1   . ILE C 3 306 ? 13.972  15.756 39.210  1.00 60.68  ? 306 ILE A CG1   1 
ATOM   3067 C  CG2   . ILE C 3 306 ? 11.884  14.378 39.171  1.00 56.10  ? 306 ILE A CG2   1 
ATOM   3068 C  CD1   . ILE C 3 306 ? 13.829  16.508 37.901  1.00 59.71  ? 306 ILE A CD1   1 
ATOM   3069 N  N     . SER C 3 307 ? 12.566  11.648 41.147  1.00 63.49  ? 307 SER A N     1 
ATOM   3070 C  CA    . SER C 3 307 ? 11.989  10.319 41.073  1.00 61.79  ? 307 SER A CA    1 
ATOM   3071 C  C     . SER C 3 307 ? 10.959  10.449 39.973  1.00 60.85  ? 307 SER A C     1 
ATOM   3072 O  O     . SER C 3 307 ? 10.461  11.558 39.704  1.00 58.15  ? 307 SER A O     1 
ATOM   3073 C  CB    . SER C 3 307 ? 11.277  9.968  42.369  1.00 62.92  ? 307 SER A CB    1 
ATOM   3074 O  OG    . SER C 3 307 ? 10.172  10.834 42.563  1.00 62.82  ? 307 SER A OG    1 
ATOM   3075 N  N     . LYS C 3 308 ? 10.634  9.325  39.344  1.00 59.99  ? 308 LYS A N     1 
ATOM   3076 C  CA    . LYS C 3 308 ? 9.658   9.339  38.266  1.00 59.28  ? 308 LYS A CA    1 
ATOM   3077 C  C     . LYS C 3 308 ? 8.356   9.929  38.804  1.00 58.02  ? 308 LYS A C     1 
ATOM   3078 O  O     . LYS C 3 308 ? 7.673   10.701 38.119  1.00 54.84  ? 308 LYS A O     1 
ATOM   3079 C  CB    . LYS C 3 308 ? 9.419   7.920  37.735  1.00 59.28  ? 308 LYS A CB    1 
ATOM   3080 C  CG    . LYS C 3 308 ? 8.661   7.897  36.409  1.00 60.60  ? 308 LYS A CG    1 
ATOM   3081 C  CD    . LYS C 3 308 ? 7.902   6.585  36.191  1.00 61.37  ? 308 LYS A CD    1 
ATOM   3082 C  CE    . LYS C 3 308 ? 8.815   5.418  35.864  1.00 59.50  ? 308 LYS A CE    1 
ATOM   3083 N  NZ    . LYS C 3 308 ? 7.975   4.190  35.727  1.00 58.69  ? 308 LYS A NZ    1 
ATOM   3084 N  N     . GLU C 3 309 ? 8.026   9.564  40.041  1.00 57.18  ? 309 GLU A N     1 
ATOM   3085 C  CA    . GLU C 3 309 ? 6.812   10.058 40.657  1.00 58.20  ? 309 GLU A CA    1 
ATOM   3086 C  C     . GLU C 3 309 ? 6.859   11.580 40.665  1.00 59.49  ? 309 GLU A C     1 
ATOM   3087 O  O     . GLU C 3 309 ? 5.905   12.245 40.239  1.00 59.02  ? 309 GLU A O     1 
ATOM   3088 C  CB    . GLU C 3 309 ? 6.662   9.494  42.071  0.50 57.06  ? 309 GLU A CB    1 
ATOM   3089 C  CG    . GLU C 3 309 ? 6.349   7.995  42.109  0.50 56.71  ? 309 GLU A CG    1 
ATOM   3090 C  CD    . GLU C 3 309 ? 7.557   7.102  41.812  0.50 57.84  ? 309 GLU A CD    1 
ATOM   3091 O  OE1   . GLU C 3 309 ? 8.636   7.633  41.466  0.50 57.45  ? 309 GLU A OE1   1 
ATOM   3092 O  OE2   . GLU C 3 309 ? 7.423   5.859  41.926  0.50 56.71  ? 309 GLU A OE2   1 
ATOM   3093 N  N     . THR C 3 310 ? 7.985   12.134 41.110  1.00 61.71  ? 310 THR A N     1 
ATOM   3094 C  CA    . THR C 3 310 ? 8.133   13.585 41.158  1.00 63.30  ? 310 THR A CA    1 
ATOM   3095 C  C     . THR C 3 310 ? 7.963   14.166 39.749  1.00 63.83  ? 310 THR A C     1 
ATOM   3096 O  O     . THR C 3 310 ? 7.270   15.174 39.567  1.00 63.97  ? 310 THR A O     1 
ATOM   3097 C  CB    . THR C 3 310 ? 9.519   14.021 41.741  1.00 64.75  ? 310 THR A CB    1 
ATOM   3098 O  OG1   . THR C 3 310 ? 9.678   13.519 43.079  1.00 62.64  ? 310 THR A OG1   1 
ATOM   3099 C  CG2   . THR C 3 310 ? 9.612   15.542 41.788  1.00 64.53  ? 310 THR A CG2   1 
ATOM   3100 N  N     . ALA C 3 311 ? 8.581   13.524 38.757  1.00 64.42  ? 311 ALA A N     1 
ATOM   3101 C  CA    . ALA C 3 311 ? 8.481   13.976 37.361  1.00 64.91  ? 311 ALA A CA    1 
ATOM   3102 C  C     . ALA C 3 311 ? 7.021   14.017 36.915  1.00 65.28  ? 311 ALA A C     1 
ATOM   3103 O  O     . ALA C 3 311 ? 6.560   14.988 36.323  1.00 65.46  ? 311 ALA A O     1 
ATOM   3104 C  CB    . ALA C 3 311 ? 9.271   13.043 36.449  1.00 65.22  ? 311 ALA A CB    1 
ATOM   3105 N  N     . TYR C 3 312 ? 6.301   12.945 37.209  1.00 66.57  ? 312 TYR A N     1 
ATOM   3106 C  CA    . TYR C 3 312 ? 4.894   12.839 36.863  1.00 66.97  ? 312 TYR A CA    1 
ATOM   3107 C  C     . TYR C 3 312 ? 4.096   14.041 37.363  1.00 67.20  ? 312 TYR A C     1 
ATOM   3108 O  O     . TYR C 3 312 ? 3.496   14.775 36.574  1.00 66.75  ? 312 TYR A O     1 
ATOM   3109 C  CB    . TYR C 3 312 ? 4.339   11.552 37.460  1.00 66.56  ? 312 TYR A CB    1 
ATOM   3110 C  CG    . TYR C 3 312 ? 4.297   10.411 36.488  1.00 67.67  ? 312 TYR A CG    1 
ATOM   3111 C  CD1   . TYR C 3 312 ? 3.226   10.273 35.620  1.00 69.04  ? 312 TYR A CD1   1 
ATOM   3112 C  CD2   . TYR C 3 312 ? 5.319   9.460  36.436  1.00 68.35  ? 312 TYR A CD2   1 
ATOM   3113 C  CE1   . TYR C 3 312 ? 3.150   9.212  34.727  1.00 70.73  ? 312 TYR A CE1   1 
ATOM   3114 C  CE2   . TYR C 3 312 ? 5.260   8.384  35.537  1.00 69.25  ? 312 TYR A CE2   1 
ATOM   3115 C  CZ    . TYR C 3 312 ? 4.162   8.269  34.683  1.00 70.70  ? 312 TYR A CZ    1 
ATOM   3116 O  OH    . TYR C 3 312 ? 4.022   7.205  33.808  1.00 68.91  ? 312 TYR A OH    1 
ATOM   3117 N  N     . SER C 3 313 ? 4.105   14.245 38.677  1.00 67.84  ? 313 SER A N     1 
ATOM   3118 C  CA    . SER C 3 313 ? 3.373   15.349 39.293  1.00 68.51  ? 313 SER A CA    1 
ATOM   3119 C  C     . SER C 3 313 ? 3.866   16.725 38.857  1.00 70.19  ? 313 SER A C     1 
ATOM   3120 O  O     . SER C 3 313 ? 3.069   17.591 38.466  1.00 69.58  ? 313 SER A O     1 
ATOM   3121 C  CB    . SER C 3 313 ? 3.466   15.244 40.810  1.00 65.45  ? 313 SER A CB    1 
ATOM   3122 O  OG    . SER C 3 313 ? 4.818   15.229 41.202  1.00 62.47  ? 313 SER A OG    1 
ATOM   3123 N  N     . GLU C 3 314 ? 5.181   16.920 38.925  1.00 70.98  ? 314 GLU A N     1 
ATOM   3124 C  CA    . GLU C 3 314 ? 5.783   18.197 38.553  1.00 73.21  ? 314 GLU A CA    1 
ATOM   3125 C  C     . GLU C 3 314 ? 5.581   18.562 37.077  1.00 73.50  ? 314 GLU A C     1 
ATOM   3126 O  O     . GLU C 3 314 ? 5.516   19.746 36.729  1.00 73.17  ? 314 GLU A O     1 
ATOM   3127 C  CB    . GLU C 3 314 ? 7.282   18.190 38.891  1.00 74.87  ? 314 GLU A CB    1 
ATOM   3128 C  CG    . GLU C 3 314 ? 7.979   19.519 38.631  1.00 78.25  ? 314 GLU A CG    1 
ATOM   3129 C  CD    . GLU C 3 314 ? 7.397   20.660 39.459  1.00 80.85  ? 314 GLU A CD    1 
ATOM   3130 O  OE1   . GLU C 3 314 ? 7.473   21.821 39.001  1.00 81.09  ? 314 GLU A OE1   1 
ATOM   3131 O  OE2   . GLU C 3 314 ? 6.871   20.399 40.568  1.00 82.87  ? 314 GLU A OE2   1 
ATOM   3132 N  N     . SER C 3 315 ? 5.474   17.548 36.215  1.00 73.34  ? 315 SER A N     1 
ATOM   3133 C  CA    . SER C 3 315 ? 5.296   17.777 34.780  1.00 72.31  ? 315 SER A CA    1 
ATOM   3134 C  C     . SER C 3 315 ? 3.937   18.386 34.509  1.00 73.29  ? 315 SER A C     1 
ATOM   3135 O  O     . SER C 3 315 ? 3.778   19.241 33.634  1.00 72.30  ? 315 SER A O     1 
ATOM   3136 C  CB    . SER C 3 315 ? 5.433   16.465 33.997  1.00 69.37  ? 315 SER A CB    1 
ATOM   3137 O  OG    . SER C 3 315 ? 4.539   15.484 34.477  1.00 65.37  ? 315 SER A OG    1 
ATOM   3138 N  N     . VAL C 3 316 ? 2.955   17.949 35.283  1.00 74.55  ? 316 VAL A N     1 
ATOM   3139 C  CA    . VAL C 3 316 ? 1.608   18.443 35.109  1.00 75.00  ? 316 VAL A CA    1 
ATOM   3140 C  C     . VAL C 3 316 ? 1.544   19.908 35.491  1.00 75.90  ? 316 VAL A C     1 
ATOM   3141 O  O     . VAL C 3 316 ? 0.863   20.696 34.831  1.00 75.48  ? 316 VAL A O     1 
ATOM   3142 C  CB    . VAL C 3 316 ? 0.624   17.643 35.954  1.00 74.51  ? 316 VAL A CB    1 
ATOM   3143 C  CG1   . VAL C 3 316 ? -0.793  18.081 35.638  1.00 73.52  ? 316 VAL A CG1   1 
ATOM   3144 C  CG2   . VAL C 3 316 ? 0.809   16.158 35.679  1.00 73.47  ? 316 VAL A CG2   1 
ATOM   3145 N  N     . LYS C 3 317 ? 2.263   20.270 36.552  1.00 76.75  ? 317 LYS A N     1 
ATOM   3146 C  CA    . LYS C 3 317 ? 2.287   21.656 37.009  1.00 77.44  ? 317 LYS A CA    1 
ATOM   3147 C  C     . LYS C 3 317 ? 2.896   22.554 35.939  1.00 77.40  ? 317 LYS A C     1 
ATOM   3148 O  O     . LYS C 3 317 ? 2.385   23.646 35.683  1.00 78.52  ? 317 LYS A O     1 
ATOM   3149 C  CB    . LYS C 3 317 ? 3.080   21.787 38.309  1.00 77.59  ? 317 LYS A CB    1 
ATOM   3150 C  CG    . LYS C 3 317 ? 2.441   21.054 39.465  1.00 80.79  ? 317 LYS A CG    1 
ATOM   3151 C  CD    . LYS C 3 317 ? 3.239   21.198 40.765  1.00 83.45  ? 317 LYS A CD    1 
ATOM   3152 C  CE    . LYS C 3 317 ? 2.619   20.368 41.907  1.00 83.75  ? 317 LYS A CE    1 
ATOM   3153 N  NZ    . LYS C 3 317 ? 3.362   20.504 43.199  1.00 84.68  ? 317 LYS A NZ    1 
ATOM   3154 N  N     . LEU C 3 318 ? 3.974   22.090 35.306  1.00 75.56  ? 318 LEU A N     1 
ATOM   3155 C  CA    . LEU C 3 318 ? 4.641   22.867 34.263  1.00 73.13  ? 318 LEU A CA    1 
ATOM   3156 C  C     . LEU C 3 318 ? 3.761   22.942 33.024  1.00 73.03  ? 318 LEU A C     1 
ATOM   3157 O  O     . LEU C 3 318 ? 3.638   24.003 32.407  1.00 72.01  ? 318 LEU A O     1 
ATOM   3158 C  CB    . LEU C 3 318 ? 5.994   22.240 33.922  1.00 70.55  ? 318 LEU A CB    1 
ATOM   3159 C  CG    . LEU C 3 318 ? 6.970   22.164 35.102  1.00 69.51  ? 318 LEU A CG    1 
ATOM   3160 C  CD1   . LEU C 3 318 ? 7.996   21.087 34.851  1.00 67.65  ? 318 LEU A CD1   1 
ATOM   3161 C  CD2   . LEU C 3 318 ? 7.640   23.515 35.321  1.00 68.84  ? 318 LEU A CD2   1 
ATOM   3162 N  N     . LEU C 3 319 ? 3.144   21.819 32.659  1.00 74.44  ? 319 LEU A N     1 
ATOM   3163 C  CA    . LEU C 3 319 ? 2.267   21.799 31.490  1.00 75.08  ? 319 LEU A CA    1 
ATOM   3164 C  C     . LEU C 3 319 ? 1.230   22.886 31.702  1.00 77.24  ? 319 LEU A C     1 
ATOM   3165 O  O     . LEU C 3 319 ? 0.872   23.623 30.771  1.00 76.76  ? 319 LEU A O     1 
ATOM   3166 C  CB    . LEU C 3 319 ? 1.565   20.445 31.337  1.00 72.06  ? 319 LEU A CB    1 
ATOM   3167 C  CG    . LEU C 3 319 ? 0.375   20.446 30.364  1.00 69.76  ? 319 LEU A CG    1 
ATOM   3168 C  CD1   . LEU C 3 319 ? 0.761   21.120 29.065  1.00 67.71  ? 319 LEU A CD1   1 
ATOM   3169 C  CD2   . LEU C 3 319 ? -0.092  19.031 30.101  1.00 68.15  ? 319 LEU A CD2   1 
ATOM   3170 N  N     . GLN C 3 320 ? 0.766   22.982 32.945  1.00 78.28  ? 320 GLN A N     1 
ATOM   3171 C  CA    . GLN C 3 320 ? -0.220  23.978 33.309  1.00 80.97  ? 320 GLN A CA    1 
ATOM   3172 C  C     . GLN C 3 320 ? 0.346   25.373 33.133  1.00 81.81  ? 320 GLN A C     1 
ATOM   3173 O  O     . GLN C 3 320 ? -0.305  26.236 32.549  1.00 82.55  ? 320 GLN A O     1 
ATOM   3174 C  CB    . GLN C 3 320 ? -0.657  23.792 34.756  1.00 82.77  ? 320 GLN A CB    1 
ATOM   3175 C  CG    . GLN C 3 320 ? -1.620  22.651 34.949  1.00 84.92  ? 320 GLN A CG    1 
ATOM   3176 C  CD    . GLN C 3 320 ? -2.342  22.743 36.270  1.00 85.77  ? 320 GLN A CD    1 
ATOM   3177 O  OE1   . GLN C 3 320 ? -1.795  22.402 37.326  1.00 84.87  ? 320 GLN A OE1   1 
ATOM   3178 N  NE2   . GLN C 3 320 ? -3.580  23.227 36.223  1.00 86.69  ? 320 GLN A NE2   1 
ATOM   3179 N  N     . LYS C 3 321 ? 1.562   25.586 33.636  1.00 82.50  ? 321 LYS A N     1 
ATOM   3180 C  CA    . LYS C 3 321 ? 2.220   26.885 33.536  1.00 81.76  ? 321 LYS A CA    1 
ATOM   3181 C  C     . LYS C 3 321 ? 2.289   27.305 32.071  1.00 83.55  ? 321 LYS A C     1 
ATOM   3182 O  O     . LYS C 3 321 ? 2.386   28.493 31.767  1.00 84.07  ? 321 LYS A O     1 
ATOM   3183 C  CB    . LYS C 3 321 ? 3.628   26.823 34.140  0.50 79.09  ? 321 LYS A CB    1 
ATOM   3184 C  CG    . LYS C 3 321 ? 4.288   28.182 34.312  0.50 75.97  ? 321 LYS A CG    1 
ATOM   3185 C  CD    . LYS C 3 321 ? 5.704   28.083 34.883  0.50 72.78  ? 321 LYS A CD    1 
ATOM   3186 C  CE    . LYS C 3 321 ? 5.719   27.440 36.268  0.50 70.74  ? 321 LYS A CE    1 
ATOM   3187 N  NZ    . LYS C 3 321 ? 7.077   27.402 36.877  0.50 66.28  ? 321 LYS A NZ    1 
ATOM   3188 N  N     . ILE C 3 322 ? 2.239   26.329 31.161  1.00 85.06  ? 322 ILE A N     1 
ATOM   3189 C  CA    . ILE C 3 322 ? 2.262   26.633 29.729  1.00 86.54  ? 322 ILE A CA    1 
ATOM   3190 C  C     . ILE C 3 322 ? 0.858   26.975 29.234  1.00 87.42  ? 322 ILE A C     1 
ATOM   3191 O  O     . ILE C 3 322 ? 0.686   27.773 28.315  1.00 86.52  ? 322 ILE A O     1 
ATOM   3192 C  CB    . ILE C 3 322 ? 2.822   25.450 28.890  1.00 86.70  ? 322 ILE A CB    1 
ATOM   3193 C  CG1   . ILE C 3 322 ? 4.340   25.353 29.085  1.00 86.69  ? 322 ILE A CG1   1 
ATOM   3194 C  CG2   . ILE C 3 322 ? 2.473   25.638 27.406  1.00 85.85  ? 322 ILE A CG2   1 
ATOM   3195 C  CD1   . ILE C 3 322 ? 5.018   24.294 28.240  1.00 86.44  ? 322 ILE A CD1   1 
ATOM   3196 N  N     . LEU C 3 323 ? -0.141  26.365 29.857  1.00 89.16  ? 323 LEU A N     1 
ATOM   3197 C  CA    . LEU C 3 323 ? -1.523  26.611 29.481  1.00 91.22  ? 323 LEU A CA    1 
ATOM   3198 C  C     . LEU C 3 323 ? -2.033  27.951 30.015  1.00 92.09  ? 323 LEU A C     1 
ATOM   3199 O  O     . LEU C 3 323 ? -2.818  28.631 29.346  1.00 92.15  ? 323 LEU A O     1 
ATOM   3200 C  CB    . LEU C 3 323 ? -2.407  25.451 29.961  1.00 92.02  ? 323 LEU A CB    1 
ATOM   3201 C  CG    . LEU C 3 323 ? -2.899  24.443 28.901  1.00 92.37  ? 323 LEU A CG    1 
ATOM   3202 C  CD1   . LEU C 3 323 ? -2.029  24.477 27.646  1.00 90.88  ? 323 LEU A CD1   1 
ATOM   3203 C  CD2   . LEU C 3 323 ? -2.919  23.052 29.521  1.00 91.62  ? 323 LEU A CD2   1 
ATOM   3204 N  N     . GLU C 3 324 ? -1.572  28.328 31.209  1.00 92.79  ? 324 GLU A N     1 
ATOM   3205 C  CA    . GLU C 3 324 ? -1.952  29.593 31.847  1.00 93.94  ? 324 GLU A CA    1 
ATOM   3206 C  C     . GLU C 3 324 ? -1.175  30.763 31.262  1.00 95.38  ? 324 GLU A C     1 
ATOM   3207 O  O     . GLU C 3 324 ? -1.569  31.916 31.448  1.00 96.50  ? 324 GLU A O     1 
ATOM   3208 C  CB    . GLU C 3 324 ? -1.660  29.582 33.350  1.00 94.26  ? 324 GLU A CB    1 
ATOM   3209 C  CG    . GLU C 3 324 ? -2.413  28.564 34.170  1.00 96.81  ? 324 GLU A CG    1 
ATOM   3210 C  CD    . GLU C 3 324 ? -1.809  28.397 35.560  1.00 98.57  ? 324 GLU A CD    1 
ATOM   3211 O  OE1   . GLU C 3 324 ? -2.432  27.713 36.405  1.00 99.59  ? 324 GLU A OE1   1 
ATOM   3212 O  OE2   . GLU C 3 324 ? -0.709  28.947 35.802  1.00 97.21  ? 324 GLU A OE2   1 
ATOM   3213 N  N     . GLU C 3 325 ? -0.069  30.472 30.573  1.00 96.23  ? 325 GLU A N     1 
ATOM   3214 C  CA    . GLU C 3 325 ? 0.775   31.517 29.981  1.00 95.99  ? 325 GLU A CA    1 
ATOM   3215 C  C     . GLU C 3 325 ? 0.801   31.579 28.458  1.00 97.02  ? 325 GLU A C     1 
ATOM   3216 O  O     . GLU C 3 325 ? 1.562   32.351 27.876  1.00 97.20  ? 325 GLU A O     1 
ATOM   3217 C  CB    . GLU C 3 325 ? 2.203   31.386 30.503  1.00 93.87  ? 325 GLU A CB    1 
ATOM   3218 C  CG    . GLU C 3 325 ? 2.334   31.820 31.944  1.00 92.49  ? 325 GLU A CG    1 
ATOM   3219 C  CD    . GLU C 3 325 ? 3.679   31.481 32.552  1.00 91.74  ? 325 GLU A CD    1 
ATOM   3220 O  OE1   . GLU C 3 325 ? 4.713   31.752 31.911  1.00 91.58  ? 325 GLU A OE1   1 
ATOM   3221 O  OE2   . GLU C 3 325 ? 3.703   30.956 33.684  1.00 90.51  ? 325 GLU A OE2   1 
ATOM   3222 N  N     . ASP C 3 326 ? -0.029  30.763 27.822  1.00 98.59  ? 326 ASP A N     1 
ATOM   3223 C  CA    . ASP C 3 326 ? -0.131  30.729 26.372  1.00 100.93 ? 326 ASP A CA    1 
ATOM   3224 C  C     . ASP C 3 326 ? -1.577  30.344 26.101  1.00 102.38 ? 326 ASP A C     1 
ATOM   3225 O  O     . ASP C 3 326 ? -2.215  29.681 26.926  1.00 102.75 ? 326 ASP A O     1 
ATOM   3226 C  CB    . ASP C 3 326 ? 0.832   29.686 25.788  1.00 101.60 ? 326 ASP A CB    1 
ATOM   3227 C  CG    . ASP C 3 326 ? 1.015   29.824 24.283  1.00 102.64 ? 326 ASP A CG    1 
ATOM   3228 O  OD1   . ASP C 3 326 ? 0.018   29.672 23.542  1.00 103.60 ? 326 ASP A OD1   1 
ATOM   3229 O  OD2   . ASP C 3 326 ? 2.160   30.083 23.843  1.00 102.59 ? 326 ASP A OD2   1 
ATOM   3230 N  N     . GLU C 3 327 ? -2.103  30.768 24.959  1.00 103.17 ? 327 GLU A N     1 
ATOM   3231 C  CA    . GLU C 3 327 ? -3.487  30.466 24.627  1.00 104.15 ? 327 GLU A CA    1 
ATOM   3232 C  C     . GLU C 3 327 ? -3.636  29.622 23.363  1.00 103.25 ? 327 GLU A C     1 
ATOM   3233 O  O     . GLU C 3 327 ? -4.732  29.167 23.038  1.00 103.40 ? 327 GLU A O     1 
ATOM   3234 C  CB    . GLU C 3 327 ? -4.279  31.767 24.482  1.00 106.14 ? 327 GLU A CB    1 
ATOM   3235 C  CG    . GLU C 3 327 ? -3.957  32.550 23.223  1.00 109.46 ? 327 GLU A CG    1 
ATOM   3236 C  CD    . GLU C 3 327 ? -4.567  33.938 23.232  1.00 111.18 ? 327 GLU A CD    1 
ATOM   3237 O  OE1   . GLU C 3 327 ? -5.762  34.061 23.589  1.00 111.95 ? 327 GLU A OE1   1 
ATOM   3238 O  OE2   . GLU C 3 327 ? -3.850  34.902 22.873  1.00 111.95 ? 327 GLU A OE2   1 
ATOM   3239 N  N     . ARG C 3 328 ? -2.535  29.410 22.653  1.00 101.94 ? 328 ARG A N     1 
ATOM   3240 C  CA    . ARG C 3 328 ? -2.574  28.608 21.436  1.00 100.55 ? 328 ARG A CA    1 
ATOM   3241 C  C     . ARG C 3 328 ? -2.840  27.148 21.761  1.00 100.02 ? 328 ARG A C     1 
ATOM   3242 O  O     . ARG C 3 328 ? -2.878  26.759 22.928  1.00 99.75  ? 328 ARG A O     1 
ATOM   3243 C  CB    . ARG C 3 328 ? -1.251  28.727 20.689  1.00 99.34  ? 328 ARG A CB    1 
ATOM   3244 C  CG    . ARG C 3 328 ? -1.025  30.102 20.115  1.00 98.22  ? 328 ARG A CG    1 
ATOM   3245 C  CD    . ARG C 3 328 ? 0.383   30.248 19.583  1.00 95.92  ? 328 ARG A CD    1 
ATOM   3246 N  NE    . ARG C 3 328 ? 1.363   30.331 20.660  1.00 92.80  ? 328 ARG A NE    1 
ATOM   3247 C  CZ    . ARG C 3 328 ? 2.675   30.395 20.465  1.00 91.00  ? 328 ARG A CZ    1 
ATOM   3248 N  NH1   . ARG C 3 328 ? 3.160   30.383 19.230  1.00 90.07  ? 328 ARG A NH1   1 
ATOM   3249 N  NH2   . ARG C 3 328 ? 3.496   30.471 21.504  1.00 88.25  ? 328 ARG A NH2   1 
ATOM   3250 N  N     . LYS C 3 329 ? -3.026  26.346 20.720  1.00 99.49  ? 329 LYS A N     1 
ATOM   3251 C  CA    . LYS C 3 329 ? -3.280  24.923 20.892  1.00 98.70  ? 329 LYS A CA    1 
ATOM   3252 C  C     . LYS C 3 329 ? -1.981  24.123 20.757  1.00 97.14  ? 329 LYS A C     1 
ATOM   3253 O  O     . LYS C 3 329 ? -1.080  24.498 20.004  1.00 97.53  ? 329 LYS A O     1 
ATOM   3254 C  CB    . LYS C 3 329 ? -4.314  24.434 19.863  1.00 100.32 ? 329 LYS A CB    1 
ATOM   3255 C  CG    . LYS C 3 329 ? -5.765  24.837 20.160  1.00 102.04 ? 329 LYS A CG    1 
ATOM   3256 C  CD    . LYS C 3 329 ? -6.729  24.252 19.124  1.00 102.19 ? 329 LYS A CD    1 
ATOM   3257 C  CE    . LYS C 3 329 ? -8.175  24.339 19.590  1.00 101.69 ? 329 LYS A CE    1 
ATOM   3258 N  NZ    . LYS C 3 329 ? -9.102  23.673 18.635  1.00 101.57 ? 329 LYS A NZ    1 
ATOM   3259 N  N     . ILE C 3 330 ? -1.891  23.021 21.495  1.00 94.33  ? 330 ILE A N     1 
ATOM   3260 C  CA    . ILE C 3 330 ? -0.709  22.175 21.464  1.00 90.10  ? 330 ILE A CA    1 
ATOM   3261 C  C     . ILE C 3 330 ? -0.842  21.113 20.382  1.00 88.11  ? 330 ILE A C     1 
ATOM   3262 O  O     . ILE C 3 330 ? -1.939  20.630 20.114  1.00 88.19  ? 330 ILE A O     1 
ATOM   3263 C  CB    . ILE C 3 330 ? -0.497  21.524 22.842  1.00 89.30  ? 330 ILE A CB    1 
ATOM   3264 C  CG1   . ILE C 3 330 ? -0.191  22.629 23.865  1.00 88.19  ? 330 ILE A CG1   1 
ATOM   3265 C  CG2   . ILE C 3 330 ? 0.622   20.500 22.779  1.00 90.30  ? 330 ILE A CG2   1 
ATOM   3266 C  CD1   . ILE C 3 330 ? 0.054   22.158 25.278  1.00 86.41  ? 330 ILE A CD1   1 
ATOM   3267 N  N     . ARG C 3 331 ? 0.274   20.772 19.748  1.00 86.14  ? 331 ARG A N     1 
ATOM   3268 C  CA    . ARG C 3 331 ? 0.286   19.763 18.690  1.00 84.83  ? 331 ARG A CA    1 
ATOM   3269 C  C     . ARG C 3 331 ? 1.216   18.612 19.068  1.00 82.57  ? 331 ARG A C     1 
ATOM   3270 O  O     . ARG C 3 331 ? 0.918   17.446 18.814  1.00 82.72  ? 331 ARG A O     1 
ATOM   3271 C  CB    . ARG C 3 331 ? 0.743   20.386 17.361  1.00 85.67  ? 331 ARG A CB    1 
ATOM   3272 C  CG    . ARG C 3 331 ? 0.868   19.392 16.194  1.00 88.18  ? 331 ARG A CG    1 
ATOM   3273 C  CD    . ARG C 3 331 ? 1.327   20.090 14.906  1.00 90.14  ? 331 ARG A CD    1 
ATOM   3274 N  NE    . ARG C 3 331 ? 1.977   19.184 13.949  1.00 90.28  ? 331 ARG A NE    1 
ATOM   3275 C  CZ    . ARG C 3 331 ? 1.508   18.912 12.735  1.00 89.77  ? 331 ARG A CZ    1 
ATOM   3276 N  NH1   . ARG C 3 331 ? 0.379   19.472 12.327  1.00 91.10  ? 331 ARG A NH1   1 
ATOM   3277 N  NH2   . ARG C 3 331 ? 2.170   18.095 11.922  1.00 88.89  ? 331 ARG A NH2   1 
ATOM   3278 N  N     . ARG C 3 332 ? 2.349   18.956 19.667  1.00 80.34  ? 332 ARG A N     1 
ATOM   3279 C  CA    . ARG C 3 332 ? 3.333   17.972 20.091  1.00 77.60  ? 332 ARG A CA    1 
ATOM   3280 C  C     . ARG C 3 332 ? 3.709   18.276 21.548  1.00 75.02  ? 332 ARG A C     1 
ATOM   3281 O  O     . ARG C 3 332 ? 4.221   19.357 21.854  1.00 74.77  ? 332 ARG A O     1 
ATOM   3282 C  CB    . ARG C 3 332 ? 4.587   18.065 19.210  1.00 78.65  ? 332 ARG A CB    1 
ATOM   3283 C  CG    . ARG C 3 332 ? 4.362   17.962 17.704  1.00 80.45  ? 332 ARG A CG    1 
ATOM   3284 C  CD    . ARG C 3 332 ? 5.704   17.950 16.950  1.00 81.95  ? 332 ARG A CD    1 
ATOM   3285 N  NE    . ARG C 3 332 ? 6.530   16.797 17.328  1.00 83.78  ? 332 ARG A NE    1 
ATOM   3286 C  CZ    . ARG C 3 332 ? 7.827   16.653 17.048  1.00 83.53  ? 332 ARG A CZ    1 
ATOM   3287 N  NH1   . ARG C 3 332 ? 8.485   17.592 16.378  1.00 83.26  ? 332 ARG A NH1   1 
ATOM   3288 N  NH2   . ARG C 3 332 ? 8.473   15.561 17.440  1.00 82.87  ? 332 ARG A NH2   1 
ATOM   3289 N  N     . ILE C 3 333 ? 3.463   17.334 22.451  1.00 71.15  ? 333 ILE A N     1 
ATOM   3290 C  CA    . ILE C 3 333 ? 3.807   17.562 23.851  1.00 67.73  ? 333 ILE A CA    1 
ATOM   3291 C  C     . ILE C 3 333 ? 4.956   16.656 24.260  1.00 64.48  ? 333 ILE A C     1 
ATOM   3292 O  O     . ILE C 3 333 ? 5.111   15.575 23.707  1.00 65.33  ? 333 ILE A O     1 
ATOM   3293 C  CB    . ILE C 3 333 ? 2.609   17.276 24.772  1.00 68.20  ? 333 ILE A CB    1 
ATOM   3294 C  CG1   . ILE C 3 333 ? 2.905   17.778 26.185  1.00 66.87  ? 333 ILE A CG1   1 
ATOM   3295 C  CG2   . ILE C 3 333 ? 2.326   15.777 24.803  1.00 68.74  ? 333 ILE A CG2   1 
ATOM   3296 C  CD1   . ILE C 3 333 ? 3.189   19.258 26.252  1.00 65.44  ? 333 ILE A CD1   1 
ATOM   3297 N  N     . GLY C 3 334 ? 5.763   17.082 25.221  1.00 60.35  ? 334 GLY A N     1 
ATOM   3298 C  CA    . GLY C 3 334 ? 6.862   16.233 25.632  1.00 58.18  ? 334 GLY A CA    1 
ATOM   3299 C  C     . GLY C 3 334 ? 7.607   16.698 26.859  1.00 56.90  ? 334 GLY A C     1 
ATOM   3300 O  O     . GLY C 3 334 ? 7.401   17.799 27.355  1.00 56.93  ? 334 GLY A O     1 
ATOM   3301 N  N     . VAL C 3 335 ? 8.481   15.850 27.367  1.00 55.23  ? 335 VAL A N     1 
ATOM   3302 C  CA    . VAL C 3 335 ? 9.251   16.220 28.533  1.00 54.88  ? 335 VAL A CA    1 
ATOM   3303 C  C     . VAL C 3 335 ? 10.728  16.226 28.115  1.00 55.78  ? 335 VAL A C     1 
ATOM   3304 O  O     . VAL C 3 335 ? 11.078  15.679 27.064  1.00 54.39  ? 335 VAL A O     1 
ATOM   3305 C  CB    . VAL C 3 335 ? 8.999   15.216 29.678  0.50 53.06  ? 335 VAL A CB    1 
ATOM   3306 C  CG1   . VAL C 3 335 ? 9.648   13.886 29.362  0.50 51.41  ? 335 VAL A CG1   1 
ATOM   3307 C  CG2   . VAL C 3 335 ? 9.500   15.780 30.981  0.50 53.85  ? 335 VAL A CG2   1 
ATOM   3308 N  N     . ARG C 3 336 ? 11.583  16.872 28.906  1.00 56.17  ? 336 ARG A N     1 
ATOM   3309 C  CA    . ARG C 3 336 ? 13.017  16.915 28.616  1.00 57.24  ? 336 ARG A CA    1 
ATOM   3310 C  C     . ARG C 3 336 ? 13.779  16.999 29.939  1.00 57.52  ? 336 ARG A C     1 
ATOM   3311 O  O     . ARG C 3 336 ? 13.596  17.957 30.696  1.00 59.45  ? 336 ARG A O     1 
ATOM   3312 C  CB    . ARG C 3 336 ? 13.354  18.120 27.739  1.00 58.18  ? 336 ARG A CB    1 
ATOM   3313 C  CG    . ARG C 3 336 ? 14.830  18.228 27.409  1.00 61.06  ? 336 ARG A CG    1 
ATOM   3314 C  CD    . ARG C 3 336 ? 15.087  18.276 25.908  1.00 64.75  ? 336 ARG A CD    1 
ATOM   3315 N  NE    . ARG C 3 336 ? 16.261  17.468 25.591  1.00 67.57  ? 336 ARG A NE    1 
ATOM   3316 C  CZ    . ARG C 3 336 ? 16.238  16.362 24.851  1.00 68.54  ? 336 ARG A CZ    1 
ATOM   3317 N  NH1   . ARG C 3 336 ? 15.098  15.926 24.324  1.00 68.40  ? 336 ARG A NH1   1 
ATOM   3318 N  NH2   . ARG C 3 336 ? 17.354  15.664 24.677  1.00 69.27  ? 336 ARG A NH2   1 
ATOM   3319 N  N     . PHE C 3 337 ? 14.640  16.020 30.206  1.00 55.54  ? 337 PHE A N     1 
ATOM   3320 C  CA    . PHE C 3 337 ? 15.381  15.978 31.459  1.00 57.68  ? 337 PHE A CA    1 
ATOM   3321 C  C     . PHE C 3 337 ? 16.863  16.318 31.390  1.00 58.90  ? 337 PHE A C     1 
ATOM   3322 O  O     . PHE C 3 337 ? 17.562  15.849 30.503  1.00 59.14  ? 337 PHE A O     1 
ATOM   3323 C  CB    . PHE C 3 337 ? 15.216  14.599 32.069  1.00 58.56  ? 337 PHE A CB    1 
ATOM   3324 C  CG    . PHE C 3 337 ? 13.797  14.258 32.407  1.00 62.52  ? 337 PHE A CG    1 
ATOM   3325 C  CD1   . PHE C 3 337 ? 13.304  14.470 33.692  1.00 63.43  ? 337 PHE A CD1   1 
ATOM   3326 C  CD2   . PHE C 3 337 ? 12.947  13.712 31.442  1.00 64.05  ? 337 PHE A CD2   1 
ATOM   3327 C  CE1   . PHE C 3 337 ? 11.980  14.135 34.017  1.00 64.97  ? 337 PHE A CE1   1 
ATOM   3328 C  CE2   . PHE C 3 337 ? 11.630  13.374 31.753  1.00 65.20  ? 337 PHE A CE2   1 
ATOM   3329 C  CZ    . PHE C 3 337 ? 11.145  13.585 33.044  1.00 65.75  ? 337 PHE A CZ    1 
ATOM   3330 N  N     . SER C 3 338 ? 17.346  17.099 32.359  1.00 60.48  ? 338 SER A N     1 
ATOM   3331 C  CA    . SER C 3 338 ? 18.754  17.500 32.386  1.00 62.32  ? 338 SER A CA    1 
ATOM   3332 C  C     . SER C 3 338 ? 19.387  17.668 33.773  1.00 63.59  ? 338 SER A C     1 
ATOM   3333 O  O     . SER C 3 338 ? 18.775  17.333 34.789  1.00 63.80  ? 338 SER A O     1 
ATOM   3334 C  CB    . SER C 3 338 ? 18.932  18.797 31.595  1.00 61.95  ? 338 SER A CB    1 
ATOM   3335 O  OG    . SER C 3 338 ? 18.060  19.800 32.063  1.00 61.18  ? 338 SER A OG    1 
ATOM   3336 N  N     . LYS C 3 339 ? 20.615  18.195 33.793  1.00 63.73  ? 339 LYS A N     1 
ATOM   3337 C  CA    . LYS C 3 339 ? 21.372  18.417 35.029  1.00 63.60  ? 339 LYS A CA    1 
ATOM   3338 C  C     . LYS C 3 339 ? 21.505  17.135 35.833  1.00 63.89  ? 339 LYS A C     1 
ATOM   3339 O  O     . LYS C 3 339 ? 21.116  17.065 36.997  1.00 62.24  ? 339 LYS A O     1 
ATOM   3340 C  CB    . LYS C 3 339 ? 20.700  19.491 35.880  1.00 62.72  ? 339 LYS A CB    1 
ATOM   3341 C  CG    . LYS C 3 339 ? 20.671  20.835 35.215  1.00 63.84  ? 339 LYS A CG    1 
ATOM   3342 C  CD    . LYS C 3 339 ? 19.910  21.855 36.043  1.00 65.35  ? 339 LYS A CD    1 
ATOM   3343 C  CE    . LYS C 3 339 ? 19.812  23.175 35.308  1.00 67.10  ? 339 LYS A CE    1 
ATOM   3344 N  NZ    . LYS C 3 339 ? 19.037  24.174 36.063  1.00 67.55  ? 339 LYS A NZ    1 
ATOM   3345 N  N     . PHE C 3 340 ? 22.067  16.118 35.196  1.00 65.60  ? 340 PHE A N     1 
ATOM   3346 C  CA    . PHE C 3 340 ? 22.248  14.825 35.838  1.00 67.35  ? 340 PHE A CA    1 
ATOM   3347 C  C     . PHE C 3 340 ? 23.242  14.866 37.010  1.00 68.78  ? 340 PHE A C     1 
ATOM   3348 O  O     . PHE C 3 340 ? 24.112  15.742 37.076  1.00 67.34  ? 340 PHE A O     1 
ATOM   3349 C  CB    . PHE C 3 340 ? 22.717  13.793 34.807  1.00 65.74  ? 340 PHE A CB    1 
ATOM   3350 C  CG    . PHE C 3 340 ? 21.904  13.782 33.538  1.00 64.84  ? 340 PHE A CG    1 
ATOM   3351 C  CD1   . PHE C 3 340 ? 20.526  13.951 33.573  1.00 64.29  ? 340 PHE A CD1   1 
ATOM   3352 C  CD2   . PHE C 3 340 ? 22.518  13.555 32.311  1.00 63.10  ? 340 PHE A CD2   1 
ATOM   3353 C  CE1   . PHE C 3 340 ? 19.775  13.888 32.399  1.00 65.12  ? 340 PHE A CE1   1 
ATOM   3354 C  CE2   . PHE C 3 340 ? 21.779  13.490 31.142  1.00 62.43  ? 340 PHE A CE2   1 
ATOM   3355 C  CZ    . PHE C 3 340 ? 20.405  13.655 31.179  1.00 63.04  ? 340 PHE A CZ    1 
ATOM   3356 N  N     . ILE C 3 341 ? 23.102  13.909 37.928  1.00 70.05  ? 341 ILE A N     1 
ATOM   3357 C  CA    . ILE C 3 341 ? 23.980  13.830 39.086  1.00 71.59  ? 341 ILE A CA    1 
ATOM   3358 C  C     . ILE C 3 341 ? 25.280  13.135 38.695  1.00 72.48  ? 341 ILE A C     1 
ATOM   3359 O  O     . ILE C 3 341 ? 25.205  12.100 38.006  1.00 73.04  ? 341 ILE A O     1 
ATOM   3360 C  CB    . ILE C 3 341 ? 23.317  13.036 40.237  1.00 72.49  ? 341 ILE A CB    1 
ATOM   3361 C  CG1   . ILE C 3 341 ? 21.978  13.682 40.619  1.00 72.97  ? 341 ILE A CG1   1 
ATOM   3362 C  CG2   . ILE C 3 341 ? 24.253  12.987 41.441  1.00 70.23  ? 341 ILE A CG2   1 
ATOM   3363 C  CD1   . ILE C 3 341 ? 21.184  12.892 41.642  1.00 72.91  ? 341 ILE A CD1   1 
HETATM 3364 CA CA    . CA  D 4 .   ? 26.509  13.707 8.540   1.00 90.65  ? 403 CA  A CA    1 
HETATM 3365 CA CA    . CA  E 4 .   ? 26.467  10.504 7.156   1.00 46.13  ? 404 CA  A CA    1 
HETATM 3366 CA CA    . CA  F 4 .   ? 24.910  25.715 5.856   1.00 74.54  ? 405 CA  A CA    1 
HETATM 3367 N  N1    . DCP G 5 .   ? 18.962  12.096 10.181  1.00 52.86  ? 804 DCP A N1    1 
HETATM 3368 C  C2    . DCP G 5 .   ? 17.567  12.297 10.460  1.00 53.64  ? 804 DCP A C2    1 
HETATM 3369 N  N3    . DCP G 5 .   ? 16.950  13.495 10.017  1.00 52.73  ? 804 DCP A N3    1 
HETATM 3370 C  C4    . DCP G 5 .   ? 17.700  14.483 9.314   1.00 51.19  ? 804 DCP A C4    1 
HETATM 3371 C  C5    . DCP G 5 .   ? 19.077  14.290 9.044   1.00 52.06  ? 804 DCP A C5    1 
HETATM 3372 C  C6    . DCP G 5 .   ? 19.703  13.106 9.475   1.00 51.18  ? 804 DCP A C6    1 
HETATM 3373 O  O2    . DCP G 5 .   ? 16.908  11.438 11.074  1.00 56.75  ? 804 DCP A O2    1 
HETATM 3374 N  N4    . DCP G 5 .   ? 17.101  15.601 8.906   1.00 51.65  ? 804 DCP A N4    1 
HETATM 3375 C  "C1'" . DCP G 5 .   ? 19.585  10.836 10.639  1.00 52.71  ? 804 DCP A "C1'" 1 
HETATM 3376 C  "C2'" . DCP G 5 .   ? 19.418  9.792  9.518   1.00 54.69  ? 804 DCP A "C2'" 1 
HETATM 3377 C  "C3'" . DCP G 5 .   ? 20.742  9.835  8.794   1.00 54.42  ? 804 DCP A "C3'" 1 
HETATM 3378 C  "C4'" . DCP G 5 .   ? 21.717  10.043 9.948   1.00 55.63  ? 804 DCP A "C4'" 1 
HETATM 3379 O  "O4'" . DCP G 5 .   ? 21.024  10.967 10.858  1.00 54.41  ? 804 DCP A "O4'" 1 
HETATM 3380 O  "O3'" . DCP G 5 .   ? 20.955  8.569  8.178   1.00 52.96  ? 804 DCP A "O3'" 1 
HETATM 3381 C  "C5'" . DCP G 5 .   ? 23.049  10.764 9.598   1.00 55.83  ? 804 DCP A "C5'" 1 
HETATM 3382 O  "O5'" . DCP G 5 .   ? 22.960  12.134 9.048   1.00 58.34  ? 804 DCP A "O5'" 1 
HETATM 3383 P  PA    . DCP G 5 .   ? 23.559  12.728 7.745   1.00 61.76  ? 804 DCP A PA    1 
HETATM 3384 O  O1A   . DCP G 5 .   ? 25.011  12.442 7.652   1.00 58.67  ? 804 DCP A O1A   1 
HETATM 3385 O  O2A   . DCP G 5 .   ? 23.161  14.163 7.651   1.00 63.84  ? 804 DCP A O2A   1 
HETATM 3386 O  O3A   . DCP G 5 .   ? 22.832  11.892 6.629   1.00 61.71  ? 804 DCP A O3A   1 
HETATM 3387 P  PB    . DCP G 5 .   ? 23.188  10.490 5.974   1.00 58.46  ? 804 DCP A PB    1 
HETATM 3388 O  O1B   . DCP G 5 .   ? 21.929  9.818  5.760   1.00 59.19  ? 804 DCP A O1B   1 
HETATM 3389 O  O2B   . DCP G 5 .   ? 24.108  9.785  6.787   1.00 59.41  ? 804 DCP A O2B   1 
HETATM 3390 O  O3B   . DCP G 5 .   ? 23.834  10.803 4.571   1.00 61.24  ? 804 DCP A O3B   1 
HETATM 3391 P  PG    . DCP G 5 .   ? 25.160  11.436 4.024   1.00 64.37  ? 804 DCP A PG    1 
HETATM 3392 O  O1G   . DCP G 5 .   ? 26.059  11.443 5.180   1.00 65.91  ? 804 DCP A O1G   1 
HETATM 3393 O  O2G   . DCP G 5 .   ? 24.972  12.663 3.382   1.00 62.37  ? 804 DCP A O2G   1 
HETATM 3394 O  O3G   . DCP G 5 .   ? 25.666  10.434 2.977   1.00 62.95  ? 804 DCP A O3G   1 
HETATM 3395 O  O     . HOH H 6 .   ? 11.415  33.850 16.710  1.00 49.25  ? 14  HOH P O     1 
HETATM 3396 O  O     . HOH H 6 .   ? 13.498  27.858 36.397  1.00 50.04  ? 15  HOH P O     1 
HETATM 3397 O  O     . HOH H 6 .   ? 14.907  25.091 19.260  1.00 61.88  ? 16  HOH P O     1 
HETATM 3398 O  O     . HOH H 6 .   ? 17.693  31.552 34.983  1.00 64.91  ? 17  HOH P O     1 
HETATM 3399 O  O     . HOH H 6 .   ? 29.345  40.281 40.112  1.00 65.21  ? 18  HOH P O     1 
HETATM 3400 O  O     . HOH H 6 .   ? 9.438   28.525 31.881  1.00 72.92  ? 19  HOH P O     1 
HETATM 3401 O  O     . HOH I 6 .   ? 25.844  27.669 20.191  1.00 44.93  ? 19  HOH T O     1 
HETATM 3402 O  O     . HOH I 6 .   ? 10.624  13.334 14.764  1.00 93.42  ? 20  HOH T O     1 
HETATM 3403 O  O     . HOH I 6 .   ? 19.375  38.938 47.120  1.00 53.35  ? 21  HOH T O     1 
HETATM 3404 O  O     . HOH I 6 .   ? 25.271  25.384 18.870  1.00 59.00  ? 22  HOH T O     1 
HETATM 3405 O  O     . HOH J 6 .   ? 28.170  15.658 8.340   1.00 45.72  ? 805 HOH A O     1 
HETATM 3406 O  O     . HOH J 6 .   ? 15.335  19.579 31.697  1.00 73.57  ? 806 HOH A O     1 
HETATM 3407 O  O     . HOH J 6 .   ? 37.538  10.318 -1.672  1.00 46.12  ? 807 HOH A O     1 
HETATM 3408 O  O     . HOH J 6 .   ? 12.157  24.876 29.075  1.00 43.65  ? 808 HOH A O     1 
HETATM 3409 O  O     . HOH J 6 .   ? 33.498  11.349 22.422  1.00 49.35  ? 809 HOH A O     1 
HETATM 3410 O  O     . HOH J 6 .   ? 10.698  17.223 17.968  1.00 58.12  ? 810 HOH A O     1 
HETATM 3411 O  O     . HOH J 6 .   ? 7.959   5.314  11.920  1.00 43.22  ? 811 HOH A O     1 
HETATM 3412 O  O     . HOH J 6 .   ? 60.744  6.955  10.643  1.00 38.37  ? 812 HOH A O     1 
HETATM 3413 O  O     . HOH J 6 .   ? 26.001  12.763 10.367  1.00 44.24  ? 813 HOH A O     1 
HETATM 3414 O  O     . HOH J 6 .   ? 28.843  12.695 38.985  1.00 42.16  ? 814 HOH A O     1 
HETATM 3415 O  O     . HOH J 6 .   ? -6.523  18.039 25.470  1.00 88.82  ? 815 HOH A O     1 
HETATM 3416 O  O     . HOH J 6 .   ? 26.339  23.623 5.541   1.00 66.76  ? 816 HOH A O     1 
HETATM 3417 O  O     . HOH J 6 .   ? 28.237  44.394 5.748   1.00 66.26  ? 817 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DG  1   1   1   DG  GUA P . n 
A 1 2   DG  2   2   2   DG  GUA P . n 
A 1 3   DC  3   3   3   DC  CYT P . n 
A 1 4   DA  4   4   4   DA  ADE P . n 
A 1 5   DC  5   5   5   DC  CYT P . n 
A 1 6   DT  6   6   6   DT  THY P . n 
A 1 7   DG  7   7   7   DG  GUA P . n 
A 1 8   DA  8   8   8   DA  ADE P . n 
A 1 9   DT  9   9   9   DT  THY P . n 
A 1 10  DC  10  10  10  DC  CYT P . n 
A 1 11  DA  11  11  11  DA  ADE P . n 
A 1 12  DC  12  12  12  DC  CYT P . n 
A 1 13  DG  13  13  13  DG  GUA P . n 
B 2 1   DT  1   1   1   DT  THY T . n 
B 2 2   DA  2   2   2   DA  ADE T . n 
B 2 3   DC  3   3   3   DC  CYT T . n 
B 2 4   DG  4   4   4   DG  GUA T . n 
B 2 5   DA  5   5   5   DA  ADE T . n 
B 2 6   DC  6   6   6   DC  CYT T . n 
B 2 7   DG  7   7   7   DG  GUA T . n 
B 2 8   DT  8   8   8   DT  THY T . n 
B 2 9   DG  9   9   9   DG  GUA T . n 
B 2 10  DA  10  10  10  DA  ADE T . n 
B 2 11  DT  11  11  11  DT  THY T . n 
B 2 12  DC  12  12  12  DC  CYT T . n 
B 2 13  DA  13  13  13  DA  ADE T . n 
B 2 14  DG  14  14  14  DG  GUA T . n 
B 2 15  DT  15  15  15  DT  THY T . n 
B 2 16  DG  16  16  16  DG  GUA T . n 
B 2 17  DC  17  17  17  DC  CYT T . n 
B 2 18  DC  18  18  18  DC  CYT T . n 
C 3 1   MET 1   1   1   MET MET A . n 
C 3 2   ILE 2   2   2   ILE ILE A . n 
C 3 3   VAL 3   3   3   VAL VAL A . n 
C 3 4   LEU 4   4   4   LEU LEU A . n 
C 3 5   PHE 5   5   5   PHE PHE A . n 
C 3 6   VAL 6   6   6   VAL VAL A . n 
C 3 7   ASP 7   7   7   ASP ASP A . n 
C 3 8   PHE 8   8   8   PHE PHE A . n 
C 3 9   ASP 9   9   9   ASP ASP A . n 
C 3 10  TYR 10  10  10  TYR TYR A . n 
C 3 11  PHE 11  11  11  PHE PHE A . n 
C 3 12  TYR 12  12  12  TYR TYR A . n 
C 3 13  ALA 13  13  13  ALA ALA A . n 
C 3 14  GLN 14  14  14  GLN GLN A . n 
C 3 15  VAL 15  15  15  VAL VAL A . n 
C 3 16  GLU 16  16  16  GLU GLU A . n 
C 3 17  GLU 17  17  17  GLU GLU A . n 
C 3 18  VAL 18  18  18  VAL VAL A . n 
C 3 19  LEU 19  19  19  LEU LEU A . n 
C 3 20  ASN 20  20  20  ASN ASN A . n 
C 3 21  PRO 21  21  21  PRO PRO A . n 
C 3 22  SER 22  22  22  SER SER A . n 
C 3 23  LEU 23  23  23  LEU LEU A . n 
C 3 24  LYS 24  24  24  LYS LYS A . n 
C 3 25  GLY 25  25  25  GLY GLY A . n 
C 3 26  LYS 26  26  26  LYS LYS A . n 
C 3 27  PRO 27  27  27  PRO PRO A . n 
C 3 28  VAL 28  28  28  VAL VAL A . n 
C 3 29  VAL 29  29  29  VAL VAL A . n 
C 3 30  VAL 30  30  30  VAL VAL A . n 
C 3 31  CYS 31  31  31  CYS CYS A . n 
C 3 32  VAL 32  32  32  VAL VAL A . n 
C 3 33  PHE 33  33  33  PHE PHE A . n 
C 3 34  SER 34  34  34  SER SER A . n 
C 3 35  GLY 35  35  35  GLY GLY A . n 
C 3 36  ARG 36  36  36  ARG ARG A . n 
C 3 37  PHE 37  37  37  PHE PHE A . n 
C 3 38  GLU 38  38  38  GLU GLU A . n 
C 3 39  ASP 39  39  39  ASP ASP A . n 
C 3 40  SER 40  40  40  SER SER A . n 
C 3 41  GLY 41  41  41  GLY GLY A . n 
C 3 42  ALA 42  42  42  ALA ALA A . n 
C 3 43  VAL 43  43  43  VAL VAL A . n 
C 3 44  ALA 44  44  44  ALA ALA A . n 
C 3 45  THR 45  45  45  THR THR A . n 
C 3 46  ALA 46  46  46  ALA ALA A . n 
C 3 47  ASN 47  47  47  ASN ASN A . n 
C 3 48  TYR 48  48  48  TYR TYR A . n 
C 3 49  GLU 49  49  49  GLU GLU A . n 
C 3 50  ALA 50  50  50  ALA ALA A . n 
C 3 51  ARG 51  51  51  ARG ARG A . n 
C 3 52  LYS 52  52  52  LYS LYS A . n 
C 3 53  PHE 53  53  53  PHE PHE A . n 
C 3 54  GLY 54  54  54  GLY GLY A . n 
C 3 55  VAL 55  55  55  VAL VAL A . n 
C 3 56  LYS 56  56  56  LYS LYS A . n 
C 3 57  ALA 57  57  57  ALA ALA A . n 
C 3 58  GLY 58  58  58  GLY GLY A . n 
C 3 59  ILE 59  59  59  ILE ILE A . n 
C 3 60  PRO 60  60  60  PRO PRO A . n 
C 3 61  ILE 61  61  61  ILE ILE A . n 
C 3 62  VAL 62  62  62  VAL VAL A . n 
C 3 63  GLU 63  63  63  GLU GLU A . n 
C 3 64  ALA 64  64  64  ALA ALA A . n 
C 3 65  LYS 65  65  65  LYS LYS A . n 
C 3 66  LYS 66  66  66  LYS LYS A . n 
C 3 67  ILE 67  67  67  ILE ILE A . n 
C 3 68  LEU 68  68  68  LEU LEU A . n 
C 3 69  PRO 69  69  69  PRO PRO A . n 
C 3 70  ASN 70  70  70  ASN ASN A . n 
C 3 71  ALA 71  71  71  ALA ALA A . n 
C 3 72  VAL 72  72  72  VAL VAL A . n 
C 3 73  TYR 73  73  73  TYR TYR A . n 
C 3 74  LEU 74  74  74  LEU LEU A . n 
C 3 75  PRO 75  75  75  PRO PRO A . n 
C 3 76  MET 76  76  76  MET MET A . n 
C 3 77  ARG 77  77  77  ARG ARG A . n 
C 3 78  LYS 78  78  78  LYS LYS A . n 
C 3 79  GLU 79  79  79  GLU GLU A . n 
C 3 80  VAL 80  80  80  VAL VAL A . n 
C 3 81  TYR 81  81  81  TYR TYR A . n 
C 3 82  GLN 82  82  82  GLN GLN A . n 
C 3 83  GLN 83  83  83  GLN GLN A . n 
C 3 84  VAL 84  84  84  VAL VAL A . n 
C 3 85  SER 85  85  85  SER SER A . n 
C 3 86  SER 86  86  86  SER SER A . n 
C 3 87  ARG 87  87  87  ARG ARG A . n 
C 3 88  ILE 88  88  88  ILE ILE A . n 
C 3 89  MET 89  89  89  MET MET A . n 
C 3 90  ASN 90  90  90  ASN ASN A . n 
C 3 91  LEU 91  91  91  LEU LEU A . n 
C 3 92  LEU 92  92  92  LEU LEU A . n 
C 3 93  ARG 93  93  93  ARG ARG A . n 
C 3 94  GLU 94  94  94  GLU GLU A . n 
C 3 95  TYR 95  95  95  TYR TYR A . n 
C 3 96  SER 96  96  96  SER SER A . n 
C 3 97  GLU 97  97  97  GLU GLU A . n 
C 3 98  LYS 98  98  98  LYS LYS A . n 
C 3 99  ILE 99  99  99  ILE ILE A . n 
C 3 100 GLU 100 100 100 GLU GLU A . n 
C 3 101 ILE 101 101 101 ILE ILE A . n 
C 3 102 ALA 102 102 102 ALA ALA A . n 
C 3 103 SER 103 103 103 SER SER A . n 
C 3 104 ILE 104 104 104 ILE ILE A . n 
C 3 105 ASP 105 105 105 ASP ASP A . n 
C 3 106 GLU 106 106 106 GLU GLU A . n 
C 3 107 ALA 107 107 107 ALA ALA A . n 
C 3 108 TYR 108 108 108 TYR TYR A . n 
C 3 109 LEU 109 109 109 LEU LEU A . n 
C 3 110 ASP 110 110 110 ASP ASP A . n 
C 3 111 ILE 111 111 111 ILE ILE A . n 
C 3 112 SER 112 112 112 SER SER A . n 
C 3 113 ASP 113 113 113 ASP ASP A . n 
C 3 114 LYS 114 114 114 LYS LYS A . n 
C 3 115 VAL 115 115 115 VAL VAL A . n 
C 3 116 ARG 116 116 116 ARG ARG A . n 
C 3 117 ASP 117 117 117 ASP ASP A . n 
C 3 118 TYR 118 118 118 TYR TYR A . n 
C 3 119 ARG 119 119 119 ARG ARG A . n 
C 3 120 GLU 120 120 120 GLU GLU A . n 
C 3 121 ALA 121 121 121 ALA ALA A . n 
C 3 122 TYR 122 122 122 TYR TYR A . n 
C 3 123 ASN 123 123 123 ASN ASN A . n 
C 3 124 LEU 124 124 124 LEU LEU A . n 
C 3 125 GLY 125 125 125 GLY GLY A . n 
C 3 126 LEU 126 126 126 LEU LEU A . n 
C 3 127 GLU 127 127 127 GLU GLU A . n 
C 3 128 ILE 128 128 128 ILE ILE A . n 
C 3 129 LYS 129 129 129 LYS LYS A . n 
C 3 130 ASN 130 130 130 ASN ASN A . n 
C 3 131 LYS 131 131 131 LYS LYS A . n 
C 3 132 ILE 132 132 132 ILE ILE A . n 
C 3 133 LEU 133 133 133 LEU LEU A . n 
C 3 134 GLU 134 134 134 GLU GLU A . n 
C 3 135 LYS 135 135 135 LYS LYS A . n 
C 3 136 GLU 136 136 136 GLU GLU A . n 
C 3 137 LYS 137 137 137 LYS LYS A . n 
C 3 138 ILE 138 138 138 ILE ILE A . n 
C 3 139 THR 139 139 139 THR THR A . n 
C 3 140 VAL 140 140 140 VAL VAL A . n 
C 3 141 THR 141 141 141 THR THR A . n 
C 3 142 VAL 142 142 142 VAL VAL A . n 
C 3 143 GLY 143 143 143 GLY GLY A . n 
C 3 144 ILE 144 144 144 ILE ILE A . n 
C 3 145 SER 145 145 145 SER SER A . n 
C 3 146 LYS 146 146 146 LYS LYS A . n 
C 3 147 ASN 147 147 147 ASN ASN A . n 
C 3 148 LYS 148 148 148 LYS LYS A . n 
C 3 149 VAL 149 149 149 VAL VAL A . n 
C 3 150 PHE 150 150 150 PHE PHE A . n 
C 3 151 ALA 151 151 151 ALA ALA A . n 
C 3 152 LYS 152 152 152 LYS LYS A . n 
C 3 153 ILE 153 153 153 ILE ILE A . n 
C 3 154 ALA 154 154 154 ALA ALA A . n 
C 3 155 ALA 155 155 155 ALA ALA A . n 
C 3 156 ASP 156 156 156 ASP ASP A . n 
C 3 157 MET 157 157 157 MET MET A . n 
C 3 158 ALA 158 158 158 ALA ALA A . n 
C 3 159 LYS 159 159 159 LYS LYS A . n 
C 3 160 PRO 160 160 160 PRO PRO A . n 
C 3 161 ASN 161 161 161 ASN ASN A . n 
C 3 162 GLY 162 162 162 GLY GLY A . n 
C 3 163 ILE 163 163 163 ILE ILE A . n 
C 3 164 LYS 164 164 164 LYS LYS A . n 
C 3 165 VAL 165 165 165 VAL VAL A . n 
C 3 166 ILE 166 166 166 ILE ILE A . n 
C 3 167 ASP 167 167 167 ASP ASP A . n 
C 3 168 ASP 168 168 168 ASP ASP A . n 
C 3 169 GLU 169 169 169 GLU GLU A . n 
C 3 170 GLU 170 170 170 GLU GLU A . n 
C 3 171 VAL 171 171 171 VAL VAL A . n 
C 3 172 LYS 172 172 172 LYS LYS A . n 
C 3 173 ARG 173 173 173 ARG ARG A . n 
C 3 174 LEU 174 174 174 LEU LEU A . n 
C 3 175 ILE 175 175 175 ILE ILE A . n 
C 3 176 ARG 176 176 176 ARG ARG A . n 
C 3 177 GLU 177 177 177 GLU GLU A . n 
C 3 178 LEU 178 178 178 LEU LEU A . n 
C 3 179 ASP 179 179 179 ASP ASP A . n 
C 3 180 ILE 180 180 180 ILE ILE A . n 
C 3 181 ALA 181 181 181 ALA ALA A . n 
C 3 182 ASP 182 182 182 ASP ASP A . n 
C 3 183 VAL 183 183 183 VAL VAL A . n 
C 3 184 PRO 184 184 184 PRO PRO A . n 
C 3 185 GLY 185 185 185 GLY GLY A . n 
C 3 186 ILE 186 186 186 ILE ILE A . n 
C 3 187 GLY 187 187 187 GLY GLY A . n 
C 3 188 ASN 188 188 188 ASN ASN A . n 
C 3 189 ILE 189 189 189 ILE ILE A . n 
C 3 190 THR 190 190 190 THR THR A . n 
C 3 191 ALA 191 191 191 ALA ALA A . n 
C 3 192 GLU 192 192 192 GLU GLU A . n 
C 3 193 LYS 193 193 193 LYS LYS A . n 
C 3 194 LEU 194 194 194 LEU LEU A . n 
C 3 195 LYS 195 195 195 LYS LYS A . n 
C 3 196 LYS 196 196 196 LYS LYS A . n 
C 3 197 LEU 197 197 197 LEU LEU A . n 
C 3 198 GLY 198 198 198 GLY GLY A . n 
C 3 199 ILE 199 199 199 ILE ILE A . n 
C 3 200 ASN 200 200 200 ASN ASN A . n 
C 3 201 LYS 201 201 201 LYS LYS A . n 
C 3 202 LEU 202 202 202 LEU LEU A . n 
C 3 203 VAL 203 203 203 VAL VAL A . n 
C 3 204 ASP 204 204 204 ASP ASP A . n 
C 3 205 THR 205 205 205 THR THR A . n 
C 3 206 LEU 206 206 206 LEU LEU A . n 
C 3 207 SER 207 207 207 SER SER A . n 
C 3 208 ILE 208 208 208 ILE ILE A . n 
C 3 209 GLU 209 209 209 GLU GLU A . n 
C 3 210 PHE 210 210 210 PHE PHE A . n 
C 3 211 ASP 211 211 211 ASP ASP A . n 
C 3 212 LYS 212 212 212 LYS LYS A . n 
C 3 213 LEU 213 213 213 LEU LEU A . n 
C 3 214 LYS 214 214 214 LYS LYS A . n 
C 3 215 GLY 215 215 215 GLY GLY A . n 
C 3 216 MET 216 216 216 MET MET A . n 
C 3 217 ILE 217 217 217 ILE ILE A . n 
C 3 218 GLY 218 218 218 GLY GLY A . n 
C 3 219 GLU 219 219 219 GLU GLU A . n 
C 3 220 ALA 220 220 220 ALA ALA A . n 
C 3 221 LYS 221 221 221 LYS LYS A . n 
C 3 222 ALA 222 222 222 ALA ALA A . n 
C 3 223 LYS 223 223 223 LYS LYS A . n 
C 3 224 TYR 224 224 224 TYR TYR A . n 
C 3 225 LEU 225 225 225 LEU LEU A . n 
C 3 226 ILE 226 226 226 ILE ILE A . n 
C 3 227 SER 227 227 227 SER SER A . n 
C 3 228 LEU 228 228 228 LEU LEU A . n 
C 3 229 ALA 229 229 229 ALA ALA A . n 
C 3 230 ARG 230 230 230 ARG ARG A . n 
C 3 231 ASP 231 231 231 ASP ASP A . n 
C 3 232 GLU 232 232 232 GLU GLU A . n 
C 3 233 TYR 233 233 233 TYR TYR A . n 
C 3 234 ASN 234 234 234 ASN ASN A . n 
C 3 235 GLU 235 235 235 GLU GLU A . n 
C 3 236 PRO 236 236 236 PRO PRO A . n 
C 3 237 ILE 237 237 237 ILE ILE A . n 
C 3 238 ARG 238 238 238 ARG ARG A . n 
C 3 239 THR 239 239 239 THR THR A . n 
C 3 240 ARG 240 240 240 ARG ARG A . n 
C 3 241 VAL 241 241 241 VAL VAL A . n 
C 3 242 ARG 242 242 242 ARG ARG A . n 
C 3 243 LYS 243 243 243 LYS LYS A . n 
C 3 244 SER 244 244 244 SER SER A . n 
C 3 245 ILE 245 245 245 ILE ILE A . n 
C 3 246 GLY 246 246 246 GLY GLY A . n 
C 3 247 ARG 247 247 247 ARG ARG A . n 
C 3 248 ILE 248 248 248 ILE ILE A . n 
C 3 249 VAL 249 249 249 VAL VAL A . n 
C 3 250 THR 250 250 250 THR THR A . n 
C 3 251 MET 251 251 251 MET MET A . n 
C 3 252 LYS 252 252 252 LYS LYS A . n 
C 3 253 ARG 253 253 253 ARG ARG A . n 
C 3 254 ASN 254 254 254 ASN ASN A . n 
C 3 255 SER 255 255 255 SER SER A . n 
C 3 256 ARG 256 256 256 ARG ARG A . n 
C 3 257 ASN 257 257 257 ASN ASN A . n 
C 3 258 LEU 258 258 258 LEU LEU A . n 
C 3 259 GLU 259 259 259 GLU GLU A . n 
C 3 260 GLU 260 260 260 GLU GLU A . n 
C 3 261 ILE 261 261 261 ILE ILE A . n 
C 3 262 LYS 262 262 262 LYS LYS A . n 
C 3 263 PRO 263 263 263 PRO PRO A . n 
C 3 264 TYR 264 264 264 TYR TYR A . n 
C 3 265 LEU 265 265 265 LEU LEU A . n 
C 3 266 PHE 266 266 266 PHE PHE A . n 
C 3 267 ARG 267 267 267 ARG ARG A . n 
C 3 268 ALA 268 268 268 ALA ALA A . n 
C 3 269 ILE 269 269 269 ILE ILE A . n 
C 3 270 GLU 270 270 270 GLU GLU A . n 
C 3 271 GLU 271 271 271 GLU GLU A . n 
C 3 272 SER 272 272 272 SER SER A . n 
C 3 273 TYR 273 273 273 TYR TYR A . n 
C 3 274 TYR 274 274 274 TYR TYR A . n 
C 3 275 LYS 275 275 275 LYS LYS A . n 
C 3 276 LEU 276 276 276 LEU LEU A . n 
C 3 277 ASP 277 277 277 ASP ASP A . n 
C 3 278 LYS 278 278 278 LYS LYS A . n 
C 3 279 ARG 279 279 279 ARG ARG A . n 
C 3 280 ILE 280 280 280 ILE ILE A . n 
C 3 281 PRO 281 281 281 PRO PRO A . n 
C 3 282 LYS 282 282 282 LYS LYS A . n 
C 3 283 ALA 283 283 283 ALA ALA A . n 
C 3 284 ILE 284 284 284 ILE ILE A . n 
C 3 285 HIS 285 285 285 HIS HIS A . n 
C 3 286 VAL 286 286 286 VAL VAL A . n 
C 3 287 VAL 287 287 287 VAL VAL A . n 
C 3 288 ALA 288 288 288 ALA ALA A . n 
C 3 289 VAL 289 289 289 VAL VAL A . n 
C 3 290 THR 290 290 290 THR THR A . n 
C 3 291 GLU 291 291 291 GLU GLU A . n 
C 3 292 ASP 292 292 292 ASP ASP A . n 
C 3 293 LEU 293 293 293 LEU LEU A . n 
C 3 294 ASP 294 294 294 ASP ASP A . n 
C 3 295 ILE 295 295 295 ILE ILE A . n 
C 3 296 VAL 296 296 296 VAL VAL A . n 
C 3 297 SER 297 297 297 SER SER A . n 
C 3 298 ARG 298 298 298 ARG ARG A . n 
C 3 299 GLY 299 299 299 GLY GLY A . n 
C 3 300 ARG 300 300 300 ARG ARG A . n 
C 3 301 THR 301 301 301 THR THR A . n 
C 3 302 PHE 302 302 302 PHE PHE A . n 
C 3 303 PRO 303 303 303 PRO PRO A . n 
C 3 304 HIS 304 304 304 HIS HIS A . n 
C 3 305 GLY 305 305 305 GLY GLY A . n 
C 3 306 ILE 306 306 306 ILE ILE A . n 
C 3 307 SER 307 307 307 SER SER A . n 
C 3 308 LYS 308 308 308 LYS LYS A . n 
C 3 309 GLU 309 309 309 GLU GLU A . n 
C 3 310 THR 310 310 310 THR THR A . n 
C 3 311 ALA 311 311 311 ALA ALA A . n 
C 3 312 TYR 312 312 312 TYR TYR A . n 
C 3 313 SER 313 313 313 SER SER A . n 
C 3 314 GLU 314 314 314 GLU GLU A . n 
C 3 315 SER 315 315 315 SER SER A . n 
C 3 316 VAL 316 316 316 VAL VAL A . n 
C 3 317 LYS 317 317 317 LYS LYS A . n 
C 3 318 LEU 318 318 318 LEU LEU A . n 
C 3 319 LEU 319 319 319 LEU LEU A . n 
C 3 320 GLN 320 320 320 GLN GLN A . n 
C 3 321 LYS 321 321 321 LYS LYS A . n 
C 3 322 ILE 322 322 322 ILE ILE A . n 
C 3 323 LEU 323 323 323 LEU LEU A . n 
C 3 324 GLU 324 324 324 GLU GLU A . n 
C 3 325 GLU 325 325 325 GLU GLU A . n 
C 3 326 ASP 326 326 326 ASP ASP A . n 
C 3 327 GLU 327 327 327 GLU GLU A . n 
C 3 328 ARG 328 328 328 ARG ARG A . n 
C 3 329 LYS 329 329 329 LYS LYS A . n 
C 3 330 ILE 330 330 330 ILE ILE A . n 
C 3 331 ARG 331 331 331 ARG ARG A . n 
C 3 332 ARG 332 332 332 ARG ARG A . n 
C 3 333 ILE 333 333 333 ILE ILE A . n 
C 3 334 GLY 334 334 334 GLY GLY A . n 
C 3 335 VAL 335 335 335 VAL VAL A . n 
C 3 336 ARG 336 336 336 ARG ARG A . n 
C 3 337 PHE 337 337 337 PHE PHE A . n 
C 3 338 SER 338 338 338 SER SER A . n 
C 3 339 LYS 339 339 339 LYS LYS A . n 
C 3 340 PHE 340 340 340 PHE PHE A . n 
C 3 341 ILE 341 341 341 ILE ILE A . n 
C 3 342 GLU 342 342 ?   ?   ?   A . n 
C 3 343 ALA 343 343 ?   ?   ?   A . n 
C 3 344 ILE 344 344 ?   ?   ?   A . n 
C 3 345 GLY 345 345 ?   ?   ?   A . n 
C 3 346 LEU 346 346 ?   ?   ?   A . n 
C 3 347 ASP 347 347 ?   ?   ?   A . n 
C 3 348 LYS 348 348 ?   ?   ?   A . n 
C 3 349 PHE 349 349 ?   ?   ?   A . n 
C 3 350 PHE 350 350 ?   ?   ?   A . n 
C 3 351 ASP 351 351 ?   ?   ?   A . n 
C 3 352 THR 352 352 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 CA  1  403 403 CA  CA2 A . 
E 4 CA  1  404 404 CA  CA2 A . 
F 4 CA  1  405 405 CA  CA2 A . 
G 5 DCP 1  804 804 DCP DCP A . 
H 6 HOH 1  14  4   HOH TIP P . 
H 6 HOH 2  15  5   HOH TIP P . 
H 6 HOH 3  16  12  HOH TIP P . 
H 6 HOH 4  17  16  HOH TIP P . 
H 6 HOH 5  18  18  HOH TIP P . 
H 6 HOH 6  19  19  HOH TIP P . 
I 6 HOH 1  19  6   HOH TIP T . 
I 6 HOH 2  20  7   HOH TIP T . 
I 6 HOH 3  21  10  HOH TIP T . 
I 6 HOH 4  22  24  HOH TIP T . 
J 6 HOH 1  805 1   HOH TIP A . 
J 6 HOH 2  806 2   HOH TIP A . 
J 6 HOH 3  807 3   HOH TIP A . 
J 6 HOH 4  808 8   HOH TIP A . 
J 6 HOH 5  809 11  HOH TIP A . 
J 6 HOH 6  810 13  HOH TIP A . 
J 6 HOH 7  811 15  HOH TIP A . 
J 6 HOH 8  812 17  HOH TIP A . 
J 6 HOH 9  813 20  HOH TIP A . 
J 6 HOH 10 814 21  HOH TIP A . 
J 6 HOH 11 815 22  HOH TIP A . 
J 6 HOH 12 816 23  HOH TIP A . 
J 6 HOH 13 817 25  HOH TIP A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O1A ? G DCP .   ? A DCP 804 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 O   ? J HOH .   ? A HOH 813 ? 1_555 85.8  ? 
2  O1A ? G DCP .   ? A DCP 804 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 OD1 ? C ASP 7   ? A ASP 7   ? 1_555 82.7  ? 
3  O   ? J HOH .   ? A HOH 813 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 OD1 ? C ASP 7   ? A ASP 7   ? 1_555 86.4  ? 
4  O1A ? G DCP .   ? A DCP 804 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 OD2 ? C ASP 7   ? A ASP 7   ? 1_555 115.1 ? 
5  O   ? J HOH .   ? A HOH 813 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 OD2 ? C ASP 7   ? A ASP 7   ? 1_555 112.1 ? 
6  OD1 ? C ASP 7   ? A ASP 7   ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 OD2 ? C ASP 7   ? A ASP 7   ? 1_555 40.8  ? 
7  O1A ? G DCP .   ? A DCP 804 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 O   ? J HOH .   ? A HOH 805 ? 1_555 149.8 ? 
8  O   ? J HOH .   ? A HOH 813 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 O   ? J HOH .   ? A HOH 805 ? 1_555 124.1 ? 
9  OD1 ? C ASP 7   ? A ASP 7   ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 O   ? J HOH .   ? A HOH 805 ? 1_555 101.9 ? 
10 OD2 ? C ASP 7   ? A ASP 7   ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 O   ? J HOH .   ? A HOH 805 ? 1_555 61.4  ? 
11 O1A ? G DCP .   ? A DCP 804 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 OE2 ? C GLU 106 ? A GLU 106 ? 1_555 153.2 ? 
12 O   ? J HOH .   ? A HOH 813 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 OE2 ? C GLU 106 ? A GLU 106 ? 1_555 67.6  ? 
13 OD1 ? C ASP 7   ? A ASP 7   ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 OE2 ? C GLU 106 ? A GLU 106 ? 1_555 91.7  ? 
14 OD2 ? C ASP 7   ? A ASP 7   ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 OE2 ? C GLU 106 ? A GLU 106 ? 1_555 74.2  ? 
15 O   ? J HOH .   ? A HOH 805 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 OE2 ? C GLU 106 ? A GLU 106 ? 1_555 57.0  ? 
16 O1G ? G DCP .   ? A DCP 804 ? 1_555 CA ? E CA . ? A CA 404 ? 1_555 OD2 ? C ASP 105 ? A ASP 105 ? 1_555 156.7 ? 
17 O1G ? G DCP .   ? A DCP 804 ? 1_555 CA ? E CA . ? A CA 404 ? 1_555 O2B ? G DCP .   ? A DCP 804 ? 1_555 79.4  ? 
18 OD2 ? C ASP 105 ? A ASP 105 ? 1_555 CA ? E CA . ? A CA 404 ? 1_555 O2B ? G DCP .   ? A DCP 804 ? 1_555 85.2  ? 
19 O1G ? G DCP .   ? A DCP 804 ? 1_555 CA ? E CA . ? A CA 404 ? 1_555 O1A ? G DCP .   ? A DCP 804 ? 1_555 74.9  ? 
20 OD2 ? C ASP 105 ? A ASP 105 ? 1_555 CA ? E CA . ? A CA 404 ? 1_555 O1A ? G DCP .   ? A DCP 804 ? 1_555 83.8  ? 
21 O2B ? G DCP .   ? A DCP 804 ? 1_555 CA ? E CA . ? A CA 404 ? 1_555 O1A ? G DCP .   ? A DCP 804 ? 1_555 72.5  ? 
22 O1G ? G DCP .   ? A DCP 804 ? 1_555 CA ? E CA . ? A CA 404 ? 1_555 OD1 ? C ASP 7   ? A ASP 7   ? 1_555 112.3 ? 
23 OD2 ? C ASP 105 ? A ASP 105 ? 1_555 CA ? E CA . ? A CA 404 ? 1_555 OD1 ? C ASP 7   ? A ASP 7   ? 1_555 82.0  ? 
24 O2B ? G DCP .   ? A DCP 804 ? 1_555 CA ? E CA . ? A CA 404 ? 1_555 OD1 ? C ASP 7   ? A ASP 7   ? 1_555 167.1 ? 
25 O1A ? G DCP .   ? A DCP 804 ? 1_555 CA ? E CA . ? A CA 404 ? 1_555 OD1 ? C ASP 7   ? A ASP 7   ? 1_555 104.5 ? 
26 O1G ? G DCP .   ? A DCP 804 ? 1_555 CA ? E CA . ? A CA 404 ? 1_555 O   ? C PHE 8   ? A PHE 8   ? 1_555 112.2 ? 
27 OD2 ? C ASP 105 ? A ASP 105 ? 1_555 CA ? E CA . ? A CA 404 ? 1_555 O   ? C PHE 8   ? A PHE 8   ? 1_555 87.1  ? 
28 O2B ? G DCP .   ? A DCP 804 ? 1_555 CA ? E CA . ? A CA 404 ? 1_555 O   ? C PHE 8   ? A PHE 8   ? 1_555 97.7  ? 
29 O1A ? G DCP .   ? A DCP 804 ? 1_555 CA ? E CA . ? A CA 404 ? 1_555 O   ? C PHE 8   ? A PHE 8   ? 1_555 167.1 ? 
30 OD1 ? C ASP 7   ? A ASP 7   ? 1_555 CA ? E CA . ? A CA 404 ? 1_555 O   ? C PHE 8   ? A PHE 8   ? 1_555 83.2  ? 
31 O   ? C ALA 181 ? A ALA 181 ? 1_555 CA ? F CA . ? A CA 405 ? 1_555 O   ? C ILE 186 ? A ILE 186 ? 1_555 90.7  ? 
32 O   ? C ALA 181 ? A ALA 181 ? 1_555 CA ? F CA . ? A CA 405 ? 1_555 O   ? J HOH .   ? A HOH 816 ? 1_555 81.6  ? 
33 O   ? C ILE 186 ? A ILE 186 ? 1_555 CA ? F CA . ? A CA 405 ? 1_555 O   ? J HOH .   ? A HOH 816 ? 1_555 131.8 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-03-30 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2018-04-04 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Source and taxonomy'       
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Data collection'           
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            diffrn_source 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    4 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_diffrn_source.type' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000  'data collection' . ? 1 
SCALEPACK 'data scaling'    . ? 2 
CNS       refinement        . ? 3 
HKL-2000  'data reduction'  . ? 4 
CNS       phasing           . ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O2    P DC  5   ? ? O P HOH 17  ? ? 2.13 
2 1 "O4'" P DT  6   ? ? O P HOH 17  ? ? 2.16 
3 1 OD1   A ASP 105 ? ? O A HOH 813 ? ? 2.17 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" P DG  13 ? ? "C1'" P DG  13 ? ? N9 P DG  13 ? ? 110.50 108.30 2.20 0.30 N 
2 1 "O4'" T DT  8  ? ? "C1'" T DT  8  ? ? N1 T DT  8  ? ? 110.34 108.30 2.04 0.30 N 
3 1 C     A ASN 20 ? ? N     A PRO 21 ? ? CA A PRO 21 ? ? 129.00 119.30 9.70 1.50 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 TYR A 10  ? ? 16.08   56.47   
2  1 PHE A 11  ? ? -36.80  -70.85  
3  1 ASN A 47  ? ? -66.89  -179.26 
4  1 SER A 96  ? ? 169.01  135.66  
5  1 ASP A 105 ? ? -148.02 29.07   
6  1 LYS A 114 ? ? -140.63 -15.13  
7  1 GLU A 134 ? ? -56.22  -73.49  
8  1 SER A 145 ? ? -175.09 -167.14 
9  1 ASN A 161 ? ? 29.19   53.95   
10 1 ASN A 254 ? ? -55.64  175.20  
11 1 SER A 255 ? ? 158.81  163.37  
12 1 ASP A 277 ? ? 29.46   93.52   
13 1 LYS A 278 ? ? 81.23   -17.34  
14 1 THR A 290 ? ? -48.67  160.61  
15 1 ARG A 300 ? ? -170.55 134.35  
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    DT 
_pdbx_validate_planes.auth_asym_id    T 
_pdbx_validate_planes.auth_seq_id     15 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.071 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 T DA 5 ? N9 ? B DA 5 N9 
2  1 Y 1 T DA 5 ? C8 ? B DA 5 C8 
3  1 Y 1 T DA 5 ? N7 ? B DA 5 N7 
4  1 Y 1 T DA 5 ? C5 ? B DA 5 C5 
5  1 Y 1 T DA 5 ? C6 ? B DA 5 C6 
6  1 Y 1 T DA 5 ? N6 ? B DA 5 N6 
7  1 Y 1 T DA 5 ? N1 ? B DA 5 N1 
8  1 Y 1 T DA 5 ? C2 ? B DA 5 C2 
9  1 Y 1 T DA 5 ? N3 ? B DA 5 N3 
10 1 Y 1 T DA 5 ? C4 ? B DA 5 C4 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLU 342 ? C GLU 342 
2  1 Y 1 A ALA 343 ? C ALA 343 
3  1 Y 1 A ILE 344 ? C ILE 344 
4  1 Y 1 A GLY 345 ? C GLY 345 
5  1 Y 1 A LEU 346 ? C LEU 346 
6  1 Y 1 A ASP 347 ? C ASP 347 
7  1 Y 1 A LYS 348 ? C LYS 348 
8  1 Y 1 A PHE 349 ? C PHE 349 
9  1 Y 1 A PHE 350 ? C PHE 350 
10 1 Y 1 A ASP 351 ? C ASP 351 
11 1 Y 1 A THR 352 ? C THR 352 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1S0N 'double helix'        
1S0N 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DG 1  1_555 B DC 18 1_555 -0.232 -0.243 -0.271 6.388   -4.856 -9.011  1  P_DG1:DC18_T P 1  ? T 18 ? 19 1 
1 A DG 2  1_555 B DC 17 1_555 -0.647 0.048  0.263  22.921  0.353  5.056   2  P_DG2:DC17_T P 2  ? T 17 ? 19 1 
1 A DC 3  1_555 B DG 16 1_555 -0.356 -0.277 -0.278 6.311   -4.273 -12.015 3  P_DC3:DG16_T P 3  ? T 16 ? 19 1 
1 A DA 4  1_555 B DT 15 1_555 0.420  -0.231 -0.526 -7.323  0.704  -4.410  4  P_DA4:DT15_T P 4  ? T 15 ? 20 1 
1 A DC 5  1_555 B DG 14 1_555 0.221  0.150  0.403  -4.289  3.204  -2.072  5  P_DC5:DG14_T P 5  ? T 14 ? 19 1 
1 A DT 6  1_555 B DA 13 1_555 -0.427 -0.265 0.214  -9.672  -3.431 -2.678  6  P_DT6:DA13_T P 6  ? T 13 ? 20 1 
1 A DG 7  1_555 B DC 12 1_555 -0.270 -0.250 -0.064 -0.210  -7.960 -0.242  7  P_DG7:DC12_T P 7  ? T 12 ? 19 1 
1 A DA 8  1_555 B DT 11 1_555 0.512  -0.353 -0.194 -7.673  -9.579 -4.711  8  P_DA8:DT11_T P 8  ? T 11 ? 20 1 
1 A DT 9  1_555 B DA 10 1_555 0.282  -0.601 -0.350 -0.976  -8.499 -2.892  9  P_DT9:DA10_T P 9  ? T 10 ? 20 1 
1 A DC 10 1_555 B DG 9  1_555 -0.231 -0.288 -0.191 9.037   0.713  -7.544  10 P_DC10:DG9_T P 10 ? T 9  ? 19 1 
1 A DA 11 1_555 B DT 8  1_555 0.676  -0.093 -0.121 4.591   2.653  -6.928  11 P_DA11:DT8_T P 11 ? T 8  ? 20 1 
1 A DC 12 1_555 B DG 7  1_555 0.213  -0.490 -0.223 7.558   8.751  1.359   12 P_DC12:DG7_T P 12 ? T 7  ? 19 1 
1 A DG 13 1_555 B DC 6  1_555 0.217  -0.683 -0.710 -12.921 -7.624 -2.696  13 P_DG13:DC6_T P 13 ? T 6  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DG 1  1_555 B DC 18 1_555 A DG 2  1_555 B DC 17 1_555 1.450  -0.198 2.979 -3.060 0.591  31.083 -0.467 -3.210 2.822 1.099  
5.692  31.235 1  PP_DG1DG2:DC17DC18_TT P 1  ? T 18 ? P 2  ? T 17 ? 
1 A DG 2  1_555 B DC 17 1_555 A DC 3  1_555 B DG 16 1_555 -1.872 -0.839 3.878 -4.036 10.150 37.023 -2.758 2.245  3.706 15.573 
6.193  38.547 2  PP_DG2DC3:DG16DC17_TT P 2  ? T 17 ? P 3  ? T 16 ? 
1 A DC 3  1_555 B DG 16 1_555 A DA 4  1_555 B DT 15 1_555 0.941  -0.423 3.712 3.423  1.181  40.768 -0.753 -0.918 3.763 1.691  
-4.902 40.922 3  PP_DC3DA4:DT15DG16_TT P 3  ? T 16 ? P 4  ? T 15 ? 
1 A DA 4  1_555 B DT 15 1_555 A DC 5  1_555 B DG 14 1_555 -0.190 -0.686 3.483 -6.079 4.881  29.834 -2.296 -0.894 3.305 9.282  
11.560 30.813 4  PP_DA4DC5:DG14DT15_TT P 4  ? T 15 ? P 5  ? T 14 ? 
1 A DC 5  1_555 B DG 14 1_555 A DT 6  1_555 B DA 13 1_555 -0.450 -0.763 3.438 3.083  8.784  34.830 -2.506 1.174  3.111 14.360 
-5.040 36.016 5  PP_DC5DT6:DA13DG14_TT P 5  ? T 14 ? P 6  ? T 13 ? 
1 A DT 6  1_555 B DA 13 1_555 A DG 7  1_555 B DC 12 1_555 -0.272 1.016  3.246 0.752  1.033  38.002 1.428  0.512  3.266 1.586  
-1.154 38.023 6  PP_DT6DG7:DC12DA13_TT P 6  ? T 13 ? P 7  ? T 12 ? 
1 A DG 7  1_555 B DC 12 1_555 A DA 8  1_555 B DT 11 1_555 -0.257 -0.653 3.586 1.845  1.629  40.659 -1.134 0.591  3.544 2.341  
-2.652 40.730 7  PP_DG7DA8:DT11DC12_TT P 7  ? T 12 ? P 8  ? T 11 ? 
1 A DA 8  1_555 B DT 11 1_555 A DT 9  1_555 B DA 10 1_555 0.125  -0.589 3.154 3.238  -1.726 33.130 -0.749 0.305  3.177 -3.016 
-5.656 33.327 8  PP_DA8DT9:DA10DT11_TT P 8  ? T 11 ? P 9  ? T 10 ? 
1 A DT 9  1_555 B DA 10 1_555 A DC 10 1_555 B DG 9  1_555 0.093  -0.682 3.173 0.915  3.246  29.916 -1.950 0.001  3.085 6.262  
-1.766 30.101 9  PP_DT9DC10:DG9DA10_TT P 9  ? T 10 ? P 10 ? T 9  ? 
1 A DC 10 1_555 B DG 9  1_555 A DA 11 1_555 B DT 8  1_555 0.765  -0.218 3.481 0.603  8.116  37.223 -1.426 -1.091 3.373 12.531 
-0.931 38.072 10 PP_DC10DA11:DT8DG9_TT P 10 ? T 9  ? P 11 ? T 8  ? 
1 A DA 11 1_555 B DT 8  1_555 A DC 12 1_555 B DG 7  1_555 0.450  -1.004 3.467 -1.542 8.703  22.269 -5.246 -1.586 2.839 21.478 
3.806  23.939 11 PP_DA11DC12:DG7DT8_TT P 11 ? T 8  ? P 12 ? T 7  ? 
1 A DC 12 1_555 B DG 7  1_555 A DG 13 1_555 B DC 6  1_555 -0.632 -0.598 4.048 1.768  6.389  30.929 -2.535 1.558  3.810 11.811 
-3.268 31.615 12 PP_DC12DG13:DC6DG7_TT P 12 ? T 7  ? P 13 ? T 6  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'CALCIUM ION'                      CA  
5 "2'-DEOXYCYTIDINE-5'-TRIPHOSPHATE" DCP 
6 water                              HOH 
#