data_1S0O
# 
_entry.id   1S0O 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.292 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1S0O         
NDB   PD0510       
RCSB  RCSB021218   
WWPDB D_1000021218 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1JX4 . unspecified 
PDB 1RYR . unspecified 
PDB 1RYS . unspecified 
PDB 1S0M . unspecified 
PDB 1S0N . unspecified 
PDB 1S10 . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1S0O 
_pdbx_database_status.recvd_initial_deposition_date   2003-12-31 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ling, H.'     1 
'Boudsocq, F.' 2 
'Woodgate, R.' 3 
'Yang, W.'     4 
# 
_citation.id                        primary 
_citation.title                     
'Snapshots of Replication through an Abasic Lesion; Structural Basis for Base Substitutions and Frameshifts.' 
_citation.journal_abbrev            Mol.Cell 
_citation.journal_volume            13 
_citation.page_first                751 
_citation.page_last                 762 
_citation.year                      2004 
_citation.journal_id_ASTM           MOCEFL 
_citation.country                   US 
_citation.journal_id_ISSN           1097-2765 
_citation.journal_id_CSD            2168 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15023344 
_citation.pdbx_database_id_DOI      '10.1016/S1097-2765(04)00101-7' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Ling, H.'     1 
primary 'Boudsocq, F.' 2 
primary 'Woodgate, R.' 3 
primary 'Yang, W.'     4 
# 
_cell.entry_id           1S0O 
_cell.length_a           98.301 
_cell.length_b           103.046 
_cell.length_c           105.912 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1S0O 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn "5'-D(*GP*GP*GP*GP*GP*AP*AP*GP*GP*AP*CP*TP*C)-3'"             4081.659  2   ?       ? ? ? 
2 polymer     syn "5'-D(*TP*CP*AP*GP*TP*AP*GP*TP*CP*CP*TP*TP*CP*CP*CP*CP*C)-3'" 5074.285  2   ?       ? ? ? 
3 polymer     man 'DNA polymerase IV'                                           40257.879 2   2.7.7.7 ? ? ? 
4 non-polymer syn 'CALCIUM ION'                                                 40.078    6   ?       ? ? ? 
5 non-polymer syn 'MAGNESIUM ION'                                               24.305    2   ?       ? ? ? 
6 non-polymer syn "THYMIDINE-5'-TRIPHOSPHATE"                                   482.168   2   ?       ? ? ? 
7 water       nat water                                                         18.015    376 ?       ? ? ? 
# 
_entity_name_com.entity_id   3 
_entity_name_com.name        'Pol IV' 
# 
_entity_name_sys.entity_id   3 
_entity_name_sys.name        2.7.7.7 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DG)(DG)(DG)(DG)(DG)(DA)(DA)(DG)(DG)(DA)(DC)(DT)(DC)' GGGGGAAGGACTC C,E ? 
2 polydeoxyribonucleotide no no '(DT)(DC)(DA)(DG)(DT)(DA)(DG)(DT)(DC)(DC)(DT)(DT)(DC)(DC)(DC)(DC)(DC)' TCAGTAGTCCTTCCCCC D,F ? 
3 'polypeptide(L)'        no no 
;MIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEARKFGVKAGIPIVEAKKILPNAVYLPMRKEV
YQQVSSRIMNLLREYSEKIEIASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVFAKIAADMAKP
NGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGINKLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTR
VRKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSESVKLLQ
KILEEDERKIRRIGVRFSKFIEAIGLDKFFDT
;
;MIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEARKFGVKAGIPIVEAKKILPNAVYLPMRKEV
YQQVSSRIMNLLREYSEKIEIASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVFAKIAADMAKP
NGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGINKLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTR
VRKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSESVKLLQ
KILEEDERKIRRIGVRFSKFIEAIGLDKFFDT
;
A,B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DG  n 
1 2   DG  n 
1 3   DG  n 
1 4   DG  n 
1 5   DG  n 
1 6   DA  n 
1 7   DA  n 
1 8   DG  n 
1 9   DG  n 
1 10  DA  n 
1 11  DC  n 
1 12  DT  n 
1 13  DC  n 
2 1   DT  n 
2 2   DC  n 
2 3   DA  n 
2 4   DG  n 
2 5   DT  n 
2 6   DA  n 
2 7   DG  n 
2 8   DT  n 
2 9   DC  n 
2 10  DC  n 
2 11  DT  n 
2 12  DT  n 
2 13  DC  n 
2 14  DC  n 
2 15  DC  n 
2 16  DC  n 
2 17  DC  n 
3 1   MET n 
3 2   ILE n 
3 3   VAL n 
3 4   LEU n 
3 5   PHE n 
3 6   VAL n 
3 7   ASP n 
3 8   PHE n 
3 9   ASP n 
3 10  TYR n 
3 11  PHE n 
3 12  TYR n 
3 13  ALA n 
3 14  GLN n 
3 15  VAL n 
3 16  GLU n 
3 17  GLU n 
3 18  VAL n 
3 19  LEU n 
3 20  ASN n 
3 21  PRO n 
3 22  SER n 
3 23  LEU n 
3 24  LYS n 
3 25  GLY n 
3 26  LYS n 
3 27  PRO n 
3 28  VAL n 
3 29  VAL n 
3 30  VAL n 
3 31  CYS n 
3 32  VAL n 
3 33  PHE n 
3 34  SER n 
3 35  GLY n 
3 36  ARG n 
3 37  PHE n 
3 38  GLU n 
3 39  ASP n 
3 40  SER n 
3 41  GLY n 
3 42  ALA n 
3 43  VAL n 
3 44  ALA n 
3 45  THR n 
3 46  ALA n 
3 47  ASN n 
3 48  TYR n 
3 49  GLU n 
3 50  ALA n 
3 51  ARG n 
3 52  LYS n 
3 53  PHE n 
3 54  GLY n 
3 55  VAL n 
3 56  LYS n 
3 57  ALA n 
3 58  GLY n 
3 59  ILE n 
3 60  PRO n 
3 61  ILE n 
3 62  VAL n 
3 63  GLU n 
3 64  ALA n 
3 65  LYS n 
3 66  LYS n 
3 67  ILE n 
3 68  LEU n 
3 69  PRO n 
3 70  ASN n 
3 71  ALA n 
3 72  VAL n 
3 73  TYR n 
3 74  LEU n 
3 75  PRO n 
3 76  MET n 
3 77  ARG n 
3 78  LYS n 
3 79  GLU n 
3 80  VAL n 
3 81  TYR n 
3 82  GLN n 
3 83  GLN n 
3 84  VAL n 
3 85  SER n 
3 86  SER n 
3 87  ARG n 
3 88  ILE n 
3 89  MET n 
3 90  ASN n 
3 91  LEU n 
3 92  LEU n 
3 93  ARG n 
3 94  GLU n 
3 95  TYR n 
3 96  SER n 
3 97  GLU n 
3 98  LYS n 
3 99  ILE n 
3 100 GLU n 
3 101 ILE n 
3 102 ALA n 
3 103 SER n 
3 104 ILE n 
3 105 ASP n 
3 106 GLU n 
3 107 ALA n 
3 108 TYR n 
3 109 LEU n 
3 110 ASP n 
3 111 ILE n 
3 112 SER n 
3 113 ASP n 
3 114 LYS n 
3 115 VAL n 
3 116 ARG n 
3 117 ASP n 
3 118 TYR n 
3 119 ARG n 
3 120 GLU n 
3 121 ALA n 
3 122 TYR n 
3 123 ASN n 
3 124 LEU n 
3 125 GLY n 
3 126 LEU n 
3 127 GLU n 
3 128 ILE n 
3 129 LYS n 
3 130 ASN n 
3 131 LYS n 
3 132 ILE n 
3 133 LEU n 
3 134 GLU n 
3 135 LYS n 
3 136 GLU n 
3 137 LYS n 
3 138 ILE n 
3 139 THR n 
3 140 VAL n 
3 141 THR n 
3 142 VAL n 
3 143 GLY n 
3 144 ILE n 
3 145 SER n 
3 146 LYS n 
3 147 ASN n 
3 148 LYS n 
3 149 VAL n 
3 150 PHE n 
3 151 ALA n 
3 152 LYS n 
3 153 ILE n 
3 154 ALA n 
3 155 ALA n 
3 156 ASP n 
3 157 MET n 
3 158 ALA n 
3 159 LYS n 
3 160 PRO n 
3 161 ASN n 
3 162 GLY n 
3 163 ILE n 
3 164 LYS n 
3 165 VAL n 
3 166 ILE n 
3 167 ASP n 
3 168 ASP n 
3 169 GLU n 
3 170 GLU n 
3 171 VAL n 
3 172 LYS n 
3 173 ARG n 
3 174 LEU n 
3 175 ILE n 
3 176 ARG n 
3 177 GLU n 
3 178 LEU n 
3 179 ASP n 
3 180 ILE n 
3 181 ALA n 
3 182 ASP n 
3 183 VAL n 
3 184 PRO n 
3 185 GLY n 
3 186 ILE n 
3 187 GLY n 
3 188 ASN n 
3 189 ILE n 
3 190 THR n 
3 191 ALA n 
3 192 GLU n 
3 193 LYS n 
3 194 LEU n 
3 195 LYS n 
3 196 LYS n 
3 197 LEU n 
3 198 GLY n 
3 199 ILE n 
3 200 ASN n 
3 201 LYS n 
3 202 LEU n 
3 203 VAL n 
3 204 ASP n 
3 205 THR n 
3 206 LEU n 
3 207 SER n 
3 208 ILE n 
3 209 GLU n 
3 210 PHE n 
3 211 ASP n 
3 212 LYS n 
3 213 LEU n 
3 214 LYS n 
3 215 GLY n 
3 216 MET n 
3 217 ILE n 
3 218 GLY n 
3 219 GLU n 
3 220 ALA n 
3 221 LYS n 
3 222 ALA n 
3 223 LYS n 
3 224 TYR n 
3 225 LEU n 
3 226 ILE n 
3 227 SER n 
3 228 LEU n 
3 229 ALA n 
3 230 ARG n 
3 231 ASP n 
3 232 GLU n 
3 233 TYR n 
3 234 ASN n 
3 235 GLU n 
3 236 PRO n 
3 237 ILE n 
3 238 ARG n 
3 239 THR n 
3 240 ARG n 
3 241 VAL n 
3 242 ARG n 
3 243 LYS n 
3 244 SER n 
3 245 ILE n 
3 246 GLY n 
3 247 ARG n 
3 248 ILE n 
3 249 VAL n 
3 250 THR n 
3 251 MET n 
3 252 LYS n 
3 253 ARG n 
3 254 ASN n 
3 255 SER n 
3 256 ARG n 
3 257 ASN n 
3 258 LEU n 
3 259 GLU n 
3 260 GLU n 
3 261 ILE n 
3 262 LYS n 
3 263 PRO n 
3 264 TYR n 
3 265 LEU n 
3 266 PHE n 
3 267 ARG n 
3 268 ALA n 
3 269 ILE n 
3 270 GLU n 
3 271 GLU n 
3 272 SER n 
3 273 TYR n 
3 274 TYR n 
3 275 LYS n 
3 276 LEU n 
3 277 ASP n 
3 278 LYS n 
3 279 ARG n 
3 280 ILE n 
3 281 PRO n 
3 282 LYS n 
3 283 ALA n 
3 284 ILE n 
3 285 HIS n 
3 286 VAL n 
3 287 VAL n 
3 288 ALA n 
3 289 VAL n 
3 290 THR n 
3 291 GLU n 
3 292 ASP n 
3 293 LEU n 
3 294 ASP n 
3 295 ILE n 
3 296 VAL n 
3 297 SER n 
3 298 ARG n 
3 299 GLY n 
3 300 ARG n 
3 301 THR n 
3 302 PHE n 
3 303 PRO n 
3 304 HIS n 
3 305 GLY n 
3 306 ILE n 
3 307 SER n 
3 308 LYS n 
3 309 GLU n 
3 310 THR n 
3 311 ALA n 
3 312 TYR n 
3 313 SER n 
3 314 GLU n 
3 315 SER n 
3 316 VAL n 
3 317 LYS n 
3 318 LEU n 
3 319 LEU n 
3 320 GLN n 
3 321 LYS n 
3 322 ILE n 
3 323 LEU n 
3 324 GLU n 
3 325 GLU n 
3 326 ASP n 
3 327 GLU n 
3 328 ARG n 
3 329 LYS n 
3 330 ILE n 
3 331 ARG n 
3 332 ARG n 
3 333 ILE n 
3 334 GLY n 
3 335 VAL n 
3 336 ARG n 
3 337 PHE n 
3 338 SER n 
3 339 LYS n 
3 340 PHE n 
3 341 ILE n 
3 342 GLU n 
3 343 ALA n 
3 344 ILE n 
3 345 GLY n 
3 346 LEU n 
3 347 ASP n 
3 348 LYS n 
3 349 PHE n 
3 350 PHE n 
3 351 ASP n 
3 352 THR n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Sulfolobus 
_entity_src_gen.pdbx_gene_src_gene                 dpo4 
_entity_src_gen.gene_src_species                   'Sulfolobus solfataricus' 
_entity_src_gen.gene_src_strain                    P2 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Sulfolobus solfataricus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     273057 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET22b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DPO42_SULSO Q97W02 3 
;MIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEARKFGVKAGIPIVEAKKILPNAVYLPMRKEV
YQQVSSRIMNLLREYSEKIEIASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVFAKIAADMAKP
NGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGINKLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTR
VRKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSESVKLLQ
KILEEDERKIRRIGVRFSKFIEAIGLDKFFDT
;
1 ? 
2 PDB 1S0O        1S0O   1 ? ? ? 
3 PDB 1S0O        1S0O   2 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1S0O A 1 ? 352 ? Q97W02 1    ? 352  ? 1    352  
2 1 1S0O B 1 ? 352 ? Q97W02 1    ? 352  ? 1    352  
3 2 1S0O C 1 ? 13  ? 1S0O   1801 ? 1813 ? 1801 1813 
4 3 1S0O D 1 ? 17  ? 1S0O   1902 ? 1918 ? 1902 1918 
5 2 1S0O E 1 ? 13  ? 1S0O   1801 ? 1813 ? 1801 1813 
6 3 1S0O F 1 ? 17  ? 1S0O   1902 ? 1918 ? 1902 1918 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'        133.103 
CA  non-polymer         . 'CALCIUM ION'                        ? 'Ca 2'              40.078  
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P'   322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'        119.119 
TTP non-polymer         . "THYMIDINE-5'-TRIPHOSPHATE"          ? 'C10 H17 N2 O14 P3' 482.168 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          1S0O 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   56.34 
_exptl_crystal.description           ? 
_exptl_crystal.density_Matthews      2.84 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_details    'PEG3350, Ca(AC)2, Hepes, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 295K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 PEG3350   ? ? ? 
1 2 1 'Ca(AC)2' ? ? ? 
1 3 1 Hepes     ? ? ? 
1 4 1 H2O       ? ? ? 
1 5 2 PEG3350   ? ? ? 
1 6 2 'Ca(AC)2' ? ? ? 
1 7 2 Hepes     ? ? ? 
1 8 2 H2O       ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2003-06-28 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    MIRRORS 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1S0O 
_reflns.number_all                   ? 
_reflns.number_obs                   69987 
_reflns.percent_possible_obs         ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            2.00 
_reflns.d_resolution_low             30.0 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_refine.entry_id                                 1S0O 
_refine.ls_number_reflns_obs                     61046 
_refine.ls_number_reflns_all                     63395 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30 
_refine.ls_d_res_high                            2.1 
_refine.ls_percent_reflns_obs                    96.3 
_refine.ls_R_factor_obs                          0.229 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.229 
_refine.ls_R_factor_R_free                       0.269 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  1942 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            -0.657 
_refine.aniso_B[2][2]                            1.266 
_refine.aniso_B[3][3]                            -0.609 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB entry 1JX4' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'ENGH & HUBER' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5486 
_refine_hist.pdbx_number_atoms_nucleic_acid   1196 
_refine_hist.pdbx_number_atoms_ligand         66 
_refine_hist.number_atoms_solvent             376 
_refine_hist.number_atoms_total               7124 
_refine_hist.d_res_high                       2.1 
_refine_hist.d_res_low                        30 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_mcbond_it  1.436 1.5 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it 2.272 2.0 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it  2.230 2.0 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it 3.432 2.5 ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d     0.008 ?   ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg  1.54  ?   ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM ? 'X-RAY DIFFRACTION' 
2 dna-rna_rep.param ? 'X-RAY DIFFRACTION' 
3 ion.param         ? 'X-RAY DIFFRACTION' 
4 ttp.param         ? 'X-RAY DIFFRACTION' 
5 WATER_REP.PARAM   ? 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1S0O 
_struct.title                     
'Snapshots of replication through an abasic lesion: structural basis for base substitution and frameshift' 
_struct.pdbx_descriptor           'DNA polymerase IV(E.C.2.7.7.7)/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1S0O 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
_struct_keywords.text            'abaic lesion, LESION BYPASS, POLYMERASE, TRANSFERASE-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 5 ? 
K N N 6 ? 
L N N 4 ? 
M N N 4 ? 
N N N 4 ? 
O N N 5 ? 
P N N 6 ? 
Q N N 7 ? 
R N N 7 ? 
S N N 7 ? 
T N N 7 ? 
U N N 7 ? 
V N N 7 ? 
# 
loop_
_struct_biol.id 
_struct_biol.pdbx_parent_biol_id 
_struct_biol.details 
1 ? ? 
2 ? ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  TYR E 10  ? ASN E 20  ? TYR A 10  ASN A 20  1 ? 11 
HELX_P HELX_P2  2  PRO E 21  ? LYS E 24  ? PRO A 21  LYS A 24  5 ? 4  
HELX_P HELX_P3  3  ASN E 47  ? LYS E 52  ? ASN A 47  LYS A 52  1 ? 6  
HELX_P HELX_P4  4  PRO E 60  ? LEU E 68  ? PRO A 60  LEU A 68  1 ? 9  
HELX_P HELX_P5  5  ARG E 77  ? GLU E 94  ? ARG A 77  GLU A 94  1 ? 18 
HELX_P HELX_P6  6  ASP E 117 ? LYS E 137 ? ASP A 117 LYS A 137 1 ? 21 
HELX_P HELX_P7  7  ASN E 147 ? LYS E 159 ? ASN A 147 LYS A 159 1 ? 13 
HELX_P HELX_P8  8  ASP E 167 ? LEU E 178 ? ASP A 167 LEU A 178 1 ? 12 
HELX_P HELX_P9  9  ASP E 179 ? VAL E 183 ? ASP A 179 VAL A 183 5 ? 5  
HELX_P HELX_P10 10 GLY E 187 ? LYS E 196 ? GLY A 187 LYS A 196 1 ? 10 
HELX_P HELX_P11 11 LYS E 201 ? ILE E 208 ? LYS A 201 ILE A 208 5 ? 8  
HELX_P HELX_P12 12 GLU E 209 ? GLY E 218 ? GLU A 209 GLY A 218 1 ? 10 
HELX_P HELX_P13 13 GLY E 218 ? ARG E 230 ? GLY A 218 ARG A 230 1 ? 13 
HELX_P HELX_P14 14 ASN E 257 ? ASP E 277 ? ASN A 257 ASP A 277 1 ? 21 
HELX_P HELX_P15 15 SER E 307 ? ASP E 326 ? SER A 307 ASP A 326 1 ? 20 
HELX_P HELX_P16 16 TYR F 10  ? ASN F 20  ? TYR B 10  ASN B 20  1 ? 11 
HELX_P HELX_P17 17 PRO F 21  ? LYS F 24  ? PRO B 21  LYS B 24  5 ? 4  
HELX_P HELX_P18 18 ASN F 47  ? PHE F 53  ? ASN B 47  PHE B 53  1 ? 7  
HELX_P HELX_P19 19 PRO F 60  ? LEU F 68  ? PRO B 60  LEU B 68  1 ? 9  
HELX_P HELX_P20 20 ARG F 77  ? GLU F 94  ? ARG B 77  GLU B 94  1 ? 18 
HELX_P HELX_P21 21 SER F 112 ? VAL F 115 ? SER B 112 VAL B 115 5 ? 4  
HELX_P HELX_P22 22 ASP F 117 ? LYS F 137 ? ASP B 117 LYS B 137 1 ? 21 
HELX_P HELX_P23 23 ASN F 147 ? LYS F 159 ? ASN B 147 LYS B 159 1 ? 13 
HELX_P HELX_P24 24 ASP F 167 ? LEU F 178 ? ASP B 167 LEU B 178 1 ? 12 
HELX_P HELX_P25 25 ASP F 179 ? VAL F 183 ? ASP B 179 VAL B 183 5 ? 5  
HELX_P HELX_P26 26 GLY F 187 ? LEU F 197 ? GLY B 187 LEU B 197 1 ? 11 
HELX_P HELX_P27 27 LYS F 201 ? SER F 207 ? LYS B 201 SER B 207 5 ? 7  
HELX_P HELX_P28 28 GLU F 209 ? GLY F 218 ? GLU B 209 GLY B 218 1 ? 10 
HELX_P HELX_P29 29 GLY F 218 ? ARG F 230 ? GLY B 218 ARG B 230 1 ? 13 
HELX_P HELX_P30 30 ASN F 257 ? ASP F 277 ? ASN B 257 ASP B 277 1 ? 21 
HELX_P HELX_P31 31 SER F 307 ? ASP F 326 ? SER B 307 ASP B 326 1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? G CA .  CA ? ? ? 1_555 E ASP 105 OD2 ? ? A CA 401  A ASP 105  1_555 ? ? ? ? ? ? ?            3.342 ? 
metalc2  metalc ? ? G CA .  CA ? ? ? 1_555 E ASP 7   OD1 ? ? A CA 401  A ASP 7    1_555 ? ? ? ? ? ? ?            2.769 ? 
metalc3  metalc ? ? G CA .  CA ? ? ? 1_555 E ASP 7   OD2 ? ? A CA 401  A ASP 7    1_555 ? ? ? ? ? ? ?            2.931 ? 
metalc4  metalc ? ? G CA .  CA ? ? ? 1_555 E ASP 105 OD1 ? ? A CA 401  A ASP 105  1_555 ? ? ? ? ? ? ?            2.504 ? 
metalc5  metalc ? ? G CA .  CA ? ? ? 1_555 E GLU 106 OE1 ? ? A CA 401  A GLU 106  1_555 ? ? ? ? ? ? ?            2.408 ? 
metalc6  metalc ? ? G CA .  CA ? ? ? 1_555 K TTP .   O2A ? ? A CA 401  A TTP 803  1_555 ? ? ? ? ? ? ?            2.429 ? 
metalc7  metalc ? ? G CA .  CA ? ? ? 1_555 U HOH .   O   ? ? A CA 401  A HOH 893  1_555 ? ? ? ? ? ? ?            2.395 ? 
metalc8  metalc ? ? G CA .  CA ? ? ? 1_555 U HOH .   O   ? ? A CA 401  A HOH 943  1_555 ? ? ? ? ? ? ?            2.449 ? 
metalc9  metalc ? ? H CA .  CA ? ? ? 1_555 K TTP .   O2B ? ? A CA 402  A TTP 803  1_555 ? ? ? ? ? ? ?            2.589 ? 
metalc10 metalc ? ? H CA .  CA ? ? ? 1_555 E PHE 8   O   ? ? A CA 402  A PHE 8    1_555 ? ? ? ? ? ? ?            2.311 ? 
metalc11 metalc ? ? H CA .  CA ? ? ? 1_555 E ASP 105 OD2 ? ? A CA 402  A ASP 105  1_555 ? ? ? ? ? ? ?            2.275 ? 
metalc12 metalc ? ? H CA .  CA ? ? ? 1_555 K TTP .   O3B ? ? A CA 402  A TTP 803  1_555 ? ? ? ? ? ? ?            2.815 ? 
metalc13 metalc ? ? H CA .  CA ? ? ? 1_555 K TTP .   O1G ? ? A CA 402  A TTP 803  1_555 ? ? ? ? ? ? ?            2.865 ? 
metalc14 metalc ? ? H CA .  CA ? ? ? 1_555 U HOH .   O   ? ? A CA 402  A HOH 813  1_555 ? ? ? ? ? ? ?            2.769 ? 
metalc15 metalc ? ? H CA .  CA ? ? ? 1_555 E ASP 7   OD1 ? ? A CA 402  A ASP 7    1_555 ? ? ? ? ? ? ?            2.253 ? 
metalc16 metalc ? ? H CA .  CA ? ? ? 1_555 K TTP .   O2A ? ? A CA 402  A TTP 803  1_555 ? ? ? ? ? ? ?            2.419 ? 
metalc17 metalc ? ? I CA .  CA ? ? ? 1_555 E ALA 181 O   ? ? A CA 406  A ALA 181  1_555 ? ? ? ? ? ? ?            2.193 ? 
metalc18 metalc ? ? I CA .  CA ? ? ? 1_555 E ILE 186 O   ? ? A CA 406  A ILE 186  1_555 ? ? ? ? ? ? ?            2.340 ? 
metalc19 metalc ? ? J MG .  MG ? ? ? 1_555 U HOH .   O   ? ? A MG 407  A HOH 891  1_555 ? ? ? ? ? ? ?            2.309 ? 
metalc20 metalc ? ? J MG .  MG ? ? ? 1_555 E ASP 294 OD1 ? ? A MG 407  A ASP 294  1_555 ? ? ? ? ? ? ?            2.189 ? 
metalc21 metalc ? ? J MG .  MG ? ? ? 1_555 E ASP 294 OD2 ? ? A MG 407  A ASP 294  1_555 ? ? ? ? ? ? ?            2.308 ? 
metalc22 metalc ? ? L CA .  CA ? ? ? 1_555 P TTP .   O2A ? ? B CA 403  B TTP 804  1_555 ? ? ? ? ? ? ?            2.387 ? 
metalc23 metalc ? ? L CA .  CA ? ? ? 1_555 V HOH .   O   ? ? B CA 403  B HOH 865  1_555 ? ? ? ? ? ? ?            1.713 ? 
metalc24 metalc ? ? L CA .  CA ? ? ? 1_555 F ASP 7   OD1 ? ? B CA 403  B ASP 7    1_555 ? ? ? ? ? ? ?            2.319 ? 
metalc25 metalc ? ? L CA .  CA ? ? ? 1_555 V HOH .   O   ? ? B CA 403  B HOH 806  1_555 ? ? ? ? ? ? ?            2.208 ? 
metalc26 metalc ? ? L CA .  CA ? ? ? 1_555 F GLU 106 OE1 ? ? B CA 403  B GLU 106  1_555 ? ? ? ? ? ? ?            2.234 ? 
metalc27 metalc ? ? L CA .  CA ? ? ? 1_555 V HOH .   O   ? ? B CA 403  B HOH 927  1_555 ? ? ? ? ? ? ?            2.438 ? 
metalc28 metalc ? ? L CA .  CA ? ? ? 1_555 F ASP 105 OD1 ? ? B CA 403  B ASP 105  1_555 ? ? ? ? ? ? ?            2.642 ? 
metalc29 metalc ? ? L CA .  CA ? ? ? 1_555 F ASP 7   OD2 ? ? B CA 403  B ASP 7    1_555 ? ? ? ? ? ? ?            3.262 ? 
metalc30 metalc ? ? M CA .  CA ? ? ? 1_555 V HOH .   O   ? ? B CA 404  B HOH 890  1_555 ? ? ? ? ? ? ?            2.498 ? 
metalc31 metalc ? ? M CA .  CA ? ? ? 1_555 V HOH .   O   ? ? B CA 404  B HOH 927  1_555 ? ? ? ? ? ? ?            2.945 ? 
metalc32 metalc ? ? M CA .  CA ? ? ? 1_555 P TTP .   O1G ? ? B CA 404  B TTP 804  1_555 ? ? ? ? ? ? ?            3.281 ? 
metalc33 metalc ? ? M CA .  CA ? ? ? 1_555 P TTP .   O2A ? ? B CA 404  B TTP 804  1_555 ? ? ? ? ? ? ?            2.333 ? 
metalc34 metalc ? ? M CA .  CA ? ? ? 1_555 P TTP .   O2B ? ? B CA 404  B TTP 804  1_555 ? ? ? ? ? ? ?            2.400 ? 
metalc35 metalc ? ? M CA .  CA ? ? ? 1_555 P TTP .   O3B ? ? B CA 404  B TTP 804  1_555 ? ? ? ? ? ? ?            2.790 ? 
metalc36 metalc ? ? M CA .  CA ? ? ? 1_555 F ASP 105 OD2 ? ? B CA 404  B ASP 105  1_555 ? ? ? ? ? ? ?            2.154 ? 
metalc37 metalc ? ? M CA .  CA ? ? ? 1_555 F PHE 8   O   ? ? B CA 404  B PHE 8    1_555 ? ? ? ? ? ? ?            2.315 ? 
metalc38 metalc ? ? M CA .  CA ? ? ? 1_555 F ASP 7   OD2 ? ? B CA 404  B ASP 7    1_555 ? ? ? ? ? ? ?            2.137 ? 
metalc39 metalc ? ? N CA .  CA ? ? ? 1_555 S HOH .   O   ? ? B CA 405  E HOH 124  1_555 ? ? ? ? ? ? ?            2.513 ? 
metalc40 metalc ? ? N CA .  CA ? ? ? 1_555 F ILE 186 O   ? ? B CA 405  B ILE 186  1_555 ? ? ? ? ? ? ?            2.527 ? 
metalc41 metalc ? ? N CA .  CA ? ? ? 1_555 F ALA 181 O   ? ? B CA 405  B ALA 181  1_555 ? ? ? ? ? ? ?            2.361 ? 
metalc42 metalc ? ? O MG .  MG ? ? ? 1_555 V HOH .   O   ? ? B MG 408  B HOH 880  1_555 ? ? ? ? ? ? ?            2.771 ? 
metalc43 metalc ? ? O MG .  MG ? ? ? 1_555 F ASP 294 OD2 ? ? B MG 408  B ASP 294  1_555 ? ? ? ? ? ? ?            2.201 ? 
metalc44 metalc ? ? O MG .  MG ? ? ? 1_555 V HOH .   O   ? ? B MG 408  B HOH 932  1_555 ? ? ? ? ? ? ?            1.911 ? 
metalc45 metalc ? ? O MG .  MG ? ? ? 1_555 F ASP 294 OD1 ? ? B MG 408  B ASP 294  1_555 ? ? ? ? ? ? ?            2.867 ? 
hydrog1  hydrog ? ? A DG 1  N1 ? ? ? 1_555 B DC  17  N3  ? ? C DG 1801 D DC  1918 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? A DG 1  N2 ? ? ? 1_555 B DC  17  O2  ? ? C DG 1801 D DC  1918 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? A DG 1  O6 ? ? ? 1_555 B DC  17  N4  ? ? C DG 1801 D DC  1918 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? A DG 2  N1 ? ? ? 1_555 B DC  16  N3  ? ? C DG 1802 D DC  1917 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? A DG 2  N2 ? ? ? 1_555 B DC  16  O2  ? ? C DG 1802 D DC  1917 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? A DG 2  O6 ? ? ? 1_555 B DC  16  N4  ? ? C DG 1802 D DC  1917 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? A DG 3  N1 ? ? ? 1_555 B DC  15  N3  ? ? C DG 1803 D DC  1916 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? A DG 3  N2 ? ? ? 1_555 B DC  15  O2  ? ? C DG 1803 D DC  1916 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? A DG 3  O6 ? ? ? 1_555 B DC  15  N4  ? ? C DG 1803 D DC  1916 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? A DG 4  N1 ? ? ? 1_555 B DC  14  N3  ? ? C DG 1804 D DC  1915 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? A DG 4  N2 ? ? ? 1_555 B DC  14  O2  ? ? C DG 1804 D DC  1915 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? A DG 4  O6 ? ? ? 1_555 B DC  14  N4  ? ? C DG 1804 D DC  1915 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? A DG 5  N1 ? ? ? 1_555 B DC  13  N3  ? ? C DG 1805 D DC  1914 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? A DG 5  N2 ? ? ? 1_555 B DC  13  O2  ? ? C DG 1805 D DC  1914 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? A DG 5  O6 ? ? ? 1_555 B DC  13  N4  ? ? C DG 1805 D DC  1914 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? A DA 6  N1 ? ? ? 1_555 B DT  12  N3  ? ? C DA 1806 D DT  1913 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? A DA 6  N6 ? ? ? 1_555 B DT  12  O4  ? ? C DA 1806 D DT  1913 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? A DA 7  N1 ? ? ? 1_555 B DT  11  N3  ? ? C DA 1807 D DT  1912 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? A DA 7  N6 ? ? ? 1_555 B DT  11  O4  ? ? C DA 1807 D DT  1912 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? A DG 8  N1 ? ? ? 1_555 B DC  10  N3  ? ? C DG 1808 D DC  1911 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? A DG 8  N2 ? ? ? 1_555 B DC  10  O2  ? ? C DG 1808 D DC  1911 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? A DG 8  O6 ? ? ? 1_555 B DC  10  N4  ? ? C DG 1808 D DC  1911 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? A DG 9  N1 ? ? ? 1_555 B DC  9   N3  ? ? C DG 1809 D DC  1910 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? A DG 9  N2 ? ? ? 1_555 B DC  9   O2  ? ? C DG 1809 D DC  1910 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? A DG 9  O6 ? ? ? 1_555 B DC  9   N4  ? ? C DG 1809 D DC  1910 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? A DA 10 N1 ? ? ? 1_555 B DT  8   N3  ? ? C DA 1810 D DT  1909 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? A DA 10 N6 ? ? ? 1_555 B DT  8   O4  ? ? C DA 1810 D DT  1909 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? A DC 11 N3 ? ? ? 1_555 B DG  7   N1  ? ? C DC 1811 D DG  1908 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? A DC 11 N4 ? ? ? 1_555 B DG  7   O6  ? ? C DC 1811 D DG  1908 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? A DC 11 O2 ? ? ? 1_555 B DG  7   N2  ? ? C DC 1811 D DG  1908 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? A DT 12 N3 ? ? ? 1_555 B DA  6   N1  ? ? C DT 1812 D DA  1907 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? A DT 12 O4 ? ? ? 1_555 B DA  6   N6  ? ? C DT 1812 D DA  1907 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? C DG 1  N1 ? ? ? 1_555 D DC  17  N3  ? ? E DG 1801 F DC  1918 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? C DG 1  N2 ? ? ? 1_555 D DC  17  O2  ? ? E DG 1801 F DC  1918 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? C DG 1  O6 ? ? ? 1_555 D DC  17  N4  ? ? E DG 1801 F DC  1918 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? C DG 2  N1 ? ? ? 1_555 D DC  16  N3  ? ? E DG 1802 F DC  1917 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? C DG 2  N2 ? ? ? 1_555 D DC  16  O2  ? ? E DG 1802 F DC  1917 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? C DG 2  O6 ? ? ? 1_555 D DC  16  N4  ? ? E DG 1802 F DC  1917 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ? ? C DG 3  N1 ? ? ? 1_555 D DC  15  N3  ? ? E DG 1803 F DC  1916 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ? ? C DG 3  N2 ? ? ? 1_555 D DC  15  O2  ? ? E DG 1803 F DC  1916 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ? ? C DG 3  O6 ? ? ? 1_555 D DC  15  N4  ? ? E DG 1803 F DC  1916 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ? ? C DG 4  N1 ? ? ? 1_555 D DC  14  N3  ? ? E DG 1804 F DC  1915 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ? ? C DG 4  N2 ? ? ? 1_555 D DC  14  O2  ? ? E DG 1804 F DC  1915 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ? ? C DG 4  O6 ? ? ? 1_555 D DC  14  N4  ? ? E DG 1804 F DC  1915 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ? ? C DG 5  N1 ? ? ? 1_555 D DC  13  N3  ? ? E DG 1805 F DC  1914 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ? ? C DG 5  N2 ? ? ? 1_555 D DC  13  O2  ? ? E DG 1805 F DC  1914 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47 hydrog ? ? C DG 5  O6 ? ? ? 1_555 D DC  13  N4  ? ? E DG 1805 F DC  1914 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48 hydrog ? ? C DA 6  N1 ? ? ? 1_555 D DT  12  N3  ? ? E DA 1806 F DT  1913 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49 hydrog ? ? C DA 6  N6 ? ? ? 1_555 D DT  12  O4  ? ? E DA 1806 F DT  1913 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50 hydrog ? ? C DA 7  N1 ? ? ? 1_555 D DT  11  N3  ? ? E DA 1807 F DT  1912 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51 hydrog ? ? C DA 7  N6 ? ? ? 1_555 D DT  11  O4  ? ? E DA 1807 F DT  1912 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog52 hydrog ? ? C DG 8  N1 ? ? ? 1_555 D DC  10  N3  ? ? E DG 1808 F DC  1911 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog53 hydrog ? ? C DG 8  N2 ? ? ? 1_555 D DC  10  O2  ? ? E DG 1808 F DC  1911 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog54 hydrog ? ? C DG 8  O6 ? ? ? 1_555 D DC  10  N4  ? ? E DG 1808 F DC  1911 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog55 hydrog ? ? C DG 9  N1 ? ? ? 1_555 D DC  9   N3  ? ? E DG 1809 F DC  1910 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog56 hydrog ? ? C DG 9  N2 ? ? ? 1_555 D DC  9   O2  ? ? E DG 1809 F DC  1910 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog57 hydrog ? ? C DG 9  O6 ? ? ? 1_555 D DC  9   N4  ? ? E DG 1809 F DC  1910 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog58 hydrog ? ? C DA 10 N1 ? ? ? 1_555 D DT  8   N3  ? ? E DA 1810 F DT  1909 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog59 hydrog ? ? C DA 10 N6 ? ? ? 1_555 D DT  8   O4  ? ? E DA 1810 F DT  1909 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog60 hydrog ? ? C DC 11 N3 ? ? ? 1_555 D DG  7   N1  ? ? E DC 1811 F DG  1908 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog61 hydrog ? ? C DC 11 N4 ? ? ? 1_555 D DG  7   O6  ? ? E DC 1811 F DG  1908 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog62 hydrog ? ? C DC 11 O2 ? ? ? 1_555 D DG  7   N2  ? ? E DC 1811 F DG  1908 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog63 hydrog ? ? C DT 12 N3 ? ? ? 1_555 D DA  6   N1  ? ? E DT 1812 F DA  1907 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog64 hydrog ? ? C DT 12 O4 ? ? ? 1_555 D DA  6   N6  ? ? E DT 1812 F DA  1907 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog65 hydrog ? ? C DC 13 N3 ? ? ? 1_555 D DG  4   N1  ? ? E DC 1813 F DG  1905 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog66 hydrog ? ? C DC 13 N4 ? ? ? 1_555 D DG  4   O6  ? ? E DC 1813 F DG  1905 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog67 hydrog ? ? C DC 13 O2 ? ? ? 1_555 D DG  4   N2  ? ? E DC 1813 F DG  1905 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LYS 159 E . ? LYS 159 A PRO 160 E ? PRO 160 A 1 -0.58 
2 LYS 159 F . ? LYS 159 B PRO 160 F ? PRO 160 B 1 0.34  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 3 ? 
C ? 4 ? 
D ? 5 ? 
E ? 3 ? 
F ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? parallel      
E 1 2 ? anti-parallel 
E 2 3 ? parallel      
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE E 99  ? SER E 103 ? ILE A 99  SER A 103 
A 2 GLU E 106 ? ASP E 110 ? GLU A 106 ASP A 110 
A 3 VAL E 3   ? PHE E 8   ? VAL A 3   PHE A 8   
A 4 VAL E 140 ? SER E 145 ? VAL A 140 SER A 145 
A 5 ILE E 163 ? VAL E 165 ? ILE A 163 VAL A 165 
B 1 GLY E 41  ? ALA E 46  ? GLY A 41  ALA A 46  
B 2 VAL E 28  ? PHE E 33  ? VAL A 28  PHE A 33  
B 3 VAL E 72  ? PRO E 75  ? VAL A 72  PRO A 75  
C 1 SER E 244 ? SER E 255 ? SER A 244 SER A 255 
C 2 ILE E 330 ? ILE E 341 ? ILE A 330 ILE A 341 
C 3 ILE E 280 ? THR E 290 ? ILE A 280 THR A 290 
C 4 ILE E 295 ? THR E 301 ? ILE A 295 THR A 301 
D 1 ILE F 99  ? SER F 103 ? ILE B 99  SER B 103 
D 2 GLU F 106 ? ASP F 110 ? GLU B 106 ASP B 110 
D 3 VAL F 3   ? PHE F 8   ? VAL B 3   PHE B 8   
D 4 VAL F 140 ? SER F 145 ? VAL B 140 SER B 145 
D 5 ILE F 163 ? VAL F 165 ? ILE B 163 VAL B 165 
E 1 GLY F 41  ? ALA F 46  ? GLY B 41  ALA B 46  
E 2 VAL F 28  ? PHE F 33  ? VAL B 28  PHE B 33  
E 3 VAL F 72  ? PRO F 75  ? VAL B 72  PRO B 75  
F 1 SER F 244 ? SER F 255 ? SER B 244 SER B 255 
F 2 ILE F 330 ? PHE F 340 ? ILE B 330 PHE B 340 
F 3 PRO F 281 ? THR F 290 ? PRO B 281 THR B 290 
F 4 ILE F 295 ? THR F 301 ? ILE B 295 THR B 301 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU E 100 ? N GLU A 100 O TYR E 108 ? O TYR A 108 
A 2 3 O LEU E 109 ? O LEU A 109 N LEU E 4   ? N LEU A 4   
A 3 4 N PHE E 5   ? N PHE A 5   O GLY E 143 ? O GLY A 143 
A 4 5 N ILE E 144 ? N ILE A 144 O LYS E 164 ? O LYS A 164 
B 1 2 O ALA E 42  ? O ALA A 42  N VAL E 32  ? N VAL A 32  
B 2 3 N CYS E 31  ? N CYS A 31  O LEU E 74  ? O LEU A 74  
C 1 2 N ILE E 245 ? N ILE A 245 O PHE E 337 ? O PHE A 337 
C 2 3 O ARG E 331 ? O ARG A 331 N VAL E 289 ? N VAL A 289 
C 3 4 N VAL E 286 ? N VAL A 286 O ARG E 298 ? O ARG A 298 
D 1 2 N GLU F 100 ? N GLU B 100 O TYR F 108 ? O TYR B 108 
D 2 3 O ALA F 107 ? O ALA B 107 N VAL F 6   ? N VAL B 6   
D 3 4 N PHE F 5   ? N PHE B 5   O GLY F 143 ? O GLY B 143 
D 4 5 N ILE F 144 ? N ILE B 144 O LYS F 164 ? O LYS B 164 
E 1 2 O ALA F 42  ? O ALA B 42  N VAL F 32  ? N VAL B 32  
E 2 3 N CYS F 31  ? N CYS B 31  O LEU F 74  ? O LEU B 74  
F 1 2 N ILE F 245 ? N ILE B 245 O PHE F 337 ? O PHE B 337 
F 2 3 O ARG F 336 ? O ARG B 336 N HIS F 285 ? N HIS B 285 
F 3 4 N ALA F 288 ? N ALA B 288 O VAL F 296 ? O VAL B 296 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE CA A 401'  
AC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA A 402'  
AC3 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE CA B 403'  
AC4 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE CA B 404'  
AC5 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CA B 405'  
AC6 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CA A 406'  
AC7 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG A 407'  
AC8 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG B 408'  
AC9 Software ? ? ? ? 24 'BINDING SITE FOR RESIDUE TTP A 803' 
BC1 Software ? ? ? ? 22 'BINDING SITE FOR RESIDUE TTP B 804' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 7  ASP E 7   ? ASP A 7    . ? 1_555 ? 
2  AC1 7  ASP E 105 ? ASP A 105  . ? 1_555 ? 
3  AC1 7  GLU E 106 ? GLU A 106  . ? 1_555 ? 
4  AC1 7  CA  H .   ? CA  A 402  . ? 1_555 ? 
5  AC1 7  TTP K .   ? TTP A 803  . ? 1_555 ? 
6  AC1 7  HOH U .   ? HOH A 893  . ? 1_555 ? 
7  AC1 7  HOH U .   ? HOH A 943  . ? 1_555 ? 
8  AC2 6  ASP E 7   ? ASP A 7    . ? 1_555 ? 
9  AC2 6  PHE E 8   ? PHE A 8    . ? 1_555 ? 
10 AC2 6  ASP E 105 ? ASP A 105  . ? 1_555 ? 
11 AC2 6  CA  G .   ? CA  A 401  . ? 1_555 ? 
12 AC2 6  TTP K .   ? TTP A 803  . ? 1_555 ? 
13 AC2 6  HOH U .   ? HOH A 813  . ? 1_555 ? 
14 AC3 8  ASP F 7   ? ASP B 7    . ? 1_555 ? 
15 AC3 8  ASP F 105 ? ASP B 105  . ? 1_555 ? 
16 AC3 8  GLU F 106 ? GLU B 106  . ? 1_555 ? 
17 AC3 8  CA  M .   ? CA  B 404  . ? 1_555 ? 
18 AC3 8  TTP P .   ? TTP B 804  . ? 1_555 ? 
19 AC3 8  HOH V .   ? HOH B 806  . ? 1_555 ? 
20 AC3 8  HOH V .   ? HOH B 865  . ? 1_555 ? 
21 AC3 8  HOH V .   ? HOH B 927  . ? 1_555 ? 
22 AC4 7  ASP F 7   ? ASP B 7    . ? 1_555 ? 
23 AC4 7  PHE F 8   ? PHE B 8    . ? 1_555 ? 
24 AC4 7  ASP F 105 ? ASP B 105  . ? 1_555 ? 
25 AC4 7  CA  L .   ? CA  B 403  . ? 1_555 ? 
26 AC4 7  TTP P .   ? TTP B 804  . ? 1_555 ? 
27 AC4 7  HOH V .   ? HOH B 890  . ? 1_555 ? 
28 AC4 7  HOH V .   ? HOH B 927  . ? 1_555 ? 
29 AC5 3  ALA F 181 ? ALA B 181  . ? 1_555 ? 
30 AC5 3  ILE F 186 ? ILE B 186  . ? 1_555 ? 
31 AC5 3  HOH S .   ? HOH E 124  . ? 1_555 ? 
32 AC6 2  ALA E 181 ? ALA A 181  . ? 1_555 ? 
33 AC6 2  ILE E 186 ? ILE A 186  . ? 1_555 ? 
34 AC7 2  ASP E 294 ? ASP A 294  . ? 1_555 ? 
35 AC7 2  HOH U .   ? HOH A 891  . ? 1_555 ? 
36 AC8 3  ASP F 294 ? ASP B 294  . ? 1_555 ? 
37 AC8 3  HOH V .   ? HOH B 880  . ? 1_555 ? 
38 AC8 3  HOH V .   ? HOH B 932  . ? 1_555 ? 
39 AC9 24 ASP E 7   ? ASP A 7    . ? 1_555 ? 
40 AC9 24 PHE E 8   ? PHE A 8    . ? 1_555 ? 
41 AC9 24 ASP E 9   ? ASP A 9    . ? 1_555 ? 
42 AC9 24 TYR E 10  ? TYR A 10   . ? 1_555 ? 
43 AC9 24 PHE E 11  ? PHE A 11   . ? 1_555 ? 
44 AC9 24 TYR E 12  ? TYR A 12   . ? 1_555 ? 
45 AC9 24 ALA E 44  ? ALA A 44   . ? 1_555 ? 
46 AC9 24 THR E 45  ? THR A 45   . ? 1_555 ? 
47 AC9 24 TYR E 48  ? TYR A 48   . ? 1_555 ? 
48 AC9 24 ARG E 51  ? ARG A 51   . ? 1_555 ? 
49 AC9 24 ASP E 105 ? ASP A 105  . ? 1_555 ? 
50 AC9 24 LYS E 159 ? LYS A 159  . ? 1_555 ? 
51 AC9 24 CA  G .   ? CA  A 401  . ? 1_555 ? 
52 AC9 24 CA  H .   ? CA  A 402  . ? 1_555 ? 
53 AC9 24 HOH U .   ? HOH A 813  . ? 1_555 ? 
54 AC9 24 HOH U .   ? HOH A 821  . ? 1_555 ? 
55 AC9 24 HOH U .   ? HOH A 856  . ? 1_555 ? 
56 AC9 24 HOH U .   ? HOH A 882  . ? 1_555 ? 
57 AC9 24 HOH U .   ? HOH A 899  . ? 1_555 ? 
58 AC9 24 HOH U .   ? HOH A 930  . ? 1_555 ? 
59 AC9 24 HOH U .   ? HOH A 943  . ? 1_555 ? 
60 AC9 24 HOH U .   ? HOH A 947  . ? 1_555 ? 
61 AC9 24 DA  B 3   ? DA  D 1904 . ? 1_555 ? 
62 AC9 24 DG  B 4   ? DG  D 1905 . ? 1_555 ? 
63 BC1 22 ASP F 7   ? ASP B 7    . ? 1_555 ? 
64 BC1 22 PHE F 8   ? PHE B 8    . ? 1_555 ? 
65 BC1 22 ASP F 9   ? ASP B 9    . ? 1_555 ? 
66 BC1 22 TYR F 10  ? TYR B 10   . ? 1_555 ? 
67 BC1 22 PHE F 11  ? PHE B 11   . ? 1_555 ? 
68 BC1 22 TYR F 12  ? TYR B 12   . ? 1_555 ? 
69 BC1 22 ALA F 44  ? ALA B 44   . ? 1_555 ? 
70 BC1 22 THR F 45  ? THR B 45   . ? 1_555 ? 
71 BC1 22 TYR F 48  ? TYR B 48   . ? 1_555 ? 
72 BC1 22 ARG F 51  ? ARG B 51   . ? 1_555 ? 
73 BC1 22 ASP F 105 ? ASP B 105  . ? 1_555 ? 
74 BC1 22 LYS F 159 ? LYS B 159  . ? 1_555 ? 
75 BC1 22 CA  L .   ? CA  B 403  . ? 1_555 ? 
76 BC1 22 CA  M .   ? CA  B 404  . ? 1_555 ? 
77 BC1 22 HOH V .   ? HOH B 823  . ? 1_555 ? 
78 BC1 22 HOH V .   ? HOH B 827  . ? 1_555 ? 
79 BC1 22 HOH V .   ? HOH B 840  . ? 1_555 ? 
80 BC1 22 HOH V .   ? HOH B 862  . ? 1_555 ? 
81 BC1 22 HOH V .   ? HOH B 865  . ? 1_555 ? 
82 BC1 22 HOH V .   ? HOH B 890  . ? 1_555 ? 
83 BC1 22 DC  C 13  ? DC  E 1813 . ? 1_555 ? 
84 BC1 22 DA  D 3   ? DA  F 1904 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1S0O 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1S0O 
_atom_sites.fract_transf_matrix[1][1]   0.010173 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009704 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009442 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O  "O5'" . DG  A 1 1   ? 55.948 49.350  60.481 1.00 43.57  ? 1801 DG  C "O5'" 1 
ATOM   2    C  "C5'" . DG  A 1 1   ? 55.245 49.022  61.677 1.00 42.12  ? 1801 DG  C "C5'" 1 
ATOM   3    C  "C4'" . DG  A 1 1   ? 55.744 47.700  62.204 1.00 42.05  ? 1801 DG  C "C4'" 1 
ATOM   4    O  "O4'" . DG  A 1 1   ? 55.086 47.394  63.453 1.00 40.26  ? 1801 DG  C "O4'" 1 
ATOM   5    C  "C3'" . DG  A 1 1   ? 55.521 46.498  61.287 1.00 42.86  ? 1801 DG  C "C3'" 1 
ATOM   6    O  "O3'" . DG  A 1 1   ? 56.722 45.715  61.258 1.00 47.31  ? 1801 DG  C "O3'" 1 
ATOM   7    C  "C2'" . DG  A 1 1   ? 54.367 45.754  61.946 1.00 39.87  ? 1801 DG  C "C2'" 1 
ATOM   8    C  "C1'" . DG  A 1 1   ? 54.525 46.096  63.420 1.00 38.94  ? 1801 DG  C "C1'" 1 
ATOM   9    N  N9    . DG  A 1 1   ? 53.289 46.146  64.196 1.00 38.71  ? 1801 DG  C N9    1 
ATOM   10   C  C8    . DG  A 1 1   ? 52.116 46.772  63.841 1.00 37.66  ? 1801 DG  C C8    1 
ATOM   11   N  N7    . DG  A 1 1   ? 51.195 46.700  64.763 1.00 36.20  ? 1801 DG  C N7    1 
ATOM   12   C  C5    . DG  A 1 1   ? 51.786 45.974  65.789 1.00 35.82  ? 1801 DG  C C5    1 
ATOM   13   C  C6    . DG  A 1 1   ? 51.274 45.591  67.059 1.00 33.82  ? 1801 DG  C C6    1 
ATOM   14   O  O6    . DG  A 1 1   ? 50.166 45.839  67.553 1.00 32.81  ? 1801 DG  C O6    1 
ATOM   15   N  N1    . DG  A 1 1   ? 52.203 44.853  67.781 1.00 33.40  ? 1801 DG  C N1    1 
ATOM   16   C  C2    . DG  A 1 1   ? 53.465 44.535  67.349 1.00 34.92  ? 1801 DG  C C2    1 
ATOM   17   N  N2    . DG  A 1 1   ? 54.211 43.818  68.202 1.00 34.93  ? 1801 DG  C N2    1 
ATOM   18   N  N3    . DG  A 1 1   ? 53.960 44.893  66.172 1.00 34.48  ? 1801 DG  C N3    1 
ATOM   19   C  C4    . DG  A 1 1   ? 53.072 45.607  65.449 1.00 35.94  ? 1801 DG  C C4    1 
ATOM   20   P  P     . DG  A 1 2   ? 56.913 44.564  60.146 1.00 49.81  ? 1802 DG  C P     1 
ATOM   21   O  OP1   . DG  A 1 2   ? 58.342 44.522  59.749 1.00 49.06  ? 1802 DG  C OP1   1 
ATOM   22   O  OP2   . DG  A 1 2   ? 55.869 44.719  59.104 1.00 49.99  ? 1802 DG  C OP2   1 
ATOM   23   O  "O5'" . DG  A 1 2   ? 56.595 43.249  60.972 1.00 47.87  ? 1802 DG  C "O5'" 1 
ATOM   24   C  "C5'" . DG  A 1 2   ? 57.234 43.022  62.217 1.00 49.05  ? 1802 DG  C "C5'" 1 
ATOM   25   C  "C4'" . DG  A 1 2   ? 56.552 41.893  62.948 1.00 51.26  ? 1802 DG  C "C4'" 1 
ATOM   26   O  "O4'" . DG  A 1 2   ? 55.334 42.347  63.590 1.00 51.51  ? 1802 DG  C "O4'" 1 
ATOM   27   C  "C3'" . DG  A 1 2   ? 56.148 40.721  62.050 1.00 51.71  ? 1802 DG  C "C3'" 1 
ATOM   28   O  "O3'" . DG  A 1 2   ? 56.389 39.508  62.753 1.00 55.30  ? 1802 DG  C "O3'" 1 
ATOM   29   C  "C2'" . DG  A 1 2   ? 54.649 40.904  61.908 1.00 51.47  ? 1802 DG  C "C2'" 1 
ATOM   30   C  "C1'" . DG  A 1 2   ? 54.305 41.423  63.288 1.00 49.91  ? 1802 DG  C "C1'" 1 
ATOM   31   N  N9    . DG  A 1 2   ? 53.019 42.099  63.421 1.00 47.02  ? 1802 DG  C N9    1 
ATOM   32   C  C8    . DG  A 1 2   ? 52.355 42.829  62.465 1.00 45.72  ? 1802 DG  C C8    1 
ATOM   33   N  N7    . DG  A 1 2   ? 51.206 43.291  62.883 1.00 44.58  ? 1802 DG  C N7    1 
ATOM   34   C  C5    . DG  A 1 2   ? 51.110 42.843  64.195 1.00 43.61  ? 1802 DG  C C5    1 
ATOM   35   C  C6    . DG  A 1 2   ? 50.077 43.024  65.163 1.00 42.68  ? 1802 DG  C C6    1 
ATOM   36   O  O6    . DG  A 1 2   ? 49.016 43.644  65.050 1.00 40.12  ? 1802 DG  C O6    1 
ATOM   37   N  N1    . DG  A 1 2   ? 50.382 42.391  66.361 1.00 40.49  ? 1802 DG  C N1    1 
ATOM   38   C  C2    . DG  A 1 2   ? 51.529 41.680  66.605 1.00 42.63  ? 1802 DG  C C2    1 
ATOM   39   N  N2    . DG  A 1 2   ? 51.637 41.141  67.825 1.00 44.06  ? 1802 DG  C N2    1 
ATOM   40   N  N3    . DG  A 1 2   ? 52.497 41.508  65.718 1.00 42.98  ? 1802 DG  C N3    1 
ATOM   41   C  C4    . DG  A 1 2   ? 52.222 42.110  64.544 1.00 44.27  ? 1802 DG  C C4    1 
ATOM   42   P  P     . DG  A 1 3   ? 56.875 38.198  61.960 1.00 57.48  ? 1803 DG  C P     1 
ATOM   43   O  OP1   . DG  A 1 3   ? 58.353 38.251  61.820 1.00 57.41  ? 1803 DG  C OP1   1 
ATOM   44   O  OP2   . DG  A 1 3   ? 56.032 38.024  60.750 1.00 56.32  ? 1803 DG  C OP2   1 
ATOM   45   O  "O5'" . DG  A 1 3   ? 56.529 37.057  63.009 1.00 58.98  ? 1803 DG  C "O5'" 1 
ATOM   46   C  "C5'" . DG  A 1 3   ? 57.018 37.154  64.343 1.00 60.83  ? 1803 DG  C "C5'" 1 
ATOM   47   C  "C4'" . DG  A 1 3   ? 56.060 36.493  65.303 1.00 62.25  ? 1803 DG  C "C4'" 1 
ATOM   48   O  "O4'" . DG  A 1 3   ? 54.908 37.335  65.552 1.00 62.15  ? 1803 DG  C "O4'" 1 
ATOM   49   C  "C3'" . DG  A 1 3   ? 55.515 35.160  64.800 1.00 64.32  ? 1803 DG  C "C3'" 1 
ATOM   50   O  "O3'" . DG  A 1 3   ? 55.521 34.203  65.856 1.00 67.40  ? 1803 DG  C "O3'" 1 
ATOM   51   C  "C2'" . DG  A 1 3   ? 54.095 35.491  64.380 1.00 63.27  ? 1803 DG  C "C2'" 1 
ATOM   52   C  "C1'" . DG  A 1 3   ? 53.723 36.584  65.362 1.00 62.02  ? 1803 DG  C "C1'" 1 
ATOM   53   N  N9    . DG  A 1 3   ? 52.681 37.489  64.888 1.00 60.75  ? 1803 DG  C N9    1 
ATOM   54   C  C8    . DG  A 1 3   ? 52.666 38.199  63.710 1.00 59.96  ? 1803 DG  C C8    1 
ATOM   55   N  N7    . DG  A 1 3   ? 51.585 38.916  63.558 1.00 58.97  ? 1803 DG  C N7    1 
ATOM   56   C  C5    . DG  A 1 3   ? 50.842 38.668  64.706 1.00 58.28  ? 1803 DG  C C5    1 
ATOM   57   C  C6    . DG  A 1 3   ? 49.570 39.162  65.107 1.00 57.48  ? 1803 DG  C C6    1 
ATOM   58   O  O6    . DG  A 1 3   ? 48.820 39.937  64.505 1.00 56.32  ? 1803 DG  C O6    1 
ATOM   59   N  N1    . DG  A 1 3   ? 49.193 38.655  66.347 1.00 56.05  ? 1803 DG  C N1    1 
ATOM   60   C  C2    . DG  A 1 3   ? 49.939 37.786  67.105 1.00 56.55  ? 1803 DG  C C2    1 
ATOM   61   N  N2    . DG  A 1 3   ? 49.409 37.419  68.278 1.00 54.52  ? 1803 DG  C N2    1 
ATOM   62   N  N3    . DG  A 1 3   ? 51.120 37.312  66.739 1.00 56.84  ? 1803 DG  C N3    1 
ATOM   63   C  C4    . DG  A 1 3   ? 51.508 37.792  65.539 1.00 58.84  ? 1803 DG  C C4    1 
ATOM   64   P  P     . DG  A 1 4   ? 55.153 32.675  65.537 1.00 70.21  ? 1804 DG  C P     1 
ATOM   65   O  OP1   . DG  A 1 4   ? 55.677 31.839  66.650 1.00 69.59  ? 1804 DG  C OP1   1 
ATOM   66   O  OP2   . DG  A 1 4   ? 55.559 32.382  64.134 1.00 68.47  ? 1804 DG  C OP2   1 
ATOM   67   O  "O5'" . DG  A 1 4   ? 53.565 32.671  65.607 1.00 68.51  ? 1804 DG  C "O5'" 1 
ATOM   68   C  "C5'" . DG  A 1 4   ? 52.899 32.907  66.842 1.00 68.27  ? 1804 DG  C "C5'" 1 
ATOM   69   C  "C4'" . DG  A 1 4   ? 51.429 32.612  66.688 1.00 67.85  ? 1804 DG  C "C4'" 1 
ATOM   70   O  "O4'" . DG  A 1 4   ? 50.710 33.787  66.228 1.00 68.24  ? 1804 DG  C "O4'" 1 
ATOM   71   C  "C3'" . DG  A 1 4   ? 51.174 31.514  65.655 1.00 67.06  ? 1804 DG  C "C3'" 1 
ATOM   72   O  "O3'" . DG  A 1 4   ? 50.223 30.570  66.140 1.00 65.83  ? 1804 DG  C "O3'" 1 
ATOM   73   C  "C2'" . DG  A 1 4   ? 50.618 32.270  64.462 1.00 66.92  ? 1804 DG  C "C2'" 1 
ATOM   74   C  "C1'" . DG  A 1 4   ? 49.887 33.414  65.136 1.00 67.05  ? 1804 DG  C "C1'" 1 
ATOM   75   N  N9    . DG  A 1 4   ? 49.669 34.578  64.282 1.00 65.33  ? 1804 DG  C N9    1 
ATOM   76   C  C8    . DG  A 1 4   ? 50.471 35.024  63.257 1.00 64.85  ? 1804 DG  C C8    1 
ATOM   77   N  N7    . DG  A 1 4   ? 49.962 36.038  62.612 1.00 63.99  ? 1804 DG  C N7    1 
ATOM   78   C  C5    . DG  A 1 4   ? 48.761 36.293  63.262 1.00 62.28  ? 1804 DG  C C5    1 
ATOM   79   C  C6    . DG  A 1 4   ? 47.761 37.265  62.999 1.00 61.05  ? 1804 DG  C C6    1 
ATOM   80   O  O6    . DG  A 1 4   ? 47.732 38.117  62.103 1.00 60.25  ? 1804 DG  C O6    1 
ATOM   81   N  N1    . DG  A 1 4   ? 46.709 37.174  63.905 1.00 59.41  ? 1804 DG  C N1    1 
ATOM   82   C  C2    . DG  A 1 4   ? 46.627 36.265  64.931 1.00 59.92  ? 1804 DG  C C2    1 
ATOM   83   N  N2    . DG  A 1 4   ? 45.532 36.337  65.699 1.00 59.46  ? 1804 DG  C N2    1 
ATOM   84   N  N3    . DG  A 1 4   ? 47.550 35.350  65.184 1.00 60.88  ? 1804 DG  C N3    1 
ATOM   85   C  C4    . DG  A 1 4   ? 48.580 35.418  64.313 1.00 62.88  ? 1804 DG  C C4    1 
ATOM   86   P  P     . DG  A 1 5   ? 49.818 29.312  65.226 1.00 63.63  ? 1805 DG  C P     1 
ATOM   87   O  OP1   . DG  A 1 5   ? 49.971 28.071  66.022 1.00 62.76  ? 1805 DG  C OP1   1 
ATOM   88   O  OP2   . DG  A 1 5   ? 50.502 29.433  63.913 1.00 64.95  ? 1805 DG  C OP2   1 
ATOM   89   O  "O5'" . DG  A 1 5   ? 48.273 29.565  64.982 1.00 62.83  ? 1805 DG  C "O5'" 1 
ATOM   90   C  "C5'" . DG  A 1 5   ? 47.430 29.915  66.068 1.00 61.56  ? 1805 DG  C "C5'" 1 
ATOM   91   C  "C4'" . DG  A 1 5   ? 46.036 30.182  65.563 1.00 60.52  ? 1805 DG  C "C4'" 1 
ATOM   92   O  "O4'" . DG  A 1 5   ? 45.933 31.496  64.967 1.00 60.58  ? 1805 DG  C "O4'" 1 
ATOM   93   C  "C3'" . DG  A 1 5   ? 45.588 29.198  64.487 1.00 60.59  ? 1805 DG  C "C3'" 1 
ATOM   94   O  "O3'" . DG  A 1 5   ? 44.205 28.974  64.665 1.00 61.83  ? 1805 DG  C "O3'" 1 
ATOM   95   C  "C2'" . DG  A 1 5   ? 45.775 29.985  63.205 1.00 60.03  ? 1805 DG  C "C2'" 1 
ATOM   96   C  "C1'" . DG  A 1 5   ? 45.372 31.366  63.673 1.00 58.80  ? 1805 DG  C "C1'" 1 
ATOM   97   N  N9    . DG  A 1 5   ? 45.858 32.468  62.855 1.00 58.18  ? 1805 DG  C N9    1 
ATOM   98   C  C8    . DG  A 1 5   ? 47.107 32.614  62.302 1.00 58.12  ? 1805 DG  C C8    1 
ATOM   99   N  N7    . DG  A 1 5   ? 47.232 33.710  61.604 1.00 57.83  ? 1805 DG  C N7    1 
ATOM   100  C  C5    . DG  A 1 5   ? 45.990 34.325  61.706 1.00 58.00  ? 1805 DG  C C5    1 
ATOM   101  C  C6    . DG  A 1 5   ? 45.516 35.546  61.150 1.00 58.30  ? 1805 DG  C C6    1 
ATOM   102  O  O6    . DG  A 1 5   ? 46.120 36.356  60.435 1.00 60.17  ? 1805 DG  C O6    1 
ATOM   103  N  N1    . DG  A 1 5   ? 44.191 35.788  61.503 1.00 57.34  ? 1805 DG  C N1    1 
ATOM   104  C  C2    . DG  A 1 5   ? 43.420 34.965  62.288 1.00 57.48  ? 1805 DG  C C2    1 
ATOM   105  N  N2    . DG  A 1 5   ? 42.160 35.367  62.507 1.00 55.58  ? 1805 DG  C N2    1 
ATOM   106  N  N3    . DG  A 1 5   ? 43.851 33.830  62.815 1.00 57.04  ? 1805 DG  C N3    1 
ATOM   107  C  C4    . DG  A 1 5   ? 45.135 33.573  62.480 1.00 57.96  ? 1805 DG  C C4    1 
ATOM   108  P  P     . DA  A 1 6   ? 43.609 27.505  64.514 1.00 60.77  ? 1806 DA  C P     1 
ATOM   109  O  OP1   . DA  A 1 6   ? 43.693 26.852  65.847 1.00 60.10  ? 1806 DA  C OP1   1 
ATOM   110  O  OP2   . DA  A 1 6   ? 44.229 26.858  63.325 1.00 59.76  ? 1806 DA  C OP2   1 
ATOM   111  O  "O5'" . DA  A 1 6   ? 42.090 27.822  64.198 1.00 58.39  ? 1806 DA  C "O5'" 1 
ATOM   112  C  "C5'" . DA  A 1 6   ? 41.416 28.836  64.927 1.00 55.20  ? 1806 DA  C "C5'" 1 
ATOM   113  C  "C4'" . DA  A 1 6   ? 40.494 29.599  64.012 1.00 53.02  ? 1806 DA  C "C4'" 1 
ATOM   114  O  "O4'" . DA  A 1 6   ? 41.193 30.630  63.276 1.00 52.93  ? 1806 DA  C "O4'" 1 
ATOM   115  C  "C3'" . DA  A 1 6   ? 39.820 28.716  62.969 1.00 51.66  ? 1806 DA  C "C3'" 1 
ATOM   116  O  "O3'" . DA  A 1 6   ? 38.453 29.074  62.891 1.00 49.37  ? 1806 DA  C "O3'" 1 
ATOM   117  C  "C2'" . DA  A 1 6   ? 40.531 29.074  61.676 1.00 50.89  ? 1806 DA  C "C2'" 1 
ATOM   118  C  "C1'" . DA  A 1 6   ? 40.841 30.539  61.907 1.00 50.68  ? 1806 DA  C "C1'" 1 
ATOM   119  N  N9    . DA  A 1 6   ? 41.943 31.086  61.118 1.00 48.65  ? 1806 DA  C N9    1 
ATOM   120  C  C8    . DA  A 1 6   ? 43.212 30.588  60.960 1.00 48.05  ? 1806 DA  C C8    1 
ATOM   121  N  N7    . DA  A 1 6   ? 43.976 31.327  60.189 1.00 47.89  ? 1806 DA  C N7    1 
ATOM   122  C  C5    . DA  A 1 6   ? 43.153 32.381  59.814 1.00 46.34  ? 1806 DA  C C5    1 
ATOM   123  C  C6    . DA  A 1 6   ? 43.366 33.512  58.999 1.00 45.58  ? 1806 DA  C C6    1 
ATOM   124  N  N6    . DA  A 1 6   ? 44.527 33.786  58.394 1.00 43.34  ? 1806 DA  C N6    1 
ATOM   125  N  N1    . DA  A 1 6   ? 42.333 34.364  58.826 1.00 43.39  ? 1806 DA  C N1    1 
ATOM   126  C  C2    . DA  A 1 6   ? 41.174 34.097  59.435 1.00 44.76  ? 1806 DA  C C2    1 
ATOM   127  N  N3    . DA  A 1 6   ? 40.852 33.073  60.225 1.00 45.83  ? 1806 DA  C N3    1 
ATOM   128  C  C4    . DA  A 1 6   ? 41.897 32.242  60.375 1.00 47.32  ? 1806 DA  C C4    1 
ATOM   129  P  P     . DA  A 1 7   ? 37.419 28.067  62.216 1.00 48.51  ? 1807 DA  C P     1 
ATOM   130  O  OP1   . DA  A 1 7   ? 36.283 27.896  63.155 1.00 48.88  ? 1807 DA  C OP1   1 
ATOM   131  O  OP2   . DA  A 1 7   ? 38.172 26.878  61.727 1.00 46.94  ? 1807 DA  C OP2   1 
ATOM   132  O  "O5'" . DA  A 1 7   ? 36.911 28.886  60.960 1.00 46.01  ? 1807 DA  C "O5'" 1 
ATOM   133  C  "C5'" . DA  A 1 7   ? 36.315 30.161  61.133 1.00 45.64  ? 1807 DA  C "C5'" 1 
ATOM   134  C  "C4'" . DA  A 1 7   ? 36.148 30.818  59.790 1.00 45.30  ? 1807 DA  C "C4'" 1 
ATOM   135  O  "O4'" . DA  A 1 7   ? 37.428 31.302  59.317 1.00 44.70  ? 1807 DA  C "O4'" 1 
ATOM   136  C  "C3'" . DA  A 1 7   ? 35.655 29.827  58.737 1.00 45.90  ? 1807 DA  C "C3'" 1 
ATOM   137  O  "O3'" . DA  A 1 7   ? 34.690 30.452  57.906 1.00 48.21  ? 1807 DA  C "O3'" 1 
ATOM   138  C  "C2'" . DA  A 1 7   ? 36.907 29.504  57.940 1.00 45.94  ? 1807 DA  C "C2'" 1 
ATOM   139  C  "C1'" . DA  A 1 7   ? 37.640 30.827  58.002 1.00 46.92  ? 1807 DA  C "C1'" 1 
ATOM   140  N  N9    . DA  A 1 7   ? 39.079 30.753  57.763 1.00 47.73  ? 1807 DA  C N9    1 
ATOM   141  C  C8    . DA  A 1 7   ? 39.967 29.801  58.195 1.00 47.52  ? 1807 DA  C C8    1 
ATOM   142  N  N7    . DA  A 1 7   ? 41.197 30.004  57.790 1.00 47.41  ? 1807 DA  C N7    1 
ATOM   143  C  C5    . DA  A 1 7   ? 41.115 31.173  57.045 1.00 47.49  ? 1807 DA  C C5    1 
ATOM   144  C  C6    . DA  A 1 7   ? 42.081 31.923  56.338 1.00 46.87  ? 1807 DA  C C6    1 
ATOM   145  N  N6    . DA  A 1 7   ? 43.371 31.590  56.260 1.00 45.04  ? 1807 DA  C N6    1 
ATOM   146  N  N1    . DA  A 1 7   ? 41.666 33.043  55.706 1.00 47.49  ? 1807 DA  C N1    1 
ATOM   147  C  C2    . DA  A 1 7   ? 40.371 33.380  55.780 1.00 48.08  ? 1807 DA  C C2    1 
ATOM   148  N  N3    . DA  A 1 7   ? 39.373 32.758  56.406 1.00 49.27  ? 1807 DA  C N3    1 
ATOM   149  C  C4    . DA  A 1 7   ? 39.817 31.649  57.025 1.00 47.88  ? 1807 DA  C C4    1 
ATOM   150  P  P     . DG  A 1 8   ? 33.575 29.560  57.187 1.00 47.96  ? 1808 DG  C P     1 
ATOM   151  O  OP1   . DG  A 1 8   ? 32.268 29.932  57.776 1.00 49.86  ? 1808 DG  C OP1   1 
ATOM   152  O  OP2   . DG  A 1 8   ? 34.027 28.141  57.216 1.00 49.09  ? 1808 DG  C OP2   1 
ATOM   153  O  "O5'" . DG  A 1 8   ? 33.617 30.069  55.679 1.00 49.87  ? 1808 DG  C "O5'" 1 
ATOM   154  C  "C5'" . DG  A 1 8   ? 33.400 31.442  55.368 1.00 50.05  ? 1808 DG  C "C5'" 1 
ATOM   155  C  "C4'" . DG  A 1 8   ? 33.988 31.763  54.014 1.00 51.31  ? 1808 DG  C "C4'" 1 
ATOM   156  O  "O4'" . DG  A 1 8   ? 35.436 31.863  54.067 1.00 48.30  ? 1808 DG  C "O4'" 1 
ATOM   157  C  "C3'" . DG  A 1 8   ? 33.673 30.720  52.945 1.00 52.12  ? 1808 DG  C "C3'" 1 
ATOM   158  O  "O3'" . DG  A 1 8   ? 33.340 31.387  51.735 1.00 55.59  ? 1808 DG  C "O3'" 1 
ATOM   159  C  "C2'" . DG  A 1 8   ? 34.981 29.970  52.787 1.00 51.21  ? 1808 DG  C "C2'" 1 
ATOM   160  C  "C1'" . DG  A 1 8   ? 36.004 31.055  53.052 1.00 49.36  ? 1808 DG  C "C1'" 1 
ATOM   161  N  N9    . DG  A 1 8   ? 37.289 30.551  53.526 1.00 49.66  ? 1808 DG  C N9    1 
ATOM   162  C  C8    . DG  A 1 8   ? 37.508 29.516  54.402 1.00 49.74  ? 1808 DG  C C8    1 
ATOM   163  N  N7    . DG  A 1 8   ? 38.771 29.274  54.609 1.00 50.79  ? 1808 DG  C N7    1 
ATOM   164  C  C5    . DG  A 1 8   ? 39.429 30.205  53.822 1.00 50.56  ? 1808 DG  C C5    1 
ATOM   165  C  C6    . DG  A 1 8   ? 40.812 30.416  53.622 1.00 50.68  ? 1808 DG  C C6    1 
ATOM   166  O  O6    . DG  A 1 8   ? 41.764 29.807  54.120 1.00 51.99  ? 1808 DG  C O6    1 
ATOM   167  N  N1    . DG  A 1 8   ? 41.045 31.459  52.736 1.00 50.43  ? 1808 DG  C N1    1 
ATOM   168  C  C2    . DG  A 1 8   ? 40.071 32.206  52.124 1.00 51.91  ? 1808 DG  C C2    1 
ATOM   169  N  N2    . DG  A 1 8   ? 40.498 33.171  51.302 1.00 51.89  ? 1808 DG  C N2    1 
ATOM   170  N  N3    . DG  A 1 8   ? 38.774 32.020  52.304 1.00 51.91  ? 1808 DG  C N3    1 
ATOM   171  C  C4    . DG  A 1 8   ? 38.527 31.008  53.157 1.00 50.57  ? 1808 DG  C C4    1 
ATOM   172  P  P     . DG  A 1 9   ? 32.920 30.538  50.441 1.00 55.52  ? 1809 DG  C P     1 
ATOM   173  O  OP1   . DG  A 1 9   ? 31.540 30.942  50.072 1.00 56.53  ? 1809 DG  C OP1   1 
ATOM   174  O  OP2   . DG  A 1 9   ? 33.232 29.097  50.655 1.00 53.60  ? 1809 DG  C OP2   1 
ATOM   175  O  "O5'" . DG  A 1 9   ? 33.927 31.100  49.343 1.00 55.29  ? 1809 DG  C "O5'" 1 
ATOM   176  C  "C5'" . DG  A 1 9   ? 34.390 32.449  49.407 1.00 52.04  ? 1809 DG  C "C5'" 1 
ATOM   177  C  "C4'" . DG  A 1 9   ? 35.623 32.618  48.549 1.00 50.72  ? 1809 DG  C "C4'" 1 
ATOM   178  O  "O4'" . DG  A 1 9   ? 36.808 32.145  49.236 1.00 49.27  ? 1809 DG  C "O4'" 1 
ATOM   179  C  "C3'" . DG  A 1 9   ? 35.566 31.852  47.226 1.00 50.37  ? 1809 DG  C "C3'" 1 
ATOM   180  O  "O3'" . DG  A 1 9   ? 36.104 32.655  46.180 1.00 50.98  ? 1809 DG  C "O3'" 1 
ATOM   181  C  "C2'" . DG  A 1 9   ? 36.471 30.657  47.471 1.00 48.72  ? 1809 DG  C "C2'" 1 
ATOM   182  C  "C1'" . DG  A 1 9   ? 37.519 31.263  48.379 1.00 48.13  ? 1809 DG  C "C1'" 1 
ATOM   183  N  N9    . DG  A 1 9   ? 38.239 30.302  49.208 1.00 47.60  ? 1809 DG  C N9    1 
ATOM   184  C  C8    . DG  A 1 9   ? 37.701 29.324  50.009 1.00 47.43  ? 1809 DG  C C8    1 
ATOM   185  N  N7    . DG  A 1 9   ? 38.605 28.616  50.628 1.00 46.00  ? 1809 DG  C N7    1 
ATOM   186  C  C5    . DG  A 1 9   ? 39.814 29.160  50.211 1.00 46.30  ? 1809 DG  C C5    1 
ATOM   187  C  C6    . DG  A 1 9   ? 41.153 28.810  50.548 1.00 45.22  ? 1809 DG  C C6    1 
ATOM   188  O  O6    . DG  A 1 9   ? 41.553 27.924  51.311 1.00 45.54  ? 1809 DG  C O6    1 
ATOM   189  N  N1    . DG  A 1 9   ? 42.073 29.620  49.893 1.00 44.29  ? 1809 DG  C N1    1 
ATOM   190  C  C2    . DG  A 1 9   ? 41.754 30.634  49.031 1.00 45.94  ? 1809 DG  C C2    1 
ATOM   191  N  N2    . DG  A 1 9   ? 42.790 31.296  48.493 1.00 47.53  ? 1809 DG  C N2    1 
ATOM   192  N  N3    . DG  A 1 9   ? 40.516 30.976  48.714 1.00 45.69  ? 1809 DG  C N3    1 
ATOM   193  C  C4    . DG  A 1 9   ? 39.603 30.202  49.334 1.00 46.36  ? 1809 DG  C C4    1 
ATOM   194  P  P     . DA  A 1 10  ? 36.120 32.094  44.680 1.00 49.24  ? 1810 DA  C P     1 
ATOM   195  O  OP1   . DA  A 1 10  ? 35.392 33.068  43.832 1.00 52.37  ? 1810 DA  C OP1   1 
ATOM   196  O  OP2   . DA  A 1 10  ? 35.686 30.675  44.704 1.00 52.68  ? 1810 DA  C OP2   1 
ATOM   197  O  "O5'" . DA  A 1 10  ? 37.666 32.126  44.309 1.00 48.34  ? 1810 DA  C "O5'" 1 
ATOM   198  C  "C5'" . DA  A 1 10  ? 38.436 33.299  44.538 1.00 46.45  ? 1810 DA  C "C5'" 1 
ATOM   199  C  "C4'" . DA  A 1 10  ? 39.842 33.105  44.026 1.00 45.54  ? 1810 DA  C "C4'" 1 
ATOM   200  O  "O4'" . DA  A 1 10  ? 40.574 32.214  44.900 1.00 45.09  ? 1810 DA  C "O4'" 1 
ATOM   201  C  "C3'" . DA  A 1 10  ? 39.916 32.492  42.631 1.00 43.69  ? 1810 DA  C "C3'" 1 
ATOM   202  O  "O3'" . DA  A 1 10  ? 40.962 33.126  41.898 1.00 44.77  ? 1810 DA  C "O3'" 1 
ATOM   203  C  "C2'" . DA  A 1 10  ? 40.210 31.023  42.900 1.00 41.59  ? 1810 DA  C "C2'" 1 
ATOM   204  C  "C1'" . DA  A 1 10  ? 41.013 31.062  44.192 1.00 43.48  ? 1810 DA  C "C1'" 1 
ATOM   205  N  N9    . DA  A 1 10  ? 40.822 29.915  45.080 1.00 42.12  ? 1810 DA  C N9    1 
ATOM   206  C  C8    . DA  A 1 10  ? 39.633 29.382  45.520 1.00 42.58  ? 1810 DA  C C8    1 
ATOM   207  N  N7    . DA  A 1 10  ? 39.778 28.397  46.374 1.00 41.08  ? 1810 DA  C N7    1 
ATOM   208  C  C5    . DA  A 1 10  ? 41.154 28.261  46.495 1.00 42.71  ? 1810 DA  C C5    1 
ATOM   209  C  C6    . DA  A 1 10  ? 41.959 27.397  47.268 1.00 42.26  ? 1810 DA  C C6    1 
ATOM   210  N  N6    . DA  A 1 10  ? 41.472 26.481  48.114 1.00 42.32  ? 1810 DA  C N6    1 
ATOM   211  N  N1    . DA  A 1 10  ? 43.299 27.512  47.146 1.00 42.02  ? 1810 DA  C N1    1 
ATOM   212  C  C2    . DA  A 1 10  ? 43.791 28.438  46.311 1.00 43.43  ? 1810 DA  C C2    1 
ATOM   213  N  N3    . DA  A 1 10  ? 43.140 29.313  45.541 1.00 43.84  ? 1810 DA  C N3    1 
ATOM   214  C  C4    . DA  A 1 10  ? 41.810 29.173  45.684 1.00 42.82  ? 1810 DA  C C4    1 
ATOM   215  P  P     . DC  A 1 11  ? 41.116 32.846  40.325 1.00 46.04  ? 1811 DC  C P     1 
ATOM   216  O  OP1   . DC  A 1 11  ? 41.734 34.052  39.723 1.00 46.27  ? 1811 DC  C OP1   1 
ATOM   217  O  OP2   . DC  A 1 11  ? 39.838 32.315  39.779 1.00 45.51  ? 1811 DC  C OP2   1 
ATOM   218  O  "O5'" . DC  A 1 11  ? 42.168 31.659  40.286 1.00 43.51  ? 1811 DC  C "O5'" 1 
ATOM   219  C  "C5'" . DC  A 1 11  ? 43.421 31.810  40.921 1.00 40.06  ? 1811 DC  C "C5'" 1 
ATOM   220  C  "C4'" . DC  A 1 11  ? 44.198 30.518  40.861 1.00 38.81  ? 1811 DC  C "C4'" 1 
ATOM   221  O  "O4'" . DC  A 1 11  ? 43.843 29.646  41.960 1.00 37.54  ? 1811 DC  C "O4'" 1 
ATOM   222  C  "C3'" . DC  A 1 11  ? 44.035 29.698  39.577 1.00 37.59  ? 1811 DC  C "C3'" 1 
ATOM   223  O  "O3'" . DC  A 1 11  ? 45.331 29.419  39.043 1.00 33.34  ? 1811 DC  C "O3'" 1 
ATOM   224  C  "C2'" . DC  A 1 11  ? 43.335 28.428  40.046 1.00 36.65  ? 1811 DC  C "C2'" 1 
ATOM   225  C  "C1'" . DC  A 1 11  ? 43.812 28.317  41.484 1.00 38.21  ? 1811 DC  C "C1'" 1 
ATOM   226  N  N1    . DC  A 1 11  ? 42.980 27.520  42.403 1.00 36.92  ? 1811 DC  C N1    1 
ATOM   227  C  C2    . DC  A 1 11  ? 43.623 26.649  43.299 1.00 37.30  ? 1811 DC  C C2    1 
ATOM   228  O  O2    . DC  A 1 11  ? 44.864 26.599  43.304 1.00 35.88  ? 1811 DC  C O2    1 
ATOM   229  N  N3    . DC  A 1 11  ? 42.881 25.895  44.135 1.00 34.79  ? 1811 DC  C N3    1 
ATOM   230  C  C4    . DC  A 1 11  ? 41.551 25.988  44.114 1.00 37.41  ? 1811 DC  C C4    1 
ATOM   231  N  N4    . DC  A 1 11  ? 40.864 25.225  44.964 1.00 33.82  ? 1811 DC  C N4    1 
ATOM   232  C  C5    . DC  A 1 11  ? 40.867 26.870  43.222 1.00 36.33  ? 1811 DC  C C5    1 
ATOM   233  C  C6    . DC  A 1 11  ? 41.616 27.611  42.391 1.00 36.69  ? 1811 DC  C C6    1 
ATOM   234  P  P     . DT  A 1 12  ? 45.479 28.623  37.658 1.00 32.46  ? 1812 DT  C P     1 
ATOM   235  O  OP1   . DT  A 1 12  ? 46.535 29.290  36.858 1.00 33.44  ? 1812 DT  C OP1   1 
ATOM   236  O  OP2   . DT  A 1 12  ? 44.141 28.407  37.055 1.00 34.23  ? 1812 DT  C OP2   1 
ATOM   237  O  "O5'" . DT  A 1 12  ? 46.049 27.225  38.161 1.00 32.67  ? 1812 DT  C "O5'" 1 
ATOM   238  C  "C5'" . DT  A 1 12  ? 47.092 27.199  39.128 1.00 35.15  ? 1812 DT  C "C5'" 1 
ATOM   239  C  "C4'" . DT  A 1 12  ? 47.435 25.778  39.497 1.00 37.52  ? 1812 DT  C "C4'" 1 
ATOM   240  O  "O4'" . DT  A 1 12  ? 46.520 25.269  40.496 1.00 35.62  ? 1812 DT  C "O4'" 1 
ATOM   241  C  "C3'" . DT  A 1 12  ? 47.385 24.802  38.322 1.00 40.42  ? 1812 DT  C "C3'" 1 
ATOM   242  O  "O3'" . DT  A 1 12  ? 48.538 23.966  38.326 1.00 45.08  ? 1812 DT  C "O3'" 1 
ATOM   243  C  "C2'" . DT  A 1 12  ? 46.131 23.982  38.583 1.00 38.44  ? 1812 DT  C "C2'" 1 
ATOM   244  C  "C1'" . DT  A 1 12  ? 46.051 23.988  40.097 1.00 36.87  ? 1812 DT  C "C1'" 1 
ATOM   245  N  N1    . DT  A 1 12  ? 44.691 23.807  40.654 1.00 38.25  ? 1812 DT  C N1    1 
ATOM   246  C  C2    . DT  A 1 12  ? 44.546 23.046  41.802 1.00 38.81  ? 1812 DT  C C2    1 
ATOM   247  O  O2    . DT  A 1 12  ? 45.479 22.504  42.373 1.00 38.16  ? 1812 DT  C O2    1 
ATOM   248  N  N3    . DT  A 1 12  ? 43.259 22.946  42.263 1.00 37.85  ? 1812 DT  C N3    1 
ATOM   249  C  C4    . DT  A 1 12  ? 42.127 23.507  41.708 1.00 38.25  ? 1812 DT  C C4    1 
ATOM   250  O  O4    . DT  A 1 12  ? 41.035 23.332  42.244 1.00 37.01  ? 1812 DT  C O4    1 
ATOM   251  C  C5    . DT  A 1 12  ? 42.349 24.280  40.501 1.00 37.70  ? 1812 DT  C C5    1 
ATOM   252  C  C7    . DT  A 1 12  ? 41.179 24.916  39.819 1.00 34.68  ? 1812 DT  C C7    1 
ATOM   253  C  C6    . DT  A 1 12  ? 43.603 24.388  40.044 1.00 37.57  ? 1812 DT  C C6    1 
ATOM   254  P  P     . DC  A 1 13  ? 48.801 22.989  37.089 1.00 46.56  ? 1813 DC  C P     1 
ATOM   255  O  OP1   . DC  A 1 13  ? 50.264 22.947  36.852 1.00 50.29  ? 1813 DC  C OP1   1 
ATOM   256  O  OP2   . DC  A 1 13  ? 47.891 23.416  35.998 1.00 47.94  ? 1813 DC  C OP2   1 
ATOM   257  O  "O5'" . DC  A 1 13  ? 48.318 21.577  37.635 1.00 51.37  ? 1813 DC  C "O5'" 1 
ATOM   258  C  "C5'" . DC  A 1 13  ? 48.932 21.012  38.792 1.00 59.98  ? 1813 DC  C "C5'" 1 
ATOM   259  C  "C4'" . DC  A 1 13  ? 48.317 19.673  39.117 1.00 64.49  ? 1813 DC  C "C4'" 1 
ATOM   260  O  "O4'" . DC  A 1 13  ? 47.014 19.868  39.715 1.00 66.21  ? 1813 DC  C "O4'" 1 
ATOM   261  C  "C3'" . DC  A 1 13  ? 48.108 18.755  37.910 1.00 66.63  ? 1813 DC  C "C3'" 1 
ATOM   262  O  "O3'" . DC  A 1 13  ? 48.300 17.379  38.262 1.00 69.50  ? 1813 DC  C "O3'" 1 
ATOM   263  C  "C2'" . DC  A 1 13  ? 46.638 18.944  37.593 1.00 68.35  ? 1813 DC  C "C2'" 1 
ATOM   264  C  "C1'" . DC  A 1 13  ? 46.048 19.151  38.978 1.00 69.26  ? 1813 DC  C "C1'" 1 
ATOM   265  N  N1    . DC  A 1 13  ? 44.776 19.894  39.018 1.00 73.19  ? 1813 DC  C N1    1 
ATOM   266  C  C2    . DC  A 1 13  ? 43.896 19.679  40.093 1.00 75.03  ? 1813 DC  C C2    1 
ATOM   267  O  O2    . DC  A 1 13  ? 44.224 18.881  40.991 1.00 75.81  ? 1813 DC  C O2    1 
ATOM   268  N  N3    . DC  A 1 13  ? 42.714 20.344  40.122 1.00 75.74  ? 1813 DC  C N3    1 
ATOM   269  C  C4    . DC  A 1 13  ? 42.401 21.192  39.138 1.00 75.52  ? 1813 DC  C C4    1 
ATOM   270  N  N4    . DC  A 1 13  ? 41.223 21.816  39.202 1.00 76.25  ? 1813 DC  C N4    1 
ATOM   271  C  C5    . DC  A 1 13  ? 43.280 21.435  38.042 1.00 74.54  ? 1813 DC  C C5    1 
ATOM   272  C  C6    . DC  A 1 13  ? 44.445 20.773  38.023 1.00 74.34  ? 1813 DC  C C6    1 
ATOM   273  O  "O5'" . DT  B 2 1   ? 23.347 19.559  33.568 1.00 94.22  ? 1902 DT  D "O5'" 1 
ATOM   274  C  "C5'" . DT  B 2 1   ? 24.655 19.037  33.832 1.00 95.41  ? 1902 DT  D "C5'" 1 
ATOM   275  C  "C4'" . DT  B 2 1   ? 25.271 18.294  32.666 1.00 95.72  ? 1902 DT  D "C4'" 1 
ATOM   276  O  "O4'" . DT  B 2 1   ? 24.419 17.190  32.278 1.00 96.45  ? 1902 DT  D "O4'" 1 
ATOM   277  C  "C3'" . DT  B 2 1   ? 25.481 19.127  31.401 1.00 95.32  ? 1902 DT  D "C3'" 1 
ATOM   278  O  "O3'" . DT  B 2 1   ? 26.676 18.698  30.732 1.00 94.04  ? 1902 DT  D "O3'" 1 
ATOM   279  C  "C2'" . DT  B 2 1   ? 24.262 18.782  30.561 1.00 95.69  ? 1902 DT  D "C2'" 1 
ATOM   280  C  "C1'" . DT  B 2 1   ? 24.042 17.320  30.914 1.00 96.39  ? 1902 DT  D "C1'" 1 
ATOM   281  N  N1    . DT  B 2 1   ? 22.653 16.838  30.789 1.00 96.86  ? 1902 DT  D N1    1 
ATOM   282  C  C2    . DT  B 2 1   ? 22.345 15.978  29.756 1.00 97.15  ? 1902 DT  D C2    1 
ATOM   283  O  O2    . DT  B 2 1   ? 23.156 15.623  28.916 1.00 96.86  ? 1902 DT  D O2    1 
ATOM   284  N  N3    . DT  B 2 1   ? 21.041 15.545  29.743 1.00 97.28  ? 1902 DT  D N3    1 
ATOM   285  C  C4    . DT  B 2 1   ? 20.040 15.883  30.634 1.00 97.59  ? 1902 DT  D C4    1 
ATOM   286  O  O4    . DT  B 2 1   ? 18.918 15.403  30.503 1.00 98.08  ? 1902 DT  D O4    1 
ATOM   287  C  C5    . DT  B 2 1   ? 20.428 16.805  31.677 1.00 97.26  ? 1902 DT  D C5    1 
ATOM   288  C  C7    . DT  B 2 1   ? 19.406 17.238  32.680 1.00 97.78  ? 1902 DT  D C7    1 
ATOM   289  C  C6    . DT  B 2 1   ? 21.697 17.232  31.700 1.00 97.09  ? 1902 DT  D C6    1 
ATOM   290  P  P     . DC  B 2 2   ? 28.102 19.304  31.171 1.00 92.09  ? 1903 DC  D P     1 
ATOM   291  O  OP1   . DC  B 2 2   ? 27.875 20.678  31.687 1.00 92.97  ? 1903 DC  D OP1   1 
ATOM   292  O  OP2   . DC  B 2 2   ? 29.062 19.089  30.056 1.00 92.12  ? 1903 DC  D OP2   1 
ATOM   293  O  "O5'" . DC  B 2 2   ? 28.544 18.394  32.406 1.00 90.62  ? 1903 DC  D "O5'" 1 
ATOM   294  C  "C5'" . DC  B 2 2   ? 28.809 16.999  32.239 1.00 86.51  ? 1903 DC  D "C5'" 1 
ATOM   295  C  "C4'" . DC  B 2 2   ? 29.738 16.512  33.327 1.00 83.99  ? 1903 DC  D "C4'" 1 
ATOM   296  O  "O4'" . DC  B 2 2   ? 30.979 17.250  33.246 1.00 84.86  ? 1903 DC  D "O4'" 1 
ATOM   297  C  "C3'" . DC  B 2 2   ? 29.223 16.712  34.750 1.00 81.66  ? 1903 DC  D "C3'" 1 
ATOM   298  O  "O3'" . DC  B 2 2   ? 29.674 15.636  35.571 1.00 75.83  ? 1903 DC  D "O3'" 1 
ATOM   299  C  "C2'" . DC  B 2 2   ? 29.856 18.024  35.179 1.00 83.78  ? 1903 DC  D "C2'" 1 
ATOM   300  C  "C1'" . DC  B 2 2   ? 31.159 18.074  34.390 1.00 86.09  ? 1903 DC  D "C1'" 1 
ATOM   301  N  N1    . DC  B 2 2   ? 31.585 19.407  33.909 1.00 88.85  ? 1903 DC  D N1    1 
ATOM   302  C  C2    . DC  B 2 2   ? 30.644 20.461  33.817 1.00 90.25  ? 1903 DC  D C2    1 
ATOM   303  O  O2    . DC  B 2 2   ? 29.468 20.265  34.161 1.00 90.03  ? 1903 DC  D O2    1 
ATOM   304  N  N3    . DC  B 2 2   ? 31.049 21.666  33.350 1.00 91.43  ? 1903 DC  D N3    1 
ATOM   305  C  C4    . DC  B 2 2   ? 32.321 21.850  32.985 1.00 91.96  ? 1903 DC  D C4    1 
ATOM   306  N  N4    . DC  B 2 2   ? 32.668 23.054  32.520 1.00 92.76  ? 1903 DC  D N4    1 
ATOM   307  C  C5    . DC  B 2 2   ? 33.293 20.808  33.076 1.00 91.42  ? 1903 DC  D C5    1 
ATOM   308  C  C6    . DC  B 2 2   ? 32.886 19.617  33.540 1.00 90.11  ? 1903 DC  D C6    1 
ATOM   309  P  P     . DA  B 2 3   ? 28.805 15.172  36.841 1.00 70.73  ? 1904 DA  D P     1 
ATOM   310  O  OP1   . DA  B 2 3   ? 27.581 14.485  36.360 1.00 69.48  ? 1904 DA  D OP1   1 
ATOM   311  O  OP2   . DA  B 2 3   ? 28.690 16.323  37.776 1.00 70.30  ? 1904 DA  D OP2   1 
ATOM   312  O  "O5'" . DA  B 2 3   ? 29.731 14.072  37.518 1.00 65.70  ? 1904 DA  D "O5'" 1 
ATOM   313  C  "C5'" . DA  B 2 3   ? 31.119 14.023  37.214 1.00 54.92  ? 1904 DA  D "C5'" 1 
ATOM   314  C  "C4'" . DA  B 2 3   ? 31.802 12.999  38.084 1.00 49.74  ? 1904 DA  D "C4'" 1 
ATOM   315  O  "O4'" . DA  B 2 3   ? 33.187 12.883  37.697 1.00 47.06  ? 1904 DA  D "O4'" 1 
ATOM   316  C  "C3'" . DA  B 2 3   ? 31.812 13.344  39.566 1.00 46.74  ? 1904 DA  D "C3'" 1 
ATOM   317  O  "O3'" . DA  B 2 3   ? 31.767 12.116  40.280 1.00 43.72  ? 1904 DA  D "O3'" 1 
ATOM   318  C  "C2'" . DA  B 2 3   ? 33.136 14.068  39.745 1.00 45.50  ? 1904 DA  D "C2'" 1 
ATOM   319  C  "C1'" . DA  B 2 3   ? 34.037 13.384  38.720 1.00 44.59  ? 1904 DA  D "C1'" 1 
ATOM   320  N  N9    . DA  B 2 3   ? 35.007 14.258  38.065 1.00 40.70  ? 1904 DA  D N9    1 
ATOM   321  C  C8    . DA  B 2 3   ? 34.815 15.527  37.580 1.00 40.22  ? 1904 DA  D C8    1 
ATOM   322  N  N7    . DA  B 2 3   ? 35.865 16.022  36.971 1.00 38.42  ? 1904 DA  D N7    1 
ATOM   323  C  C5    . DA  B 2 3   ? 36.814 15.013  37.071 1.00 36.49  ? 1904 DA  D C5    1 
ATOM   324  C  C6    . DA  B 2 3   ? 38.135 14.908  36.609 1.00 35.62  ? 1904 DA  D C6    1 
ATOM   325  N  N6    . DA  B 2 3   ? 38.753 15.860  35.906 1.00 32.39  ? 1904 DA  D N6    1 
ATOM   326  N  N1    . DA  B 2 3   ? 38.810 13.771  36.894 1.00 36.58  ? 1904 DA  D N1    1 
ATOM   327  C  C2    . DA  B 2 3   ? 38.190 12.814  37.588 1.00 35.46  ? 1904 DA  D C2    1 
ATOM   328  N  N3    . DA  B 2 3   ? 36.950 12.792  38.065 1.00 37.83  ? 1904 DA  D N3    1 
ATOM   329  C  C4    . DA  B 2 3   ? 36.307 13.934  37.767 1.00 38.55  ? 1904 DA  D C4    1 
ATOM   330  P  P     . DG  B 2 4   ? 31.554 12.114  41.862 1.00 42.60  ? 1905 DG  D P     1 
ATOM   331  O  OP1   . DG  B 2 4   ? 31.036 10.763  42.195 1.00 40.95  ? 1905 DG  D OP1   1 
ATOM   332  O  OP2   . DG  B 2 4   ? 30.789 13.321  42.262 1.00 43.80  ? 1905 DG  D OP2   1 
ATOM   333  O  "O5'" . DG  B 2 4   ? 33.031 12.265  42.423 1.00 42.73  ? 1905 DG  D "O5'" 1 
ATOM   334  C  "C5'" . DG  B 2 4   ? 33.999 11.260  42.163 1.00 41.83  ? 1905 DG  D "C5'" 1 
ATOM   335  C  "C4'" . DG  B 2 4   ? 35.358 11.717  42.627 1.00 41.90  ? 1905 DG  D "C4'" 1 
ATOM   336  O  "O4'" . DG  B 2 4   ? 35.921 12.688  41.713 1.00 40.62  ? 1905 DG  D "O4'" 1 
ATOM   337  C  "C3'" . DG  B 2 4   ? 35.351 12.381  44.004 1.00 42.42  ? 1905 DG  D "C3'" 1 
ATOM   338  O  "O3'" . DG  B 2 4   ? 36.463 11.896  44.748 1.00 45.05  ? 1905 DG  D "O3'" 1 
ATOM   339  C  "C2'" . DG  B 2 4   ? 35.540 13.854  43.683 1.00 42.04  ? 1905 DG  D "C2'" 1 
ATOM   340  C  "C1'" . DG  B 2 4   ? 36.442 13.763  42.469 1.00 42.50  ? 1905 DG  D "C1'" 1 
ATOM   341  N  N9    . DG  B 2 4   ? 36.518 14.941  41.608 1.00 42.79  ? 1905 DG  D N9    1 
ATOM   342  C  C8    . DG  B 2 4   ? 35.574 15.928  41.441 1.00 43.72  ? 1905 DG  D C8    1 
ATOM   343  N  N7    . DG  B 2 4   ? 35.953 16.862  40.606 1.00 44.51  ? 1905 DG  D N7    1 
ATOM   344  C  C5    . DG  B 2 4   ? 37.221 16.465  40.197 1.00 42.44  ? 1905 DG  D C5    1 
ATOM   345  C  C6    . DG  B 2 4   ? 38.131 17.069  39.292 1.00 42.12  ? 1905 DG  D C6    1 
ATOM   346  O  O6    . DG  B 2 4   ? 38.002 18.109  38.659 1.00 42.88  ? 1905 DG  D O6    1 
ATOM   347  N  N1    . DG  B 2 4   ? 39.296 16.325  39.161 1.00 40.49  ? 1905 DG  D N1    1 
ATOM   348  C  C2    . DG  B 2 4   ? 39.561 15.152  39.818 1.00 40.38  ? 1905 DG  D C2    1 
ATOM   349  N  N2    . DG  B 2 4   ? 40.747 14.581  39.562 1.00 40.47  ? 1905 DG  D N2    1 
ATOM   350  N  N3    . DG  B 2 4   ? 38.727 14.577  40.665 1.00 40.87  ? 1905 DG  D N3    1 
ATOM   351  C  C4    . DG  B 2 4   ? 37.583 15.281  40.804 1.00 42.59  ? 1905 DG  D C4    1 
ATOM   352  P  P     . DT  B 2 5   ? 36.318 11.653  46.326 1.00 46.68  ? 1906 DT  D P     1 
ATOM   353  O  OP1   . DT  B 2 5   ? 36.925 10.339  46.649 1.00 47.32  ? 1906 DT  D OP1   1 
ATOM   354  O  OP2   . DT  B 2 5   ? 34.917 11.937  46.728 1.00 46.89  ? 1906 DT  D OP2   1 
ATOM   355  O  "O5'" . DT  B 2 5   ? 37.243 12.775  46.946 1.00 45.86  ? 1906 DT  D "O5'" 1 
ATOM   356  C  "C5'" . DT  B 2 5   ? 38.643 12.751  46.729 1.00 48.32  ? 1906 DT  D "C5'" 1 
ATOM   357  C  "C4'" . DT  B 2 5   ? 39.209 14.117  47.016 1.00 49.41  ? 1906 DT  D "C4'" 1 
ATOM   358  O  "O4'" . DT  B 2 5   ? 38.713 15.037  46.016 1.00 50.97  ? 1906 DT  D "O4'" 1 
ATOM   359  C  "C3'" . DT  B 2 5   ? 38.745 14.669  48.360 1.00 48.86  ? 1906 DT  D "C3'" 1 
ATOM   360  O  "O3'" . DT  B 2 5   ? 39.765 15.508  48.886 1.00 48.40  ? 1906 DT  D "O3'" 1 
ATOM   361  C  "C2'" . DT  B 2 5   ? 37.522 15.490  47.994 1.00 49.48  ? 1906 DT  D "C2'" 1 
ATOM   362  C  "C1'" . DT  B 2 5   ? 37.894 16.029  46.622 1.00 49.84  ? 1906 DT  D "C1'" 1 
ATOM   363  P  P     . DA  B 2 6   ? 40.579 15.053  50.188 1.00 48.37  ? 1907 DA  D P     1 
ATOM   364  O  OP1   . DA  B 2 6   ? 40.445 13.580  50.397 1.00 45.66  ? 1907 DA  D OP1   1 
ATOM   365  O  OP2   . DA  B 2 6   ? 40.206 15.998  51.275 1.00 44.07  ? 1907 DA  D OP2   1 
ATOM   366  O  "O5'" . DA  B 2 6   ? 42.087 15.349  49.788 1.00 47.24  ? 1907 DA  D "O5'" 1 
ATOM   367  C  "C5'" . DA  B 2 6   ? 42.843 14.417  49.026 1.00 43.05  ? 1907 DA  D "C5'" 1 
ATOM   368  C  "C4'" . DA  B 2 6   ? 44.108 15.082  48.547 1.00 43.49  ? 1907 DA  D "C4'" 1 
ATOM   369  O  "O4'" . DA  B 2 6   ? 43.806 15.922  47.406 1.00 39.45  ? 1907 DA  D "O4'" 1 
ATOM   370  C  "C3'" . DA  B 2 6   ? 44.728 15.997  49.604 1.00 42.93  ? 1907 DA  D "C3'" 1 
ATOM   371  O  "O3'" . DA  B 2 6   ? 46.147 15.857  49.620 1.00 48.63  ? 1907 DA  D "O3'" 1 
ATOM   372  C  "C2'" . DA  B 2 6   ? 44.311 17.393  49.172 1.00 41.57  ? 1907 DA  D "C2'" 1 
ATOM   373  C  "C1'" . DA  B 2 6   ? 44.186 17.266  47.660 1.00 40.45  ? 1907 DA  D "C1'" 1 
ATOM   374  N  N9    . DA  B 2 6   ? 43.167 18.131  47.069 1.00 38.40  ? 1907 DA  D N9    1 
ATOM   375  C  C8    . DA  B 2 6   ? 41.805 18.030  47.214 1.00 39.23  ? 1907 DA  D C8    1 
ATOM   376  N  N7    . DA  B 2 6   ? 41.132 18.955  46.570 1.00 38.41  ? 1907 DA  D N7    1 
ATOM   377  C  C5    . DA  B 2 6   ? 42.115 19.717  45.955 1.00 37.32  ? 1907 DA  D C5    1 
ATOM   378  C  C6    . DA  B 2 6   ? 42.051 20.847  45.123 1.00 37.14  ? 1907 DA  D C6    1 
ATOM   379  N  N6    . DA  B 2 6   ? 40.908 21.438  44.761 1.00 36.70  ? 1907 DA  D N6    1 
ATOM   380  N  N1    . DA  B 2 6   ? 43.215 21.359  44.668 1.00 35.02  ? 1907 DA  D N1    1 
ATOM   381  C  C2    . DA  B 2 6   ? 44.359 20.769  45.035 1.00 36.35  ? 1907 DA  D C2    1 
ATOM   382  N  N3    . DA  B 2 6   ? 44.551 19.707  45.820 1.00 35.85  ? 1907 DA  D N3    1 
ATOM   383  C  C4    . DA  B 2 6   ? 43.374 19.219  46.252 1.00 38.83  ? 1907 DA  D C4    1 
ATOM   384  P  P     . DG  B 2 7   ? 47.010 16.631  50.730 1.00 49.13  ? 1908 DG  D P     1 
ATOM   385  O  OP1   . DG  B 2 7   ? 48.220 15.819  50.981 1.00 53.24  ? 1908 DG  D OP1   1 
ATOM   386  O  OP2   . DG  B 2 7   ? 46.132 17.021  51.858 1.00 51.40  ? 1908 DG  D OP2   1 
ATOM   387  O  "O5'" . DG  B 2 7   ? 47.461 17.951  49.980 1.00 52.90  ? 1908 DG  D "O5'" 1 
ATOM   388  C  "C5'" . DG  B 2 7   ? 48.299 17.862  48.840 1.00 55.59  ? 1908 DG  D "C5'" 1 
ATOM   389  C  "C4'" . DG  B 2 7   ? 48.756 19.238  48.435 1.00 57.87  ? 1908 DG  D "C4'" 1 
ATOM   390  O  "O4'" . DG  B 2 7   ? 47.660 19.962  47.826 1.00 56.04  ? 1908 DG  D "O4'" 1 
ATOM   391  C  "C3'" . DG  B 2 7   ? 49.215 20.082  49.621 1.00 59.75  ? 1908 DG  D "C3'" 1 
ATOM   392  O  "O3'" . DG  B 2 7   ? 50.369 20.831  49.259 1.00 65.13  ? 1908 DG  D "O3'" 1 
ATOM   393  C  "C2'" . DG  B 2 7   ? 48.037 21.006  49.876 1.00 56.87  ? 1908 DG  D "C2'" 1 
ATOM   394  C  "C1'" . DG  B 2 7   ? 47.507 21.212  48.473 1.00 54.46  ? 1908 DG  D "C1'" 1 
ATOM   395  N  N9    . DG  B 2 7   ? 46.101 21.593  48.385 1.00 50.27  ? 1908 DG  D N9    1 
ATOM   396  C  C8    . DG  B 2 7   ? 45.054 21.106  49.127 1.00 49.85  ? 1908 DG  D C8    1 
ATOM   397  N  N7    . DG  B 2 7   ? 43.911 21.656  48.821 1.00 49.27  ? 1908 DG  D N7    1 
ATOM   398  C  C5    . DG  B 2 7   ? 44.223 22.555  47.811 1.00 47.31  ? 1908 DG  D C5    1 
ATOM   399  C  C6    . DG  B 2 7   ? 43.392 23.438  47.082 1.00 46.62  ? 1908 DG  D C6    1 
ATOM   400  O  O6    . DG  B 2 7   ? 42.174 23.602  47.181 1.00 44.87  ? 1908 DG  D O6    1 
ATOM   401  N  N1    . DG  B 2 7   ? 44.121 24.178  46.154 1.00 46.20  ? 1908 DG  D N1    1 
ATOM   402  C  C2    . DG  B 2 7   ? 45.477 24.079  45.952 1.00 47.91  ? 1908 DG  D C2    1 
ATOM   403  N  N2    . DG  B 2 7   ? 46.004 24.888  45.019 1.00 45.67  ? 1908 DG  D N2    1 
ATOM   404  N  N3    . DG  B 2 7   ? 46.262 23.249  46.622 1.00 47.22  ? 1908 DG  D N3    1 
ATOM   405  C  C4    . DG  B 2 7   ? 45.572 22.527  47.531 1.00 48.44  ? 1908 DG  D C4    1 
ATOM   406  P  P     . DT  B 2 8   ? 51.196 21.588  50.397 1.00 69.89  ? 1909 DT  D P     1 
ATOM   407  O  OP1   . DT  B 2 8   ? 52.245 22.378  49.693 1.00 69.39  ? 1909 DT  D OP1   1 
ATOM   408  O  OP2   . DT  B 2 8   ? 51.587 20.604  51.441 1.00 70.52  ? 1909 DT  D OP2   1 
ATOM   409  O  "O5'" . DT  B 2 8   ? 50.109 22.560  51.035 1.00 67.96  ? 1909 DT  D "O5'" 1 
ATOM   410  C  "C5'" . DT  B 2 8   ? 50.356 23.951  51.129 1.00 65.33  ? 1909 DT  D "C5'" 1 
ATOM   411  C  "C4'" . DT  B 2 8   ? 50.698 24.507  49.767 1.00 61.41  ? 1909 DT  D "C4'" 1 
ATOM   412  O  "O4'" . DT  B 2 8   ? 49.566 24.387  48.874 1.00 59.27  ? 1909 DT  D "O4'" 1 
ATOM   413  C  "C3'" . DT  B 2 8   ? 51.048 25.985  49.811 1.00 60.30  ? 1909 DT  D "C3'" 1 
ATOM   414  O  "O3'" . DT  B 2 8   ? 52.116 26.268  48.912 1.00 59.61  ? 1909 DT  D "O3'" 1 
ATOM   415  C  "C2'" . DT  B 2 8   ? 49.752 26.680  49.436 1.00 58.36  ? 1909 DT  D "C2'" 1 
ATOM   416  C  "C1'" . DT  B 2 8   ? 49.014 25.666  48.576 1.00 54.56  ? 1909 DT  D "C1'" 1 
ATOM   417  N  N1    . DT  B 2 8   ? 47.574 25.611  48.892 1.00 50.12  ? 1909 DT  D N1    1 
ATOM   418  C  C2    . DT  B 2 8   ? 46.701 26.329  48.112 1.00 47.17  ? 1909 DT  D C2    1 
ATOM   419  O  O2    . DT  B 2 8   ? 47.061 27.027  47.181 1.00 48.50  ? 1909 DT  D O2    1 
ATOM   420  N  N3    . DT  B 2 8   ? 45.382 26.202  48.465 1.00 44.99  ? 1909 DT  D N3    1 
ATOM   421  C  C4    . DT  B 2 8   ? 44.861 25.450  49.502 1.00 44.77  ? 1909 DT  D C4    1 
ATOM   422  O  O4    . DT  B 2 8   ? 43.648 25.428  49.696 1.00 42.63  ? 1909 DT  D O4    1 
ATOM   423  C  C5    . DT  B 2 8   ? 45.835 24.731  50.288 1.00 46.34  ? 1909 DT  D C5    1 
ATOM   424  C  C7    . DT  B 2 8   ? 45.365 23.894  51.435 1.00 45.79  ? 1909 DT  D C7    1 
ATOM   425  C  C6    . DT  B 2 8   ? 47.126 24.847  49.949 1.00 48.18  ? 1909 DT  D C6    1 
ATOM   426  P  P     . DC  B 2 9   ? 52.915 27.646  49.059 1.00 59.84  ? 1910 DC  D P     1 
ATOM   427  O  OP1   . DC  B 2 9   ? 54.138 27.572  48.224 1.00 61.11  ? 1910 DC  D OP1   1 
ATOM   428  O  OP2   . DC  B 2 9   ? 53.022 27.979  50.503 1.00 57.05  ? 1910 DC  D OP2   1 
ATOM   429  O  "O5'" . DC  B 2 9   ? 51.933 28.688  48.380 1.00 57.86  ? 1910 DC  D "O5'" 1 
ATOM   430  C  "C5'" . DC  B 2 9   ? 51.410 29.760  49.121 1.00 54.77  ? 1910 DC  D "C5'" 1 
ATOM   431  C  "C4'" . DC  B 2 9   ? 50.391 30.496  48.292 1.00 52.99  ? 1910 DC  D "C4'" 1 
ATOM   432  O  "O4'" . DC  B 2 9   ? 49.134 29.774  48.316 1.00 51.98  ? 1910 DC  D "O4'" 1 
ATOM   433  C  "C3'" . DC  B 2 9   ? 50.102 31.879  48.856 1.00 51.18  ? 1910 DC  D "C3'" 1 
ATOM   434  O  "O3'" . DC  B 2 9   ? 50.021 32.830  47.806 1.00 48.44  ? 1910 DC  D "O3'" 1 
ATOM   435  C  "C2'" . DC  B 2 9   ? 48.779 31.723  49.578 1.00 51.39  ? 1910 DC  D "C2'" 1 
ATOM   436  C  "C1'" . DC  B 2 9   ? 48.093 30.610  48.812 1.00 51.25  ? 1910 DC  D "C1'" 1 
ATOM   437  N  N1    . DC  B 2 9   ? 47.226 29.801  49.683 1.00 49.64  ? 1910 DC  D N1    1 
ATOM   438  C  C2    . DC  B 2 9   ? 45.844 29.846  49.489 1.00 49.60  ? 1910 DC  D C2    1 
ATOM   439  O  O2    . DC  B 2 9   ? 45.391 30.545  48.570 1.00 49.35  ? 1910 DC  D O2    1 
ATOM   440  N  N3    . DC  B 2 9   ? 45.038 29.130  50.307 1.00 48.72  ? 1910 DC  D N3    1 
ATOM   441  C  C4    . DC  B 2 9   ? 45.568 28.393  51.287 1.00 48.60  ? 1910 DC  D C4    1 
ATOM   442  N  N4    . DC  B 2 9   ? 44.737 27.712  52.078 1.00 50.07  ? 1910 DC  D N4    1 
ATOM   443  C  C5    . DC  B 2 9   ? 46.973 28.323  51.499 1.00 48.31  ? 1910 DC  D C5    1 
ATOM   444  C  C6    . DC  B 2 9   ? 47.758 29.032  50.680 1.00 48.69  ? 1910 DC  D C6    1 
ATOM   445  P  P     . DC  B 2 10  ? 50.172 34.379  48.155 1.00 46.91  ? 1911 DC  D P     1 
ATOM   446  O  OP1   . DC  B 2 10  ? 50.762 35.065  46.979 1.00 46.69  ? 1911 DC  D OP1   1 
ATOM   447  O  OP2   . DC  B 2 10  ? 50.836 34.482  49.479 1.00 42.94  ? 1911 DC  D OP2   1 
ATOM   448  O  "O5'" . DC  B 2 10  ? 48.663 34.838  48.309 1.00 49.06  ? 1911 DC  D "O5'" 1 
ATOM   449  C  "C5'" . DC  B 2 10  ? 47.776 34.763  47.207 1.00 52.35  ? 1911 DC  D "C5'" 1 
ATOM   450  C  "C4'" . DC  B 2 10  ? 46.441 35.334  47.606 1.00 56.57  ? 1911 DC  D "C4'" 1 
ATOM   451  O  "O4'" . DC  B 2 10  ? 45.687 34.357  48.366 1.00 57.73  ? 1911 DC  D "O4'" 1 
ATOM   452  C  "C3'" . DC  B 2 10  ? 46.585 36.558  48.508 1.00 57.72  ? 1911 DC  D "C3'" 1 
ATOM   453  O  "O3'" . DC  B 2 10  ? 45.605 37.528  48.151 1.00 61.60  ? 1911 DC  D "O3'" 1 
ATOM   454  C  "C2'" . DC  B 2 10  ? 46.324 36.003  49.898 1.00 57.14  ? 1911 DC  D "C2'" 1 
ATOM   455  C  "C1'" . DC  B 2 10  ? 45.305 34.915  49.612 1.00 56.27  ? 1911 DC  D "C1'" 1 
ATOM   456  N  N1    . DC  B 2 10  ? 45.233 33.823  50.600 1.00 55.25  ? 1911 DC  D N1    1 
ATOM   457  C  C2    . DC  B 2 10  ? 43.973 33.361  50.987 1.00 54.09  ? 1911 DC  D C2    1 
ATOM   458  O  O2    . DC  B 2 10  ? 42.968 33.870  50.472 1.00 52.70  ? 1911 DC  D O2    1 
ATOM   459  N  N3    . DC  B 2 10  ? 43.882 32.375  51.906 1.00 52.32  ? 1911 DC  D N3    1 
ATOM   460  C  C4    . DC  B 2 10  ? 44.989 31.848  52.429 1.00 53.11  ? 1911 DC  D C4    1 
ATOM   461  N  N4    . DC  B 2 10  ? 44.850 30.886  53.338 1.00 52.39  ? 1911 DC  D N4    1 
ATOM   462  C  C5    . DC  B 2 10  ? 46.289 32.289  52.044 1.00 53.74  ? 1911 DC  D C5    1 
ATOM   463  C  C6    . DC  B 2 10  ? 46.364 33.271  51.134 1.00 54.50  ? 1911 DC  D C6    1 
ATOM   464  P  P     . DT  B 2 11  ? 45.748 39.039  48.677 1.00 64.66  ? 1912 DT  D P     1 
ATOM   465  O  OP1   . DT  B 2 11  ? 45.829 39.931  47.491 1.00 64.94  ? 1912 DT  D OP1   1 
ATOM   466  O  OP2   . DT  B 2 11  ? 46.811 39.093  49.718 1.00 64.03  ? 1912 DT  D OP2   1 
ATOM   467  O  "O5'" . DT  B 2 11  ? 44.354 39.283  49.389 1.00 63.02  ? 1912 DT  D "O5'" 1 
ATOM   468  C  "C5'" . DT  B 2 11  ? 43.167 38.760  48.817 1.00 65.00  ? 1912 DT  D "C5'" 1 
ATOM   469  C  "C4'" . DT  B 2 11  ? 42.102 38.646  49.876 1.00 66.21  ? 1912 DT  D "C4'" 1 
ATOM   470  O  "O4'" . DT  B 2 11  ? 42.278 37.446  50.670 1.00 65.10  ? 1912 DT  D "O4'" 1 
ATOM   471  C  "C3'" . DT  B 2 11  ? 42.124 39.819  50.852 1.00 67.04  ? 1912 DT  D "C3'" 1 
ATOM   472  O  "O3'" . DT  B 2 11  ? 40.798 40.288  51.052 1.00 70.66  ? 1912 DT  D "O3'" 1 
ATOM   473  C  "C2'" . DT  B 2 11  ? 42.696 39.220  52.128 1.00 65.39  ? 1912 DT  D "C2'" 1 
ATOM   474  C  "C1'" . DT  B 2 11  ? 42.226 37.779  52.045 1.00 64.42  ? 1912 DT  D "C1'" 1 
ATOM   475  N  N1    . DT  B 2 11  ? 43.045 36.797  52.784 1.00 62.73  ? 1912 DT  D N1    1 
ATOM   476  C  C2    . DT  B 2 11  ? 42.384 35.846  53.529 1.00 62.78  ? 1912 DT  D C2    1 
ATOM   477  O  O2    . DT  B 2 11  ? 41.167 35.781  53.598 1.00 63.14  ? 1912 DT  D O2    1 
ATOM   478  N  N3    . DT  B 2 11  ? 43.202 34.968  54.194 1.00 62.30  ? 1912 DT  D N3    1 
ATOM   479  C  C4    . DT  B 2 11  ? 44.582 34.944  54.186 1.00 62.44  ? 1912 DT  D C4    1 
ATOM   480  O  O4    . DT  B 2 11  ? 45.182 34.096  54.841 1.00 61.50  ? 1912 DT  D O4    1 
ATOM   481  C  C5    . DT  B 2 11  ? 45.210 35.966  53.377 1.00 62.71  ? 1912 DT  D C5    1 
ATOM   482  C  C7    . DT  B 2 11  ? 46.703 36.015  53.302 1.00 62.54  ? 1912 DT  D C7    1 
ATOM   483  C  C6    . DT  B 2 11  ? 44.421 36.829  52.725 1.00 62.05  ? 1912 DT  D C6    1 
ATOM   484  P  P     . DT  B 2 12  ? 40.551 41.827  51.430 1.00 71.64  ? 1913 DT  D P     1 
ATOM   485  O  OP1   . DT  B 2 12  ? 39.640 42.394  50.398 1.00 71.95  ? 1913 DT  D OP1   1 
ATOM   486  O  OP2   . DT  B 2 12  ? 41.865 42.473  51.689 1.00 71.60  ? 1913 DT  D OP2   1 
ATOM   487  O  "O5'" . DT  B 2 12  ? 39.762 41.707  52.803 1.00 71.40  ? 1913 DT  D "O5'" 1 
ATOM   488  C  "C5'" . DT  B 2 12  ? 38.675 40.797  52.922 1.00 70.14  ? 1913 DT  D "C5'" 1 
ATOM   489  C  "C4'" . DT  B 2 12  ? 38.543 40.330  54.350 1.00 69.25  ? 1913 DT  D "C4'" 1 
ATOM   490  O  "O4'" . DT  B 2 12  ? 39.452 39.246  54.670 1.00 67.90  ? 1913 DT  D "O4'" 1 
ATOM   491  C  "C3'" . DT  B 2 12  ? 38.787 41.413  55.402 1.00 68.91  ? 1913 DT  D "C3'" 1 
ATOM   492  O  "O3'" . DT  B 2 12  ? 37.865 41.168  56.451 1.00 71.33  ? 1913 DT  D "O3'" 1 
ATOM   493  C  "C2'" . DT  B 2 12  ? 40.164 41.050  55.933 1.00 67.85  ? 1913 DT  D "C2'" 1 
ATOM   494  C  "C1'" . DT  B 2 12  ? 40.025 39.541  55.931 1.00 66.72  ? 1913 DT  D "C1'" 1 
ATOM   495  N  N1    . DT  B 2 12  ? 41.252 38.737  56.104 1.00 64.91  ? 1913 DT  D N1    1 
ATOM   496  C  C2    . DT  B 2 12  ? 41.144 37.565  56.834 1.00 64.21  ? 1913 DT  D C2    1 
ATOM   497  O  O2    . DT  B 2 12  ? 40.093 37.172  57.321 1.00 61.52  ? 1913 DT  D O2    1 
ATOM   498  N  N3    . DT  B 2 12  ? 42.318 36.870  56.977 1.00 62.00  ? 1913 DT  D N3    1 
ATOM   499  C  C4    . DT  B 2 12  ? 43.557 37.217  56.485 1.00 62.38  ? 1913 DT  D C4    1 
ATOM   500  O  O4    . DT  B 2 12  ? 44.522 36.494  56.706 1.00 63.74  ? 1913 DT  D O4    1 
ATOM   501  C  C5    . DT  B 2 12  ? 43.599 38.453  55.729 1.00 63.08  ? 1913 DT  D C5    1 
ATOM   502  C  C7    . DT  B 2 12  ? 44.907 38.914  55.168 1.00 63.19  ? 1913 DT  D C7    1 
ATOM   503  C  C6    . DT  B 2 12  ? 42.458 39.138  55.571 1.00 63.36  ? 1913 DT  D C6    1 
ATOM   504  P  P     . DC  B 2 13  ? 36.787 42.279  56.874 1.00 71.62  ? 1914 DC  D P     1 
ATOM   505  O  OP1   . DC  B 2 13  ? 35.762 42.373  55.809 1.00 71.48  ? 1914 DC  D OP1   1 
ATOM   506  O  OP2   . DC  B 2 13  ? 37.516 43.504  57.311 1.00 71.14  ? 1914 DC  D OP2   1 
ATOM   507  O  "O5'" . DC  B 2 13  ? 36.140 41.582  58.153 1.00 70.87  ? 1914 DC  D "O5'" 1 
ATOM   508  C  "C5'" . DC  B 2 13  ? 36.652 40.322  58.609 1.00 68.25  ? 1914 DC  D "C5'" 1 
ATOM   509  C  "C4'" . DC  B 2 13  ? 37.005 40.393  60.077 1.00 66.75  ? 1914 DC  D "C4'" 1 
ATOM   510  O  "O4'" . DC  B 2 13  ? 38.127 39.490  60.265 1.00 65.43  ? 1914 DC  D "O4'" 1 
ATOM   511  C  "C3'" . DC  B 2 13  ? 37.482 41.768  60.559 1.00 66.54  ? 1914 DC  D "C3'" 1 
ATOM   512  O  "O3'" . DC  B 2 13  ? 36.726 42.269  61.671 1.00 69.06  ? 1914 DC  D "O3'" 1 
ATOM   513  C  "C2'" . DC  B 2 13  ? 38.974 41.629  60.810 1.00 64.92  ? 1914 DC  D "C2'" 1 
ATOM   514  C  "C1'" . DC  B 2 13  ? 39.212 40.133  60.917 1.00 64.17  ? 1914 DC  D "C1'" 1 
ATOM   515  N  N1    . DC  B 2 13  ? 40.480 39.672  60.302 1.00 62.36  ? 1914 DC  D N1    1 
ATOM   516  C  C2    . DC  B 2 13  ? 41.045 38.467  60.735 1.00 61.23  ? 1914 DC  D C2    1 
ATOM   517  O  O2    . DC  B 2 13  ? 40.414 37.759  61.530 1.00 61.44  ? 1914 DC  D O2    1 
ATOM   518  N  N3    . DC  B 2 13  ? 42.264 38.101  60.272 1.00 60.21  ? 1914 DC  D N3    1 
ATOM   519  C  C4    . DC  B 2 13  ? 42.906 38.875  59.397 1.00 59.87  ? 1914 DC  D C4    1 
ATOM   520  N  N4    . DC  B 2 13  ? 44.130 38.502  59.013 1.00 59.60  ? 1914 DC  D N4    1 
ATOM   521  C  C5    . DC  B 2 13  ? 42.329 40.073  58.888 1.00 60.35  ? 1914 DC  D C5    1 
ATOM   522  C  C6    . DC  B 2 13  ? 41.124 40.429  59.359 1.00 61.93  ? 1914 DC  D C6    1 
ATOM   523  P  P     . DC  B 2 14  ? 36.503 41.369  62.981 1.00 67.35  ? 1915 DC  D P     1 
ATOM   524  O  OP1   . DC  B 2 14  ? 35.465 40.366  62.641 1.00 68.67  ? 1915 DC  D OP1   1 
ATOM   525  O  OP2   . DC  B 2 14  ? 36.293 42.266  64.138 1.00 67.79  ? 1915 DC  D OP2   1 
ATOM   526  O  "O5'" . DC  B 2 14  ? 37.878 40.601  63.194 1.00 68.19  ? 1915 DC  D "O5'" 1 
ATOM   527  C  "C5'" . DC  B 2 14  ? 37.865 39.265  63.675 1.00 65.05  ? 1915 DC  D "C5'" 1 
ATOM   528  C  "C4'" . DC  B 2 14  ? 38.932 39.070  64.724 1.00 61.09  ? 1915 DC  D "C4'" 1 
ATOM   529  O  "O4'" . DC  B 2 14  ? 40.198 38.750  64.102 1.00 58.22  ? 1915 DC  D "O4'" 1 
ATOM   530  C  "C3'" . DC  B 2 14  ? 39.183 40.259  65.656 1.00 58.91  ? 1915 DC  D "C3'" 1 
ATOM   531  O  "O3'" . DC  B 2 14  ? 39.266 39.769  66.994 1.00 57.58  ? 1915 DC  D "O3'" 1 
ATOM   532  C  "C2'" . DC  B 2 14  ? 40.532 40.778  65.189 1.00 58.43  ? 1915 DC  D "C2'" 1 
ATOM   533  C  "C1'" . DC  B 2 14  ? 41.205 39.494  64.742 1.00 56.45  ? 1915 DC  D "C1'" 1 
ATOM   534  N  N1    . DC  B 2 14  ? 42.335 39.633  63.826 1.00 53.47  ? 1915 DC  D N1    1 
ATOM   535  C  C2    . DC  B 2 14  ? 43.398 38.730  63.931 1.00 52.76  ? 1915 DC  D C2    1 
ATOM   536  O  O2    . DC  B 2 14  ? 43.324 37.804  64.752 1.00 52.04  ? 1915 DC  D O2    1 
ATOM   537  N  N3    . DC  B 2 14  ? 44.475 38.886  63.134 1.00 51.81  ? 1915 DC  D N3    1 
ATOM   538  C  C4    . DC  B 2 14  ? 44.508 39.884  62.250 1.00 52.35  ? 1915 DC  D C4    1 
ATOM   539  N  N4    . DC  B 2 14  ? 45.598 40.013  61.495 1.00 52.42  ? 1915 DC  D N4    1 
ATOM   540  C  C5    . DC  B 2 14  ? 43.424 40.799  62.104 1.00 52.53  ? 1915 DC  D C5    1 
ATOM   541  C  C6    . DC  B 2 14  ? 42.367 40.635  62.903 1.00 51.91  ? 1915 DC  D C6    1 
ATOM   542  P  P     . DC  B 2 15  ? 39.552 40.772  68.216 1.00 58.44  ? 1916 DC  D P     1 
ATOM   543  O  OP1   . DC  B 2 15  ? 38.321 40.887  69.034 1.00 56.24  ? 1916 DC  D OP1   1 
ATOM   544  O  OP2   . DC  B 2 15  ? 40.202 42.001  67.693 1.00 60.17  ? 1916 DC  D OP2   1 
ATOM   545  O  "O5'" . DC  B 2 15  ? 40.617 39.960  69.081 1.00 57.08  ? 1916 DC  D "O5'" 1 
ATOM   546  C  "C5'" . DC  B 2 15  ? 40.421 38.568  69.349 1.00 53.39  ? 1916 DC  D "C5'" 1 
ATOM   547  C  "C4'" . DC  B 2 15  ? 41.669 37.972  69.953 1.00 51.13  ? 1916 DC  D "C4'" 1 
ATOM   548  O  "O4'" . DC  B 2 15  ? 42.724 37.902  68.962 1.00 50.62  ? 1916 DC  D "O4'" 1 
ATOM   549  C  "C3'" . DC  B 2 15  ? 42.223 38.799  71.110 1.00 50.84  ? 1916 DC  D "C3'" 1 
ATOM   550  O  "O3'" . DC  B 2 15  ? 42.650 37.951  72.171 1.00 52.38  ? 1916 DC  D "O3'" 1 
ATOM   551  C  "C2'" . DC  B 2 15  ? 43.398 39.538  70.497 1.00 50.17  ? 1916 DC  D "C2'" 1 
ATOM   552  C  "C1'" . DC  B 2 15  ? 43.884 38.571  69.437 1.00 48.49  ? 1916 DC  D "C1'" 1 
ATOM   553  N  N1    . DC  B 2 15  ? 44.531 39.227  68.291 1.00 47.33  ? 1916 DC  D N1    1 
ATOM   554  C  C2    . DC  B 2 15  ? 45.868 38.944  68.024 1.00 48.03  ? 1916 DC  D C2    1 
ATOM   555  O  O2    . DC  B 2 15  ? 46.464 38.141  68.753 1.00 50.19  ? 1916 DC  D O2    1 
ATOM   556  N  N3    . DC  B 2 15  ? 46.481 39.550  66.981 1.00 47.81  ? 1916 DC  D N3    1 
ATOM   557  C  C4    . DC  B 2 15  ? 45.802 40.410  66.220 1.00 46.02  ? 1916 DC  D C4    1 
ATOM   558  N  N4    . DC  B 2 15  ? 46.451 40.998  65.208 1.00 42.58  ? 1916 DC  D N4    1 
ATOM   559  C  C5    . DC  B 2 15  ? 44.432 40.711  66.464 1.00 45.72  ? 1916 DC  D C5    1 
ATOM   560  C  C6    . DC  B 2 15  ? 43.842 40.103  67.501 1.00 46.80  ? 1916 DC  D C6    1 
ATOM   561  P  P     . DC  B 2 16  ? 43.221 38.604  73.521 1.00 53.04  ? 1917 DC  D P     1 
ATOM   562  O  OP1   . DC  B 2 16  ? 43.233 37.553  74.575 1.00 53.48  ? 1917 DC  D OP1   1 
ATOM   563  O  OP2   . DC  B 2 16  ? 42.483 39.874  73.755 1.00 52.52  ? 1917 DC  D OP2   1 
ATOM   564  O  "O5'" . DC  B 2 16  ? 44.725 38.958  73.134 1.00 53.82  ? 1917 DC  D "O5'" 1 
ATOM   565  C  "C5'" . DC  B 2 16  ? 45.641 37.922  72.778 1.00 52.22  ? 1917 DC  D "C5'" 1 
ATOM   566  C  "C4'" . DC  B 2 16  ? 47.039 38.477  72.652 1.00 52.87  ? 1917 DC  D "C4'" 1 
ATOM   567  O  "O4'" . DC  B 2 16  ? 47.266 39.078  71.354 1.00 52.50  ? 1917 DC  D "O4'" 1 
ATOM   568  C  "C3'" . DC  B 2 16  ? 47.397 39.545  73.686 1.00 52.88  ? 1917 DC  D "C3'" 1 
ATOM   569  O  "O3'" . DC  B 2 16  ? 48.735 39.336  74.108 1.00 53.85  ? 1917 DC  D "O3'" 1 
ATOM   570  C  "C2'" . DC  B 2 16  ? 47.344 40.832  72.882 1.00 52.41  ? 1917 DC  D "C2'" 1 
ATOM   571  C  "C1'" . DC  B 2 16  ? 47.869 40.348  71.545 1.00 51.76  ? 1917 DC  D "C1'" 1 
ATOM   572  N  N1    . DC  B 2 16  ? 47.559 41.194  70.377 1.00 50.71  ? 1917 DC  D N1    1 
ATOM   573  C  C2    . DC  B 2 16  ? 48.523 41.315  69.373 1.00 50.48  ? 1917 DC  D C2    1 
ATOM   574  O  O2    . DC  B 2 16  ? 49.599 40.717  69.504 1.00 50.18  ? 1917 DC  D O2    1 
ATOM   575  N  N3    . DC  B 2 16  ? 48.262 42.083  68.289 1.00 50.77  ? 1917 DC  D N3    1 
ATOM   576  C  C4    . DC  B 2 16  ? 47.095 42.722  68.192 1.00 49.10  ? 1917 DC  D C4    1 
ATOM   577  N  N4    . DC  B 2 16  ? 46.885 43.474  67.107 1.00 49.56  ? 1917 DC  D N4    1 
ATOM   578  C  C5    . DC  B 2 16  ? 46.093 42.620  69.202 1.00 49.35  ? 1917 DC  D C5    1 
ATOM   579  C  C6    . DC  B 2 16  ? 46.363 41.850  70.267 1.00 49.51  ? 1917 DC  D C6    1 
ATOM   580  P  P     . DC  B 2 17  ? 49.095 39.368  75.668 1.00 54.62  ? 1918 DC  D P     1 
ATOM   581  O  OP1   . DC  B 2 17  ? 49.079 37.964  76.144 1.00 54.58  ? 1918 DC  D OP1   1 
ATOM   582  O  OP2   . DC  B 2 17  ? 48.237 40.381  76.334 1.00 51.01  ? 1918 DC  D OP2   1 
ATOM   583  O  "O5'" . DC  B 2 17  ? 50.612 39.857  75.659 1.00 52.46  ? 1918 DC  D "O5'" 1 
ATOM   584  C  "C5'" . DC  B 2 17  ? 51.617 39.040  75.060 1.00 52.98  ? 1918 DC  D "C5'" 1 
ATOM   585  C  "C4'" . DC  B 2 17  ? 52.705 39.885  74.431 1.00 52.57  ? 1918 DC  D "C4'" 1 
ATOM   586  O  "O4'" . DC  B 2 17  ? 52.256 40.519  73.204 1.00 49.82  ? 1918 DC  D "O4'" 1 
ATOM   587  C  "C3'" . DC  B 2 17  ? 53.287 40.998  75.306 1.00 53.56  ? 1918 DC  D "C3'" 1 
ATOM   588  O  "O3'" . DC  B 2 17  ? 54.708 41.028  75.116 1.00 57.06  ? 1918 DC  D "O3'" 1 
ATOM   589  C  "C2'" . DC  B 2 17  ? 52.718 42.263  74.683 1.00 51.52  ? 1918 DC  D "C2'" 1 
ATOM   590  C  "C1'" . DC  B 2 17  ? 52.664 41.878  73.211 1.00 48.54  ? 1918 DC  D "C1'" 1 
ATOM   591  N  N1    . DC  B 2 17  ? 51.712 42.655  72.395 1.00 44.49  ? 1918 DC  D N1    1 
ATOM   592  C  C2    . DC  B 2 17  ? 52.062 42.984  71.074 1.00 43.49  ? 1918 DC  D C2    1 
ATOM   593  O  O2    . DC  B 2 17  ? 53.145 42.583  70.618 1.00 41.62  ? 1918 DC  D O2    1 
ATOM   594  N  N3    . DC  B 2 17  ? 51.207 43.730  70.331 1.00 42.51  ? 1918 DC  D N3    1 
ATOM   595  C  C4    . DC  B 2 17  ? 50.046 44.141  70.857 1.00 41.87  ? 1918 DC  D C4    1 
ATOM   596  N  N4    . DC  B 2 17  ? 49.242 44.885  70.097 1.00 38.59  ? 1918 DC  D N4    1 
ATOM   597  C  C5    . DC  B 2 17  ? 49.662 43.806  72.189 1.00 41.79  ? 1918 DC  D C5    1 
ATOM   598  C  C6    . DC  B 2 17  ? 50.515 43.066  72.914 1.00 43.02  ? 1918 DC  D C6    1 
ATOM   599  O  "O5'" . DG  C 1 1   ? 40.975 100.513 46.091 1.00 44.10  ? 1801 DG  E "O5'" 1 
ATOM   600  C  "C5'" . DG  C 1 1   ? 42.041 99.944  45.338 1.00 40.44  ? 1801 DG  E "C5'" 1 
ATOM   601  C  "C4'" . DG  C 1 1   ? 41.578 98.665  44.682 1.00 39.88  ? 1801 DG  E "C4'" 1 
ATOM   602  O  "O4'" . DG  C 1 1   ? 42.390 98.404  43.515 1.00 38.74  ? 1801 DG  E "O4'" 1 
ATOM   603  C  "C3'" . DG  C 1 1   ? 41.660 97.411  45.552 1.00 38.84  ? 1801 DG  E "C3'" 1 
ATOM   604  O  "O3'" . DG  C 1 1   ? 40.501 96.597  45.331 1.00 40.63  ? 1801 DG  E "O3'" 1 
ATOM   605  C  "C2'" . DG  C 1 1   ? 42.922 96.719  45.059 1.00 38.00  ? 1801 DG  E "C2'" 1 
ATOM   606  C  "C1'" . DG  C 1 1   ? 42.962 97.110  43.587 1.00 37.76  ? 1801 DG  E "C1'" 1 
ATOM   607  N  N9    . DG  C 1 1   ? 44.292 97.195  42.994 1.00 34.70  ? 1801 DG  E N9    1 
ATOM   608  C  C8    . DG  C 1 1   ? 45.345 97.954  43.444 1.00 34.67  ? 1801 DG  E C8    1 
ATOM   609  N  N7    . DG  C 1 1   ? 46.403 97.865  42.682 1.00 35.43  ? 1801 DG  E N7    1 
ATOM   610  C  C5    . DG  C 1 1   ? 46.027 96.989  41.673 1.00 33.45  ? 1801 DG  E C5    1 
ATOM   611  C  C6    . DG  C 1 1   ? 46.755 96.514  40.541 1.00 32.15  ? 1801 DG  E C6    1 
ATOM   612  O  O6    . DG  C 1 1   ? 47.902 96.807  40.178 1.00 33.59  ? 1801 DG  E O6    1 
ATOM   613  N  N1    . DG  C 1 1   ? 46.004 95.621  39.788 1.00 30.37  ? 1801 DG  E N1    1 
ATOM   614  C  C2    . DG  C 1 1   ? 44.716 95.249  40.065 1.00 32.80  ? 1801 DG  E C2    1 
ATOM   615  N  N2    . DG  C 1 1   ? 44.169 94.382  39.206 1.00 32.26  ? 1801 DG  E N2    1 
ATOM   616  N  N3    . DG  C 1 1   ? 44.016 95.697  41.103 1.00 33.98  ? 1801 DG  E N3    1 
ATOM   617  C  C4    . DG  C 1 1   ? 44.731 96.555  41.860 1.00 32.30  ? 1801 DG  E C4    1 
ATOM   618  P  P     . DG  C 1 2   ? 40.135 95.428  46.374 1.00 42.31  ? 1802 DG  E P     1 
ATOM   619  O  OP1   . DG  C 1 2   ? 38.657 95.288  46.417 1.00 42.33  ? 1802 DG  E OP1   1 
ATOM   620  O  OP2   . DG  C 1 2   ? 40.883 95.720  47.630 1.00 41.01  ? 1802 DG  E OP2   1 
ATOM   621  O  "O5'" . DG  C 1 2   ? 40.738 94.136  45.677 1.00 39.16  ? 1802 DG  E "O5'" 1 
ATOM   622  C  "C5'" . DG  C 1 2   ? 40.257 93.727  44.404 1.00 40.08  ? 1802 DG  E "C5'" 1 
ATOM   623  C  "C4'" . DG  C 1 2   ? 41.170 92.681  43.812 1.00 42.55  ? 1802 DG  E "C4'" 1 
ATOM   624  O  "O4'" . DG  C 1 2   ? 42.428 93.264  43.379 1.00 42.23  ? 1802 DG  E "O4'" 1 
ATOM   625  C  "C3'" . DG  C 1 2   ? 41.540 91.530  44.754 1.00 43.12  ? 1802 DG  E "C3'" 1 
ATOM   626  O  "O3'" . DG  C 1 2   ? 41.570 90.321  43.995 1.00 47.72  ? 1802 DG  E "O3'" 1 
ATOM   627  C  "C2'" . DG  C 1 2   ? 42.971 91.861  45.141 1.00 43.61  ? 1802 DG  E "C2'" 1 
ATOM   628  C  "C1'" . DG  C 1 2   ? 43.467 92.410  43.820 1.00 40.13  ? 1802 DG  E "C1'" 1 
ATOM   629  N  N9    . DG  C 1 2   ? 44.728 93.148  43.828 1.00 38.27  ? 1802 DG  E N9    1 
ATOM   630  C  C8    . DG  C 1 2   ? 45.213 93.993  44.796 1.00 35.56  ? 1802 DG  E C8    1 
ATOM   631  N  N7    . DG  C 1 2   ? 46.400 94.462  44.519 1.00 34.14  ? 1802 DG  E N7    1 
ATOM   632  C  C5    . DG  C 1 2   ? 46.713 93.900  43.288 1.00 34.42  ? 1802 DG  E C5    1 
ATOM   633  C  C6    . DG  C 1 2   ? 47.878 94.033  42.476 1.00 32.48  ? 1802 DG  E C6    1 
ATOM   634  O  O6    . DG  C 1 2   ? 48.899 94.690  42.693 1.00 33.68  ? 1802 DG  E O6    1 
ATOM   635  N  N1    . DG  C 1 2   ? 47.769 93.296  41.304 1.00 31.84  ? 1802 DG  E N1    1 
ATOM   636  C  C2    . DG  C 1 2   ? 46.685 92.531  40.951 1.00 32.98  ? 1802 DG  E C2    1 
ATOM   637  N  N2    . DG  C 1 2   ? 46.749 91.908  39.769 1.00 31.09  ? 1802 DG  E N2    1 
ATOM   638  N  N3    . DG  C 1 2   ? 45.608 92.390  41.698 1.00 35.59  ? 1802 DG  E N3    1 
ATOM   639  C  C4    . DG  C 1 2   ? 45.689 93.098  42.844 1.00 34.91  ? 1802 DG  E C4    1 
ATOM   640  P  P     . DG  C 1 3   ? 40.894 88.989  44.578 1.00 49.07  ? 1803 DG  E P     1 
ATOM   641  O  OP1   . DG  C 1 3   ? 39.420 89.140  44.460 1.00 49.10  ? 1803 DG  E OP1   1 
ATOM   642  O  OP2   . DG  C 1 3   ? 41.503 88.713  45.908 1.00 48.01  ? 1803 DG  E OP2   1 
ATOM   643  O  "O5'" . DG  C 1 3   ? 41.377 87.878  43.547 1.00 48.02  ? 1803 DG  E "O5'" 1 
ATOM   644  C  "C5'" . DG  C 1 3   ? 41.067 87.992  42.161 1.00 47.14  ? 1803 DG  E "C5'" 1 
ATOM   645  C  "C4'" . DG  C 1 3   ? 42.152 87.351  41.329 1.00 47.19  ? 1803 DG  E "C4'" 1 
ATOM   646  O  "O4'" . DG  C 1 3   ? 43.323 88.202  41.282 1.00 45.64  ? 1803 DG  E "O4'" 1 
ATOM   647  C  "C3'" . DG  C 1 3   ? 42.626 85.995  41.852 1.00 49.06  ? 1803 DG  E "C3'" 1 
ATOM   648  O  "O3'" . DG  C 1 3   ? 42.821 85.088  40.763 1.00 51.06  ? 1803 DG  E "O3'" 1 
ATOM   649  C  "C2'" . DG  C 1 3   ? 43.944 86.318  42.536 1.00 46.79  ? 1803 DG  E "C2'" 1 
ATOM   650  C  "C1'" . DG  C 1 3   ? 44.469 87.477  41.705 1.00 45.64  ? 1803 DG  E "C1'" 1 
ATOM   651  N  N9    . DG  C 1 3   ? 45.329 88.401  42.437 1.00 43.86  ? 1803 DG  E N9    1 
ATOM   652  C  C8    . DG  C 1 3   ? 45.017 89.095  43.583 1.00 42.59  ? 1803 DG  E C8    1 
ATOM   653  N  N7    . DG  C 1 3   ? 45.985 89.872  43.991 1.00 40.01  ? 1803 DG  E N7    1 
ATOM   654  C  C5    . DG  C 1 3   ? 46.998 89.675  43.062 1.00 40.08  ? 1803 DG  E C5    1 
ATOM   655  C  C6    . DG  C 1 3   ? 48.292 90.254  42.976 1.00 38.12  ? 1803 DG  E C6    1 
ATOM   656  O  O6    . DG  C 1 3   ? 48.816 91.080  43.729 1.00 36.22  ? 1803 DG  E O6    1 
ATOM   657  N  N1    . DG  C 1 3   ? 48.996 89.773  41.879 1.00 38.11  ? 1803 DG  E N1    1 
ATOM   658  C  C2    . DG  C 1 3   ? 48.520 88.850  40.980 1.00 40.18  ? 1803 DG  E C2    1 
ATOM   659  N  N2    . DG  C 1 3   ? 49.356 88.500  39.994 1.00 37.61  ? 1803 DG  E N2    1 
ATOM   660  N  N3    . DG  C 1 3   ? 47.312 88.306  41.044 1.00 41.10  ? 1803 DG  E N3    1 
ATOM   661  C  C4    . DG  C 1 3   ? 46.612 88.762  42.102 1.00 41.74  ? 1803 DG  E C4    1 
ATOM   662  P  P     . DG  C 1 4   ? 43.094 83.535  41.063 1.00 51.79  ? 1804 DG  E P     1 
ATOM   663  O  OP1   . DG  C 1 4   ? 42.717 82.764  39.847 1.00 50.55  ? 1804 DG  E OP1   1 
ATOM   664  O  OP2   . DG  C 1 4   ? 42.484 83.198  42.382 1.00 50.06  ? 1804 DG  E OP2   1 
ATOM   665  O  "O5'" . DG  C 1 4   ? 44.673 83.469  41.215 1.00 51.56  ? 1804 DG  E "O5'" 1 
ATOM   666  C  "C5'" . DG  C 1 4   ? 45.504 83.745  40.097 1.00 53.38  ? 1804 DG  E "C5'" 1 
ATOM   667  C  "C4'" . DG  C 1 4   ? 46.950 83.548  40.471 1.00 52.76  ? 1804 DG  E "C4'" 1 
ATOM   668  O  "O4'" . DG  C 1 4   ? 47.457 84.695  41.192 1.00 52.35  ? 1804 DG  E "O4'" 1 
ATOM   669  C  "C3'" . DG  C 1 4   ? 47.173 82.343  41.379 1.00 53.60  ? 1804 DG  E "C3'" 1 
ATOM   670  O  "O3'" . DG  C 1 4   ? 48.354 81.668  40.976 1.00 54.76  ? 1804 DG  E "O3'" 1 
ATOM   671  C  "C2'" . DG  C 1 4   ? 47.383 82.968  42.746 1.00 51.99  ? 1804 DG  E "C2'" 1 
ATOM   672  C  "C1'" . DG  C 1 4   ? 48.102 84.244  42.366 1.00 50.25  ? 1804 DG  E "C1'" 1 
ATOM   673  N  N9    . DG  C 1 4   ? 48.043 85.312  43.356 1.00 46.45  ? 1804 DG  E N9    1 
ATOM   674  C  C8    . DG  C 1 4   ? 47.019 85.590  44.227 1.00 46.63  ? 1804 DG  E C8    1 
ATOM   675  N  N7    . DG  C 1 4   ? 47.276 86.600  45.013 1.00 45.81  ? 1804 DG  E N7    1 
ATOM   676  C  C5    . DG  C 1 4   ? 48.545 87.016  44.630 1.00 43.11  ? 1804 DG  E C5    1 
ATOM   677  C  C6    . DG  C 1 4   ? 49.355 88.071  45.123 1.00 39.88  ? 1804 DG  E C6    1 
ATOM   678  O  O6    . DG  C 1 4   ? 49.104 88.875  46.029 1.00 36.73  ? 1804 DG  E O6    1 
ATOM   679  N  N1    . DG  C 1 4   ? 50.569 88.142  44.448 1.00 38.71  ? 1804 DG  E N1    1 
ATOM   680  C  C2    . DG  C 1 4   ? 50.957 87.308  43.431 1.00 38.75  ? 1804 DG  E C2    1 
ATOM   681  N  N2    . DG  C 1 4   ? 52.174 87.530  42.912 1.00 38.15  ? 1804 DG  E N2    1 
ATOM   682  N  N3    . DG  C 1 4   ? 50.210 86.325  42.958 1.00 41.70  ? 1804 DG  E N3    1 
ATOM   683  C  C4    . DG  C 1 4   ? 49.027 86.236  43.603 1.00 43.99  ? 1804 DG  E C4    1 
ATOM   684  P  P     . DG  C 1 5   ? 48.645 80.195  41.524 1.00 56.55  ? 1805 DG  E P     1 
ATOM   685  O  OP1   . DG  C 1 5   ? 48.443 79.249  40.397 1.00 56.48  ? 1805 DG  E OP1   1 
ATOM   686  O  OP2   . DG  C 1 5   ? 47.899 80.002  42.799 1.00 54.68  ? 1805 DG  E OP2   1 
ATOM   687  O  "O5'" . DG  C 1 5   ? 50.193 80.260  41.865 1.00 53.48  ? 1805 DG  E "O5'" 1 
ATOM   688  C  "C5'" . DG  C 1 5   ? 51.092 80.917  40.984 1.00 49.11  ? 1805 DG  E "C5'" 1 
ATOM   689  C  "C4'" . DG  C 1 5   ? 52.333 81.329  41.737 1.00 46.45  ? 1805 DG  E "C4'" 1 
ATOM   690  O  "O4'" . DG  C 1 5   ? 52.097 82.520  42.526 1.00 41.88  ? 1805 DG  E "O4'" 1 
ATOM   691  C  "C3'" . DG  C 1 5   ? 52.830 80.268  42.716 1.00 44.22  ? 1805 DG  E "C3'" 1 
ATOM   692  O  "O3'" . DG  C 1 5   ? 54.252 80.259  42.676 1.00 46.29  ? 1805 DG  E "O3'" 1 
ATOM   693  C  "C2'" . DG  C 1 5   ? 52.337 80.782  44.056 1.00 42.77  ? 1805 DG  E "C2'" 1 
ATOM   694  C  "C1'" . DG  C 1 5   ? 52.485 82.276  43.863 1.00 40.55  ? 1805 DG  E "C1'" 1 
ATOM   695  N  N9    . DG  C 1 5   ? 51.672 83.115  44.737 1.00 38.56  ? 1805 DG  E N9    1 
ATOM   696  C  C8    . DG  C 1 5   ? 50.353 82.942  45.077 1.00 37.87  ? 1805 DG  E C8    1 
ATOM   697  N  N7    . DG  C 1 5   ? 49.908 83.862  45.893 1.00 38.93  ? 1805 DG  E N7    1 
ATOM   698  C  C5    . DG  C 1 5   ? 50.999 84.698  46.097 1.00 37.40  ? 1805 DG  E C5    1 
ATOM   699  C  C6    . DG  C 1 5   ? 51.128 85.875  46.892 1.00 35.51  ? 1805 DG  E C6    1 
ATOM   700  O  O6    . DG  C 1 5   ? 50.270 86.445  47.580 1.00 31.95  ? 1805 DG  E O6    1 
ATOM   701  N  N1    . DG  C 1 5   ? 52.416 86.392  46.830 1.00 35.58  ? 1805 DG  E N1    1 
ATOM   702  C  C2    . DG  C 1 5   ? 53.447 85.860  46.093 1.00 37.03  ? 1805 DG  E C2    1 
ATOM   703  N  N2    . DG  C 1 5   ? 54.623 86.502  46.169 1.00 33.30  ? 1805 DG  E N2    1 
ATOM   704  N  N3    . DG  C 1 5   ? 53.335 84.778  45.338 1.00 37.14  ? 1805 DG  E N3    1 
ATOM   705  C  C4    . DG  C 1 5   ? 52.095 84.249  45.393 1.00 37.10  ? 1805 DG  E C4    1 
ATOM   706  P  P     . DA  C 1 6   ? 55.067 79.106  43.431 1.00 45.99  ? 1806 DA  E P     1 
ATOM   707  O  OP1   . DA  C 1 6   ? 55.806 78.324  42.410 1.00 47.81  ? 1806 DA  E OP1   1 
ATOM   708  O  OP2   . DA  C 1 6   ? 54.142 78.411  44.365 1.00 47.13  ? 1806 DA  E OP2   1 
ATOM   709  O  "O5'" . DA  C 1 6   ? 56.131 79.935  44.269 1.00 43.89  ? 1806 DA  E "O5'" 1 
ATOM   710  C  "C5'" . DA  C 1 6   ? 56.943 80.909  43.624 1.00 40.05  ? 1806 DA  E "C5'" 1 
ATOM   711  C  "C4'" . DA  C 1 6   ? 57.809 81.607  44.642 1.00 37.48  ? 1806 DA  E "C4'" 1 
ATOM   712  O  "O4'" . DA  C 1 6   ? 57.009 82.498  45.450 1.00 35.73  ? 1806 DA  E "O4'" 1 
ATOM   713  C  "C3'" . DA  C 1 6   ? 58.484 80.654  45.616 1.00 35.35  ? 1806 DA  E "C3'" 1 
ATOM   714  O  "O3'" . DA  C 1 6   ? 59.770 81.164  45.922 1.00 36.49  ? 1806 DA  E "O3'" 1 
ATOM   715  C  "C2'" . DA  C 1 6   ? 57.570 80.679  46.827 1.00 34.18  ? 1806 DA  E "C2'" 1 
ATOM   716  C  "C1'" . DA  C 1 6   ? 57.019 82.096  46.809 1.00 33.37  ? 1806 DA  E "C1'" 1 
ATOM   717  N  N9    . DA  C 1 6   ? 55.645 82.221  47.290 1.00 33.58  ? 1806 DA  E N9    1 
ATOM   718  C  C8    . DA  C 1 6   ? 54.580 81.398  47.002 1.00 31.10  ? 1806 DA  E C8    1 
ATOM   719  N  N7    . DA  C 1 6   ? 53.443 81.808  47.512 1.00 32.23  ? 1806 DA  E N7    1 
ATOM   720  C  C5    . DA  C 1 6   ? 53.782 82.968  48.196 1.00 31.97  ? 1806 DA  E C5    1 
ATOM   721  C  C6    . DA  C 1 6   ? 53.019 83.886  48.950 1.00 31.32  ? 1806 DA  E C6    1 
ATOM   722  N  N6    . DA  C 1 6   ? 51.699 83.792  49.127 1.00 29.94  ? 1806 DA  E N6    1 
ATOM   723  N  N1    . DA  C 1 6   ? 53.669 84.922  49.521 1.00 31.88  ? 1806 DA  E N1    1 
ATOM   724  C  C2    . DA  C 1 6   ? 54.994 85.032  49.333 1.00 31.52  ? 1806 DA  E C2    1 
ATOM   725  N  N3    . DA  C 1 6   ? 55.816 84.245  48.638 1.00 33.25  ? 1806 DA  E N3    1 
ATOM   726  C  C4    . DA  C 1 6   ? 55.141 83.220  48.089 1.00 32.08  ? 1806 DA  E C4    1 
ATOM   727  P  P     . DA  C 1 7   ? 60.772 80.296  46.805 1.00 36.35  ? 1807 DA  E P     1 
ATOM   728  O  OP1   . DA  C 1 7   ? 62.150 80.563  46.315 1.00 38.90  ? 1807 DA  E OP1   1 
ATOM   729  O  OP2   . DA  C 1 7   ? 60.251 78.908  46.831 1.00 38.05  ? 1807 DA  E OP2   1 
ATOM   730  O  "O5'" . DA  C 1 7   ? 60.621 80.939  48.249 1.00 37.80  ? 1807 DA  E "O5'" 1 
ATOM   731  C  "C5'" . DA  C 1 7   ? 60.999 82.289  48.464 1.00 36.89  ? 1807 DA  E "C5'" 1 
ATOM   732  C  "C4'" . DA  C 1 7   ? 60.612 82.728  49.854 1.00 37.85  ? 1807 DA  E "C4'" 1 
ATOM   733  O  "O4'" . DA  C 1 7   ? 59.173 82.813  49.985 1.00 38.23  ? 1807 DA  E "O4'" 1 
ATOM   734  C  "C3'" . DA  C 1 7   ? 61.089 81.820  50.988 1.00 38.55  ? 1807 DA  E "C3'" 1 
ATOM   735  O  "O3'" . DA  C 1 7   ? 61.532 82.656  52.047 1.00 38.43  ? 1807 DA  E "O3'" 1 
ATOM   736  C  "C2'" . DA  C 1 7   ? 59.822 81.097  51.411 1.00 37.67  ? 1807 DA  E "C2'" 1 
ATOM   737  C  "C1'" . DA  C 1 7   ? 58.788 82.176  51.188 1.00 37.45  ? 1807 DA  E "C1'" 1 
ATOM   738  N  N9    . DA  C 1 7   ? 57.412 81.708  51.039 1.00 35.84  ? 1807 DA  E N9    1 
ATOM   739  C  C8    . DA  C 1 7   ? 56.948 80.609  50.365 1.00 35.09  ? 1807 DA  E C8    1 
ATOM   740  N  N7    . DA  C 1 7   ? 55.646 80.456  50.435 1.00 35.74  ? 1807 DA  E N7    1 
ATOM   741  C  C5    . DA  C 1 7   ? 55.225 81.531  51.206 1.00 36.78  ? 1807 DA  E C5    1 
ATOM   742  C  C6    . DA  C 1 7   ? 53.952 81.943  51.652 1.00 36.08  ? 1807 DA  E C6    1 
ATOM   743  N  N6    . DA  C 1 7   ? 52.820 81.294  51.371 1.00 33.92  ? 1807 DA  E N6    1 
ATOM   744  N  N1    . DA  C 1 7   ? 53.883 83.065  52.404 1.00 36.16  ? 1807 DA  E N1    1 
ATOM   745  C  C2    . DA  C 1 7   ? 55.015 83.722  52.678 1.00 35.68  ? 1807 DA  E C2    1 
ATOM   746  N  N3    . DA  C 1 7   ? 56.266 83.436  52.319 1.00 38.00  ? 1807 DA  E N3    1 
ATOM   747  C  C4    . DA  C 1 7   ? 56.303 82.314  51.579 1.00 36.66  ? 1807 DA  E C4    1 
ATOM   748  P  P     . DG  C 1 8   ? 62.359 82.043  53.271 1.00 38.34  ? 1808 DG  E P     1 
ATOM   749  O  OP1   . DG  C 1 8   ? 63.719 82.622  53.210 1.00 38.56  ? 1808 DG  E OP1   1 
ATOM   750  O  OP2   . DG  C 1 8   ? 62.184 80.576  53.339 1.00 38.79  ? 1808 DG  E OP2   1 
ATOM   751  O  "O5'" . DG  C 1 8   ? 61.613 82.697  54.509 1.00 38.67  ? 1808 DG  E "O5'" 1 
ATOM   752  C  "C5'" . DG  C 1 8   ? 61.348 84.093  54.502 1.00 39.03  ? 1808 DG  E "C5'" 1 
ATOM   753  C  "C4'" . DG  C 1 8   ? 60.336 84.442  55.565 1.00 41.38  ? 1808 DG  E "C4'" 1 
ATOM   754  O  "O4'" . DG  C 1 8   ? 59.014 83.998  55.176 1.00 39.18  ? 1808 DG  E "O4'" 1 
ATOM   755  C  "C3'" . DG  C 1 8   ? 60.616 83.828  56.935 1.00 42.37  ? 1808 DG  E "C3'" 1 
ATOM   756  O  "O3'" . DG  C 1 8   ? 60.399 84.830  57.925 1.00 45.48  ? 1808 DG  E "O3'" 1 
ATOM   757  C  "C2'" . DG  C 1 8   ? 59.606 82.694  57.035 1.00 40.44  ? 1808 DG  E "C2'" 1 
ATOM   758  C  "C1'" . DG  C 1 8   ? 58.439 83.211  56.210 1.00 40.18  ? 1808 DG  E "C1'" 1 
ATOM   759  N  N9    . DG  C 1 8   ? 57.616 82.182  55.576 1.00 40.31  ? 1808 DG  E N9    1 
ATOM   760  C  C8    . DG  C 1 8   ? 58.048 81.125  54.809 1.00 39.49  ? 1808 DG  E C8    1 
ATOM   761  N  N7    . DG  C 1 8   ? 57.071 80.380  54.367 1.00 38.66  ? 1808 DG  E N7    1 
ATOM   762  C  C5    . DG  C 1 8   ? 55.926 80.980  54.871 1.00 38.51  ? 1808 DG  E C5    1 
ATOM   763  C  C6    . DG  C 1 8   ? 54.557 80.628  54.719 1.00 37.76  ? 1808 DG  E C6    1 
ATOM   764  O  O6    . DG  C 1 8   ? 54.065 79.695  54.073 1.00 37.37  ? 1808 DG  E O6    1 
ATOM   765  N  N1    . DG  C 1 8   ? 53.725 81.505  55.409 1.00 38.32  ? 1808 DG  E N1    1 
ATOM   766  C  C2    . DG  C 1 8   ? 54.151 82.590  56.136 1.00 38.24  ? 1808 DG  E C2    1 
ATOM   767  N  N2    . DG  C 1 8   ? 53.194 83.320  56.726 1.00 37.15  ? 1808 DG  E N2    1 
ATOM   768  N  N3    . DG  C 1 8   ? 55.419 82.935  56.274 1.00 39.14  ? 1808 DG  E N3    1 
ATOM   769  C  C4    . DG  C 1 8   ? 56.247 82.091  55.623 1.00 38.65  ? 1808 DG  E C4    1 
ATOM   770  P  P     . DG  C 1 9   ? 60.502 84.455  59.476 1.00 47.37  ? 1809 DG  E P     1 
ATOM   771  O  OP1   . DG  C 1 9   ? 61.073 85.644  60.158 1.00 49.32  ? 1809 DG  E OP1   1 
ATOM   772  O  OP2   . DG  C 1 9   ? 61.176 83.137  59.602 1.00 49.38  ? 1809 DG  E OP2   1 
ATOM   773  O  "O5'" . DG  C 1 9   ? 58.976 84.292  59.895 1.00 47.00  ? 1809 DG  E "O5'" 1 
ATOM   774  C  "C5'" . DG  C 1 9   ? 58.017 85.273  59.504 1.00 47.99  ? 1809 DG  E "C5'" 1 
ATOM   775  C  "C4'" . DG  C 1 9   ? 56.704 85.031  60.207 1.00 48.85  ? 1809 DG  E "C4'" 1 
ATOM   776  O  "O4'" . DG  C 1 9   ? 55.922 84.034  59.511 1.00 48.14  ? 1809 DG  E "O4'" 1 
ATOM   777  C  "C3'" . DG  C 1 9   ? 56.851 84.533  61.642 1.00 49.26  ? 1809 DG  E "C3'" 1 
ATOM   778  O  "O3'" . DG  C 1 9   ? 55.867 85.159  62.468 1.00 49.89  ? 1809 DG  E "O3'" 1 
ATOM   779  C  "C2'" . DG  C 1 9   ? 56.615 83.037  61.522 1.00 47.65  ? 1809 DG  E "C2'" 1 
ATOM   780  C  "C1'" . DG  C 1 9   ? 55.609 82.958  60.385 1.00 47.66  ? 1809 DG  E "C1'" 1 
ATOM   781  N  N9    . DG  C 1 9   ? 55.648 81.733  59.593 1.00 45.69  ? 1809 DG  E N9    1 
ATOM   782  C  C8    . DG  C 1 9   ? 56.757 81.114  59.067 1.00 44.41  ? 1809 DG  E C8    1 
ATOM   783  N  N7    . DG  C 1 9   ? 56.464 80.072  58.340 1.00 43.79  ? 1809 DG  E N7    1 
ATOM   784  C  C5    . DG  C 1 9   ? 55.080 79.988  58.403 1.00 43.65  ? 1809 DG  E C5    1 
ATOM   785  C  C6    . DG  C 1 9   ? 54.186 79.068  57.795 1.00 43.16  ? 1809 DG  E C6    1 
ATOM   786  O  O6    . DG  C 1 9   ? 54.447 78.116  57.049 1.00 43.55  ? 1809 DG  E O6    1 
ATOM   787  N  N1    . DG  C 1 9   ? 52.866 79.347  58.125 1.00 42.85  ? 1809 DG  E N1    1 
ATOM   788  C  C2    . DG  C 1 9   ? 52.454 80.378  58.933 1.00 42.32  ? 1809 DG  E C2    1 
ATOM   789  N  N2    . DG  C 1 9   ? 51.135 80.475  59.141 1.00 41.28  ? 1809 DG  E N2    1 
ATOM   790  N  N3    . DG  C 1 9   ? 53.275 81.248  59.496 1.00 42.71  ? 1809 DG  E N3    1 
ATOM   791  C  C4    . DG  C 1 9   ? 54.564 80.993  59.189 1.00 43.87  ? 1809 DG  E C4    1 
ATOM   792  P  P     . DA  C 1 10  ? 55.934 84.980  64.062 1.00 50.74  ? 1810 DA  E P     1 
ATOM   793  O  OP1   . DA  C 1 10  ? 55.547 86.273  64.674 1.00 47.18  ? 1810 DA  E OP1   1 
ATOM   794  O  OP2   . DA  C 1 10  ? 57.227 84.332  64.430 1.00 45.36  ? 1810 DA  E OP2   1 
ATOM   795  O  "O5'" . DA  C 1 10  ? 54.768 83.943  64.346 1.00 45.92  ? 1810 DA  E "O5'" 1 
ATOM   796  C  "C5'" . DA  C 1 10  ? 53.444 84.255  63.968 1.00 41.32  ? 1810 DA  E "C5'" 1 
ATOM   797  C  "C4'" . DA  C 1 10  ? 52.525 83.117  64.326 1.00 37.83  ? 1810 DA  E "C4'" 1 
ATOM   798  O  "O4'" . DA  C 1 10  ? 52.622 82.060  63.340 1.00 35.34  ? 1810 DA  E "O4'" 1 
ATOM   799  C  "C3'" . DA  C 1 10  ? 52.800 82.481  65.691 1.00 34.97  ? 1810 DA  E "C3'" 1 
ATOM   800  O  "O3'" . DA  C 1 10  ? 51.562 82.408  66.397 1.00 34.37  ? 1810 DA  E "O3'" 1 
ATOM   801  C  "C2'" . DA  C 1 10  ? 53.376 81.112  65.351 1.00 33.69  ? 1810 DA  E "C2'" 1 
ATOM   802  C  "C1'" . DA  C 1 10  ? 52.761 80.805  63.990 1.00 34.24  ? 1810 DA  E "C1'" 1 
ATOM   803  N  N9    . DA  C 1 10  ? 53.557 79.943  63.114 1.00 31.63  ? 1810 DA  E N9    1 
ATOM   804  C  C8    . DA  C 1 10  ? 54.920 79.941  62.927 1.00 32.52  ? 1810 DA  E C8    1 
ATOM   805  N  N7    . DA  C 1 10  ? 55.336 79.047  62.059 1.00 31.02  ? 1810 DA  E N7    1 
ATOM   806  C  C5    . DA  C 1 10  ? 54.170 78.417  61.646 1.00 31.68  ? 1810 DA  E C5    1 
ATOM   807  C  C6    . DA  C 1 10  ? 53.926 77.367  60.732 1.00 29.76  ? 1810 DA  E C6    1 
ATOM   808  N  N6    . DA  C 1 10  ? 54.878 76.744  60.040 1.00 26.90  ? 1810 DA  E N6    1 
ATOM   809  N  N1    . DA  C 1 10  ? 52.647 76.974  60.556 1.00 29.49  ? 1810 DA  E N1    1 
ATOM   810  C  C2    . DA  C 1 10  ? 51.685 77.593  61.251 1.00 31.81  ? 1810 DA  E C2    1 
ATOM   811  N  N3    . DA  C 1 10  ? 51.786 78.588  62.135 1.00 31.77  ? 1810 DA  E N3    1 
ATOM   812  C  C4    . DA  C 1 10  ? 53.067 78.957  62.290 1.00 30.57  ? 1810 DA  E C4    1 
ATOM   813  P  P     . DC  C 1 11  ? 51.496 81.744  67.853 1.00 33.70  ? 1811 DC  E P     1 
ATOM   814  O  OP1   . DC  C 1 11  ? 50.400 82.427  68.585 1.00 34.78  ? 1811 DC  E OP1   1 
ATOM   815  O  OP2   . DC  C 1 11  ? 52.850 81.685  68.449 1.00 34.14  ? 1811 DC  E OP2   1 
ATOM   816  O  "O5'" . DC  C 1 11  ? 51.000 80.276  67.512 1.00 31.47  ? 1811 DC  E "O5'" 1 
ATOM   817  C  "C5'" . DC  C 1 11  ? 49.931 80.102  66.593 1.00 32.77  ? 1811 DC  E "C5'" 1 
ATOM   818  C  "C4'" . DC  C 1 11  ? 49.679 78.636  66.338 1.00 35.59  ? 1811 DC  E "C4'" 1 
ATOM   819  O  "O4'" . DC  C 1 11  ? 50.541 78.113  65.291 1.00 32.68  ? 1811 DC  E "O4'" 1 
ATOM   820  C  "C3'" . DC  C 1 11  ? 49.893 77.758  67.568 1.00 35.77  ? 1811 DC  E "C3'" 1 
ATOM   821  O  "O3'" . DC  C 1 11  ? 48.709 77.030  67.880 1.00 40.10  ? 1811 DC  E "O3'" 1 
ATOM   822  C  "C2'" . DC  C 1 11  ? 51.041 76.835  67.171 1.00 33.94  ? 1811 DC  E "C2'" 1 
ATOM   823  C  "C1'" . DC  C 1 11  ? 50.979 76.813  65.652 1.00 33.62  ? 1811 DC  E "C1'" 1 
ATOM   824  N  N1    . DC  C 1 11  ? 52.282 76.553  64.992 1.00 32.23  ? 1811 DC  E N1    1 
ATOM   825  C  C2    . DC  C 1 11  ? 52.363 75.570  63.979 1.00 32.41  ? 1811 DC  E C2    1 
ATOM   826  O  O2    . DC  C 1 11  ? 51.335 75.009  63.595 1.00 28.40  ? 1811 DC  E O2    1 
ATOM   827  N  N3    . DC  C 1 11  ? 53.569 75.275  63.437 1.00 29.38  ? 1811 DC  E N3    1 
ATOM   828  C  C4    . DC  C 1 11  ? 54.657 75.932  63.836 1.00 30.73  ? 1811 DC  E C4    1 
ATOM   829  N  N4    . DC  C 1 11  ? 55.828 75.598  63.280 1.00 27.89  ? 1811 DC  E N4    1 
ATOM   830  C  C5    . DC  C 1 11  ? 54.598 76.961  64.828 1.00 29.33  ? 1811 DC  E C5    1 
ATOM   831  C  C6    . DC  C 1 11  ? 53.404 77.235  65.372 1.00 30.82  ? 1811 DC  E C6    1 
ATOM   832  P  P     . DT  C 1 12  ? 48.659 76.162  69.224 1.00 42.84  ? 1812 DT  E P     1 
ATOM   833  O  OP1   . DT  C 1 12  ? 47.295 75.618  69.415 1.00 45.47  ? 1812 DT  E OP1   1 
ATOM   834  O  OP2   . DT  C 1 12  ? 49.285 76.963  70.296 1.00 43.40  ? 1812 DT  E OP2   1 
ATOM   835  O  "O5'" . DT  C 1 12  ? 49.672 74.990  68.891 1.00 49.94  ? 1812 DT  E "O5'" 1 
ATOM   836  C  "C5'" . DT  C 1 12  ? 49.313 73.640  69.066 1.00 55.97  ? 1812 DT  E "C5'" 1 
ATOM   837  C  "C4'" . DT  C 1 12  ? 48.683 73.107  67.803 1.00 59.72  ? 1812 DT  E "C4'" 1 
ATOM   838  O  "O4'" . DT  C 1 12  ? 49.457 73.518  66.649 1.00 57.50  ? 1812 DT  E "O4'" 1 
ATOM   839  C  "C3'" . DT  C 1 12  ? 48.675 71.588  67.807 1.00 62.35  ? 1812 DT  E "C3'" 1 
ATOM   840  O  "O3'" . DT  C 1 12  ? 47.394 71.032  67.568 1.00 70.87  ? 1812 DT  E "O3'" 1 
ATOM   841  C  "C2'" . DT  C 1 12  ? 49.720 71.169  66.795 1.00 59.76  ? 1812 DT  E "C2'" 1 
ATOM   842  C  "C1'" . DT  C 1 12  ? 50.031 72.406  65.978 1.00 55.03  ? 1812 DT  E "C1'" 1 
ATOM   843  N  N1    . DT  C 1 12  ? 51.490 72.608  65.934 1.00 50.24  ? 1812 DT  E N1    1 
ATOM   844  C  C2    . DT  C 1 12  ? 52.207 71.903  65.000 1.00 48.66  ? 1812 DT  E C2    1 
ATOM   845  O  O2    . DT  C 1 12  ? 51.688 71.130  64.213 1.00 48.93  ? 1812 DT  E O2    1 
ATOM   846  N  N3    . DT  C 1 12  ? 53.562 72.125  65.030 1.00 46.50  ? 1812 DT  E N3    1 
ATOM   847  C  C4    . DT  C 1 12  ? 54.249 72.968  65.878 1.00 45.93  ? 1812 DT  E C4    1 
ATOM   848  O  O4    . DT  C 1 12  ? 55.465 73.068  65.784 1.00 46.44  ? 1812 DT  E O4    1 
ATOM   849  C  C5    . DT  C 1 12  ? 53.434 73.676  66.836 1.00 47.02  ? 1812 DT  E C5    1 
ATOM   850  C  C7    . DT  C 1 12  ? 54.094 74.606  67.805 1.00 44.53  ? 1812 DT  E C7    1 
ATOM   851  C  C6    . DT  C 1 12  ? 52.111 73.469  66.810 1.00 48.07  ? 1812 DT  E C6    1 
ATOM   852  P  P     . DC  C 1 13  ? 46.828 69.974  68.628 1.00 76.41  ? 1813 DC  E P     1 
ATOM   853  O  OP1   . DC  C 1 13  ? 46.222 68.834  67.889 1.00 77.24  ? 1813 DC  E OP1   1 
ATOM   854  O  OP2   . DC  C 1 13  ? 46.018 70.733  69.618 1.00 77.35  ? 1813 DC  E OP2   1 
ATOM   855  O  "O5'" . DC  C 1 13  ? 48.160 69.487  69.361 1.00 74.98  ? 1813 DC  E "O5'" 1 
ATOM   856  C  "C5'" . DC  C 1 13  ? 48.547 68.113  69.369 1.00 75.67  ? 1813 DC  E "C5'" 1 
ATOM   857  C  "C4'" . DC  C 1 13  ? 49.001 67.677  67.994 1.00 75.24  ? 1813 DC  E "C4'" 1 
ATOM   858  O  "O4'" . DC  C 1 13  ? 50.082 68.522  67.524 1.00 74.00  ? 1813 DC  E "O4'" 1 
ATOM   859  C  "C3'" . DC  C 1 13  ? 49.540 66.245  67.939 1.00 75.37  ? 1813 DC  E "C3'" 1 
ATOM   860  O  "O3'" . DC  C 1 13  ? 49.297 65.636  66.668 1.00 76.60  ? 1813 DC  E "O3'" 1 
ATOM   861  C  "C2'" . DC  C 1 13  ? 51.041 66.446  68.001 1.00 74.38  ? 1813 DC  E "C2'" 1 
ATOM   862  C  "C1'" . DC  C 1 13  ? 51.199 67.712  67.186 1.00 72.61  ? 1813 DC  E "C1'" 1 
ATOM   863  N  N1    . DC  C 1 13  ? 52.428 68.472  67.456 1.00 70.37  ? 1813 DC  E N1    1 
ATOM   864  C  C2    . DC  C 1 13  ? 53.638 67.963  66.985 1.00 69.40  ? 1813 DC  E C2    1 
ATOM   865  O  O2    . DC  C 1 13  ? 53.635 66.875  66.394 1.00 69.13  ? 1813 DC  E O2    1 
ATOM   866  N  N3    . DC  C 1 13  ? 54.776 68.661  67.185 1.00 68.72  ? 1813 DC  E N3    1 
ATOM   867  C  C4    . DC  C 1 13  ? 54.737 69.821  67.841 1.00 69.27  ? 1813 DC  E C4    1 
ATOM   868  N  N4    . DC  C 1 13  ? 55.884 70.485  68.005 1.00 68.72  ? 1813 DC  E N4    1 
ATOM   869  C  C5    . DC  C 1 13  ? 53.519 70.356  68.355 1.00 69.55  ? 1813 DC  E C5    1 
ATOM   870  C  C6    . DC  C 1 13  ? 52.398 69.654  68.142 1.00 69.78  ? 1813 DC  E C6    1 
ATOM   871  O  "O5'" . DT  D 2 1   ? 72.928 71.609  76.308 1.00 100.76 ? 1902 DT  F "O5'" 1 
ATOM   872  C  "C5'" . DT  D 2 1   ? 72.334 70.335  76.068 1.00 98.58  ? 1902 DT  F "C5'" 1 
ATOM   873  C  "C4'" . DT  D 2 1   ? 71.299 70.345  74.964 1.00 96.63  ? 1902 DT  F "C4'" 1 
ATOM   874  O  "O4'" . DT  D 2 1   ? 70.706 71.669  74.827 1.00 96.59  ? 1902 DT  F "O4'" 1 
ATOM   875  C  "C3'" . DT  D 2 1   ? 71.809 69.962  73.586 1.00 94.56  ? 1902 DT  F "C3'" 1 
ATOM   876  O  "O3'" . DT  D 2 1   ? 70.837 69.145  72.934 1.00 90.58  ? 1902 DT  F "O3'" 1 
ATOM   877  C  "C2'" . DT  D 2 1   ? 71.966 71.300  72.888 1.00 95.53  ? 1902 DT  F "C2'" 1 
ATOM   878  C  "C1'" . DT  D 2 1   ? 70.879 72.169  73.508 1.00 96.45  ? 1902 DT  F "C1'" 1 
ATOM   879  N  N1    . DT  D 2 1   ? 71.300 73.595  73.596 1.00 96.98  ? 1902 DT  F N1    1 
ATOM   880  C  C2    . DT  D 2 1   ? 70.363 74.622  73.614 1.00 97.02  ? 1902 DT  F C2    1 
ATOM   881  O  O2    . DT  D 2 1   ? 69.154 74.439  73.602 1.00 96.83  ? 1902 DT  F O2    1 
ATOM   882  N  N3    . DT  D 2 1   ? 70.911 75.889  73.641 1.00 96.99  ? 1902 DT  F N3    1 
ATOM   883  C  C4    . DT  D 2 1   ? 72.257 76.223  73.655 1.00 97.01  ? 1902 DT  F C4    1 
ATOM   884  O  O4    . DT  D 2 1   ? 72.600 77.406  73.658 1.00 97.46  ? 1902 DT  F O4    1 
ATOM   885  C  C5    . DT  D 2 1   ? 73.168 75.104  73.656 1.00 97.03  ? 1902 DT  F C5    1 
ATOM   886  C  C7    . DT  D 2 1   ? 74.640 75.366  73.676 1.00 96.81  ? 1902 DT  F C7    1 
ATOM   887  C  C6    . DT  D 2 1   ? 72.651 73.871  73.637 1.00 96.91  ? 1902 DT  F C6    1 
ATOM   888  P  P     . DC  D 2 2   ? 70.811 69.079  71.334 1.00 87.00  ? 1903 DC  F P     1 
ATOM   889  O  OP1   . DC  D 2 2   ? 70.369 67.722  70.931 1.00 86.07  ? 1903 DC  F OP1   1 
ATOM   890  O  OP2   . DC  D 2 2   ? 72.131 69.586  70.882 1.00 88.24  ? 1903 DC  F OP2   1 
ATOM   891  O  "O5'" . DC  D 2 2   ? 69.680 70.131  70.951 1.00 83.10  ? 1903 DC  F "O5'" 1 
ATOM   892  C  "C5'" . DC  D 2 2   ? 68.356 69.983  71.458 1.00 80.02  ? 1903 DC  F "C5'" 1 
ATOM   893  C  "C4'" . DC  D 2 2   ? 67.370 69.977  70.317 1.00 79.47  ? 1903 DC  F "C4'" 1 
ATOM   894  O  "O4'" . DC  D 2 2   ? 66.489 71.117  70.453 1.00 80.91  ? 1903 DC  F "O4'" 1 
ATOM   895  C  "C3'" . DC  D 2 2   ? 68.026 70.091  68.941 1.00 78.90  ? 1903 DC  F "C3'" 1 
ATOM   896  O  "O3'" . DC  D 2 2   ? 67.494 69.132  68.022 1.00 74.47  ? 1903 DC  F "O3'" 1 
ATOM   897  C  "C2'" . DC  D 2 2   ? 67.843 71.544  68.537 1.00 80.61  ? 1903 DC  F "C2'" 1 
ATOM   898  C  "C1'" . DC  D 2 2   ? 66.727 72.077  69.433 1.00 82.09  ? 1903 DC  F "C1'" 1 
ATOM   899  N  N1    . DC  D 2 2   ? 67.028 73.366  70.095 1.00 83.60  ? 1903 DC  F N1    1 
ATOM   900  C  C2    . DC  D 2 2   ? 68.375 73.788  70.242 1.00 83.94  ? 1903 DC  F C2    1 
ATOM   901  O  O2    . DC  D 2 2   ? 69.296 73.042  69.880 1.00 84.10  ? 1903 DC  F O2    1 
ATOM   902  N  N3    . DC  D 2 2   ? 68.628 74.997  70.787 1.00 84.39  ? 1903 DC  F N3    1 
ATOM   903  C  C4    . DC  D 2 2   ? 67.620 75.770  71.197 1.00 84.74  ? 1903 DC  F C4    1 
ATOM   904  N  N4    . DC  D 2 2   ? 67.921 76.968  71.708 1.00 85.52  ? 1903 DC  F N4    1 
ATOM   905  C  C5    . DC  D 2 2   ? 66.258 75.354  71.097 1.00 84.48  ? 1903 DC  F C5    1 
ATOM   906  C  C6    . DC  D 2 2   ? 66.010 74.159  70.545 1.00 83.62  ? 1903 DC  F C6    1 
ATOM   907  P  P     . DA  D 2 3   ? 66.236 69.501  67.097 1.00 70.96  ? 1904 DA  F P     1 
ATOM   908  O  OP1   . DA  D 2 3   ? 66.671 70.250  65.889 1.00 69.77  ? 1904 DA  F OP1   1 
ATOM   909  O  OP2   . DA  D 2 3   ? 65.198 70.082  67.995 1.00 72.26  ? 1904 DA  F OP2   1 
ATOM   910  O  "O5'" . DA  D 2 3   ? 65.736 68.062  66.645 1.00 66.08  ? 1904 DA  F "O5'" 1 
ATOM   911  C  "C5'" . DA  D 2 3   ? 66.364 66.888  67.160 1.00 56.61  ? 1904 DA  F "C5'" 1 
ATOM   912  C  "C4'" . DA  D 2 3   ? 65.702 65.664  66.583 1.00 51.22  ? 1904 DA  F "C4'" 1 
ATOM   913  O  "O4'" . DA  D 2 3   ? 64.386 65.505  67.154 1.00 47.75  ? 1904 DA  F "O4'" 1 
ATOM   914  C  "C3'" . DA  D 2 3   ? 65.489 65.761  65.081 1.00 48.57  ? 1904 DA  F "C3'" 1 
ATOM   915  O  "O3'" . DA  D 2 3   ? 65.609 64.458  64.516 1.00 49.54  ? 1904 DA  F "O3'" 1 
ATOM   916  C  "C2'" . DA  D 2 3   ? 64.086 66.338  64.963 1.00 47.19  ? 1904 DA  F "C2'" 1 
ATOM   917  C  "C1'" . DA  D 2 3   ? 63.375 65.791  66.198 1.00 43.70  ? 1904 DA  F "C1'" 1 
ATOM   918  N  N9    . DA  D 2 3   ? 62.441 66.706  66.851 1.00 39.37  ? 1904 DA  F N9    1 
ATOM   919  C  C8    . DA  D 2 3   ? 62.678 67.998  67.235 1.00 36.88  ? 1904 DA  F C8    1 
ATOM   920  N  N7    . DA  D 2 3   ? 61.687 68.542  67.897 1.00 36.75  ? 1904 DA  F N7    1 
ATOM   921  C  C5    . DA  D 2 3   ? 60.722 67.548  67.931 1.00 35.86  ? 1904 DA  F C5    1 
ATOM   922  C  C6    . DA  D 2 3   ? 59.437 67.493  68.508 1.00 35.18  ? 1904 DA  F C6    1 
ATOM   923  N  N6    . DA  D 2 3   ? 58.892 68.494  69.208 1.00 34.39  ? 1904 DA  F N6    1 
ATOM   924  N  N1    . DA  D 2 3   ? 58.728 66.356  68.351 1.00 32.26  ? 1904 DA  F N1    1 
ATOM   925  C  C2    . DA  D 2 3   ? 59.283 65.343  67.675 1.00 35.11  ? 1904 DA  F C2    1 
ATOM   926  N  N3    . DA  D 2 3   ? 60.485 65.269  67.101 1.00 37.63  ? 1904 DA  F N3    1 
ATOM   927  C  C4    . DA  D 2 3   ? 61.162 66.419  67.267 1.00 37.74  ? 1904 DA  F C4    1 
ATOM   928  P  P     . DG  D 2 4   ? 65.770 64.300  62.940 1.00 48.83  ? 1905 DG  F P     1 
ATOM   929  O  OP1   . DG  D 2 4   ? 66.073 62.890  62.618 1.00 47.74  ? 1905 DG  F OP1   1 
ATOM   930  O  OP2   . DG  D 2 4   ? 66.703 65.362  62.502 1.00 50.42  ? 1905 DG  F OP2   1 
ATOM   931  O  "O5'" . DG  D 2 4   ? 64.306 64.658  62.419 1.00 53.96  ? 1905 DG  F "O5'" 1 
ATOM   932  C  "C5'" . DG  D 2 4   ? 63.193 63.826  62.746 1.00 58.31  ? 1905 DG  F "C5'" 1 
ATOM   933  C  "C4'" . DG  D 2 4   ? 61.900 64.426  62.236 1.00 59.27  ? 1905 DG  F "C4'" 1 
ATOM   934  O  "O4'" . DG  D 2 4   ? 61.199 65.213  63.230 1.00 59.45  ? 1905 DG  F "O4'" 1 
ATOM   935  C  "C3'" . DG  D 2 4   ? 61.919 65.265  60.947 1.00 60.11  ? 1905 DG  F "C3'" 1 
ATOM   936  O  "O3'" . DG  D 2 4   ? 60.689 64.924  60.234 1.00 62.12  ? 1905 DG  F "O3'" 1 
ATOM   937  C  "C2'" . DG  D 2 4   ? 61.760 66.672  61.514 1.00 58.71  ? 1905 DG  F "C2'" 1 
ATOM   938  C  "C1'" . DG  D 2 4   ? 60.707 66.367  62.575 1.00 58.51  ? 1905 DG  F "C1'" 1 
ATOM   939  N  N9    . DG  D 2 4   ? 60.398 67.390  63.573 1.00 56.50  ? 1905 DG  F N9    1 
ATOM   940  C  C8    . DG  D 2 4   ? 61.190 68.430  63.962 1.00 54.96  ? 1905 DG  F C8    1 
ATOM   941  N  N7    . DG  D 2 4   ? 60.614 69.218  64.834 1.00 55.66  ? 1905 DG  F N7    1 
ATOM   942  C  C5    . DG  D 2 4   ? 59.369 68.652  65.042 1.00 56.03  ? 1905 DG  F C5    1 
ATOM   943  C  C6    . DG  D 2 4   ? 58.298 69.065  65.875 1.00 54.52  ? 1905 DG  F C6    1 
ATOM   944  O  O6    . DG  D 2 4   ? 58.234 70.046  66.616 1.00 56.93  ? 1905 DG  F O6    1 
ATOM   945  N  N1    . DG  D 2 4   ? 57.219 68.200  65.783 1.00 55.30  ? 1905 DG  F N1    1 
ATOM   946  C  C2    . DG  D 2 4   ? 57.173 67.082  64.991 1.00 55.62  ? 1905 DG  F C2    1 
ATOM   947  N  N2    . DG  D 2 4   ? 56.042 66.373  65.034 1.00 55.95  ? 1905 DG  F N2    1 
ATOM   948  N  N3    . DG  D 2 4   ? 58.163 66.687  64.210 1.00 56.34  ? 1905 DG  F N3    1 
ATOM   949  C  C4    . DG  D 2 4   ? 59.222 67.513  64.283 1.00 55.84  ? 1905 DG  F C4    1 
ATOM   950  P  P     . DT  D 2 5   ? 60.729 64.227  58.786 1.00 63.01  ? 1906 DT  F P     1 
ATOM   951  O  OP1   . DT  D 2 5   ? 61.471 65.437  58.576 1.00 65.72  ? 1906 DT  F OP1   1 
ATOM   952  O  OP2   . DT  D 2 5   ? 59.270 64.037  58.511 1.00 66.52  ? 1906 DT  F OP2   1 
ATOM   953  O  "O5'" . DT  D 2 5   ? 61.531 62.929  59.039 1.00 66.65  ? 1906 DT  F "O5'" 1 
ATOM   954  C  "C5'" . DT  D 2 5   ? 61.416 62.494  60.319 1.00 70.85  ? 1906 DT  F "C5'" 1 
ATOM   955  C  "C4'" . DT  D 2 5   ? 60.371 61.432  60.324 1.00 72.91  ? 1906 DT  F "C4'" 1 
ATOM   956  O  "O4'" . DT  D 2 5   ? 61.188 60.395  60.848 1.00 74.14  ? 1906 DT  F "O4'" 1 
ATOM   957  C  "C3'" . DT  D 2 5   ? 59.051 61.447  61.116 1.00 73.07  ? 1906 DT  F "C3'" 1 
ATOM   958  O  "O3'" . DT  D 2 5   ? 58.184 60.451  60.493 1.00 72.31  ? 1906 DT  F "O3'" 1 
ATOM   959  C  "C2'" . DT  D 2 5   ? 59.476 60.762  62.400 1.00 73.83  ? 1906 DT  F "C2'" 1 
ATOM   960  C  "C1'" . DT  D 2 5   ? 60.514 59.760  61.896 1.00 74.32  ? 1906 DT  F "C1'" 1 
ATOM   961  P  P     . DA  D 2 6   ? 56.864 60.821  59.603 1.00 71.17  ? 1907 DA  F P     1 
ATOM   962  O  OP1   . DA  D 2 6   ? 55.596 60.487  60.315 1.00 71.89  ? 1907 DA  F OP1   1 
ATOM   963  O  OP2   . DA  D 2 6   ? 57.136 60.163  58.296 1.00 71.34  ? 1907 DA  F OP2   1 
ATOM   964  O  "O5'" . DA  D 2 6   ? 56.896 62.388  59.341 1.00 70.03  ? 1907 DA  F "O5'" 1 
ATOM   965  C  "C5'" . DA  D 2 6   ? 56.906 63.329  60.412 1.00 62.68  ? 1907 DA  F "C5'" 1 
ATOM   966  C  "C4'" . DA  D 2 6   ? 56.217 64.587  59.956 1.00 58.29  ? 1907 DA  F "C4'" 1 
ATOM   967  O  "O4'" . DA  D 2 6   ? 56.312 65.683  60.902 1.00 54.78  ? 1907 DA  F "O4'" 1 
ATOM   968  C  "C3'" . DA  D 2 6   ? 56.791 65.121  58.643 1.00 55.41  ? 1907 DA  F "C3'" 1 
ATOM   969  O  "O3'" . DA  D 2 6   ? 55.698 65.626  57.921 1.00 54.42  ? 1907 DA  F "O3'" 1 
ATOM   970  C  "C2'" . DA  D 2 6   ? 57.567 66.341  59.089 1.00 54.25  ? 1907 DA  F "C2'" 1 
ATOM   971  C  "C1'" . DA  D 2 6   ? 56.585 66.830  60.122 1.00 52.69  ? 1907 DA  F "C1'" 1 
ATOM   972  N  N9    . DA  D 2 6   ? 57.016 67.924  60.986 1.00 50.45  ? 1907 DA  F N9    1 
ATOM   973  C  C8    . DA  D 2 6   ? 58.272 68.453  61.138 1.00 49.02  ? 1907 DA  F C8    1 
ATOM   974  N  N7    . DA  D 2 6   ? 58.320 69.470  61.964 1.00 47.87  ? 1907 DA  F N7    1 
ATOM   975  C  C5    . DA  D 2 6   ? 57.008 69.612  62.394 1.00 47.87  ? 1907 DA  F C5    1 
ATOM   976  C  C6    . DA  D 2 6   ? 56.395 70.513  63.282 1.00 48.54  ? 1907 DA  F C6    1 
ATOM   977  N  N6    . DA  D 2 6   ? 57.050 71.484  63.927 1.00 47.95  ? 1907 DA  F N6    1 
ATOM   978  N  N1    . DA  D 2 6   ? 55.067 70.384  63.489 1.00 47.83  ? 1907 DA  F N1    1 
ATOM   979  C  C2    . DA  D 2 6   ? 54.408 69.416  62.840 1.00 49.30  ? 1907 DA  F C2    1 
ATOM   980  N  N3    . DA  D 2 6   ? 54.872 68.510  61.982 1.00 49.07  ? 1907 DA  F N3    1 
ATOM   981  C  C4    . DA  D 2 6   ? 56.196 68.663  61.802 1.00 49.24  ? 1907 DA  F C4    1 
ATOM   982  P  P     . DG  D 2 7   ? 55.295 65.002  56.510 1.00 51.55  ? 1908 DG  F P     1 
ATOM   983  O  OP1   . DG  D 2 7   ? 55.012 63.555  56.653 1.00 54.95  ? 1908 DG  F OP1   1 
ATOM   984  O  OP2   . DG  D 2 7   ? 56.282 65.465  55.508 1.00 52.70  ? 1908 DG  F OP2   1 
ATOM   985  O  "O5'" . DG  D 2 7   ? 53.908 65.743  56.311 1.00 51.26  ? 1908 DG  F "O5'" 1 
ATOM   986  C  "C5'" . DG  D 2 7   ? 52.947 65.680  57.362 1.00 47.94  ? 1908 DG  F "C5'" 1 
ATOM   987  C  "C4'" . DG  D 2 7   ? 52.283 67.019  57.590 1.00 44.47  ? 1908 DG  F "C4'" 1 
ATOM   988  O  "O4'" . DG  D 2 7   ? 52.931 67.860  58.585 1.00 42.46  ? 1908 DG  F "O4'" 1 
ATOM   989  C  "C3'" . DG  D 2 7   ? 52.052 67.886  56.358 1.00 40.80  ? 1908 DG  F "C3'" 1 
ATOM   990  O  "O3'" . DG  D 2 7   ? 50.668 68.125  56.266 1.00 40.04  ? 1908 DG  F "O3'" 1 
ATOM   991  C  "C2'" . DG  D 2 7   ? 52.767 69.185  56.691 1.00 40.18  ? 1908 DG  F "C2'" 1 
ATOM   992  C  "C1'" . DG  D 2 7   ? 52.724 69.206  58.211 1.00 39.68  ? 1908 DG  F "C1'" 1 
ATOM   993  N  N9    . DG  D 2 7   ? 53.757 70.036  58.834 1.00 39.53  ? 1908 DG  F N9    1 
ATOM   994  C  C8    . DG  D 2 7   ? 55.108 70.002  58.592 1.00 38.37  ? 1908 DG  F C8    1 
ATOM   995  N  N7    . DG  D 2 7   ? 55.768 70.939  59.222 1.00 36.98  ? 1908 DG  F N7    1 
ATOM   996  C  C5    . DG  D 2 7   ? 54.798 71.618  59.948 1.00 37.28  ? 1908 DG  F C5    1 
ATOM   997  C  C6    . DG  D 2 7   ? 54.914 72.740  60.819 1.00 36.95  ? 1908 DG  F C6    1 
ATOM   998  O  O6    . DG  D 2 7   ? 55.926 73.395  61.111 1.00 36.97  ? 1908 DG  F O6    1 
ATOM   999  N  N1    . DG  D 2 7   ? 53.686 73.085  61.368 1.00 35.97  ? 1908 DG  F N1    1 
ATOM   1000 C  C2    . DG  D 2 7   ? 52.499 72.441  61.113 1.00 36.67  ? 1908 DG  F C2    1 
ATOM   1001 N  N2    . DG  D 2 7   ? 51.424 72.913  61.757 1.00 33.83  ? 1908 DG  F N2    1 
ATOM   1002 N  N3    . DG  D 2 7   ? 52.376 71.409  60.293 1.00 34.35  ? 1908 DG  F N3    1 
ATOM   1003 C  C4    . DG  D 2 7   ? 53.555 71.054  59.746 1.00 37.25  ? 1908 DG  F C4    1 
ATOM   1004 P  P     . DT  D 2 8   ? 50.081 68.935  55.023 1.00 39.98  ? 1909 DT  F P     1 
ATOM   1005 O  OP1   . DT  D 2 8   ? 49.173 68.010  54.301 1.00 40.71  ? 1909 DT  F OP1   1 
ATOM   1006 O  OP2   . DT  D 2 8   ? 51.163 69.633  54.300 1.00 37.93  ? 1909 DT  F OP2   1 
ATOM   1007 O  "O5'" . DT  D 2 8   ? 49.184 70.023  55.746 1.00 38.72  ? 1909 DT  F "O5'" 1 
ATOM   1008 C  "C5'" . DT  D 2 8   ? 48.437 69.662  56.899 1.00 36.15  ? 1909 DT  F "C5'" 1 
ATOM   1009 C  "C4'" . DT  D 2 8   ? 47.749 70.877  57.463 1.00 38.39  ? 1909 DT  F "C4'" 1 
ATOM   1010 O  "O4'" . DT  D 2 8   ? 48.686 71.682  58.211 1.00 36.94  ? 1909 DT  F "O4'" 1 
ATOM   1011 C  "C3'" . DT  D 2 8   ? 47.163 71.783  56.388 1.00 38.77  ? 1909 DT  F "C3'" 1 
ATOM   1012 O  "O3'" . DT  D 2 8   ? 45.897 72.234  56.830 1.00 42.67  ? 1909 DT  F "O3'" 1 
ATOM   1013 C  "C2'" . DT  D 2 8   ? 48.167 72.919  56.286 1.00 37.43  ? 1909 DT  F "C2'" 1 
ATOM   1014 C  "C1'" . DT  D 2 8   ? 48.722 73.004  57.701 1.00 37.35  ? 1909 DT  F "C1'" 1 
ATOM   1015 N  N1    . DT  D 2 8   ? 50.122 73.476  57.803 1.00 37.06  ? 1909 DT  F N1    1 
ATOM   1016 C  C2    . DT  D 2 8   ? 50.446 74.413  58.771 1.00 37.90  ? 1909 DT  F C2    1 
ATOM   1017 O  O2    . DT  D 2 8   ? 49.633 74.886  59.551 1.00 37.20  ? 1909 DT  F O2    1 
ATOM   1018 N  N3    . DT  D 2 8   ? 51.775 74.770  58.796 1.00 34.86  ? 1909 DT  F N3    1 
ATOM   1019 C  C4    . DT  D 2 8   ? 52.780 74.294  57.980 1.00 31.62  ? 1909 DT  F C4    1 
ATOM   1020 O  O4    . DT  D 2 8   ? 53.927 74.687  58.133 1.00 29.34  ? 1909 DT  F O4    1 
ATOM   1021 C  C5    . DT  D 2 8   ? 52.365 73.332  56.985 1.00 32.17  ? 1909 DT  F C5    1 
ATOM   1022 C  C7    . DT  D 2 8   ? 53.384 72.783  56.040 1.00 31.24  ? 1909 DT  F C7    1 
ATOM   1023 C  C6    . DT  D 2 8   ? 51.079 72.974  56.950 1.00 33.68  ? 1909 DT  F C6    1 
ATOM   1024 P  P     . DC  D 2 9   ? 44.953 73.046  55.829 1.00 45.23  ? 1910 DC  F P     1 
ATOM   1025 O  OP1   . DC  D 2 9   ? 43.554 72.649  56.146 1.00 45.37  ? 1910 DC  F OP1   1 
ATOM   1026 O  OP2   . DC  D 2 9   ? 45.472 72.900  54.446 1.00 43.08  ? 1910 DC  F OP2   1 
ATOM   1027 O  "O5'" . DC  D 2 9   ? 45.157 74.540  56.316 1.00 43.60  ? 1910 DC  F "O5'" 1 
ATOM   1028 C  "C5'" . DC  D 2 9   ? 44.888 74.870  57.668 1.00 43.33  ? 1910 DC  F "C5'" 1 
ATOM   1029 C  "C4'" . DC  D 2 9   ? 45.272 76.300  57.940 1.00 43.14  ? 1910 DC  F "C4'" 1 
ATOM   1030 O  "O4'" . DC  D 2 9   ? 46.712 76.428  58.007 1.00 41.36  ? 1910 DC  F "O4'" 1 
ATOM   1031 C  "C3'" . DC  D 2 9   ? 44.795 77.294  56.883 1.00 43.67  ? 1910 DC  F "C3'" 1 
ATOM   1032 O  "O3'" . DC  D 2 9   ? 44.246 78.420  57.567 1.00 45.53  ? 1910 DC  F "O3'" 1 
ATOM   1033 C  "C2'" . DC  D 2 9   ? 46.069 77.640  56.122 1.00 41.52  ? 1910 DC  F "C2'" 1 
ATOM   1034 C  "C1'" . DC  D 2 9   ? 47.130 77.510  57.202 1.00 40.20  ? 1910 DC  F "C1'" 1 
ATOM   1035 N  N1    . DC  D 2 9   ? 48.501 77.230  56.748 1.00 37.43  ? 1910 DC  F N1    1 
ATOM   1036 C  C2    . DC  D 2 9   ? 49.561 77.869  57.396 1.00 35.82  ? 1910 DC  F C2    1 
ATOM   1037 O  O2    . DC  D 2 9   ? 49.314 78.650  58.314 1.00 36.14  ? 1910 DC  F O2    1 
ATOM   1038 N  N3    . DC  D 2 9   ? 50.826 77.621  57.004 1.00 35.74  ? 1910 DC  F N3    1 
ATOM   1039 C  C4    . DC  D 2 9   ? 51.058 76.779  56.001 1.00 35.97  ? 1910 DC  F C4    1 
ATOM   1040 N  N4    . DC  D 2 9   ? 52.328 76.574  55.643 1.00 34.11  ? 1910 DC  F N4    1 
ATOM   1041 C  C5    . DC  D 2 9   ? 49.998 76.112  55.316 1.00 35.67  ? 1910 DC  F C5    1 
ATOM   1042 C  C6    . DC  D 2 9   ? 48.746 76.365  55.720 1.00 37.50  ? 1910 DC  F C6    1 
ATOM   1043 P  P     . DC  D 2 10  ? 43.622 79.643  56.743 1.00 46.58  ? 1911 DC  F P     1 
ATOM   1044 O  OP1   . DC  D 2 10  ? 42.305 79.932  57.368 1.00 46.70  ? 1911 DC  F OP1   1 
ATOM   1045 O  OP2   . DC  D 2 10  ? 43.717 79.419  55.280 1.00 44.53  ? 1911 DC  F OP2   1 
ATOM   1046 O  "O5'" . DC  D 2 10  ? 44.593 80.839  57.128 1.00 44.46  ? 1911 DC  F "O5'" 1 
ATOM   1047 C  "C5'" . DC  D 2 10  ? 44.980 81.021  58.480 1.00 40.10  ? 1911 DC  F "C5'" 1 
ATOM   1048 C  "C4'" . DC  D 2 10  ? 46.069 82.059  58.567 1.00 38.26  ? 1911 DC  F "C4'" 1 
ATOM   1049 O  "O4'" . DC  D 2 10  ? 47.334 81.492  58.149 1.00 34.41  ? 1911 DC  F "O4'" 1 
ATOM   1050 C  "C3'" . DC  D 2 10  ? 45.817 83.273  57.673 1.00 37.63  ? 1911 DC  F "C3'" 1 
ATOM   1051 O  "O3'" . DC  D 2 10  ? 46.050 84.476  58.402 1.00 36.95  ? 1911 DC  F "O3'" 1 
ATOM   1052 C  "C2'" . DC  D 2 10  ? 46.827 83.112  56.549 1.00 35.59  ? 1911 DC  F "C2'" 1 
ATOM   1053 C  "C1'" . DC  D 2 10  ? 47.962 82.373  57.235 1.00 36.37  ? 1911 DC  F "C1'" 1 
ATOM   1054 N  N1    . DC  D 2 10  ? 48.800 81.565  56.332 1.00 36.54  ? 1911 DC  F N1    1 
ATOM   1055 C  C2    . DC  D 2 10  ? 50.178 81.785  56.319 1.00 35.63  ? 1911 DC  F C2    1 
ATOM   1056 O  O2    . DC  D 2 10  ? 50.656 82.654  57.070 1.00 34.08  ? 1911 DC  F O2    1 
ATOM   1057 N  N3    . DC  D 2 10  ? 50.958 81.048  55.491 1.00 33.17  ? 1911 DC  F N3    1 
ATOM   1058 C  C4    . DC  D 2 10  ? 50.408 80.120  54.704 1.00 34.33  ? 1911 DC  F C4    1 
ATOM   1059 N  N4    . DC  D 2 10  ? 51.218 79.406  53.910 1.00 33.82  ? 1911 DC  F N4    1 
ATOM   1060 C  C5    . DC  D 2 10  ? 49.004 79.878  54.695 1.00 34.65  ? 1911 DC  F C5    1 
ATOM   1061 C  C6    . DC  D 2 10  ? 48.244 80.616  55.518 1.00 36.51  ? 1911 DC  F C6    1 
ATOM   1062 P  P     . DT  D 2 11  ? 45.829 85.892  57.689 1.00 34.88  ? 1912 DT  F P     1 
ATOM   1063 O  OP1   . DT  D 2 11  ? 45.092 86.750  58.650 1.00 37.90  ? 1912 DT  F OP1   1 
ATOM   1064 O  OP2   . DT  D 2 11  ? 45.284 85.675  56.330 1.00 38.11  ? 1912 DT  F OP2   1 
ATOM   1065 O  "O5'" . DT  D 2 11  ? 47.310 86.440  57.545 1.00 34.47  ? 1912 DT  F "O5'" 1 
ATOM   1066 C  "C5'" . DT  D 2 11  ? 48.204 86.340  58.638 1.00 32.82  ? 1912 DT  F "C5'" 1 
ATOM   1067 C  "C4'" . DT  D 2 11  ? 49.553 86.880  58.247 1.00 33.65  ? 1912 DT  F "C4'" 1 
ATOM   1068 O  "O4'" . DT  D 2 11  ? 50.229 85.948  57.372 1.00 33.16  ? 1912 DT  F "O4'" 1 
ATOM   1069 C  "C3'" . DT  D 2 11  ? 49.491 88.210  57.500 1.00 35.57  ? 1912 DT  F "C3'" 1 
ATOM   1070 O  "O3'" . DT  D 2 11  ? 50.519 89.052  58.011 1.00 39.87  ? 1912 DT  F "O3'" 1 
ATOM   1071 C  "C2'" . DT  D 2 11  ? 49.753 87.821  56.052 1.00 33.79  ? 1912 DT  F "C2'" 1 
ATOM   1072 C  "C1'" . DT  D 2 11  ? 50.667 86.612  56.197 1.00 33.14  ? 1912 DT  F "C1'" 1 
ATOM   1073 N  N1    . DT  D 2 11  ? 50.613 85.635  55.093 1.00 30.78  ? 1912 DT  F N1    1 
ATOM   1074 C  C2    . DT  D 2 11  ? 51.796 85.229  54.503 1.00 30.15  ? 1912 DT  F C2    1 
ATOM   1075 O  O2    . DT  D 2 11  ? 52.883 85.687  54.799 1.00 28.77  ? 1912 DT  F O2    1 
ATOM   1076 N  N3    . DT  D 2 11  ? 51.653 84.262  53.538 1.00 29.01  ? 1912 DT  F N3    1 
ATOM   1077 C  C4    . DT  D 2 11  ? 50.473 83.694  53.097 1.00 30.71  ? 1912 DT  F C4    1 
ATOM   1078 O  O4    . DT  D 2 11  ? 50.496 82.825  52.228 1.00 31.14  ? 1912 DT  F O4    1 
ATOM   1079 C  C5    . DT  D 2 11  ? 49.274 84.194  53.728 1.00 30.75  ? 1912 DT  F C5    1 
ATOM   1080 C  C7    . DT  D 2 11  ? 47.951 83.655  53.286 1.00 31.80  ? 1912 DT  F C7    1 
ATOM   1081 C  C6    . DT  D 2 11  ? 49.402 85.124  54.683 1.00 30.26  ? 1912 DT  F C6    1 
ATOM   1082 P  P     . DT  D 2 12  ? 50.592 90.585  57.563 1.00 44.43  ? 1913 DT  F P     1 
ATOM   1083 O  OP1   . DT  D 2 12  ? 50.882 91.375  58.786 1.00 46.04  ? 1913 DT  F OP1   1 
ATOM   1084 O  OP2   . DT  D 2 12  ? 49.408 90.913  56.727 1.00 43.71  ? 1913 DT  F OP2   1 
ATOM   1085 O  "O5'" . DT  D 2 12  ? 51.879 90.611  56.631 1.00 43.86  ? 1913 DT  F "O5'" 1 
ATOM   1086 C  "C5'" . DT  D 2 12  ? 53.089 90.018  57.080 1.00 42.74  ? 1913 DT  F "C5'" 1 
ATOM   1087 C  "C4'" . DT  D 2 12  ? 54.104 90.007  55.966 1.00 42.44  ? 1913 DT  F "C4'" 1 
ATOM   1088 O  "O4'" . DT  D 2 12  ? 53.841 88.930  55.035 1.00 40.95  ? 1913 DT  F "O4'" 1 
ATOM   1089 C  "C3'" . DT  D 2 12  ? 54.140 91.291  55.142 1.00 42.79  ? 1913 DT  F "C3'" 1 
ATOM   1090 O  "O3'" . DT  D 2 12  ? 55.499 91.647  54.927 1.00 46.23  ? 1913 DT  F "O3'" 1 
ATOM   1091 C  "C2'" . DT  D 2 12  ? 53.462 90.901  53.838 1.00 40.73  ? 1913 DT  F "C2'" 1 
ATOM   1092 C  "C1'" . DT  D 2 12  ? 53.827 89.433  53.710 1.00 38.87  ? 1913 DT  F "C1'" 1 
ATOM   1093 N  N1    . DT  D 2 12  ? 52.895 88.596  52.926 1.00 35.48  ? 1913 DT  F N1    1 
ATOM   1094 C  C2    . DT  D 2 12  ? 53.442 87.607  52.134 1.00 33.16  ? 1913 DT  F C2    1 
ATOM   1095 O  O2    . DT  D 2 12  ? 54.642 87.426  52.025 1.00 32.79  ? 1913 DT  F O2    1 
ATOM   1096 N  N3    . DT  D 2 12  ? 52.528 86.832  51.473 1.00 33.06  ? 1913 DT  F N3    1 
ATOM   1097 C  C4    . DT  D 2 12  ? 51.154 86.940  51.515 1.00 34.41  ? 1913 DT  F C4    1 
ATOM   1098 O  O4    . DT  D 2 12  ? 50.459 86.146  50.879 1.00 32.77  ? 1913 DT  F O4    1 
ATOM   1099 C  C5    . DT  D 2 12  ? 50.645 88.017  52.342 1.00 34.74  ? 1913 DT  F C5    1 
ATOM   1100 C  C7    . DT  D 2 12  ? 49.168 88.228  52.425 1.00 33.69  ? 1913 DT  F C7    1 
ATOM   1101 C  C6    . DT  D 2 12  ? 51.531 88.781  52.999 1.00 33.50  ? 1913 DT  F C6    1 
ATOM   1102 P  P     . DC  D 2 13  ? 55.860 93.064  54.273 1.00 48.38  ? 1914 DC  F P     1 
ATOM   1103 O  OP1   . DC  D 2 13  ? 57.014 93.596  55.042 1.00 47.80  ? 1914 DC  F OP1   1 
ATOM   1104 O  OP2   . DC  D 2 13  ? 54.627 93.878  54.131 1.00 47.72  ? 1914 DC  F OP2   1 
ATOM   1105 O  "O5'" . DC  D 2 13  ? 56.364 92.651  52.825 1.00 45.29  ? 1914 DC  F "O5'" 1 
ATOM   1106 C  "C5'" . DC  D 2 13  ? 57.387 91.679  52.692 1.00 42.23  ? 1914 DC  F "C5'" 1 
ATOM   1107 C  "C4'" . DC  D 2 13  ? 57.550 91.283  51.246 1.00 42.83  ? 1914 DC  F "C4'" 1 
ATOM   1108 O  "O4'" . DC  D 2 13  ? 56.509 90.367  50.839 1.00 42.33  ? 1914 DC  F "O4'" 1 
ATOM   1109 C  "C3'" . DC  D 2 13  ? 57.523 92.440  50.251 1.00 43.43  ? 1914 DC  F "C3'" 1 
ATOM   1110 O  "O3'" . DC  D 2 13  ? 58.613 92.288  49.350 1.00 45.52  ? 1914 DC  F "O3'" 1 
ATOM   1111 C  "C2'" . DC  D 2 13  ? 56.201 92.255  49.521 1.00 42.25  ? 1914 DC  F "C2'" 1 
ATOM   1112 C  "C1'" . DC  D 2 13  ? 56.027 90.749  49.566 1.00 41.78  ? 1914 DC  F "C1'" 1 
ATOM   1113 N  N1    . DC  D 2 13  ? 54.641 90.260  49.440 1.00 40.41  ? 1914 DC  F N1    1 
ATOM   1114 C  C2    . DC  D 2 13  ? 54.396 89.122  48.655 1.00 38.70  ? 1914 DC  F C2    1 
ATOM   1115 O  O2    . DC  D 2 13  ? 55.348 88.568  48.083 1.00 38.89  ? 1914 DC  F O2    1 
ATOM   1116 N  N3    . DC  D 2 13  ? 53.131 88.657  48.542 1.00 37.08  ? 1914 DC  F N3    1 
ATOM   1117 C  C4    . DC  D 2 13  ? 52.134 89.276  49.176 1.00 36.98  ? 1914 DC  F C4    1 
ATOM   1118 N  N4    . DC  D 2 13  ? 50.906 88.775  49.044 1.00 36.98  ? 1914 DC  F N4    1 
ATOM   1119 C  C5    . DC  D 2 13  ? 52.353 90.436  49.977 1.00 37.33  ? 1914 DC  F C5    1 
ATOM   1120 C  C6    . DC  D 2 13  ? 53.609 90.890  50.078 1.00 39.13  ? 1914 DC  F C6    1 
ATOM   1121 P  P     . DC  D 2 14  ? 58.950 93.451  48.308 1.00 47.06  ? 1915 DC  F P     1 
ATOM   1122 O  OP1   . DC  D 2 14  ? 60.422 93.649  48.343 1.00 46.17  ? 1915 DC  F OP1   1 
ATOM   1123 O  OP2   . DC  D 2 14  ? 58.041 94.604  48.535 1.00 47.16  ? 1915 DC  F OP2   1 
ATOM   1124 O  "O5'" . DC  D 2 14  ? 58.562 92.778  46.923 1.00 46.89  ? 1915 DC  F "O5'" 1 
ATOM   1125 C  "C5'" . DC  D 2 14  ? 59.036 91.475  46.613 1.00 44.57  ? 1915 DC  F "C5'" 1 
ATOM   1126 C  "C4'" . DC  D 2 14  ? 58.396 90.981  45.341 1.00 42.96  ? 1915 DC  F "C4'" 1 
ATOM   1127 O  "O4'" . DC  D 2 14  ? 57.082 90.439  45.612 1.00 43.17  ? 1915 DC  F "O4'" 1 
ATOM   1128 C  "C3'" . DC  D 2 14  ? 58.210 92.067  44.282 1.00 41.46  ? 1915 DC  F "C3'" 1 
ATOM   1129 O  "O3'" . DC  D 2 14  ? 58.627 91.570  43.021 1.00 40.62  ? 1915 DC  F "O3'" 1 
ATOM   1130 C  "C2'" . DC  D 2 14  ? 56.713 92.318  44.285 1.00 41.72  ? 1915 DC  F "C2'" 1 
ATOM   1131 C  "C1'" . DC  D 2 14  ? 56.163 90.959  44.671 1.00 42.16  ? 1915 DC  F "C1'" 1 
ATOM   1132 N  N1    . DC  D 2 14  ? 54.835 90.993  45.300 1.00 40.83  ? 1915 DC  F N1    1 
ATOM   1133 C  C2    . DC  D 2 14  ? 53.902 90.025  44.940 1.00 40.50  ? 1915 DC  F C2    1 
ATOM   1134 O  O2    . DC  D 2 14  ? 54.231 89.149  44.129 1.00 41.64  ? 1915 DC  F O2    1 
ATOM   1135 N  N3    . DC  D 2 14  ? 52.666 90.066  45.476 1.00 39.72  ? 1915 DC  F N3    1 
ATOM   1136 C  C4    . DC  D 2 14  ? 52.348 91.028  46.340 1.00 41.21  ? 1915 DC  F C4    1 
ATOM   1137 N  N4    . DC  D 2 14  ? 51.102 91.046  46.825 1.00 39.80  ? 1915 DC  F N4    1 
ATOM   1138 C  C5    . DC  D 2 14  ? 53.290 92.021  46.742 1.00 40.81  ? 1915 DC  F C5    1 
ATOM   1139 C  C6    . DC  D 2 14  ? 54.511 91.962  46.206 1.00 40.77  ? 1915 DC  F C6    1 
ATOM   1140 P  P     . DC  D 2 15  ? 58.640 92.540  41.746 1.00 38.80  ? 1916 DC  F P     1 
ATOM   1141 O  OP1   . DC  D 2 15  ? 60.027 92.622  41.227 1.00 40.46  ? 1916 DC  F OP1   1 
ATOM   1142 O  OP2   . DC  D 2 15  ? 57.905 93.785  42.083 1.00 40.97  ? 1916 DC  F OP2   1 
ATOM   1143 O  "O5'" . DC  D 2 15  ? 57.796 91.693  40.707 1.00 40.11  ? 1916 DC  F "O5'" 1 
ATOM   1144 C  "C5'" . DC  D 2 15  ? 58.105 90.318  40.527 1.00 38.92  ? 1916 DC  F "C5'" 1 
ATOM   1145 C  "C4'" . DC  D 2 15  ? 57.059 89.655  39.672 1.00 38.57  ? 1916 DC  F "C4'" 1 
ATOM   1146 O  "O4'" . DC  D 2 15  ? 55.816 89.541  40.410 1.00 35.55  ? 1916 DC  F "O4'" 1 
ATOM   1147 C  "C3'" . DC  D 2 15  ? 56.735 90.409  38.382 1.00 36.88  ? 1916 DC  F "C3'" 1 
ATOM   1148 O  "O3'" . DC  D 2 15  ? 56.604 89.456  37.326 1.00 39.62  ? 1916 DC  F "O3'" 1 
ATOM   1149 C  "C2'" . DC  D 2 15  ? 55.423 91.104  38.702 1.00 34.88  ? 1916 DC  F "C2'" 1 
ATOM   1150 C  "C1'" . DC  D 2 15  ? 54.761 90.139  39.676 1.00 35.35  ? 1916 DC  F "C1'" 1 
ATOM   1151 N  N1    . DC  D 2 15  ? 53.845 90.759  40.644 1.00 32.85  ? 1916 DC  F N1    1 
ATOM   1152 C  C2    . DC  D 2 15  ? 52.541 90.277  40.732 1.00 32.07  ? 1916 DC  F C2    1 
ATOM   1153 O  O2    . DC  D 2 15  ? 52.195 89.365  39.977 1.00 34.01  ? 1916 DC  F O2    1 
ATOM   1154 N  N3    . DC  D 2 15  ? 51.692 90.815  41.636 1.00 31.56  ? 1916 DC  F N3    1 
ATOM   1155 C  C4    . DC  D 2 15  ? 52.106 91.808  42.427 1.00 32.67  ? 1916 DC  F C4    1 
ATOM   1156 N  N4    . DC  D 2 15  ? 51.237 92.312  43.304 1.00 32.70  ? 1916 DC  F N4    1 
ATOM   1157 C  C5    . DC  D 2 15  ? 53.432 92.328  42.353 1.00 31.23  ? 1916 DC  F C5    1 
ATOM   1158 C  C6    . DC  D 2 15  ? 54.260 91.780  41.455 1.00 32.71  ? 1916 DC  F C6    1 
ATOM   1159 P  P     . DC  D 2 16  ? 56.488 89.949  35.808 1.00 40.44  ? 1917 DC  F P     1 
ATOM   1160 O  OP1   . DC  D 2 16  ? 56.843 88.802  34.946 1.00 42.79  ? 1917 DC  F OP1   1 
ATOM   1161 O  OP2   . DC  D 2 16  ? 57.215 91.233  35.665 1.00 42.76  ? 1917 DC  F OP2   1 
ATOM   1162 O  "O5'" . DC  D 2 16  ? 54.927 90.172  35.661 1.00 41.20  ? 1917 DC  F "O5'" 1 
ATOM   1163 C  "C5'" . DC  D 2 16  ? 54.053 89.116  36.031 1.00 42.58  ? 1917 DC  F "C5'" 1 
ATOM   1164 C  "C4'" . DC  D 2 16  ? 52.614 89.552  35.922 1.00 43.26  ? 1917 DC  F "C4'" 1 
ATOM   1165 O  "O4'" . DC  D 2 16  ? 52.156 90.187  37.141 1.00 42.37  ? 1917 DC  F "O4'" 1 
ATOM   1166 C  "C3'" . DC  D 2 16  ? 52.333 90.528  34.780 1.00 43.11  ? 1917 DC  F "C3'" 1 
ATOM   1167 O  "O3'" . DC  D 2 16  ? 51.283 90.026  33.974 1.00 45.87  ? 1917 DC  F "O3'" 1 
ATOM   1168 C  "C2'" . DC  D 2 16  ? 51.885 91.798  35.484 1.00 43.66  ? 1917 DC  F "C2'" 1 
ATOM   1169 C  "C1'" . DC  D 2 16  ? 51.319 91.274  36.796 1.00 41.96  ? 1917 DC  F "C1'" 1 
ATOM   1170 N  N1    . DC  D 2 16  ? 51.335 92.240  37.914 1.00 39.48  ? 1917 DC  F N1    1 
ATOM   1171 C  C2    . DC  D 2 16  ? 50.200 92.346  38.729 1.00 38.31  ? 1917 DC  F C2    1 
ATOM   1172 O  O2    . DC  D 2 16  ? 49.226 91.616  38.499 1.00 37.04  ? 1917 DC  F O2    1 
ATOM   1173 N  N3    . DC  D 2 16  ? 50.196 93.245  39.745 1.00 38.31  ? 1917 DC  F N3    1 
ATOM   1174 C  C4    . DC  D 2 16  ? 51.268 94.013  39.961 1.00 36.76  ? 1917 DC  F C4    1 
ATOM   1175 N  N4    . DC  D 2 16  ? 51.215 94.888  40.967 1.00 33.90  ? 1917 DC  F N4    1 
ATOM   1176 C  C5    . DC  D 2 16  ? 52.438 93.918  39.155 1.00 37.00  ? 1917 DC  F C5    1 
ATOM   1177 C  C6    . DC  D 2 16  ? 52.430 93.027  38.152 1.00 38.22  ? 1917 DC  F C6    1 
ATOM   1178 P  P     . DC  D 2 17  ? 51.101 90.571  32.480 1.00 46.11  ? 1918 DC  F P     1 
ATOM   1179 O  OP1   . DC  D 2 17  ? 51.419 89.478  31.531 1.00 46.86  ? 1918 DC  F OP1   1 
ATOM   1180 O  OP2   . DC  D 2 17  ? 51.827 91.857  32.378 1.00 47.64  ? 1918 DC  F OP2   1 
ATOM   1181 O  "O5'" . DC  D 2 17  ? 49.535 90.846  32.433 1.00 46.50  ? 1918 DC  F "O5'" 1 
ATOM   1182 C  "C5'" . DC  D 2 17  ? 48.620 89.819  32.808 1.00 43.45  ? 1918 DC  F "C5'" 1 
ATOM   1183 C  "C4'" . DC  D 2 17  ? 47.285 90.407  33.207 1.00 42.66  ? 1918 DC  F "C4'" 1 
ATOM   1184 O  "O4'" . DC  D 2 17  ? 47.382 91.056  34.498 1.00 38.68  ? 1918 DC  F "O4'" 1 
ATOM   1185 C  "C3'" . DC  D 2 17  ? 46.692 91.438  32.240 1.00 43.02  ? 1918 DC  F "C3'" 1 
ATOM   1186 O  "O3'" . DC  D 2 17  ? 45.295 91.223  32.002 1.00 47.49  ? 1918 DC  F "O3'" 1 
ATOM   1187 C  "C2'" . DC  D 2 17  ? 46.816 92.749  32.995 1.00 39.77  ? 1918 DC  F "C2'" 1 
ATOM   1188 C  "C1'" . DC  D 2 17  ? 46.732 92.312  34.449 1.00 37.83  ? 1918 DC  F "C1'" 1 
ATOM   1189 N  N1    . DC  D 2 17  ? 47.436 93.221  35.366 1.00 35.88  ? 1918 DC  F N1    1 
ATOM   1190 C  C2    . DC  D 2 17  ? 46.774 93.693  36.504 1.00 34.70  ? 1918 DC  F C2    1 
ATOM   1191 O  O2    . DC  D 2 17  ? 45.631 93.290  36.742 1.00 33.24  ? 1918 DC  F O2    1 
ATOM   1192 N  N3    . DC  D 2 17  ? 47.402 94.577  37.315 1.00 33.82  ? 1918 DC  F N3    1 
ATOM   1193 C  C4    . DC  D 2 17  ? 48.644 94.978  37.027 1.00 33.55  ? 1918 DC  F C4    1 
ATOM   1194 N  N4    . DC  D 2 17  ? 49.225 95.875  37.837 1.00 31.00  ? 1918 DC  F N4    1 
ATOM   1195 C  C5    . DC  D 2 17  ? 49.349 94.487  35.892 1.00 35.69  ? 1918 DC  F C5    1 
ATOM   1196 C  C6    . DC  D 2 17  ? 48.715 93.619  35.098 1.00 35.25  ? 1918 DC  F C6    1 
ATOM   1197 N  N     . MET E 3 1   ? 72.108 19.651  43.513 1.00 35.63  ? 1    MET A N     1 
ATOM   1198 C  CA    . MET E 3 1   ? 70.976 18.709  43.688 1.00 34.99  ? 1    MET A CA    1 
ATOM   1199 C  C     . MET E 3 1   ? 70.620 18.097  42.350 1.00 32.89  ? 1    MET A C     1 
ATOM   1200 O  O     . MET E 3 1   ? 70.495 18.813  41.365 1.00 34.37  ? 1    MET A O     1 
ATOM   1201 C  CB    . MET E 3 1   ? 69.748 19.443  44.242 1.00 37.83  ? 1    MET A CB    1 
ATOM   1202 C  CG    . MET E 3 1   ? 68.499 18.572  44.335 1.00 45.15  ? 1    MET A CG    1 
ATOM   1203 S  SD    . MET E 3 1   ? 67.115 19.264  45.319 1.00 52.26  ? 1    MET A SD    1 
ATOM   1204 C  CE    . MET E 3 1   ? 66.008 19.759  44.090 1.00 53.10  ? 1    MET A CE    1 
ATOM   1205 N  N     . ILE E 3 2   ? 70.482 16.776  42.304 1.00 30.06  ? 2    ILE A N     1 
ATOM   1206 C  CA    . ILE E 3 2   ? 70.076 16.111  41.063 1.00 30.25  ? 2    ILE A CA    1 
ATOM   1207 C  C     . ILE E 3 2   ? 68.736 15.446  41.371 1.00 28.52  ? 2    ILE A C     1 
ATOM   1208 O  O     . ILE E 3 2   ? 68.634 14.649  42.304 1.00 28.19  ? 2    ILE A O     1 
ATOM   1209 C  CB    . ILE E 3 2   ? 71.074 15.027  40.607 1.00 30.29  ? 2    ILE A CB    1 
ATOM   1210 C  CG1   . ILE E 3 2   ? 72.443 15.653  40.345 1.00 29.68  ? 2    ILE A CG1   1 
ATOM   1211 C  CG2   . ILE E 3 2   ? 70.557 14.353  39.323 1.00 27.15  ? 2    ILE A CG2   1 
ATOM   1212 C  CD1   . ILE E 3 2   ? 73.456 14.652  39.818 1.00 29.64  ? 2    ILE A CD1   1 
ATOM   1213 N  N     . VAL E 3 3   ? 67.713 15.793  40.597 1.00 29.09  ? 3    VAL A N     1 
ATOM   1214 C  CA    . VAL E 3 3   ? 66.373 15.253  40.813 1.00 26.76  ? 3    VAL A CA    1 
ATOM   1215 C  C     . VAL E 3 3   ? 65.899 14.357  39.677 1.00 26.92  ? 3    VAL A C     1 
ATOM   1216 O  O     . VAL E 3 3   ? 66.103 14.657  38.494 1.00 25.49  ? 3    VAL A O     1 
ATOM   1217 C  CB    . VAL E 3 3   ? 65.337 16.395  41.007 1.00 24.39  ? 3    VAL A CB    1 
ATOM   1218 C  CG1   . VAL E 3 3   ? 63.944 15.819  41.246 1.00 22.08  ? 3    VAL A CG1   1 
ATOM   1219 C  CG2   . VAL E 3 3   ? 65.738 17.254  42.180 1.00 24.29  ? 3    VAL A CG2   1 
ATOM   1220 N  N     . LEU E 3 4   ? 65.262 13.256  40.057 1.00 25.09  ? 4    LEU A N     1 
ATOM   1221 C  CA    . LEU E 3 4   ? 64.724 12.288  39.107 1.00 26.74  ? 4    LEU A CA    1 
ATOM   1222 C  C     . LEU E 3 4   ? 63.233 12.145  39.435 1.00 26.07  ? 4    LEU A C     1 
ATOM   1223 O  O     . LEU E 3 4   ? 62.863 11.695  40.529 1.00 24.71  ? 4    LEU A O     1 
ATOM   1224 C  CB    . LEU E 3 4   ? 65.456 10.949  39.260 1.00 26.82  ? 4    LEU A CB    1 
ATOM   1225 C  CG    . LEU E 3 4   ? 65.251 9.895   38.166 1.00 27.73  ? 4    LEU A CG    1 
ATOM   1226 C  CD1   . LEU E 3 4   ? 66.417 8.908   38.185 1.00 24.56  ? 4    LEU A CD1   1 
ATOM   1227 C  CD2   . LEU E 3 4   ? 63.929 9.189   38.368 1.00 24.79  ? 4    LEU A CD2   1 
ATOM   1228 N  N     . PHE E 3 5   ? 62.401 12.561  38.482 1.00 22.94  ? 5    PHE A N     1 
ATOM   1229 C  CA    . PHE E 3 5   ? 60.950 12.551  38.601 1.00 21.62  ? 5    PHE A CA    1 
ATOM   1230 C  C     . PHE E 3 5   ? 60.394 11.418  37.756 1.00 21.94  ? 5    PHE A C     1 
ATOM   1231 O  O     . PHE E 3 5   ? 60.838 11.202  36.631 1.00 21.91  ? 5    PHE A O     1 
ATOM   1232 C  CB    . PHE E 3 5   ? 60.408 13.915  38.115 1.00 25.17  ? 5    PHE A CB    1 
ATOM   1233 C  CG    . PHE E 3 5   ? 58.898 13.987  37.971 1.00 23.10  ? 5    PHE A CG    1 
ATOM   1234 C  CD1   . PHE E 3 5   ? 58.071 14.057  39.087 1.00 24.34  ? 5    PHE A CD1   1 
ATOM   1235 C  CD2   . PHE E 3 5   ? 58.314 14.023  36.708 1.00 22.99  ? 5    PHE A CD2   1 
ATOM   1236 C  CE1   . PHE E 3 5   ? 56.676 14.168  38.950 1.00 24.58  ? 5    PHE A CE1   1 
ATOM   1237 C  CE2   . PHE E 3 5   ? 56.923 14.132  36.552 1.00 23.87  ? 5    PHE A CE2   1 
ATOM   1238 C  CZ    . PHE E 3 5   ? 56.100 14.206  37.680 1.00 21.99  ? 5    PHE A CZ    1 
ATOM   1239 N  N     . VAL E 3 6   ? 59.431 10.686  38.312 1.00 23.04  ? 6    VAL A N     1 
ATOM   1240 C  CA    . VAL E 3 6   ? 58.792 9.578   37.613 1.00 21.71  ? 6    VAL A CA    1 
ATOM   1241 C  C     . VAL E 3 6   ? 57.283 9.797   37.563 1.00 22.90  ? 6    VAL A C     1 
ATOM   1242 O  O     . VAL E 3 6   ? 56.654 10.093  38.583 1.00 23.17  ? 6    VAL A O     1 
ATOM   1243 C  CB    . VAL E 3 6   ? 59.049 8.241   38.306 1.00 22.91  ? 6    VAL A CB    1 
ATOM   1244 C  CG1   . VAL E 3 6   ? 58.400 7.129   37.505 1.00 20.88  ? 6    VAL A CG1   1 
ATOM   1245 C  CG2   . VAL E 3 6   ? 60.545 7.994   38.445 1.00 21.48  ? 6    VAL A CG2   1 
ATOM   1246 N  N     . ASP E 3 7   ? 56.714 9.627   36.376 1.00 21.45  ? 7    ASP A N     1 
ATOM   1247 C  CA    . ASP E 3 7   ? 55.282 9.828   36.133 1.00 23.77  ? 7    ASP A CA    1 
ATOM   1248 C  C     . ASP E 3 7   ? 54.825 8.634   35.304 1.00 23.87  ? 7    ASP A C     1 
ATOM   1249 O  O     . ASP E 3 7   ? 55.311 8.457   34.186 1.00 23.76  ? 7    ASP A O     1 
ATOM   1250 C  CB    . ASP E 3 7   ? 55.103 11.104  35.312 1.00 24.92  ? 7    ASP A CB    1 
ATOM   1251 C  CG    . ASP E 3 7   ? 53.669 11.582  35.256 1.00 28.46  ? 7    ASP A CG    1 
ATOM   1252 O  OD1   . ASP E 3 7   ? 52.735 10.773  35.414 1.00 30.00  ? 7    ASP A OD1   1 
ATOM   1253 O  OD2   . ASP E 3 7   ? 53.481 12.795  35.034 1.00 35.16  ? 7    ASP A OD2   1 
ATOM   1254 N  N     . PHE E 3 8   ? 53.907 7.819   35.831 1.00 23.54  ? 8    PHE A N     1 
ATOM   1255 C  CA    . PHE E 3 8   ? 53.441 6.625   35.107 1.00 22.88  ? 8    PHE A CA    1 
ATOM   1256 C  C     . PHE E 3 8   ? 52.604 7.016   33.876 1.00 23.14  ? 8    PHE A C     1 
ATOM   1257 O  O     . PHE E 3 8   ? 51.809 7.939   33.946 1.00 21.51  ? 8    PHE A O     1 
ATOM   1258 C  CB    . PHE E 3 8   ? 52.619 5.731   36.044 1.00 23.05  ? 8    PHE A CB    1 
ATOM   1259 C  CG    . PHE E 3 8   ? 53.203 5.588   37.439 1.00 20.60  ? 8    PHE A CG    1 
ATOM   1260 C  CD1   . PHE E 3 8   ? 54.571 5.675   37.659 1.00 19.71  ? 8    PHE A CD1   1 
ATOM   1261 C  CD2   . PHE E 3 8   ? 52.370 5.342   38.528 1.00 21.73  ? 8    PHE A CD2   1 
ATOM   1262 C  CE1   . PHE E 3 8   ? 55.110 5.524   38.947 1.00 21.39  ? 8    PHE A CE1   1 
ATOM   1263 C  CE2   . PHE E 3 8   ? 52.895 5.188   39.824 1.00 20.71  ? 8    PHE A CE2   1 
ATOM   1264 C  CZ    . PHE E 3 8   ? 54.273 5.279   40.028 1.00 20.93  ? 8    PHE A CZ    1 
ATOM   1265 N  N     . ASP E 3 9   ? 52.784 6.319   32.751 1.00 25.29  ? 9    ASP A N     1 
ATOM   1266 C  CA    . ASP E 3 9   ? 52.054 6.651   31.516 1.00 23.21  ? 9    ASP A CA    1 
ATOM   1267 C  C     . ASP E 3 9   ? 50.570 6.273   31.553 1.00 24.21  ? 9    ASP A C     1 
ATOM   1268 O  O     . ASP E 3 9   ? 50.220 5.162   31.976 1.00 23.32  ? 9    ASP A O     1 
ATOM   1269 C  CB    . ASP E 3 9   ? 52.719 5.981   30.304 1.00 24.23  ? 9    ASP A CB    1 
ATOM   1270 C  CG    . ASP E 3 9   ? 54.205 6.323   30.165 1.00 25.84  ? 9    ASP A CG    1 
ATOM   1271 O  OD1   . ASP E 3 9   ? 54.600 7.492   30.354 1.00 23.74  ? 9    ASP A OD1   1 
ATOM   1272 O  OD2   . ASP E 3 9   ? 54.991 5.406   29.846 1.00 28.82  ? 9    ASP A OD2   1 
ATOM   1273 N  N     . TYR E 3 10  ? 49.717 7.197   31.093 1.00 22.50  ? 10   TYR A N     1 
ATOM   1274 C  CA    . TYR E 3 10  ? 48.256 7.041   31.066 1.00 21.78  ? 10   TYR A CA    1 
ATOM   1275 C  C     . TYR E 3 10  ? 47.840 6.016   32.101 1.00 23.51  ? 10   TYR A C     1 
ATOM   1276 O  O     . TYR E 3 10  ? 47.107 5.066   31.817 1.00 21.74  ? 10   TYR A O     1 
ATOM   1277 C  CB    . TYR E 3 10  ? 47.777 6.646   29.655 1.00 25.66  ? 10   TYR A CB    1 
ATOM   1278 C  CG    . TYR E 3 10  ? 48.306 5.336   29.100 1.00 28.58  ? 10   TYR A CG    1 
ATOM   1279 C  CD1   . TYR E 3 10  ? 47.463 4.229   28.945 1.00 28.44  ? 10   TYR A CD1   1 
ATOM   1280 C  CD2   . TYR E 3 10  ? 49.638 5.206   28.708 1.00 29.02  ? 10   TYR A CD2   1 
ATOM   1281 C  CE1   . TYR E 3 10  ? 47.934 3.033   28.414 1.00 28.11  ? 10   TYR A CE1   1 
ATOM   1282 C  CE2   . TYR E 3 10  ? 50.119 4.011   28.177 1.00 30.08  ? 10   TYR A CE2   1 
ATOM   1283 C  CZ    . TYR E 3 10  ? 49.262 2.929   28.034 1.00 29.89  ? 10   TYR A CZ    1 
ATOM   1284 O  OH    . TYR E 3 10  ? 49.748 1.741   27.533 1.00 30.61  ? 10   TYR A OH    1 
ATOM   1285 N  N     . PHE E 3 11  ? 48.300 6.261   33.325 1.00 22.02  ? 11   PHE A N     1 
ATOM   1286 C  CA    . PHE E 3 11  ? 48.122 5.345   34.435 1.00 22.55  ? 11   PHE A CA    1 
ATOM   1287 C  C     . PHE E 3 11  ? 46.859 4.520   34.615 1.00 20.77  ? 11   PHE A C     1 
ATOM   1288 O  O     . PHE E 3 11  ? 46.934 3.306   34.502 1.00 20.63  ? 11   PHE A O     1 
ATOM   1289 C  CB    . PHE E 3 11  ? 48.451 6.031   35.757 1.00 21.26  ? 11   PHE A CB    1 
ATOM   1290 C  CG    . PHE E 3 11  ? 48.701 5.061   36.868 1.00 22.55  ? 11   PHE A CG    1 
ATOM   1291 C  CD1   . PHE E 3 11  ? 49.550 3.969   36.662 1.00 24.17  ? 11   PHE A CD1   1 
ATOM   1292 C  CD2   . PHE E 3 11  ? 48.081 5.208   38.103 1.00 21.35  ? 11   PHE A CD2   1 
ATOM   1293 C  CE1   . PHE E 3 11  ? 49.778 3.031   37.674 1.00 20.48  ? 11   PHE A CE1   1 
ATOM   1294 C  CE2   . PHE E 3 11  ? 48.305 4.278   39.122 1.00 24.78  ? 11   PHE A CE2   1 
ATOM   1295 C  CZ    . PHE E 3 11  ? 49.154 3.183   38.902 1.00 21.47  ? 11   PHE A CZ    1 
ATOM   1296 N  N     . TYR E 3 12  ? 45.720 5.139   34.916 1.00 20.96  ? 12   TYR A N     1 
ATOM   1297 C  CA    . TYR E 3 12  ? 44.491 4.361   35.117 1.00 23.54  ? 12   TYR A CA    1 
ATOM   1298 C  C     . TYR E 3 12  ? 44.186 3.443   33.946 1.00 24.30  ? 12   TYR A C     1 
ATOM   1299 O  O     . TYR E 3 12  ? 43.810 2.283   34.131 1.00 24.71  ? 12   TYR A O     1 
ATOM   1300 C  CB    . TYR E 3 12  ? 43.284 5.278   35.352 1.00 22.73  ? 12   TYR A CB    1 
ATOM   1301 C  CG    . TYR E 3 12  ? 43.268 6.005   36.680 1.00 26.34  ? 12   TYR A CG    1 
ATOM   1302 C  CD1   . TYR E 3 12  ? 44.406 6.059   37.488 1.00 27.41  ? 12   TYR A CD1   1 
ATOM   1303 C  CD2   . TYR E 3 12  ? 42.126 6.694   37.103 1.00 28.70  ? 12   TYR A CD2   1 
ATOM   1304 C  CE1   . TYR E 3 12  ? 44.406 6.778   38.667 1.00 29.00  ? 12   TYR A CE1   1 
ATOM   1305 C  CE2   . TYR E 3 12  ? 42.120 7.422   38.288 1.00 26.81  ? 12   TYR A CE2   1 
ATOM   1306 C  CZ    . TYR E 3 12  ? 43.260 7.461   39.061 1.00 29.67  ? 12   TYR A CZ    1 
ATOM   1307 O  OH    . TYR E 3 12  ? 43.270 8.192   40.226 1.00 29.75  ? 12   TYR A OH    1 
ATOM   1308 N  N     . ALA E 3 13  ? 44.355 3.956   32.735 1.00 24.31  ? 13   ALA A N     1 
ATOM   1309 C  CA    . ALA E 3 13  ? 44.075 3.161   31.550 1.00 24.11  ? 13   ALA A CA    1 
ATOM   1310 C  C     . ALA E 3 13  ? 45.112 2.052   31.360 1.00 24.33  ? 13   ALA A C     1 
ATOM   1311 O  O     . ALA E 3 13  ? 44.765 0.915   31.002 1.00 22.66  ? 13   ALA A O     1 
ATOM   1312 C  CB    . ALA E 3 13  ? 44.033 4.069   30.311 1.00 25.51  ? 13   ALA A CB    1 
ATOM   1313 N  N     . GLN E 3 14  ? 46.379 2.375   31.596 1.00 20.95  ? 14   GLN A N     1 
ATOM   1314 C  CA    . GLN E 3 14  ? 47.428 1.378   31.427 1.00 22.37  ? 14   GLN A CA    1 
ATOM   1315 C  C     . GLN E 3 14  ? 47.218 0.239   32.417 1.00 20.70  ? 14   GLN A C     1 
ATOM   1316 O  O     . GLN E 3 14  ? 47.405 -0.920  32.066 1.00 20.46  ? 14   GLN A O     1 
ATOM   1317 C  CB    . GLN E 3 14  ? 48.827 1.990   31.614 1.00 20.78  ? 14   GLN A CB    1 
ATOM   1318 C  CG    . GLN E 3 14  ? 49.943 1.069   31.080 1.00 22.82  ? 14   GLN A CG    1 
ATOM   1319 C  CD    . GLN E 3 14  ? 51.361 1.552   31.370 1.00 23.99  ? 14   GLN A CD    1 
ATOM   1320 O  OE1   . GLN E 3 14  ? 52.327 0.825   31.130 1.00 27.21  ? 14   GLN A OE1   1 
ATOM   1321 N  NE2   . GLN E 3 14  ? 51.494 2.775   31.883 1.00 23.45  ? 14   GLN A NE2   1 
ATOM   1322 N  N     . VAL E 3 15  ? 46.818 0.558   33.647 1.00 20.45  ? 15   VAL A N     1 
ATOM   1323 C  CA    . VAL E 3 15  ? 46.591 -0.495  34.632 1.00 22.30  ? 15   VAL A CA    1 
ATOM   1324 C  C     . VAL E 3 15  ? 45.493 -1.442  34.145 1.00 23.68  ? 15   VAL A C     1 
ATOM   1325 O  O     . VAL E 3 15  ? 45.612 -2.658  34.284 1.00 22.18  ? 15   VAL A O     1 
ATOM   1326 C  CB    . VAL E 3 15  ? 46.183 0.072   36.006 1.00 22.49  ? 15   VAL A CB    1 
ATOM   1327 C  CG1   . VAL E 3 15  ? 45.724 -1.057  36.913 1.00 18.97  ? 15   VAL A CG1   1 
ATOM   1328 C  CG2   . VAL E 3 15  ? 47.359 0.787   36.637 1.00 19.26  ? 15   VAL A CG2   1 
ATOM   1329 N  N     . GLU E 3 16  ? 44.425 -0.886  33.577 1.00 22.86  ? 16   GLU A N     1 
ATOM   1330 C  CA    . GLU E 3 16  ? 43.340 -1.719  33.065 1.00 25.75  ? 16   GLU A CA    1 
ATOM   1331 C  C     . GLU E 3 16  ? 43.876 -2.620  31.943 1.00 26.75  ? 16   GLU A C     1 
ATOM   1332 O  O     . GLU E 3 16  ? 43.484 -3.786  31.846 1.00 28.76  ? 16   GLU A O     1 
ATOM   1333 C  CB    . GLU E 3 16  ? 42.180 -0.852  32.550 1.00 24.79  ? 16   GLU A CB    1 
ATOM   1334 C  CG    . GLU E 3 16  ? 41.427 -0.065  33.646 1.00 26.63  ? 16   GLU A CG    1 
ATOM   1335 C  CD    . GLU E 3 16  ? 40.655 -0.965  34.611 1.00 29.07  ? 16   GLU A CD    1 
ATOM   1336 O  OE1   . GLU E 3 16  ? 40.473 -2.162  34.308 1.00 30.33  ? 16   GLU A OE1   1 
ATOM   1337 O  OE2   . GLU E 3 16  ? 40.220 -0.479  35.674 1.00 27.67  ? 16   GLU A OE2   1 
ATOM   1338 N  N     . GLU E 3 17  ? 44.778 -2.089  31.114 1.00 25.87  ? 17   GLU A N     1 
ATOM   1339 C  CA    . GLU E 3 17  ? 45.372 -2.867  30.018 1.00 30.15  ? 17   GLU A CA    1 
ATOM   1340 C  C     . GLU E 3 17  ? 46.276 -3.984  30.547 1.00 29.77  ? 17   GLU A C     1 
ATOM   1341 O  O     . GLU E 3 17  ? 46.400 -5.039  29.916 1.00 30.19  ? 17   GLU A O     1 
ATOM   1342 C  CB    . GLU E 3 17  ? 46.226 -1.992  29.089 1.00 29.71  ? 17   GLU A CB    1 
ATOM   1343 C  CG    . GLU E 3 17  ? 45.512 -0.843  28.426 1.00 35.74  ? 17   GLU A CG    1 
ATOM   1344 C  CD    . GLU E 3 17  ? 46.416 -0.111  27.449 1.00 39.17  ? 17   GLU A CD    1 
ATOM   1345 O  OE1   . GLU E 3 17  ? 47.653 -0.142  27.643 1.00 39.44  ? 17   GLU A OE1   1 
ATOM   1346 O  OE2   . GLU E 3 17  ? 45.891 0.505   26.496 1.00 40.49  ? 17   GLU A OE2   1 
ATOM   1347 N  N     . VAL E 3 18  ? 46.943 -3.742  31.674 1.00 27.44  ? 18   VAL A N     1 
ATOM   1348 C  CA    . VAL E 3 18  ? 47.813 -4.770  32.234 1.00 27.77  ? 18   VAL A CA    1 
ATOM   1349 C  C     . VAL E 3 18  ? 46.938 -5.875  32.796 1.00 28.95  ? 18   VAL A C     1 
ATOM   1350 O  O     . VAL E 3 18  ? 47.269 -7.056  32.686 1.00 30.85  ? 18   VAL A O     1 
ATOM   1351 C  CB    . VAL E 3 18  ? 48.724 -4.219  33.351 1.00 27.79  ? 18   VAL A CB    1 
ATOM   1352 C  CG1   . VAL E 3 18  ? 49.534 -5.359  33.971 1.00 28.80  ? 18   VAL A CG1   1 
ATOM   1353 C  CG2   . VAL E 3 18  ? 49.666 -3.170  32.787 1.00 26.13  ? 18   VAL A CG2   1 
ATOM   1354 N  N     . LEU E 3 19  ? 45.810 -5.492  33.389 1.00 28.61  ? 19   LEU A N     1 
ATOM   1355 C  CA    . LEU E 3 19  ? 44.884 -6.462  33.951 1.00 29.58  ? 19   LEU A CA    1 
ATOM   1356 C  C     . LEU E 3 19  ? 44.039 -7.140  32.876 1.00 29.98  ? 19   LEU A C     1 
ATOM   1357 O  O     . LEU E 3 19  ? 43.412 -8.161  33.140 1.00 29.39  ? 19   LEU A O     1 
ATOM   1358 C  CB    . LEU E 3 19  ? 43.980 -5.798  34.994 1.00 28.19  ? 19   LEU A CB    1 
ATOM   1359 C  CG    . LEU E 3 19  ? 44.522 -5.909  36.428 1.00 29.11  ? 19   LEU A CG    1 
ATOM   1360 C  CD1   . LEU E 3 19  ? 45.934 -5.344  36.492 1.00 29.71  ? 19   LEU A CD1   1 
ATOM   1361 C  CD2   . LEU E 3 19  ? 43.597 -5.182  37.387 1.00 28.18  ? 19   LEU A CD2   1 
ATOM   1362 N  N     . ASN E 3 20  ? 44.024 -6.575  31.670 1.00 29.81  ? 20   ASN A N     1 
ATOM   1363 C  CA    . ASN E 3 20  ? 43.268 -7.160  30.562 1.00 32.36  ? 20   ASN A CA    1 
ATOM   1364 C  C     . ASN E 3 20  ? 43.957 -6.827  29.238 1.00 33.11  ? 20   ASN A C     1 
ATOM   1365 O  O     . ASN E 3 20  ? 43.572 -5.888  28.543 1.00 32.73  ? 20   ASN A O     1 
ATOM   1366 C  CB    . ASN E 3 20  ? 41.827 -6.634  30.546 1.00 32.73  ? 20   ASN A CB    1 
ATOM   1367 C  CG    . ASN E 3 20  ? 40.982 -7.299  29.474 1.00 36.18  ? 20   ASN A CG    1 
ATOM   1368 O  OD1   . ASN E 3 20  ? 41.495 -8.056  28.651 1.00 36.36  ? 20   ASN A OD1   1 
ATOM   1369 N  ND2   . ASN E 3 20  ? 39.683 -7.014  29.473 1.00 35.04  ? 20   ASN A ND2   1 
ATOM   1370 N  N     . PRO E 3 21  ? 44.990 -7.604  28.877 1.00 34.58  ? 21   PRO A N     1 
ATOM   1371 C  CA    . PRO E 3 21  ? 45.800 -7.468  27.661 1.00 35.10  ? 21   PRO A CA    1 
ATOM   1372 C  C     . PRO E 3 21  ? 45.055 -7.273  26.338 1.00 35.58  ? 21   PRO A C     1 
ATOM   1373 O  O     . PRO E 3 21  ? 45.578 -6.647  25.420 1.00 34.66  ? 21   PRO A O     1 
ATOM   1374 C  CB    . PRO E 3 21  ? 46.630 -8.748  27.665 1.00 37.84  ? 21   PRO A CB    1 
ATOM   1375 C  CG    . PRO E 3 21  ? 46.842 -8.993  29.115 1.00 36.69  ? 21   PRO A CG    1 
ATOM   1376 C  CD    . PRO E 3 21  ? 45.469 -8.740  29.689 1.00 35.01  ? 21   PRO A CD    1 
ATOM   1377 N  N     . SER E 3 22  ? 43.847 -7.810  26.227 1.00 34.61  ? 22   SER A N     1 
ATOM   1378 C  CA    . SER E 3 22  ? 43.100 -7.660  24.990 1.00 36.77  ? 22   SER A CA    1 
ATOM   1379 C  C     . SER E 3 22  ? 42.759 -6.194  24.724 1.00 36.39  ? 22   SER A C     1 
ATOM   1380 O  O     . SER E 3 22  ? 42.376 -5.839  23.609 1.00 36.10  ? 22   SER A O     1 
ATOM   1381 C  CB    . SER E 3 22  ? 41.813 -8.488  25.036 1.00 37.63  ? 22   SER A CB    1 
ATOM   1382 O  OG    . SER E 3 22  ? 40.896 -7.928  25.952 1.00 40.08  ? 22   SER A OG    1 
ATOM   1383 N  N     . LEU E 3 23  ? 42.897 -5.347  25.743 1.00 35.27  ? 23   LEU A N     1 
ATOM   1384 C  CA    . LEU E 3 23  ? 42.601 -3.921  25.601 1.00 35.14  ? 23   LEU A CA    1 
ATOM   1385 C  C     . LEU E 3 23  ? 43.712 -3.165  24.890 1.00 35.03  ? 23   LEU A C     1 
ATOM   1386 O  O     . LEU E 3 23  ? 43.478 -2.103  24.306 1.00 34.41  ? 23   LEU A O     1 
ATOM   1387 C  CB    . LEU E 3 23  ? 42.369 -3.273  26.972 1.00 33.71  ? 23   LEU A CB    1 
ATOM   1388 C  CG    . LEU E 3 23  ? 41.117 -3.696  27.735 1.00 33.86  ? 23   LEU A CG    1 
ATOM   1389 C  CD1   . LEU E 3 23  ? 41.085 -2.997  29.079 1.00 33.97  ? 23   LEU A CD1   1 
ATOM   1390 C  CD2   . LEU E 3 23  ? 39.888 -3.357  26.927 1.00 32.14  ? 23   LEU A CD2   1 
ATOM   1391 N  N     . LYS E 3 24  ? 44.924 -3.701  24.949 1.00 34.93  ? 24   LYS A N     1 
ATOM   1392 C  CA    . LYS E 3 24  ? 46.064 -3.055  24.306 1.00 37.21  ? 24   LYS A CA    1 
ATOM   1393 C  C     . LYS E 3 24  ? 45.777 -2.825  22.827 1.00 35.97  ? 24   LYS A C     1 
ATOM   1394 O  O     . LYS E 3 24  ? 45.349 -3.735  22.125 1.00 36.08  ? 24   LYS A O     1 
ATOM   1395 C  CB    . LYS E 3 24  ? 47.320 -3.918  24.479 1.00 39.34  ? 24   LYS A CB    1 
ATOM   1396 C  CG    . LYS E 3 24  ? 47.701 -4.125  25.941 1.00 43.74  ? 24   LYS A CG    1 
ATOM   1397 C  CD    . LYS E 3 24  ? 48.839 -5.125  26.125 1.00 45.61  ? 24   LYS A CD    1 
ATOM   1398 C  CE    . LYS E 3 24  ? 49.180 -5.271  27.605 1.00 47.67  ? 24   LYS A CE    1 
ATOM   1399 N  NZ    . LYS E 3 24  ? 50.245 -6.288  27.841 1.00 52.47  ? 24   LYS A NZ    1 
ATOM   1400 N  N     . GLY E 3 25  ? 45.992 -1.602  22.355 1.00 37.00  ? 25   GLY A N     1 
ATOM   1401 C  CA    . GLY E 3 25  ? 45.739 -1.318  20.951 1.00 35.89  ? 25   GLY A CA    1 
ATOM   1402 C  C     . GLY E 3 25  ? 44.378 -0.703  20.664 1.00 36.60  ? 25   GLY A C     1 
ATOM   1403 O  O     . GLY E 3 25  ? 44.169 -0.130  19.597 1.00 37.80  ? 25   GLY A O     1 
ATOM   1404 N  N     . LYS E 3 26  ? 43.441 -0.815  21.599 1.00 33.03  ? 26   LYS A N     1 
ATOM   1405 C  CA    . LYS E 3 26  ? 42.119 -0.228  21.391 1.00 31.75  ? 26   LYS A CA    1 
ATOM   1406 C  C     . LYS E 3 26  ? 42.017 1.068   22.187 1.00 30.33  ? 26   LYS A C     1 
ATOM   1407 O  O     . LYS E 3 26  ? 42.742 1.264   23.148 1.00 27.82  ? 26   LYS A O     1 
ATOM   1408 C  CB    . LYS E 3 26  ? 41.019 -1.159  21.905 1.00 32.64  ? 26   LYS A CB    1 
ATOM   1409 C  CG    . LYS E 3 26  ? 41.072 -2.596  21.421 1.00 35.65  ? 26   LYS A CG    1 
ATOM   1410 C  CD    . LYS E 3 26  ? 39.866 -3.362  21.958 1.00 37.34  ? 26   LYS A CD    1 
ATOM   1411 C  CE    . LYS E 3 26  ? 39.952 -4.849  21.644 1.00 41.09  ? 26   LYS A CE    1 
ATOM   1412 N  NZ    . LYS E 3 26  ? 38.715 -5.579  22.065 1.00 42.73  ? 26   LYS A NZ    1 
ATOM   1413 N  N     . PRO E 3 27  ? 41.134 1.985   21.782 1.00 29.40  ? 27   PRO A N     1 
ATOM   1414 C  CA    . PRO E 3 27  ? 41.060 3.198   22.597 1.00 29.08  ? 27   PRO A CA    1 
ATOM   1415 C  C     . PRO E 3 27  ? 40.354 2.793   23.892 1.00 29.51  ? 27   PRO A C     1 
ATOM   1416 O  O     . PRO E 3 27  ? 39.325 2.099   23.859 1.00 29.33  ? 27   PRO A O     1 
ATOM   1417 C  CB    . PRO E 3 27  ? 40.223 4.142   21.738 1.00 28.75  ? 27   PRO A CB    1 
ATOM   1418 C  CG    . PRO E 3 27  ? 39.361 3.206   20.944 1.00 31.59  ? 27   PRO A CG    1 
ATOM   1419 C  CD    . PRO E 3 27  ? 40.339 2.125   20.552 1.00 30.84  ? 27   PRO A CD    1 
ATOM   1420 N  N     . VAL E 3 28  ? 40.914 3.188   25.030 1.00 27.37  ? 28   VAL A N     1 
ATOM   1421 C  CA    . VAL E 3 28  ? 40.324 2.845   26.323 1.00 25.19  ? 28   VAL A CA    1 
ATOM   1422 C  C     . VAL E 3 28  ? 40.098 4.119   27.117 1.00 25.17  ? 28   VAL A C     1 
ATOM   1423 O  O     . VAL E 3 28  ? 41.001 4.952   27.226 1.00 24.59  ? 28   VAL A O     1 
ATOM   1424 C  CB    . VAL E 3 28  ? 41.244 1.917   27.132 1.00 25.91  ? 28   VAL A CB    1 
ATOM   1425 C  CG1   . VAL E 3 28  ? 40.622 1.627   28.507 1.00 26.55  ? 28   VAL A CG1   1 
ATOM   1426 C  CG2   . VAL E 3 28  ? 41.460 0.624   26.376 1.00 26.57  ? 28   VAL A CG2   1 
ATOM   1427 N  N     . VAL E 3 29  ? 38.900 4.256   27.676 1.00 23.16  ? 29   VAL A N     1 
ATOM   1428 C  CA    . VAL E 3 29  ? 38.533 5.448   28.429 1.00 23.16  ? 29   VAL A CA    1 
ATOM   1429 C  C     . VAL E 3 29  ? 38.051 5.086   29.839 1.00 23.34  ? 29   VAL A C     1 
ATOM   1430 O  O     . VAL E 3 29  ? 37.038 4.395   29.986 1.00 24.36  ? 29   VAL A O     1 
ATOM   1431 C  CB    . VAL E 3 29  ? 37.398 6.206   27.687 1.00 24.05  ? 29   VAL A CB    1 
ATOM   1432 C  CG1   . VAL E 3 29  ? 37.221 7.591   28.266 1.00 21.04  ? 29   VAL A CG1   1 
ATOM   1433 C  CG2   . VAL E 3 29  ? 37.709 6.281   26.192 1.00 21.13  ? 29   VAL A CG2   1 
ATOM   1434 N  N     . VAL E 3 30  ? 38.777 5.524   30.869 1.00 23.09  ? 30   VAL A N     1 
ATOM   1435 C  CA    . VAL E 3 30  ? 38.372 5.241   32.252 1.00 22.84  ? 30   VAL A CA    1 
ATOM   1436 C  C     . VAL E 3 30  ? 37.386 6.349   32.655 1.00 23.60  ? 30   VAL A C     1 
ATOM   1437 O  O     . VAL E 3 30  ? 37.696 7.536   32.582 1.00 21.33  ? 30   VAL A O     1 
ATOM   1438 C  CB    . VAL E 3 30  ? 39.583 5.211   33.199 1.00 23.88  ? 30   VAL A CB    1 
ATOM   1439 C  CG1   . VAL E 3 30  ? 39.121 4.886   34.644 1.00 18.92  ? 30   VAL A CG1   1 
ATOM   1440 C  CG2   . VAL E 3 30  ? 40.583 4.158   32.719 1.00 21.59  ? 30   VAL A CG2   1 
ATOM   1441 N  N     . CYS E 3 31  ? 36.197 5.951   33.082 1.00 24.65  ? 31   CYS A N     1 
ATOM   1442 C  CA    . CYS E 3 31  ? 35.158 6.920   33.385 1.00 29.37  ? 31   CYS A CA    1 
ATOM   1443 C  C     . CYS E 3 31  ? 34.671 7.010   34.822 1.00 29.88  ? 31   CYS A C     1 
ATOM   1444 O  O     . CYS E 3 31  ? 34.680 6.028   35.558 1.00 27.99  ? 31   CYS A O     1 
ATOM   1445 C  CB    . CYS E 3 31  ? 33.941 6.636   32.494 1.00 29.27  ? 31   CYS A CB    1 
ATOM   1446 S  SG    . CYS E 3 31  ? 34.302 6.436   30.729 1.00 33.30  ? 31   CYS A SG    1 
ATOM   1447 N  N     . VAL E 3 32  ? 34.226 8.205   35.198 1.00 30.92  ? 32   VAL A N     1 
ATOM   1448 C  CA    . VAL E 3 32  ? 33.662 8.442   36.523 1.00 33.52  ? 32   VAL A CA    1 
ATOM   1449 C  C     . VAL E 3 32  ? 32.172 8.707   36.290 1.00 32.79  ? 32   VAL A C     1 
ATOM   1450 O  O     . VAL E 3 32  ? 31.772 9.832   36.010 1.00 33.72  ? 32   VAL A O     1 
ATOM   1451 C  CB    . VAL E 3 32  ? 34.298 9.671   37.212 1.00 33.29  ? 32   VAL A CB    1 
ATOM   1452 C  CG1   . VAL E 3 32  ? 33.613 9.923   38.544 1.00 33.92  ? 32   VAL A CG1   1 
ATOM   1453 C  CG2   . VAL E 3 32  ? 35.790 9.437   37.439 1.00 31.65  ? 32   VAL A CG2   1 
ATOM   1454 N  N     . PHE E 3 33  ? 31.364 7.655   36.374 1.00 34.92  ? 33   PHE A N     1 
ATOM   1455 C  CA    . PHE E 3 33  ? 29.915 7.757   36.169 1.00 38.39  ? 33   PHE A CA    1 
ATOM   1456 C  C     . PHE E 3 33  ? 29.248 8.393   37.397 1.00 40.93  ? 33   PHE A C     1 
ATOM   1457 O  O     . PHE E 3 33  ? 29.419 7.907   38.515 1.00 40.55  ? 33   PHE A O     1 
ATOM   1458 C  CB    . PHE E 3 33  ? 29.342 6.359   35.913 1.00 38.22  ? 33   PHE A CB    1 
ATOM   1459 C  CG    . PHE E 3 33  ? 29.800 5.741   34.617 1.00 39.29  ? 33   PHE A CG    1 
ATOM   1460 C  CD1   . PHE E 3 33  ? 29.227 6.120   33.406 1.00 39.62  ? 33   PHE A CD1   1 
ATOM   1461 C  CD2   . PHE E 3 33  ? 30.815 4.785   34.603 1.00 38.68  ? 33   PHE A CD2   1 
ATOM   1462 C  CE1   . PHE E 3 33  ? 29.659 5.554   32.199 1.00 40.23  ? 33   PHE A CE1   1 
ATOM   1463 C  CE2   . PHE E 3 33  ? 31.254 4.216   33.405 1.00 38.33  ? 33   PHE A CE2   1 
ATOM   1464 C  CZ    . PHE E 3 33  ? 30.675 4.600   32.201 1.00 38.74  ? 33   PHE A CZ    1 
ATOM   1465 N  N     . SER E 3 34  ? 28.493 9.474   37.191 1.00 44.09  ? 34   SER A N     1 
ATOM   1466 C  CA    . SER E 3 34  ? 27.839 10.179  38.303 1.00 47.47  ? 34   SER A CA    1 
ATOM   1467 C  C     . SER E 3 34  ? 26.456 9.673   38.721 1.00 49.30  ? 34   SER A C     1 
ATOM   1468 O  O     . SER E 3 34  ? 25.987 10.000  39.806 1.00 50.26  ? 34   SER A O     1 
ATOM   1469 C  CB    . SER E 3 34  ? 27.760 11.677  38.008 1.00 45.69  ? 34   SER A CB    1 
ATOM   1470 O  OG    . SER E 3 34  ? 27.031 11.923  36.825 1.00 48.77  ? 34   SER A OG    1 
ATOM   1471 N  N     . GLY E 3 35  ? 25.798 8.894   37.867 1.00 52.33  ? 35   GLY A N     1 
ATOM   1472 C  CA    . GLY E 3 35  ? 24.493 8.351   38.223 1.00 54.26  ? 35   GLY A CA    1 
ATOM   1473 C  C     . GLY E 3 35  ? 23.236 9.159   37.932 1.00 55.53  ? 35   GLY A C     1 
ATOM   1474 O  O     . GLY E 3 35  ? 22.124 8.629   38.009 1.00 54.73  ? 35   GLY A O     1 
ATOM   1475 N  N     . ARG E 3 36  ? 23.395 10.433  37.599 1.00 56.85  ? 36   ARG A N     1 
ATOM   1476 C  CA    . ARG E 3 36  ? 22.248 11.286  37.307 1.00 58.89  ? 36   ARG A CA    1 
ATOM   1477 C  C     . ARG E 3 36  ? 21.430 10.835  36.092 1.00 59.27  ? 36   ARG A C     1 
ATOM   1478 O  O     . ARG E 3 36  ? 20.201 10.916  36.100 1.00 60.17  ? 36   ARG A O     1 
ATOM   1479 C  CB    . ARG E 3 36  ? 22.720 12.721  37.112 1.00 60.50  ? 36   ARG A CB    1 
ATOM   1480 C  CG    . ARG E 3 36  ? 23.289 13.332  38.372 1.00 63.32  ? 36   ARG A CG    1 
ATOM   1481 C  CD    . ARG E 3 36  ? 22.227 13.403  39.454 1.00 65.97  ? 36   ARG A CD    1 
ATOM   1482 N  NE    . ARG E 3 36  ? 22.358 14.626  40.233 1.00 68.99  ? 36   ARG A NE    1 
ATOM   1483 C  CZ    . ARG E 3 36  ? 22.334 15.844  39.704 1.00 71.05  ? 36   ARG A CZ    1 
ATOM   1484 N  NH1   . ARG E 3 36  ? 22.179 16.004  38.395 1.00 72.15  ? 36   ARG A NH1   1 
ATOM   1485 N  NH2   . ARG E 3 36  ? 22.480 16.904  40.483 1.00 72.73  ? 36   ARG A NH2   1 
ATOM   1486 N  N     . PHE E 3 37  ? 22.114 10.374  35.050 1.00 58.63  ? 37   PHE A N     1 
ATOM   1487 C  CA    . PHE E 3 37  ? 21.454 9.892   33.841 1.00 58.09  ? 37   PHE A CA    1 
ATOM   1488 C  C     . PHE E 3 37  ? 22.416 9.001   33.063 1.00 58.69  ? 37   PHE A C     1 
ATOM   1489 O  O     . PHE E 3 37  ? 23.598 8.917   33.405 1.00 58.35  ? 37   PHE A O     1 
ATOM   1490 C  CB    . PHE E 3 37  ? 20.966 11.066  32.977 1.00 57.08  ? 37   PHE A CB    1 
ATOM   1491 C  CG    . PHE E 3 37  ? 22.060 11.980  32.495 1.00 57.20  ? 37   PHE A CG    1 
ATOM   1492 C  CD1   . PHE E 3 37  ? 22.899 11.598  31.452 1.00 56.44  ? 37   PHE A CD1   1 
ATOM   1493 C  CD2   . PHE E 3 37  ? 22.243 13.232  33.075 1.00 56.54  ? 37   PHE A CD2   1 
ATOM   1494 C  CE1   . PHE E 3 37  ? 23.904 12.452  30.992 1.00 55.75  ? 37   PHE A CE1   1 
ATOM   1495 C  CE2   . PHE E 3 37  ? 23.248 14.094  32.621 1.00 56.40  ? 37   PHE A CE2   1 
ATOM   1496 C  CZ    . PHE E 3 37  ? 24.079 13.701  31.577 1.00 54.79  ? 37   PHE A CZ    1 
ATOM   1497 N  N     . GLU E 3 38  ? 21.913 8.330   32.028 1.00 58.87  ? 38   GLU A N     1 
ATOM   1498 C  CA    . GLU E 3 38  ? 22.745 7.427   31.236 1.00 58.52  ? 38   GLU A CA    1 
ATOM   1499 C  C     . GLU E 3 38  ? 24.004 8.103   30.708 1.00 54.97  ? 38   GLU A C     1 
ATOM   1500 O  O     . GLU E 3 38  ? 23.936 9.076   29.955 1.00 53.41  ? 38   GLU A O     1 
ATOM   1501 C  CB    . GLU E 3 38  ? 21.956 6.836   30.060 1.00 61.80  ? 38   GLU A CB    1 
ATOM   1502 C  CG    . GLU E 3 38  ? 22.713 5.725   29.335 1.00 66.95  ? 38   GLU A CG    1 
ATOM   1503 C  CD    . GLU E 3 38  ? 22.003 4.381   29.400 1.00 70.70  ? 38   GLU A CD    1 
ATOM   1504 O  OE1   . GLU E 3 38  ? 22.680 3.337   29.236 1.00 71.18  ? 38   GLU A OE1   1 
ATOM   1505 O  OE2   . GLU E 3 38  ? 20.766 4.372   29.605 1.00 73.40  ? 38   GLU A OE2   1 
ATOM   1506 N  N     . ASP E 3 39  ? 25.149 7.562   31.117 1.00 51.65  ? 39   ASP A N     1 
ATOM   1507 C  CA    . ASP E 3 39  ? 26.459 8.064   30.722 1.00 47.79  ? 39   ASP A CA    1 
ATOM   1508 C  C     . ASP E 3 39  ? 26.800 9.424   31.307 1.00 45.75  ? 39   ASP A C     1 
ATOM   1509 O  O     . ASP E 3 39  ? 27.626 10.146  30.743 1.00 44.83  ? 39   ASP A O     1 
ATOM   1510 C  CB    . ASP E 3 39  ? 26.590 8.122   29.195 1.00 47.11  ? 39   ASP A CB    1 
ATOM   1511 C  CG    . ASP E 3 39  ? 26.719 6.746   28.569 1.00 48.65  ? 39   ASP A CG    1 
ATOM   1512 O  OD1   . ASP E 3 39  ? 27.385 5.878   29.171 1.00 48.67  ? 39   ASP A OD1   1 
ATOM   1513 O  OD2   . ASP E 3 39  ? 26.165 6.533   27.469 1.00 50.47  ? 39   ASP A OD2   1 
ATOM   1514 N  N     . SER E 3 40  ? 26.168 9.783   32.424 1.00 42.06  ? 40   SER A N     1 
ATOM   1515 C  CA    . SER E 3 40  ? 26.468 11.059  33.064 1.00 40.57  ? 40   SER A CA    1 
ATOM   1516 C  C     . SER E 3 40  ? 27.788 10.900  33.804 1.00 39.20  ? 40   SER A C     1 
ATOM   1517 O  O     . SER E 3 40  ? 28.042 9.866   34.422 1.00 38.55  ? 40   SER A O     1 
ATOM   1518 C  CB    . SER E 3 40  ? 25.371 11.460  34.054 1.00 41.27  ? 40   SER A CB    1 
ATOM   1519 O  OG    . SER E 3 40  ? 25.267 10.523  35.110 1.00 41.15  ? 40   SER A OG    1 
ATOM   1520 N  N     . GLY E 3 41  ? 28.638 11.913  33.731 1.00 37.87  ? 41   GLY A N     1 
ATOM   1521 C  CA    . GLY E 3 41  ? 29.913 11.826  34.413 1.00 36.26  ? 41   GLY A CA    1 
ATOM   1522 C  C     . GLY E 3 41  ? 31.040 12.403  33.588 1.00 35.11  ? 41   GLY A C     1 
ATOM   1523 O  O     . GLY E 3 41  ? 30.810 12.993  32.528 1.00 36.64  ? 41   GLY A O     1 
ATOM   1524 N  N     . ALA E 3 42  ? 32.267 12.230  34.067 1.00 32.15  ? 42   ALA A N     1 
ATOM   1525 C  CA    . ALA E 3 42  ? 33.417 12.759  33.359 1.00 31.26  ? 42   ALA A CA    1 
ATOM   1526 C  C     . ALA E 3 42  ? 34.478 11.689  33.127 1.00 30.50  ? 42   ALA A C     1 
ATOM   1527 O  O     . ALA E 3 42  ? 34.478 10.646  33.786 1.00 27.54  ? 42   ALA A O     1 
ATOM   1528 C  CB    . ALA E 3 42  ? 34.011 13.930  34.143 1.00 30.45  ? 42   ALA A CB    1 
ATOM   1529 N  N     . VAL E 3 43  ? 35.371 11.956  32.178 1.00 28.60  ? 43   VAL A N     1 
ATOM   1530 C  CA    . VAL E 3 43  ? 36.465 11.043  31.868 1.00 26.87  ? 43   VAL A CA    1 
ATOM   1531 C  C     . VAL E 3 43  ? 37.621 11.316  32.836 1.00 27.36  ? 43   VAL A C     1 
ATOM   1532 O  O     . VAL E 3 43  ? 38.010 12.470  33.037 1.00 26.67  ? 43   VAL A O     1 
ATOM   1533 C  CB    . VAL E 3 43  ? 36.965 11.245  30.408 1.00 26.50  ? 43   VAL A CB    1 
ATOM   1534 C  CG1   . VAL E 3 43  ? 38.252 10.449  30.168 1.00 22.90  ? 43   VAL A CG1   1 
ATOM   1535 C  CG2   . VAL E 3 43  ? 35.881 10.807  29.422 1.00 23.85  ? 43   VAL A CG2   1 
ATOM   1536 N  N     . ALA E 3 44  ? 38.158 10.260  33.445 1.00 24.28  ? 44   ALA A N     1 
ATOM   1537 C  CA    . ALA E 3 44  ? 39.274 10.404  34.375 1.00 23.87  ? 44   ALA A CA    1 
ATOM   1538 C  C     . ALA E 3 44  ? 40.555 10.452  33.555 1.00 24.64  ? 44   ALA A C     1 
ATOM   1539 O  O     . ALA E 3 44  ? 41.466 11.225  33.836 1.00 22.64  ? 44   ALA A O     1 
ATOM   1540 C  CB    . ALA E 3 44  ? 39.301 9.237   35.345 1.00 23.49  ? 44   ALA A CB    1 
ATOM   1541 N  N     . THR E 3 45  ? 40.615 9.597   32.541 1.00 25.23  ? 45   THR A N     1 
ATOM   1542 C  CA    . THR E 3 45  ? 41.736 9.562   31.618 1.00 25.69  ? 45   THR A CA    1 
ATOM   1543 C  C     . THR E 3 45  ? 41.463 8.541   30.508 1.00 25.42  ? 45   THR A C     1 
ATOM   1544 O  O     . THR E 3 45  ? 40.539 7.725   30.601 1.00 24.78  ? 45   THR A O     1 
ATOM   1545 C  CB    . THR E 3 45  ? 43.068 9.223   32.332 1.00 28.10  ? 45   THR A CB    1 
ATOM   1546 O  OG1   . THR E 3 45  ? 44.155 9.587   31.475 1.00 28.88  ? 45   THR A OG1   1 
ATOM   1547 C  CG2   . THR E 3 45  ? 43.168 7.730   32.647 1.00 27.34  ? 45   THR A CG2   1 
ATOM   1548 N  N     . ALA E 3 46  ? 42.259 8.604   29.450 1.00 24.19  ? 46   ALA A N     1 
ATOM   1549 C  CA    . ALA E 3 46  ? 42.111 7.692   28.324 1.00 22.67  ? 46   ALA A CA    1 
ATOM   1550 C  C     . ALA E 3 46  ? 43.508 7.390   27.829 1.00 23.06  ? 46   ALA A C     1 
ATOM   1551 O  O     . ALA E 3 46  ? 44.419 8.194   28.039 1.00 20.03  ? 46   ALA A O     1 
ATOM   1552 C  CB    . ALA E 3 46  ? 41.297 8.345   27.233 1.00 22.58  ? 46   ALA A CB    1 
ATOM   1553 N  N     . ASN E 3 47  ? 43.692 6.231   27.196 1.00 24.17  ? 47   ASN A N     1 
ATOM   1554 C  CA    . ASN E 3 47  ? 45.015 5.889   26.692 1.00 24.01  ? 47   ASN A CA    1 
ATOM   1555 C  C     . ASN E 3 47  ? 45.265 6.713   25.442 1.00 25.87  ? 47   ASN A C     1 
ATOM   1556 O  O     . ASN E 3 47  ? 44.376 7.442   24.980 1.00 23.23  ? 47   ASN A O     1 
ATOM   1557 C  CB    . ASN E 3 47  ? 45.141 4.380   26.421 1.00 23.13  ? 47   ASN A CB    1 
ATOM   1558 C  CG    . ASN E 3 47  ? 44.223 3.889   25.326 1.00 23.73  ? 47   ASN A CG    1 
ATOM   1559 O  OD1   . ASN E 3 47  ? 43.500 4.662   24.700 1.00 23.76  ? 47   ASN A OD1   1 
ATOM   1560 N  ND2   . ASN E 3 47  ? 44.255 2.584   25.084 1.00 20.13  ? 47   ASN A ND2   1 
ATOM   1561 N  N     . TYR E 3 48  ? 46.468 6.620   24.894 1.00 28.28  ? 48   TYR A N     1 
ATOM   1562 C  CA    . TYR E 3 48  ? 46.801 7.418   23.728 1.00 31.02  ? 48   TYR A CA    1 
ATOM   1563 C  C     . TYR E 3 48  ? 45.970 7.155   22.472 1.00 31.91  ? 48   TYR A C     1 
ATOM   1564 O  O     . TYR E 3 48  ? 45.734 8.073   21.678 1.00 31.42  ? 48   TYR A O     1 
ATOM   1565 C  CB    . TYR E 3 48  ? 48.305 7.321   23.461 1.00 33.53  ? 48   TYR A CB    1 
ATOM   1566 C  CG    . TYR E 3 48  ? 49.094 8.130   24.477 1.00 36.72  ? 48   TYR A CG    1 
ATOM   1567 C  CD1   . TYR E 3 48  ? 49.317 7.648   25.766 1.00 36.86  ? 48   TYR A CD1   1 
ATOM   1568 C  CD2   . TYR E 3 48  ? 49.524 9.420   24.179 1.00 39.80  ? 48   TYR A CD2   1 
ATOM   1569 C  CE1   . TYR E 3 48  ? 49.941 8.429   26.732 1.00 38.10  ? 48   TYR A CE1   1 
ATOM   1570 C  CE2   . TYR E 3 48  ? 50.152 10.218  25.143 1.00 41.00  ? 48   TYR A CE2   1 
ATOM   1571 C  CZ    . TYR E 3 48  ? 50.355 9.717   26.419 1.00 40.48  ? 48   TYR A CZ    1 
ATOM   1572 O  OH    . TYR E 3 48  ? 50.958 10.514  27.374 1.00 39.50  ? 48   TYR A OH    1 
ATOM   1573 N  N     . GLU E 3 49  ? 45.505 5.922   22.308 1.00 32.45  ? 49   GLU A N     1 
ATOM   1574 C  CA    . GLU E 3 49  ? 44.675 5.562   21.162 1.00 34.65  ? 49   GLU A CA    1 
ATOM   1575 C  C     . GLU E 3 49  ? 43.432 6.447   21.143 1.00 33.62  ? 49   GLU A C     1 
ATOM   1576 O  O     . GLU E 3 49  ? 43.040 6.970   20.098 1.00 31.54  ? 49   GLU A O     1 
ATOM   1577 C  CB    . GLU E 3 49  ? 44.248 4.094   21.257 1.00 39.67  ? 49   GLU A CB    1 
ATOM   1578 C  CG    . GLU E 3 49  ? 45.016 3.160   20.343 1.00 49.83  ? 49   GLU A CG    1 
ATOM   1579 C  CD    . GLU E 3 49  ? 46.518 3.273   20.528 1.00 55.01  ? 49   GLU A CD    1 
ATOM   1580 O  OE1   . GLU E 3 49  ? 47.023 2.894   21.614 1.00 57.43  ? 49   GLU A OE1   1 
ATOM   1581 O  OE2   . GLU E 3 49  ? 47.191 3.749   19.584 1.00 58.92  ? 49   GLU A OE2   1 
ATOM   1582 N  N     . ALA E 3 50  ? 42.811 6.607   22.311 1.00 31.05  ? 50   ALA A N     1 
ATOM   1583 C  CA    . ALA E 3 50  ? 41.616 7.429   22.435 1.00 30.28  ? 50   ALA A CA    1 
ATOM   1584 C  C     . ALA E 3 50  ? 41.958 8.910   22.468 1.00 30.44  ? 50   ALA A C     1 
ATOM   1585 O  O     . ALA E 3 50  ? 41.253 9.738   21.902 1.00 30.73  ? 50   ALA A O     1 
ATOM   1586 C  CB    . ALA E 3 50  ? 40.857 7.056   23.695 1.00 31.37  ? 50   ALA A CB    1 
ATOM   1587 N  N     . ARG E 3 51  ? 43.046 9.239   23.140 1.00 30.57  ? 51   ARG A N     1 
ATOM   1588 C  CA    . ARG E 3 51  ? 43.474 10.621  23.280 1.00 33.35  ? 51   ARG A CA    1 
ATOM   1589 C  C     . ARG E 3 51  ? 43.795 11.237  21.920 1.00 34.53  ? 51   ARG A C     1 
ATOM   1590 O  O     . ARG E 3 51  ? 43.724 12.451  21.730 1.00 34.01  ? 51   ARG A O     1 
ATOM   1591 C  CB    . ARG E 3 51  ? 44.704 10.654  24.187 1.00 33.28  ? 51   ARG A CB    1 
ATOM   1592 C  CG    . ARG E 3 51  ? 44.969 11.972  24.843 1.00 35.72  ? 51   ARG A CG    1 
ATOM   1593 C  CD    . ARG E 3 51  ? 46.120 11.854  25.831 1.00 34.33  ? 51   ARG A CD    1 
ATOM   1594 N  NE    . ARG E 3 51  ? 45.819 10.974  26.959 1.00 30.34  ? 51   ARG A NE    1 
ATOM   1595 C  CZ    . ARG E 3 51  ? 46.610 10.846  28.020 1.00 31.12  ? 51   ARG A CZ    1 
ATOM   1596 N  NH1   . ARG E 3 51  ? 47.747 11.540  28.090 1.00 23.51  ? 51   ARG A NH1   1 
ATOM   1597 N  NH2   . ARG E 3 51  ? 46.267 10.038  29.017 1.00 30.41  ? 51   ARG A NH2   1 
ATOM   1598 N  N     . LYS E 3 52  ? 44.137 10.371  20.975 1.00 36.41  ? 52   LYS A N     1 
ATOM   1599 C  CA    . LYS E 3 52  ? 44.504 10.763  19.621 1.00 36.95  ? 52   LYS A CA    1 
ATOM   1600 C  C     . LYS E 3 52  ? 43.361 11.472  18.887 1.00 37.88  ? 52   LYS A C     1 
ATOM   1601 O  O     . LYS E 3 52  ? 43.601 12.330  18.031 1.00 39.44  ? 52   LYS A O     1 
ATOM   1602 C  CB    . LYS E 3 52  ? 44.918 9.510   18.841 1.00 38.68  ? 52   LYS A CB    1 
ATOM   1603 C  CG    . LYS E 3 52  ? 45.802 9.752   17.643 1.00 42.79  ? 52   LYS A CG    1 
ATOM   1604 C  CD    . LYS E 3 52  ? 45.941 8.485   16.795 1.00 46.55  ? 52   LYS A CD    1 
ATOM   1605 C  CE    . LYS E 3 52  ? 46.561 7.329   17.571 1.00 48.14  ? 52   LYS A CE    1 
ATOM   1606 N  NZ    . LYS E 3 52  ? 46.616 6.080   16.753 1.00 49.67  ? 52   LYS A NZ    1 
ATOM   1607 N  N     . PHE E 3 53  ? 42.123 11.115  19.225 1.00 33.81  ? 53   PHE A N     1 
ATOM   1608 C  CA    . PHE E 3 53  ? 40.955 11.706  18.581 1.00 31.88  ? 53   PHE A CA    1 
ATOM   1609 C  C     . PHE E 3 53  ? 40.231 12.733  19.431 1.00 30.82  ? 53   PHE A C     1 
ATOM   1610 O  O     . PHE E 3 53  ? 39.105 13.120  19.117 1.00 29.26  ? 53   PHE A O     1 
ATOM   1611 C  CB    . PHE E 3 53  ? 39.989 10.599  18.165 1.00 29.99  ? 53   PHE A CB    1 
ATOM   1612 C  CG    . PHE E 3 53  ? 40.585 9.630   17.197 1.00 28.99  ? 53   PHE A CG    1 
ATOM   1613 C  CD1   . PHE E 3 53  ? 40.762 9.980   15.864 1.00 28.22  ? 53   PHE A CD1   1 
ATOM   1614 C  CD2   . PHE E 3 53  ? 41.011 8.379   17.627 1.00 29.02  ? 53   PHE A CD2   1 
ATOM   1615 C  CE1   . PHE E 3 53  ? 41.359 9.092   14.965 1.00 28.89  ? 53   PHE A CE1   1 
ATOM   1616 C  CE2   . PHE E 3 53  ? 41.608 7.485   16.747 1.00 29.62  ? 53   PHE A CE2   1 
ATOM   1617 C  CZ    . PHE E 3 53  ? 41.783 7.841   15.408 1.00 30.43  ? 53   PHE A CZ    1 
ATOM   1618 N  N     . GLY E 3 54  ? 40.870 13.166  20.513 1.00 29.91  ? 54   GLY A N     1 
ATOM   1619 C  CA    . GLY E 3 54  ? 40.265 14.172  21.362 1.00 29.18  ? 54   GLY A CA    1 
ATOM   1620 C  C     . GLY E 3 54  ? 39.604 13.711  22.649 1.00 28.72  ? 54   GLY A C     1 
ATOM   1621 O  O     . GLY E 3 54  ? 39.079 14.534  23.388 1.00 28.94  ? 54   GLY A O     1 
ATOM   1622 N  N     . VAL E 3 55  ? 39.605 12.410  22.917 1.00 30.62  ? 55   VAL A N     1 
ATOM   1623 C  CA    . VAL E 3 55  ? 39.007 11.898  24.147 1.00 30.32  ? 55   VAL A CA    1 
ATOM   1624 C  C     . VAL E 3 55  ? 40.092 11.946  25.206 1.00 32.80  ? 55   VAL A C     1 
ATOM   1625 O  O     . VAL E 3 55  ? 41.070 11.201  25.143 1.00 33.54  ? 55   VAL A O     1 
ATOM   1626 C  CB    . VAL E 3 55  ? 38.494 10.439  23.983 1.00 31.48  ? 55   VAL A CB    1 
ATOM   1627 C  CG1   . VAL E 3 55  ? 38.060 9.872   25.330 1.00 30.02  ? 55   VAL A CG1   1 
ATOM   1628 C  CG2   . VAL E 3 55  ? 37.316 10.413  23.018 1.00 30.23  ? 55   VAL A CG2   1 
ATOM   1629 N  N     . LYS E 3 56  ? 39.924 12.838  26.172 1.00 33.34  ? 56   LYS A N     1 
ATOM   1630 C  CA    . LYS E 3 56  ? 40.910 12.999  27.227 1.00 35.14  ? 56   LYS A CA    1 
ATOM   1631 C  C     . LYS E 3 56  ? 40.273 13.324  28.574 1.00 34.23  ? 56   LYS A C     1 
ATOM   1632 O  O     . LYS E 3 56  ? 39.061 13.534  28.675 1.00 34.66  ? 56   LYS A O     1 
ATOM   1633 C  CB    . LYS E 3 56  ? 41.867 14.119  26.849 1.00 36.27  ? 56   LYS A CB    1 
ATOM   1634 C  CG    . LYS E 3 56  ? 41.157 15.449  26.672 1.00 38.80  ? 56   LYS A CG    1 
ATOM   1635 C  CD    . LYS E 3 56  ? 42.116 16.544  26.244 1.00 42.65  ? 56   LYS A CD    1 
ATOM   1636 C  CE    . LYS E 3 56  ? 41.389 17.871  26.082 1.00 42.03  ? 56   LYS A CE    1 
ATOM   1637 N  NZ    . LYS E 3 56  ? 42.323 18.960  25.690 1.00 47.03  ? 56   LYS A NZ    1 
ATOM   1638 N  N     . ALA E 3 57  ? 41.114 13.388  29.599 1.00 34.47  ? 57   ALA A N     1 
ATOM   1639 C  CA    . ALA E 3 57  ? 40.684 13.672  30.964 1.00 34.39  ? 57   ALA A CA    1 
ATOM   1640 C  C     . ALA E 3 57  ? 39.828 14.922  31.078 1.00 34.56  ? 57   ALA A C     1 
ATOM   1641 O  O     . ALA E 3 57  ? 40.117 15.938  30.455 1.00 35.48  ? 57   ALA A O     1 
ATOM   1642 C  CB    . ALA E 3 57  ? 41.906 13.808  31.867 1.00 33.27  ? 57   ALA A CB    1 
ATOM   1643 N  N     . GLY E 3 58  ? 38.768 14.839  31.873 1.00 35.10  ? 58   GLY A N     1 
ATOM   1644 C  CA    . GLY E 3 58  ? 37.912 15.994  32.078 1.00 36.16  ? 58   GLY A CA    1 
ATOM   1645 C  C     . GLY E 3 58  ? 36.664 16.166  31.227 1.00 37.41  ? 58   GLY A C     1 
ATOM   1646 O  O     . GLY E 3 58  ? 35.660 16.686  31.717 1.00 37.94  ? 58   GLY A O     1 
ATOM   1647 N  N     . ILE E 3 59  ? 36.696 15.753  29.964 1.00 36.87  ? 59   ILE A N     1 
ATOM   1648 C  CA    . ILE E 3 59  ? 35.513 15.928  29.126 1.00 33.80  ? 59   ILE A CA    1 
ATOM   1649 C  C     . ILE E 3 59  ? 34.361 15.024  29.566 1.00 33.74  ? 59   ILE A C     1 
ATOM   1650 O  O     . ILE E 3 59  ? 34.574 14.009  30.227 1.00 32.70  ? 59   ILE A O     1 
ATOM   1651 C  CB    . ILE E 3 59  ? 35.840 15.697  27.631 1.00 32.58  ? 59   ILE A CB    1 
ATOM   1652 C  CG1   . ILE E 3 59  ? 36.044 14.211  27.339 1.00 32.62  ? 59   ILE A CG1   1 
ATOM   1653 C  CG2   . ILE E 3 59  ? 37.105 16.466  27.268 1.00 31.22  ? 59   ILE A CG2   1 
ATOM   1654 C  CD1   . ILE E 3 59  ? 36.259 13.913  25.874 1.00 30.91  ? 59   ILE A CD1   1 
ATOM   1655 N  N     . PRO E 3 60  ? 33.115 15.406  29.233 1.00 33.34  ? 60   PRO A N     1 
ATOM   1656 C  CA    . PRO E 3 60  ? 31.956 14.594  29.618 1.00 33.07  ? 60   PRO A CA    1 
ATOM   1657 C  C     . PRO E 3 60  ? 31.956 13.234  28.927 1.00 32.82  ? 60   PRO A C     1 
ATOM   1658 O  O     . PRO E 3 60  ? 32.305 13.123  27.749 1.00 33.42  ? 60   PRO A O     1 
ATOM   1659 C  CB    . PRO E 3 60  ? 30.763 15.456  29.186 1.00 34.65  ? 60   PRO A CB    1 
ATOM   1660 C  CG    . PRO E 3 60  ? 31.307 16.866  29.282 1.00 35.16  ? 60   PRO A CG    1 
ATOM   1661 C  CD    . PRO E 3 60  ? 32.685 16.704  28.675 1.00 34.02  ? 60   PRO A CD    1 
ATOM   1662 N  N     . ILE E 3 61  ? 31.570 12.202  29.664 1.00 31.21  ? 61   ILE A N     1 
ATOM   1663 C  CA    . ILE E 3 61  ? 31.518 10.864  29.097 1.00 32.69  ? 61   ILE A CA    1 
ATOM   1664 C  C     . ILE E 3 61  ? 30.643 10.866  27.852 1.00 32.16  ? 61   ILE A C     1 
ATOM   1665 O  O     . ILE E 3 61  ? 30.977 10.229  26.854 1.00 32.77  ? 61   ILE A O     1 
ATOM   1666 C  CB    . ILE E 3 61  ? 30.959 9.850   30.112 1.00 32.02  ? 61   ILE A CB    1 
ATOM   1667 C  CG1   . ILE E 3 61  ? 31.895 9.763   31.323 1.00 32.64  ? 61   ILE A CG1   1 
ATOM   1668 C  CG2   . ILE E 3 61  ? 30.811 8.491   29.462 1.00 30.14  ? 61   ILE A CG2   1 
ATOM   1669 C  CD1   . ILE E 3 61  ? 31.393 8.850   32.437 1.00 34.98  ? 61   ILE A CD1   1 
ATOM   1670 N  N     . VAL E 3 62  ? 29.527 11.589  27.912 1.00 32.24  ? 62   VAL A N     1 
ATOM   1671 C  CA    . VAL E 3 62  ? 28.612 11.681  26.778 1.00 33.07  ? 62   VAL A CA    1 
ATOM   1672 C  C     . VAL E 3 62  ? 29.342 12.185  25.535 1.00 33.98  ? 62   VAL A C     1 
ATOM   1673 O  O     . VAL E 3 62  ? 29.102 11.692  24.432 1.00 33.96  ? 62   VAL A O     1 
ATOM   1674 C  CB    . VAL E 3 62  ? 27.416 12.625  27.094 1.00 35.16  ? 62   VAL A CB    1 
ATOM   1675 C  CG1   . VAL E 3 62  ? 26.757 13.114  25.806 1.00 36.01  ? 62   VAL A CG1   1 
ATOM   1676 C  CG2   . VAL E 3 62  ? 26.390 11.880  27.927 1.00 34.94  ? 62   VAL A CG2   1 
ATOM   1677 N  N     . GLU E 3 63  ? 30.232 13.160  25.713 1.00 32.32  ? 63   GLU A N     1 
ATOM   1678 C  CA    . GLU E 3 63  ? 30.988 13.708  24.591 1.00 34.65  ? 63   GLU A CA    1 
ATOM   1679 C  C     . GLU E 3 63  ? 32.004 12.699  24.050 1.00 33.81  ? 63   GLU A C     1 
ATOM   1680 O  O     . GLU E 3 63  ? 32.219 12.599  22.838 1.00 32.10  ? 63   GLU A O     1 
ATOM   1681 C  CB    . GLU E 3 63  ? 31.713 14.985  25.015 1.00 35.53  ? 63   GLU A CB    1 
ATOM   1682 C  CG    . GLU E 3 63  ? 30.779 16.120  25.375 1.00 44.52  ? 63   GLU A CG    1 
ATOM   1683 C  CD    . GLU E 3 63  ? 29.830 16.478  24.238 1.00 47.21  ? 63   GLU A CD    1 
ATOM   1684 O  OE1   . GLU E 3 63  ? 30.315 16.876  23.153 1.00 51.00  ? 63   GLU A OE1   1 
ATOM   1685 O  OE2   . GLU E 3 63  ? 28.599 16.361  24.427 1.00 48.47  ? 63   GLU A OE2   1 
ATOM   1686 N  N     . ALA E 3 64  ? 32.636 11.960  24.955 1.00 31.85  ? 64   ALA A N     1 
ATOM   1687 C  CA    . ALA E 3 64  ? 33.615 10.961  24.552 1.00 31.74  ? 64   ALA A CA    1 
ATOM   1688 C  C     . ALA E 3 64  ? 32.935 9.967   23.612 1.00 31.96  ? 64   ALA A C     1 
ATOM   1689 O  O     . ALA E 3 64  ? 33.453 9.645   22.542 1.00 28.99  ? 64   ALA A O     1 
ATOM   1690 C  CB    . ALA E 3 64  ? 34.163 10.233  25.781 1.00 29.71  ? 64   ALA A CB    1 
ATOM   1691 N  N     . LYS E 3 65  ? 31.759 9.501   24.016 1.00 33.18  ? 65   LYS A N     1 
ATOM   1692 C  CA    . LYS E 3 65  ? 31.019 8.538   23.224 1.00 35.59  ? 65   LYS A CA    1 
ATOM   1693 C  C     . LYS E 3 65  ? 30.584 9.063   21.860 1.00 35.92  ? 65   LYS A C     1 
ATOM   1694 O  O     . LYS E 3 65  ? 30.342 8.284   20.945 1.00 36.39  ? 65   LYS A O     1 
ATOM   1695 C  CB    . LYS E 3 65  ? 29.824 8.024   24.023 1.00 36.63  ? 65   LYS A CB    1 
ATOM   1696 C  CG    . LYS E 3 65  ? 30.261 7.205   25.227 1.00 39.64  ? 65   LYS A CG    1 
ATOM   1697 C  CD    . LYS E 3 65  ? 29.133 6.374   25.809 1.00 40.37  ? 65   LYS A CD    1 
ATOM   1698 C  CE    . LYS E 3 65  ? 29.662 5.457   26.908 1.00 41.01  ? 65   LYS A CE    1 
ATOM   1699 N  NZ    . LYS E 3 65  ? 28.618 4.535   27.432 1.00 40.53  ? 65   LYS A NZ    1 
ATOM   1700 N  N     . LYS E 3 66  ? 30.494 10.378  21.714 1.00 36.64  ? 66   LYS A N     1 
ATOM   1701 C  CA    . LYS E 3 66  ? 30.114 10.941  20.427 1.00 38.13  ? 66   LYS A CA    1 
ATOM   1702 C  C     . LYS E 3 66  ? 31.302 10.870  19.477 1.00 37.37  ? 66   LYS A C     1 
ATOM   1703 O  O     . LYS E 3 66  ? 31.136 10.704  18.269 1.00 39.12  ? 66   LYS A O     1 
ATOM   1704 C  CB    . LYS E 3 66  ? 29.660 12.394  20.582 1.00 39.81  ? 66   LYS A CB    1 
ATOM   1705 C  CG    . LYS E 3 66  ? 28.242 12.549  21.101 1.00 41.44  ? 66   LYS A CG    1 
ATOM   1706 C  CD    . LYS E 3 66  ? 27.919 14.012  21.346 1.00 44.18  ? 66   LYS A CD    1 
ATOM   1707 C  CE    . LYS E 3 66  ? 26.599 14.168  22.071 1.00 47.38  ? 66   LYS A CE    1 
ATOM   1708 N  NZ    . LYS E 3 66  ? 26.421 15.556  22.591 1.00 50.54  ? 66   LYS A NZ    1 
ATOM   1709 N  N     . ILE E 3 67  ? 32.499 10.994  20.042 1.00 35.33  ? 67   ILE A N     1 
ATOM   1710 C  CA    . ILE E 3 67  ? 33.738 10.950  19.278 1.00 32.62  ? 67   ILE A CA    1 
ATOM   1711 C  C     . ILE E 3 67  ? 34.176 9.521   18.956 1.00 33.09  ? 67   ILE A C     1 
ATOM   1712 O  O     . ILE E 3 67  ? 34.520 9.212   17.812 1.00 31.67  ? 67   ILE A O     1 
ATOM   1713 C  CB    . ILE E 3 67  ? 34.869 11.669  20.049 1.00 31.24  ? 67   ILE A CB    1 
ATOM   1714 C  CG1   . ILE E 3 67  ? 34.517 13.149  20.195 1.00 28.24  ? 67   ILE A CG1   1 
ATOM   1715 C  CG2   . ILE E 3 67  ? 36.195 11.507  19.314 1.00 24.77  ? 67   ILE A CG2   1 
ATOM   1716 C  CD1   . ILE E 3 67  ? 35.398 13.908  21.166 1.00 28.38  ? 67   ILE A CD1   1 
ATOM   1717 N  N     . LEU E 3 68  ? 34.182 8.658   19.969 1.00 32.06  ? 68   LEU A N     1 
ATOM   1718 C  CA    . LEU E 3 68  ? 34.571 7.258   19.787 1.00 31.49  ? 68   LEU A CA    1 
ATOM   1719 C  C     . LEU E 3 68  ? 33.484 6.371   20.395 1.00 32.08  ? 68   LEU A C     1 
ATOM   1720 O  O     . LEU E 3 68  ? 33.654 5.814   21.477 1.00 32.24  ? 68   LEU A O     1 
ATOM   1721 C  CB    . LEU E 3 68  ? 35.919 6.972   20.476 1.00 30.41  ? 68   LEU A CB    1 
ATOM   1722 C  CG    . LEU E 3 68  ? 37.168 7.740   20.015 1.00 29.63  ? 68   LEU A CG    1 
ATOM   1723 C  CD1   . LEU E 3 68  ? 38.409 7.211   20.739 1.00 26.13  ? 68   LEU A CD1   1 
ATOM   1724 C  CD2   . LEU E 3 68  ? 37.337 7.589   18.505 1.00 27.49  ? 68   LEU A CD2   1 
ATOM   1725 N  N     . PRO E 3 69  ? 32.354 6.217   19.694 1.00 32.13  ? 69   PRO A N     1 
ATOM   1726 C  CA    . PRO E 3 69  ? 31.277 5.389   20.233 1.00 32.90  ? 69   PRO A CA    1 
ATOM   1727 C  C     . PRO E 3 69  ? 31.659 3.938   20.437 1.00 34.02  ? 69   PRO A C     1 
ATOM   1728 O  O     . PRO E 3 69  ? 31.027 3.241   21.225 1.00 35.86  ? 69   PRO A O     1 
ATOM   1729 C  CB    . PRO E 3 69  ? 30.164 5.558   19.205 1.00 32.40  ? 69   PRO A CB    1 
ATOM   1730 C  CG    . PRO E 3 69  ? 30.915 5.717   17.936 1.00 33.00  ? 69   PRO A CG    1 
ATOM   1731 C  CD    . PRO E 3 69  ? 32.036 6.664   18.327 1.00 32.83  ? 69   PRO A CD    1 
ATOM   1732 N  N     . ASN E 3 70  ? 32.702 3.486   19.748 1.00 34.98  ? 70   ASN A N     1 
ATOM   1733 C  CA    . ASN E 3 70  ? 33.122 2.092   19.861 1.00 35.08  ? 70   ASN A CA    1 
ATOM   1734 C  C     . ASN E 3 70  ? 34.334 1.862   20.755 1.00 33.83  ? 70   ASN A C     1 
ATOM   1735 O  O     . ASN E 3 70  ? 34.876 0.757   20.802 1.00 32.95  ? 70   ASN A O     1 
ATOM   1736 C  CB    . ASN E 3 70  ? 33.379 1.510   18.464 1.00 36.77  ? 70   ASN A CB    1 
ATOM   1737 C  CG    . ASN E 3 70  ? 32.208 1.746   17.519 1.00 38.72  ? 70   ASN A CG    1 
ATOM   1738 O  OD1   . ASN E 3 70  ? 31.048 1.575   17.900 1.00 38.63  ? 70   ASN A OD1   1 
ATOM   1739 N  ND2   . ASN E 3 70  ? 32.506 2.144   16.284 1.00 38.96  ? 70   ASN A ND2   1 
ATOM   1740 N  N     . ALA E 3 71  ? 34.762 2.899   21.466 1.00 32.96  ? 71   ALA A N     1 
ATOM   1741 C  CA    . ALA E 3 71  ? 35.901 2.760   22.369 1.00 31.30  ? 71   ALA A CA    1 
ATOM   1742 C  C     . ALA E 3 71  ? 35.428 1.903   23.546 1.00 30.14  ? 71   ALA A C     1 
ATOM   1743 O  O     . ALA E 3 71  ? 34.223 1.667   23.698 1.00 29.53  ? 71   ALA A O     1 
ATOM   1744 C  CB    . ALA E 3 71  ? 36.354 4.138   22.865 1.00 31.04  ? 71   ALA A CB    1 
ATOM   1745 N  N     . VAL E 3 72  ? 36.367 1.426   24.359 1.00 28.43  ? 72   VAL A N     1 
ATOM   1746 C  CA    . VAL E 3 72  ? 36.020 0.622   25.527 1.00 26.82  ? 72   VAL A CA    1 
ATOM   1747 C  C     . VAL E 3 72  ? 35.895 1.569   26.707 1.00 26.82  ? 72   VAL A C     1 
ATOM   1748 O  O     . VAL E 3 72  ? 36.851 2.266   27.053 1.00 26.41  ? 72   VAL A O     1 
ATOM   1749 C  CB    . VAL E 3 72  ? 37.106 -0.422  25.858 1.00 29.19  ? 72   VAL A CB    1 
ATOM   1750 C  CG1   . VAL E 3 72  ? 36.653 -1.273  27.047 1.00 28.76  ? 72   VAL A CG1   1 
ATOM   1751 C  CG2   . VAL E 3 72  ? 37.381 -1.296  24.642 1.00 28.86  ? 72   VAL A CG2   1 
ATOM   1752 N  N     . TYR E 3 73  ? 34.715 1.601   27.315 1.00 27.02  ? 73   TYR A N     1 
ATOM   1753 C  CA    . TYR E 3 73  ? 34.457 2.479   28.453 1.00 28.04  ? 73   TYR A CA    1 
ATOM   1754 C  C     . TYR E 3 73  ? 34.424 1.687   29.759 1.00 27.88  ? 73   TYR A C     1 
ATOM   1755 O  O     . TYR E 3 73  ? 33.578 0.810   29.967 1.00 28.36  ? 73   TYR A O     1 
ATOM   1756 C  CB    . TYR E 3 73  ? 33.146 3.243   28.224 1.00 28.52  ? 73   TYR A CB    1 
ATOM   1757 C  CG    . TYR E 3 73  ? 33.262 4.232   27.087 1.00 28.32  ? 73   TYR A CG    1 
ATOM   1758 C  CD1   . TYR E 3 73  ? 33.623 5.556   27.327 1.00 27.12  ? 73   TYR A CD1   1 
ATOM   1759 C  CD2   . TYR E 3 73  ? 33.128 3.815   25.758 1.00 28.08  ? 73   TYR A CD2   1 
ATOM   1760 C  CE1   . TYR E 3 73  ? 33.860 6.435   26.282 1.00 27.63  ? 73   TYR A CE1   1 
ATOM   1761 C  CE2   . TYR E 3 73  ? 33.364 4.688   24.706 1.00 29.02  ? 73   TYR A CE2   1 
ATOM   1762 C  CZ    . TYR E 3 73  ? 33.735 5.995   24.976 1.00 28.00  ? 73   TYR A CZ    1 
ATOM   1763 O  OH    . TYR E 3 73  ? 34.020 6.853   23.945 1.00 27.80  ? 73   TYR A OH    1 
ATOM   1764 N  N     . LEU E 3 74  ? 35.364 2.007   30.633 1.00 25.85  ? 74   LEU A N     1 
ATOM   1765 C  CA    . LEU E 3 74  ? 35.488 1.325   31.904 1.00 26.50  ? 74   LEU A CA    1 
ATOM   1766 C  C     . LEU E 3 74  ? 35.290 2.262   33.082 1.00 26.95  ? 74   LEU A C     1 
ATOM   1767 O  O     . LEU E 3 74  ? 35.740 3.414   33.069 1.00 25.54  ? 74   LEU A O     1 
ATOM   1768 C  CB    . LEU E 3 74  ? 36.868 0.685   32.010 1.00 27.91  ? 74   LEU A CB    1 
ATOM   1769 C  CG    . LEU E 3 74  ? 37.291 -0.262  30.884 1.00 29.26  ? 74   LEU A CG    1 
ATOM   1770 C  CD1   . LEU E 3 74  ? 38.739 -0.682  31.090 1.00 28.11  ? 74   LEU A CD1   1 
ATOM   1771 C  CD2   . LEU E 3 74  ? 36.369 -1.476  30.860 1.00 29.55  ? 74   LEU A CD2   1 
ATOM   1772 N  N     . PRO E 3 75  ? 34.604 1.778   34.121 1.00 26.67  ? 75   PRO A N     1 
ATOM   1773 C  CA    . PRO E 3 75  ? 34.359 2.589   35.313 1.00 26.52  ? 75   PRO A CA    1 
ATOM   1774 C  C     . PRO E 3 75  ? 35.673 2.707   36.073 1.00 27.28  ? 75   PRO A C     1 
ATOM   1775 O  O     . PRO E 3 75  ? 36.415 1.737   36.177 1.00 25.09  ? 75   PRO A O     1 
ATOM   1776 C  CB    . PRO E 3 75  ? 33.327 1.768   36.076 1.00 28.14  ? 75   PRO A CB    1 
ATOM   1777 C  CG    . PRO E 3 75  ? 33.726 0.357   35.747 1.00 29.36  ? 75   PRO A CG    1 
ATOM   1778 C  CD    . PRO E 3 75  ? 34.006 0.438   34.256 1.00 26.87  ? 75   PRO A CD    1 
ATOM   1779 N  N     . MET E 3 76  ? 35.976 3.888   36.588 1.00 25.63  ? 76   MET A N     1 
ATOM   1780 C  CA    . MET E 3 76  ? 37.207 4.063   37.338 1.00 28.60  ? 76   MET A CA    1 
ATOM   1781 C  C     . MET E 3 76  ? 37.199 3.146   38.566 1.00 30.51  ? 76   MET A C     1 
ATOM   1782 O  O     . MET E 3 76  ? 36.180 3.035   39.250 1.00 26.98  ? 76   MET A O     1 
ATOM   1783 C  CB    . MET E 3 76  ? 37.325 5.509   37.797 1.00 32.32  ? 76   MET A CB    1 
ATOM   1784 C  CG    . MET E 3 76  ? 38.557 5.796   38.613 1.00 37.33  ? 76   MET A CG    1 
ATOM   1785 S  SD    . MET E 3 76  ? 38.268 7.264   39.543 1.00 43.93  ? 76   MET A SD    1 
ATOM   1786 C  CE    . MET E 3 76  ? 38.958 8.489   38.513 1.00 44.61  ? 76   MET A CE    1 
ATOM   1787 N  N     . ARG E 3 77  ? 38.327 2.486   38.825 1.00 29.38  ? 77   ARG A N     1 
ATOM   1788 C  CA    . ARG E 3 77  ? 38.474 1.600   39.987 1.00 30.78  ? 77   ARG A CA    1 
ATOM   1789 C  C     . ARG E 3 77  ? 39.713 2.083   40.733 1.00 30.83  ? 77   ARG A C     1 
ATOM   1790 O  O     . ARG E 3 77  ? 40.757 1.420   40.746 1.00 29.17  ? 77   ARG A O     1 
ATOM   1791 C  CB    . ARG E 3 77  ? 38.664 0.149   39.543 1.00 28.52  ? 77   ARG A CB    1 
ATOM   1792 C  CG    . ARG E 3 77  ? 37.436 -0.451  38.911 1.00 29.16  ? 77   ARG A CG    1 
ATOM   1793 C  CD    . ARG E 3 77  ? 37.626 -1.920  38.658 1.00 29.92  ? 77   ARG A CD    1 
ATOM   1794 N  NE    . ARG E 3 77  ? 38.701 -2.194  37.717 1.00 32.38  ? 77   ARG A NE    1 
ATOM   1795 C  CZ    . ARG E 3 77  ? 39.186 -3.409  37.497 1.00 34.90  ? 77   ARG A CZ    1 
ATOM   1796 N  NH1   . ARG E 3 77  ? 38.689 -4.445  38.159 1.00 36.13  ? 77   ARG A NH1   1 
ATOM   1797 N  NH2   . ARG E 3 77  ? 40.148 -3.595  36.611 1.00 35.13  ? 77   ARG A NH2   1 
ATOM   1798 N  N     . LYS E 3 78  ? 39.584 3.253   41.344 1.00 31.07  ? 78   LYS A N     1 
ATOM   1799 C  CA    . LYS E 3 78  ? 40.690 3.876   42.047 1.00 33.82  ? 78   LYS A CA    1 
ATOM   1800 C  C     . LYS E 3 78  ? 41.421 3.017   43.062 1.00 34.68  ? 78   LYS A C     1 
ATOM   1801 O  O     . LYS E 3 78  ? 42.642 3.126   43.197 1.00 34.61  ? 78   LYS A O     1 
ATOM   1802 C  CB    . LYS E 3 78  ? 40.232 5.176   42.708 1.00 34.60  ? 78   LYS A CB    1 
ATOM   1803 C  CG    . LYS E 3 78  ? 41.398 5.975   43.262 1.00 38.05  ? 78   LYS A CG    1 
ATOM   1804 C  CD    . LYS E 3 78  ? 41.104 7.454   43.350 1.00 39.52  ? 78   LYS A CD    1 
ATOM   1805 C  CE    . LYS E 3 78  ? 42.314 8.195   43.900 1.00 41.13  ? 78   LYS A CE    1 
ATOM   1806 N  NZ    . LYS E 3 78  ? 42.104 9.670   43.883 1.00 44.55  ? 78   LYS A NZ    1 
ATOM   1807 N  N     . GLU E 3 79  ? 40.693 2.168   43.779 1.00 34.59  ? 79   GLU A N     1 
ATOM   1808 C  CA    . GLU E 3 79  ? 41.336 1.319   44.764 1.00 35.65  ? 79   GLU A CA    1 
ATOM   1809 C  C     . GLU E 3 79  ? 42.373 0.440   44.092 1.00 34.82  ? 79   GLU A C     1 
ATOM   1810 O  O     . GLU E 3 79  ? 43.484 0.274   44.603 1.00 35.93  ? 79   GLU A O     1 
ATOM   1811 C  CB    . GLU E 3 79  ? 40.312 0.443   45.491 1.00 39.34  ? 79   GLU A CB    1 
ATOM   1812 C  CG    . GLU E 3 79  ? 39.817 1.029   46.804 1.00 46.80  ? 79   GLU A CG    1 
ATOM   1813 C  CD    . GLU E 3 79  ? 38.404 1.580   46.715 1.00 52.98  ? 79   GLU A CD    1 
ATOM   1814 O  OE1   . GLU E 3 79  ? 37.794 1.491   45.623 1.00 56.61  ? 79   GLU A OE1   1 
ATOM   1815 O  OE2   . GLU E 3 79  ? 37.902 2.097   47.740 1.00 56.09  ? 79   GLU A OE2   1 
ATOM   1816 N  N     . VAL E 3 80  ? 42.017 -0.119  42.942 1.00 32.17  ? 80   VAL A N     1 
ATOM   1817 C  CA    . VAL E 3 80  ? 42.936 -0.985  42.226 1.00 30.84  ? 80   VAL A CA    1 
ATOM   1818 C  C     . VAL E 3 80  ? 44.148 -0.205  41.734 1.00 29.75  ? 80   VAL A C     1 
ATOM   1819 O  O     . VAL E 3 80  ? 45.270 -0.688  41.821 1.00 28.65  ? 80   VAL A O     1 
ATOM   1820 C  CB    . VAL E 3 80  ? 42.248 -1.674  41.029 1.00 33.53  ? 80   VAL A CB    1 
ATOM   1821 C  CG1   . VAL E 3 80  ? 43.268 -2.470  40.234 1.00 32.22  ? 80   VAL A CG1   1 
ATOM   1822 C  CG2   . VAL E 3 80  ? 41.137 -2.601  41.531 1.00 33.93  ? 80   VAL A CG2   1 
ATOM   1823 N  N     . TYR E 3 81  ? 43.933 1.010   41.235 1.00 28.02  ? 81   TYR A N     1 
ATOM   1824 C  CA    . TYR E 3 81  ? 45.057 1.797   40.752 1.00 27.51  ? 81   TYR A CA    1 
ATOM   1825 C  C     . TYR E 3 81  ? 45.944 2.203   41.918 1.00 26.40  ? 81   TYR A C     1 
ATOM   1826 O  O     . TYR E 3 81  ? 47.160 2.269   41.780 1.00 25.63  ? 81   TYR A O     1 
ATOM   1827 C  CB    . TYR E 3 81  ? 44.569 3.046   40.014 1.00 25.89  ? 81   TYR A CB    1 
ATOM   1828 C  CG    . TYR E 3 81  ? 43.431 2.770   39.072 1.00 24.71  ? 81   TYR A CG    1 
ATOM   1829 C  CD1   . TYR E 3 81  ? 43.396 1.598   38.320 1.00 23.48  ? 81   TYR A CD1   1 
ATOM   1830 C  CD2   . TYR E 3 81  ? 42.386 3.675   38.933 1.00 22.55  ? 81   TYR A CD2   1 
ATOM   1831 C  CE1   . TYR E 3 81  ? 42.353 1.336   37.461 1.00 24.15  ? 81   TYR A CE1   1 
ATOM   1832 C  CE2   . TYR E 3 81  ? 41.332 3.420   38.069 1.00 23.92  ? 81   TYR A CE2   1 
ATOM   1833 C  CZ    . TYR E 3 81  ? 41.325 2.257   37.340 1.00 24.76  ? 81   TYR A CZ    1 
ATOM   1834 O  OH    . TYR E 3 81  ? 40.297 2.010   36.471 1.00 26.18  ? 81   TYR A OH    1 
ATOM   1835 N  N     . GLN E 3 82  ? 45.329 2.459   43.071 1.00 28.50  ? 82   GLN A N     1 
ATOM   1836 C  CA    . GLN E 3 82  ? 46.082 2.862   44.250 1.00 29.81  ? 82   GLN A CA    1 
ATOM   1837 C  C     . GLN E 3 82  ? 47.025 1.762   44.742 1.00 30.55  ? 82   GLN A C     1 
ATOM   1838 O  O     . GLN E 3 82  ? 48.164 2.039   45.114 1.00 29.64  ? 82   GLN A O     1 
ATOM   1839 C  CB    . GLN E 3 82  ? 45.135 3.274   45.381 1.00 30.03  ? 82   GLN A CB    1 
ATOM   1840 C  CG    . GLN E 3 82  ? 45.869 3.718   46.646 1.00 33.11  ? 82   GLN A CG    1 
ATOM   1841 C  CD    . GLN E 3 82  ? 46.762 4.928   46.414 1.00 34.69  ? 82   GLN A CD    1 
ATOM   1842 O  OE1   . GLN E 3 82  ? 46.277 6.049   46.245 1.00 38.08  ? 82   GLN A OE1   1 
ATOM   1843 N  NE2   . GLN E 3 82  ? 48.073 4.704   46.392 1.00 34.91  ? 82   GLN A NE2   1 
ATOM   1844 N  N     . GLN E 3 83  ? 46.554 0.517   44.748 1.00 31.12  ? 83   GLN A N     1 
ATOM   1845 C  CA    . GLN E 3 83  ? 47.393 -0.591  45.192 1.00 30.58  ? 83   GLN A CA    1 
ATOM   1846 C  C     . GLN E 3 83  ? 48.545 -0.801  44.212 1.00 29.86  ? 83   GLN A C     1 
ATOM   1847 O  O     . GLN E 3 83  ? 49.688 -0.990  44.632 1.00 29.14  ? 83   GLN A O     1 
ATOM   1848 C  CB    . GLN E 3 83  ? 46.562 -1.873  45.354 1.00 33.47  ? 83   GLN A CB    1 
ATOM   1849 C  CG    . GLN E 3 83  ? 45.352 -1.667  46.279 1.00 41.93  ? 83   GLN A CG    1 
ATOM   1850 C  CD    . GLN E 3 83  ? 44.912 -2.921  47.034 1.00 44.76  ? 83   GLN A CD    1 
ATOM   1851 O  OE1   . GLN E 3 83  ? 44.687 -3.982  46.444 1.00 44.10  ? 83   GLN A OE1   1 
ATOM   1852 N  NE2   . GLN E 3 83  ? 44.771 -2.789  48.352 1.00 45.47  ? 83   GLN A NE2   1 
ATOM   1853 N  N     . VAL E 3 84  ? 48.262 -0.760  42.911 1.00 27.47  ? 84   VAL A N     1 
ATOM   1854 C  CA    . VAL E 3 84  ? 49.329 -0.925  41.930 1.00 26.04  ? 84   VAL A CA    1 
ATOM   1855 C  C     . VAL E 3 84  ? 50.324 0.211   42.148 1.00 25.74  ? 84   VAL A C     1 
ATOM   1856 O  O     . VAL E 3 84  ? 51.544 0.003   42.154 1.00 26.57  ? 84   VAL A O     1 
ATOM   1857 C  CB    . VAL E 3 84  ? 48.803 -0.855  40.470 1.00 26.07  ? 84   VAL A CB    1 
ATOM   1858 C  CG1   . VAL E 3 84  ? 49.966 -0.827  39.504 1.00 19.86  ? 84   VAL A CG1   1 
ATOM   1859 C  CG2   . VAL E 3 84  ? 47.915 -2.050  40.169 1.00 26.42  ? 84   VAL A CG2   1 
ATOM   1860 N  N     . SER E 3 85  ? 49.796 1.417   42.343 1.00 26.06  ? 85   SER A N     1 
ATOM   1861 C  CA    . SER E 3 85  ? 50.648 2.583   42.571 1.00 26.09  ? 85   SER A CA    1 
ATOM   1862 C  C     . SER E 3 85  ? 51.549 2.381   43.781 1.00 27.02  ? 85   SER A C     1 
ATOM   1863 O  O     . SER E 3 85  ? 52.757 2.594   43.697 1.00 28.67  ? 85   SER A O     1 
ATOM   1864 C  CB    . SER E 3 85  ? 49.810 3.843   42.787 1.00 25.18  ? 85   SER A CB    1 
ATOM   1865 O  OG    . SER E 3 85  ? 50.655 4.919   43.166 1.00 24.15  ? 85   SER A OG    1 
ATOM   1866 N  N     . SER E 3 86  ? 50.965 1.972   44.905 1.00 26.73  ? 86   SER A N     1 
ATOM   1867 C  CA    . SER E 3 86  ? 51.751 1.748   46.117 1.00 27.36  ? 86   SER A CA    1 
ATOM   1868 C  C     . SER E 3 86  ? 52.907 0.782   45.887 1.00 25.61  ? 86   SER A C     1 
ATOM   1869 O  O     . SER E 3 86  ? 54.008 1.009   46.377 1.00 26.58  ? 86   SER A O     1 
ATOM   1870 C  CB    . SER E 3 86  ? 50.864 1.231   47.246 1.00 26.66  ? 86   SER A CB    1 
ATOM   1871 O  OG    . SER E 3 86  ? 49.971 2.249   47.660 1.00 31.52  ? 86   SER A OG    1 
ATOM   1872 N  N     . ARG E 3 87  ? 52.675 -0.291  45.142 1.00 25.64  ? 87   ARG A N     1 
ATOM   1873 C  CA    . ARG E 3 87  ? 53.762 -1.231  44.882 1.00 26.85  ? 87   ARG A CA    1 
ATOM   1874 C  C     . ARG E 3 87  ? 54.884 -0.547  44.094 1.00 27.25  ? 87   ARG A C     1 
ATOM   1875 O  O     . ARG E 3 87  ? 56.070 -0.717  44.407 1.00 27.03  ? 87   ARG A O     1 
ATOM   1876 C  CB    . ARG E 3 87  ? 53.255 -2.464  44.122 1.00 27.32  ? 87   ARG A CB    1 
ATOM   1877 C  CG    . ARG E 3 87  ? 52.164 -3.253  44.878 1.00 28.48  ? 87   ARG A CG    1 
ATOM   1878 C  CD    . ARG E 3 87  ? 52.081 -4.708  44.419 1.00 28.37  ? 87   ARG A CD    1 
ATOM   1879 N  NE    . ARG E 3 87  ? 51.663 -4.853  43.025 1.00 27.09  ? 87   ARG A NE    1 
ATOM   1880 C  CZ    . ARG E 3 87  ? 50.396 -4.929  42.617 1.00 27.79  ? 87   ARG A CZ    1 
ATOM   1881 N  NH1   . ARG E 3 87  ? 49.400 -4.877  43.496 1.00 24.79  ? 87   ARG A NH1   1 
ATOM   1882 N  NH2   . ARG E 3 87  ? 50.123 -5.053  41.319 1.00 22.14  ? 87   ARG A NH2   1 
ATOM   1883 N  N     . ILE E 3 88  ? 54.519 0.242   43.088 1.00 26.17  ? 88   ILE A N     1 
ATOM   1884 C  CA    . ILE E 3 88  ? 55.529 0.921   42.284 1.00 25.64  ? 88   ILE A CA    1 
ATOM   1885 C  C     . ILE E 3 88  ? 56.310 1.929   43.116 1.00 26.76  ? 88   ILE A C     1 
ATOM   1886 O  O     . ILE E 3 88  ? 57.524 2.050   42.955 1.00 27.15  ? 88   ILE A O     1 
ATOM   1887 C  CB    . ILE E 3 88  ? 54.909 1.639   41.056 1.00 25.20  ? 88   ILE A CB    1 
ATOM   1888 C  CG1   . ILE E 3 88  ? 54.213 0.615   40.158 1.00 25.37  ? 88   ILE A CG1   1 
ATOM   1889 C  CG2   . ILE E 3 88  ? 56.004 2.345   40.259 1.00 23.44  ? 88   ILE A CG2   1 
ATOM   1890 C  CD1   . ILE E 3 88  ? 53.496 1.231   38.965 1.00 26.79  ? 88   ILE A CD1   1 
ATOM   1891 N  N     . MET E 3 89  ? 55.631 2.653   44.007 1.00 26.07  ? 89   MET A N     1 
ATOM   1892 C  CA    . MET E 3 89  ? 56.338 3.620   44.837 1.00 27.40  ? 89   MET A CA    1 
ATOM   1893 C  C     . MET E 3 89  ? 57.364 2.872   45.682 1.00 28.97  ? 89   MET A C     1 
ATOM   1894 O  O     . MET E 3 89  ? 58.471 3.364   45.905 1.00 29.60  ? 89   MET A O     1 
ATOM   1895 C  CB    . MET E 3 89  ? 55.378 4.396   45.754 1.00 26.80  ? 89   MET A CB    1 
ATOM   1896 C  CG    . MET E 3 89  ? 54.418 5.322   45.024 1.00 26.16  ? 89   MET A CG    1 
ATOM   1897 S  SD    . MET E 3 89  ? 55.228 6.386   43.801 1.00 27.40  ? 89   MET A SD    1 
ATOM   1898 C  CE    . MET E 3 89  ? 53.810 7.238   43.074 1.00 25.25  ? 89   MET A CE    1 
ATOM   1899 N  N     . ASN E 3 90  ? 56.997 1.680   46.149 1.00 30.87  ? 90   ASN A N     1 
ATOM   1900 C  CA    . ASN E 3 90  ? 57.917 0.889   46.955 1.00 31.46  ? 90   ASN A CA    1 
ATOM   1901 C  C     . ASN E 3 90  ? 59.138 0.489   46.138 1.00 30.77  ? 90   ASN A C     1 
ATOM   1902 O  O     . ASN E 3 90  ? 60.241 0.399   46.674 1.00 31.48  ? 90   ASN A O     1 
ATOM   1903 C  CB    . ASN E 3 90  ? 57.219 -0.338  47.542 1.00 33.84  ? 90   ASN A CB    1 
ATOM   1904 C  CG    . ASN E 3 90  ? 56.334 0.016   48.715 1.00 35.52  ? 90   ASN A CG    1 
ATOM   1905 O  OD1   . ASN E 3 90  ? 56.658 0.916   49.495 1.00 37.13  ? 90   ASN A OD1   1 
ATOM   1906 N  ND2   . ASN E 3 90  ? 55.220 -0.693  48.859 1.00 36.90  ? 90   ASN A ND2   1 
ATOM   1907 N  N     . LEU E 3 91  ? 58.956 0.253   44.842 1.00 29.42  ? 91   LEU A N     1 
ATOM   1908 C  CA    . LEU E 3 91  ? 60.109 -0.074  44.014 1.00 29.30  ? 91   LEU A CA    1 
ATOM   1909 C  C     . LEU E 3 91  ? 61.032 1.145   43.978 1.00 29.04  ? 91   LEU A C     1 
ATOM   1910 O  O     . LEU E 3 91  ? 62.249 1.001   43.994 1.00 28.50  ? 91   LEU A O     1 
ATOM   1911 C  CB    . LEU E 3 91  ? 59.695 -0.414  42.585 1.00 30.00  ? 91   LEU A CB    1 
ATOM   1912 C  CG    . LEU E 3 91  ? 58.887 -1.687  42.359 1.00 30.34  ? 91   LEU A CG    1 
ATOM   1913 C  CD1   . LEU E 3 91  ? 58.728 -1.905  40.856 1.00 32.45  ? 91   LEU A CD1   1 
ATOM   1914 C  CD2   . LEU E 3 91  ? 59.608 -2.871  42.999 1.00 33.23  ? 91   LEU A CD2   1 
ATOM   1915 N  N     . LEU E 3 92  ? 60.440 2.342   43.943 1.00 26.91  ? 92   LEU A N     1 
ATOM   1916 C  CA    . LEU E 3 92  ? 61.208 3.583   43.885 1.00 27.25  ? 92   LEU A CA    1 
ATOM   1917 C  C     . LEU E 3 92  ? 62.047 3.867   45.135 1.00 29.05  ? 92   LEU A C     1 
ATOM   1918 O  O     . LEU E 3 92  ? 63.182 4.336   45.033 1.00 26.06  ? 92   LEU A O     1 
ATOM   1919 C  CB    . LEU E 3 92  ? 60.276 4.768   43.602 1.00 24.17  ? 92   LEU A CB    1 
ATOM   1920 C  CG    . LEU E 3 92  ? 59.612 4.776   42.221 1.00 27.57  ? 92   LEU A CG    1 
ATOM   1921 C  CD1   . LEU E 3 92  ? 58.762 6.037   42.075 1.00 24.33  ? 92   LEU A CD1   1 
ATOM   1922 C  CD2   . LEU E 3 92  ? 60.675 4.727   41.129 1.00 24.69  ? 92   LEU A CD2   1 
ATOM   1923 N  N     . ARG E 3 93  ? 61.498 3.571   46.308 1.00 31.60  ? 93   ARG A N     1 
ATOM   1924 C  CA    . ARG E 3 93  ? 62.215 3.803   47.556 1.00 36.92  ? 93   ARG A CA    1 
ATOM   1925 C  C     . ARG E 3 93  ? 63.566 3.089   47.566 1.00 38.18  ? 93   ARG A C     1 
ATOM   1926 O  O     . ARG E 3 93  ? 64.490 3.498   48.263 1.00 38.65  ? 93   ARG A O     1 
ATOM   1927 C  CB    . ARG E 3 93  ? 61.383 3.321   48.745 1.00 37.55  ? 93   ARG A CB    1 
ATOM   1928 C  CG    . ARG E 3 93  ? 60.017 3.963   48.859 1.00 40.35  ? 93   ARG A CG    1 
ATOM   1929 C  CD    . ARG E 3 93  ? 59.144 3.156   49.803 1.00 42.49  ? 93   ARG A CD    1 
ATOM   1930 N  NE    . ARG E 3 93  ? 57.744 3.556   49.739 1.00 44.69  ? 93   ARG A NE    1 
ATOM   1931 C  CZ    . ARG E 3 93  ? 57.289 4.740   50.129 1.00 46.02  ? 93   ARG A CZ    1 
ATOM   1932 N  NH1   . ARG E 3 93  ? 58.128 5.648   50.613 1.00 45.98  ? 93   ARG A NH1   1 
ATOM   1933 N  NH2   . ARG E 3 93  ? 55.993 5.011   50.043 1.00 46.24  ? 93   ARG A NH2   1 
ATOM   1934 N  N     . GLU E 3 94  ? 63.681 2.018   46.792 1.00 41.29  ? 94   GLU A N     1 
ATOM   1935 C  CA    . GLU E 3 94  ? 64.926 1.268   46.738 1.00 43.01  ? 94   GLU A CA    1 
ATOM   1936 C  C     . GLU E 3 94  ? 66.036 2.077   46.082 1.00 41.95  ? 94   GLU A C     1 
ATOM   1937 O  O     . GLU E 3 94  ? 67.215 1.766   46.242 1.00 42.95  ? 94   GLU A O     1 
ATOM   1938 C  CB    . GLU E 3 94  ? 64.732 -0.027  45.952 1.00 46.65  ? 94   GLU A CB    1 
ATOM   1939 C  CG    . GLU E 3 94  ? 63.649 -0.941  46.492 1.00 53.37  ? 94   GLU A CG    1 
ATOM   1940 C  CD    . GLU E 3 94  ? 63.862 -1.290  47.948 1.00 57.81  ? 94   GLU A CD    1 
ATOM   1941 O  OE1   . GLU E 3 94  ? 64.997 -1.680  48.302 1.00 60.26  ? 94   GLU A OE1   1 
ATOM   1942 O  OE2   . GLU E 3 94  ? 62.894 -1.179  48.734 1.00 60.60  ? 94   GLU A OE2   1 
ATOM   1943 N  N     . TYR E 3 95  ? 65.666 3.115   45.340 1.00 40.17  ? 95   TYR A N     1 
ATOM   1944 C  CA    . TYR E 3 95  ? 66.665 3.924   44.654 1.00 38.59  ? 95   TYR A CA    1 
ATOM   1945 C  C     . TYR E 3 95  ? 67.039 5.197   45.397 1.00 37.52  ? 95   TYR A C     1 
ATOM   1946 O  O     . TYR E 3 95  ? 68.017 5.853   45.050 1.00 37.54  ? 95   TYR A O     1 
ATOM   1947 C  CB    . TYR E 3 95  ? 66.181 4.247   43.239 1.00 37.46  ? 95   TYR A CB    1 
ATOM   1948 C  CG    . TYR E 3 95  ? 66.078 3.010   42.379 1.00 36.62  ? 95   TYR A CG    1 
ATOM   1949 C  CD1   . TYR E 3 95  ? 67.201 2.482   41.747 1.00 37.03  ? 95   TYR A CD1   1 
ATOM   1950 C  CD2   . TYR E 3 95  ? 64.871 2.325   42.258 1.00 37.33  ? 95   TYR A CD2   1 
ATOM   1951 C  CE1   . TYR E 3 95  ? 67.125 1.296   41.017 1.00 36.86  ? 95   TYR A CE1   1 
ATOM   1952 C  CE2   . TYR E 3 95  ? 64.784 1.137   41.533 1.00 37.19  ? 95   TYR A CE2   1 
ATOM   1953 C  CZ    . TYR E 3 95  ? 65.911 0.632   40.919 1.00 37.39  ? 95   TYR A CZ    1 
ATOM   1954 O  OH    . TYR E 3 95  ? 65.822 -0.541  40.218 1.00 39.66  ? 95   TYR A OH    1 
ATOM   1955 N  N     . SER E 3 96  ? 66.266 5.543   46.420 1.00 37.20  ? 96   SER A N     1 
ATOM   1956 C  CA    . SER E 3 96  ? 66.551 6.735   47.208 1.00 38.66  ? 96   SER A CA    1 
ATOM   1957 C  C     . SER E 3 96  ? 65.660 6.865   48.434 1.00 40.56  ? 96   SER A C     1 
ATOM   1958 O  O     . SER E 3 96  ? 64.461 6.601   48.366 1.00 40.69  ? 96   SER A O     1 
ATOM   1959 C  CB    . SER E 3 96  ? 66.398 7.991   46.354 1.00 38.21  ? 96   SER A CB    1 
ATOM   1960 O  OG    . SER E 3 96  ? 66.639 9.140   47.144 1.00 41.06  ? 96   SER A OG    1 
ATOM   1961 N  N     . GLU E 3 97  ? 66.255 7.285   49.548 1.00 43.12  ? 97   GLU A N     1 
ATOM   1962 C  CA    . GLU E 3 97  ? 65.521 7.476   50.798 1.00 47.07  ? 97   GLU A CA    1 
ATOM   1963 C  C     . GLU E 3 97  ? 64.656 8.730   50.664 1.00 46.56  ? 97   GLU A C     1 
ATOM   1964 O  O     . GLU E 3 97  ? 63.536 8.794   51.180 1.00 47.72  ? 97   GLU A O     1 
ATOM   1965 C  CB    . GLU E 3 97  ? 66.477 7.695   51.984 1.00 50.91  ? 97   GLU A CB    1 
ATOM   1966 C  CG    . GLU E 3 97  ? 67.704 6.796   52.045 1.00 56.58  ? 97   GLU A CG    1 
ATOM   1967 C  CD    . GLU E 3 97  ? 68.646 7.016   50.882 1.00 59.75  ? 97   GLU A CD    1 
ATOM   1968 O  OE1   . GLU E 3 97  ? 68.665 8.137   50.329 1.00 62.56  ? 97   GLU A OE1   1 
ATOM   1969 O  OE2   . GLU E 3 97  ? 69.378 6.067   50.528 1.00 63.03  ? 97   GLU A OE2   1 
ATOM   1970 N  N     . LYS E 3 98  ? 65.204 9.733   49.982 1.00 44.57  ? 98   LYS A N     1 
ATOM   1971 C  CA    . LYS E 3 98  ? 64.521 11.001  49.780 1.00 41.93  ? 98   LYS A CA    1 
ATOM   1972 C  C     . LYS E 3 98  ? 63.582 10.914  48.593 1.00 40.04  ? 98   LYS A C     1 
ATOM   1973 O  O     . LYS E 3 98  ? 63.994 11.118  47.454 1.00 38.11  ? 98   LYS A O     1 
ATOM   1974 C  CB    . LYS E 3 98  ? 65.546 12.111  49.538 1.00 44.35  ? 98   LYS A CB    1 
ATOM   1975 C  CG    . LYS E 3 98  ? 66.551 12.285  50.665 1.00 46.14  ? 98   LYS A CG    1 
ATOM   1976 C  CD    . LYS E 3 98  ? 67.620 13.301  50.286 1.00 49.21  ? 98   LYS A CD    1 
ATOM   1977 C  CE    . LYS E 3 98  ? 68.727 13.356  51.329 1.00 51.07  ? 98   LYS A CE    1 
ATOM   1978 N  NZ    . LYS E 3 98  ? 69.893 14.155  50.846 1.00 54.82  ? 98   LYS A NZ    1 
ATOM   1979 N  N     . ILE E 3 99  ? 62.317 10.612  48.868 1.00 36.78  ? 99   ILE A N     1 
ATOM   1980 C  CA    . ILE E 3 99  ? 61.319 10.496  47.819 1.00 35.02  ? 99   ILE A CA    1 
ATOM   1981 C  C     . ILE E 3 99  ? 60.057 11.284  48.168 1.00 32.04  ? 99   ILE A C     1 
ATOM   1982 O  O     . ILE E 3 99  ? 59.578 11.261  49.305 1.00 30.74  ? 99   ILE A O     1 
ATOM   1983 C  CB    . ILE E 3 99  ? 60.950 9.019   47.572 1.00 35.52  ? 99   ILE A CB    1 
ATOM   1984 C  CG1   . ILE E 3 99  ? 59.840 8.926   46.523 1.00 36.24  ? 99   ILE A CG1   1 
ATOM   1985 C  CG2   . ILE E 3 99  ? 60.524 8.368   48.883 1.00 35.96  ? 99   ILE A CG2   1 
ATOM   1986 C  CD1   . ILE E 3 99  ? 59.485 7.504   46.110 1.00 38.10  ? 99   ILE A CD1   1 
ATOM   1987 N  N     . GLU E 3 100 ? 59.522 11.986  47.178 1.00 29.40  ? 100  GLU A N     1 
ATOM   1988 C  CA    . GLU E 3 100 ? 58.325 12.778  47.393 1.00 28.18  ? 100  GLU A CA    1 
ATOM   1989 C  C     . GLU E 3 100 ? 57.228 12.311  46.451 1.00 27.28  ? 100  GLU A C     1 
ATOM   1990 O  O     . GLU E 3 100 ? 57.265 12.576  45.255 1.00 23.44  ? 100  GLU A O     1 
ATOM   1991 C  CB    . GLU E 3 100 ? 58.625 14.263  47.151 1.00 28.64  ? 100  GLU A CB    1 
ATOM   1992 C  CG    . GLU E 3 100 ? 57.494 15.208  47.523 1.00 30.12  ? 100  GLU A CG    1 
ATOM   1993 C  CD    . GLU E 3 100 ? 57.905 16.672  47.426 1.00 33.74  ? 100  GLU A CD    1 
ATOM   1994 O  OE1   . GLU E 3 100 ? 59.055 17.010  47.787 1.00 33.54  ? 100  GLU A OE1   1 
ATOM   1995 O  OE2   . GLU E 3 100 ? 57.074 17.493  46.998 1.00 37.10  ? 100  GLU A OE2   1 
ATOM   1996 N  N     . ILE E 3 101 ? 56.255 11.597  46.997 1.00 27.77  ? 101  ILE A N     1 
ATOM   1997 C  CA    . ILE E 3 101 ? 55.139 11.121  46.205 1.00 28.02  ? 101  ILE A CA    1 
ATOM   1998 C  C     . ILE E 3 101 ? 54.215 12.318  46.051 1.00 28.43  ? 101  ILE A C     1 
ATOM   1999 O  O     . ILE E 3 101 ? 53.607 12.768  47.022 1.00 29.91  ? 101  ILE A O     1 
ATOM   2000 C  CB    . ILE E 3 101 ? 54.422 9.986   46.936 1.00 29.27  ? 101  ILE A CB    1 
ATOM   2001 C  CG1   . ILE E 3 101 ? 55.388 8.812   47.117 1.00 30.07  ? 101  ILE A CG1   1 
ATOM   2002 C  CG2   . ILE E 3 101 ? 53.180 9.569   46.164 1.00 27.93  ? 101  ILE A CG2   1 
ATOM   2003 C  CD1   . ILE E 3 101 ? 54.928 7.800   48.142 1.00 35.48  ? 101  ILE A CD1   1 
ATOM   2004 N  N     . ALA E 3 102 ? 54.109 12.836  44.834 1.00 29.29  ? 102  ALA A N     1 
ATOM   2005 C  CA    . ALA E 3 102 ? 53.288 14.017  44.588 1.00 30.88  ? 102  ALA A CA    1 
ATOM   2006 C  C     . ALA E 3 102 ? 51.834 13.737  44.220 1.00 30.92  ? 102  ALA A C     1 
ATOM   2007 O  O     . ALA E 3 102 ? 50.976 14.597  44.395 1.00 30.48  ? 102  ALA A O     1 
ATOM   2008 C  CB    . ALA E 3 102 ? 53.944 14.885  43.516 1.00 29.09  ? 102  ALA A CB    1 
ATOM   2009 N  N     . SER E 3 103 ? 51.558 12.547  43.696 1.00 30.72  ? 103  SER A N     1 
ATOM   2010 C  CA    . SER E 3 103 ? 50.189 12.184  43.328 1.00 29.49  ? 103  SER A CA    1 
ATOM   2011 C  C     . SER E 3 103 ? 50.119 10.674  43.209 1.00 28.92  ? 103  SER A C     1 
ATOM   2012 O  O     . SER E 3 103 ? 51.095 9.976   43.481 1.00 28.13  ? 103  SER A O     1 
ATOM   2013 C  CB    . SER E 3 103 ? 49.793 12.817  41.995 1.00 30.33  ? 103  SER A CB    1 
ATOM   2014 O  OG    . SER E 3 103 ? 50.377 12.117  40.910 1.00 34.35  ? 103  SER A OG    1 
ATOM   2015 N  N     . ILE E 3 104 ? 48.977 10.161  42.778 1.00 28.74  ? 104  ILE A N     1 
ATOM   2016 C  CA    . ILE E 3 104 ? 48.836 8.723   42.659 1.00 28.14  ? 104  ILE A CA    1 
ATOM   2017 C  C     . ILE E 3 104 ? 49.744 8.094   41.605 1.00 27.00  ? 104  ILE A C     1 
ATOM   2018 O  O     . ILE E 3 104 ? 49.967 6.888   41.627 1.00 25.99  ? 104  ILE A O     1 
ATOM   2019 C  CB    . ILE E 3 104 ? 47.377 8.323   42.356 1.00 28.27  ? 104  ILE A CB    1 
ATOM   2020 C  CG1   . ILE E 3 104 ? 47.242 6.800   42.447 1.00 27.99  ? 104  ILE A CG1   1 
ATOM   2021 C  CG2   . ILE E 3 104 ? 46.969 8.835   40.973 1.00 28.85  ? 104  ILE A CG2   1 
ATOM   2022 C  CD1   . ILE E 3 104 ? 45.825 6.311   42.580 1.00 33.82  ? 104  ILE A CD1   1 
ATOM   2023 N  N     . ASP E 3 105 ? 50.280 8.888   40.686 1.00 25.28  ? 105  ASP A N     1 
ATOM   2024 C  CA    . ASP E 3 105 ? 51.134 8.294   39.662 1.00 25.72  ? 105  ASP A CA    1 
ATOM   2025 C  C     . ASP E 3 105 ? 52.470 8.995   39.405 1.00 24.13  ? 105  ASP A C     1 
ATOM   2026 O  O     . ASP E 3 105 ? 53.052 8.834   38.341 1.00 25.84  ? 105  ASP A O     1 
ATOM   2027 C  CB    . ASP E 3 105 ? 50.361 8.188   38.344 1.00 24.01  ? 105  ASP A CB    1 
ATOM   2028 C  CG    . ASP E 3 105 ? 50.461 9.448   37.506 1.00 24.84  ? 105  ASP A CG    1 
ATOM   2029 O  OD1   . ASP E 3 105 ? 50.582 10.546  38.092 1.00 24.39  ? 105  ASP A OD1   1 
ATOM   2030 O  OD2   . ASP E 3 105 ? 50.408 9.343   36.261 1.00 23.22  ? 105  ASP A OD2   1 
ATOM   2031 N  N     . GLU E 3 106 ? 52.965 9.764   40.363 1.00 23.72  ? 106  GLU A N     1 
ATOM   2032 C  CA    . GLU E 3 106 ? 54.239 10.440  40.151 1.00 24.72  ? 106  GLU A CA    1 
ATOM   2033 C  C     . GLU E 3 106 ? 54.986 10.688  41.449 1.00 24.74  ? 106  GLU A C     1 
ATOM   2034 O  O     . GLU E 3 106 ? 54.377 10.830  42.509 1.00 22.99  ? 106  GLU A O     1 
ATOM   2035 C  CB    . GLU E 3 106 ? 54.028 11.765  39.420 1.00 26.22  ? 106  GLU A CB    1 
ATOM   2036 C  CG    . GLU E 3 106 ? 53.354 12.840  40.241 1.00 27.21  ? 106  GLU A CG    1 
ATOM   2037 C  CD    . GLU E 3 106 ? 52.987 14.043  39.398 1.00 31.11  ? 106  GLU A CD    1 
ATOM   2038 O  OE1   . GLU E 3 106 ? 52.363 13.850  38.333 1.00 29.48  ? 106  GLU A OE1   1 
ATOM   2039 O  OE2   . GLU E 3 106 ? 53.322 15.180  39.796 1.00 32.68  ? 106  GLU A OE2   1 
ATOM   2040 N  N     . ALA E 3 107 ? 56.311 10.741  41.359 1.00 22.30  ? 107  ALA A N     1 
ATOM   2041 C  CA    . ALA E 3 107 ? 57.134 10.966  42.534 1.00 22.71  ? 107  ALA A CA    1 
ATOM   2042 C  C     . ALA E 3 107 ? 58.476 11.555  42.152 1.00 23.73  ? 107  ALA A C     1 
ATOM   2043 O  O     . ALA E 3 107 ? 58.944 11.367  41.032 1.00 23.37  ? 107  ALA A O     1 
ATOM   2044 C  CB    . ALA E 3 107 ? 57.344 9.652   43.280 1.00 20.26  ? 107  ALA A CB    1 
ATOM   2045 N  N     . TYR E 3 108 ? 59.091 12.259  43.096 1.00 23.87  ? 108  TYR A N     1 
ATOM   2046 C  CA    . TYR E 3 108 ? 60.405 12.855  42.892 1.00 26.11  ? 108  TYR A CA    1 
ATOM   2047 C  C     . TYR E 3 108 ? 61.415 12.137  43.770 1.00 26.49  ? 108  TYR A C     1 
ATOM   2048 O  O     . TYR E 3 108 ? 61.145 11.862  44.945 1.00 29.77  ? 108  TYR A O     1 
ATOM   2049 C  CB    . TYR E 3 108 ? 60.409 14.323  43.305 1.00 23.32  ? 108  TYR A CB    1 
ATOM   2050 C  CG    . TYR E 3 108 ? 59.480 15.198  42.517 1.00 25.48  ? 108  TYR A CG    1 
ATOM   2051 C  CD1   . TYR E 3 108 ? 59.916 15.852  41.358 1.00 24.74  ? 108  TYR A CD1   1 
ATOM   2052 C  CD2   . TYR E 3 108 ? 58.158 15.383  42.926 1.00 24.16  ? 108  TYR A CD2   1 
ATOM   2053 C  CE1   . TYR E 3 108 ? 59.052 16.673  40.629 1.00 23.77  ? 108  TYR A CE1   1 
ATOM   2054 C  CE2   . TYR E 3 108 ? 57.291 16.194  42.205 1.00 23.55  ? 108  TYR A CE2   1 
ATOM   2055 C  CZ    . TYR E 3 108 ? 57.742 16.835  41.061 1.00 25.07  ? 108  TYR A CZ    1 
ATOM   2056 O  OH    . TYR E 3 108 ? 56.874 17.633  40.352 1.00 26.00  ? 108  TYR A OH    1 
ATOM   2057 N  N     . LEU E 3 109 ? 62.578 11.841  43.203 1.00 27.43  ? 109  LEU A N     1 
ATOM   2058 C  CA    . LEU E 3 109 ? 63.655 11.200  43.948 1.00 27.65  ? 109  LEU A CA    1 
ATOM   2059 C  C     . LEU E 3 109 ? 64.850 12.137  43.942 1.00 28.08  ? 109  LEU A C     1 
ATOM   2060 O  O     . LEU E 3 109 ? 65.261 12.623  42.881 1.00 25.90  ? 109  LEU A O     1 
ATOM   2061 C  CB    . LEU E 3 109 ? 64.075 9.872   43.306 1.00 27.22  ? 109  LEU A CB    1 
ATOM   2062 C  CG    . LEU E 3 109 ? 63.151 8.663   43.456 1.00 29.74  ? 109  LEU A CG    1 
ATOM   2063 C  CD1   . LEU E 3 109 ? 61.809 8.959   42.820 1.00 29.76  ? 109  LEU A CD1   1 
ATOM   2064 C  CD2   . LEU E 3 109 ? 63.790 7.452   42.790 1.00 30.07  ? 109  LEU A CD2   1 
ATOM   2065 N  N     . ASP E 3 110 ? 65.389 12.415  45.125 1.00 28.07  ? 110  ASP A N     1 
ATOM   2066 C  CA    . ASP E 3 110 ? 66.575 13.255  45.225 1.00 28.94  ? 110  ASP A CA    1 
ATOM   2067 C  C     . ASP E 3 110 ? 67.701 12.233  45.183 1.00 28.53  ? 110  ASP A C     1 
ATOM   2068 O  O     . ASP E 3 110 ? 67.966 11.558  46.173 1.00 30.23  ? 110  ASP A O     1 
ATOM   2069 C  CB    . ASP E 3 110 ? 66.609 14.001  46.558 1.00 28.83  ? 110  ASP A CB    1 
ATOM   2070 C  CG    . ASP E 3 110 ? 67.853 14.865  46.714 1.00 30.32  ? 110  ASP A CG    1 
ATOM   2071 O  OD1   . ASP E 3 110 ? 68.931 14.478  46.214 1.00 30.77  ? 110  ASP A OD1   1 
ATOM   2072 O  OD2   . ASP E 3 110 ? 67.757 15.928  47.357 1.00 32.26  ? 110  ASP A OD2   1 
ATOM   2073 N  N     . ILE E 3 111 ? 68.348 12.096  44.034 1.00 29.80  ? 111  ILE A N     1 
ATOM   2074 C  CA    . ILE E 3 111 ? 69.428 11.126  43.909 1.00 30.45  ? 111  ILE A CA    1 
ATOM   2075 C  C     . ILE E 3 111 ? 70.811 11.765  43.956 1.00 31.01  ? 111  ILE A C     1 
ATOM   2076 O  O     . ILE E 3 111 ? 71.763 11.215  43.416 1.00 30.90  ? 111  ILE A O     1 
ATOM   2077 C  CB    . ILE E 3 111 ? 69.286 10.311  42.603 1.00 29.12  ? 111  ILE A CB    1 
ATOM   2078 C  CG1   . ILE E 3 111 ? 69.443 11.227  41.390 1.00 30.08  ? 111  ILE A CG1   1 
ATOM   2079 C  CG2   . ILE E 3 111 ? 67.914 9.624   42.566 1.00 25.64  ? 111  ILE A CG2   1 
ATOM   2080 C  CD1   . ILE E 3 111 ? 69.271 10.502  40.045 1.00 28.14  ? 111  ILE A CD1   1 
ATOM   2081 N  N     . SER E 3 112 ? 70.913 12.924  44.606 1.00 33.04  ? 112  SER A N     1 
ATOM   2082 C  CA    . SER E 3 112 ? 72.186 13.644  44.737 1.00 35.62  ? 112  SER A CA    1 
ATOM   2083 C  C     . SER E 3 112 ? 73.282 12.753  45.332 1.00 36.06  ? 112  SER A C     1 
ATOM   2084 O  O     . SER E 3 112 ? 74.414 12.761  44.871 1.00 35.03  ? 112  SER A O     1 
ATOM   2085 C  CB    . SER E 3 112 ? 72.006 14.881  45.630 1.00 34.79  ? 112  SER A CB    1 
ATOM   2086 O  OG    . SER E 3 112 ? 71.034 15.768  45.097 1.00 35.08  ? 112  SER A OG    1 
ATOM   2087 N  N     . ASP E 3 113 ? 72.938 11.990  46.364 1.00 39.63  ? 113  ASP A N     1 
ATOM   2088 C  CA    . ASP E 3 113 ? 73.901 11.099  47.002 1.00 43.33  ? 113  ASP A CA    1 
ATOM   2089 C  C     . ASP E 3 113 ? 73.959 9.726   46.328 1.00 43.22  ? 113  ASP A C     1 
ATOM   2090 O  O     . ASP E 3 113 ? 74.556 8.802   46.875 1.00 44.61  ? 113  ASP A O     1 
ATOM   2091 C  CB    . ASP E 3 113 ? 73.550 10.890  48.483 1.00 45.96  ? 113  ASP A CB    1 
ATOM   2092 C  CG    . ASP E 3 113 ? 73.510 12.187  49.276 1.00 50.00  ? 113  ASP A CG    1 
ATOM   2093 O  OD1   . ASP E 3 113 ? 74.418 13.026  49.097 1.00 51.99  ? 113  ASP A OD1   1 
ATOM   2094 O  OD2   . ASP E 3 113 ? 72.577 12.360  50.097 1.00 52.31  ? 113  ASP A OD2   1 
ATOM   2095 N  N     . LYS E 3 114 ? 73.345 9.583   45.156 1.00 43.20  ? 114  LYS A N     1 
ATOM   2096 C  CA    . LYS E 3 114 ? 73.334 8.289   44.464 1.00 43.13  ? 114  LYS A CA    1 
ATOM   2097 C  C     . LYS E 3 114 ? 74.122 8.258   43.156 1.00 42.27  ? 114  LYS A C     1 
ATOM   2098 O  O     . LYS E 3 114 ? 74.644 7.215   42.764 1.00 42.59  ? 114  LYS A O     1 
ATOM   2099 C  CB    . LYS E 3 114 ? 71.892 7.852   44.190 1.00 44.06  ? 114  LYS A CB    1 
ATOM   2100 C  CG    . LYS E 3 114 ? 71.012 7.811   45.424 1.00 44.91  ? 114  LYS A CG    1 
ATOM   2101 C  CD    . LYS E 3 114 ? 71.531 6.809   46.441 1.00 45.46  ? 114  LYS A CD    1 
ATOM   2102 C  CE    . LYS E 3 114 ? 70.754 6.893   47.737 1.00 47.60  ? 114  LYS A CE    1 
ATOM   2103 N  NZ    . LYS E 3 114 ? 71.357 6.023   48.784 1.00 48.23  ? 114  LYS A NZ    1 
ATOM   2104 N  N     . VAL E 3 115 ? 74.191 9.391   42.466 1.00 41.92  ? 115  VAL A N     1 
ATOM   2105 C  CA    . VAL E 3 115 ? 74.942 9.471   41.215 1.00 41.32  ? 115  VAL A CA    1 
ATOM   2106 C  C     . VAL E 3 115 ? 75.886 10.664  41.292 1.00 43.88  ? 115  VAL A C     1 
ATOM   2107 O  O     . VAL E 3 115 ? 75.797 11.470  42.218 1.00 43.14  ? 115  VAL A O     1 
ATOM   2108 C  CB    . VAL E 3 115 ? 74.009 9.625   40.000 1.00 39.45  ? 115  VAL A CB    1 
ATOM   2109 C  CG1   . VAL E 3 115 ? 73.063 8.436   39.933 1.00 39.24  ? 115  VAL A CG1   1 
ATOM   2110 C  CG2   . VAL E 3 115 ? 73.227 10.920  40.094 1.00 35.97  ? 115  VAL A CG2   1 
ATOM   2111 N  N     . ARG E 3 116 ? 76.788 10.783  40.324 1.00 46.11  ? 116  ARG A N     1 
ATOM   2112 C  CA    . ARG E 3 116 ? 77.745 11.882  40.336 1.00 46.74  ? 116  ARG A CA    1 
ATOM   2113 C  C     . ARG E 3 116 ? 77.523 12.895  39.224 1.00 46.46  ? 116  ARG A C     1 
ATOM   2114 O  O     . ARG E 3 116 ? 77.989 14.032  39.310 1.00 47.57  ? 116  ARG A O     1 
ATOM   2115 C  CB    . ARG E 3 116 ? 79.172 11.323  40.281 1.00 49.34  ? 116  ARG A CB    1 
ATOM   2116 C  CG    . ARG E 3 116 ? 79.566 10.570  41.552 1.00 52.59  ? 116  ARG A CG    1 
ATOM   2117 C  CD    . ARG E 3 116 ? 80.980 9.989   41.503 1.00 56.32  ? 116  ARG A CD    1 
ATOM   2118 N  NE    . ARG E 3 116 ? 81.077 8.807   40.648 1.00 57.36  ? 116  ARG A NE    1 
ATOM   2119 C  CZ    . ARG E 3 116 ? 81.726 7.694   40.983 1.00 57.60  ? 116  ARG A CZ    1 
ATOM   2120 N  NH1   . ARG E 3 116 ? 82.340 7.602   42.155 1.00 58.37  ? 116  ARG A NH1   1 
ATOM   2121 N  NH2   . ARG E 3 116 ? 81.753 6.667   40.148 1.00 57.78  ? 116  ARG A NH2   1 
ATOM   2122 N  N     . ASP E 3 117 ? 76.816 12.488  38.178 1.00 44.79  ? 117  ASP A N     1 
ATOM   2123 C  CA    . ASP E 3 117 ? 76.527 13.385  37.066 1.00 43.29  ? 117  ASP A CA    1 
ATOM   2124 C  C     . ASP E 3 117 ? 75.255 12.940  36.342 1.00 41.98  ? 117  ASP A C     1 
ATOM   2125 O  O     . ASP E 3 117 ? 74.643 11.933  36.715 1.00 41.37  ? 117  ASP A O     1 
ATOM   2126 C  CB    . ASP E 3 117 ? 77.708 13.436  36.088 1.00 45.23  ? 117  ASP A CB    1 
ATOM   2127 C  CG    . ASP E 3 117 ? 78.087 12.070  35.548 1.00 46.02  ? 117  ASP A CG    1 
ATOM   2128 O  OD1   . ASP E 3 117 ? 77.194 11.340  35.064 1.00 44.13  ? 117  ASP A OD1   1 
ATOM   2129 O  OD2   . ASP E 3 117 ? 79.290 11.733  35.599 1.00 47.96  ? 117  ASP A OD2   1 
ATOM   2130 N  N     . TYR E 3 118 ? 74.857 13.685  35.315 1.00 39.74  ? 118  TYR A N     1 
ATOM   2131 C  CA    . TYR E 3 118 ? 73.651 13.343  34.580 1.00 39.18  ? 118  TYR A CA    1 
ATOM   2132 C  C     . TYR E 3 118 ? 73.764 12.049  33.795 1.00 39.67  ? 118  TYR A C     1 
ATOM   2133 O  O     . TYR E 3 118 ? 72.760 11.362  33.584 1.00 37.49  ? 118  TYR A O     1 
ATOM   2134 C  CB    . TYR E 3 118 ? 73.228 14.494  33.663 1.00 38.81  ? 118  TYR A CB    1 
ATOM   2135 C  CG    . TYR E 3 118 ? 72.590 15.636  34.424 1.00 38.31  ? 118  TYR A CG    1 
ATOM   2136 C  CD1   . TYR E 3 118 ? 71.688 15.385  35.463 1.00 38.04  ? 118  TYR A CD1   1 
ATOM   2137 C  CD2   . TYR E 3 118 ? 72.880 16.963  34.115 1.00 37.07  ? 118  TYR A CD2   1 
ATOM   2138 C  CE1   . TYR E 3 118 ? 71.097 16.426  36.178 1.00 35.85  ? 118  TYR A CE1   1 
ATOM   2139 C  CE2   . TYR E 3 118 ? 72.291 18.012  34.825 1.00 36.06  ? 118  TYR A CE2   1 
ATOM   2140 C  CZ    . TYR E 3 118 ? 71.401 17.733  35.854 1.00 35.63  ? 118  TYR A CZ    1 
ATOM   2141 O  OH    . TYR E 3 118 ? 70.814 18.760  36.556 1.00 36.36  ? 118  TYR A OH    1 
ATOM   2142 N  N     . ARG E 3 119 ? 74.979 11.704  33.373 1.00 40.28  ? 119  ARG A N     1 
ATOM   2143 C  CA    . ARG E 3 119 ? 75.184 10.461  32.633 1.00 40.49  ? 119  ARG A CA    1 
ATOM   2144 C  C     . ARG E 3 119 ? 74.745 9.296   33.520 1.00 38.07  ? 119  ARG A C     1 
ATOM   2145 O  O     . ARG E 3 119 ? 73.981 8.429   33.091 1.00 36.59  ? 119  ARG A O     1 
ATOM   2146 C  CB    . ARG E 3 119 ? 76.656 10.291  32.251 1.00 44.74  ? 119  ARG A CB    1 
ATOM   2147 C  CG    . ARG E 3 119 ? 76.927 9.032   31.433 1.00 50.19  ? 119  ARG A CG    1 
ATOM   2148 C  CD    . ARG E 3 119 ? 78.421 8.837   31.157 1.00 55.93  ? 119  ARG A CD    1 
ATOM   2149 N  NE    . ARG E 3 119 ? 79.209 8.620   32.375 1.00 59.78  ? 119  ARG A NE    1 
ATOM   2150 C  CZ    . ARG E 3 119 ? 79.128 7.536   33.149 1.00 61.59  ? 119  ARG A CZ    1 
ATOM   2151 N  NH1   . ARG E 3 119 ? 78.291 6.550   32.845 1.00 62.47  ? 119  ARG A NH1   1 
ATOM   2152 N  NH2   . ARG E 3 119 ? 79.890 7.434   34.231 1.00 61.83  ? 119  ARG A NH2   1 
ATOM   2153 N  N     . GLU E 3 120 ? 75.226 9.288   34.760 1.00 36.37  ? 120  GLU A N     1 
ATOM   2154 C  CA    . GLU E 3 120 ? 74.862 8.245   35.709 1.00 37.23  ? 120  GLU A CA    1 
ATOM   2155 C  C     . GLU E 3 120 ? 73.381 8.349   36.078 1.00 36.71  ? 120  GLU A C     1 
ATOM   2156 O  O     . GLU E 3 120 ? 72.702 7.336   36.245 1.00 36.44  ? 120  GLU A O     1 
ATOM   2157 C  CB    . GLU E 3 120 ? 75.722 8.353   36.974 1.00 39.57  ? 120  GLU A CB    1 
ATOM   2158 C  CG    . GLU E 3 120 ? 77.129 7.783   36.815 1.00 41.91  ? 120  GLU A CG    1 
ATOM   2159 C  CD    . GLU E 3 120 ? 77.948 7.827   38.097 1.00 43.27  ? 120  GLU A CD    1 
ATOM   2160 O  OE1   . GLU E 3 120 ? 77.375 8.060   39.183 1.00 45.64  ? 120  GLU A OE1   1 
ATOM   2161 O  OE2   . GLU E 3 120 ? 79.178 7.617   38.017 1.00 44.58  ? 120  GLU A OE2   1 
ATOM   2162 N  N     . ALA E 3 121 ? 72.888 9.577   36.207 1.00 34.96  ? 121  ALA A N     1 
ATOM   2163 C  CA    . ALA E 3 121 ? 71.488 9.809   36.544 1.00 33.67  ? 121  ALA A CA    1 
ATOM   2164 C  C     . ALA E 3 121 ? 70.615 9.179   35.463 1.00 32.34  ? 121  ALA A C     1 
ATOM   2165 O  O     . ALA E 3 121 ? 69.634 8.500   35.758 1.00 31.70  ? 121  ALA A O     1 
ATOM   2166 C  CB    . ALA E 3 121 ? 71.216 11.306  36.639 1.00 33.81  ? 121  ALA A CB    1 
ATOM   2167 N  N     . TYR E 3 122 ? 70.992 9.409   34.210 1.00 32.16  ? 122  TYR A N     1 
ATOM   2168 C  CA    . TYR E 3 122 ? 70.274 8.864   33.069 1.00 31.90  ? 122  TYR A CA    1 
ATOM   2169 C  C     . TYR E 3 122 ? 70.209 7.344   33.186 1.00 33.03  ? 122  TYR A C     1 
ATOM   2170 O  O     . TYR E 3 122 ? 69.132 6.760   33.102 1.00 32.27  ? 122  TYR A O     1 
ATOM   2171 C  CB    . TYR E 3 122 ? 70.989 9.246   31.778 1.00 32.54  ? 122  TYR A CB    1 
ATOM   2172 C  CG    . TYR E 3 122 ? 70.269 8.834   30.516 1.00 33.71  ? 122  TYR A CG    1 
ATOM   2173 C  CD1   . TYR E 3 122 ? 69.258 9.621   29.979 1.00 34.43  ? 122  TYR A CD1   1 
ATOM   2174 C  CD2   . TYR E 3 122 ? 70.602 7.652   29.858 1.00 35.19  ? 122  TYR A CD2   1 
ATOM   2175 C  CE1   . TYR E 3 122 ? 68.591 9.246   28.811 1.00 35.11  ? 122  TYR A CE1   1 
ATOM   2176 C  CE2   . TYR E 3 122 ? 69.944 7.265   28.695 1.00 34.58  ? 122  TYR A CE2   1 
ATOM   2177 C  CZ    . TYR E 3 122 ? 68.940 8.065   28.179 1.00 35.78  ? 122  TYR A CZ    1 
ATOM   2178 O  OH    . TYR E 3 122 ? 68.273 7.678   27.041 1.00 37.04  ? 122  TYR A OH    1 
ATOM   2179 N  N     . ASN E 3 123 ? 71.362 6.707   33.396 1.00 32.45  ? 123  ASN A N     1 
ATOM   2180 C  CA    . ASN E 3 123 ? 71.414 5.255   33.519 1.00 32.25  ? 123  ASN A CA    1 
ATOM   2181 C  C     . ASN E 3 123 ? 70.529 4.755   34.655 1.00 30.31  ? 123  ASN A C     1 
ATOM   2182 O  O     . ASN E 3 123 ? 69.841 3.748   34.510 1.00 29.57  ? 123  ASN A O     1 
ATOM   2183 C  CB    . ASN E 3 123 ? 72.856 4.777   33.735 1.00 34.76  ? 123  ASN A CB    1 
ATOM   2184 C  CG    . ASN E 3 123 ? 73.750 5.069   32.539 1.00 38.62  ? 123  ASN A CG    1 
ATOM   2185 O  OD1   . ASN E 3 123 ? 73.307 5.011   31.383 1.00 37.99  ? 123  ASN A OD1   1 
ATOM   2186 N  ND2   . ASN E 3 123 ? 75.019 5.371   32.808 1.00 38.83  ? 123  ASN A ND2   1 
ATOM   2187 N  N     . LEU E 3 124 ? 70.548 5.457   35.784 1.00 28.00  ? 124  LEU A N     1 
ATOM   2188 C  CA    . LEU E 3 124 ? 69.719 5.063   36.914 1.00 28.25  ? 124  LEU A CA    1 
ATOM   2189 C  C     . LEU E 3 124 ? 68.264 5.151   36.456 1.00 28.03  ? 124  LEU A C     1 
ATOM   2190 O  O     . LEU E 3 124 ? 67.419 4.344   36.848 1.00 27.34  ? 124  LEU A O     1 
ATOM   2191 C  CB    . LEU E 3 124 ? 69.962 5.998   38.100 1.00 28.09  ? 124  LEU A CB    1 
ATOM   2192 C  CG    . LEU E 3 124 ? 69.259 5.626   39.407 1.00 30.51  ? 124  LEU A CG    1 
ATOM   2193 C  CD1   . LEU E 3 124 ? 69.727 4.255   39.864 1.00 30.49  ? 124  LEU A CD1   1 
ATOM   2194 C  CD2   . LEU E 3 124 ? 69.574 6.669   40.478 1.00 30.63  ? 124  LEU A CD2   1 
ATOM   2195 N  N     . GLY E 3 125 ? 67.985 6.132   35.602 1.00 27.69  ? 125  GLY A N     1 
ATOM   2196 C  CA    . GLY E 3 125 ? 66.637 6.296   35.098 1.00 28.02  ? 125  GLY A CA    1 
ATOM   2197 C  C     . GLY E 3 125 ? 66.210 5.090   34.285 1.00 28.40  ? 125  GLY A C     1 
ATOM   2198 O  O     . GLY E 3 125 ? 65.094 4.586   34.451 1.00 26.33  ? 125  GLY A O     1 
ATOM   2199 N  N     . LEU E 3 126 ? 67.089 4.641   33.393 1.00 26.85  ? 126  LEU A N     1 
ATOM   2200 C  CA    . LEU E 3 126 ? 66.801 3.478   32.562 1.00 30.09  ? 126  LEU A CA    1 
ATOM   2201 C  C     . LEU E 3 126 ? 66.616 2.261   33.463 1.00 30.10  ? 126  LEU A C     1 
ATOM   2202 O  O     . LEU E 3 126 ? 65.781 1.403   33.205 1.00 29.84  ? 126  LEU A O     1 
ATOM   2203 C  CB    . LEU E 3 126 ? 67.956 3.212   31.592 1.00 32.09  ? 126  LEU A CB    1 
ATOM   2204 C  CG    . LEU E 3 126 ? 68.239 4.278   30.530 1.00 35.28  ? 126  LEU A CG    1 
ATOM   2205 C  CD1   . LEU E 3 126 ? 69.509 3.923   29.773 1.00 34.59  ? 126  LEU A CD1   1 
ATOM   2206 C  CD2   . LEU E 3 126 ? 67.058 4.375   29.575 1.00 33.62  ? 126  LEU A CD2   1 
ATOM   2207 N  N     . GLU E 3 127 ? 67.408 2.206   34.525 1.00 31.92  ? 127  GLU A N     1 
ATOM   2208 C  CA    . GLU E 3 127 ? 67.360 1.111   35.485 1.00 34.39  ? 127  GLU A CA    1 
ATOM   2209 C  C     . GLU E 3 127 ? 65.978 1.052   36.127 1.00 33.91  ? 127  GLU A C     1 
ATOM   2210 O  O     . GLU E 3 127 ? 65.362 -0.011  36.212 1.00 34.01  ? 127  GLU A O     1 
ATOM   2211 C  CB    . GLU E 3 127 ? 68.413 1.338   36.562 1.00 36.94  ? 127  GLU A CB    1 
ATOM   2212 C  CG    . GLU E 3 127 ? 69.097 0.082   37.038 1.00 42.78  ? 127  GLU A CG    1 
ATOM   2213 C  CD    . GLU E 3 127 ? 70.155 0.374   38.085 1.00 45.72  ? 127  GLU A CD    1 
ATOM   2214 O  OE1   . GLU E 3 127 ? 71.033 1.230   37.827 1.00 46.56  ? 127  GLU A OE1   1 
ATOM   2215 O  OE2   . GLU E 3 127 ? 70.106 -0.252  39.164 1.00 47.12  ? 127  GLU A OE2   1 
ATOM   2216 N  N     . ILE E 3 128 ? 65.500 2.207   36.579 1.00 31.78  ? 128  ILE A N     1 
ATOM   2217 C  CA    . ILE E 3 128 ? 64.190 2.306   37.208 1.00 29.96  ? 128  ILE A CA    1 
ATOM   2218 C  C     . ILE E 3 128 ? 63.057 1.935   36.247 1.00 29.43  ? 128  ILE A C     1 
ATOM   2219 O  O     . ILE E 3 128 ? 62.112 1.245   36.629 1.00 27.89  ? 128  ILE A O     1 
ATOM   2220 C  CB    . ILE E 3 128 ? 63.968 3.723   37.761 1.00 28.81  ? 128  ILE A CB    1 
ATOM   2221 C  CG1   . ILE E 3 128 ? 64.914 3.944   38.944 1.00 29.55  ? 128  ILE A CG1   1 
ATOM   2222 C  CG2   . ILE E 3 128 ? 62.505 3.913   38.175 1.00 29.15  ? 128  ILE A CG2   1 
ATOM   2223 C  CD1   . ILE E 3 128 ? 64.856 5.334   39.542 1.00 28.70  ? 128  ILE A CD1   1 
ATOM   2224 N  N     . LYS E 3 129 ? 63.151 2.385   35.002 1.00 27.34  ? 129  LYS A N     1 
ATOM   2225 C  CA    . LYS E 3 129 ? 62.129 2.055   34.021 1.00 27.68  ? 129  LYS A CA    1 
ATOM   2226 C  C     . LYS E 3 129 ? 62.091 0.539   33.758 1.00 29.57  ? 129  LYS A C     1 
ATOM   2227 O  O     . LYS E 3 129 ? 61.014 -0.048  33.612 1.00 27.30  ? 129  LYS A O     1 
ATOM   2228 C  CB    . LYS E 3 129 ? 62.396 2.800   32.707 1.00 27.83  ? 129  LYS A CB    1 
ATOM   2229 C  CG    . LYS E 3 129 ? 62.059 4.288   32.734 1.00 23.53  ? 129  LYS A CG    1 
ATOM   2230 C  CD    . LYS E 3 129 ? 62.595 4.975   31.500 1.00 25.33  ? 129  LYS A CD    1 
ATOM   2231 C  CE    . LYS E 3 129 ? 62.054 4.354   30.213 1.00 23.88  ? 129  LYS A CE    1 
ATOM   2232 N  NZ    . LYS E 3 129 ? 60.627 4.677   29.967 1.00 19.70  ? 129  LYS A NZ    1 
ATOM   2233 N  N     . ASN E 3 130 ? 63.260 -0.093  33.682 1.00 29.64  ? 130  ASN A N     1 
ATOM   2234 C  CA    . ASN E 3 130 ? 63.303 -1.533  33.438 1.00 32.03  ? 130  ASN A CA    1 
ATOM   2235 C  C     . ASN E 3 130 ? 62.732 -2.276  34.638 1.00 31.99  ? 130  ASN A C     1 
ATOM   2236 O  O     . ASN E 3 130 ? 61.968 -3.223  34.487 1.00 31.64  ? 130  ASN A O     1 
ATOM   2237 C  CB    . ASN E 3 130 ? 64.739 -2.008  33.176 1.00 34.59  ? 130  ASN A CB    1 
ATOM   2238 C  CG    . ASN E 3 130 ? 65.292 -1.499  31.853 1.00 39.92  ? 130  ASN A CG    1 
ATOM   2239 O  OD1   . ASN E 3 130 ? 64.558 -1.371  30.866 1.00 40.21  ? 130  ASN A OD1   1 
ATOM   2240 N  ND2   . ASN E 3 130 ? 66.597 -1.223  31.819 1.00 40.18  ? 130  ASN A ND2   1 
ATOM   2241 N  N     . LYS E 3 131 ? 63.105 -1.829  35.833 1.00 32.22  ? 131  LYS A N     1 
ATOM   2242 C  CA    . LYS E 3 131 ? 62.632 -2.435  37.073 1.00 32.95  ? 131  LYS A CA    1 
ATOM   2243 C  C     . LYS E 3 131 ? 61.107 -2.461  37.150 1.00 32.37  ? 131  LYS A C     1 
ATOM   2244 O  O     . LYS E 3 131 ? 60.510 -3.504  37.404 1.00 31.44  ? 131  LYS A O     1 
ATOM   2245 C  CB    . LYS E 3 131 ? 63.185 -1.665  38.277 1.00 33.89  ? 131  LYS A CB    1 
ATOM   2246 C  CG    . LYS E 3 131 ? 62.702 -2.172  39.635 1.00 37.79  ? 131  LYS A CG    1 
ATOM   2247 C  CD    . LYS E 3 131 ? 63.125 -3.615  39.876 1.00 39.93  ? 131  LYS A CD    1 
ATOM   2248 C  CE    . LYS E 3 131 ? 64.645 -3.747  39.866 1.00 42.68  ? 131  LYS A CE    1 
ATOM   2249 N  NZ    . LYS E 3 131 ? 65.094 -5.166  40.015 1.00 44.17  ? 131  LYS A NZ    1 
ATOM   2250 N  N     . ILE E 3 132 ? 60.483 -1.305  36.939 1.00 31.66  ? 132  ILE A N     1 
ATOM   2251 C  CA    . ILE E 3 132 ? 59.027 -1.204  37.002 1.00 29.86  ? 132  ILE A CA    1 
ATOM   2252 C  C     . ILE E 3 132 ? 58.369 -2.036  35.907 1.00 30.43  ? 132  ILE A C     1 
ATOM   2253 O  O     . ILE E 3 132 ? 57.321 -2.647  36.130 1.00 29.07  ? 132  ILE A O     1 
ATOM   2254 C  CB    . ILE E 3 132 ? 58.557 0.272   36.891 1.00 27.29  ? 132  ILE A CB    1 
ATOM   2255 C  CG1   . ILE E 3 132 ? 59.128 1.082   38.055 1.00 26.46  ? 132  ILE A CG1   1 
ATOM   2256 C  CG2   . ILE E 3 132 ? 57.038 0.351   36.931 1.00 26.46  ? 132  ILE A CG2   1 
ATOM   2257 C  CD1   . ILE E 3 132 ? 58.860 2.587   37.954 1.00 26.26  ? 132  ILE A CD1   1 
ATOM   2258 N  N     . LEU E 3 133 ? 58.987 -2.072  34.732 1.00 30.50  ? 133  LEU A N     1 
ATOM   2259 C  CA    . LEU E 3 133 ? 58.436 -2.847  33.629 1.00 33.53  ? 133  LEU A CA    1 
ATOM   2260 C  C     . LEU E 3 133 ? 58.505 -4.339  33.957 1.00 34.53  ? 133  LEU A C     1 
ATOM   2261 O  O     . LEU E 3 133 ? 57.567 -5.091  33.705 1.00 34.83  ? 133  LEU A O     1 
ATOM   2262 C  CB    . LEU E 3 133 ? 59.214 -2.563  32.342 1.00 36.05  ? 133  LEU A CB    1 
ATOM   2263 C  CG    . LEU E 3 133 ? 58.570 -3.172  31.096 1.00 39.83  ? 133  LEU A CG    1 
ATOM   2264 C  CD1   . LEU E 3 133 ? 57.183 -2.570  30.895 1.00 36.25  ? 133  LEU A CD1   1 
ATOM   2265 C  CD2   . LEU E 3 133 ? 59.445 -2.907  29.875 1.00 42.20  ? 133  LEU A CD2   1 
ATOM   2266 N  N     . GLU E 3 134 ? 59.627 -4.752  34.528 1.00 35.47  ? 134  GLU A N     1 
ATOM   2267 C  CA    . GLU E 3 134 ? 59.846 -6.140  34.907 1.00 38.78  ? 134  GLU A CA    1 
ATOM   2268 C  C     . GLU E 3 134 ? 58.863 -6.608  35.988 1.00 37.66  ? 134  GLU A C     1 
ATOM   2269 O  O     . GLU E 3 134 ? 58.232 -7.654  35.856 1.00 35.64  ? 134  GLU A O     1 
ATOM   2270 C  CB    . GLU E 3 134 ? 61.286 -6.305  35.406 1.00 41.57  ? 134  GLU A CB    1 
ATOM   2271 C  CG    . GLU E 3 134 ? 61.531 -7.544  36.249 1.00 48.53  ? 134  GLU A CG    1 
ATOM   2272 C  CD    . GLU E 3 134 ? 62.897 -7.528  36.918 1.00 53.25  ? 134  GLU A CD    1 
ATOM   2273 O  OE1   . GLU E 3 134 ? 63.360 -6.430  37.296 1.00 55.71  ? 134  GLU A OE1   1 
ATOM   2274 O  OE2   . GLU E 3 134 ? 63.502 -8.611  37.082 1.00 56.82  ? 134  GLU A OE2   1 
ATOM   2275 N  N     . LYS E 3 135 ? 58.721 -5.812  37.041 1.00 36.42  ? 135  LYS A N     1 
ATOM   2276 C  CA    . LYS E 3 135 ? 57.857 -6.166  38.162 1.00 35.89  ? 135  LYS A CA    1 
ATOM   2277 C  C     . LYS E 3 135 ? 56.359 -5.994  37.964 1.00 34.59  ? 135  LYS A C     1 
ATOM   2278 O  O     . LYS E 3 135 ? 55.570 -6.803  38.446 1.00 34.04  ? 135  LYS A O     1 
ATOM   2279 C  CB    . LYS E 3 135 ? 58.267 -5.365  39.400 1.00 37.87  ? 135  LYS A CB    1 
ATOM   2280 C  CG    . LYS E 3 135 ? 59.714 -5.539  39.818 1.00 40.04  ? 135  LYS A CG    1 
ATOM   2281 C  CD    . LYS E 3 135 ? 60.025 -6.976  40.181 1.00 42.94  ? 135  LYS A CD    1 
ATOM   2282 C  CE    . LYS E 3 135 ? 61.447 -7.096  40.698 1.00 44.73  ? 135  LYS A CE    1 
ATOM   2283 N  NZ    . LYS E 3 135 ? 61.806 -8.504  40.987 1.00 46.39  ? 135  LYS A NZ    1 
ATOM   2284 N  N     . GLU E 3 136 ? 55.965 -4.936  37.265 1.00 32.94  ? 136  GLU A N     1 
ATOM   2285 C  CA    . GLU E 3 136 ? 54.554 -4.655  37.077 1.00 30.32  ? 136  GLU A CA    1 
ATOM   2286 C  C     . GLU E 3 136 ? 54.130 -4.484  35.622 1.00 31.07  ? 136  GLU A C     1 
ATOM   2287 O  O     . GLU E 3 136 ? 52.944 -4.284  35.341 1.00 29.98  ? 136  GLU A O     1 
ATOM   2288 C  CB    . GLU E 3 136 ? 54.202 -3.390  37.846 1.00 28.91  ? 136  GLU A CB    1 
ATOM   2289 C  CG    . GLU E 3 136 ? 54.548 -3.420  39.329 1.00 29.48  ? 136  GLU A CG    1 
ATOM   2290 C  CD    . GLU E 3 136 ? 53.606 -4.293  40.133 1.00 31.10  ? 136  GLU A CD    1 
ATOM   2291 O  OE1   . GLU E 3 136 ? 52.568 -4.725  39.582 1.00 32.62  ? 136  GLU A OE1   1 
ATOM   2292 O  OE2   . GLU E 3 136 ? 53.896 -4.539  41.323 1.00 32.47  ? 136  GLU A OE2   1 
ATOM   2293 N  N     . LYS E 3 137 ? 55.090 -4.546  34.706 1.00 29.92  ? 137  LYS A N     1 
ATOM   2294 C  CA    . LYS E 3 137 ? 54.800 -4.376  33.283 1.00 32.38  ? 137  LYS A CA    1 
ATOM   2295 C  C     . LYS E 3 137 ? 54.073 -3.049  33.042 1.00 31.36  ? 137  LYS A C     1 
ATOM   2296 O  O     . LYS E 3 137 ? 53.067 -2.991  32.328 1.00 28.98  ? 137  LYS A O     1 
ATOM   2297 C  CB    . LYS E 3 137 ? 53.960 -5.550  32.770 1.00 33.62  ? 137  LYS A CB    1 
ATOM   2298 C  CG    . LYS E 3 137 ? 54.652 -6.901  32.930 1.00 36.33  ? 137  LYS A CG    1 
ATOM   2299 C  CD    . LYS E 3 137 ? 55.875 -7.029  32.023 1.00 42.71  ? 137  LYS A CD    1 
ATOM   2300 C  CE    . LYS E 3 137 ? 56.994 -7.820  32.706 1.00 44.03  ? 137  LYS A CE    1 
ATOM   2301 N  NZ    . LYS E 3 137 ? 56.494 -9.063  33.387 1.00 48.28  ? 137  LYS A NZ    1 
ATOM   2302 N  N     . ILE E 3 138 ? 54.593 -1.993  33.669 1.00 29.38  ? 138  ILE A N     1 
ATOM   2303 C  CA    . ILE E 3 138 ? 54.048 -0.647  33.539 1.00 27.28  ? 138  ILE A CA    1 
ATOM   2304 C  C     . ILE E 3 138 ? 55.141 0.267   32.977 1.00 26.33  ? 138  ILE A C     1 
ATOM   2305 O  O     . ILE E 3 138 ? 56.294 0.214   33.416 1.00 26.69  ? 138  ILE A O     1 
ATOM   2306 C  CB    . ILE E 3 138 ? 53.579 -0.105  34.916 1.00 26.83  ? 138  ILE A CB    1 
ATOM   2307 C  CG1   . ILE E 3 138 ? 52.308 -0.829  35.361 1.00 26.01  ? 138  ILE A CG1   1 
ATOM   2308 C  CG2   . ILE E 3 138 ? 53.317 1.391   34.841 1.00 22.55  ? 138  ILE A CG2   1 
ATOM   2309 C  CD1   . ILE E 3 138 ? 51.099 -0.509  34.509 1.00 29.34  ? 138  ILE A CD1   1 
ATOM   2310 N  N     . THR E 3 139 ? 54.794 1.081   31.985 1.00 24.07  ? 139  THR A N     1 
ATOM   2311 C  CA    . THR E 3 139 ? 55.767 2.003   31.413 1.00 22.89  ? 139  THR A CA    1 
ATOM   2312 C  C     . THR E 3 139 ? 55.575 3.347   32.101 1.00 22.78  ? 139  THR A C     1 
ATOM   2313 O  O     . THR E 3 139 ? 54.454 3.734   32.421 1.00 26.06  ? 139  THR A O     1 
ATOM   2314 C  CB    . THR E 3 139 ? 55.571 2.195   29.894 1.00 23.95  ? 139  THR A CB    1 
ATOM   2315 O  OG1   . THR E 3 139 ? 54.316 2.838   29.655 1.00 24.93  ? 139  THR A OG1   1 
ATOM   2316 C  CG2   . THR E 3 139 ? 55.581 0.853   29.180 1.00 21.44  ? 139  THR A CG2   1 
ATOM   2317 N  N     . VAL E 3 140 ? 56.677 4.042   32.339 1.00 20.16  ? 140  VAL A N     1 
ATOM   2318 C  CA    . VAL E 3 140 ? 56.654 5.330   33.000 1.00 21.99  ? 140  VAL A CA    1 
ATOM   2319 C  C     . VAL E 3 140 ? 57.608 6.247   32.262 1.00 23.26  ? 140  VAL A C     1 
ATOM   2320 O  O     . VAL E 3 140 ? 58.391 5.801   31.432 1.00 25.97  ? 140  VAL A O     1 
ATOM   2321 C  CB    . VAL E 3 140 ? 57.157 5.225   34.439 1.00 21.72  ? 140  VAL A CB    1 
ATOM   2322 C  CG1   . VAL E 3 140 ? 56.405 4.146   35.166 1.00 22.79  ? 140  VAL A CG1   1 
ATOM   2323 C  CG2   . VAL E 3 140 ? 58.667 4.927   34.442 1.00 20.36  ? 140  VAL A CG2   1 
ATOM   2324 N  N     . THR E 3 141 ? 57.558 7.524   32.585 1.00 20.52  ? 141  THR A N     1 
ATOM   2325 C  CA    . THR E 3 141 ? 58.428 8.474   31.941 1.00 22.00  ? 141  THR A CA    1 
ATOM   2326 C  C     . THR E 3 141 ? 59.271 9.104   33.023 1.00 21.33  ? 141  THR A C     1 
ATOM   2327 O  O     . THR E 3 141 ? 58.770 9.453   34.092 1.00 20.13  ? 141  THR A O     1 
ATOM   2328 C  CB    . THR E 3 141 ? 57.618 9.544   31.176 1.00 22.33  ? 141  THR A CB    1 
ATOM   2329 O  OG1   . THR E 3 141 ? 56.921 8.917   30.091 1.00 22.66  ? 141  THR A OG1   1 
ATOM   2330 C  CG2   . THR E 3 141 ? 58.542 10.620  30.611 1.00 23.56  ? 141  THR A CG2   1 
ATOM   2331 N  N     . VAL E 3 142 ? 60.563 9.216   32.747 1.00 21.41  ? 142  VAL A N     1 
ATOM   2332 C  CA    . VAL E 3 142 ? 61.497 9.790   33.693 1.00 23.03  ? 142  VAL A CA    1 
ATOM   2333 C  C     . VAL E 3 142 ? 61.956 11.163  33.233 1.00 25.54  ? 142  VAL A C     1 
ATOM   2334 O  O     . VAL E 3 142 ? 62.175 11.388  32.036 1.00 25.38  ? 142  VAL A O     1 
ATOM   2335 C  CB    . VAL E 3 142 ? 62.731 8.879   33.863 1.00 21.73  ? 142  VAL A CB    1 
ATOM   2336 C  CG1   . VAL E 3 142 ? 63.795 9.575   34.701 1.00 19.44  ? 142  VAL A CG1   1 
ATOM   2337 C  CG2   . VAL E 3 142 ? 62.310 7.579   34.524 1.00 20.41  ? 142  VAL A CG2   1 
ATOM   2338 N  N     . GLY E 3 143 ? 62.079 12.072  34.201 1.00 25.66  ? 143  GLY A N     1 
ATOM   2339 C  CA    . GLY E 3 143 ? 62.541 13.426  33.943 1.00 25.71  ? 143  GLY A CA    1 
ATOM   2340 C  C     . GLY E 3 143 ? 63.658 13.705  34.933 1.00 27.16  ? 143  GLY A C     1 
ATOM   2341 O  O     . GLY E 3 143 ? 63.517 13.456  36.133 1.00 28.03  ? 143  GLY A O     1 
ATOM   2342 N  N     . ILE E 3 144 ? 64.779 14.211  34.443 1.00 27.38  ? 144  ILE A N     1 
ATOM   2343 C  CA    . ILE E 3 144 ? 65.919 14.484  35.306 1.00 27.35  ? 144  ILE A CA    1 
ATOM   2344 C  C     . ILE E 3 144 ? 66.454 15.897  35.087 1.00 26.58  ? 144  ILE A C     1 
ATOM   2345 O  O     . ILE E 3 144 ? 66.595 16.342  33.951 1.00 26.01  ? 144  ILE A O     1 
ATOM   2346 C  CB    . ILE E 3 144 ? 67.059 13.479  35.019 1.00 26.88  ? 144  ILE A CB    1 
ATOM   2347 C  CG1   . ILE E 3 144 ? 66.529 12.047  35.131 1.00 30.15  ? 144  ILE A CG1   1 
ATOM   2348 C  CG2   . ILE E 3 144 ? 68.207 13.698  35.983 1.00 28.61  ? 144  ILE A CG2   1 
ATOM   2349 C  CD1   . ILE E 3 144 ? 67.529 10.981  34.678 1.00 31.47  ? 144  ILE A CD1   1 
ATOM   2350 N  N     . SER E 3 145 ? 66.744 16.599  36.176 1.00 25.79  ? 145  SER A N     1 
ATOM   2351 C  CA    . SER E 3 145 ? 67.292 17.947  36.083 1.00 27.07  ? 145  SER A CA    1 
ATOM   2352 C  C     . SER E 3 145 ? 67.777 18.435  37.446 1.00 26.38  ? 145  SER A C     1 
ATOM   2353 O  O     . SER E 3 145 ? 67.840 17.657  38.392 1.00 26.53  ? 145  SER A O     1 
ATOM   2354 C  CB    . SER E 3 145 ? 66.254 18.906  35.508 1.00 25.63  ? 145  SER A CB    1 
ATOM   2355 O  OG    . SER E 3 145 ? 66.872 20.147  35.199 1.00 28.33  ? 145  SER A OG    1 
ATOM   2356 N  N     . LYS E 3 146 ? 68.110 19.720  37.546 1.00 27.80  ? 146  LYS A N     1 
ATOM   2357 C  CA    . LYS E 3 146 ? 68.640 20.293  38.783 1.00 27.58  ? 146  LYS A CA    1 
ATOM   2358 C  C     . LYS E 3 146 ? 67.619 20.562  39.882 1.00 27.54  ? 146  LYS A C     1 
ATOM   2359 O  O     . LYS E 3 146 ? 67.990 20.800  41.028 1.00 28.51  ? 146  LYS A O     1 
ATOM   2360 C  CB    . LYS E 3 146 ? 69.408 21.584  38.467 1.00 28.99  ? 146  LYS A CB    1 
ATOM   2361 C  CG    . LYS E 3 146 ? 68.560 22.704  37.883 1.00 30.09  ? 146  LYS A CG    1 
ATOM   2362 C  CD    . LYS E 3 146 ? 69.431 23.815  37.306 1.00 31.73  ? 146  LYS A CD    1 
ATOM   2363 C  CE    . LYS E 3 146 ? 70.299 24.458  38.378 1.00 31.29  ? 146  LYS A CE    1 
ATOM   2364 N  NZ    . LYS E 3 146 ? 71.095 25.590  37.806 1.00 38.31  ? 146  LYS A NZ    1 
ATOM   2365 N  N     . ASN E 3 147 ? 66.337 20.550  39.542 1.00 26.76  ? 147  ASN A N     1 
ATOM   2366 C  CA    . ASN E 3 147 ? 65.313 20.761  40.556 1.00 27.30  ? 147  ASN A CA    1 
ATOM   2367 C  C     . ASN E 3 147 ? 64.017 20.073  40.159 1.00 24.97  ? 147  ASN A C     1 
ATOM   2368 O  O     . ASN E 3 147 ? 63.879 19.586  39.037 1.00 22.11  ? 147  ASN A O     1 
ATOM   2369 C  CB    . ASN E 3 147 ? 65.064 22.257  40.797 1.00 26.86  ? 147  ASN A CB    1 
ATOM   2370 C  CG    . ASN E 3 147 ? 64.518 22.962  39.575 1.00 28.91  ? 147  ASN A CG    1 
ATOM   2371 O  OD1   . ASN E 3 147 ? 63.602 22.467  38.915 1.00 27.83  ? 147  ASN A OD1   1 
ATOM   2372 N  ND2   . ASN E 3 147 ? 65.068 24.141  39.274 1.00 28.85  ? 147  ASN A ND2   1 
ATOM   2373 N  N     . LYS E 3 148 ? 63.071 20.046  41.090 1.00 25.56  ? 148  LYS A N     1 
ATOM   2374 C  CA    . LYS E 3 148 ? 61.784 19.404  40.856 1.00 26.28  ? 148  LYS A CA    1 
ATOM   2375 C  C     . LYS E 3 148 ? 61.029 19.958  39.655 1.00 25.44  ? 148  LYS A C     1 
ATOM   2376 O  O     . LYS E 3 148 ? 60.567 19.199  38.812 1.00 27.11  ? 148  LYS A O     1 
ATOM   2377 C  CB    . LYS E 3 148 ? 60.913 19.508  42.109 1.00 23.97  ? 148  LYS A CB    1 
ATOM   2378 C  CG    . LYS E 3 148 ? 61.447 18.702  43.263 1.00 26.63  ? 148  LYS A CG    1 
ATOM   2379 C  CD    . LYS E 3 148 ? 60.412 18.501  44.363 1.00 28.41  ? 148  LYS A CD    1 
ATOM   2380 C  CE    . LYS E 3 148 ? 60.167 19.765  45.161 1.00 29.66  ? 148  LYS A CE    1 
ATOM   2381 N  NZ    . LYS E 3 148 ? 59.244 19.484  46.293 1.00 32.67  ? 148  LYS A NZ    1 
ATOM   2382 N  N     . VAL E 3 149 ? 60.903 21.279  39.572 1.00 26.43  ? 149  VAL A N     1 
ATOM   2383 C  CA    . VAL E 3 149 ? 60.175 21.890  38.464 1.00 24.38  ? 149  VAL A CA    1 
ATOM   2384 C  C     . VAL E 3 149 ? 60.692 21.473  37.097 1.00 22.82  ? 149  VAL A C     1 
ATOM   2385 O  O     . VAL E 3 149 ? 59.919 21.055  36.240 1.00 24.80  ? 149  VAL A O     1 
ATOM   2386 C  CB    . VAL E 3 149 ? 60.188 23.428  38.556 1.00 24.02  ? 149  VAL A CB    1 
ATOM   2387 C  CG1   . VAL E 3 149 ? 59.526 24.032  37.329 1.00 25.01  ? 149  VAL A CG1   1 
ATOM   2388 C  CG2   . VAL E 3 149 ? 59.448 23.875  39.801 1.00 27.56  ? 149  VAL A CG2   1 
ATOM   2389 N  N     . PHE E 3 150 ? 61.994 21.569  36.876 1.00 24.55  ? 150  PHE A N     1 
ATOM   2390 C  CA    . PHE E 3 150 ? 62.530 21.188  35.571 1.00 24.42  ? 150  PHE A CA    1 
ATOM   2391 C  C     . PHE E 3 150 ? 62.581 19.683  35.356 1.00 24.25  ? 150  PHE A C     1 
ATOM   2392 O  O     . PHE E 3 150 ? 62.599 19.206  34.219 1.00 21.90  ? 150  PHE A O     1 
ATOM   2393 C  CB    . PHE E 3 150 ? 63.900 21.831  35.360 1.00 25.84  ? 150  PHE A CB    1 
ATOM   2394 C  CG    . PHE E 3 150 ? 63.817 23.290  35.025 1.00 27.83  ? 150  PHE A CG    1 
ATOM   2395 C  CD1   . PHE E 3 150 ? 63.435 23.699  33.755 1.00 28.51  ? 150  PHE A CD1   1 
ATOM   2396 C  CD2   . PHE E 3 150 ? 64.066 24.255  35.994 1.00 30.19  ? 150  PHE A CD2   1 
ATOM   2397 C  CE1   . PHE E 3 150 ? 63.303 25.051  33.453 1.00 30.81  ? 150  PHE A CE1   1 
ATOM   2398 C  CE2   . PHE E 3 150 ? 63.938 25.608  35.704 1.00 31.40  ? 150  PHE A CE2   1 
ATOM   2399 C  CZ    . PHE E 3 150 ? 63.556 26.008  34.432 1.00 31.35  ? 150  PHE A CZ    1 
ATOM   2400 N  N     . ALA E 3 151 ? 62.592 18.922  36.443 1.00 22.73  ? 151  ALA A N     1 
ATOM   2401 C  CA    . ALA E 3 151 ? 62.592 17.477  36.286 1.00 22.38  ? 151  ALA A CA    1 
ATOM   2402 C  C     . ALA E 3 151 ? 61.203 17.122  35.760 1.00 22.56  ? 151  ALA A C     1 
ATOM   2403 O  O     . ALA E 3 151 ? 61.055 16.247  34.903 1.00 20.47  ? 151  ALA A O     1 
ATOM   2404 C  CB    . ALA E 3 151 ? 62.856 16.803  37.619 1.00 21.59  ? 151  ALA A CB    1 
ATOM   2405 N  N     . LYS E 3 152 ? 60.179 17.816  36.259 1.00 23.16  ? 152  LYS A N     1 
ATOM   2406 C  CA    . LYS E 3 152 ? 58.815 17.539  35.800 1.00 24.72  ? 152  LYS A CA    1 
ATOM   2407 C  C     . LYS E 3 152 ? 58.677 17.985  34.354 1.00 25.00  ? 152  LYS A C     1 
ATOM   2408 O  O     . LYS E 3 152 ? 58.105 17.270  33.525 1.00 24.78  ? 152  LYS A O     1 
ATOM   2409 C  CB    . LYS E 3 152 ? 57.774 18.259  36.656 1.00 25.16  ? 152  LYS A CB    1 
ATOM   2410 C  CG    . LYS E 3 152 ? 56.330 17.950  36.246 1.00 25.02  ? 152  LYS A CG    1 
ATOM   2411 C  CD    . LYS E 3 152 ? 55.350 18.527  37.258 1.00 29.83  ? 152  LYS A CD    1 
ATOM   2412 C  CE    . LYS E 3 152 ? 53.906 18.271  36.853 1.00 31.70  ? 152  LYS A CE    1 
ATOM   2413 N  NZ    . LYS E 3 152 ? 53.594 16.819  36.809 1.00 33.65  ? 152  LYS A NZ    1 
ATOM   2414 N  N     . ILE E 3 153 ? 59.197 19.168  34.048 1.00 24.91  ? 153  ILE A N     1 
ATOM   2415 C  CA    . ILE E 3 153 ? 59.131 19.665  32.675 1.00 24.59  ? 153  ILE A CA    1 
ATOM   2416 C  C     . ILE E 3 153 ? 59.833 18.670  31.759 1.00 25.35  ? 153  ILE A C     1 
ATOM   2417 O  O     . ILE E 3 153 ? 59.374 18.411  30.642 1.00 24.06  ? 153  ILE A O     1 
ATOM   2418 C  CB    . ILE E 3 153 ? 59.804 21.047  32.547 1.00 24.49  ? 153  ILE A CB    1 
ATOM   2419 C  CG1   . ILE E 3 153 ? 58.898 22.113  33.174 1.00 23.07  ? 153  ILE A CG1   1 
ATOM   2420 C  CG2   . ILE E 3 153 ? 60.106 21.358  31.067 1.00 21.03  ? 153  ILE A CG2   1 
ATOM   2421 C  CD1   . ILE E 3 153 ? 59.596 23.454  33.418 1.00 24.70  ? 153  ILE A CD1   1 
ATOM   2422 N  N     . ALA E 3 154 ? 60.947 18.111  32.230 1.00 24.41  ? 154  ALA A N     1 
ATOM   2423 C  CA    . ALA E 3 154 ? 61.677 17.127  31.426 1.00 24.95  ? 154  ALA A CA    1 
ATOM   2424 C  C     . ALA E 3 154 ? 60.776 15.936  31.091 1.00 24.93  ? 154  ALA A C     1 
ATOM   2425 O  O     . ALA E 3 154 ? 60.740 15.474  29.954 1.00 23.55  ? 154  ALA A O     1 
ATOM   2426 C  CB    . ALA E 3 154 ? 62.909 16.649  32.165 1.00 23.47  ? 154  ALA A CB    1 
ATOM   2427 N  N     . ALA E 3 155 ? 60.037 15.440  32.080 1.00 25.80  ? 155  ALA A N     1 
ATOM   2428 C  CA    . ALA E 3 155 ? 59.148 14.304  31.843 1.00 25.19  ? 155  ALA A CA    1 
ATOM   2429 C  C     . ALA E 3 155 ? 57.989 14.679  30.904 1.00 25.23  ? 155  ALA A C     1 
ATOM   2430 O  O     . ALA E 3 155 ? 57.640 13.910  30.012 1.00 22.78  ? 155  ALA A O     1 
ATOM   2431 C  CB    . ALA E 3 155 ? 58.604 13.769  33.173 1.00 26.53  ? 155  ALA A CB    1 
ATOM   2432 N  N     . ASP E 3 156 ? 57.404 15.859  31.094 1.00 25.42  ? 156  ASP A N     1 
ATOM   2433 C  CA    . ASP E 3 156 ? 56.305 16.290  30.232 1.00 29.57  ? 156  ASP A CA    1 
ATOM   2434 C  C     . ASP E 3 156 ? 56.730 16.296  28.763 1.00 30.25  ? 156  ASP A C     1 
ATOM   2435 O  O     . ASP E 3 156 ? 55.920 16.028  27.870 1.00 28.86  ? 156  ASP A O     1 
ATOM   2436 C  CB    . ASP E 3 156 ? 55.815 17.704  30.599 1.00 30.67  ? 156  ASP A CB    1 
ATOM   2437 C  CG    . ASP E 3 156 ? 55.084 17.759  31.939 1.00 33.28  ? 156  ASP A CG    1 
ATOM   2438 O  OD1   . ASP E 3 156 ? 54.531 16.730  32.382 1.00 32.29  ? 156  ASP A OD1   1 
ATOM   2439 O  OD2   . ASP E 3 156 ? 55.050 18.854  32.543 1.00 36.59  ? 156  ASP A OD2   1 
ATOM   2440 N  N     . MET E 3 157 ? 57.997 16.614  28.513 1.00 30.54  ? 157  MET A N     1 
ATOM   2441 C  CA    . MET E 3 157 ? 58.505 16.663  27.146 1.00 32.06  ? 157  MET A CA    1 
ATOM   2442 C  C     . MET E 3 157 ? 58.753 15.285  26.542 1.00 33.13  ? 157  MET A C     1 
ATOM   2443 O  O     . MET E 3 157 ? 58.597 15.100  25.335 1.00 33.26  ? 157  MET A O     1 
ATOM   2444 C  CB    . MET E 3 157 ? 59.825 17.443  27.086 1.00 33.92  ? 157  MET A CB    1 
ATOM   2445 C  CG    . MET E 3 157 ? 59.753 18.888  27.546 1.00 39.46  ? 157  MET A CG    1 
ATOM   2446 S  SD    . MET E 3 157 ? 61.333 19.747  27.332 1.00 41.61  ? 157  MET A SD    1 
ATOM   2447 C  CE    . MET E 3 157 ? 62.300 18.974  28.534 1.00 46.85  ? 157  MET A CE    1 
ATOM   2448 N  N     . ALA E 3 158 ? 59.142 14.321  27.375 1.00 31.31  ? 158  ALA A N     1 
ATOM   2449 C  CA    . ALA E 3 158 ? 59.474 12.986  26.885 1.00 31.88  ? 158  ALA A CA    1 
ATOM   2450 C  C     . ALA E 3 158 ? 58.390 11.921  26.944 1.00 32.30  ? 158  ALA A C     1 
ATOM   2451 O  O     . ALA E 3 158 ? 58.633 10.782  26.542 1.00 30.65  ? 158  ALA A O     1 
ATOM   2452 C  CB    . ALA E 3 158 ? 60.708 12.480  27.617 1.00 31.08  ? 158  ALA A CB    1 
ATOM   2453 N  N     . LYS E 3 159 ? 57.206 12.263  27.440 1.00 32.01  ? 159  LYS A N     1 
ATOM   2454 C  CA    . LYS E 3 159 ? 56.159 11.256  27.539 1.00 33.94  ? 159  LYS A CA    1 
ATOM   2455 C  C     . LYS E 3 159 ? 55.451 11.047  26.211 1.00 32.37  ? 159  LYS A C     1 
ATOM   2456 O  O     . LYS E 3 159 ? 55.408 11.943  25.380 1.00 33.27  ? 159  LYS A O     1 
ATOM   2457 C  CB    . LYS E 3 159 ? 55.153 11.612  28.645 1.00 35.27  ? 159  LYS A CB    1 
ATOM   2458 C  CG    . LYS E 3 159 ? 54.323 12.866  28.430 1.00 35.44  ? 159  LYS A CG    1 
ATOM   2459 C  CD    . LYS E 3 159 ? 53.272 13.028  29.555 1.00 36.69  ? 159  LYS A CD    1 
ATOM   2460 C  CE    . LYS E 3 159 ? 53.915 13.097  30.950 1.00 37.90  ? 159  LYS A CE    1 
ATOM   2461 N  NZ    . LYS E 3 159 ? 52.938 13.324  32.064 1.00 33.31  ? 159  LYS A NZ    1 
ATOM   2462 N  N     . PRO E 3 160 ? 54.888 9.851   25.997 1.00 32.67  ? 160  PRO A N     1 
ATOM   2463 C  CA    . PRO E 3 160 ? 54.910 8.723   26.936 1.00 32.46  ? 160  PRO A CA    1 
ATOM   2464 C  C     . PRO E 3 160 ? 56.130 7.793   26.842 1.00 33.48  ? 160  PRO A C     1 
ATOM   2465 O  O     . PRO E 3 160 ? 56.926 7.869   25.902 1.00 34.29  ? 160  PRO A O     1 
ATOM   2466 C  CB    . PRO E 3 160 ? 53.617 7.995   26.606 1.00 33.23  ? 160  PRO A CB    1 
ATOM   2467 C  CG    . PRO E 3 160 ? 53.560 8.137   25.094 1.00 32.55  ? 160  PRO A CG    1 
ATOM   2468 C  CD    . PRO E 3 160 ? 53.983 9.578   24.861 1.00 32.66  ? 160  PRO A CD    1 
ATOM   2469 N  N     . ASN E 3 161 ? 56.263 6.922   27.840 1.00 32.90  ? 161  ASN A N     1 
ATOM   2470 C  CA    . ASN E 3 161 ? 57.336 5.935   27.903 1.00 31.84  ? 161  ASN A CA    1 
ATOM   2471 C  C     . ASN E 3 161 ? 58.672 6.480   27.440 1.00 31.29  ? 161  ASN A C     1 
ATOM   2472 O  O     . ASN E 3 161 ? 59.249 5.978   26.487 1.00 31.61  ? 161  ASN A O     1 
ATOM   2473 C  CB    . ASN E 3 161 ? 56.943 4.710   27.063 1.00 31.90  ? 161  ASN A CB    1 
ATOM   2474 C  CG    . ASN E 3 161 ? 57.962 3.585   27.140 1.00 33.78  ? 161  ASN A CG    1 
ATOM   2475 O  OD1   . ASN E 3 161 ? 58.754 3.499   28.081 1.00 32.32  ? 161  ASN A OD1   1 
ATOM   2476 N  ND2   . ASN E 3 161 ? 57.936 2.704   26.149 1.00 34.51  ? 161  ASN A ND2   1 
ATOM   2477 N  N     . GLY E 3 162 ? 59.169 7.499   28.129 1.00 30.66  ? 162  GLY A N     1 
ATOM   2478 C  CA    . GLY E 3 162 ? 60.436 8.088   27.741 1.00 30.32  ? 162  GLY A CA    1 
ATOM   2479 C  C     . GLY E 3 162 ? 61.363 8.410   28.896 1.00 30.23  ? 162  GLY A C     1 
ATOM   2480 O  O     . GLY E 3 162 ? 61.166 7.963   30.027 1.00 30.83  ? 162  GLY A O     1 
ATOM   2481 N  N     . ILE E 3 163 ? 62.393 9.185   28.596 1.00 29.10  ? 163  ILE A N     1 
ATOM   2482 C  CA    . ILE E 3 163 ? 63.362 9.593   29.596 1.00 28.51  ? 163  ILE A CA    1 
ATOM   2483 C  C     . ILE E 3 163 ? 64.141 10.772  29.040 1.00 29.63  ? 163  ILE A C     1 
ATOM   2484 O  O     . ILE E 3 163 ? 64.584 10.749  27.885 1.00 29.04  ? 163  ILE A O     1 
ATOM   2485 C  CB    . ILE E 3 163 ? 64.329 8.441   29.962 1.00 27.83  ? 163  ILE A CB    1 
ATOM   2486 C  CG1   . ILE E 3 163 ? 65.359 8.935   30.978 1.00 26.01  ? 163  ILE A CG1   1 
ATOM   2487 C  CG2   . ILE E 3 163 ? 65.011 7.899   28.709 1.00 27.53  ? 163  ILE A CG2   1 
ATOM   2488 C  CD1   . ILE E 3 163 ? 66.276 7.852   31.495 1.00 24.70  ? 163  ILE A CD1   1 
ATOM   2489 N  N     . LYS E 3 164 ? 64.283 11.813  29.857 1.00 29.16  ? 164  LYS A N     1 
ATOM   2490 C  CA    . LYS E 3 164 ? 64.999 12.999  29.432 1.00 30.30  ? 164  LYS A CA    1 
ATOM   2491 C  C     . LYS E 3 164 ? 65.724 13.728  30.559 1.00 30.08  ? 164  LYS A C     1 
ATOM   2492 O  O     . LYS E 3 164 ? 65.279 13.761  31.707 1.00 29.62  ? 164  LYS A O     1 
ATOM   2493 C  CB    . LYS E 3 164 ? 64.043 13.962  28.729 1.00 33.26  ? 164  LYS A CB    1 
ATOM   2494 C  CG    . LYS E 3 164 ? 64.702 15.270  28.309 1.00 36.23  ? 164  LYS A CG    1 
ATOM   2495 C  CD    . LYS E 3 164 ? 63.844 16.049  27.347 1.00 40.22  ? 164  LYS A CD    1 
ATOM   2496 C  CE    . LYS E 3 164 ? 64.546 17.326  26.912 1.00 44.29  ? 164  LYS A CE    1 
ATOM   2497 N  NZ    . LYS E 3 164 ? 65.894 17.051  26.356 1.00 45.69  ? 164  LYS A NZ    1 
ATOM   2498 N  N     . VAL E 3 165 ? 66.861 14.309  30.206 1.00 30.25  ? 165  VAL A N     1 
ATOM   2499 C  CA    . VAL E 3 165 ? 67.679 15.062  31.146 1.00 29.45  ? 165  VAL A CA    1 
ATOM   2500 C  C     . VAL E 3 165 ? 67.752 16.496  30.648 1.00 29.06  ? 165  VAL A C     1 
ATOM   2501 O  O     . VAL E 3 165 ? 67.963 16.725  29.462 1.00 29.45  ? 165  VAL A O     1 
ATOM   2502 C  CB    . VAL E 3 165 ? 69.126 14.535  31.199 1.00 28.33  ? 165  VAL A CB    1 
ATOM   2503 C  CG1   . VAL E 3 165 ? 69.966 15.443  32.088 1.00 30.19  ? 165  VAL A CG1   1 
ATOM   2504 C  CG2   . VAL E 3 165 ? 69.152 13.100  31.710 1.00 30.07  ? 165  VAL A CG2   1 
ATOM   2505 N  N     . ILE E 3 166 ? 67.555 17.456  31.542 1.00 28.73  ? 166  ILE A N     1 
ATOM   2506 C  CA    . ILE E 3 166 ? 67.662 18.859  31.168 1.00 29.45  ? 166  ILE A CA    1 
ATOM   2507 C  C     . ILE E 3 166 ? 68.848 19.372  31.959 1.00 30.37  ? 166  ILE A C     1 
ATOM   2508 O  O     . ILE E 3 166 ? 68.729 19.669  33.149 1.00 30.41  ? 166  ILE A O     1 
ATOM   2509 C  CB    . ILE E 3 166 ? 66.397 19.660  31.542 1.00 29.23  ? 166  ILE A CB    1 
ATOM   2510 C  CG1   . ILE E 3 166 ? 65.237 19.265  30.622 1.00 27.85  ? 166  ILE A CG1   1 
ATOM   2511 C  CG2   . ILE E 3 166 ? 66.672 21.162  31.410 1.00 29.79  ? 166  ILE A CG2   1 
ATOM   2512 C  CD1   . ILE E 3 166 ? 63.926 19.935  30.991 1.00 27.52  ? 166  ILE A CD1   1 
ATOM   2513 N  N     . ASP E 3 167 ? 70.005 19.438  31.305 1.00 32.50  ? 167  ASP A N     1 
ATOM   2514 C  CA    . ASP E 3 167 ? 71.220 19.888  31.972 1.00 34.91  ? 167  ASP A CA    1 
ATOM   2515 C  C     . ASP E 3 167 ? 71.169 21.376  32.280 1.00 35.63  ? 167  ASP A C     1 
ATOM   2516 O  O     . ASP E 3 167 ? 70.249 22.078  31.860 1.00 36.48  ? 167  ASP A O     1 
ATOM   2517 C  CB    . ASP E 3 167 ? 72.466 19.561  31.126 1.00 36.29  ? 167  ASP A CB    1 
ATOM   2518 C  CG    . ASP E 3 167 ? 72.422 20.181  29.739 1.00 37.98  ? 167  ASP A CG    1 
ATOM   2519 O  OD1   . ASP E 3 167 ? 72.109 21.383  29.626 1.00 37.30  ? 167  ASP A OD1   1 
ATOM   2520 O  OD2   . ASP E 3 167 ? 72.714 19.464  28.757 1.00 41.43  ? 167  ASP A OD2   1 
ATOM   2521 N  N     . ASP E 3 168 ? 72.156 21.853  33.026 1.00 37.67  ? 168  ASP A N     1 
ATOM   2522 C  CA    . ASP E 3 168 ? 72.214 23.260  33.394 1.00 41.85  ? 168  ASP A CA    1 
ATOM   2523 C  C     . ASP E 3 168 ? 72.058 24.203  32.211 1.00 41.94  ? 168  ASP A C     1 
ATOM   2524 O  O     . ASP E 3 168 ? 71.346 25.204  32.298 1.00 42.38  ? 168  ASP A O     1 
ATOM   2525 C  CB    . ASP E 3 168 ? 73.525 23.537  34.115 1.00 42.16  ? 168  ASP A CB    1 
ATOM   2526 C  CG    . ASP E 3 168 ? 73.547 22.936  35.491 1.00 46.06  ? 168  ASP A CG    1 
ATOM   2527 O  OD1   . ASP E 3 168 ? 72.720 22.033  35.751 1.00 44.74  ? 168  ASP A OD1   1 
ATOM   2528 O  OD2   . ASP E 3 168 ? 74.388 23.361  36.309 1.00 49.41  ? 168  ASP A OD2   1 
ATOM   2529 N  N     . GLU E 3 169 ? 72.718 23.874  31.108 1.00 43.04  ? 169  GLU A N     1 
ATOM   2530 C  CA    . GLU E 3 169 ? 72.656 24.692  29.906 1.00 44.21  ? 169  GLU A CA    1 
ATOM   2531 C  C     . GLU E 3 169 ? 71.246 24.765  29.326 1.00 42.40  ? 169  GLU A C     1 
ATOM   2532 O  O     . GLU E 3 169 ? 70.780 25.844  28.959 1.00 43.38  ? 169  GLU A O     1 
ATOM   2533 C  CB    . GLU E 3 169 ? 73.624 24.150  28.850 1.00 48.59  ? 169  GLU A CB    1 
ATOM   2534 C  CG    . GLU E 3 169 ? 73.490 24.816  27.482 1.00 57.42  ? 169  GLU A CG    1 
ATOM   2535 C  CD    . GLU E 3 169 ? 74.415 24.211  26.426 1.00 62.48  ? 169  GLU A CD    1 
ATOM   2536 O  OE1   . GLU E 3 169 ? 74.386 22.970  26.237 1.00 65.18  ? 169  GLU A OE1   1 
ATOM   2537 O  OE2   . GLU E 3 169 ? 75.165 24.979  25.780 1.00 65.11  ? 169  GLU A OE2   1 
ATOM   2538 N  N     . GLU E 3 170 ? 70.562 23.627  29.231 1.00 38.71  ? 170  GLU A N     1 
ATOM   2539 C  CA    . GLU E 3 170 ? 69.215 23.644  28.680 1.00 37.05  ? 170  GLU A CA    1 
ATOM   2540 C  C     . GLU E 3 170 ? 68.238 24.342  29.625 1.00 34.59  ? 170  GLU A C     1 
ATOM   2541 O  O     . GLU E 3 170 ? 67.223 24.871  29.183 1.00 33.19  ? 170  GLU A O     1 
ATOM   2542 C  CB    . GLU E 3 170 ? 68.717 22.237  28.367 1.00 37.92  ? 170  GLU A CB    1 
ATOM   2543 C  CG    . GLU E 3 170 ? 67.569 22.252  27.375 1.00 41.97  ? 170  GLU A CG    1 
ATOM   2544 C  CD    . GLU E 3 170 ? 66.957 20.893  27.176 1.00 46.13  ? 170  GLU A CD    1 
ATOM   2545 O  OE1   . GLU E 3 170 ? 67.589 19.903  27.590 1.00 49.69  ? 170  GLU A OE1   1 
ATOM   2546 O  OE2   . GLU E 3 170 ? 65.851 20.811  26.602 1.00 48.43  ? 170  GLU A OE2   1 
ATOM   2547 N  N     . VAL E 3 171 ? 68.536 24.339  30.922 1.00 32.22  ? 171  VAL A N     1 
ATOM   2548 C  CA    . VAL E 3 171 ? 67.672 25.029  31.873 1.00 32.06  ? 171  VAL A CA    1 
ATOM   2549 C  C     . VAL E 3 171 ? 67.701 26.523  31.522 1.00 34.63  ? 171  VAL A C     1 
ATOM   2550 O  O     . VAL E 3 171 ? 66.665 27.198  31.481 1.00 32.34  ? 171  VAL A O     1 
ATOM   2551 C  CB    . VAL E 3 171 ? 68.169 24.856  33.322 1.00 31.13  ? 171  VAL A CB    1 
ATOM   2552 C  CG1   . VAL E 3 171 ? 67.481 25.866  34.228 1.00 29.06  ? 171  VAL A CG1   1 
ATOM   2553 C  CG2   . VAL E 3 171 ? 67.887 23.432  33.811 1.00 30.41  ? 171  VAL A CG2   1 
ATOM   2554 N  N     . LYS E 3 172 ? 68.902 27.035  31.272 1.00 35.13  ? 172  LYS A N     1 
ATOM   2555 C  CA    . LYS E 3 172 ? 69.062 28.440  30.922 1.00 37.52  ? 172  LYS A CA    1 
ATOM   2556 C  C     . LYS E 3 172 ? 68.341 28.739  29.607 1.00 35.98  ? 172  LYS A C     1 
ATOM   2557 O  O     . LYS E 3 172 ? 67.737 29.796  29.452 1.00 34.84  ? 172  LYS A O     1 
ATOM   2558 C  CB    . LYS E 3 172 ? 70.552 28.780  30.833 1.00 39.25  ? 172  LYS A CB    1 
ATOM   2559 C  CG    . LYS E 3 172 ? 71.258 28.668  32.175 1.00 43.46  ? 172  LYS A CG    1 
ATOM   2560 C  CD    . LYS E 3 172 ? 72.774 28.692  32.043 1.00 48.38  ? 172  LYS A CD    1 
ATOM   2561 C  CE    . LYS E 3 172 ? 73.276 30.016  31.494 1.00 51.68  ? 172  LYS A CE    1 
ATOM   2562 N  NZ    . LYS E 3 172 ? 74.761 30.009  31.313 1.00 54.57  ? 172  LYS A NZ    1 
ATOM   2563 N  N     . ARG E 3 173 ? 68.387 27.793  28.673 1.00 36.36  ? 173  ARG A N     1 
ATOM   2564 C  CA    . ARG E 3 173 ? 67.718 27.955  27.388 1.00 36.71  ? 173  ARG A CA    1 
ATOM   2565 C  C     . ARG E 3 173 ? 66.205 27.995  27.592 1.00 38.00  ? 173  ARG A C     1 
ATOM   2566 O  O     . ARG E 3 173 ? 65.516 28.864  27.053 1.00 38.13  ? 173  ARG A O     1 
ATOM   2567 C  CB    . ARG E 3 173 ? 68.064 26.790  26.454 1.00 38.45  ? 173  ARG A CB    1 
ATOM   2568 C  CG    . ARG E 3 173 ? 67.390 26.863  25.076 1.00 42.48  ? 173  ARG A CG    1 
ATOM   2569 C  CD    . ARG E 3 173 ? 67.748 25.669  24.171 1.00 45.52  ? 173  ARG A CD    1 
ATOM   2570 N  NE    . ARG E 3 173 ? 67.077 24.426  24.559 1.00 50.46  ? 173  ARG A NE    1 
ATOM   2571 C  CZ    . ARG E 3 173 ? 65.784 24.169  24.361 1.00 52.86  ? 173  ARG A CZ    1 
ATOM   2572 N  NH1   . ARG E 3 173 ? 65.006 25.068  23.771 1.00 53.55  ? 173  ARG A NH1   1 
ATOM   2573 N  NH2   . ARG E 3 173 ? 65.262 23.014  24.760 1.00 52.79  ? 173  ARG A NH2   1 
ATOM   2574 N  N     . LEU E 3 174 ? 65.689 27.046  28.372 1.00 38.76  ? 174  LEU A N     1 
ATOM   2575 C  CA    . LEU E 3 174 ? 64.253 26.969  28.627 1.00 37.10  ? 174  LEU A CA    1 
ATOM   2576 C  C     . LEU E 3 174 ? 63.731 28.210  29.337 1.00 36.60  ? 174  LEU A C     1 
ATOM   2577 O  O     . LEU E 3 174 ? 62.620 28.669  29.055 1.00 35.52  ? 174  LEU A O     1 
ATOM   2578 C  CB    . LEU E 3 174 ? 63.921 25.707  29.429 1.00 35.41  ? 174  LEU A CB    1 
ATOM   2579 C  CG    . LEU E 3 174 ? 63.941 24.426  28.588 1.00 33.69  ? 174  LEU A CG    1 
ATOM   2580 C  CD1   . LEU E 3 174 ? 63.707 23.214  29.480 1.00 34.17  ? 174  LEU A CD1   1 
ATOM   2581 C  CD2   . LEU E 3 174 ? 62.872 24.501  27.510 1.00 33.81  ? 174  LEU A CD2   1 
ATOM   2582 N  N     . ILE E 3 175 ? 64.529 28.761  30.248 1.00 35.47  ? 175  ILE A N     1 
ATOM   2583 C  CA    . ILE E 3 175 ? 64.121 29.970  30.948 1.00 37.06  ? 175  ILE A CA    1 
ATOM   2584 C  C     . ILE E 3 175 ? 63.815 31.082  29.936 1.00 39.20  ? 175  ILE A C     1 
ATOM   2585 O  O     . ILE E 3 175 ? 63.126 32.045  30.257 1.00 39.89  ? 175  ILE A O     1 
ATOM   2586 C  CB    . ILE E 3 175 ? 65.215 30.460  31.908 1.00 36.23  ? 175  ILE A CB    1 
ATOM   2587 C  CG1   . ILE E 3 175 ? 65.383 29.466  33.052 1.00 35.06  ? 175  ILE A CG1   1 
ATOM   2588 C  CG2   . ILE E 3 175 ? 64.855 31.830  32.464 1.00 38.16  ? 175  ILE A CG2   1 
ATOM   2589 C  CD1   . ILE E 3 175 ? 66.446 29.862  34.034 1.00 35.97  ? 175  ILE A CD1   1 
ATOM   2590 N  N     . ARG E 3 176 ? 64.319 30.940  28.712 1.00 41.76  ? 176  ARG A N     1 
ATOM   2591 C  CA    . ARG E 3 176 ? 64.086 31.942  27.674 1.00 44.72  ? 176  ARG A CA    1 
ATOM   2592 C  C     . ARG E 3 176 ? 63.127 31.481  26.582 1.00 44.91  ? 176  ARG A C     1 
ATOM   2593 O  O     . ARG E 3 176 ? 62.262 32.246  26.147 1.00 44.86  ? 176  ARG A O     1 
ATOM   2594 C  CB    . ARG E 3 176 ? 65.410 32.361  27.013 1.00 47.38  ? 176  ARG A CB    1 
ATOM   2595 C  CG    . ARG E 3 176 ? 66.344 33.166  27.905 1.00 51.74  ? 176  ARG A CG    1 
ATOM   2596 C  CD    . ARG E 3 176 ? 67.604 33.637  27.165 1.00 54.09  ? 176  ARG A CD    1 
ATOM   2597 N  NE    . ARG E 3 176 ? 68.484 32.536  26.772 1.00 56.93  ? 176  ARG A NE    1 
ATOM   2598 C  CZ    . ARG E 3 176 ? 68.409 31.879  25.616 1.00 59.23  ? 176  ARG A CZ    1 
ATOM   2599 N  NH1   . ARG E 3 176 ? 67.490 32.205  24.712 1.00 61.04  ? 176  ARG A NH1   1 
ATOM   2600 N  NH2   . ARG E 3 176 ? 69.257 30.889  25.362 1.00 58.20  ? 176  ARG A NH2   1 
ATOM   2601 N  N     . GLU E 3 177 ? 63.271 30.234  26.142 1.00 43.98  ? 177  GLU A N     1 
ATOM   2602 C  CA    . GLU E 3 177 ? 62.427 29.724  25.068 1.00 44.64  ? 177  GLU A CA    1 
ATOM   2603 C  C     . GLU E 3 177 ? 61.144 28.999  25.484 1.00 43.73  ? 177  GLU A C     1 
ATOM   2604 O  O     . GLU E 3 177 ? 60.241 28.844  24.668 1.00 43.19  ? 177  GLU A O     1 
ATOM   2605 C  CB    . GLU E 3 177 ? 63.245 28.796  24.153 1.00 47.93  ? 177  GLU A CB    1 
ATOM   2606 C  CG    . GLU E 3 177 ? 64.546 29.400  23.601 1.00 54.19  ? 177  GLU A CG    1 
ATOM   2607 C  CD    . GLU E 3 177 ? 65.228 28.523  22.534 1.00 57.92  ? 177  GLU A CD    1 
ATOM   2608 O  OE1   . GLU E 3 177 ? 65.461 27.318  22.783 1.00 59.64  ? 177  GLU A OE1   1 
ATOM   2609 O  OE2   . GLU E 3 177 ? 65.543 29.047  21.440 1.00 59.83  ? 177  GLU A OE2   1 
ATOM   2610 N  N     . LEU E 3 178 ? 61.040 28.564  26.737 1.00 41.11  ? 178  LEU A N     1 
ATOM   2611 C  CA    . LEU E 3 178 ? 59.848 27.829  27.157 1.00 39.83  ? 178  LEU A CA    1 
ATOM   2612 C  C     . LEU E 3 178 ? 58.596 28.670  27.388 1.00 38.48  ? 178  LEU A C     1 
ATOM   2613 O  O     . LEU E 3 178 ? 58.633 29.692  28.074 1.00 36.43  ? 178  LEU A O     1 
ATOM   2614 C  CB    . LEU E 3 178 ? 60.138 27.009  28.425 1.00 39.88  ? 178  LEU A CB    1 
ATOM   2615 C  CG    . LEU E 3 178 ? 58.957 26.153  28.907 1.00 41.84  ? 178  LEU A CG    1 
ATOM   2616 C  CD1   . LEU E 3 178 ? 58.509 25.230  27.773 1.00 41.10  ? 178  LEU A CD1   1 
ATOM   2617 C  CD2   . LEU E 3 178 ? 59.343 25.339  30.136 1.00 40.42  ? 178  LEU A CD2   1 
ATOM   2618 N  N     . ASP E 3 179 ? 57.486 28.229  26.805 1.00 37.34  ? 179  ASP A N     1 
ATOM   2619 C  CA    . ASP E 3 179 ? 56.214 28.918  26.977 1.00 39.46  ? 179  ASP A CA    1 
ATOM   2620 C  C     . ASP E 3 179 ? 55.917 28.851  28.478 1.00 39.39  ? 179  ASP A C     1 
ATOM   2621 O  O     . ASP E 3 179 ? 55.940 27.770  29.074 1.00 36.48  ? 179  ASP A O     1 
ATOM   2622 C  CB    . ASP E 3 179 ? 55.107 28.205  26.199 1.00 43.51  ? 179  ASP A CB    1 
ATOM   2623 C  CG    . ASP E 3 179 ? 53.797 28.975  26.215 1.00 49.53  ? 179  ASP A CG    1 
ATOM   2624 O  OD1   . ASP E 3 179 ? 53.477 29.593  27.263 1.00 51.82  ? 179  ASP A OD1   1 
ATOM   2625 O  OD2   . ASP E 3 179 ? 53.083 28.954  25.183 1.00 51.48  ? 179  ASP A OD2   1 
ATOM   2626 N  N     . ILE E 3 180 ? 55.637 29.998  29.085 1.00 37.36  ? 180  ILE A N     1 
ATOM   2627 C  CA    . ILE E 3 180 ? 55.393 30.041  30.516 1.00 36.66  ? 180  ILE A CA    1 
ATOM   2628 C  C     . ILE E 3 180 ? 54.148 29.291  30.984 1.00 37.20  ? 180  ILE A C     1 
ATOM   2629 O  O     . ILE E 3 180 ? 54.040 28.933  32.158 1.00 35.85  ? 180  ILE A O     1 
ATOM   2630 C  CB    . ILE E 3 180 ? 55.343 31.498  31.018 1.00 37.19  ? 180  ILE A CB    1 
ATOM   2631 C  CG1   . ILE E 3 180 ? 55.599 31.522  32.532 1.00 34.99  ? 180  ILE A CG1   1 
ATOM   2632 C  CG2   . ILE E 3 180 ? 54.002 32.134  30.645 1.00 35.15  ? 180  ILE A CG2   1 
ATOM   2633 C  CD1   . ILE E 3 180 ? 55.970 32.879  33.096 1.00 34.58  ? 180  ILE A CD1   1 
ATOM   2634 N  N     . ALA E 3 181 ? 53.214 29.041  30.073 1.00 37.01  ? 181  ALA A N     1 
ATOM   2635 C  CA    . ALA E 3 181 ? 52.003 28.322  30.436 1.00 36.34  ? 181  ALA A CA    1 
ATOM   2636 C  C     . ALA E 3 181 ? 52.332 26.860  30.675 1.00 36.48  ? 181  ALA A C     1 
ATOM   2637 O  O     . ALA E 3 181 ? 51.535 26.135  31.252 1.00 37.26  ? 181  ALA A O     1 
ATOM   2638 C  CB    . ALA E 3 181 ? 50.963 28.441  29.336 1.00 37.73  ? 181  ALA A CB    1 
ATOM   2639 N  N     . ASP E 3 182 ? 53.511 26.424  30.242 1.00 35.80  ? 182  ASP A N     1 
ATOM   2640 C  CA    . ASP E 3 182 ? 53.887 25.030  30.425 1.00 34.71  ? 182  ASP A CA    1 
ATOM   2641 C  C     . ASP E 3 182 ? 54.708 24.794  31.692 1.00 35.14  ? 182  ASP A C     1 
ATOM   2642 O  O     . ASP E 3 182 ? 55.216 23.693  31.935 1.00 33.32  ? 182  ASP A O     1 
ATOM   2643 C  CB    . ASP E 3 182 ? 54.629 24.518  29.189 1.00 36.91  ? 182  ASP A CB    1 
ATOM   2644 C  CG    . ASP E 3 182 ? 53.740 24.490  27.953 1.00 41.02  ? 182  ASP A CG    1 
ATOM   2645 O  OD1   . ASP E 3 182 ? 52.502 24.401  28.107 1.00 44.12  ? 182  ASP A OD1   1 
ATOM   2646 O  OD2   . ASP E 3 182 ? 54.270 24.543  26.827 1.00 44.58  ? 182  ASP A OD2   1 
ATOM   2647 N  N     . VAL E 3 183 ? 54.834 25.833  32.506 1.00 32.60  ? 183  VAL A N     1 
ATOM   2648 C  CA    . VAL E 3 183 ? 55.555 25.706  33.759 1.00 31.50  ? 183  VAL A CA    1 
ATOM   2649 C  C     . VAL E 3 183 ? 54.588 25.126  34.789 1.00 30.80  ? 183  VAL A C     1 
ATOM   2650 O  O     . VAL E 3 183 ? 53.445 25.572  34.897 1.00 31.44  ? 183  VAL A O     1 
ATOM   2651 C  CB    . VAL E 3 183 ? 56.064 27.066  34.253 1.00 28.89  ? 183  VAL A CB    1 
ATOM   2652 C  CG1   . VAL E 3 183 ? 56.454 26.971  35.716 1.00 29.08  ? 183  VAL A CG1   1 
ATOM   2653 C  CG2   . VAL E 3 183 ? 57.268 27.493  33.418 1.00 31.23  ? 183  VAL A CG2   1 
ATOM   2654 N  N     . PRO E 3 184 ? 55.028 24.115  35.549 1.00 29.52  ? 184  PRO A N     1 
ATOM   2655 C  CA    . PRO E 3 184 ? 54.145 23.518  36.555 1.00 29.26  ? 184  PRO A CA    1 
ATOM   2656 C  C     . PRO E 3 184 ? 53.574 24.588  37.475 1.00 29.88  ? 184  PRO A C     1 
ATOM   2657 O  O     . PRO E 3 184 ? 54.299 25.484  37.907 1.00 27.86  ? 184  PRO A O     1 
ATOM   2658 C  CB    . PRO E 3 184 ? 55.069 22.557  37.300 1.00 27.38  ? 184  PRO A CB    1 
ATOM   2659 C  CG    . PRO E 3 184 ? 56.036 22.134  36.224 1.00 29.43  ? 184  PRO A CG    1 
ATOM   2660 C  CD    . PRO E 3 184 ? 56.337 23.436  35.516 1.00 27.32  ? 184  PRO A CD    1 
ATOM   2661 N  N     . GLY E 3 185 ? 52.277 24.499  37.766 1.00 30.33  ? 185  GLY A N     1 
ATOM   2662 C  CA    . GLY E 3 185 ? 51.654 25.470  38.651 1.00 30.81  ? 185  GLY A CA    1 
ATOM   2663 C  C     . GLY E 3 185 ? 51.028 26.656  37.940 1.00 32.94  ? 185  GLY A C     1 
ATOM   2664 O  O     . GLY E 3 185 ? 50.435 27.535  38.571 1.00 33.70  ? 185  GLY A O     1 
ATOM   2665 N  N     . ILE E 3 186 ? 51.166 26.699  36.623 1.00 32.74  ? 186  ILE A N     1 
ATOM   2666 C  CA    . ILE E 3 186 ? 50.583 27.791  35.863 1.00 33.01  ? 186  ILE A CA    1 
ATOM   2667 C  C     . ILE E 3 186 ? 49.414 27.244  35.055 1.00 34.48  ? 186  ILE A C     1 
ATOM   2668 O  O     . ILE E 3 186 ? 49.607 26.567  34.044 1.00 33.94  ? 186  ILE A O     1 
ATOM   2669 C  CB    . ILE E 3 186 ? 51.601 28.426  34.900 1.00 31.75  ? 186  ILE A CB    1 
ATOM   2670 C  CG1   . ILE E 3 186 ? 52.812 28.944  35.672 1.00 33.60  ? 186  ILE A CG1   1 
ATOM   2671 C  CG2   . ILE E 3 186 ? 50.954 29.559  34.146 1.00 32.88  ? 186  ILE A CG2   1 
ATOM   2672 C  CD1   . ILE E 3 186 ? 52.495 29.929  36.782 1.00 33.46  ? 186  ILE A CD1   1 
ATOM   2673 N  N     . GLY E 3 187 ? 48.202 27.534  35.515 1.00 35.71  ? 187  GLY A N     1 
ATOM   2674 C  CA    . GLY E 3 187 ? 47.014 27.075  34.822 1.00 37.20  ? 187  GLY A CA    1 
ATOM   2675 C  C     . GLY E 3 187 ? 46.509 28.116  33.844 1.00 39.27  ? 187  GLY A C     1 
ATOM   2676 O  O     . GLY E 3 187 ? 47.165 29.130  33.601 1.00 38.19  ? 187  GLY A O     1 
ATOM   2677 N  N     . ASN E 3 188 ? 45.329 27.866  33.288 1.00 41.12  ? 188  ASN A N     1 
ATOM   2678 C  CA    . ASN E 3 188 ? 44.728 28.766  32.314 1.00 42.81  ? 188  ASN A CA    1 
ATOM   2679 C  C     . ASN E 3 188 ? 44.533 30.165  32.874 1.00 41.18  ? 188  ASN A C     1 
ATOM   2680 O  O     . ASN E 3 188 ? 44.841 31.149  32.210 1.00 41.40  ? 188  ASN A O     1 
ATOM   2681 C  CB    . ASN E 3 188 ? 43.383 28.203  31.841 1.00 47.19  ? 188  ASN A CB    1 
ATOM   2682 C  CG    . ASN E 3 188 ? 43.539 26.937  31.008 1.00 53.26  ? 188  ASN A CG    1 
ATOM   2683 O  OD1   . ASN E 3 188 ? 42.582 26.174  30.819 1.00 55.52  ? 188  ASN A OD1   1 
ATOM   2684 N  ND2   . ASN E 3 188 ? 44.747 26.712  30.494 1.00 54.03  ? 188  ASN A ND2   1 
ATOM   2685 N  N     . ILE E 3 189 ? 44.032 30.246  34.101 1.00 38.95  ? 189  ILE A N     1 
ATOM   2686 C  CA    . ILE E 3 189 ? 43.776 31.527  34.734 1.00 37.86  ? 189  ILE A CA    1 
ATOM   2687 C  C     . ILE E 3 189 ? 45.036 32.377  34.891 1.00 38.45  ? 189  ILE A C     1 
ATOM   2688 O  O     . ILE E 3 189 ? 45.031 33.578  34.584 1.00 37.78  ? 189  ILE A O     1 
ATOM   2689 C  CB    . ILE E 3 189 ? 43.104 31.331  36.117 1.00 38.72  ? 189  ILE A CB    1 
ATOM   2690 C  CG1   . ILE E 3 189 ? 41.710 30.713  35.924 1.00 41.02  ? 189  ILE A CG1   1 
ATOM   2691 C  CG2   . ILE E 3 189 ? 43.014 32.661  36.850 1.00 37.64  ? 189  ILE A CG2   1 
ATOM   2692 C  CD1   . ILE E 3 189 ? 40.935 30.461  37.209 1.00 40.65  ? 189  ILE A CD1   1 
ATOM   2693 N  N     . THR E 3 190 ? 46.115 31.760  35.363 1.00 35.85  ? 190  THR A N     1 
ATOM   2694 C  CA    . THR E 3 190 ? 47.366 32.485  35.548 1.00 34.30  ? 190  THR A CA    1 
ATOM   2695 C  C     . THR E 3 190 ? 48.051 32.743  34.205 1.00 33.40  ? 190  THR A C     1 
ATOM   2696 O  O     . THR E 3 190 ? 48.600 33.818  33.975 1.00 31.71  ? 190  THR A O     1 
ATOM   2697 C  CB    . THR E 3 190 ? 48.323 31.714  36.478 1.00 32.26  ? 190  THR A CB    1 
ATOM   2698 O  OG1   . THR E 3 190 ? 47.668 31.458  37.730 1.00 32.19  ? 190  THR A OG1   1 
ATOM   2699 C  CG2   . THR E 3 190 ? 49.566 32.533  36.745 1.00 30.45  ? 190  THR A CG2   1 
ATOM   2700 N  N     . ALA E 3 191 ? 48.008 31.758  33.316 1.00 34.19  ? 191  ALA A N     1 
ATOM   2701 C  CA    . ALA E 3 191 ? 48.625 31.902  32.003 1.00 35.73  ? 191  ALA A CA    1 
ATOM   2702 C  C     . ALA E 3 191 ? 48.035 33.125  31.308 1.00 36.93  ? 191  ALA A C     1 
ATOM   2703 O  O     . ALA E 3 191 ? 48.756 33.970  30.785 1.00 36.04  ? 191  ALA A O     1 
ATOM   2704 C  CB    . ALA E 3 191 ? 48.374 30.659  31.169 1.00 34.21  ? 191  ALA A CB    1 
ATOM   2705 N  N     . GLU E 3 192 ? 46.711 33.211  31.324 1.00 39.10  ? 192  GLU A N     1 
ATOM   2706 C  CA    . GLU E 3 192 ? 46.009 34.318  30.694 1.00 41.77  ? 192  GLU A CA    1 
ATOM   2707 C  C     . GLU E 3 192 ? 46.419 35.662  31.292 1.00 40.87  ? 192  GLU A C     1 
ATOM   2708 O  O     . GLU E 3 192 ? 46.654 36.619  30.557 1.00 41.78  ? 192  GLU A O     1 
ATOM   2709 C  CB    . GLU E 3 192 ? 44.492 34.114  30.821 1.00 45.63  ? 192  GLU A CB    1 
ATOM   2710 C  CG    . GLU E 3 192 ? 43.654 35.178  30.126 1.00 51.59  ? 192  GLU A CG    1 
ATOM   2711 C  CD    . GLU E 3 192 ? 44.070 35.393  28.678 1.00 54.92  ? 192  GLU A CD    1 
ATOM   2712 O  OE1   . GLU E 3 192 ? 44.094 34.405  27.907 1.00 55.83  ? 192  GLU A OE1   1 
ATOM   2713 O  OE2   . GLU E 3 192 ? 44.375 36.554  28.316 1.00 56.25  ? 192  GLU A OE2   1 
ATOM   2714 N  N     . LYS E 3 193 ? 46.507 35.737  32.619 1.00 39.59  ? 193  LYS A N     1 
ATOM   2715 C  CA    . LYS E 3 193 ? 46.899 36.981  33.274 1.00 39.75  ? 193  LYS A CA    1 
ATOM   2716 C  C     . LYS E 3 193 ? 48.305 37.394  32.831 1.00 40.25  ? 193  LYS A C     1 
ATOM   2717 O  O     . LYS E 3 193 ? 48.591 38.580  32.648 1.00 38.54  ? 193  LYS A O     1 
ATOM   2718 C  CB    . LYS E 3 193 ? 46.880 36.820  34.799 1.00 39.89  ? 193  LYS A CB    1 
ATOM   2719 C  CG    . LYS E 3 193 ? 45.502 36.683  35.439 1.00 37.54  ? 193  LYS A CG    1 
ATOM   2720 C  CD    . LYS E 3 193 ? 45.672 36.310  36.903 1.00 38.45  ? 193  LYS A CD    1 
ATOM   2721 C  CE    . LYS E 3 193 ? 44.357 36.294  37.676 1.00 39.97  ? 193  LYS A CE    1 
ATOM   2722 N  NZ    . LYS E 3 193 ? 44.565 35.735  39.062 1.00 39.11  ? 193  LYS A NZ    1 
ATOM   2723 N  N     . LEU E 3 194 ? 49.180 36.405  32.664 1.00 40.57  ? 194  LEU A N     1 
ATOM   2724 C  CA    . LEU E 3 194 ? 50.557 36.661  32.255 1.00 42.64  ? 194  LEU A CA    1 
ATOM   2725 C  C     . LEU E 3 194 ? 50.629 37.166  30.820 1.00 44.34  ? 194  LEU A C     1 
ATOM   2726 O  O     . LEU E 3 194 ? 51.439 38.036  30.495 1.00 43.55  ? 194  LEU A O     1 
ATOM   2727 C  CB    . LEU E 3 194 ? 51.395 35.389  32.396 1.00 40.33  ? 194  LEU A CB    1 
ATOM   2728 C  CG    . LEU E 3 194 ? 51.607 34.900  33.826 1.00 38.78  ? 194  LEU A CG    1 
ATOM   2729 C  CD1   . LEU E 3 194 ? 52.264 33.528  33.793 1.00 38.08  ? 194  LEU A CD1   1 
ATOM   2730 C  CD2   . LEU E 3 194 ? 52.463 35.900  34.588 1.00 38.89  ? 194  LEU A CD2   1 
ATOM   2731 N  N     . LYS E 3 195 ? 49.786 36.603  29.963 1.00 46.69  ? 195  LYS A N     1 
ATOM   2732 C  CA    . LYS E 3 195 ? 49.746 37.005  28.568 1.00 48.80  ? 195  LYS A CA    1 
ATOM   2733 C  C     . LYS E 3 195 ? 49.306 38.468  28.516 1.00 49.31  ? 195  LYS A C     1 
ATOM   2734 O  O     . LYS E 3 195 ? 49.824 39.249  27.726 1.00 49.26  ? 195  LYS A O     1 
ATOM   2735 C  CB    . LYS E 3 195 ? 48.768 36.115  27.799 1.00 48.92  ? 195  LYS A CB    1 
ATOM   2736 C  CG    . LYS E 3 195 ? 48.809 36.302  26.303 1.00 50.24  ? 195  LYS A CG    1 
ATOM   2737 C  CD    . LYS E 3 195 ? 47.894 35.307  25.617 1.00 53.90  ? 195  LYS A CD    1 
ATOM   2738 C  CE    . LYS E 3 195 ? 47.950 35.456  24.104 1.00 55.39  ? 195  LYS A CE    1 
ATOM   2739 N  NZ    . LYS E 3 195 ? 47.118 34.429  23.420 1.00 56.89  ? 195  LYS A NZ    1 
ATOM   2740 N  N     . LYS E 3 196 ? 48.357 38.832  29.376 1.00 49.91  ? 196  LYS A N     1 
ATOM   2741 C  CA    . LYS E 3 196 ? 47.862 40.205  29.440 1.00 50.62  ? 196  LYS A CA    1 
ATOM   2742 C  C     . LYS E 3 196 ? 48.938 41.148  29.951 1.00 49.36  ? 196  LYS A C     1 
ATOM   2743 O  O     . LYS E 3 196 ? 48.700 42.343  30.083 1.00 51.47  ? 196  LYS A O     1 
ATOM   2744 C  CB    . LYS E 3 196 ? 46.655 40.321  30.377 1.00 52.97  ? 196  LYS A CB    1 
ATOM   2745 C  CG    . LYS E 3 196 ? 45.290 40.257  29.708 1.00 56.46  ? 196  LYS A CG    1 
ATOM   2746 C  CD    . LYS E 3 196 ? 44.222 40.799  30.662 1.00 58.45  ? 196  LYS A CD    1 
ATOM   2747 C  CE    . LYS E 3 196 ? 42.810 40.649  30.104 1.00 60.50  ? 196  LYS A CE    1 
ATOM   2748 N  NZ    . LYS E 3 196 ? 42.376 39.223  30.014 1.00 61.39  ? 196  LYS A NZ    1 
ATOM   2749 N  N     . LEU E 3 197 ? 50.107 40.612  30.268 1.00 46.08  ? 197  LEU A N     1 
ATOM   2750 C  CA    . LEU E 3 197 ? 51.202 41.439  30.760 1.00 43.56  ? 197  LEU A CA    1 
ATOM   2751 C  C     . LEU E 3 197 ? 52.349 41.362  29.772 1.00 41.42  ? 197  LEU A C     1 
ATOM   2752 O  O     . LEU E 3 197 ? 53.414 41.949  29.980 1.00 41.73  ? 197  LEU A O     1 
ATOM   2753 C  CB    . LEU E 3 197 ? 51.671 40.950  32.136 1.00 42.41  ? 197  LEU A CB    1 
ATOM   2754 C  CG    . LEU E 3 197 ? 50.687 41.120  33.297 1.00 41.31  ? 197  LEU A CG    1 
ATOM   2755 C  CD1   . LEU E 3 197 ? 51.281 40.543  34.577 1.00 39.06  ? 197  LEU A CD1   1 
ATOM   2756 C  CD2   . LEU E 3 197 ? 50.374 42.593  33.474 1.00 40.41  ? 197  LEU A CD2   1 
ATOM   2757 N  N     . GLY E 3 198 ? 52.122 40.626  28.692 1.00 38.75  ? 198  GLY A N     1 
ATOM   2758 C  CA    . GLY E 3 198 ? 53.153 40.471  27.690 1.00 37.92  ? 198  GLY A CA    1 
ATOM   2759 C  C     . GLY E 3 198 ? 54.190 39.466  28.143 1.00 37.27  ? 198  GLY A C     1 
ATOM   2760 O  O     . GLY E 3 198 ? 55.252 39.360  27.535 1.00 38.60  ? 198  GLY A O     1 
ATOM   2761 N  N     . ILE E 3 199 ? 53.892 38.737  29.219 1.00 36.24  ? 199  ILE A N     1 
ATOM   2762 C  CA    . ILE E 3 199 ? 54.812 37.723  29.739 1.00 36.78  ? 199  ILE A CA    1 
ATOM   2763 C  C     . ILE E 3 199 ? 54.499 36.362  29.115 1.00 37.07  ? 199  ILE A C     1 
ATOM   2764 O  O     . ILE E 3 199 ? 53.430 35.800  29.340 1.00 38.27  ? 199  ILE A O     1 
ATOM   2765 C  CB    . ILE E 3 199 ? 54.708 37.605  31.280 1.00 36.86  ? 199  ILE A CB    1 
ATOM   2766 C  CG1   . ILE E 3 199 ? 55.125 38.921  31.923 1.00 37.85  ? 199  ILE A CG1   1 
ATOM   2767 C  CG2   . ILE E 3 199 ? 55.590 36.480  31.785 1.00 36.67  ? 199  ILE A CG2   1 
ATOM   2768 C  CD1   . ILE E 3 199 ? 55.155 38.942  33.418 1.00 37.25  ? 199  ILE A CD1   1 
ATOM   2769 N  N     . ASN E 3 200 ? 55.429 35.838  28.325 1.00 38.42  ? 200  ASN A N     1 
ATOM   2770 C  CA    . ASN E 3 200 ? 55.231 34.545  27.674 1.00 39.25  ? 200  ASN A CA    1 
ATOM   2771 C  C     . ASN E 3 200 ? 56.359 33.557  27.976 1.00 37.37  ? 200  ASN A C     1 
ATOM   2772 O  O     . ASN E 3 200 ? 56.266 32.379  27.635 1.00 37.05  ? 200  ASN A O     1 
ATOM   2773 C  CB    . ASN E 3 200 ? 55.126 34.732  26.156 1.00 42.79  ? 200  ASN A CB    1 
ATOM   2774 C  CG    . ASN E 3 200 ? 54.080 35.758  25.764 1.00 45.10  ? 200  ASN A CG    1 
ATOM   2775 O  OD1   . ASN E 3 200 ? 52.926 35.687  26.191 1.00 47.68  ? 200  ASN A OD1   1 
ATOM   2776 N  ND2   . ASN E 3 200 ? 54.481 36.722  24.939 1.00 46.70  ? 200  ASN A ND2   1 
ATOM   2777 N  N     . LYS E 3 201 ? 57.422 34.044  28.606 1.00 36.53  ? 201  LYS A N     1 
ATOM   2778 C  CA    . LYS E 3 201 ? 58.574 33.213  28.941 1.00 36.22  ? 201  LYS A CA    1 
ATOM   2779 C  C     . LYS E 3 201 ? 59.029 33.593  30.339 1.00 37.14  ? 201  LYS A C     1 
ATOM   2780 O  O     . LYS E 3 201 ? 58.843 34.735  30.769 1.00 35.69  ? 201  LYS A O     1 
ATOM   2781 C  CB    . LYS E 3 201 ? 59.720 33.477  27.963 1.00 38.75  ? 201  LYS A CB    1 
ATOM   2782 C  CG    . LYS E 3 201 ? 59.327 33.455  26.489 1.00 40.88  ? 201  LYS A CG    1 
ATOM   2783 C  CD    . LYS E 3 201 ? 59.098 32.043  25.971 1.00 42.77  ? 201  LYS A CD    1 
ATOM   2784 C  CE    . LYS E 3 201 ? 58.804 32.068  24.476 1.00 44.52  ? 201  LYS A CE    1 
ATOM   2785 N  NZ    . LYS E 3 201 ? 58.720 30.713  23.867 1.00 46.23  ? 201  LYS A NZ    1 
ATOM   2786 N  N     . LEU E 3 202 ? 59.629 32.641  31.044 1.00 35.69  ? 202  LEU A N     1 
ATOM   2787 C  CA    . LEU E 3 202 ? 60.107 32.886  32.396 1.00 34.86  ? 202  LEU A CA    1 
ATOM   2788 C  C     . LEU E 3 202 ? 60.991 34.132  32.481 1.00 35.30  ? 202  LEU A C     1 
ATOM   2789 O  O     . LEU E 3 202 ? 60.845 34.943  33.395 1.00 34.57  ? 202  LEU A O     1 
ATOM   2790 C  CB    . LEU E 3 202 ? 60.881 31.666  32.906 1.00 33.30  ? 202  LEU A CB    1 
ATOM   2791 C  CG    . LEU E 3 202 ? 60.040 30.475  33.394 1.00 33.29  ? 202  LEU A CG    1 
ATOM   2792 C  CD1   . LEU E 3 202 ? 60.920 29.244  33.521 1.00 32.68  ? 202  LEU A CD1   1 
ATOM   2793 C  CD2   . LEU E 3 202 ? 59.395 30.807  34.733 1.00 31.60  ? 202  LEU A CD2   1 
ATOM   2794 N  N     . VAL E 3 203 ? 61.899 34.288  31.524 1.00 35.51  ? 203  VAL A N     1 
ATOM   2795 C  CA    . VAL E 3 203 ? 62.800 35.433  31.537 1.00 35.87  ? 203  VAL A CA    1 
ATOM   2796 C  C     . VAL E 3 203 ? 62.041 36.766  31.607 1.00 34.99  ? 203  VAL A C     1 
ATOM   2797 O  O     . VAL E 3 203 ? 62.470 37.685  32.302 1.00 36.25  ? 203  VAL A O     1 
ATOM   2798 C  CB    . VAL E 3 203 ? 63.751 35.408  30.312 1.00 34.83  ? 203  VAL A CB    1 
ATOM   2799 C  CG1   . VAL E 3 203 ? 62.972 35.624  29.025 1.00 33.82  ? 203  VAL A CG1   1 
ATOM   2800 C  CG2   . VAL E 3 203 ? 64.838 36.456  30.488 1.00 35.06  ? 203  VAL A CG2   1 
ATOM   2801 N  N     . ASP E 3 204 ? 60.903 36.856  30.919 1.00 34.13  ? 204  ASP A N     1 
ATOM   2802 C  CA    . ASP E 3 204 ? 60.089 38.075  30.925 1.00 34.17  ? 204  ASP A CA    1 
ATOM   2803 C  C     . ASP E 3 204 ? 59.703 38.566  32.326 1.00 34.77  ? 204  ASP A C     1 
ATOM   2804 O  O     . ASP E 3 204 ? 59.557 39.768  32.552 1.00 34.44  ? 204  ASP A O     1 
ATOM   2805 C  CB    . ASP E 3 204 ? 58.796 37.866  30.134 1.00 34.04  ? 204  ASP A CB    1 
ATOM   2806 C  CG    . ASP E 3 204 ? 59.042 37.566  28.675 1.00 36.38  ? 204  ASP A CG    1 
ATOM   2807 O  OD1   . ASP E 3 204 ? 60.159 37.849  28.187 1.00 36.03  ? 204  ASP A OD1   1 
ATOM   2808 O  OD2   . ASP E 3 204 ? 58.108 37.056  28.014 1.00 35.36  ? 204  ASP A OD2   1 
ATOM   2809 N  N     . THR E 3 205 ? 59.512 37.637  33.259 1.00 35.22  ? 205  THR A N     1 
ATOM   2810 C  CA    . THR E 3 205 ? 59.130 37.998  34.619 1.00 35.41  ? 205  THR A CA    1 
ATOM   2811 C  C     . THR E 3 205 ? 60.199 38.859  35.276 1.00 36.30  ? 205  THR A C     1 
ATOM   2812 O  O     . THR E 3 205 ? 59.927 39.580  36.232 1.00 36.61  ? 205  THR A O     1 
ATOM   2813 C  CB    . THR E 3 205 ? 58.918 36.744  35.494 1.00 36.28  ? 205  THR A CB    1 
ATOM   2814 O  OG1   . THR E 3 205 ? 60.188 36.132  35.762 1.00 33.79  ? 205  THR A OG1   1 
ATOM   2815 C  CG2   . THR E 3 205 ? 58.013 35.739  34.778 1.00 33.62  ? 205  THR A CG2   1 
ATOM   2816 N  N     . LEU E 3 206 ? 61.418 38.778  34.757 1.00 38.21  ? 206  LEU A N     1 
ATOM   2817 C  CA    . LEU E 3 206 ? 62.530 39.549  35.296 1.00 40.86  ? 206  LEU A CA    1 
ATOM   2818 C  C     . LEU E 3 206 ? 62.546 41.004  34.824 1.00 42.45  ? 206  LEU A C     1 
ATOM   2819 O  O     . LEU E 3 206 ? 63.240 41.835  35.405 1.00 42.49  ? 206  LEU A O     1 
ATOM   2820 C  CB    . LEU E 3 206 ? 63.857 38.896  34.915 1.00 39.39  ? 206  LEU A CB    1 
ATOM   2821 C  CG    . LEU E 3 206 ? 64.095 37.475  35.420 1.00 39.58  ? 206  LEU A CG    1 
ATOM   2822 C  CD1   . LEU E 3 206 ? 65.457 36.998  34.956 1.00 39.78  ? 206  LEU A CD1   1 
ATOM   2823 C  CD2   . LEU E 3 206 ? 64.008 37.449  36.929 1.00 39.41  ? 206  LEU A CD2   1 
ATOM   2824 N  N     . SER E 3 207 ? 61.796 41.320  33.776 1.00 43.35  ? 207  SER A N     1 
ATOM   2825 C  CA    . SER E 3 207 ? 61.801 42.688  33.286 1.00 46.81  ? 207  SER A CA    1 
ATOM   2826 C  C     . SER E 3 207 ? 60.564 43.491  33.663 1.00 47.49  ? 207  SER A C     1 
ATOM   2827 O  O     . SER E 3 207 ? 60.395 44.626  33.220 1.00 48.90  ? 207  SER A O     1 
ATOM   2828 C  CB    . SER E 3 207 ? 62.015 42.710  31.768 1.00 46.44  ? 207  SER A CB    1 
ATOM   2829 O  OG    . SER E 3 207 ? 61.153 41.805  31.105 1.00 49.99  ? 207  SER A OG    1 
ATOM   2830 N  N     . ILE E 3 208 ? 59.700 42.908  34.487 1.00 48.12  ? 208  ILE A N     1 
ATOM   2831 C  CA    . ILE E 3 208 ? 58.505 43.617  34.923 1.00 47.41  ? 208  ILE A CA    1 
ATOM   2832 C  C     . ILE E 3 208 ? 58.704 44.106  36.349 1.00 49.31  ? 208  ILE A C     1 
ATOM   2833 O  O     . ILE E 3 208 ? 59.567 43.612  37.076 1.00 49.27  ? 208  ILE A O     1 
ATOM   2834 C  CB    . ILE E 3 208 ? 57.247 42.718  34.885 1.00 47.39  ? 208  ILE A CB    1 
ATOM   2835 C  CG1   . ILE E 3 208 ? 56.004 43.562  35.171 1.00 46.06  ? 208  ILE A CG1   1 
ATOM   2836 C  CG2   . ILE E 3 208 ? 57.357 41.609  35.922 1.00 44.38  ? 208  ILE A CG2   1 
ATOM   2837 C  CD1   . ILE E 3 208 ? 54.703 42.820  34.983 1.00 46.33  ? 208  ILE A CD1   1 
ATOM   2838 N  N     . GLU E 3 209 ? 57.910 45.092  36.740 1.00 50.32  ? 209  GLU A N     1 
ATOM   2839 C  CA    . GLU E 3 209 ? 57.979 45.636  38.088 1.00 51.97  ? 209  GLU A CA    1 
ATOM   2840 C  C     . GLU E 3 209 ? 57.365 44.550  38.966 1.00 49.91  ? 209  GLU A C     1 
ATOM   2841 O  O     . GLU E 3 209 ? 56.267 44.082  38.686 1.00 48.26  ? 209  GLU A O     1 
ATOM   2842 C  CB    . GLU E 3 209 ? 57.148 46.914  38.144 1.00 55.92  ? 209  GLU A CB    1 
ATOM   2843 C  CG    . GLU E 3 209 ? 57.510 47.888  39.238 1.00 61.16  ? 209  GLU A CG    1 
ATOM   2844 C  CD    . GLU E 3 209 ? 56.889 49.254  38.990 1.00 64.74  ? 209  GLU A CD    1 
ATOM   2845 O  OE1   . GLU E 3 209 ? 55.641 49.339  38.922 1.00 65.69  ? 209  GLU A OE1   1 
ATOM   2846 O  OE2   . GLU E 3 209 ? 57.651 50.239  38.850 1.00 66.61  ? 209  GLU A OE2   1 
ATOM   2847 N  N     . PHE E 3 210 ? 58.072 44.142  40.013 1.00 49.65  ? 210  PHE A N     1 
ATOM   2848 C  CA    . PHE E 3 210 ? 57.584 43.085  40.895 1.00 49.81  ? 210  PHE A CA    1 
ATOM   2849 C  C     . PHE E 3 210 ? 56.156 43.251  41.387 1.00 50.29  ? 210  PHE A C     1 
ATOM   2850 O  O     . PHE E 3 210 ? 55.331 42.358  41.224 1.00 49.62  ? 210  PHE A O     1 
ATOM   2851 C  CB    . PHE E 3 210 ? 58.487 42.928  42.114 1.00 49.46  ? 210  PHE A CB    1 
ATOM   2852 C  CG    . PHE E 3 210 ? 58.038 41.842  43.055 1.00 49.42  ? 210  PHE A CG    1 
ATOM   2853 C  CD1   . PHE E 3 210 ? 58.261 40.503  42.751 1.00 49.60  ? 210  PHE A CD1   1 
ATOM   2854 C  CD2   . PHE E 3 210 ? 57.361 42.156  44.228 1.00 50.12  ? 210  PHE A CD2   1 
ATOM   2855 C  CE1   . PHE E 3 210 ? 57.813 39.486  43.602 1.00 48.80  ? 210  PHE A CE1   1 
ATOM   2856 C  CE2   . PHE E 3 210 ? 56.908 41.147  45.086 1.00 51.20  ? 210  PHE A CE2   1 
ATOM   2857 C  CZ    . PHE E 3 210 ? 57.137 39.809  44.769 1.00 49.80  ? 210  PHE A CZ    1 
ATOM   2858 N  N     . ASP E 3 211 ? 55.869 44.390  42.004 1.00 52.08  ? 211  ASP A N     1 
ATOM   2859 C  CA    . ASP E 3 211 ? 54.538 44.646  42.543 1.00 52.77  ? 211  ASP A CA    1 
ATOM   2860 C  C     . ASP E 3 211 ? 53.442 44.583  41.498 1.00 51.65  ? 211  ASP A C     1 
ATOM   2861 O  O     . ASP E 3 211 ? 52.295 44.260  41.806 1.00 51.04  ? 211  ASP A O     1 
ATOM   2862 C  CB    . ASP E 3 211 ? 54.528 45.997  43.243 1.00 56.39  ? 211  ASP A CB    1 
ATOM   2863 C  CG    . ASP E 3 211 ? 55.559 46.070  44.340 1.00 60.23  ? 211  ASP A CG    1 
ATOM   2864 O  OD1   . ASP E 3 211 ? 55.410 45.328  45.334 1.00 62.62  ? 211  ASP A OD1   1 
ATOM   2865 O  OD2   . ASP E 3 211 ? 56.526 46.851  44.200 1.00 63.74  ? 211  ASP A OD2   1 
ATOM   2866 N  N     . LYS E 3 212 ? 53.792 44.889  40.256 1.00 50.23  ? 212  LYS A N     1 
ATOM   2867 C  CA    . LYS E 3 212 ? 52.816 44.843  39.180 1.00 49.53  ? 212  LYS A CA    1 
ATOM   2868 C  C     . LYS E 3 212 ? 52.512 43.367  38.904 1.00 47.45  ? 212  LYS A C     1 
ATOM   2869 O  O     . LYS E 3 212 ? 51.357 42.974  38.742 1.00 45.35  ? 212  LYS A O     1 
ATOM   2870 C  CB    . LYS E 3 212 ? 53.392 45.520  37.940 1.00 51.52  ? 212  LYS A CB    1 
ATOM   2871 C  CG    . LYS E 3 212 ? 52.400 45.730  36.829 1.00 55.33  ? 212  LYS A CG    1 
ATOM   2872 C  CD    . LYS E 3 212 ? 53.075 46.394  35.647 1.00 58.89  ? 212  LYS A CD    1 
ATOM   2873 C  CE    . LYS E 3 212 ? 52.120 46.517  34.472 1.00 60.78  ? 212  LYS A CE    1 
ATOM   2874 N  NZ    . LYS E 3 212 ? 52.816 47.030  33.265 1.00 64.47  ? 212  LYS A NZ    1 
ATOM   2875 N  N     . LEU E 3 213 ? 53.567 42.560  38.857 1.00 45.54  ? 213  LEU A N     1 
ATOM   2876 C  CA    . LEU E 3 213 ? 53.435 41.128  38.630 1.00 44.13  ? 213  LEU A CA    1 
ATOM   2877 C  C     . LEU E 3 213 ? 52.666 40.555  39.813 1.00 44.32  ? 213  LEU A C     1 
ATOM   2878 O  O     . LEU E 3 213 ? 51.656 39.863  39.651 1.00 42.53  ? 213  LEU A O     1 
ATOM   2879 C  CB    . LEU E 3 213 ? 54.818 40.477  38.556 1.00 42.48  ? 213  LEU A CB    1 
ATOM   2880 C  CG    . LEU E 3 213 ? 54.852 38.969  38.286 1.00 41.86  ? 213  LEU A CG    1 
ATOM   2881 C  CD1   . LEU E 3 213 ? 54.116 38.660  36.983 1.00 40.47  ? 213  LEU A CD1   1 
ATOM   2882 C  CD2   . LEU E 3 213 ? 56.301 38.497  38.213 1.00 41.05  ? 213  LEU A CD2   1 
ATOM   2883 N  N     . LYS E 3 214 ? 53.163 40.860  41.006 1.00 44.85  ? 214  LYS A N     1 
ATOM   2884 C  CA    . LYS E 3 214 ? 52.554 40.412  42.246 1.00 46.77  ? 214  LYS A CA    1 
ATOM   2885 C  C     . LYS E 3 214 ? 51.077 40.758  42.254 1.00 47.57  ? 214  LYS A C     1 
ATOM   2886 O  O     . LYS E 3 214 ? 50.221 39.879  42.306 1.00 47.93  ? 214  LYS A O     1 
ATOM   2887 C  CB    . LYS E 3 214 ? 53.239 41.086  43.439 1.00 46.99  ? 214  LYS A CB    1 
ATOM   2888 C  CG    . LYS E 3 214 ? 52.460 40.973  44.737 1.00 49.92  ? 214  LYS A CG    1 
ATOM   2889 C  CD    . LYS E 3 214 ? 53.184 41.652  45.893 1.00 51.96  ? 214  LYS A CD    1 
ATOM   2890 C  CE    . LYS E 3 214 ? 52.371 41.544  47.174 1.00 52.95  ? 214  LYS A CE    1 
ATOM   2891 N  NZ    . LYS E 3 214 ? 53.079 42.117  48.355 1.00 56.04  ? 214  LYS A NZ    1 
ATOM   2892 N  N     . GLY E 3 215 ? 50.789 42.051  42.200 1.00 48.50  ? 215  GLY A N     1 
ATOM   2893 C  CA    . GLY E 3 215 ? 49.412 42.504  42.216 1.00 49.12  ? 215  GLY A CA    1 
ATOM   2894 C  C     . GLY E 3 215 ? 48.521 41.797  41.220 1.00 49.56  ? 215  GLY A C     1 
ATOM   2895 O  O     . GLY E 3 215 ? 47.305 41.757  41.395 1.00 50.46  ? 215  GLY A O     1 
ATOM   2896 N  N     . MET E 3 216 ? 49.117 41.226  40.179 1.00 49.31  ? 216  MET A N     1 
ATOM   2897 C  CA    . MET E 3 216 ? 48.340 40.535  39.157 1.00 48.80  ? 216  MET A CA    1 
ATOM   2898 C  C     . MET E 3 216 ? 48.165 39.038  39.377 1.00 46.42  ? 216  MET A C     1 
ATOM   2899 O  O     . MET E 3 216 ? 47.094 38.494  39.106 1.00 46.05  ? 216  MET A O     1 
ATOM   2900 C  CB    . MET E 3 216 ? 48.965 40.753  37.783 1.00 52.12  ? 216  MET A CB    1 
ATOM   2901 C  CG    . MET E 3 216 ? 48.148 40.151  36.656 1.00 56.62  ? 216  MET A CG    1 
ATOM   2902 S  SD    . MET E 3 216 ? 46.468 40.809  36.680 1.00 64.55  ? 216  MET A SD    1 
ATOM   2903 C  CE    . MET E 3 216 ? 46.826 42.592  36.634 1.00 62.16  ? 216  MET A CE    1 
ATOM   2904 N  N     . ILE E 3 217 ? 49.210 38.370  39.857 1.00 43.66  ? 217  ILE A N     1 
ATOM   2905 C  CA    . ILE E 3 217 ? 49.144 36.926  40.071 1.00 41.31  ? 217  ILE A CA    1 
ATOM   2906 C  C     . ILE E 3 217 ? 49.413 36.453  41.501 1.00 40.44  ? 217  ILE A C     1 
ATOM   2907 O  O     . ILE E 3 217 ? 49.471 35.251  41.757 1.00 39.02  ? 217  ILE A O     1 
ATOM   2908 C  CB    . ILE E 3 217 ? 50.119 36.192  39.131 1.00 40.85  ? 217  ILE A CB    1 
ATOM   2909 C  CG1   . ILE E 3 217 ? 51.559 36.614  39.429 1.00 39.73  ? 217  ILE A CG1   1 
ATOM   2910 C  CG2   . ILE E 3 217 ? 49.776 36.508  37.687 1.00 39.50  ? 217  ILE A CG2   1 
ATOM   2911 C  CD1   . ILE E 3 217 ? 52.595 35.783  38.703 1.00 36.14  ? 217  ILE A CD1   1 
ATOM   2912 N  N     . GLY E 3 218 ? 49.565 37.388  42.432 1.00 39.84  ? 218  GLY A N     1 
ATOM   2913 C  CA    . GLY E 3 218 ? 49.822 37.010  43.810 1.00 40.40  ? 218  GLY A CA    1 
ATOM   2914 C  C     . GLY E 3 218 ? 51.308 36.971  44.115 1.00 40.12  ? 218  GLY A C     1 
ATOM   2915 O  O     . GLY E 3 218 ? 52.124 36.698  43.237 1.00 40.44  ? 218  GLY A O     1 
ATOM   2916 N  N     . GLU E 3 219 ? 51.653 37.240  45.368 1.00 39.50  ? 219  GLU A N     1 
ATOM   2917 C  CA    . GLU E 3 219 ? 53.038 37.259  45.815 1.00 40.38  ? 219  GLU A CA    1 
ATOM   2918 C  C     . GLU E 3 219 ? 53.775 35.924  45.679 1.00 39.36  ? 219  GLU A C     1 
ATOM   2919 O  O     . GLU E 3 219 ? 54.931 35.888  45.261 1.00 39.43  ? 219  GLU A O     1 
ATOM   2920 C  CB    . GLU E 3 219 ? 53.094 37.736  47.271 1.00 41.49  ? 219  GLU A CB    1 
ATOM   2921 C  CG    . GLU E 3 219 ? 54.460 37.618  47.914 1.00 47.10  ? 219  GLU A CG    1 
ATOM   2922 C  CD    . GLU E 3 219 ? 54.516 38.234  49.303 1.00 50.76  ? 219  GLU A CD    1 
ATOM   2923 O  OE1   . GLU E 3 219 ? 53.717 37.825  50.176 1.00 53.42  ? 219  GLU A OE1   1 
ATOM   2924 O  OE2   . GLU E 3 219 ? 55.366 39.125  49.520 1.00 52.18  ? 219  GLU A OE2   1 
ATOM   2925 N  N     . ALA E 3 220 ? 53.111 34.828  46.030 1.00 38.00  ? 220  ALA A N     1 
ATOM   2926 C  CA    . ALA E 3 220 ? 53.741 33.518  45.956 1.00 36.24  ? 220  ALA A CA    1 
ATOM   2927 C  C     . ALA E 3 220 ? 54.084 33.120  44.523 1.00 33.93  ? 220  ALA A C     1 
ATOM   2928 O  O     . ALA E 3 220 ? 55.228 32.771  44.229 1.00 31.95  ? 220  ALA A O     1 
ATOM   2929 C  CB    . ALA E 3 220 ? 52.838 32.469  46.594 1.00 37.24  ? 220  ALA A CB    1 
ATOM   2930 N  N     . LYS E 3 221 ? 53.098 33.172  43.632 1.00 33.02  ? 221  LYS A N     1 
ATOM   2931 C  CA    . LYS E 3 221 ? 53.330 32.805  42.240 1.00 32.54  ? 221  LYS A CA    1 
ATOM   2932 C  C     . LYS E 3 221 ? 54.371 33.703  41.586 1.00 31.36  ? 221  LYS A C     1 
ATOM   2933 O  O     . LYS E 3 221 ? 55.193 33.239  40.793 1.00 29.67  ? 221  LYS A O     1 
ATOM   2934 C  CB    . LYS E 3 221 ? 52.030 32.863  41.444 1.00 34.61  ? 221  LYS A CB    1 
ATOM   2935 C  CG    . LYS E 3 221 ? 51.586 31.506  40.939 1.00 39.04  ? 221  LYS A CG    1 
ATOM   2936 C  CD    . LYS E 3 221 ? 50.177 31.181  41.392 1.00 41.10  ? 221  LYS A CD    1 
ATOM   2937 C  CE    . LYS E 3 221 ? 49.830 29.721  41.120 1.00 44.01  ? 221  LYS A CE    1 
ATOM   2938 N  NZ    . LYS E 3 221 ? 48.540 29.329  41.780 1.00 47.28  ? 221  LYS A NZ    1 
ATOM   2939 N  N     . ALA E 3 222 ? 54.336 34.990  41.913 1.00 30.46  ? 222  ALA A N     1 
ATOM   2940 C  CA    . ALA E 3 222 ? 55.310 35.925  41.349 1.00 31.81  ? 222  ALA A CA    1 
ATOM   2941 C  C     . ALA E 3 222 ? 56.723 35.527  41.791 1.00 30.94  ? 222  ALA A C     1 
ATOM   2942 O  O     . ALA E 3 222 ? 57.644 35.434  40.972 1.00 28.78  ? 222  ALA A O     1 
ATOM   2943 C  CB    . ALA E 3 222 ? 54.995 37.353  41.806 1.00 31.16  ? 222  ALA A CB    1 
ATOM   2944 N  N     . LYS E 3 223 ? 56.887 35.286  43.091 1.00 29.90  ? 223  LYS A N     1 
ATOM   2945 C  CA    . LYS E 3 223 ? 58.187 34.901  43.621 1.00 31.82  ? 223  LYS A CA    1 
ATOM   2946 C  C     . LYS E 3 223 ? 58.633 33.558  43.057 1.00 30.51  ? 223  LYS A C     1 
ATOM   2947 O  O     . LYS E 3 223 ? 59.807 33.353  42.764 1.00 30.21  ? 223  LYS A O     1 
ATOM   2948 C  CB    . LYS E 3 223 ? 58.135 34.848  45.149 1.00 33.88  ? 223  LYS A CB    1 
ATOM   2949 C  CG    . LYS E 3 223 ? 57.916 36.218  45.767 1.00 39.92  ? 223  LYS A CG    1 
ATOM   2950 C  CD    . LYS E 3 223 ? 58.068 36.196  47.277 1.00 41.60  ? 223  LYS A CD    1 
ATOM   2951 C  CE    . LYS E 3 223 ? 58.025 37.609  47.826 1.00 44.22  ? 223  LYS A CE    1 
ATOM   2952 N  NZ    . LYS E 3 223 ? 58.133 37.632  49.312 1.00 47.55  ? 223  LYS A NZ    1 
ATOM   2953 N  N     . TYR E 3 224 ? 57.682 32.649  42.897 1.00 30.35  ? 224  TYR A N     1 
ATOM   2954 C  CA    . TYR E 3 224 ? 57.967 31.330  42.355 1.00 30.19  ? 224  TYR A CA    1 
ATOM   2955 C  C     . TYR E 3 224 ? 58.541 31.473  40.951 1.00 31.03  ? 224  TYR A C     1 
ATOM   2956 O  O     . TYR E 3 224 ? 59.612 30.952  40.645 1.00 30.63  ? 224  TYR A O     1 
ATOM   2957 C  CB    . TYR E 3 224 ? 56.673 30.516  42.314 1.00 27.59  ? 224  TYR A CB    1 
ATOM   2958 C  CG    . TYR E 3 224 ? 56.723 29.242  41.489 1.00 26.89  ? 224  TYR A CG    1 
ATOM   2959 C  CD1   . TYR E 3 224 ? 57.515 28.161  41.873 1.00 28.96  ? 224  TYR A CD1   1 
ATOM   2960 C  CD2   . TYR E 3 224 ? 55.919 29.097  40.360 1.00 28.15  ? 224  TYR A CD2   1 
ATOM   2961 C  CE1   . TYR E 3 224 ? 57.494 26.958  41.154 1.00 29.45  ? 224  TYR A CE1   1 
ATOM   2962 C  CE2   . TYR E 3 224 ? 55.893 27.911  39.643 1.00 26.69  ? 224  TYR A CE2   1 
ATOM   2963 C  CZ    . TYR E 3 224 ? 56.679 26.845  40.043 1.00 26.59  ? 224  TYR A CZ    1 
ATOM   2964 O  OH    . TYR E 3 224 ? 56.646 25.673  39.329 1.00 26.17  ? 224  TYR A OH    1 
ATOM   2965 N  N     . LEU E 3 225 ? 57.819 32.187  40.096 1.00 32.40  ? 225  LEU A N     1 
ATOM   2966 C  CA    . LEU E 3 225 ? 58.260 32.372  38.724 1.00 34.05  ? 225  LEU A CA    1 
ATOM   2967 C  C     . LEU E 3 225 ? 59.585 33.112  38.653 1.00 33.31  ? 225  LEU A C     1 
ATOM   2968 O  O     . LEU E 3 225 ? 60.455 32.758  37.868 1.00 34.29  ? 225  LEU A O     1 
ATOM   2969 C  CB    . LEU E 3 225 ? 57.191 33.114  37.921 1.00 34.20  ? 225  LEU A CB    1 
ATOM   2970 C  CG    . LEU E 3 225 ? 55.900 32.337  37.662 1.00 32.97  ? 225  LEU A CG    1 
ATOM   2971 C  CD1   . LEU E 3 225 ? 54.864 33.276  37.084 1.00 33.72  ? 225  LEU A CD1   1 
ATOM   2972 C  CD2   . LEU E 3 225 ? 56.161 31.175  36.714 1.00 33.03  ? 225  LEU A CD2   1 
ATOM   2973 N  N     . ILE E 3 226 ? 59.749 34.132  39.481 1.00 34.14  ? 226  ILE A N     1 
ATOM   2974 C  CA    . ILE E 3 226 ? 60.995 34.881  39.472 1.00 35.39  ? 226  ILE A CA    1 
ATOM   2975 C  C     . ILE E 3 226 ? 62.181 34.007  39.893 1.00 34.84  ? 226  ILE A C     1 
ATOM   2976 O  O     . ILE E 3 226 ? 63.230 34.026  39.248 1.00 34.43  ? 226  ILE A O     1 
ATOM   2977 C  CB    . ILE E 3 226 ? 60.900 36.112  40.394 1.00 36.60  ? 226  ILE A CB    1 
ATOM   2978 C  CG1   . ILE E 3 226 ? 59.955 37.143  39.762 1.00 37.66  ? 226  ILE A CG1   1 
ATOM   2979 C  CG2   . ILE E 3 226 ? 62.290 36.705  40.641 1.00 35.23  ? 226  ILE A CG2   1 
ATOM   2980 C  CD1   . ILE E 3 226 ? 59.782 38.401  40.585 1.00 39.47  ? 226  ILE A CD1   1 
ATOM   2981 N  N     . SER E 3 227 ? 62.014 33.232  40.961 1.00 33.57  ? 227  SER A N     1 
ATOM   2982 C  CA    . SER E 3 227 ? 63.103 32.384  41.427 1.00 33.37  ? 227  SER A CA    1 
ATOM   2983 C  C     . SER E 3 227 ? 63.511 31.396  40.337 1.00 31.72  ? 227  SER A C     1 
ATOM   2984 O  O     . SER E 3 227 ? 64.681 31.036  40.223 1.00 31.98  ? 227  SER A O     1 
ATOM   2985 C  CB    . SER E 3 227 ? 62.700 31.622  42.694 1.00 34.57  ? 227  SER A CB    1 
ATOM   2986 O  OG    . SER E 3 227 ? 61.872 30.519  42.370 1.00 39.12  ? 227  SER A OG    1 
ATOM   2987 N  N     . LEU E 3 228 ? 62.545 30.961  39.536 1.00 31.80  ? 228  LEU A N     1 
ATOM   2988 C  CA    . LEU E 3 228 ? 62.823 30.028  38.452 1.00 31.00  ? 228  LEU A CA    1 
ATOM   2989 C  C     . LEU E 3 228 ? 63.567 30.763  37.345 1.00 32.69  ? 228  LEU A C     1 
ATOM   2990 O  O     . LEU E 3 228 ? 64.528 30.245  36.774 1.00 32.49  ? 228  LEU A O     1 
ATOM   2991 C  CB    . LEU E 3 228 ? 61.517 29.436  37.910 1.00 30.13  ? 228  LEU A CB    1 
ATOM   2992 C  CG    . LEU E 3 228 ? 60.893 28.301  38.737 1.00 30.20  ? 228  LEU A CG    1 
ATOM   2993 C  CD1   . LEU E 3 228 ? 59.459 28.048  38.296 1.00 28.64  ? 228  LEU A CD1   1 
ATOM   2994 C  CD2   . LEU E 3 228 ? 61.742 27.028  38.576 1.00 32.30  ? 228  LEU A CD2   1 
ATOM   2995 N  N     . ALA E 3 229 ? 63.118 31.977  37.048 1.00 32.96  ? 229  ALA A N     1 
ATOM   2996 C  CA    . ALA E 3 229 ? 63.747 32.787  36.013 1.00 35.26  ? 229  ALA A CA    1 
ATOM   2997 C  C     . ALA E 3 229 ? 65.212 33.011  36.380 1.00 35.01  ? 229  ALA A C     1 
ATOM   2998 O  O     . ALA E 3 229 ? 66.092 32.980  35.520 1.00 34.65  ? 229  ALA A O     1 
ATOM   2999 C  CB    . ALA E 3 229 ? 63.021 34.135  35.882 1.00 34.10  ? 229  ALA A CB    1 
ATOM   3000 N  N     . ARG E 3 230 ? 65.462 33.220  37.669 1.00 34.86  ? 230  ARG A N     1 
ATOM   3001 C  CA    . ARG E 3 230 ? 66.813 33.456  38.160 1.00 35.61  ? 230  ARG A CA    1 
ATOM   3002 C  C     . ARG E 3 230 ? 67.584 32.167  38.326 1.00 36.68  ? 230  ARG A C     1 
ATOM   3003 O  O     . ARG E 3 230 ? 68.733 32.181  38.776 1.00 35.01  ? 230  ARG A O     1 
ATOM   3004 C  CB    . ARG E 3 230 ? 66.770 34.156  39.509 1.00 37.94  ? 230  ARG A CB    1 
ATOM   3005 C  CG    . ARG E 3 230 ? 66.282 35.578  39.469 1.00 40.17  ? 230  ARG A CG    1 
ATOM   3006 C  CD    . ARG E 3 230 ? 66.206 36.120  40.878 1.00 43.13  ? 230  ARG A CD    1 
ATOM   3007 N  NE    . ARG E 3 230 ? 65.800 37.516  40.887 1.00 46.70  ? 230  ARG A NE    1 
ATOM   3008 C  CZ    . ARG E 3 230 ? 65.445 38.178  41.980 1.00 49.10  ? 230  ARG A CZ    1 
ATOM   3009 N  NH1   . ARG E 3 230 ? 65.442 37.569  43.162 1.00 48.30  ? 230  ARG A NH1   1 
ATOM   3010 N  NH2   . ARG E 3 230 ? 65.093 39.452  41.887 1.00 52.49  ? 230  ARG A NH2   1 
ATOM   3011 N  N     . ASP E 3 231 ? 66.955 31.050  37.973 1.00 37.00  ? 231  ASP A N     1 
ATOM   3012 C  CA    . ASP E 3 231 ? 67.600 29.756  38.119 1.00 37.09  ? 231  ASP A CA    1 
ATOM   3013 C  C     . ASP E 3 231 ? 68.020 29.624  39.581 1.00 36.35  ? 231  ASP A C     1 
ATOM   3014 O  O     . ASP E 3 231 ? 69.142 29.238  39.881 1.00 35.69  ? 231  ASP A O     1 
ATOM   3015 C  CB    . ASP E 3 231 ? 68.825 29.667  37.200 1.00 39.20  ? 231  ASP A CB    1 
ATOM   3016 C  CG    . ASP E 3 231 ? 69.416 28.265  37.134 1.00 42.57  ? 231  ASP A CG    1 
ATOM   3017 O  OD1   . ASP E 3 231 ? 68.808 27.324  37.693 1.00 43.21  ? 231  ASP A OD1   1 
ATOM   3018 O  OD2   . ASP E 3 231 ? 70.490 28.103  36.510 1.00 43.67  ? 231  ASP A OD2   1 
ATOM   3019 N  N     . GLU E 3 232 ? 67.108 29.967  40.485 1.00 36.47  ? 232  GLU A N     1 
ATOM   3020 C  CA    . GLU E 3 232 ? 67.370 29.881  41.916 1.00 38.19  ? 232  GLU A CA    1 
ATOM   3021 C  C     . GLU E 3 232 ? 66.433 28.919  42.655 1.00 38.51  ? 232  GLU A C     1 
ATOM   3022 O  O     . GLU E 3 232 ? 66.623 28.652  43.843 1.00 39.23  ? 232  GLU A O     1 
ATOM   3023 C  CB    . GLU E 3 232 ? 67.275 31.269  42.549 1.00 39.85  ? 232  GLU A CB    1 
ATOM   3024 C  CG    . GLU E 3 232 ? 68.574 32.058  42.515 1.00 42.54  ? 232  GLU A CG    1 
ATOM   3025 C  CD    . GLU E 3 232 ? 68.411 33.467  43.053 1.00 43.78  ? 232  GLU A CD    1 
ATOM   3026 O  OE1   . GLU E 3 232 ? 67.541 33.666  43.930 1.00 41.87  ? 232  GLU A OE1   1 
ATOM   3027 O  OE2   . GLU E 3 232 ? 69.160 34.368  42.605 1.00 44.16  ? 232  GLU A OE2   1 
ATOM   3028 N  N     . TYR E 3 233 ? 65.420 28.406  41.961 1.00 37.96  ? 233  TYR A N     1 
ATOM   3029 C  CA    . TYR E 3 233 ? 64.473 27.479  42.576 1.00 35.20  ? 233  TYR A CA    1 
ATOM   3030 C  C     . TYR E 3 233 ? 65.207 26.202  42.982 1.00 35.89  ? 233  TYR A C     1 
ATOM   3031 O  O     . TYR E 3 233 ? 65.859 25.572  42.153 1.00 35.29  ? 233  TYR A O     1 
ATOM   3032 C  CB    . TYR E 3 233 ? 63.360 27.132  41.585 1.00 34.94  ? 233  TYR A CB    1 
ATOM   3033 C  CG    . TYR E 3 233 ? 62.327 26.179  42.140 1.00 32.90  ? 233  TYR A CG    1 
ATOM   3034 C  CD1   . TYR E 3 233 ? 61.195 26.654  42.800 1.00 30.79  ? 233  TYR A CD1   1 
ATOM   3035 C  CD2   . TYR E 3 233 ? 62.496 24.799  42.027 1.00 32.72  ? 233  TYR A CD2   1 
ATOM   3036 C  CE1   . TYR E 3 233 ? 60.259 25.780  43.336 1.00 30.69  ? 233  TYR A CE1   1 
ATOM   3037 C  CE2   . TYR E 3 233 ? 61.563 23.913  42.557 1.00 32.29  ? 233  TYR A CE2   1 
ATOM   3038 C  CZ    . TYR E 3 233 ? 60.450 24.411  43.209 1.00 32.09  ? 233  TYR A CZ    1 
ATOM   3039 O  OH    . TYR E 3 233 ? 59.530 23.540  43.734 1.00 34.80  ? 233  TYR A OH    1 
ATOM   3040 N  N     . ASN E 3 234 ? 65.093 25.807  44.246 1.00 36.88  ? 234  ASN A N     1 
ATOM   3041 C  CA    . ASN E 3 234 ? 65.772 24.598  44.717 1.00 38.12  ? 234  ASN A CA    1 
ATOM   3042 C  C     . ASN E 3 234 ? 65.030 23.932  45.898 1.00 38.41  ? 234  ASN A C     1 
ATOM   3043 O  O     . ASN E 3 234 ? 65.659 23.466  46.850 1.00 39.01  ? 234  ASN A O     1 
ATOM   3044 C  CB    . ASN E 3 234 ? 67.206 24.972  45.123 1.00 38.92  ? 234  ASN A CB    1 
ATOM   3045 C  CG    . ASN E 3 234 ? 68.176 23.819  45.057 1.00 41.60  ? 234  ASN A CG    1 
ATOM   3046 O  OD1   . ASN E 3 234 ? 68.892 23.527  46.023 1.00 41.51  ? 234  ASN A OD1   1 
ATOM   3047 N  ND2   . ASN E 3 234 ? 68.236 23.174  43.901 1.00 40.43  ? 234  ASN A ND2   1 
ATOM   3048 N  N     . GLU E 3 235 ? 63.701 23.876  45.833 1.00 37.31  ? 235  GLU A N     1 
ATOM   3049 C  CA    . GLU E 3 235 ? 62.924 23.262  46.913 1.00 37.65  ? 235  GLU A CA    1 
ATOM   3050 C  C     . GLU E 3 235 ? 63.330 21.816  47.161 1.00 35.43  ? 235  GLU A C     1 
ATOM   3051 O  O     . GLU E 3 235 ? 63.437 21.018  46.236 1.00 34.17  ? 235  GLU A O     1 
ATOM   3052 C  CB    . GLU E 3 235 ? 61.424 23.335  46.617 1.00 38.29  ? 235  GLU A CB    1 
ATOM   3053 C  CG    . GLU E 3 235 ? 60.869 24.752  46.665 1.00 43.26  ? 235  GLU A CG    1 
ATOM   3054 C  CD    . GLU E 3 235 ? 61.119 25.443  48.006 1.00 45.85  ? 235  GLU A CD    1 
ATOM   3055 O  OE1   . GLU E 3 235 ? 60.499 25.042  49.015 1.00 48.57  ? 235  GLU A OE1   1 
ATOM   3056 O  OE2   . GLU E 3 235 ? 61.942 26.385  48.054 1.00 46.29  ? 235  GLU A OE2   1 
ATOM   3057 N  N     . PRO E 3 236 ? 63.544 21.457  48.429 1.00 34.61  ? 236  PRO A N     1 
ATOM   3058 C  CA    . PRO E 3 236 ? 63.944 20.094  48.771 1.00 35.02  ? 236  PRO A CA    1 
ATOM   3059 C  C     . PRO E 3 236 ? 62.853 19.069  48.496 1.00 35.36  ? 236  PRO A C     1 
ATOM   3060 O  O     . PRO E 3 236 ? 61.666 19.399  48.443 1.00 32.03  ? 236  PRO A O     1 
ATOM   3061 C  CB    . PRO E 3 236 ? 64.257 20.198  50.255 1.00 36.92  ? 236  PRO A CB    1 
ATOM   3062 C  CG    . PRO E 3 236 ? 63.207 21.168  50.726 1.00 37.46  ? 236  PRO A CG    1 
ATOM   3063 C  CD    . PRO E 3 236 ? 63.250 22.240  49.643 1.00 36.61  ? 236  PRO A CD    1 
ATOM   3064 N  N     . ILE E 3 237 ? 63.276 17.827  48.308 1.00 35.24  ? 237  ILE A N     1 
ATOM   3065 C  CA    . ILE E 3 237 ? 62.355 16.731  48.075 1.00 38.27  ? 237  ILE A CA    1 
ATOM   3066 C  C     . ILE E 3 237 ? 61.976 16.241  49.468 1.00 40.45  ? 237  ILE A C     1 
ATOM   3067 O  O     . ILE E 3 237 ? 62.843 15.813  50.222 1.00 42.37  ? 237  ILE A O     1 
ATOM   3068 C  CB    . ILE E 3 237 ? 63.039 15.592  47.292 1.00 35.95  ? 237  ILE A CB    1 
ATOM   3069 C  CG1   . ILE E 3 237 ? 62.994 15.881  45.787 1.00 36.58  ? 237  ILE A CG1   1 
ATOM   3070 C  CG2   . ILE E 3 237 ? 62.363 14.276  47.594 1.00 36.92  ? 237  ILE A CG2   1 
ATOM   3071 C  CD1   . ILE E 3 237 ? 63.698 17.146  45.371 1.00 34.24  ? 237  ILE A CD1   1 
ATOM   3072 N  N     . ARG E 3 238 ? 60.699 16.315  49.825 1.00 41.21  ? 238  ARG A N     1 
ATOM   3073 C  CA    . ARG E 3 238 ? 60.303 15.866  51.154 1.00 44.53  ? 238  ARG A CA    1 
ATOM   3074 C  C     . ARG E 3 238 ? 59.125 14.901  51.192 1.00 42.77  ? 238  ARG A C     1 
ATOM   3075 O  O     . ARG E 3 238 ? 58.236 14.934  50.339 1.00 41.51  ? 238  ARG A O     1 
ATOM   3076 C  CB    . ARG E 3 238 ? 59.992 17.070  52.040 1.00 50.02  ? 238  ARG A CB    1 
ATOM   3077 C  CG    . ARG E 3 238 ? 58.868 17.936  51.513 1.00 56.93  ? 238  ARG A CG    1 
ATOM   3078 C  CD    . ARG E 3 238 ? 58.528 19.048  52.493 1.00 64.15  ? 238  ARG A CD    1 
ATOM   3079 N  NE    . ARG E 3 238 ? 59.618 20.009  52.642 1.00 68.44  ? 238  ARG A NE    1 
ATOM   3080 C  CZ    . ARG E 3 238 ? 59.575 21.063  53.453 1.00 72.10  ? 238  ARG A CZ    1 
ATOM   3081 N  NH1   . ARG E 3 238 ? 60.612 21.890  53.524 1.00 72.66  ? 238  ARG A NH1   1 
ATOM   3082 N  NH2   . ARG E 3 238 ? 58.497 21.288  54.198 1.00 72.83  ? 238  ARG A NH2   1 
ATOM   3083 N  N     . THR E 3 239 ? 59.137 14.042  52.204 1.00 40.55  ? 239  THR A N     1 
ATOM   3084 C  CA    . THR E 3 239 ? 58.097 13.046  52.417 1.00 39.84  ? 239  THR A CA    1 
ATOM   3085 C  C     . THR E 3 239 ? 56.748 13.740  52.507 1.00 39.06  ? 239  THR A C     1 
ATOM   3086 O  O     . THR E 3 239 ? 56.590 14.674  53.282 1.00 37.70  ? 239  THR A O     1 
ATOM   3087 C  CB    . THR E 3 239 ? 58.350 12.291  53.734 1.00 40.27  ? 239  THR A CB    1 
ATOM   3088 O  OG1   . THR E 3 239 ? 59.612 11.617  53.655 1.00 42.75  ? 239  THR A OG1   1 
ATOM   3089 C  CG2   . THR E 3 239 ? 57.246 11.280  54.002 1.00 39.72  ? 239  THR A CG2   1 
ATOM   3090 N  N     . ARG E 3 240 ? 55.767 13.310  51.725 1.00 38.61  ? 240  ARG A N     1 
ATOM   3091 C  CA    . ARG E 3 240 ? 54.491 13.982  51.835 1.00 40.57  ? 240  ARG A CA    1 
ATOM   3092 C  C     . ARG E 3 240 ? 53.593 13.378  52.887 1.00 39.52  ? 240  ARG A C     1 
ATOM   3093 O  O     . ARG E 3 240 ? 53.455 12.164  53.006 1.00 39.53  ? 240  ARG A O     1 
ATOM   3094 C  CB    . ARG E 3 240 ? 53.765 14.059  50.492 1.00 44.15  ? 240  ARG A CB    1 
ATOM   3095 C  CG    . ARG E 3 240 ? 54.219 15.264  49.679 1.00 49.43  ? 240  ARG A CG    1 
ATOM   3096 C  CD    . ARG E 3 240 ? 53.242 15.649  48.588 1.00 51.33  ? 240  ARG A CD    1 
ATOM   3097 N  NE    . ARG E 3 240 ? 53.896 16.527  47.622 1.00 55.29  ? 240  ARG A NE    1 
ATOM   3098 C  CZ    . ARG E 3 240 ? 53.310 17.030  46.540 1.00 57.03  ? 240  ARG A CZ    1 
ATOM   3099 N  NH1   . ARG E 3 240 ? 52.035 16.749  46.274 1.00 57.09  ? 240  ARG A NH1   1 
ATOM   3100 N  NH2   . ARG E 3 240 ? 54.009 17.798  45.712 1.00 56.21  ? 240  ARG A NH2   1 
ATOM   3101 N  N     . VAL E 3 241 ? 53.006 14.267  53.670 1.00 39.11  ? 241  VAL A N     1 
ATOM   3102 C  CA    . VAL E 3 241 ? 52.103 13.897  54.740 1.00 40.16  ? 241  VAL A CA    1 
ATOM   3103 C  C     . VAL E 3 241 ? 50.750 14.432  54.309 1.00 38.58  ? 241  VAL A C     1 
ATOM   3104 O  O     . VAL E 3 241 ? 50.578 15.646  54.178 1.00 37.78  ? 241  VAL A O     1 
ATOM   3105 C  CB    . VAL E 3 241 ? 52.521 14.586  56.058 1.00 40.70  ? 241  VAL A CB    1 
ATOM   3106 C  CG1   . VAL E 3 241 ? 51.623 14.127  57.200 1.00 41.92  ? 241  VAL A CG1   1 
ATOM   3107 C  CG2   . VAL E 3 241 ? 53.984 14.290  56.353 1.00 40.20  ? 241  VAL A CG2   1 
ATOM   3108 N  N     . ARG E 3 242 ? 49.801 13.536  54.063 1.00 39.08  ? 242  ARG A N     1 
ATOM   3109 C  CA    . ARG E 3 242 ? 48.473 13.968  53.647 1.00 40.11  ? 242  ARG A CA    1 
ATOM   3110 C  C     . ARG E 3 242 ? 47.929 14.950  54.682 1.00 38.08  ? 242  ARG A C     1 
ATOM   3111 O  O     . ARG E 3 242 ? 48.004 14.697  55.883 1.00 36.41  ? 242  ARG A O     1 
ATOM   3112 C  CB    . ARG E 3 242 ? 47.540 12.767  53.507 1.00 43.82  ? 242  ARG A CB    1 
ATOM   3113 C  CG    . ARG E 3 242 ? 46.395 13.026  52.545 1.00 52.70  ? 242  ARG A CG    1 
ATOM   3114 C  CD    . ARG E 3 242 ? 45.484 11.823  52.425 1.00 58.14  ? 242  ARG A CD    1 
ATOM   3115 N  NE    . ARG E 3 242 ? 44.454 12.014  51.407 1.00 62.47  ? 242  ARG A NE    1 
ATOM   3116 C  CZ    . ARG E 3 242 ? 43.502 11.125  51.139 1.00 64.87  ? 242  ARG A CZ    1 
ATOM   3117 N  NH1   . ARG E 3 242 ? 43.451 9.986   51.820 1.00 66.55  ? 242  ARG A NH1   1 
ATOM   3118 N  NH2   . ARG E 3 242 ? 42.606 11.371  50.189 1.00 66.96  ? 242  ARG A NH2   1 
ATOM   3119 N  N     . LYS E 3 243 ? 47.396 16.075  54.216 1.00 37.23  ? 243  LYS A N     1 
ATOM   3120 C  CA    . LYS E 3 243 ? 46.878 17.096  55.116 1.00 37.33  ? 243  LYS A CA    1 
ATOM   3121 C  C     . LYS E 3 243 ? 45.361 17.096  55.287 1.00 35.83  ? 243  LYS A C     1 
ATOM   3122 O  O     . LYS E 3 243 ? 44.830 17.721  56.213 1.00 34.36  ? 243  LYS A O     1 
ATOM   3123 C  CB    . LYS E 3 243 ? 47.354 18.473  54.656 1.00 38.52  ? 243  LYS A CB    1 
ATOM   3124 C  CG    . LYS E 3 243 ? 48.870 18.635  54.679 1.00 42.78  ? 243  LYS A CG    1 
ATOM   3125 C  CD    . LYS E 3 243 ? 49.429 18.457  56.081 1.00 45.53  ? 243  LYS A CD    1 
ATOM   3126 C  CE    . LYS E 3 243 ? 50.953 18.622  56.124 1.00 48.35  ? 243  LYS A CE    1 
ATOM   3127 N  NZ    . LYS E 3 243 ? 51.495 18.411  57.514 1.00 47.45  ? 243  LYS A NZ    1 
ATOM   3128 N  N     . SER E 3 244 ? 44.655 16.412  54.398 1.00 33.44  ? 244  SER A N     1 
ATOM   3129 C  CA    . SER E 3 244 ? 43.214 16.342  54.533 1.00 32.12  ? 244  SER A CA    1 
ATOM   3130 C  C     . SER E 3 244 ? 42.681 15.086  53.882 1.00 31.11  ? 244  SER A C     1 
ATOM   3131 O  O     . SER E 3 244 ? 43.219 14.601  52.888 1.00 31.33  ? 244  SER A O     1 
ATOM   3132 C  CB    . SER E 3 244 ? 42.541 17.587  53.942 1.00 32.71  ? 244  SER A CB    1 
ATOM   3133 O  OG    . SER E 3 244 ? 42.568 17.591  52.535 1.00 34.96  ? 244  SER A OG    1 
ATOM   3134 N  N     . ILE E 3 245 ? 41.622 14.552  54.464 1.00 29.28  ? 245  ILE A N     1 
ATOM   3135 C  CA    . ILE E 3 245 ? 41.014 13.346  53.955 1.00 29.81  ? 245  ILE A CA    1 
ATOM   3136 C  C     . ILE E 3 245 ? 39.518 13.566  53.939 1.00 30.39  ? 245  ILE A C     1 
ATOM   3137 O  O     . ILE E 3 245 ? 38.928 13.954  54.946 1.00 28.64  ? 245  ILE A O     1 
ATOM   3138 C  CB    . ILE E 3 245 ? 41.366 12.149  54.849 1.00 30.70  ? 245  ILE A CB    1 
ATOM   3139 C  CG1   . ILE E 3 245 ? 42.846 11.806  54.669 1.00 32.60  ? 245  ILE A CG1   1 
ATOM   3140 C  CG2   . ILE E 3 245 ? 40.477 10.960  54.529 1.00 28.03  ? 245  ILE A CG2   1 
ATOM   3141 C  CD1   . ILE E 3 245 ? 43.289 10.562  55.432 1.00 37.10  ? 245  ILE A CD1   1 
ATOM   3142 N  N     . GLY E 3 246 ? 38.908 13.333  52.786 1.00 29.72  ? 246  GLY A N     1 
ATOM   3143 C  CA    . GLY E 3 246 ? 37.482 13.532  52.677 1.00 32.33  ? 246  GLY A CA    1 
ATOM   3144 C  C     . GLY E 3 246 ? 36.841 12.726  51.573 1.00 33.72  ? 246  GLY A C     1 
ATOM   3145 O  O     . GLY E 3 246 ? 37.493 11.923  50.904 1.00 32.11  ? 246  GLY A O     1 
ATOM   3146 N  N     . ARG E 3 247 ? 35.549 12.961  51.390 1.00 33.95  ? 247  ARG A N     1 
ATOM   3147 C  CA    . ARG E 3 247 ? 34.756 12.275  50.390 1.00 36.49  ? 247  ARG A CA    1 
ATOM   3148 C  C     . ARG E 3 247 ? 33.616 13.207  50.016 1.00 37.74  ? 247  ARG A C     1 
ATOM   3149 O  O     . ARG E 3 247 ? 32.997 13.815  50.883 1.00 36.20  ? 247  ARG A O     1 
ATOM   3150 C  CB    . ARG E 3 247 ? 34.183 10.987  50.972 1.00 37.70  ? 247  ARG A CB    1 
ATOM   3151 C  CG    . ARG E 3 247 ? 33.332 10.191  50.006 1.00 44.00  ? 247  ARG A CG    1 
ATOM   3152 C  CD    . ARG E 3 247 ? 34.195 9.393   49.038 1.00 47.09  ? 247  ARG A CD    1 
ATOM   3153 N  NE    . ARG E 3 247 ? 33.397 8.401   48.324 1.00 49.25  ? 247  ARG A NE    1 
ATOM   3154 C  CZ    . ARG E 3 247 ? 32.699 8.643   47.219 1.00 51.31  ? 247  ARG A CZ    1 
ATOM   3155 N  NH1   . ARG E 3 247 ? 32.700 9.854   46.672 1.00 52.00  ? 247  ARG A NH1   1 
ATOM   3156 N  NH2   . ARG E 3 247 ? 31.978 7.675   46.669 1.00 51.90  ? 247  ARG A NH2   1 
ATOM   3157 N  N     . ILE E 3 248 ? 33.343 13.322  48.725 1.00 38.67  ? 248  ILE A N     1 
ATOM   3158 C  CA    . ILE E 3 248 ? 32.272 14.189  48.259 1.00 40.77  ? 248  ILE A CA    1 
ATOM   3159 C  C     . ILE E 3 248 ? 31.527 13.417  47.168 1.00 41.81  ? 248  ILE A C     1 
ATOM   3160 O  O     . ILE E 3 248 ? 32.117 12.999  46.169 1.00 41.15  ? 248  ILE A O     1 
ATOM   3161 C  CB    . ILE E 3 248 ? 32.865 15.534  47.733 1.00 41.80  ? 248  ILE A CB    1 
ATOM   3162 C  CG1   . ILE E 3 248 ? 31.756 16.556  47.498 1.00 43.50  ? 248  ILE A CG1   1 
ATOM   3163 C  CG2   . ILE E 3 248 ? 33.668 15.297  46.468 1.00 43.85  ? 248  ILE A CG2   1 
ATOM   3164 C  CD1   . ILE E 3 248 ? 30.757 16.150  46.461 1.00 46.94  ? 248  ILE A CD1   1 
ATOM   3165 N  N     . VAL E 3 249 ? 30.228 13.219  47.369 1.00 42.51  ? 249  VAL A N     1 
ATOM   3166 C  CA    . VAL E 3 249 ? 29.427 12.460  46.421 1.00 43.35  ? 249  VAL A CA    1 
ATOM   3167 C  C     . VAL E 3 249 ? 28.280 13.226  45.756 1.00 44.74  ? 249  VAL A C     1 
ATOM   3168 O  O     . VAL E 3 249 ? 27.680 14.119  46.349 1.00 45.04  ? 249  VAL A O     1 
ATOM   3169 C  CB    . VAL E 3 249 ? 28.846 11.211  47.110 1.00 43.31  ? 249  VAL A CB    1 
ATOM   3170 C  CG1   . VAL E 3 249 ? 29.973 10.370  47.677 1.00 42.06  ? 249  VAL A CG1   1 
ATOM   3171 C  CG2   . VAL E 3 249 ? 27.887 11.622  48.215 1.00 41.41  ? 249  VAL A CG2   1 
ATOM   3172 N  N     . THR E 3 250 ? 27.983 12.859  44.515 1.00 45.82  ? 250  THR A N     1 
ATOM   3173 C  CA    . THR E 3 250 ? 26.903 13.478  43.760 1.00 46.82  ? 250  THR A CA    1 
ATOM   3174 C  C     . THR E 3 250 ? 25.590 12.842  44.198 1.00 47.60  ? 250  THR A C     1 
ATOM   3175 O  O     . THR E 3 250 ? 25.501 11.620  44.325 1.00 47.36  ? 250  THR A O     1 
ATOM   3176 C  CB    . THR E 3 250 ? 27.081 13.246  42.248 1.00 47.51  ? 250  THR A CB    1 
ATOM   3177 O  OG1   . THR E 3 250 ? 28.326 13.808  41.823 1.00 47.03  ? 250  THR A OG1   1 
ATOM   3178 C  CG2   . THR E 3 250 ? 25.948 13.902  41.466 1.00 49.63  ? 250  THR A CG2   1 
ATOM   3179 N  N     . MET E 3 251 ? 24.575 13.667  44.434 1.00 48.47  ? 251  MET A N     1 
ATOM   3180 C  CA    . MET E 3 251 ? 23.270 13.169  44.860 1.00 50.45  ? 251  MET A CA    1 
ATOM   3181 C  C     . MET E 3 251 ? 22.403 12.850  43.646 1.00 52.21  ? 251  MET A C     1 
ATOM   3182 O  O     . MET E 3 251 ? 22.495 13.528  42.625 1.00 51.44  ? 251  MET A O     1 
ATOM   3183 C  CB    . MET E 3 251 ? 22.567 14.211  45.729 1.00 47.98  ? 251  MET A CB    1 
ATOM   3184 C  CG    . MET E 3 251 ? 23.409 14.706  46.888 1.00 47.46  ? 251  MET A CG    1 
ATOM   3185 S  SD    . MET E 3 251 ? 22.537 15.881  47.933 1.00 45.00  ? 251  MET A SD    1 
ATOM   3186 C  CE    . MET E 3 251 ? 22.440 17.275  46.847 1.00 43.30  ? 251  MET A CE    1 
ATOM   3187 N  N     . LYS E 3 252 ? 21.562 11.823  43.768 1.00 55.93  ? 252  LYS A N     1 
ATOM   3188 C  CA    . LYS E 3 252 ? 20.678 11.403  42.676 1.00 58.95  ? 252  LYS A CA    1 
ATOM   3189 C  C     . LYS E 3 252 ? 20.008 12.593  42.001 1.00 59.17  ? 252  LYS A C     1 
ATOM   3190 O  O     . LYS E 3 252 ? 19.736 12.562  40.801 1.00 59.60  ? 252  LYS A O     1 
ATOM   3191 C  CB    . LYS E 3 252 ? 19.614 10.432  43.194 1.00 60.98  ? 252  LYS A CB    1 
ATOM   3192 C  CG    . LYS E 3 252 ? 18.536 10.081  42.178 1.00 64.72  ? 252  LYS A CG    1 
ATOM   3193 C  CD    . LYS E 3 252 ? 19.114 9.490   40.897 1.00 67.64  ? 252  LYS A CD    1 
ATOM   3194 C  CE    . LYS E 3 252 ? 17.999 9.142   39.911 1.00 69.46  ? 252  LYS A CE    1 
ATOM   3195 N  NZ    . LYS E 3 252 ? 18.517 8.530   38.653 1.00 70.32  ? 252  LYS A NZ    1 
ATOM   3196 N  N     . ARG E 3 253 ? 19.738 13.637  42.779 1.00 59.61  ? 253  ARG A N     1 
ATOM   3197 C  CA    . ARG E 3 253 ? 19.135 14.849  42.240 1.00 59.51  ? 253  ARG A CA    1 
ATOM   3198 C  C     . ARG E 3 253 ? 19.411 16.010  43.189 1.00 57.73  ? 253  ARG A C     1 
ATOM   3199 O  O     . ARG E 3 253 ? 19.529 15.814  44.398 1.00 56.87  ? 253  ARG A O     1 
ATOM   3200 C  CB    . ARG E 3 253 ? 17.624 14.668  42.036 1.00 62.33  ? 253  ARG A CB    1 
ATOM   3201 C  CG    . ARG E 3 253 ? 16.759 14.861  43.271 1.00 66.60  ? 253  ARG A CG    1 
ATOM   3202 C  CD    . ARG E 3 253 ? 15.306 15.065  42.852 1.00 71.59  ? 253  ARG A CD    1 
ATOM   3203 N  NE    . ARG E 3 253 ? 14.544 15.833  43.835 1.00 76.33  ? 253  ARG A NE    1 
ATOM   3204 C  CZ    . ARG E 3 253 ? 13.991 15.321  44.930 1.00 78.01  ? 253  ARG A CZ    1 
ATOM   3205 N  NH1   . ARG E 3 253 ? 14.102 14.026  45.192 1.00 78.73  ? 253  ARG A NH1   1 
ATOM   3206 N  NH2   . ARG E 3 253 ? 13.333 16.111  45.771 1.00 79.90  ? 253  ARG A NH2   1 
ATOM   3207 N  N     . ASN E 3 254 ? 19.533 17.212  42.633 1.00 56.03  ? 254  ASN A N     1 
ATOM   3208 C  CA    . ASN E 3 254 ? 19.799 18.405  43.430 1.00 55.95  ? 254  ASN A CA    1 
ATOM   3209 C  C     . ASN E 3 254 ? 18.732 18.586  44.496 1.00 54.62  ? 254  ASN A C     1 
ATOM   3210 O  O     . ASN E 3 254 ? 17.618 18.072  44.367 1.00 54.16  ? 254  ASN A O     1 
ATOM   3211 C  CB    . ASN E 3 254 ? 19.840 19.646  42.541 1.00 56.55  ? 254  ASN A CB    1 
ATOM   3212 C  CG    . ASN E 3 254 ? 20.864 19.531  41.441 1.00 57.62  ? 254  ASN A CG    1 
ATOM   3213 O  OD1   . ASN E 3 254 ? 20.858 18.569  40.682 1.00 58.45  ? 254  ASN A OD1   1 
ATOM   3214 N  ND2   . ASN E 3 254 ? 21.750 20.515  41.342 1.00 59.70  ? 254  ASN A ND2   1 
ATOM   3215 N  N     . SER E 3 255 ? 19.075 19.331  45.541 1.00 53.12  ? 255  SER A N     1 
ATOM   3216 C  CA    . SER E 3 255 ? 18.151 19.558  46.641 1.00 53.76  ? 255  SER A CA    1 
ATOM   3217 C  C     . SER E 3 255 ? 18.722 20.470  47.713 1.00 52.88  ? 255  SER A C     1 
ATOM   3218 O  O     . SER E 3 255 ? 19.934 20.644  47.824 1.00 53.57  ? 255  SER A O     1 
ATOM   3219 C  CB    . SER E 3 255 ? 17.782 18.217  47.283 1.00 54.72  ? 255  SER A CB    1 
ATOM   3220 O  OG    . SER E 3 255 ? 17.166 18.396  48.545 1.00 55.81  ? 255  SER A OG    1 
ATOM   3221 N  N     . ARG E 3 256 ? 17.836 21.069  48.494 1.00 51.74  ? 256  ARG A N     1 
ATOM   3222 C  CA    . ARG E 3 256 ? 18.271 21.909  49.586 1.00 51.51  ? 256  ARG A CA    1 
ATOM   3223 C  C     . ARG E 3 256 ? 17.377 21.572  50.760 1.00 50.64  ? 256  ARG A C     1 
ATOM   3224 O  O     . ARG E 3 256 ? 17.106 22.393  51.632 1.00 50.39  ? 256  ARG A O     1 
ATOM   3225 C  CB    . ARG E 3 256 ? 18.229 23.392  49.206 1.00 53.63  ? 256  ARG A CB    1 
ATOM   3226 C  CG    . ARG E 3 256 ? 16.886 23.997  48.910 1.00 55.68  ? 256  ARG A CG    1 
ATOM   3227 C  CD    . ARG E 3 256 ? 17.114 25.344  48.235 1.00 56.70  ? 256  ARG A CD    1 
ATOM   3228 N  NE    . ARG E 3 256 ? 18.371 25.964  48.659 1.00 58.72  ? 256  ARG A NE    1 
ATOM   3229 C  CZ    . ARG E 3 256 ? 18.537 26.674  49.773 1.00 59.48  ? 256  ARG A CZ    1 
ATOM   3230 N  NH1   . ARG E 3 256 ? 17.523 26.874  50.603 1.00 60.18  ? 256  ARG A NH1   1 
ATOM   3231 N  NH2   . ARG E 3 256 ? 19.725 27.187  50.058 1.00 58.76  ? 256  ARG A NH2   1 
ATOM   3232 N  N     . ASN E 3 257 ? 16.927 20.321  50.751 1.00 49.65  ? 257  ASN A N     1 
ATOM   3233 C  CA    . ASN E 3 257 ? 16.094 19.761  51.803 1.00 49.31  ? 257  ASN A CA    1 
ATOM   3234 C  C     . ASN E 3 257 ? 17.042 18.985  52.712 1.00 48.09  ? 257  ASN A C     1 
ATOM   3235 O  O     . ASN E 3 257 ? 17.551 17.926  52.337 1.00 47.32  ? 257  ASN A O     1 
ATOM   3236 C  CB    . ASN E 3 257 ? 15.046 18.812  51.213 1.00 49.77  ? 257  ASN A CB    1 
ATOM   3237 C  CG    . ASN E 3 257 ? 14.384 17.947  52.273 1.00 51.18  ? 257  ASN A CG    1 
ATOM   3238 O  OD1   . ASN E 3 257 ? 14.998 17.030  52.820 1.00 51.15  ? 257  ASN A OD1   1 
ATOM   3239 N  ND2   . ASN E 3 257 ? 13.129 18.242  52.575 1.00 53.26  ? 257  ASN A ND2   1 
ATOM   3240 N  N     . LEU E 3 258 ? 17.274 19.521  53.904 1.00 46.87  ? 258  LEU A N     1 
ATOM   3241 C  CA    . LEU E 3 258 ? 18.176 18.907  54.866 1.00 47.27  ? 258  LEU A CA    1 
ATOM   3242 C  C     . LEU E 3 258 ? 18.042 17.390  55.014 1.00 48.06  ? 258  LEU A C     1 
ATOM   3243 O  O     . LEU E 3 258 ? 19.013 16.656  54.841 1.00 46.82  ? 258  LEU A O     1 
ATOM   3244 C  CB    . LEU E 3 258 ? 18.001 19.572  56.231 1.00 45.72  ? 258  LEU A CB    1 
ATOM   3245 C  CG    . LEU E 3 258 ? 18.969 19.119  57.323 1.00 46.03  ? 258  LEU A CG    1 
ATOM   3246 C  CD1   . LEU E 3 258 ? 20.398 19.249  56.828 1.00 43.20  ? 258  LEU A CD1   1 
ATOM   3247 C  CD2   . LEU E 3 258 ? 18.756 19.963  58.572 1.00 45.47  ? 258  LEU A CD2   1 
ATOM   3248 N  N     . GLU E 3 259 ? 16.842 16.924  55.337 1.00 49.55  ? 259  GLU A N     1 
ATOM   3249 C  CA    . GLU E 3 259 ? 16.605 15.500  55.526 1.00 50.12  ? 259  GLU A CA    1 
ATOM   3250 C  C     . GLU E 3 259 ? 16.968 14.660  54.313 1.00 49.74  ? 259  GLU A C     1 
ATOM   3251 O  O     . GLU E 3 259 ? 17.379 13.507  54.449 1.00 50.01  ? 259  GLU A O     1 
ATOM   3252 C  CB    . GLU E 3 259 ? 15.140 15.252  55.900 1.00 51.84  ? 259  GLU A CB    1 
ATOM   3253 C  CG    . GLU E 3 259 ? 14.769 15.724  57.301 1.00 54.28  ? 259  GLU A CG    1 
ATOM   3254 C  CD    . GLU E 3 259 ? 15.595 15.045  58.383 1.00 56.45  ? 259  GLU A CD    1 
ATOM   3255 O  OE1   . GLU E 3 259 ? 15.598 13.795  58.435 1.00 57.07  ? 259  GLU A OE1   1 
ATOM   3256 O  OE2   . GLU E 3 259 ? 16.240 15.760  59.183 1.00 57.42  ? 259  GLU A OE2   1 
ATOM   3257 N  N     . GLU E 3 260 ? 16.819 15.234  53.127 1.00 49.12  ? 260  GLU A N     1 
ATOM   3258 C  CA    . GLU E 3 260 ? 17.127 14.511  51.901 1.00 49.42  ? 260  GLU A CA    1 
ATOM   3259 C  C     . GLU E 3 260 ? 18.627 14.478  51.592 1.00 47.66  ? 260  GLU A C     1 
ATOM   3260 O  O     . GLU E 3 260 ? 19.105 13.577  50.904 1.00 47.92  ? 260  GLU A O     1 
ATOM   3261 C  CB    . GLU E 3 260 ? 16.368 15.130  50.722 1.00 50.82  ? 260  GLU A CB    1 
ATOM   3262 C  CG    . GLU E 3 260 ? 16.693 14.488  49.385 1.00 53.41  ? 260  GLU A CG    1 
ATOM   3263 C  CD    . GLU E 3 260 ? 15.855 15.036  48.245 1.00 56.62  ? 260  GLU A CD    1 
ATOM   3264 O  OE1   . GLU E 3 260 ? 15.806 16.272  48.064 1.00 58.74  ? 260  GLU A OE1   1 
ATOM   3265 O  OE2   . GLU E 3 260 ? 15.248 14.225  47.519 1.00 58.27  ? 260  GLU A OE2   1 
ATOM   3266 N  N     . ILE E 3 261 ? 19.360 15.461  52.105 1.00 45.15  ? 261  ILE A N     1 
ATOM   3267 C  CA    . ILE E 3 261 ? 20.800 15.554  51.880 1.00 42.89  ? 261  ILE A CA    1 
ATOM   3268 C  C     . ILE E 3 261 ? 21.584 14.753  52.914 1.00 43.54  ? 261  ILE A C     1 
ATOM   3269 O  O     . ILE E 3 261 ? 22.619 14.156  52.599 1.00 42.32  ? 261  ILE A O     1 
ATOM   3270 C  CB    . ILE E 3 261 ? 21.277 17.025  51.946 1.00 41.60  ? 261  ILE A CB    1 
ATOM   3271 C  CG1   . ILE E 3 261 ? 20.595 17.843  50.851 1.00 41.25  ? 261  ILE A CG1   1 
ATOM   3272 C  CG2   . ILE E 3 261 ? 22.785 17.098  51.787 1.00 39.75  ? 261  ILE A CG2   1 
ATOM   3273 C  CD1   . ILE E 3 261 ? 20.925 19.318  50.900 1.00 42.30  ? 261  ILE A CD1   1 
ATOM   3274 N  N     . LYS E 3 262 ? 21.077 14.745  54.145 1.00 43.53  ? 262  LYS A N     1 
ATOM   3275 C  CA    . LYS E 3 262 ? 21.720 14.045  55.249 1.00 45.44  ? 262  LYS A CA    1 
ATOM   3276 C  C     . LYS E 3 262 ? 22.311 12.672  54.913 1.00 45.72  ? 262  LYS A C     1 
ATOM   3277 O  O     . LYS E 3 262 ? 23.507 12.456  55.091 1.00 45.41  ? 262  LYS A O     1 
ATOM   3278 C  CB    . LYS E 3 262 ? 20.749 13.906  56.423 1.00 44.74  ? 262  LYS A CB    1 
ATOM   3279 C  CG    . LYS E 3 262 ? 20.599 15.157  57.269 1.00 45.20  ? 262  LYS A CG    1 
ATOM   3280 C  CD    . LYS E 3 262 ? 19.747 14.847  58.489 1.00 44.87  ? 262  LYS A CD    1 
ATOM   3281 C  CE    . LYS E 3 262 ? 19.643 16.024  59.425 1.00 45.38  ? 262  LYS A CE    1 
ATOM   3282 N  NZ    . LYS E 3 262 ? 18.966 15.619  60.691 1.00 47.03  ? 262  LYS A NZ    1 
ATOM   3283 N  N     . PRO E 3 263 ? 21.485 11.727  54.431 1.00 45.96  ? 263  PRO A N     1 
ATOM   3284 C  CA    . PRO E 3 263 ? 22.004 10.394  54.098 1.00 46.56  ? 263  PRO A CA    1 
ATOM   3285 C  C     . PRO E 3 263 ? 23.339 10.439  53.359 1.00 45.44  ? 263  PRO A C     1 
ATOM   3286 O  O     . PRO E 3 263 ? 24.268 9.713   53.709 1.00 46.40  ? 263  PRO A O     1 
ATOM   3287 C  CB    . PRO E 3 263 ? 20.886 9.792   53.250 1.00 47.54  ? 263  PRO A CB    1 
ATOM   3288 C  CG    . PRO E 3 263 ? 19.659 10.381  53.887 1.00 48.76  ? 263  PRO A CG    1 
ATOM   3289 C  CD    . PRO E 3 263 ? 20.057 11.836  54.076 1.00 46.96  ? 263  PRO A CD    1 
ATOM   3290 N  N     . TYR E 3 264 ? 23.428 11.297  52.346 1.00 43.38  ? 264  TYR A N     1 
ATOM   3291 C  CA    . TYR E 3 264 ? 24.652 11.444  51.565 1.00 42.72  ? 264  TYR A CA    1 
ATOM   3292 C  C     . TYR E 3 264 ? 25.766 11.992  52.446 1.00 41.13  ? 264  TYR A C     1 
ATOM   3293 O  O     . TYR E 3 264 ? 26.872 11.451  52.472 1.00 39.00  ? 264  TYR A O     1 
ATOM   3294 C  CB    . TYR E 3 264 ? 24.431 12.405  50.399 1.00 45.52  ? 264  TYR A CB    1 
ATOM   3295 C  CG    . TYR E 3 264 ? 23.442 11.925  49.368 1.00 49.60  ? 264  TYR A CG    1 
ATOM   3296 C  CD1   . TYR E 3 264 ? 23.754 10.871  48.511 1.00 52.08  ? 264  TYR A CD1   1 
ATOM   3297 C  CD2   . TYR E 3 264 ? 22.200 12.544  49.228 1.00 51.45  ? 264  TYR A CD2   1 
ATOM   3298 C  CE1   . TYR E 3 264 ? 22.855 10.447  47.535 1.00 54.25  ? 264  TYR A CE1   1 
ATOM   3299 C  CE2   . TYR E 3 264 ? 21.293 12.128  48.260 1.00 52.93  ? 264  TYR A CE2   1 
ATOM   3300 C  CZ    . TYR E 3 264 ? 21.626 11.081  47.417 1.00 54.26  ? 264  TYR A CZ    1 
ATOM   3301 O  OH    . TYR E 3 264 ? 20.730 10.667  46.458 1.00 56.14  ? 264  TYR A OH    1 
ATOM   3302 N  N     . LEU E 3 265 ? 25.466 13.072  53.161 1.00 38.89  ? 265  LEU A N     1 
ATOM   3303 C  CA    . LEU E 3 265 ? 26.437 13.695  54.044 1.00 38.65  ? 265  LEU A CA    1 
ATOM   3304 C  C     . LEU E 3 265 ? 26.994 12.680  55.030 1.00 39.45  ? 265  LEU A C     1 
ATOM   3305 O  O     . LEU E 3 265 ? 28.200 12.650  55.294 1.00 40.32  ? 265  LEU A O     1 
ATOM   3306 C  CB    . LEU E 3 265 ? 25.798 14.851  54.821 1.00 36.86  ? 265  LEU A CB    1 
ATOM   3307 C  CG    . LEU E 3 265 ? 26.743 15.537  55.820 1.00 36.36  ? 265  LEU A CG    1 
ATOM   3308 C  CD1   . LEU E 3 265 ? 27.941 16.119  55.082 1.00 34.30  ? 265  LEU A CD1   1 
ATOM   3309 C  CD2   . LEU E 3 265 ? 26.005 16.635  56.574 1.00 34.86  ? 265  LEU A CD2   1 
ATOM   3310 N  N     . PHE E 3 266 ? 26.109 11.847  55.569 1.00 39.09  ? 266  PHE A N     1 
ATOM   3311 C  CA    . PHE E 3 266 ? 26.500 10.834  56.534 1.00 40.25  ? 266  PHE A CA    1 
ATOM   3312 C  C     . PHE E 3 266 ? 27.288 9.704   55.878 1.00 40.12  ? 266  PHE A C     1 
ATOM   3313 O  O     . PHE E 3 266 ? 28.156 9.095   56.501 1.00 38.54  ? 266  PHE A O     1 
ATOM   3314 C  CB    . PHE E 3 266 ? 25.259 10.287  57.247 1.00 41.33  ? 266  PHE A CB    1 
ATOM   3315 C  CG    . PHE E 3 266 ? 24.558 11.301  58.116 1.00 42.19  ? 266  PHE A CG    1 
ATOM   3316 C  CD1   . PHE E 3 266 ? 25.238 12.415  58.606 1.00 41.86  ? 266  PHE A CD1   1 
ATOM   3317 C  CD2   . PHE E 3 266 ? 23.232 11.112  58.492 1.00 43.19  ? 266  PHE A CD2   1 
ATOM   3318 C  CE1   . PHE E 3 266 ? 24.610 13.322  59.461 1.00 41.51  ? 266  PHE A CE1   1 
ATOM   3319 C  CE2   . PHE E 3 266 ? 22.595 12.014  59.348 1.00 42.90  ? 266  PHE A CE2   1 
ATOM   3320 C  CZ    . PHE E 3 266 ? 23.284 13.119  59.833 1.00 41.39  ? 266  PHE A CZ    1 
ATOM   3321 N  N     . ARG E 3 267 ? 26.983 9.431   54.615 1.00 41.18  ? 267  ARG A N     1 
ATOM   3322 C  CA    . ARG E 3 267 ? 27.690 8.400   53.864 1.00 41.96  ? 267  ARG A CA    1 
ATOM   3323 C  C     . ARG E 3 267 ? 29.122 8.910   53.673 1.00 39.84  ? 267  ARG A C     1 
ATOM   3324 O  O     . ARG E 3 267 ? 30.095 8.173   53.836 1.00 38.21  ? 267  ARG A O     1 
ATOM   3325 C  CB    . ARG E 3 267 ? 27.017 8.202   52.502 1.00 44.89  ? 267  ARG A CB    1 
ATOM   3326 C  CG    . ARG E 3 267 ? 27.563 7.055   51.662 1.00 50.70  ? 267  ARG A CG    1 
ATOM   3327 C  CD    . ARG E 3 267 ? 26.823 6.992   50.325 1.00 56.69  ? 267  ARG A CD    1 
ATOM   3328 N  NE    . ARG E 3 267 ? 25.377 7.123   50.522 1.00 61.58  ? 267  ARG A NE    1 
ATOM   3329 C  CZ    . ARG E 3 267 ? 24.498 7.354   49.550 1.00 62.04  ? 267  ARG A CZ    1 
ATOM   3330 N  NH1   . ARG E 3 267 ? 24.907 7.480   48.294 1.00 62.15  ? 267  ARG A NH1   1 
ATOM   3331 N  NH2   . ARG E 3 267 ? 23.208 7.475   49.840 1.00 62.94  ? 267  ARG A NH2   1 
ATOM   3332 N  N     . ALA E 3 268 ? 29.231 10.191  53.337 1.00 37.22  ? 268  ALA A N     1 
ATOM   3333 C  CA    . ALA E 3 268 ? 30.524 10.827  53.125 1.00 35.22  ? 268  ALA A CA    1 
ATOM   3334 C  C     . ALA E 3 268 ? 31.352 10.797  54.401 1.00 33.24  ? 268  ALA A C     1 
ATOM   3335 O  O     . ALA E 3 268 ? 32.570 10.626  54.354 1.00 30.93  ? 268  ALA A O     1 
ATOM   3336 C  CB    . ALA E 3 268 ? 30.327 12.263  52.668 1.00 34.78  ? 268  ALA A CB    1 
ATOM   3337 N  N     . ILE E 3 269 ? 30.690 10.965  55.541 1.00 33.28  ? 269  ILE A N     1 
ATOM   3338 C  CA    . ILE E 3 269 ? 31.392 10.961  56.817 1.00 35.16  ? 269  ILE A CA    1 
ATOM   3339 C  C     . ILE E 3 269 ? 31.911 9.568   57.117 1.00 36.48  ? 269  ILE A C     1 
ATOM   3340 O  O     . ILE E 3 269 ? 33.042 9.402   57.570 1.00 35.58  ? 269  ILE A O     1 
ATOM   3341 C  CB    . ILE E 3 269 ? 30.479 11.411  57.982 1.00 34.79  ? 269  ILE A CB    1 
ATOM   3342 C  CG1   . ILE E 3 269 ? 30.121 12.889  57.823 1.00 35.30  ? 269  ILE A CG1   1 
ATOM   3343 C  CG2   . ILE E 3 269 ? 31.183 11.183  59.324 1.00 31.44  ? 269  ILE A CG2   1 
ATOM   3344 C  CD1   . ILE E 3 269 ? 29.207 13.423  58.927 1.00 35.93  ? 269  ILE A CD1   1 
ATOM   3345 N  N     . GLU E 3 270 ? 31.079 8.569   56.858 1.00 37.28  ? 270  GLU A N     1 
ATOM   3346 C  CA    . GLU E 3 270 ? 31.459 7.190   57.107 1.00 39.21  ? 270  GLU A CA    1 
ATOM   3347 C  C     . GLU E 3 270 ? 32.690 6.794   56.306 1.00 38.51  ? 270  GLU A C     1 
ATOM   3348 O  O     . GLU E 3 270 ? 33.652 6.275   56.863 1.00 39.48  ? 270  GLU A O     1 
ATOM   3349 C  CB    . GLU E 3 270 ? 30.291 6.256   56.781 1.00 40.18  ? 270  GLU A CB    1 
ATOM   3350 C  CG    . GLU E 3 270 ? 29.227 6.241   57.860 1.00 42.25  ? 270  GLU A CG    1 
ATOM   3351 C  CD    . GLU E 3 270 ? 29.801 5.834   59.198 1.00 44.02  ? 270  GLU A CD    1 
ATOM   3352 O  OE1   . GLU E 3 270 ? 30.493 4.795   59.239 1.00 47.32  ? 270  GLU A OE1   1 
ATOM   3353 O  OE2   . GLU E 3 270 ? 29.568 6.539   60.204 1.00 43.15  ? 270  GLU A OE2   1 
ATOM   3354 N  N     . GLU E 3 271 ? 32.664 7.047   55.004 1.00 38.47  ? 271  GLU A N     1 
ATOM   3355 C  CA    . GLU E 3 271 ? 33.796 6.702   54.154 1.00 39.12  ? 271  GLU A CA    1 
ATOM   3356 C  C     . GLU E 3 271 ? 35.056 7.470   54.538 1.00 38.76  ? 271  GLU A C     1 
ATOM   3357 O  O     . GLU E 3 271 ? 36.154 6.905   54.550 1.00 37.77  ? 271  GLU A O     1 
ATOM   3358 C  CB    . GLU E 3 271 ? 33.447 6.943   52.682 1.00 39.45  ? 271  GLU A CB    1 
ATOM   3359 C  CG    . GLU E 3 271 ? 32.624 5.817   52.061 1.00 43.87  ? 271  GLU A CG    1 
ATOM   3360 C  CD    . GLU E 3 271 ? 32.270 6.063   50.605 1.00 46.09  ? 271  GLU A CD    1 
ATOM   3361 O  OE1   . GLU E 3 271 ? 33.148 6.537   49.852 1.00 47.95  ? 271  GLU A OE1   1 
ATOM   3362 O  OE2   . GLU E 3 271 ? 31.117 5.771   50.210 1.00 47.79  ? 271  GLU A OE2   1 
ATOM   3363 N  N     . SER E 3 272 ? 34.903 8.751   54.865 1.00 38.05  ? 272  SER A N     1 
ATOM   3364 C  CA    . SER E 3 272 ? 36.052 9.562   55.244 1.00 38.43  ? 272  SER A CA    1 
ATOM   3365 C  C     . SER E 3 272 ? 36.748 8.994   56.474 1.00 40.31  ? 272  SER A C     1 
ATOM   3366 O  O     . SER E 3 272 ? 37.971 8.870   56.501 1.00 39.90  ? 272  SER A O     1 
ATOM   3367 C  CB    . SER E 3 272 ? 35.631 11.006  55.526 1.00 38.45  ? 272  SER A CB    1 
ATOM   3368 O  OG    . SER E 3 272 ? 35.141 11.636  54.356 1.00 37.80  ? 272  SER A OG    1 
ATOM   3369 N  N     . TYR E 3 273 ? 35.974 8.650   57.495 1.00 41.72  ? 273  TYR A N     1 
ATOM   3370 C  CA    . TYR E 3 273 ? 36.562 8.108   58.710 1.00 44.18  ? 273  TYR A CA    1 
ATOM   3371 C  C     . TYR E 3 273 ? 37.329 6.826   58.460 1.00 46.42  ? 273  TYR A C     1 
ATOM   3372 O  O     . TYR E 3 273 ? 38.373 6.595   59.067 1.00 46.58  ? 273  TYR A O     1 
ATOM   3373 C  CB    . TYR E 3 273 ? 35.485 7.896   59.765 1.00 44.94  ? 273  TYR A CB    1 
ATOM   3374 C  CG    . TYR E 3 273 ? 35.505 8.996   60.778 1.00 44.50  ? 273  TYR A CG    1 
ATOM   3375 C  CD1   . TYR E 3 273 ? 36.193 8.848   61.979 1.00 44.30  ? 273  TYR A CD1   1 
ATOM   3376 C  CD2   . TYR E 3 273 ? 34.919 10.224  60.499 1.00 45.36  ? 273  TYR A CD2   1 
ATOM   3377 C  CE1   . TYR E 3 273 ? 36.299 9.898   62.877 1.00 43.80  ? 273  TYR A CE1   1 
ATOM   3378 C  CE2   . TYR E 3 273 ? 35.022 11.282  61.388 1.00 45.89  ? 273  TYR A CE2   1 
ATOM   3379 C  CZ    . TYR E 3 273 ? 35.714 11.114  62.572 1.00 45.19  ? 273  TYR A CZ    1 
ATOM   3380 O  OH    . TYR E 3 273 ? 35.824 12.174  63.440 1.00 48.57  ? 273  TYR A OH    1 
ATOM   3381 N  N     . TYR E 3 274 ? 36.813 5.991   57.568 1.00 48.37  ? 274  TYR A N     1 
ATOM   3382 C  CA    . TYR E 3 274 ? 37.493 4.751   57.225 1.00 50.72  ? 274  TYR A CA    1 
ATOM   3383 C  C     . TYR E 3 274 ? 38.874 5.133   56.683 1.00 49.78  ? 274  TYR A C     1 
ATOM   3384 O  O     . TYR E 3 274 ? 39.890 4.597   57.126 1.00 48.86  ? 274  TYR A O     1 
ATOM   3385 C  CB    . TYR E 3 274 ? 36.688 3.995   56.166 1.00 55.62  ? 274  TYR A CB    1 
ATOM   3386 C  CG    . TYR E 3 274 ? 37.383 2.786   55.576 1.00 61.62  ? 274  TYR A CG    1 
ATOM   3387 C  CD1   . TYR E 3 274 ? 37.669 1.662   56.358 1.00 63.35  ? 274  TYR A CD1   1 
ATOM   3388 C  CD2   . TYR E 3 274 ? 37.749 2.763   54.228 1.00 62.86  ? 274  TYR A CD2   1 
ATOM   3389 C  CE1   . TYR E 3 274 ? 38.303 0.540   55.807 1.00 65.37  ? 274  TYR A CE1   1 
ATOM   3390 C  CE2   . TYR E 3 274 ? 38.381 1.653   53.669 1.00 65.83  ? 274  TYR A CE2   1 
ATOM   3391 C  CZ    . TYR E 3 274 ? 38.655 0.544   54.461 1.00 66.55  ? 274  TYR A CZ    1 
ATOM   3392 O  OH    . TYR E 3 274 ? 39.276 -0.552  53.903 1.00 67.71  ? 274  TYR A OH    1 
ATOM   3393 N  N     . LYS E 3 275 ? 38.903 6.078   55.742 1.00 48.11  ? 275  LYS A N     1 
ATOM   3394 C  CA    . LYS E 3 275 ? 40.155 6.544   55.142 1.00 45.93  ? 275  LYS A CA    1 
ATOM   3395 C  C     . LYS E 3 275 ? 41.108 7.144   56.171 1.00 44.71  ? 275  LYS A C     1 
ATOM   3396 O  O     . LYS E 3 275 ? 42.321 7.009   56.042 1.00 44.25  ? 275  LYS A O     1 
ATOM   3397 C  CB    . LYS E 3 275 ? 39.897 7.618   54.087 1.00 46.72  ? 275  LYS A CB    1 
ATOM   3398 C  CG    . LYS E 3 275 ? 39.193 7.194   52.811 1.00 49.71  ? 275  LYS A CG    1 
ATOM   3399 C  CD    . LYS E 3 275 ? 39.093 8.425   51.898 1.00 51.63  ? 275  LYS A CD    1 
ATOM   3400 C  CE    . LYS E 3 275 ? 38.517 8.139   50.517 1.00 52.98  ? 275  LYS A CE    1 
ATOM   3401 N  NZ    . LYS E 3 275 ? 38.519 9.395   49.692 1.00 49.93  ? 275  LYS A NZ    1 
ATOM   3402 N  N     . LEU E 3 276 ? 40.561 7.834   57.172 1.00 43.92  ? 276  LEU A N     1 
ATOM   3403 C  CA    . LEU E 3 276 ? 41.378 8.462   58.205 1.00 44.06  ? 276  LEU A CA    1 
ATOM   3404 C  C     . LEU E 3 276 ? 42.256 7.444   58.894 1.00 46.32  ? 276  LEU A C     1 
ATOM   3405 O  O     . LEU E 3 276 ? 43.315 7.779   59.428 1.00 46.74  ? 276  LEU A O     1 
ATOM   3406 C  CB    . LEU E 3 276 ? 40.504 9.136   59.257 1.00 42.65  ? 276  LEU A CB    1 
ATOM   3407 C  CG    . LEU E 3 276 ? 39.808 10.435  58.870 1.00 43.14  ? 276  LEU A CG    1 
ATOM   3408 C  CD1   . LEU E 3 276 ? 38.870 10.851  59.989 1.00 45.91  ? 276  LEU A CD1   1 
ATOM   3409 C  CD2   . LEU E 3 276 ? 40.843 11.509  58.600 1.00 41.38  ? 276  LEU A CD2   1 
ATOM   3410 N  N     . ASP E 3 277 ? 41.807 6.196   58.877 1.00 48.91  ? 277  ASP A N     1 
ATOM   3411 C  CA    . ASP E 3 277 ? 42.534 5.115   59.515 1.00 51.37  ? 277  ASP A CA    1 
ATOM   3412 C  C     . ASP E 3 277 ? 42.643 5.440   61.003 1.00 52.09  ? 277  ASP A C     1 
ATOM   3413 O  O     . ASP E 3 277 ? 41.638 5.514   61.704 1.00 51.78  ? 277  ASP A O     1 
ATOM   3414 C  CB    . ASP E 3 277 ? 43.931 4.976   58.910 1.00 53.43  ? 277  ASP A CB    1 
ATOM   3415 C  CG    . ASP E 3 277 ? 44.402 3.538   58.867 1.00 57.38  ? 277  ASP A CG    1 
ATOM   3416 O  OD1   . ASP E 3 277 ? 44.018 2.759   59.770 1.00 56.96  ? 277  ASP A OD1   1 
ATOM   3417 O  OD2   . ASP E 3 277 ? 45.159 3.191   57.935 1.00 58.83  ? 277  ASP A OD2   1 
ATOM   3418 N  N     . LYS E 3 278 ? 43.861 5.661   61.480 1.00 52.80  ? 278  LYS A N     1 
ATOM   3419 C  CA    . LYS E 3 278 ? 44.063 5.965   62.889 1.00 52.91  ? 278  LYS A CA    1 
ATOM   3420 C  C     . LYS E 3 278 ? 44.241 7.455   63.152 1.00 51.46  ? 278  LYS A C     1 
ATOM   3421 O  O     . LYS E 3 278 ? 44.468 7.870   64.290 1.00 51.23  ? 278  LYS A O     1 
ATOM   3422 C  CB    . LYS E 3 278 ? 45.271 5.190   63.420 1.00 56.67  ? 278  LYS A CB    1 
ATOM   3423 C  CG    . LYS E 3 278 ? 45.114 3.676   63.309 1.00 61.24  ? 278  LYS A CG    1 
ATOM   3424 C  CD    . LYS E 3 278 ? 46.271 2.936   63.965 1.00 65.06  ? 278  LYS A CD    1 
ATOM   3425 C  CE    . LYS E 3 278 ? 46.087 1.426   63.867 1.00 67.43  ? 278  LYS A CE    1 
ATOM   3426 N  NZ    . LYS E 3 278 ? 47.207 0.689   64.526 1.00 68.84  ? 278  LYS A NZ    1 
ATOM   3427 N  N     . ARG E 3 279 ? 44.131 8.262   62.102 1.00 48.58  ? 279  ARG A N     1 
ATOM   3428 C  CA    . ARG E 3 279 ? 44.281 9.704   62.253 1.00 45.02  ? 279  ARG A CA    1 
ATOM   3429 C  C     . ARG E 3 279 ? 43.087 10.348  62.956 1.00 42.12  ? 279  ARG A C     1 
ATOM   3430 O  O     . ARG E 3 279 ? 41.942 9.931   62.773 1.00 41.19  ? 279  ARG A O     1 
ATOM   3431 C  CB    . ARG E 3 279 ? 44.501 10.350  60.880 1.00 45.92  ? 279  ARG A CB    1 
ATOM   3432 C  CG    . ARG E 3 279 ? 45.959 10.329  60.438 1.00 47.93  ? 279  ARG A CG    1 
ATOM   3433 C  CD    . ARG E 3 279 ? 46.118 10.522  58.940 1.00 47.56  ? 279  ARG A CD    1 
ATOM   3434 N  NE    . ARG E 3 279 ? 45.581 9.379   58.217 1.00 50.25  ? 279  ARG A NE    1 
ATOM   3435 C  CZ    . ARG E 3 279 ? 45.970 9.016   57.002 1.00 49.42  ? 279  ARG A CZ    1 
ATOM   3436 N  NH1   . ARG E 3 279 ? 46.905 9.716   56.373 1.00 49.82  ? 279  ARG A NH1   1 
ATOM   3437 N  NH2   . ARG E 3 279 ? 45.432 7.948   56.426 1.00 49.58  ? 279  ARG A NH2   1 
ATOM   3438 N  N     . ILE E 3 280 ? 43.369 11.359  63.774 1.00 39.74  ? 280  ILE A N     1 
ATOM   3439 C  CA    . ILE E 3 280 ? 42.325 12.082  64.499 1.00 38.39  ? 280  ILE A CA    1 
ATOM   3440 C  C     . ILE E 3 280 ? 42.346 13.542  64.059 1.00 35.42  ? 280  ILE A C     1 
ATOM   3441 O  O     . ILE E 3 280 ? 43.296 14.268  64.332 1.00 36.03  ? 280  ILE A O     1 
ATOM   3442 C  CB    . ILE E 3 280 ? 42.535 12.029  66.032 1.00 38.13  ? 280  ILE A CB    1 
ATOM   3443 C  CG1   . ILE E 3 280 ? 42.641 10.577  66.500 1.00 39.59  ? 280  ILE A CG1   1 
ATOM   3444 C  CG2   . ILE E 3 280 ? 41.365 12.703  66.736 1.00 35.32  ? 280  ILE A CG2   1 
ATOM   3445 C  CD1   . ILE E 3 280 ? 41.418 9.742   66.168 1.00 41.77  ? 280  ILE A CD1   1 
ATOM   3446 N  N     . PRO E 3 281 ? 41.293 13.986  63.366 1.00 33.09  ? 281  PRO A N     1 
ATOM   3447 C  CA    . PRO E 3 281 ? 41.220 15.367  62.893 1.00 32.03  ? 281  PRO A CA    1 
ATOM   3448 C  C     . PRO E 3 281 ? 40.653 16.346  63.913 1.00 31.41  ? 281  PRO A C     1 
ATOM   3449 O  O     . PRO E 3 281 ? 39.822 15.985  64.738 1.00 30.18  ? 281  PRO A O     1 
ATOM   3450 C  CB    . PRO E 3 281 ? 40.338 15.251  61.661 1.00 31.78  ? 281  PRO A CB    1 
ATOM   3451 C  CG    . PRO E 3 281 ? 39.341 14.209  62.094 1.00 32.82  ? 281  PRO A CG    1 
ATOM   3452 C  CD    . PRO E 3 281 ? 40.203 13.173  62.796 1.00 31.91  ? 281  PRO A CD    1 
ATOM   3453 N  N     . LYS E 3 282 ? 41.122 17.586  63.850 1.00 30.63  ? 282  LYS A N     1 
ATOM   3454 C  CA    . LYS E 3 282 ? 40.643 18.624  64.744 1.00 31.54  ? 282  LYS A CA    1 
ATOM   3455 C  C     . LYS E 3 282 ? 39.793 19.593  63.939 1.00 30.38  ? 282  LYS A C     1 
ATOM   3456 O  O     . LYS E 3 282 ? 39.174 20.500  64.490 1.00 32.88  ? 282  LYS A O     1 
ATOM   3457 C  CB    . LYS E 3 282 ? 41.816 19.359  65.409 1.00 30.77  ? 282  LYS A CB    1 
ATOM   3458 C  CG    . LYS E 3 282 ? 42.570 18.494  66.428 1.00 37.35  ? 282  LYS A CG    1 
ATOM   3459 C  CD    . LYS E 3 282 ? 43.420 19.322  67.402 1.00 39.82  ? 282  LYS A CD    1 
ATOM   3460 C  CE    . LYS E 3 282 ? 44.572 20.021  66.693 1.00 43.54  ? 282  LYS A CE    1 
ATOM   3461 N  NZ    . LYS E 3 282 ? 45.451 19.043  65.977 1.00 46.50  ? 282  LYS A NZ    1 
ATOM   3462 N  N     . ALA E 3 283 ? 39.753 19.390  62.628 1.00 29.39  ? 283  ALA A N     1 
ATOM   3463 C  CA    . ALA E 3 283 ? 38.977 20.264  61.764 1.00 27.84  ? 283  ALA A CA    1 
ATOM   3464 C  C     . ALA E 3 283 ? 38.084 19.495  60.809 1.00 26.56  ? 283  ALA A C     1 
ATOM   3465 O  O     . ALA E 3 283 ? 38.428 18.401  60.357 1.00 24.95  ? 283  ALA A O     1 
ATOM   3466 C  CB    . ALA E 3 283 ? 39.909 21.181  60.978 1.00 29.85  ? 283  ALA A CB    1 
ATOM   3467 N  N     . ILE E 3 284 ? 36.931 20.080  60.505 1.00 25.77  ? 284  ILE A N     1 
ATOM   3468 C  CA    . ILE E 3 284 ? 35.984 19.473  59.591 1.00 25.87  ? 284  ILE A CA    1 
ATOM   3469 C  C     . ILE E 3 284 ? 35.388 20.552  58.705 1.00 28.26  ? 284  ILE A C     1 
ATOM   3470 O  O     . ILE E 3 284 ? 35.077 21.645  59.176 1.00 27.99  ? 284  ILE A O     1 
ATOM   3471 C  CB    . ILE E 3 284 ? 34.838 18.764  60.344 1.00 25.43  ? 284  ILE A CB    1 
ATOM   3472 C  CG1   . ILE E 3 284 ? 33.826 18.195  59.344 1.00 26.66  ? 284  ILE A CG1   1 
ATOM   3473 C  CG2   . ILE E 3 284 ? 34.132 19.752  61.276 1.00 26.81  ? 284  ILE A CG2   1 
ATOM   3474 C  CD1   . ILE E 3 284 ? 32.672 17.415  59.988 1.00 25.84  ? 284  ILE A CD1   1 
ATOM   3475 N  N     . HIS E 3 285 ? 35.265 20.249  57.414 1.00 29.51  ? 285  HIS A N     1 
ATOM   3476 C  CA    . HIS E 3 285 ? 34.666 21.169  56.456 1.00 29.96  ? 285  HIS A CA    1 
ATOM   3477 C  C     . HIS E 3 285 ? 33.577 20.435  55.698 1.00 28.56  ? 285  HIS A C     1 
ATOM   3478 O  O     . HIS E 3 285 ? 33.786 19.312  55.247 1.00 29.23  ? 285  HIS A O     1 
ATOM   3479 C  CB    . HIS E 3 285 ? 35.688 21.679  55.437 1.00 32.12  ? 285  HIS A CB    1 
ATOM   3480 C  CG    . HIS E 3 285 ? 36.695 22.629  56.001 1.00 34.98  ? 285  HIS A CG    1 
ATOM   3481 N  ND1   . HIS E 3 285 ? 37.634 22.249  56.936 1.00 35.82  ? 285  HIS A ND1   1 
ATOM   3482 C  CD2   . HIS E 3 285 ? 36.908 23.945  55.769 1.00 36.47  ? 285  HIS A CD2   1 
ATOM   3483 C  CE1   . HIS E 3 285 ? 38.382 23.289  57.254 1.00 37.46  ? 285  HIS A CE1   1 
ATOM   3484 N  NE2   . HIS E 3 285 ? 37.962 24.332  56.561 1.00 37.05  ? 285  HIS A NE2   1 
ATOM   3485 N  N     . VAL E 3 286 ? 32.409 21.058  55.577 1.00 29.53  ? 286  VAL A N     1 
ATOM   3486 C  CA    . VAL E 3 286 ? 31.322 20.472  54.806 1.00 27.24  ? 286  VAL A CA    1 
ATOM   3487 C  C     . VAL E 3 286 ? 31.414 21.185  53.467 1.00 28.91  ? 286  VAL A C     1 
ATOM   3488 O  O     . VAL E 3 286 ? 31.374 22.419  53.403 1.00 29.26  ? 286  VAL A O     1 
ATOM   3489 C  CB    . VAL E 3 286 ? 29.932 20.727  55.439 1.00 25.18  ? 286  VAL A CB    1 
ATOM   3490 C  CG1   . VAL E 3 286 ? 28.833 20.376  54.444 1.00 22.99  ? 286  VAL A CG1   1 
ATOM   3491 C  CG2   . VAL E 3 286 ? 29.763 19.865  56.683 1.00 24.27  ? 286  VAL A CG2   1 
ATOM   3492 N  N     . VAL E 3 287 ? 31.567 20.406  52.402 1.00 29.95  ? 287  VAL A N     1 
ATOM   3493 C  CA    . VAL E 3 287 ? 31.691 20.962  51.061 1.00 31.34  ? 287  VAL A CA    1 
ATOM   3494 C  C     . VAL E 3 287 ? 30.483 20.646  50.194 1.00 32.39  ? 287  VAL A C     1 
ATOM   3495 O  O     . VAL E 3 287 ? 30.059 19.491  50.068 1.00 30.49  ? 287  VAL A O     1 
ATOM   3496 C  CB    . VAL E 3 287 ? 32.958 20.434  50.350 1.00 32.64  ? 287  VAL A CB    1 
ATOM   3497 C  CG1   . VAL E 3 287 ? 33.028 20.986  48.928 1.00 31.60  ? 287  VAL A CG1   1 
ATOM   3498 C  CG2   . VAL E 3 287 ? 34.196 20.823  51.142 1.00 32.24  ? 287  VAL A CG2   1 
ATOM   3499 N  N     . ALA E 3 288 ? 29.938 21.695  49.596 1.00 33.52  ? 288  ALA A N     1 
ATOM   3500 C  CA    . ALA E 3 288 ? 28.784 21.573  48.734 1.00 35.67  ? 288  ALA A CA    1 
ATOM   3501 C  C     . ALA E 3 288 ? 29.129 22.081  47.342 1.00 35.70  ? 288  ALA A C     1 
ATOM   3502 O  O     . ALA E 3 288 ? 29.769 23.116  47.187 1.00 34.70  ? 288  ALA A O     1 
ATOM   3503 C  CB    . ALA E 3 288 ? 27.614 22.384  49.306 1.00 34.74  ? 288  ALA A CB    1 
ATOM   3504 N  N     . VAL E 3 289 ? 28.726 21.323  46.335 1.00 37.38  ? 289  VAL A N     1 
ATOM   3505 C  CA    . VAL E 3 289 ? 28.928 21.723  44.958 1.00 39.32  ? 289  VAL A CA    1 
ATOM   3506 C  C     . VAL E 3 289 ? 27.513 22.083  44.525 1.00 41.41  ? 289  VAL A C     1 
ATOM   3507 O  O     . VAL E 3 289 ? 26.637 21.219  44.444 1.00 40.84  ? 289  VAL A O     1 
ATOM   3508 C  CB    . VAL E 3 289 ? 29.455 20.568  44.087 1.00 38.86  ? 289  VAL A CB    1 
ATOM   3509 C  CG1   . VAL E 3 289 ? 29.471 20.989  42.626 1.00 38.36  ? 289  VAL A CG1   1 
ATOM   3510 C  CG2   . VAL E 3 289 ? 30.854 20.182  44.531 1.00 38.96  ? 289  VAL A CG2   1 
ATOM   3511 N  N     . THR E 3 290 ? 27.288 23.368  44.283 1.00 43.96  ? 290  THR A N     1 
ATOM   3512 C  CA    . THR E 3 290 ? 25.978 23.858  43.885 1.00 46.26  ? 290  THR A CA    1 
ATOM   3513 C  C     . THR E 3 290 ? 25.553 23.377  42.497 1.00 49.20  ? 290  THR A C     1 
ATOM   3514 O  O     . THR E 3 290 ? 26.331 22.752  41.772 1.00 49.36  ? 290  THR A O     1 
ATOM   3515 C  CB    . THR E 3 290 ? 25.952 25.396  43.926 1.00 45.81  ? 290  THR A CB    1 
ATOM   3516 O  OG1   . THR E 3 290 ? 27.010 25.922  43.119 1.00 45.00  ? 290  THR A OG1   1 
ATOM   3517 C  CG2   . THR E 3 290 ? 26.121 25.885  45.352 1.00 47.15  ? 290  THR A CG2   1 
ATOM   3518 N  N     . GLU E 3 291 ? 24.303 23.663  42.141 1.00 52.23  ? 291  GLU A N     1 
ATOM   3519 C  CA    . GLU E 3 291 ? 23.753 23.274  40.846 1.00 53.45  ? 291  GLU A CA    1 
ATOM   3520 C  C     . GLU E 3 291 ? 24.552 23.885  39.699 1.00 53.51  ? 291  GLU A C     1 
ATOM   3521 O  O     . GLU E 3 291 ? 24.758 23.240  38.679 1.00 53.94  ? 291  GLU A O     1 
ATOM   3522 C  CB    . GLU E 3 291 ? 22.276 23.695  40.746 1.00 54.50  ? 291  GLU A CB    1 
ATOM   3523 C  CG    . GLU E 3 291 ? 22.027 25.179  40.987 1.00 58.46  ? 291  GLU A CG    1 
ATOM   3524 C  CD    . GLU E 3 291 ? 20.550 25.532  41.072 1.00 60.12  ? 291  GLU A CD    1 
ATOM   3525 O  OE1   . GLU E 3 291 ? 20.234 26.664  41.503 1.00 60.94  ? 291  GLU A OE1   1 
ATOM   3526 O  OE2   . GLU E 3 291 ? 19.709 24.682  40.706 1.00 61.29  ? 291  GLU A OE2   1 
ATOM   3527 N  N     . ASP E 3 292 ? 25.008 25.123  39.871 1.00 54.16  ? 292  ASP A N     1 
ATOM   3528 C  CA    . ASP E 3 292 ? 25.785 25.792  38.833 1.00 54.65  ? 292  ASP A CA    1 
ATOM   3529 C  C     . ASP E 3 292 ? 27.262 25.411  38.939 1.00 54.04  ? 292  ASP A C     1 
ATOM   3530 O  O     . ASP E 3 292 ? 28.122 25.997  38.283 1.00 52.68  ? 292  ASP A O     1 
ATOM   3531 C  CB    . ASP E 3 292 ? 25.610 27.318  38.934 1.00 56.33  ? 292  ASP A CB    1 
ATOM   3532 C  CG    . ASP E 3 292 ? 26.128 27.887  40.242 1.00 58.16  ? 292  ASP A CG    1 
ATOM   3533 O  OD1   . ASP E 3 292 ? 25.716 27.394  41.312 1.00 58.79  ? 292  ASP A OD1   1 
ATOM   3534 O  OD2   . ASP E 3 292 ? 26.943 28.836  40.199 1.00 59.37  ? 292  ASP A OD2   1 
ATOM   3535 N  N     . LEU E 3 293 ? 27.541 24.421  39.782 1.00 54.33  ? 293  LEU A N     1 
ATOM   3536 C  CA    . LEU E 3 293 ? 28.904 23.916  39.995 1.00 53.85  ? 293  LEU A CA    1 
ATOM   3537 C  C     . LEU E 3 293 ? 29.883 24.787  40.811 1.00 53.33  ? 293  LEU A C     1 
ATOM   3538 O  O     . LEU E 3 293 ? 31.082 24.477  40.819 1.00 53.10  ? 293  LEU A O     1 
ATOM   3539 C  CB    . LEU E 3 293 ? 29.532 23.567  38.637 1.00 54.45  ? 293  LEU A CB    1 
ATOM   3540 C  CG    . LEU E 3 293 ? 28.840 22.460  37.838 1.00 54.13  ? 293  LEU A CG    1 
ATOM   3541 C  CD1   . LEU E 3 293 ? 29.616 22.205  36.562 1.00 56.43  ? 293  LEU A CD1   1 
ATOM   3542 C  CD2   . LEU E 3 293 ? 28.756 21.190  38.669 1.00 53.84  ? 293  LEU A CD2   1 
ATOM   3543 N  N     . ASP E 3 294 ? 29.380 25.831  41.481 1.00 52.22  ? 294  ASP A N     1 
ATOM   3544 C  CA    . ASP E 3 294 ? 30.212 26.715  42.290 1.00 53.03  ? 294  ASP A CA    1 
ATOM   3545 C  C     . ASP E 3 294 ? 30.588 25.939  43.578 1.00 52.09  ? 294  ASP A C     1 
ATOM   3546 O  O     . ASP E 3 294 ? 29.877 24.979  43.897 1.00 51.70  ? 294  ASP A O     1 
ATOM   3547 C  CB    . ASP E 3 294 ? 29.399 28.022  42.557 1.00 47.58  ? 294  ASP A CB    1 
ATOM   3548 C  CG    . ASP E 3 294 ? 30.214 29.105  43.166 1.00 47.59  ? 294  ASP A CG    1 
ATOM   3549 O  OD1   . ASP E 3 294 ? 31.234 28.786  43.787 1.00 42.26  ? 294  ASP A OD1   1 
ATOM   3550 O  OD2   . ASP E 3 294 ? 29.848 30.281  43.057 1.00 41.12  ? 294  ASP A OD2   1 
ATOM   3551 N  N     . ILE E 3 295 ? 31.610 26.279  44.321 1.00 50.69  ? 295  ILE A N     1 
ATOM   3552 C  CA    . ILE E 3 295 ? 31.848 25.432  45.483 1.00 48.91  ? 295  ILE A CA    1 
ATOM   3553 C  C     . ILE E 3 295 ? 31.604 26.265  46.727 1.00 47.08  ? 295  ILE A C     1 
ATOM   3554 O  O     . ILE E 3 295 ? 32.183 27.337  46.845 1.00 47.11  ? 295  ILE A O     1 
ATOM   3555 C  CB    . ILE E 3 295 ? 33.273 24.879  45.474 1.00 48.92  ? 295  ILE A CB    1 
ATOM   3556 C  CG1   . ILE E 3 295 ? 33.507 24.080  44.190 1.00 50.63  ? 295  ILE A CG1   1 
ATOM   3557 C  CG2   . ILE E 3 295 ? 33.547 24.025  46.678 1.00 49.58  ? 295  ILE A CG2   1 
ATOM   3558 C  CD1   . ILE E 3 295 ? 34.975 23.818  43.890 1.00 51.94  ? 295  ILE A CD1   1 
ATOM   3559 N  N     . VAL E 3 296 ? 30.750 25.792  47.633 1.00 44.43  ? 296  VAL A N     1 
ATOM   3560 C  CA    . VAL E 3 296 ? 30.470 26.515  48.864 1.00 42.77  ? 296  VAL A CA    1 
ATOM   3561 C  C     . VAL E 3 296 ? 30.941 25.633  50.015 1.00 42.02  ? 296  VAL A C     1 
ATOM   3562 O  O     . VAL E 3 296 ? 30.550 24.468  50.126 1.00 41.19  ? 296  VAL A O     1 
ATOM   3563 C  CB    . VAL E 3 296 ? 28.955 26.802  49.024 1.00 43.75  ? 296  VAL A CB    1 
ATOM   3564 C  CG1   . VAL E 3 296 ? 28.711 27.641  50.268 1.00 43.06  ? 296  VAL A CG1   1 
ATOM   3565 C  CG2   . VAL E 3 296 ? 28.431 27.530  47.796 1.00 45.49  ? 296  VAL A CG2   1 
ATOM   3566 N  N     . SER E 3 297 ? 31.783 26.189  50.873 1.00 39.67  ? 297  SER A N     1 
ATOM   3567 C  CA    . SER E 3 297 ? 32.314 25.431  51.989 1.00 38.84  ? 297  SER A CA    1 
ATOM   3568 C  C     . SER E 3 297 ? 32.241 26.160  53.324 1.00 37.09  ? 297  SER A C     1 
ATOM   3569 O  O     . SER E 3 297 ? 32.460 27.371  53.401 1.00 36.59  ? 297  SER A O     1 
ATOM   3570 C  CB    . SER E 3 297 ? 33.762 25.046  51.696 1.00 39.01  ? 297  SER A CB    1 
ATOM   3571 O  OG    . SER E 3 297 ? 34.483 24.870  52.899 1.00 42.04  ? 297  SER A OG    1 
ATOM   3572 N  N     . ARG E 3 298 ? 31.931 25.400  54.369 1.00 34.24  ? 298  ARG A N     1 
ATOM   3573 C  CA    . ARG E 3 298 ? 31.835 25.926  55.726 1.00 33.58  ? 298  ARG A CA    1 
ATOM   3574 C  C     . ARG E 3 298 ? 32.479 24.923  56.666 1.00 33.60  ? 298  ARG A C     1 
ATOM   3575 O  O     . ARG E 3 298 ? 32.119 23.736  56.676 1.00 31.12  ? 298  ARG A O     1 
ATOM   3576 C  CB    . ARG E 3 298 ? 30.374 26.147  56.121 1.00 34.79  ? 298  ARG A CB    1 
ATOM   3577 C  CG    . ARG E 3 298 ? 29.699 27.300  55.392 1.00 35.23  ? 298  ARG A CG    1 
ATOM   3578 C  CD    . ARG E 3 298 ? 30.464 28.606  55.615 1.00 36.56  ? 298  ARG A CD    1 
ATOM   3579 N  NE    . ARG E 3 298 ? 29.801 29.751  54.990 1.00 37.61  ? 298  ARG A NE    1 
ATOM   3580 C  CZ    . ARG E 3 298 ? 29.659 29.926  53.677 1.00 39.21  ? 298  ARG A CZ    1 
ATOM   3581 N  NH1   . ARG E 3 298 ? 30.140 29.030  52.822 1.00 38.28  ? 298  ARG A NH1   1 
ATOM   3582 N  NH2   . ARG E 3 298 ? 29.021 30.996  53.216 1.00 37.86  ? 298  ARG A NH2   1 
ATOM   3583 N  N     . GLY E 3 299 ? 33.441 25.391  57.452 1.00 32.77  ? 299  GLY A N     1 
ATOM   3584 C  CA    . GLY E 3 299 ? 34.116 24.492  58.363 1.00 32.98  ? 299  GLY A CA    1 
ATOM   3585 C  C     . GLY E 3 299 ? 34.285 25.028  59.761 1.00 33.78  ? 299  GLY A C     1 
ATOM   3586 O  O     . GLY E 3 299 ? 33.846 26.136  60.080 1.00 31.76  ? 299  GLY A O     1 
ATOM   3587 N  N     . ARG E 3 300 ? 34.934 24.222  60.595 1.00 35.71  ? 300  ARG A N     1 
ATOM   3588 C  CA    . ARG E 3 300 ? 35.203 24.579  61.978 1.00 37.86  ? 300  ARG A CA    1 
ATOM   3589 C  C     . ARG E 3 300 ? 36.400 23.802  62.509 1.00 37.81  ? 300  ARG A C     1 
ATOM   3590 O  O     . ARG E 3 300 ? 36.608 22.638  62.164 1.00 37.82  ? 300  ARG A O     1 
ATOM   3591 C  CB    . ARG E 3 300 ? 33.984 24.293  62.863 1.00 39.42  ? 300  ARG A CB    1 
ATOM   3592 C  CG    . ARG E 3 300 ? 34.247 24.583  64.339 1.00 44.49  ? 300  ARG A CG    1 
ATOM   3593 C  CD    . ARG E 3 300 ? 33.009 24.421  65.210 1.00 46.84  ? 300  ARG A CD    1 
ATOM   3594 N  NE    . ARG E 3 300 ? 33.349 24.543  66.626 1.00 50.79  ? 300  ARG A NE    1 
ATOM   3595 C  CZ    . ARG E 3 300 ? 32.484 24.395  67.628 1.00 52.76  ? 300  ARG A CZ    1 
ATOM   3596 N  NH1   . ARG E 3 300 ? 31.209 24.120  67.375 1.00 52.33  ? 300  ARG A NH1   1 
ATOM   3597 N  NH2   . ARG E 3 300 ? 32.896 24.509  68.886 1.00 51.68  ? 300  ARG A NH2   1 
ATOM   3598 N  N     . THR E 3 301 ? 37.191 24.465  63.343 1.00 37.24  ? 301  THR A N     1 
ATOM   3599 C  CA    . THR E 3 301 ? 38.356 23.850  63.954 1.00 38.42  ? 301  THR A CA    1 
ATOM   3600 C  C     . THR E 3 301 ? 38.112 23.746  65.454 1.00 39.00  ? 301  THR A C     1 
ATOM   3601 O  O     . THR E 3 301 ? 37.745 24.727  66.095 1.00 40.31  ? 301  THR A O     1 
ATOM   3602 C  CB    . THR E 3 301 ? 39.616 24.693  63.722 1.00 38.87  ? 301  THR A CB    1 
ATOM   3603 O  OG1   . THR E 3 301 ? 39.880 24.771  62.317 1.00 38.49  ? 301  THR A OG1   1 
ATOM   3604 C  CG2   . THR E 3 301 ? 40.813 24.071  64.431 1.00 37.88  ? 301  THR A CG2   1 
ATOM   3605 N  N     . PHE E 3 302 ? 38.300 22.555  66.008 1.00 38.57  ? 302  PHE A N     1 
ATOM   3606 C  CA    . PHE E 3 302 ? 38.105 22.351  67.435 1.00 39.37  ? 302  PHE A CA    1 
ATOM   3607 C  C     . PHE E 3 302 ? 39.453 22.293  68.136 1.00 40.17  ? 302  PHE A C     1 
ATOM   3608 O  O     . PHE E 3 302 ? 40.482 22.029  67.506 1.00 39.65  ? 302  PHE A O     1 
ATOM   3609 C  CB    . PHE E 3 302 ? 37.369 21.038  67.708 1.00 40.07  ? 302  PHE A CB    1 
ATOM   3610 C  CG    . PHE E 3 302 ? 35.994 20.966  67.114 1.00 41.67  ? 302  PHE A CG    1 
ATOM   3611 C  CD1   . PHE E 3 302 ? 35.816 20.894  65.738 1.00 43.09  ? 302  PHE A CD1   1 
ATOM   3612 C  CD2   . PHE E 3 302 ? 34.874 20.925  67.937 1.00 43.60  ? 302  PHE A CD2   1 
ATOM   3613 C  CE1   . PHE E 3 302 ? 34.540 20.778  65.188 1.00 44.23  ? 302  PHE A CE1   1 
ATOM   3614 C  CE2   . PHE E 3 302 ? 33.596 20.810  67.401 1.00 43.89  ? 302  PHE A CE2   1 
ATOM   3615 C  CZ    . PHE E 3 302 ? 33.428 20.735  66.021 1.00 45.51  ? 302  PHE A CZ    1 
ATOM   3616 N  N     . PRO E 3 303 ? 39.468 22.550  69.454 1.00 40.31  ? 303  PRO A N     1 
ATOM   3617 C  CA    . PRO E 3 303 ? 40.713 22.509  70.226 1.00 41.47  ? 303  PRO A CA    1 
ATOM   3618 C  C     . PRO E 3 303 ? 41.176 21.070  70.473 1.00 41.14  ? 303  PRO A C     1 
ATOM   3619 O  O     . PRO E 3 303 ? 42.324 20.835  70.835 1.00 42.07  ? 303  PRO A O     1 
ATOM   3620 C  CB    . PRO E 3 303 ? 40.342 23.244  71.515 1.00 42.47  ? 303  PRO A CB    1 
ATOM   3621 C  CG    . PRO E 3 303 ? 38.877 22.941  71.664 1.00 40.23  ? 303  PRO A CG    1 
ATOM   3622 C  CD    . PRO E 3 303 ? 38.371 23.125  70.255 1.00 39.51  ? 303  PRO A CD    1 
ATOM   3623 N  N     . HIS E 3 304 ? 40.279 20.110  70.259 1.00 41.64  ? 304  HIS A N     1 
ATOM   3624 C  CA    . HIS E 3 304 ? 40.598 18.696  70.455 1.00 42.38  ? 304  HIS A CA    1 
ATOM   3625 C  C     . HIS E 3 304 ? 40.105 17.851  69.283 1.00 41.27  ? 304  HIS A C     1 
ATOM   3626 O  O     . HIS E 3 304 ? 39.335 18.324  68.443 1.00 39.82  ? 304  HIS A O     1 
ATOM   3627 C  CB    . HIS E 3 304 ? 39.964 18.183  71.750 1.00 46.26  ? 304  HIS A CB    1 
ATOM   3628 C  CG    . HIS E 3 304 ? 40.295 19.010  72.952 1.00 52.99  ? 304  HIS A CG    1 
ATOM   3629 N  ND1   . HIS E 3 304 ? 41.590 19.354  73.288 1.00 55.80  ? 304  HIS A ND1   1 
ATOM   3630 C  CD2   . HIS E 3 304 ? 39.505 19.565  73.902 1.00 55.06  ? 304  HIS A CD2   1 
ATOM   3631 C  CE1   . HIS E 3 304 ? 41.581 20.083  74.389 1.00 56.56  ? 304  HIS A CE1   1 
ATOM   3632 N  NE2   . HIS E 3 304 ? 40.326 20.226  74.783 1.00 56.69  ? 304  HIS A NE2   1 
ATOM   3633 N  N     . GLY E 3 305 ? 40.552 16.599  69.238 1.00 39.51  ? 305  GLY A N     1 
ATOM   3634 C  CA    . GLY E 3 305 ? 40.156 15.698  68.168 1.00 38.21  ? 305  GLY A CA    1 
ATOM   3635 C  C     . GLY E 3 305 ? 38.651 15.580  68.018 1.00 38.17  ? 305  GLY A C     1 
ATOM   3636 O  O     . GLY E 3 305 ? 37.914 15.711  68.995 1.00 39.35  ? 305  GLY A O     1 
ATOM   3637 N  N     . ILE E 3 306 ? 38.197 15.333  66.793 1.00 36.21  ? 306  ILE A N     1 
ATOM   3638 C  CA    . ILE E 3 306 ? 36.772 15.201  66.490 1.00 36.35  ? 306  ILE A CA    1 
ATOM   3639 C  C     . ILE E 3 306 ? 36.384 13.731  66.436 1.00 35.87  ? 306  ILE A C     1 
ATOM   3640 O  O     . ILE E 3 306 ? 36.884 12.990  65.599 1.00 34.85  ? 306  ILE A O     1 
ATOM   3641 C  CB    . ILE E 3 306 ? 36.426 15.832  65.102 1.00 35.73  ? 306  ILE A CB    1 
ATOM   3642 C  CG1   . ILE E 3 306 ? 36.727 17.332  65.110 1.00 37.36  ? 306  ILE A CG1   1 
ATOM   3643 C  CG2   . ILE E 3 306 ? 34.973 15.566  64.745 1.00 31.93  ? 306  ILE A CG2   1 
ATOM   3644 C  CD1   . ILE E 3 306 ? 36.513 18.015  63.748 1.00 37.06  ? 306  ILE A CD1   1 
ATOM   3645 N  N     . SER E 3 307 ? 35.499 13.309  67.331 1.00 37.43  ? 307  SER A N     1 
ATOM   3646 C  CA    . SER E 3 307 ? 35.044 11.925  67.344 1.00 37.58  ? 307  SER A CA    1 
ATOM   3647 C  C     . SER E 3 307 ? 34.030 11.816  66.218 1.00 37.43  ? 307  SER A C     1 
ATOM   3648 O  O     . SER E 3 307 ? 33.487 12.832  65.778 1.00 35.21  ? 307  SER A O     1 
ATOM   3649 C  CB    . SER E 3 307 ? 34.374 11.601  68.678 1.00 39.01  ? 307  SER A CB    1 
ATOM   3650 O  OG    . SER E 3 307 ? 33.216 12.399  68.853 1.00 40.38  ? 307  SER A OG    1 
ATOM   3651 N  N     . LYS E 3 308 ? 33.756 10.602  65.752 1.00 38.61  ? 308  LYS A N     1 
ATOM   3652 C  CA    . LYS E 3 308 ? 32.799 10.448  64.666 1.00 40.49  ? 308  LYS A CA    1 
ATOM   3653 C  C     . LYS E 3 308 ? 31.414 10.956  65.056 1.00 41.62  ? 308  LYS A C     1 
ATOM   3654 O  O     . LYS E 3 308 ? 30.653 11.415  64.202 1.00 39.58  ? 308  LYS A O     1 
ATOM   3655 C  CB    . LYS E 3 308 ? 32.685 8.992   64.210 1.00 42.97  ? 308  LYS A CB    1 
ATOM   3656 C  CG    . LYS E 3 308 ? 31.994 8.870   62.843 1.00 45.42  ? 308  LYS A CG    1 
ATOM   3657 C  CD    . LYS E 3 308 ? 31.493 7.463   62.533 1.00 48.80  ? 308  LYS A CD    1 
ATOM   3658 C  CE    . LYS E 3 308 ? 32.627 6.471   62.348 1.00 50.72  ? 308  LYS A CE    1 
ATOM   3659 N  NZ    . LYS E 3 308 ? 32.097 5.106   62.054 1.00 52.54  ? 308  LYS A NZ    1 
ATOM   3660 N  N     . GLU E 3 309 ? 31.081 10.872  66.340 1.00 42.37  ? 309  GLU A N     1 
ATOM   3661 C  CA    . GLU E 3 309 ? 29.777 11.347  66.787 1.00 44.18  ? 309  GLU A CA    1 
ATOM   3662 C  C     . GLU E 3 309 ? 29.725 12.862  66.635 1.00 42.05  ? 309  GLU A C     1 
ATOM   3663 O  O     . GLU E 3 309 ? 28.753 13.405  66.114 1.00 40.78  ? 309  GLU A O     1 
ATOM   3664 C  CB    . GLU E 3 309 ? 29.502 10.939  68.246 1.00 47.52  ? 309  GLU A CB    1 
ATOM   3665 C  CG    . GLU E 3 309 ? 29.182 9.451   68.427 1.00 52.56  ? 309  GLU A CG    1 
ATOM   3666 C  CD    . GLU E 3 309 ? 30.428 8.575   68.537 1.00 56.37  ? 309  GLU A CD    1 
ATOM   3667 O  OE1   . GLU E 3 309 ? 31.424 8.842   67.827 1.00 57.66  ? 309  GLU A OE1   1 
ATOM   3668 O  OE2   . GLU E 3 309 ? 30.406 7.605   69.327 1.00 57.84  ? 309  GLU A OE2   1 
ATOM   3669 N  N     . THR E 3 310 ? 30.778 13.539  67.081 1.00 40.85  ? 310  THR A N     1 
ATOM   3670 C  CA    . THR E 3 310 ? 30.836 14.987  66.956 1.00 40.74  ? 310  THR A CA    1 
ATOM   3671 C  C     . THR E 3 310 ? 30.793 15.373  65.485 1.00 39.98  ? 310  THR A C     1 
ATOM   3672 O  O     . THR E 3 310 ? 30.192 16.384  65.118 1.00 40.77  ? 310  THR A O     1 
ATOM   3673 C  CB    . THR E 3 310 ? 32.114 15.554  67.570 1.00 41.21  ? 310  THR A CB    1 
ATOM   3674 O  OG1   . THR E 3 310 ? 32.109 15.302  68.976 1.00 44.56  ? 310  THR A OG1   1 
ATOM   3675 C  CG2   . THR E 3 310 ? 32.201 17.058  67.338 1.00 41.26  ? 310  THR A CG2   1 
ATOM   3676 N  N     . ALA E 3 311 ? 31.430 14.562  64.645 1.00 39.07  ? 311  ALA A N     1 
ATOM   3677 C  CA    . ALA E 3 311 ? 31.462 14.827  63.212 1.00 37.84  ? 311  ALA A CA    1 
ATOM   3678 C  C     . ALA E 3 311 ? 30.057 14.840  62.635 1.00 39.20  ? 311  ALA A C     1 
ATOM   3679 O  O     . ALA E 3 311 ? 29.742 15.650  61.760 1.00 38.53  ? 311  ALA A O     1 
ATOM   3680 C  CB    . ALA E 3 311 ? 32.301 13.774  62.499 1.00 36.54  ? 311  ALA A CB    1 
ATOM   3681 N  N     . TYR E 3 312 ? 29.211 13.942  63.125 1.00 38.83  ? 312  TYR A N     1 
ATOM   3682 C  CA    . TYR E 3 312 ? 27.845 13.861  62.636 1.00 41.82  ? 312  TYR A CA    1 
ATOM   3683 C  C     . TYR E 3 312 ? 27.051 15.112  62.966 1.00 41.28  ? 312  TYR A C     1 
ATOM   3684 O  O     . TYR E 3 312 ? 26.472 15.746  62.084 1.00 41.30  ? 312  TYR A O     1 
ATOM   3685 C  CB    . TYR E 3 312 ? 27.153 12.627  63.218 1.00 44.62  ? 312  TYR A CB    1 
ATOM   3686 C  CG    . TYR E 3 312 ? 27.223 11.424  62.305 1.00 46.86  ? 312  TYR A CG    1 
ATOM   3687 C  CD1   . TYR E 3 312 ? 26.156 11.101  61.475 1.00 48.15  ? 312  TYR A CD1   1 
ATOM   3688 C  CD2   . TYR E 3 312 ? 28.371 10.632  62.240 1.00 47.65  ? 312  TYR A CD2   1 
ATOM   3689 C  CE1   . TYR E 3 312 ? 26.223 10.024  60.600 1.00 51.74  ? 312  TYR A CE1   1 
ATOM   3690 C  CE2   . TYR E 3 312 ? 28.451 9.550   61.364 1.00 49.56  ? 312  TYR A CE2   1 
ATOM   3691 C  CZ    . TYR E 3 312 ? 27.371 9.253   60.547 1.00 51.08  ? 312  TYR A CZ    1 
ATOM   3692 O  OH    . TYR E 3 312 ? 27.424 8.194   59.669 1.00 54.31  ? 312  TYR A OH    1 
ATOM   3693 N  N     . SER E 3 313 ? 27.038 15.474  64.240 1.00 41.54  ? 313  SER A N     1 
ATOM   3694 C  CA    . SER E 3 313 ? 26.302 16.650  64.675 1.00 42.59  ? 313  SER A CA    1 
ATOM   3695 C  C     . SER E 3 313 ? 26.853 17.934  64.069 1.00 41.01  ? 313  SER A C     1 
ATOM   3696 O  O     . SER E 3 313 ? 26.097 18.751  63.541 1.00 41.39  ? 313  SER A O     1 
ATOM   3697 C  CB    . SER E 3 313 ? 26.329 16.748  66.198 1.00 42.13  ? 313  SER A CB    1 
ATOM   3698 O  OG    . SER E 3 313 ? 27.654 16.611  66.673 1.00 45.43  ? 313  SER A OG    1 
ATOM   3699 N  N     . GLU E 3 314 ? 28.170 18.103  64.128 1.00 39.85  ? 314  GLU A N     1 
ATOM   3700 C  CA    . GLU E 3 314 ? 28.798 19.306  63.601 1.00 36.14  ? 314  GLU A CA    1 
ATOM   3701 C  C     . GLU E 3 314 ? 28.597 19.473  62.098 1.00 35.64  ? 314  GLU A C     1 
ATOM   3702 O  O     . GLU E 3 314 ? 28.325 20.574  61.622 1.00 35.34  ? 314  GLU A O     1 
ATOM   3703 C  CB    . GLU E 3 314 ? 30.285 19.308  63.931 1.00 37.37  ? 314  GLU A CB    1 
ATOM   3704 C  CG    . GLU E 3 314 ? 30.924 20.664  63.747 1.00 42.38  ? 314  GLU A CG    1 
ATOM   3705 C  CD    . GLU E 3 314 ? 30.300 21.720  64.648 1.00 44.29  ? 314  GLU A CD    1 
ATOM   3706 O  OE1   . GLU E 3 314 ? 30.231 22.890  64.214 1.00 45.07  ? 314  GLU A OE1   1 
ATOM   3707 O  OE2   . GLU E 3 314 ? 29.889 21.382  65.784 1.00 43.70  ? 314  GLU A OE2   1 
ATOM   3708 N  N     . SER E 3 315 ? 28.715 18.389  61.343 1.00 33.97  ? 315  SER A N     1 
ATOM   3709 C  CA    . SER E 3 315 ? 28.540 18.487  59.901 1.00 34.21  ? 315  SER A CA    1 
ATOM   3710 C  C     . SER E 3 315 ? 27.152 19.017  59.547 1.00 32.81  ? 315  SER A C     1 
ATOM   3711 O  O     . SER E 3 315 ? 27.000 19.776  58.589 1.00 30.32  ? 315  SER A O     1 
ATOM   3712 C  CB    . SER E 3 315 ? 28.757 17.128  59.247 1.00 34.51  ? 315  SER A CB    1 
ATOM   3713 O  OG    . SER E 3 315 ? 27.848 16.184  59.777 1.00 40.44  ? 315  SER A OG    1 
ATOM   3714 N  N     . VAL E 3 316 ? 26.145 18.627  60.325 1.00 33.31  ? 316  VAL A N     1 
ATOM   3715 C  CA    . VAL E 3 316 ? 24.774 19.076  60.079 1.00 33.49  ? 316  VAL A CA    1 
ATOM   3716 C  C     . VAL E 3 316 ? 24.647 20.585  60.309 1.00 32.92  ? 316  VAL A C     1 
ATOM   3717 O  O     . VAL E 3 316 ? 23.900 21.262  59.607 1.00 33.30  ? 316  VAL A O     1 
ATOM   3718 C  CB    . VAL E 3 316 ? 23.772 18.309  60.975 1.00 35.39  ? 316  VAL A CB    1 
ATOM   3719 C  CG1   . VAL E 3 316 ? 22.368 18.901  60.836 1.00 33.34  ? 316  VAL A CG1   1 
ATOM   3720 C  CG2   . VAL E 3 316 ? 23.766 16.839  60.581 1.00 32.36  ? 316  VAL A CG2   1 
ATOM   3721 N  N     . LYS E 3 317 ? 25.384 21.110  61.282 1.00 33.22  ? 317  LYS A N     1 
ATOM   3722 C  CA    . LYS E 3 317 ? 25.368 22.544  61.553 1.00 34.88  ? 317  LYS A CA    1 
ATOM   3723 C  C     . LYS E 3 317 ? 25.961 23.273  60.351 1.00 33.65  ? 317  LYS A C     1 
ATOM   3724 O  O     . LYS E 3 317 ? 25.407 24.257  59.858 1.00 32.70  ? 317  LYS A O     1 
ATOM   3725 C  CB    . LYS E 3 317 ? 26.228 22.887  62.774 1.00 38.13  ? 317  LYS A CB    1 
ATOM   3726 C  CG    . LYS E 3 317 ? 25.777 22.291  64.098 1.00 41.54  ? 317  LYS A CG    1 
ATOM   3727 C  CD    . LYS E 3 317 ? 26.696 22.792  65.204 1.00 46.26  ? 317  LYS A CD    1 
ATOM   3728 C  CE    . LYS E 3 317 ? 26.326 22.231  66.567 1.00 51.42  ? 317  LYS A CE    1 
ATOM   3729 N  NZ    . LYS E 3 317 ? 27.272 22.697  67.632 1.00 54.59  ? 317  LYS A NZ    1 
ATOM   3730 N  N     . LEU E 3 318 ? 27.111 22.787  59.900 1.00 32.88  ? 318  LEU A N     1 
ATOM   3731 C  CA    . LEU E 3 318 ? 27.812 23.388  58.777 1.00 32.07  ? 318  LEU A CA    1 
ATOM   3732 C  C     . LEU E 3 318 ? 26.965 23.332  57.514 1.00 32.67  ? 318  LEU A C     1 
ATOM   3733 O  O     . LEU E 3 318 ? 26.887 24.316  56.775 1.00 31.87  ? 318  LEU A O     1 
ATOM   3734 C  CB    . LEU E 3 318 ? 29.157 22.687  58.573 1.00 30.73  ? 318  LEU A CB    1 
ATOM   3735 C  CG    . LEU E 3 318 ? 30.118 22.831  59.765 1.00 33.16  ? 318  LEU A CG    1 
ATOM   3736 C  CD1   . LEU E 3 318 ? 31.331 21.904  59.587 1.00 30.16  ? 318  LEU A CD1   1 
ATOM   3737 C  CD2   . LEU E 3 318 ? 30.566 24.294  59.893 1.00 30.07  ? 318  LEU A CD2   1 
ATOM   3738 N  N     . LEU E 3 319 ? 26.319 22.195  57.267 1.00 31.65  ? 319  LEU A N     1 
ATOM   3739 C  CA    . LEU E 3 319 ? 25.466 22.072  56.087 1.00 32.78  ? 319  LEU A CA    1 
ATOM   3740 C  C     . LEU E 3 319 ? 24.357 23.125  56.127 1.00 34.88  ? 319  LEU A C     1 
ATOM   3741 O  O     . LEU E 3 319 ? 24.043 23.760  55.114 1.00 34.28  ? 319  LEU A O     1 
ATOM   3742 C  CB    . LEU E 3 319 ? 24.846 20.678  56.014 1.00 31.17  ? 319  LEU A CB    1 
ATOM   3743 C  CG    . LEU E 3 319 ? 23.726 20.471  54.992 1.00 31.72  ? 319  LEU A CG    1 
ATOM   3744 C  CD1   . LEU E 3 319 ? 24.166 20.962  53.610 1.00 32.05  ? 319  LEU A CD1   1 
ATOM   3745 C  CD2   . LEU E 3 319 ? 23.343 18.988  54.964 1.00 31.03  ? 319  LEU A CD2   1 
ATOM   3746 N  N     . GLN E 3 320 ? 23.759 23.319  57.297 1.00 34.79  ? 320  GLN A N     1 
ATOM   3747 C  CA    . GLN E 3 320 ? 22.702 24.309  57.401 1.00 37.49  ? 320  GLN A CA    1 
ATOM   3748 C  C     . GLN E 3 320 ? 23.248 25.719  57.217 1.00 37.48  ? 320  GLN A C     1 
ATOM   3749 O  O     . GLN E 3 320 ? 22.582 26.573  56.628 1.00 37.23  ? 320  GLN A O     1 
ATOM   3750 C  CB    . GLN E 3 320 ? 21.973 24.166  58.733 1.00 39.55  ? 320  GLN A CB    1 
ATOM   3751 C  CG    . GLN E 3 320 ? 21.007 22.995  58.729 1.00 43.71  ? 320  GLN A CG    1 
ATOM   3752 C  CD    . GLN E 3 320 ? 20.197 22.897  60.004 1.00 47.84  ? 320  GLN A CD    1 
ATOM   3753 O  OE1   . GLN E 3 320 ? 20.741 22.643  61.085 1.00 49.13  ? 320  GLN A OE1   1 
ATOM   3754 N  NE2   . GLN E 3 320 ? 18.885 23.102  59.886 1.00 46.22  ? 320  GLN A NE2   1 
ATOM   3755 N  N     . LYS E 3 321 ? 24.466 25.961  57.697 1.00 37.36  ? 321  LYS A N     1 
ATOM   3756 C  CA    . LYS E 3 321 ? 25.077 27.277  57.533 1.00 38.25  ? 321  LYS A CA    1 
ATOM   3757 C  C     . LYS E 3 321 ? 25.149 27.570  56.035 1.00 38.61  ? 321  LYS A C     1 
ATOM   3758 O  O     . LYS E 3 321 ? 24.818 28.670  55.586 1.00 38.77  ? 321  LYS A O     1 
ATOM   3759 C  CB    . LYS E 3 321 ? 26.475 27.305  58.150 1.00 38.34  ? 321  LYS A CB    1 
ATOM   3760 C  CG    . LYS E 3 321 ? 27.095 28.695  58.233 1.00 40.85  ? 321  LYS A CG    1 
ATOM   3761 C  CD    . LYS E 3 321 ? 28.340 28.701  59.115 1.00 43.78  ? 321  LYS A CD    1 
ATOM   3762 C  CE    . LYS E 3 321 ? 28.921 30.104  59.240 1.00 46.87  ? 321  LYS A CE    1 
ATOM   3763 N  NZ    . LYS E 3 321 ? 27.927 31.081  59.785 1.00 46.11  ? 321  LYS A NZ    1 
ATOM   3764 N  N     . ILE E 3 322 ? 25.574 26.573  55.264 1.00 38.22  ? 322  ILE A N     1 
ATOM   3765 C  CA    . ILE E 3 322 ? 25.660 26.712  53.814 1.00 40.09  ? 322  ILE A CA    1 
ATOM   3766 C  C     . ILE E 3 322 ? 24.263 26.996  53.264 1.00 40.80  ? 322  ILE A C     1 
ATOM   3767 O  O     . ILE E 3 322 ? 24.070 27.914  52.467 1.00 40.94  ? 322  ILE A O     1 
ATOM   3768 C  CB    . ILE E 3 322 ? 26.187 25.411  53.149 1.00 39.59  ? 322  ILE A CB    1 
ATOM   3769 C  CG1   . ILE E 3 322 ? 27.664 25.204  53.494 1.00 39.50  ? 322  ILE A CG1   1 
ATOM   3770 C  CG2   . ILE E 3 322 ? 25.979 25.469  51.639 1.00 38.09  ? 322  ILE A CG2   1 
ATOM   3771 C  CD1   . ILE E 3 322 ? 28.256 23.919  52.933 1.00 38.31  ? 322  ILE A CD1   1 
ATOM   3772 N  N     . LEU E 3 323 ? 23.298 26.192  53.702 1.00 42.87  ? 323  LEU A N     1 
ATOM   3773 C  CA    . LEU E 3 323 ? 21.909 26.319  53.271 1.00 44.36  ? 323  LEU A CA    1 
ATOM   3774 C  C     . LEU E 3 323 ? 21.337 27.715  53.501 1.00 44.70  ? 323  LEU A C     1 
ATOM   3775 O  O     . LEU E 3 323 ? 20.652 28.249  52.631 1.00 45.45  ? 323  LEU A O     1 
ATOM   3776 C  CB    . LEU E 3 323 ? 21.051 25.276  53.990 1.00 44.81  ? 323  LEU A CB    1 
ATOM   3777 C  CG    . LEU E 3 323 ? 20.339 24.224  53.132 1.00 47.22  ? 323  LEU A CG    1 
ATOM   3778 C  CD1   . LEU E 3 323 ? 21.193 23.827  51.940 1.00 47.40  ? 323  LEU A CD1   1 
ATOM   3779 C  CD2   . LEU E 3 323 ? 20.014 23.010  54.000 1.00 47.77  ? 323  LEU A CD2   1 
ATOM   3780 N  N     . GLU E 3 324 ? 21.619 28.311  54.657 1.00 44.74  ? 324  GLU A N     1 
ATOM   3781 C  CA    . GLU E 3 324 ? 21.103 29.647  54.939 1.00 46.03  ? 324  GLU A CA    1 
ATOM   3782 C  C     . GLU E 3 324 ? 21.924 30.770  54.302 1.00 45.66  ? 324  GLU A C     1 
ATOM   3783 O  O     . GLU E 3 324 ? 21.414 31.868  54.085 1.00 44.41  ? 324  GLU A O     1 
ATOM   3784 C  CB    . GLU E 3 324 ? 20.999 29.893  56.453 1.00 46.77  ? 324  GLU A CB    1 
ATOM   3785 C  CG    . GLU E 3 324 ? 22.316 30.025  57.180 1.00 48.54  ? 324  GLU A CG    1 
ATOM   3786 C  CD    . GLU E 3 324 ? 22.153 30.639  58.567 1.00 51.01  ? 324  GLU A CD    1 
ATOM   3787 O  OE1   . GLU E 3 324 ? 21.985 31.875  58.665 1.00 48.79  ? 324  GLU A OE1   1 
ATOM   3788 O  OE2   . GLU E 3 324 ? 22.184 29.885  59.563 1.00 51.79  ? 324  GLU A OE2   1 
ATOM   3789 N  N     . GLU E 3 325 ? 23.189 30.503  53.993 1.00 44.63  ? 325  GLU A N     1 
ATOM   3790 C  CA    . GLU E 3 325 ? 24.028 31.532  53.398 1.00 44.83  ? 325  GLU A CA    1 
ATOM   3791 C  C     . GLU E 3 325 ? 24.141 31.430  51.882 1.00 44.52  ? 325  GLU A C     1 
ATOM   3792 O  O     . GLU E 3 325 ? 24.776 32.263  51.240 1.00 45.01  ? 325  GLU A O     1 
ATOM   3793 C  CB    . GLU E 3 325 ? 25.409 31.519  54.059 1.00 45.22  ? 325  GLU A CB    1 
ATOM   3794 C  CG    . GLU E 3 325 ? 25.403 32.176  55.438 1.00 45.23  ? 325  GLU A CG    1 
ATOM   3795 C  CD    . GLU E 3 325 ? 26.686 31.960  56.220 1.00 45.27  ? 325  GLU A CD    1 
ATOM   3796 O  OE1   . GLU E 3 325 ? 27.778 32.001  55.617 1.00 46.91  ? 325  GLU A OE1   1 
ATOM   3797 O  OE2   . GLU E 3 325 ? 26.604 31.765  57.450 1.00 44.76  ? 325  GLU A OE2   1 
ATOM   3798 N  N     . ASP E 3 326 ? 23.512 30.413  51.309 1.00 45.39  ? 326  ASP A N     1 
ATOM   3799 C  CA    . ASP E 3 326 ? 23.527 30.240  49.861 1.00 46.14  ? 326  ASP A CA    1 
ATOM   3800 C  C     . ASP E 3 326 ? 22.192 29.650  49.426 1.00 46.35  ? 326  ASP A C     1 
ATOM   3801 O  O     . ASP E 3 326 ? 21.838 28.536  49.806 1.00 44.77  ? 326  ASP A O     1 
ATOM   3802 C  CB    . ASP E 3 326 ? 24.679 29.331  49.435 1.00 46.11  ? 326  ASP A CB    1 
ATOM   3803 C  CG    . ASP E 3 326 ? 25.079 29.553  47.990 1.00 46.85  ? 326  ASP A CG    1 
ATOM   3804 O  OD1   . ASP E 3 326 ? 24.271 29.242  47.090 1.00 44.57  ? 326  ASP A OD1   1 
ATOM   3805 O  OD2   . ASP E 3 326 ? 26.202 30.052  47.758 1.00 48.54  ? 326  ASP A OD2   1 
ATOM   3806 N  N     . GLU E 3 327 ? 21.454 30.403  48.621 1.00 48.04  ? 327  GLU A N     1 
ATOM   3807 C  CA    . GLU E 3 327 ? 20.137 29.971  48.178 1.00 51.15  ? 327  GLU A CA    1 
ATOM   3808 C  C     . GLU E 3 327 ? 20.091 28.955  47.045 1.00 50.75  ? 327  GLU A C     1 
ATOM   3809 O  O     . GLU E 3 327 ? 19.041 28.381  46.769 1.00 50.40  ? 327  GLU A O     1 
ATOM   3810 C  CB    . GLU E 3 327 ? 19.299 31.197  47.816 1.00 55.13  ? 327  GLU A CB    1 
ATOM   3811 C  CG    . GLU E 3 327 ? 19.058 32.105  49.015 1.00 61.21  ? 327  GLU A CG    1 
ATOM   3812 C  CD    . GLU E 3 327 ? 17.755 32.874  48.916 1.00 65.72  ? 327  GLU A CD    1 
ATOM   3813 O  OE1   . GLU E 3 327 ? 16.821 32.370  48.250 1.00 67.21  ? 327  GLU A OE1   1 
ATOM   3814 O  OE2   . GLU E 3 327 ? 17.659 33.969  49.519 1.00 67.85  ? 327  GLU A OE2   1 
ATOM   3815 N  N     . ARG E 3 328 ? 21.222 28.722  46.395 1.00 50.53  ? 328  ARG A N     1 
ATOM   3816 C  CA    . ARG E 3 328 ? 21.268 27.764  45.300 1.00 50.97  ? 328  ARG A CA    1 
ATOM   3817 C  C     . ARG E 3 328 ? 20.949 26.345  45.758 1.00 50.04  ? 328  ARG A C     1 
ATOM   3818 O  O     . ARG E 3 328 ? 20.941 26.057  46.954 1.00 49.92  ? 328  ARG A O     1 
ATOM   3819 C  CB    . ARG E 3 328 ? 22.647 27.798  44.652 1.00 51.64  ? 328  ARG A CB    1 
ATOM   3820 C  CG    . ARG E 3 328 ? 22.911 29.049  43.851 1.00 51.87  ? 328  ARG A CG    1 
ATOM   3821 C  CD    . ARG E 3 328 ? 24.344 29.101  43.369 1.00 51.76  ? 328  ARG A CD    1 
ATOM   3822 N  NE    . ARG E 3 328 ? 25.278 29.373  44.457 1.00 53.93  ? 328  ARG A NE    1 
ATOM   3823 C  CZ    . ARG E 3 328 ? 26.566 29.641  44.276 1.00 54.85  ? 328  ARG A CZ    1 
ATOM   3824 N  NH1   . ARG E 3 328 ? 27.069 29.671  43.048 1.00 56.20  ? 328  ARG A NH1   1 
ATOM   3825 N  NH2   . ARG E 3 328 ? 27.353 29.883  45.314 1.00 54.23  ? 328  ARG A NH2   1 
ATOM   3826 N  N     . LYS E 3 329 ? 20.672 25.466  44.800 1.00 49.95  ? 329  LYS A N     1 
ATOM   3827 C  CA    . LYS E 3 329 ? 20.371 24.069  45.098 1.00 49.09  ? 329  LYS A CA    1 
ATOM   3828 C  C     . LYS E 3 329 ? 21.696 23.308  45.124 1.00 49.10  ? 329  LYS A C     1 
ATOM   3829 O  O     . LYS E 3 329 ? 22.636 23.660  44.410 1.00 47.94  ? 329  LYS A O     1 
ATOM   3830 C  CB    . LYS E 3 329 ? 19.462 23.468  44.022 1.00 51.15  ? 329  LYS A CB    1 
ATOM   3831 C  CG    . LYS E 3 329 ? 18.134 24.186  43.824 1.00 53.60  ? 329  LYS A CG    1 
ATOM   3832 C  CD    . LYS E 3 329 ? 17.303 23.484  42.760 1.00 56.46  ? 329  LYS A CD    1 
ATOM   3833 C  CE    . LYS E 3 329 ? 16.019 24.235  42.450 1.00 57.51  ? 329  LYS A CE    1 
ATOM   3834 N  NZ    . LYS E 3 329 ? 15.246 23.544  41.383 1.00 57.79  ? 329  LYS A NZ    1 
ATOM   3835 N  N     . ILE E 3 330 ? 21.780 22.262  45.936 1.00 47.69  ? 330  ILE A N     1 
ATOM   3836 C  CA    . ILE E 3 330 ? 23.020 21.508  46.017 1.00 46.22  ? 330  ILE A CA    1 
ATOM   3837 C  C     . ILE E 3 330 ? 23.011 20.280  45.119 1.00 46.39  ? 330  ILE A C     1 
ATOM   3838 O  O     . ILE E 3 330 ? 22.049 19.518  45.095 1.00 45.92  ? 330  ILE A O     1 
ATOM   3839 C  CB    . ILE E 3 330 ? 23.312 21.097  47.471 1.00 46.21  ? 330  ILE A CB    1 
ATOM   3840 C  CG1   . ILE E 3 330 ? 23.504 22.356  48.321 1.00 42.40  ? 330  ILE A CG1   1 
ATOM   3841 C  CG2   . ILE E 3 330 ? 24.554 20.202  47.529 1.00 45.98  ? 330  ILE A CG2   1 
ATOM   3842 C  CD1   . ILE E 3 330 ? 23.686 22.083  49.785 1.00 43.95  ? 330  ILE A CD1   1 
ATOM   3843 N  N     . ARG E 3 331 ? 24.097 20.107  44.372 1.00 47.38  ? 331  ARG A N     1 
ATOM   3844 C  CA    . ARG E 3 331 ? 24.256 18.983  43.454 1.00 46.94  ? 331  ARG A CA    1 
ATOM   3845 C  C     . ARG E 3 331 ? 25.106 17.885  44.100 1.00 45.65  ? 331  ARG A C     1 
ATOM   3846 O  O     . ARG E 3 331 ? 24.770 16.698  44.033 1.00 44.25  ? 331  ARG A O     1 
ATOM   3847 C  CB    . ARG E 3 331 ? 24.928 19.471  42.173 1.00 49.22  ? 331  ARG A CB    1 
ATOM   3848 C  CG    . ARG E 3 331 ? 25.201 18.396  41.138 1.00 53.72  ? 331  ARG A CG    1 
ATOM   3849 C  CD    . ARG E 3 331 ? 26.097 18.965  40.053 1.00 57.68  ? 331  ARG A CD    1 
ATOM   3850 N  NE    . ARG E 3 331 ? 26.399 18.000  39.005 1.00 61.11  ? 331  ARG A NE    1 
ATOM   3851 C  CZ    . ARG E 3 331 ? 25.807 17.979  37.816 1.00 62.48  ? 331  ARG A CZ    1 
ATOM   3852 N  NH1   . ARG E 3 331 ? 24.874 18.874  37.519 1.00 63.28  ? 331  ARG A NH1   1 
ATOM   3853 N  NH2   . ARG E 3 331 ? 26.153 17.067  36.919 1.00 63.06  ? 331  ARG A NH2   1 
ATOM   3854 N  N     . ARG E 3 332 ? 26.216 18.291  44.712 1.00 42.63  ? 332  ARG A N     1 
ATOM   3855 C  CA    . ARG E 3 332 ? 27.110 17.354  45.384 1.00 40.96  ? 332  ARG A CA    1 
ATOM   3856 C  C     . ARG E 3 332 ? 27.319 17.787  46.839 1.00 39.28  ? 332  ARG A C     1 
ATOM   3857 O  O     . ARG E 3 332 ? 27.375 18.983  47.147 1.00 38.01  ? 332  ARG A O     1 
ATOM   3858 C  CB    . ARG E 3 332 ? 28.474 17.316  44.696 1.00 42.35  ? 332  ARG A CB    1 
ATOM   3859 C  CG    . ARG E 3 332 ? 28.478 16.979  43.229 1.00 44.40  ? 332  ARG A CG    1 
ATOM   3860 C  CD    . ARG E 3 332 ? 29.900 17.083  42.717 1.00 47.25  ? 332  ARG A CD    1 
ATOM   3861 N  NE    . ARG E 3 332 ? 29.964 17.219  41.267 1.00 49.78  ? 332  ARG A NE    1 
ATOM   3862 C  CZ    . ARG E 3 332 ? 31.065 17.559  40.602 1.00 51.06  ? 332  ARG A CZ    1 
ATOM   3863 N  NH1   . ARG E 3 332 ? 32.190 17.794  41.267 1.00 50.84  ? 332  ARG A NH1   1 
ATOM   3864 N  NH2   . ARG E 3 332 ? 31.041 17.677  39.278 1.00 50.30  ? 332  ARG A NH2   1 
ATOM   3865 N  N     . ILE E 3 333 ? 27.451 16.814  47.730 1.00 36.39  ? 333  ILE A N     1 
ATOM   3866 C  CA    . ILE E 3 333 ? 27.664 17.121  49.131 1.00 34.60  ? 333  ILE A CA    1 
ATOM   3867 C  C     . ILE E 3 333 ? 28.772 16.224  49.673 1.00 36.14  ? 333  ILE A C     1 
ATOM   3868 O  O     . ILE E 3 333 ? 28.886 15.050  49.300 1.00 35.08  ? 333  ILE A O     1 
ATOM   3869 C  CB    . ILE E 3 333 ? 26.371 16.918  49.944 1.00 31.90  ? 333  ILE A CB    1 
ATOM   3870 C  CG1   . ILE E 3 333 ? 26.564 17.446  51.368 1.00 31.16  ? 333  ILE A CG1   1 
ATOM   3871 C  CG2   . ILE E 3 333 ? 25.990 15.450  49.966 1.00 31.99  ? 333  ILE A CG2   1 
ATOM   3872 C  CD1   . ILE E 3 333 ? 26.890 18.932  51.427 1.00 27.12  ? 333  ILE A CD1   1 
ATOM   3873 N  N     . GLY E 3 334 ? 29.600 16.782  50.545 1.00 35.52  ? 334  GLY A N     1 
ATOM   3874 C  CA    . GLY E 3 334 ? 30.680 15.992  51.092 1.00 34.30  ? 334  GLY A CA    1 
ATOM   3875 C  C     . GLY E 3 334 ? 31.304 16.607  52.321 1.00 33.81  ? 334  GLY A C     1 
ATOM   3876 O  O     . GLY E 3 334 ? 30.925 17.696  52.750 1.00 31.10  ? 334  GLY A O     1 
ATOM   3877 N  N     . VAL E 3 335 ? 32.277 15.903  52.884 1.00 32.93  ? 335  VAL A N     1 
ATOM   3878 C  CA    . VAL E 3 335 ? 32.953 16.378  54.069 1.00 31.95  ? 335  VAL A CA    1 
ATOM   3879 C  C     . VAL E 3 335 ? 34.455 16.236  53.871 1.00 33.16  ? 335  VAL A C     1 
ATOM   3880 O  O     . VAL E 3 335 ? 34.911 15.401  53.085 1.00 32.05  ? 335  VAL A O     1 
ATOM   3881 C  CB    . VAL E 3 335 ? 32.499 15.574  55.297 1.00 32.11  ? 335  VAL A CB    1 
ATOM   3882 C  CG1   . VAL E 3 335 ? 32.888 14.114  55.135 1.00 30.27  ? 335  VAL A CG1   1 
ATOM   3883 C  CG2   . VAL E 3 335 ? 33.094 16.165  56.551 1.00 35.02  ? 335  VAL A CG2   1 
ATOM   3884 N  N     . ARG E 3 336 ? 35.223 17.048  54.590 1.00 31.83  ? 336  ARG A N     1 
ATOM   3885 C  CA    . ARG E 3 336 ? 36.669 17.019  54.469 1.00 31.77  ? 336  ARG A CA    1 
ATOM   3886 C  C     . ARG E 3 336 ? 37.309 17.246  55.838 1.00 30.60  ? 336  ARG A C     1 
ATOM   3887 O  O     . ARG E 3 336 ? 37.047 18.259  56.486 1.00 30.85  ? 336  ARG A O     1 
ATOM   3888 C  CB    . ARG E 3 336 ? 37.074 18.110  53.486 1.00 35.48  ? 336  ARG A CB    1 
ATOM   3889 C  CG    . ARG E 3 336 ? 38.389 17.910  52.801 1.00 41.25  ? 336  ARG A CG    1 
ATOM   3890 C  CD    . ARG E 3 336 ? 38.341 18.595  51.445 1.00 42.58  ? 336  ARG A CD    1 
ATOM   3891 N  NE    . ARG E 3 336 ? 39.670 18.765  50.887 1.00 43.64  ? 336  ARG A NE    1 
ATOM   3892 C  CZ    . ARG E 3 336 ? 40.019 19.788  50.116 1.00 48.39  ? 336  ARG A CZ    1 
ATOM   3893 N  NH1   . ARG E 3 336 ? 39.129 20.724  49.815 1.00 48.45  ? 336  ARG A NH1   1 
ATOM   3894 N  NH2   . ARG E 3 336 ? 41.261 19.890  49.664 1.00 50.27  ? 336  ARG A NH2   1 
ATOM   3895 N  N     . PHE E 3 337 ? 38.150 16.310  56.268 1.00 28.19  ? 337  PHE A N     1 
ATOM   3896 C  CA    . PHE E 3 337 ? 38.812 16.392  57.574 1.00 28.27  ? 337  PHE A CA    1 
ATOM   3897 C  C     . PHE E 3 337 ? 40.282 16.776  57.483 1.00 27.95  ? 337  PHE A C     1 
ATOM   3898 O  O     . PHE E 3 337 ? 41.000 16.316  56.595 1.00 28.07  ? 337  PHE A O     1 
ATOM   3899 C  CB    . PHE E 3 337 ? 38.700 15.050  58.300 1.00 26.28  ? 337  PHE A CB    1 
ATOM   3900 C  CG    . PHE E 3 337 ? 37.292 14.641  58.601 1.00 29.50  ? 337  PHE A CG    1 
ATOM   3901 C  CD1   . PHE E 3 337 ? 36.633 15.138  59.725 1.00 31.22  ? 337  PHE A CD1   1 
ATOM   3902 C  CD2   . PHE E 3 337 ? 36.617 13.768  57.762 1.00 29.00  ? 337  PHE A CD2   1 
ATOM   3903 C  CE1   . PHE E 3 337 ? 35.320 14.771  60.012 1.00 30.31  ? 337  PHE A CE1   1 
ATOM   3904 C  CE2   . PHE E 3 337 ? 35.307 13.394  58.038 1.00 32.42  ? 337  PHE A CE2   1 
ATOM   3905 C  CZ    . PHE E 3 337 ? 34.654 13.897  59.169 1.00 32.55  ? 337  PHE A CZ    1 
ATOM   3906 N  N     . SER E 3 338 ? 40.740 17.592  58.425 1.00 26.25  ? 338  SER A N     1 
ATOM   3907 C  CA    . SER E 3 338 ? 42.129 18.029  58.421 1.00 27.42  ? 338  SER A CA    1 
ATOM   3908 C  C     . SER E 3 338 ? 42.681 18.315  59.820 1.00 29.02  ? 338  SER A C     1 
ATOM   3909 O  O     . SER E 3 338 ? 42.014 18.049  60.825 1.00 27.60  ? 338  SER A O     1 
ATOM   3910 C  CB    . SER E 3 338 ? 42.269 19.272  57.535 1.00 27.33  ? 338  SER A CB    1 
ATOM   3911 O  OG    . SER E 3 338 ? 41.405 20.308  57.970 1.00 28.10  ? 338  SER A OG    1 
ATOM   3912 N  N     . LYS E 3 339 ? 43.899 18.858  59.861 1.00 29.89  ? 339  LYS A N     1 
ATOM   3913 C  CA    . LYS E 3 339 ? 44.597 19.180  61.104 1.00 33.74  ? 339  LYS A CA    1 
ATOM   3914 C  C     . LYS E 3 339 ? 44.609 17.956  62.001 1.00 34.30  ? 339  LYS A C     1 
ATOM   3915 O  O     . LYS E 3 339 ? 44.018 17.939  63.078 1.00 35.50  ? 339  LYS A O     1 
ATOM   3916 C  CB    . LYS E 3 339 ? 43.928 20.366  61.804 1.00 35.10  ? 339  LYS A CB    1 
ATOM   3917 C  CG    . LYS E 3 339 ? 44.051 21.656  61.007 1.00 38.50  ? 339  LYS A CG    1 
ATOM   3918 C  CD    . LYS E 3 339 ? 43.416 22.833  61.714 1.00 42.52  ? 339  LYS A CD    1 
ATOM   3919 C  CE    . LYS E 3 339 ? 43.349 24.042  60.787 1.00 44.90  ? 339  LYS A CE    1 
ATOM   3920 N  NZ    . LYS E 3 339 ? 42.537 25.156  61.361 1.00 47.49  ? 339  LYS A NZ    1 
ATOM   3921 N  N     . PHE E 3 340 ? 45.296 16.927  61.530 1.00 35.63  ? 340  PHE A N     1 
ATOM   3922 C  CA    . PHE E 3 340 ? 45.388 15.669  62.243 1.00 38.52  ? 340  PHE A CA    1 
ATOM   3923 C  C     . PHE E 3 340 ? 46.298 15.759  63.456 1.00 40.82  ? 340  PHE A C     1 
ATOM   3924 O  O     . PHE E 3 340 ? 47.268 16.518  63.462 1.00 40.78  ? 340  PHE A O     1 
ATOM   3925 C  CB    . PHE E 3 340 ? 45.902 14.582  61.297 1.00 38.85  ? 340  PHE A CB    1 
ATOM   3926 C  CG    . PHE E 3 340 ? 45.125 14.479  60.014 1.00 41.01  ? 340  PHE A CG    1 
ATOM   3927 C  CD1   . PHE E 3 340 ? 43.744 14.278  60.035 1.00 41.24  ? 340  PHE A CD1   1 
ATOM   3928 C  CD2   . PHE E 3 340 ? 45.773 14.562  58.783 1.00 40.57  ? 340  PHE A CD2   1 
ATOM   3929 C  CE1   . PHE E 3 340 ? 43.017 14.158  58.846 1.00 40.77  ? 340  PHE A CE1   1 
ATOM   3930 C  CE2   . PHE E 3 340 ? 45.058 14.444  57.587 1.00 40.89  ? 340  PHE A CE2   1 
ATOM   3931 C  CZ    . PHE E 3 340 ? 43.675 14.241  57.619 1.00 41.78  ? 340  PHE A CZ    1 
ATOM   3932 N  N     . ILE E 3 341 ? 45.980 14.987  64.488 1.00 42.49  ? 341  ILE A N     1 
ATOM   3933 C  CA    . ILE E 3 341 ? 46.813 14.977  65.683 1.00 46.32  ? 341  ILE A CA    1 
ATOM   3934 C  C     . ILE E 3 341 ? 47.955 14.001  65.421 1.00 46.97  ? 341  ILE A C     1 
ATOM   3935 O  O     . ILE E 3 341 ? 47.686 12.966  64.772 1.00 48.10  ? 341  ILE A O     1 
ATOM   3936 C  CB    . ILE E 3 341 ? 46.030 14.496  66.921 1.00 46.69  ? 341  ILE A CB    1 
ATOM   3937 C  CG1   . ILE E 3 341 ? 44.857 15.440  67.202 1.00 48.25  ? 341  ILE A CG1   1 
ATOM   3938 C  CG2   . ILE E 3 341 ? 46.958 14.451  68.125 1.00 47.65  ? 341  ILE A CG2   1 
ATOM   3939 C  CD1   . ILE E 3 341 ? 43.909 14.944  68.281 1.00 48.45  ? 341  ILE A CD1   1 
ATOM   3940 N  N     . MET F 3 1   ? 24.644 70.383  65.585 1.00 43.30  ? 1    MET B N     1 
ATOM   3941 C  CA    . MET F 3 1   ? 25.747 69.402  65.418 1.00 41.70  ? 1    MET B CA    1 
ATOM   3942 C  C     . MET F 3 1   ? 26.304 69.000  66.772 1.00 39.92  ? 1    MET B C     1 
ATOM   3943 O  O     . MET F 3 1   ? 26.487 69.838  67.653 1.00 37.82  ? 1    MET B O     1 
ATOM   3944 C  CB    . MET F 3 1   ? 26.863 70.010  64.556 1.00 44.45  ? 1    MET B CB    1 
ATOM   3945 C  CG    . MET F 3 1   ? 28.130 69.160  64.454 1.00 48.32  ? 1    MET B CG    1 
ATOM   3946 S  SD    . MET F 3 1   ? 29.328 69.775  63.221 1.00 51.76  ? 1    MET B SD    1 
ATOM   3947 C  CE    . MET F 3 1   ? 29.851 71.326  63.969 1.00 48.40  ? 1    MET B CE    1 
ATOM   3948 N  N     . ILE F 3 2   ? 26.540 67.704  66.939 1.00 37.48  ? 2    ILE B N     1 
ATOM   3949 C  CA    . ILE F 3 2   ? 27.121 67.181  68.163 1.00 34.52  ? 2    ILE B CA    1 
ATOM   3950 C  C     . ILE F 3 2   ? 28.452 66.563  67.746 1.00 33.71  ? 2    ILE B C     1 
ATOM   3951 O  O     . ILE F 3 2   ? 28.487 65.642  66.918 1.00 33.82  ? 2    ILE B O     1 
ATOM   3952 C  CB    . ILE F 3 2   ? 26.240 66.100  68.804 1.00 34.17  ? 2    ILE B CB    1 
ATOM   3953 C  CG1   . ILE F 3 2   ? 24.904 66.704  69.240 1.00 35.36  ? 2    ILE B CG1   1 
ATOM   3954 C  CG2   . ILE F 3 2   ? 26.944 65.503  70.021 1.00 30.79  ? 2    ILE B CG2   1 
ATOM   3955 C  CD1   . ILE F 3 2   ? 23.992 65.698  69.938 1.00 37.17  ? 2    ILE B CD1   1 
ATOM   3956 N  N     . VAL F 3 3   ? 29.545 67.079  68.298 1.00 31.72  ? 3    VAL B N     1 
ATOM   3957 C  CA    . VAL F 3 3   ? 30.871 66.573  67.958 1.00 29.24  ? 3    VAL B CA    1 
ATOM   3958 C  C     . VAL F 3 3   ? 31.507 65.777  69.089 1.00 29.93  ? 3    VAL B C     1 
ATOM   3959 O  O     . VAL F 3 3   ? 31.434 66.162  70.263 1.00 28.67  ? 3    VAL B O     1 
ATOM   3960 C  CB    . VAL F 3 3   ? 31.833 67.720  67.588 1.00 28.66  ? 3    VAL B CB    1 
ATOM   3961 C  CG1   . VAL F 3 3   ? 33.208 67.154  67.267 1.00 27.20  ? 3    VAL B CG1   1 
ATOM   3962 C  CG2   . VAL F 3 3   ? 31.302 68.490  66.401 1.00 27.29  ? 3    VAL B CG2   1 
ATOM   3963 N  N     . LEU F 3 4   ? 32.129 64.660  68.727 1.00 29.04  ? 4    LEU B N     1 
ATOM   3964 C  CA    . LEU F 3 4   ? 32.812 63.812  69.692 1.00 29.12  ? 4    LEU B CA    1 
ATOM   3965 C  C     . LEU F 3 4   ? 34.236 63.692  69.170 1.00 28.70  ? 4    LEU B C     1 
ATOM   3966 O  O     . LEU F 3 4   ? 34.468 63.144  68.090 1.00 29.17  ? 4    LEU B O     1 
ATOM   3967 C  CB    . LEU F 3 4   ? 32.141 62.433  69.775 1.00 30.80  ? 4    LEU B CB    1 
ATOM   3968 C  CG    . LEU F 3 4   ? 32.649 61.448  70.840 1.00 32.64  ? 4    LEU B CG    1 
ATOM   3969 C  CD1   . LEU F 3 4   ? 31.561 60.424  71.146 1.00 31.92  ? 4    LEU B CD1   1 
ATOM   3970 C  CD2   . LEU F 3 4   ? 33.931 60.764  70.375 1.00 30.12  ? 4    LEU B CD2   1 
ATOM   3971 N  N     . PHE F 3 5   ? 35.176 64.220  69.947 1.00 28.34  ? 5    PHE B N     1 
ATOM   3972 C  CA    . PHE F 3 5   ? 36.598 64.236  69.603 1.00 26.71  ? 5    PHE B CA    1 
ATOM   3973 C  C     . PHE F 3 5   ? 37.353 63.212  70.434 1.00 25.84  ? 5    PHE B C     1 
ATOM   3974 O  O     . PHE F 3 5   ? 37.123 63.096  71.635 1.00 28.22  ? 5    PHE B O     1 
ATOM   3975 C  CB    . PHE F 3 5   ? 37.138 65.649  69.856 1.00 26.40  ? 5    PHE B CB    1 
ATOM   3976 C  CG    . PHE F 3 5   ? 38.642 65.768  69.800 1.00 25.37  ? 5    PHE B CG    1 
ATOM   3977 C  CD1   . PHE F 3 5   ? 39.324 65.713  68.586 1.00 24.67  ? 5    PHE B CD1   1 
ATOM   3978 C  CD2   . PHE F 3 5   ? 39.370 65.983  70.966 1.00 24.29  ? 5    PHE B CD2   1 
ATOM   3979 C  CE1   . PHE F 3 5   ? 40.715 65.876  68.535 1.00 24.61  ? 5    PHE B CE1   1 
ATOM   3980 C  CE2   . PHE F 3 5   ? 40.753 66.147  70.930 1.00 24.87  ? 5    PHE B CE2   1 
ATOM   3981 C  CZ    . PHE F 3 5   ? 41.431 66.095  69.706 1.00 24.82  ? 5    PHE B CZ    1 
ATOM   3982 N  N     . VAL F 3 6   ? 38.242 62.457  69.793 1.00 26.69  ? 6    VAL B N     1 
ATOM   3983 C  CA    . VAL F 3 6   ? 39.026 61.438  70.484 1.00 25.15  ? 6    VAL B CA    1 
ATOM   3984 C  C     . VAL F 3 6   ? 40.520 61.696  70.331 1.00 25.82  ? 6    VAL B C     1 
ATOM   3985 O  O     . VAL F 3 6   ? 41.019 61.830  69.223 1.00 24.39  ? 6    VAL B O     1 
ATOM   3986 C  CB    . VAL F 3 6   ? 38.734 60.032  69.942 1.00 26.71  ? 6    VAL B CB    1 
ATOM   3987 C  CG1   . VAL F 3 6   ? 39.547 58.994  70.728 1.00 23.74  ? 6    VAL B CG1   1 
ATOM   3988 C  CG2   . VAL F 3 6   ? 37.237 59.733  70.037 1.00 26.69  ? 6    VAL B CG2   1 
ATOM   3989 N  N     . ASP F 3 7   ? 41.224 61.731  71.457 1.00 26.98  ? 7    ASP B N     1 
ATOM   3990 C  CA    . ASP F 3 7   ? 42.662 61.993  71.495 1.00 26.70  ? 7    ASP B CA    1 
ATOM   3991 C  C     . ASP F 3 7   ? 43.308 60.880  72.316 1.00 27.15  ? 7    ASP B C     1 
ATOM   3992 O  O     . ASP F 3 7   ? 42.997 60.745  73.497 1.00 28.12  ? 7    ASP B O     1 
ATOM   3993 C  CB    . ASP F 3 7   ? 42.889 63.344  72.179 1.00 28.26  ? 7    ASP B CB    1 
ATOM   3994 C  CG    . ASP F 3 7   ? 44.312 63.843  72.056 1.00 25.52  ? 7    ASP B CG    1 
ATOM   3995 O  OD1   . ASP F 3 7   ? 44.515 64.873  71.386 1.00 30.92  ? 7    ASP B OD1   1 
ATOM   3996 O  OD2   . ASP F 3 7   ? 45.226 63.212  72.612 1.00 26.07  ? 7    ASP B OD2   1 
ATOM   3997 N  N     . PHE F 3 8   ? 44.202 60.096  71.712 1.00 25.48  ? 8    PHE B N     1 
ATOM   3998 C  CA    . PHE F 3 8   ? 44.852 58.987  72.425 1.00 25.97  ? 8    PHE B CA    1 
ATOM   3999 C  C     . PHE F 3 8   ? 45.815 59.476  73.511 1.00 26.90  ? 8    PHE B C     1 
ATOM   4000 O  O     . PHE F 3 8   ? 46.584 60.404  73.284 1.00 26.24  ? 8    PHE B O     1 
ATOM   4001 C  CB    . PHE F 3 8   ? 45.618 58.078  71.452 1.00 22.90  ? 8    PHE B CB    1 
ATOM   4002 C  CG    . PHE F 3 8   ? 44.840 57.698  70.218 1.00 22.39  ? 8    PHE B CG    1 
ATOM   4003 C  CD1   . PHE F 3 8   ? 43.449 57.718  70.209 1.00 19.19  ? 8    PHE B CD1   1 
ATOM   4004 C  CD2   . PHE F 3 8   ? 45.508 57.292  69.065 1.00 22.63  ? 8    PHE B CD2   1 
ATOM   4005 C  CE1   . PHE F 3 8   ? 42.736 57.330  69.066 1.00 23.96  ? 8    PHE B CE1   1 
ATOM   4006 C  CE2   . PHE F 3 8   ? 44.803 56.904  67.918 1.00 25.46  ? 8    PHE B CE2   1 
ATOM   4007 C  CZ    . PHE F 3 8   ? 43.418 56.925  67.918 1.00 21.18  ? 8    PHE B CZ    1 
ATOM   4008 N  N     . ASP F 3 9   ? 45.783 58.832  74.679 1.00 26.74  ? 9    ASP B N     1 
ATOM   4009 C  CA    . ASP F 3 9   ? 46.639 59.235  75.795 1.00 27.26  ? 9    ASP B CA    1 
ATOM   4010 C  C     . ASP F 3 9   ? 48.131 58.929  75.601 1.00 26.65  ? 9    ASP B C     1 
ATOM   4011 O  O     . ASP F 3 9   ? 48.503 57.810  75.218 1.00 22.73  ? 9    ASP B O     1 
ATOM   4012 C  CB    . ASP F 3 9   ? 46.120 58.621  77.107 1.00 27.84  ? 9    ASP B CB    1 
ATOM   4013 C  CG    . ASP F 3 9   ? 44.703 59.096  77.466 1.00 30.35  ? 9    ASP B CG    1 
ATOM   4014 O  OD1   . ASP F 3 9   ? 44.338 60.244  77.138 1.00 31.51  ? 9    ASP B OD1   1 
ATOM   4015 O  OD2   . ASP F 3 9   ? 43.949 58.325  78.095 1.00 31.33  ? 9    ASP B OD2   1 
ATOM   4016 N  N     . TYR F 3 10  ? 48.967 59.945  75.862 1.00 24.51  ? 10   TYR B N     1 
ATOM   4017 C  CA    . TYR F 3 10  ? 50.429 59.861  75.727 1.00 26.34  ? 10   TYR B CA    1 
ATOM   4018 C  C     . TYR F 3 10  ? 50.753 58.778  74.726 1.00 25.50  ? 10   TYR B C     1 
ATOM   4019 O  O     . TYR F 3 10  ? 51.530 57.863  74.997 1.00 26.13  ? 10   TYR B O     1 
ATOM   4020 C  CB    . TYR F 3 10  ? 51.087 59.573  77.096 1.00 28.62  ? 10   TYR B CB    1 
ATOM   4021 C  CG    . TYR F 3 10  ? 50.698 58.258  77.770 1.00 32.04  ? 10   TYR B CG    1 
ATOM   4022 C  CD1   . TYR F 3 10  ? 51.590 57.180  77.816 1.00 32.74  ? 10   TYR B CD1   1 
ATOM   4023 C  CD2   . TYR F 3 10  ? 49.451 58.103  78.380 1.00 32.50  ? 10   TYR B CD2   1 
ATOM   4024 C  CE1   . TYR F 3 10  ? 51.249 55.985  78.453 1.00 32.89  ? 10   TYR B CE1   1 
ATOM   4025 C  CE2   . TYR F 3 10  ? 49.104 56.913  79.015 1.00 32.95  ? 10   TYR B CE2   1 
ATOM   4026 C  CZ    . TYR F 3 10  ? 50.005 55.862  79.049 1.00 32.93  ? 10   TYR B CZ    1 
ATOM   4027 O  OH    . TYR F 3 10  ? 49.652 54.688  79.681 1.00 37.86  ? 10   TYR B OH    1 
ATOM   4028 N  N     . PHE F 3 11  ? 50.175 58.925  73.535 1.00 26.12  ? 11   PHE B N     1 
ATOM   4029 C  CA    . PHE F 3 11  ? 50.271 57.911  72.499 1.00 25.12  ? 11   PHE B CA    1 
ATOM   4030 C  C     . PHE F 3 11  ? 51.532 57.101  72.223 1.00 23.90  ? 11   PHE B C     1 
ATOM   4031 O  O     . PHE F 3 11  ? 51.542 55.902  72.477 1.00 24.47  ? 11   PHE B O     1 
ATOM   4032 C  CB    . PHE F 3 11  ? 49.727 58.450  71.176 1.00 24.38  ? 11   PHE B CB    1 
ATOM   4033 C  CG    . PHE F 3 11  ? 49.346 57.361  70.217 1.00 25.59  ? 11   PHE B CG    1 
ATOM   4034 C  CD1   . PHE F 3 11  ? 48.580 56.277  70.654 1.00 26.51  ? 11   PHE B CD1   1 
ATOM   4035 C  CD2   . PHE F 3 11  ? 49.739 57.406  68.886 1.00 25.15  ? 11   PHE B CD2   1 
ATOM   4036 C  CE1   . PHE F 3 11  ? 48.213 55.252  69.776 1.00 27.32  ? 11   PHE B CE1   1 
ATOM   4037 C  CE2   . PHE F 3 11  ? 49.372 56.383  68.000 1.00 25.64  ? 11   PHE B CE2   1 
ATOM   4038 C  CZ    . PHE F 3 11  ? 48.612 55.310  68.443 1.00 25.28  ? 11   PHE B CZ    1 
ATOM   4039 N  N     . TYR F 3 12  ? 52.581 57.707  71.684 1.00 23.95  ? 12   TYR B N     1 
ATOM   4040 C  CA    . TYR F 3 12  ? 53.781 56.920  71.385 1.00 25.41  ? 12   TYR B CA    1 
ATOM   4041 C  C     . TYR F 3 12  ? 54.258 56.110  72.591 1.00 25.55  ? 12   TYR B C     1 
ATOM   4042 O  O     . TYR F 3 12  ? 54.591 54.931  72.464 1.00 26.27  ? 12   TYR B O     1 
ATOM   4043 C  CB    . TYR F 3 12  ? 54.918 57.821  70.888 1.00 25.07  ? 12   TYR B CB    1 
ATOM   4044 C  CG    . TYR F 3 12  ? 54.668 58.483  69.547 1.00 23.51  ? 12   TYR B CG    1 
ATOM   4045 C  CD1   . TYR F 3 12  ? 53.433 58.387  68.908 1.00 24.96  ? 12   TYR B CD1   1 
ATOM   4046 C  CD2   . TYR F 3 12  ? 55.665 59.233  68.934 1.00 25.20  ? 12   TYR B CD2   1 
ATOM   4047 C  CE1   . TYR F 3 12  ? 53.197 59.027  67.693 1.00 24.27  ? 12   TYR B CE1   1 
ATOM   4048 C  CE2   . TYR F 3 12  ? 55.442 59.876  67.720 1.00 26.91  ? 12   TYR B CE2   1 
ATOM   4049 C  CZ    . TYR F 3 12  ? 54.212 59.772  67.106 1.00 27.69  ? 12   TYR B CZ    1 
ATOM   4050 O  OH    . TYR F 3 12  ? 54.001 60.420  65.910 1.00 28.47  ? 12   TYR B OH    1 
ATOM   4051 N  N     . ALA F 3 13  ? 54.291 56.738  73.760 1.00 25.98  ? 13   ALA B N     1 
ATOM   4052 C  CA    . ALA F 3 13  ? 54.728 56.033  74.952 1.00 26.60  ? 13   ALA B CA    1 
ATOM   4053 C  C     . ALA F 3 13  ? 53.714 54.954  75.329 1.00 27.01  ? 13   ALA B C     1 
ATOM   4054 O  O     . ALA F 3 13  ? 54.104 53.853  75.716 1.00 26.25  ? 13   ALA B O     1 
ATOM   4055 C  CB    . ALA F 3 13  ? 54.921 57.010  76.111 1.00 24.62  ? 13   ALA B CB    1 
ATOM   4056 N  N     . GLN F 3 14  ? 52.419 55.249  75.224 1.00 25.02  ? 14   GLN B N     1 
ATOM   4057 C  CA    . GLN F 3 14  ? 51.439 54.223  75.587 1.00 25.51  ? 14   GLN B CA    1 
ATOM   4058 C  C     . GLN F 3 14  ? 51.510 52.991  74.686 1.00 25.28  ? 14   GLN B C     1 
ATOM   4059 O  O     . GLN F 3 14  ? 51.281 51.877  75.142 1.00 28.80  ? 14   GLN B O     1 
ATOM   4060 C  CB    . GLN F 3 14  ? 50.008 54.770  75.585 1.00 24.48  ? 14   GLN B CB    1 
ATOM   4061 C  CG    . GLN F 3 14  ? 49.043 53.809  76.288 1.00 25.13  ? 14   GLN B CG    1 
ATOM   4062 C  CD    . GLN F 3 14  ? 47.589 54.248  76.266 1.00 28.42  ? 14   GLN B CD    1 
ATOM   4063 O  OE1   . GLN F 3 14  ? 46.719 53.550  76.796 1.00 28.81  ? 14   GLN B OE1   1 
ATOM   4064 N  NE2   . GLN F 3 14  ? 47.314 55.399  75.653 1.00 27.51  ? 14   GLN B NE2   1 
ATOM   4065 N  N     . VAL F 3 15  ? 51.831 53.175  73.408 1.00 25.85  ? 15   VAL B N     1 
ATOM   4066 C  CA    . VAL F 3 15  ? 51.926 52.031  72.515 1.00 26.34  ? 15   VAL B CA    1 
ATOM   4067 C  C     . VAL F 3 15  ? 53.128 51.178  72.913 1.00 29.12  ? 15   VAL B C     1 
ATOM   4068 O  O     . VAL F 3 15  ? 53.073 49.946  72.866 1.00 29.48  ? 15   VAL B O     1 
ATOM   4069 C  CB    . VAL F 3 15  ? 52.083 52.455  71.038 1.00 26.43  ? 15   VAL B CB    1 
ATOM   4070 C  CG1   . VAL F 3 15  ? 52.456 51.252  70.194 1.00 24.02  ? 15   VAL B CG1   1 
ATOM   4071 C  CG2   . VAL F 3 15  ? 50.780 53.067  70.531 1.00 25.00  ? 15   VAL B CG2   1 
ATOM   4072 N  N     . GLU F 3 16  ? 54.218 51.831  73.302 1.00 28.41  ? 16   GLU B N     1 
ATOM   4073 C  CA    . GLU F 3 16  ? 55.402 51.094  73.709 1.00 29.63  ? 16   GLU B CA    1 
ATOM   4074 C  C     . GLU F 3 16  ? 55.063 50.286  74.962 1.00 30.09  ? 16   GLU B C     1 
ATOM   4075 O  O     . GLU F 3 16  ? 55.537 49.166  75.127 1.00 30.60  ? 16   GLU B O     1 
ATOM   4076 C  CB    . GLU F 3 16  ? 56.570 52.053  73.985 1.00 30.26  ? 16   GLU B CB    1 
ATOM   4077 C  CG    . GLU F 3 16  ? 57.142 52.765  72.750 1.00 30.22  ? 16   GLU B CG    1 
ATOM   4078 C  CD    . GLU F 3 16  ? 57.835 51.817  71.778 1.00 31.06  ? 16   GLU B CD    1 
ATOM   4079 O  OE1   . GLU F 3 16  ? 58.020 50.642  72.133 1.00 33.87  ? 16   GLU B OE1   1 
ATOM   4080 O  OE2   . GLU F 3 16  ? 58.205 52.244  70.663 1.00 31.63  ? 16   GLU B OE2   1 
ATOM   4081 N  N     . GLU F 3 17  ? 54.231 50.843  75.838 1.00 31.93  ? 17   GLU B N     1 
ATOM   4082 C  CA    . GLU F 3 17  ? 53.857 50.123  77.049 1.00 34.08  ? 17   GLU B CA    1 
ATOM   4083 C  C     . GLU F 3 17  ? 53.008 48.919  76.683 1.00 36.65  ? 17   GLU B C     1 
ATOM   4084 O  O     . GLU F 3 17  ? 53.120 47.869  77.307 1.00 38.11  ? 17   GLU B O     1 
ATOM   4085 C  CB    . GLU F 3 17  ? 53.065 51.007  78.010 1.00 34.88  ? 17   GLU B CB    1 
ATOM   4086 C  CG    . GLU F 3 17  ? 53.831 52.181  78.551 1.00 37.39  ? 17   GLU B CG    1 
ATOM   4087 C  CD    . GLU F 3 17  ? 53.047 52.934  79.596 1.00 39.29  ? 17   GLU B CD    1 
ATOM   4088 O  OE1   . GLU F 3 17  ? 51.796 52.887  79.560 1.00 42.94  ? 17   GLU B OE1   1 
ATOM   4089 O  OE2   . GLU F 3 17  ? 53.680 53.586  80.446 1.00 41.33  ? 17   GLU B OE2   1 
ATOM   4090 N  N     . VAL F 3 18  ? 52.150 49.069  75.678 1.00 36.04  ? 18   VAL B N     1 
ATOM   4091 C  CA    . VAL F 3 18  ? 51.305 47.962  75.259 1.00 35.24  ? 18   VAL B CA    1 
ATOM   4092 C  C     . VAL F 3 18  ? 52.161 46.845  74.674 1.00 36.14  ? 18   VAL B C     1 
ATOM   4093 O  O     . VAL F 3 18  ? 51.875 45.668  74.879 1.00 37.76  ? 18   VAL B O     1 
ATOM   4094 C  CB    . VAL F 3 18  ? 50.259 48.422  74.218 1.00 34.35  ? 18   VAL B CB    1 
ATOM   4095 C  CG1   . VAL F 3 18  ? 49.577 47.228  73.577 1.00 33.33  ? 18   VAL B CG1   1 
ATOM   4096 C  CG2   . VAL F 3 18  ? 49.219 49.302  74.902 1.00 34.58  ? 18   VAL B CG2   1 
ATOM   4097 N  N     . LEU F 3 19  ? 53.222 47.210  73.963 1.00 36.38  ? 19   LEU B N     1 
ATOM   4098 C  CA    . LEU F 3 19  ? 54.101 46.214  73.354 1.00 36.75  ? 19   LEU B CA    1 
ATOM   4099 C  C     . LEU F 3 19  ? 55.116 45.599  74.328 1.00 37.35  ? 19   LEU B C     1 
ATOM   4100 O  O     . LEU F 3 19  ? 55.731 44.575  74.030 1.00 36.97  ? 19   LEU B O     1 
ATOM   4101 C  CB    . LEU F 3 19  ? 54.833 46.825  72.155 1.00 36.27  ? 19   LEU B CB    1 
ATOM   4102 C  CG    . LEU F 3 19  ? 54.194 46.601  70.775 1.00 36.31  ? 19   LEU B CG    1 
ATOM   4103 C  CD1   . LEU F 3 19  ? 52.742 47.009  70.792 1.00 33.47  ? 19   LEU B CD1   1 
ATOM   4104 C  CD2   . LEU F 3 19  ? 54.952 47.401  69.720 1.00 34.58  ? 19   LEU B CD2   1 
ATOM   4105 N  N     . ASN F 3 20  ? 55.285 46.226  75.488 1.00 38.39  ? 20   ASN B N     1 
ATOM   4106 C  CA    . ASN F 3 20  ? 56.219 45.749  76.507 1.00 36.58  ? 20   ASN B CA    1 
ATOM   4107 C  C     . ASN F 3 20  ? 55.691 46.191  77.862 1.00 36.21  ? 20   ASN B C     1 
ATOM   4108 O  O     . ASN F 3 20  ? 56.205 47.126  78.464 1.00 37.15  ? 20   ASN B O     1 
ATOM   4109 C  CB    . ASN F 3 20  ? 57.606 46.342  76.274 1.00 36.60  ? 20   ASN B CB    1 
ATOM   4110 C  CG    . ASN F 3 20  ? 58.587 45.964  77.366 1.00 39.65  ? 20   ASN B CG    1 
ATOM   4111 O  OD1   . ASN F 3 20  ? 58.208 45.374  78.378 1.00 42.19  ? 20   ASN B OD1   1 
ATOM   4112 N  ND2   . ASN F 3 20  ? 59.853 46.310  77.172 1.00 38.18  ? 20   ASN B ND2   1 
ATOM   4113 N  N     . PRO F 3 21  ? 54.646 45.514  78.357 1.00 36.47  ? 21   PRO B N     1 
ATOM   4114 C  CA    . PRO F 3 21  ? 53.965 45.761  79.630 1.00 35.38  ? 21   PRO B CA    1 
ATOM   4115 C  C     . PRO F 3 21  ? 54.798 46.033  80.890 1.00 36.45  ? 21   PRO B C     1 
ATOM   4116 O  O     . PRO F 3 21  ? 54.343 46.755  81.786 1.00 35.18  ? 21   PRO B O     1 
ATOM   4117 C  CB    . PRO F 3 21  ? 53.075 44.533  79.770 1.00 37.37  ? 21   PRO B CB    1 
ATOM   4118 C  CG    . PRO F 3 21  ? 52.687 44.270  78.351 1.00 35.28  ? 21   PRO B CG    1 
ATOM   4119 C  CD    . PRO F 3 21  ? 54.013 44.387  77.646 1.00 36.36  ? 21   PRO B CD    1 
ATOM   4120 N  N     . SER F 3 22  ? 56.004 45.478  80.978 1.00 36.23  ? 22   SER B N     1 
ATOM   4121 C  CA    . SER F 3 22  ? 56.814 45.715  82.171 1.00 37.18  ? 22   SER B CA    1 
ATOM   4122 C  C     . SER F 3 22  ? 57.148 47.197  82.305 1.00 39.12  ? 22   SER B C     1 
ATOM   4123 O  O     . SER F 3 22  ? 57.617 47.648  83.357 1.00 37.74  ? 22   SER B O     1 
ATOM   4124 C  CB    . SER F 3 22  ? 58.105 44.877  82.143 1.00 37.19  ? 22   SER B CB    1 
ATOM   4125 O  OG    . SER F 3 22  ? 58.887 45.120  80.984 1.00 37.77  ? 22   SER B OG    1 
ATOM   4126 N  N     . LEU F 3 23  ? 56.894 47.955  81.240 1.00 39.13  ? 23   LEU B N     1 
ATOM   4127 C  CA    . LEU F 3 23  ? 57.161 49.394  81.242 1.00 40.22  ? 23   LEU B CA    1 
ATOM   4128 C  C     . LEU F 3 23  ? 56.166 50.157  82.113 1.00 40.18  ? 23   LEU B C     1 
ATOM   4129 O  O     . LEU F 3 23  ? 56.484 51.227  82.629 1.00 40.38  ? 23   LEU B O     1 
ATOM   4130 C  CB    . LEU F 3 23  ? 57.109 49.953  79.812 1.00 39.49  ? 23   LEU B CB    1 
ATOM   4131 C  CG    . LEU F 3 23  ? 58.193 49.497  78.836 1.00 39.85  ? 23   LEU B CG    1 
ATOM   4132 C  CD1   . LEU F 3 23  ? 57.894 50.023  77.441 1.00 39.30  ? 23   LEU B CD1   1 
ATOM   4133 C  CD2   . LEU F 3 23  ? 59.537 49.993  79.320 1.00 38.97  ? 23   LEU B CD2   1 
ATOM   4134 N  N     . LYS F 3 24  ? 54.965 49.604  82.266 1.00 41.30  ? 24   LYS B N     1 
ATOM   4135 C  CA    . LYS F 3 24  ? 53.908 50.232  83.063 1.00 44.29  ? 24   LYS B CA    1 
ATOM   4136 C  C     . LYS F 3 24  ? 54.397 50.700  84.426 1.00 43.48  ? 24   LYS B C     1 
ATOM   4137 O  O     . LYS F 3 24  ? 55.146 49.992  85.098 1.00 42.84  ? 24   LYS B O     1 
ATOM   4138 C  CB    . LYS F 3 24  ? 52.744 49.255  83.278 1.00 47.09  ? 24   LYS B CB    1 
ATOM   4139 C  CG    . LYS F 3 24  ? 52.010 48.833  82.021 1.00 52.27  ? 24   LYS B CG    1 
ATOM   4140 C  CD    . LYS F 3 24  ? 51.230 49.986  81.428 1.00 55.79  ? 24   LYS B CD    1 
ATOM   4141 C  CE    . LYS F 3 24  ? 50.449 49.549  80.194 1.00 58.57  ? 24   LYS B CE    1 
ATOM   4142 N  NZ    . LYS F 3 24  ? 49.687 50.693  79.609 1.00 58.60  ? 24   LYS B NZ    1 
ATOM   4143 N  N     . GLY F 3 25  ? 53.962 51.888  84.834 1.00 42.97  ? 25   GLY B N     1 
ATOM   4144 C  CA    . GLY F 3 25  ? 54.354 52.412  86.130 1.00 44.74  ? 25   GLY B CA    1 
ATOM   4145 C  C     . GLY F 3 25  ? 55.678 53.150  86.163 1.00 46.33  ? 25   GLY B C     1 
ATOM   4146 O  O     . GLY F 3 25  ? 55.870 54.034  86.995 1.00 47.90  ? 25   GLY B O     1 
ATOM   4147 N  N     . LYS F 3 26  ? 56.593 52.791  85.269 1.00 47.04  ? 26   LYS B N     1 
ATOM   4148 C  CA    . LYS F 3 26  ? 57.900 53.438  85.206 1.00 47.38  ? 26   LYS B CA    1 
ATOM   4149 C  C     . LYS F 3 26  ? 57.816 54.589  84.217 1.00 46.90  ? 26   LYS B C     1 
ATOM   4150 O  O     . LYS F 3 26  ? 57.092 54.506  83.229 1.00 46.74  ? 26   LYS B O     1 
ATOM   4151 C  CB    . LYS F 3 26  ? 58.967 52.466  84.698 1.00 50.34  ? 26   LYS B CB    1 
ATOM   4152 C  CG    . LYS F 3 26  ? 59.005 51.099  85.365 1.00 52.91  ? 26   LYS B CG    1 
ATOM   4153 C  CD    . LYS F 3 26  ? 59.945 50.177  84.592 1.00 54.63  ? 26   LYS B CD    1 
ATOM   4154 C  CE    . LYS F 3 26  ? 59.934 48.761  85.143 1.00 55.58  ? 26   LYS B CE    1 
ATOM   4155 N  NZ    . LYS F 3 26  ? 60.795 47.859  84.325 1.00 56.93  ? 26   LYS B NZ    1 
ATOM   4156 N  N     . PRO F 3 27  ? 58.559 55.680  84.463 1.00 46.44  ? 27   PRO B N     1 
ATOM   4157 C  CA    . PRO F 3 27  ? 58.514 56.808  83.527 1.00 45.24  ? 27   PRO B CA    1 
ATOM   4158 C  C     . PRO F 3 27  ? 59.128 56.354  82.207 1.00 43.70  ? 27   PRO B C     1 
ATOM   4159 O  O     . PRO F 3 27  ? 60.204 55.751  82.202 1.00 44.17  ? 27   PRO B O     1 
ATOM   4160 C  CB    . PRO F 3 27  ? 59.361 57.865  84.227 1.00 45.63  ? 27   PRO B CB    1 
ATOM   4161 C  CG    . PRO F 3 27  ? 60.383 57.029  84.954 1.00 46.42  ? 27   PRO B CG    1 
ATOM   4162 C  CD    . PRO F 3 27  ? 59.531 55.928  85.542 1.00 45.79  ? 27   PRO B CD    1 
ATOM   4163 N  N     . VAL F 3 28  ? 58.440 56.609  81.095 1.00 40.61  ? 28   VAL B N     1 
ATOM   4164 C  CA    . VAL F 3 28  ? 58.955 56.208  79.783 1.00 37.29  ? 28   VAL B CA    1 
ATOM   4165 C  C     . VAL F 3 28  ? 59.079 57.422  78.875 1.00 34.51  ? 28   VAL B C     1 
ATOM   4166 O  O     . VAL F 3 28  ? 58.190 58.268  78.838 1.00 33.16  ? 28   VAL B O     1 
ATOM   4167 C  CB    . VAL F 3 28  ? 58.044 55.166  79.104 1.00 36.56  ? 28   VAL B CB    1 
ATOM   4168 C  CG1   . VAL F 3 28  ? 58.658 54.729  77.782 1.00 36.90  ? 28   VAL B CG1   1 
ATOM   4169 C  CG2   . VAL F 3 28  ? 57.866 53.960  80.013 1.00 37.07  ? 28   VAL B CG2   1 
ATOM   4170 N  N     . VAL F 3 29  ? 60.184 57.496  78.144 1.00 32.62  ? 29   VAL B N     1 
ATOM   4171 C  CA    . VAL F 3 29  ? 60.448 58.628  77.263 1.00 32.33  ? 29   VAL B CA    1 
ATOM   4172 C  C     . VAL F 3 29  ? 60.748 58.188  75.833 1.00 30.10  ? 29   VAL B C     1 
ATOM   4173 O  O     . VAL F 3 29  ? 61.749 57.518  75.581 1.00 31.35  ? 29   VAL B O     1 
ATOM   4174 C  CB    . VAL F 3 29  ? 61.651 59.461  77.794 1.00 34.24  ? 29   VAL B CB    1 
ATOM   4175 C  CG1   . VAL F 3 29  ? 61.793 60.760  77.002 1.00 33.63  ? 29   VAL B CG1   1 
ATOM   4176 C  CG2   . VAL F 3 29  ? 61.466 59.759  79.269 1.00 31.55  ? 29   VAL B CG2   1 
ATOM   4177 N  N     . VAL F 3 30  ? 59.871 58.552  74.901 1.00 28.53  ? 30   VAL B N     1 
ATOM   4178 C  CA    . VAL F 3 30  ? 60.070 58.201  73.495 1.00 26.96  ? 30   VAL B CA    1 
ATOM   4179 C  C     . VAL F 3 30  ? 60.901 59.319  72.870 1.00 27.41  ? 30   VAL B C     1 
ATOM   4180 O  O     . VAL F 3 30  ? 60.501 60.488  72.871 1.00 27.82  ? 30   VAL B O     1 
ATOM   4181 C  CB    . VAL F 3 30  ? 58.719 58.032  72.774 1.00 24.19  ? 30   VAL B CB    1 
ATOM   4182 C  CG1   . VAL F 3 30  ? 58.941 57.717  71.309 1.00 23.36  ? 30   VAL B CG1   1 
ATOM   4183 C  CG2   . VAL F 3 30  ? 57.941 56.894  73.428 1.00 20.73  ? 30   VAL B CG2   1 
ATOM   4184 N  N     . CYS F 3 31  ? 62.058 58.946  72.333 1.00 29.14  ? 31   CYS B N     1 
ATOM   4185 C  CA    . CYS F 3 31  ? 63.003 59.914  71.790 1.00 30.25  ? 31   CYS B CA    1 
ATOM   4186 C  C     . CYS F 3 31  ? 63.339 59.902  70.309 1.00 30.28  ? 31   CYS B C     1 
ATOM   4187 O  O     . CYS F 3 31  ? 63.262 58.868  69.644 1.00 30.52  ? 31   CYS B O     1 
ATOM   4188 C  CB    . CYS F 3 31  ? 64.315 59.783  72.554 1.00 32.13  ? 31   CYS B CB    1 
ATOM   4189 S  SG    . CYS F 3 31  ? 64.133 59.769  74.337 1.00 37.00  ? 31   CYS B SG    1 
ATOM   4190 N  N     . VAL F 3 32  ? 63.742 61.077  69.821 1.00 29.69  ? 32   VAL B N     1 
ATOM   4191 C  CA    . VAL F 3 32  ? 64.165 61.260  68.438 1.00 30.82  ? 32   VAL B CA    1 
ATOM   4192 C  C     . VAL F 3 32  ? 65.646 61.612  68.511 1.00 30.62  ? 32   VAL B C     1 
ATOM   4193 O  O     . VAL F 3 32  ? 66.002 62.769  68.723 1.00 30.18  ? 32   VAL B O     1 
ATOM   4194 C  CB    . VAL F 3 32  ? 63.436 62.441  67.737 1.00 31.70  ? 32   VAL B CB    1 
ATOM   4195 C  CG1   . VAL F 3 32  ? 63.743 62.415  66.243 1.00 31.46  ? 32   VAL B CG1   1 
ATOM   4196 C  CG2   . VAL F 3 32  ? 61.937 62.363  67.970 1.00 33.09  ? 32   VAL B CG2   1 
ATOM   4197 N  N     . PHE F 3 33  ? 66.501 60.609  68.346 1.00 32.76  ? 33   PHE B N     1 
ATOM   4198 C  CA    . PHE F 3 33  ? 67.949 60.794  68.407 1.00 36.13  ? 33   PHE B CA    1 
ATOM   4199 C  C     . PHE F 3 33  ? 68.494 61.369  67.095 1.00 37.06  ? 33   PHE B C     1 
ATOM   4200 O  O     . PHE F 3 33  ? 68.415 60.724  66.056 1.00 37.01  ? 33   PHE B O     1 
ATOM   4201 C  CB    . PHE F 3 33  ? 68.615 59.446  68.719 1.00 38.87  ? 33   PHE B CB    1 
ATOM   4202 C  CG    . PHE F 3 33  ? 68.275 58.894  70.088 1.00 40.49  ? 33   PHE B CG    1 
ATOM   4203 C  CD1   . PHE F 3 33  ? 68.797 59.480  71.241 1.00 41.54  ? 33   PHE B CD1   1 
ATOM   4204 C  CD2   . PHE F 3 33  ? 67.447 57.781  70.223 1.00 40.44  ? 33   PHE B CD2   1 
ATOM   4205 C  CE1   . PHE F 3 33  ? 68.499 58.961  72.511 1.00 42.17  ? 33   PHE B CE1   1 
ATOM   4206 C  CE2   . PHE F 3 33  ? 67.146 57.258  71.488 1.00 41.89  ? 33   PHE B CE2   1 
ATOM   4207 C  CZ    . PHE F 3 33  ? 67.675 57.852  72.632 1.00 40.17  ? 33   PHE B CZ    1 
ATOM   4208 N  N     . SER F 3 34  ? 69.050 62.577  67.154 1.00 39.10  ? 34   SER B N     1 
ATOM   4209 C  CA    . SER F 3 34  ? 69.581 63.250  65.966 1.00 42.53  ? 34   SER B CA    1 
ATOM   4210 C  C     . SER F 3 34  ? 70.922 62.707  65.486 1.00 44.18  ? 34   SER B C     1 
ATOM   4211 O  O     . SER F 3 34  ? 71.269 62.847  64.315 1.00 44.58  ? 34   SER B O     1 
ATOM   4212 C  CB    . SER F 3 34  ? 69.709 64.750  66.222 1.00 42.71  ? 34   SER B CB    1 
ATOM   4213 O  OG    . SER F 3 34  ? 70.678 65.005  67.212 1.00 42.08  ? 34   SER B OG    1 
ATOM   4214 N  N     . GLY F 3 35  ? 71.689 62.123  66.398 1.00 46.36  ? 35   GLY B N     1 
ATOM   4215 C  CA    . GLY F 3 35  ? 72.959 61.534  66.018 1.00 48.90  ? 35   GLY B CA    1 
ATOM   4216 C  C     . GLY F 3 35  ? 74.198 62.394  65.860 1.00 51.00  ? 35   GLY B C     1 
ATOM   4217 O  O     . GLY F 3 35  ? 75.172 61.939  65.261 1.00 53.05  ? 35   GLY B O     1 
ATOM   4218 N  N     . ARG F 3 36  ? 74.200 63.620  66.368 1.00 52.12  ? 36   ARG B N     1 
ATOM   4219 C  CA    . ARG F 3 36  ? 75.405 64.428  66.236 1.00 54.33  ? 36   ARG B CA    1 
ATOM   4220 C  C     . ARG F 3 36  ? 76.298 64.322  67.469 1.00 55.42  ? 36   ARG B C     1 
ATOM   4221 O  O     . ARG F 3 36  ? 77.322 64.991  67.569 1.00 55.93  ? 36   ARG B O     1 
ATOM   4222 C  CB    . ARG F 3 36  ? 75.068 65.890  65.932 1.00 53.84  ? 36   ARG B CB    1 
ATOM   4223 C  CG    . ARG F 3 36  ? 73.996 66.537  66.776 1.00 54.82  ? 36   ARG B CG    1 
ATOM   4224 C  CD    . ARG F 3 36  ? 74.001 68.043  66.508 1.00 55.61  ? 36   ARG B CD    1 
ATOM   4225 N  NE    . ARG F 3 36  ? 74.228 68.322  65.091 1.00 55.93  ? 36   ARG B NE    1 
ATOM   4226 C  CZ    . ARG F 3 36  ? 74.637 69.489  64.597 1.00 55.61  ? 36   ARG B CZ    1 
ATOM   4227 N  NH1   . ARG F 3 36  ? 74.874 70.520  65.394 1.00 53.95  ? 36   ARG B NH1   1 
ATOM   4228 N  NH2   . ARG F 3 36  ? 74.826 69.619  63.294 1.00 55.21  ? 36   ARG B NH2   1 
ATOM   4229 N  N     . PHE F 3 37  ? 75.895 63.461  68.397 1.00 56.38  ? 37   PHE B N     1 
ATOM   4230 C  CA    . PHE F 3 37  ? 76.631 63.197  69.631 1.00 57.07  ? 37   PHE B CA    1 
ATOM   4231 C  C     . PHE F 3 37  ? 75.714 62.465  70.605 1.00 57.29  ? 37   PHE B C     1 
ATOM   4232 O  O     . PHE F 3 37  ? 74.504 62.694  70.610 1.00 57.83  ? 37   PHE B O     1 
ATOM   4233 C  CB    . PHE F 3 37  ? 77.183 64.496  70.251 1.00 56.22  ? 37   PHE B CB    1 
ATOM   4234 C  CG    . PHE F 3 37  ? 76.137 65.425  70.805 1.00 55.81  ? 37   PHE B CG    1 
ATOM   4235 C  CD1   . PHE F 3 37  ? 75.479 65.132  72.000 1.00 55.43  ? 37   PHE B CD1   1 
ATOM   4236 C  CD2   . PHE F 3 37  ? 75.846 66.621  70.159 1.00 55.00  ? 37   PHE B CD2   1 
ATOM   4237 C  CE1   . PHE F 3 37  ? 74.550 66.022  72.546 1.00 55.73  ? 37   PHE B CE1   1 
ATOM   4238 C  CE2   . PHE F 3 37  ? 74.918 67.519  70.696 1.00 56.00  ? 37   PHE B CE2   1 
ATOM   4239 C  CZ    . PHE F 3 37  ? 74.270 67.217  71.893 1.00 55.81  ? 37   PHE B CZ    1 
ATOM   4240 N  N     . GLU F 3 38  ? 76.287 61.574  71.410 1.00 57.63  ? 38   GLU B N     1 
ATOM   4241 C  CA    . GLU F 3 38  ? 75.511 60.795  72.371 1.00 57.50  ? 38   GLU B CA    1 
ATOM   4242 C  C     . GLU F 3 38  ? 74.363 61.579  72.996 1.00 55.15  ? 38   GLU B C     1 
ATOM   4243 O  O     . GLU F 3 38  ? 74.566 62.634  73.606 1.00 54.34  ? 38   GLU B O     1 
ATOM   4244 C  CB    . GLU F 3 38  ? 76.415 60.236  73.481 1.00 60.56  ? 38   GLU B CB    1 
ATOM   4245 C  CG    . GLU F 3 38  ? 75.633 59.630  74.651 1.00 65.78  ? 38   GLU B CG    1 
ATOM   4246 C  CD    . GLU F 3 38  ? 76.413 58.575  75.422 1.00 67.48  ? 38   GLU B CD    1 
ATOM   4247 O  OE1   . GLU F 3 38  ? 75.896 58.092  76.453 1.00 68.22  ? 38   GLU B OE1   1 
ATOM   4248 O  OE2   . GLU F 3 38  ? 77.533 58.222  74.995 1.00 69.34  ? 38   GLU B OE2   1 
ATOM   4249 N  N     . ASP F 3 39  ? 73.157 61.049  72.824 1.00 51.60  ? 39   ASP B N     1 
ATOM   4250 C  CA    . ASP F 3 39  ? 71.950 61.658  73.359 1.00 48.92  ? 39   ASP B CA    1 
ATOM   4251 C  C     . ASP F 3 39  ? 71.551 62.994  72.740 1.00 45.84  ? 39   ASP B C     1 
ATOM   4252 O  O     . ASP F 3 39  ? 70.907 63.815  73.390 1.00 45.04  ? 39   ASP B O     1 
ATOM   4253 C  CB    . ASP F 3 39  ? 72.059 61.806  74.882 1.00 51.10  ? 39   ASP B CB    1 
ATOM   4254 C  CG    . ASP F 3 39  ? 72.156 60.464  75.596 1.00 52.91  ? 39   ASP B CG    1 
ATOM   4255 O  OD1   . ASP F 3 39  ? 71.438 59.522  75.193 1.00 53.31  ? 39   ASP B OD1   1 
ATOM   4256 O  OD2   . ASP F 3 39  ? 72.938 60.352  76.565 1.00 53.96  ? 39   ASP B OD2   1 
ATOM   4257 N  N     . SER F 3 40  ? 71.939 63.226  71.490 1.00 42.86  ? 40   SER B N     1 
ATOM   4258 C  CA    . SER F 3 40  ? 71.541 64.462  70.815 1.00 39.65  ? 40   SER B CA    1 
ATOM   4259 C  C     . SER F 3 40  ? 70.142 64.171  70.265 1.00 36.79  ? 40   SER B C     1 
ATOM   4260 O  O     . SER F 3 40  ? 69.886 63.077  69.768 1.00 34.55  ? 40   SER B O     1 
ATOM   4261 C  CB    . SER F 3 40  ? 72.483 64.779  69.656 1.00 37.06  ? 40   SER B CB    1 
ATOM   4262 O  OG    . SER F 3 40  ? 72.390 63.772  68.663 1.00 38.84  ? 40   SER B OG    1 
ATOM   4263 N  N     . GLY F 3 41  ? 69.238 65.136  70.368 1.00 36.49  ? 41   GLY B N     1 
ATOM   4264 C  CA    . GLY F 3 41  ? 67.891 64.926  69.874 1.00 35.64  ? 41   GLY B CA    1 
ATOM   4265 C  C     . GLY F 3 41  ? 66.827 65.453  70.817 1.00 35.86  ? 41   GLY B C     1 
ATOM   4266 O  O     . GLY F 3 41  ? 67.135 66.036  71.858 1.00 33.82  ? 41   GLY B O     1 
ATOM   4267 N  N     . ALA F 3 42  ? 65.565 65.234  70.459 1.00 35.62  ? 42   ALA B N     1 
ATOM   4268 C  CA    . ALA F 3 42  ? 64.462 65.707  71.278 1.00 34.69  ? 42   ALA B CA    1 
ATOM   4269 C  C     . ALA F 3 42  ? 63.502 64.604  71.719 1.00 33.97  ? 42   ALA B C     1 
ATOM   4270 O  O     . ALA F 3 42  ? 63.457 63.518  71.135 1.00 32.62  ? 42   ALA B O     1 
ATOM   4271 C  CB    . ALA F 3 42  ? 63.695 66.787  70.522 1.00 35.63  ? 42   ALA B CB    1 
ATOM   4272 N  N     . VAL F 3 43  ? 62.746 64.902  72.770 1.00 33.79  ? 43   VAL B N     1 
ATOM   4273 C  CA    . VAL F 3 43  ? 61.750 63.988  73.301 1.00 32.44  ? 43   VAL B CA    1 
ATOM   4274 C  C     . VAL F 3 43  ? 60.493 64.178  72.454 1.00 30.00  ? 43   VAL B C     1 
ATOM   4275 O  O     . VAL F 3 43  ? 60.022 65.303  72.304 1.00 27.16  ? 43   VAL B O     1 
ATOM   4276 C  CB    . VAL F 3 43  ? 61.396 64.328  74.776 1.00 32.68  ? 43   VAL B CB    1 
ATOM   4277 C  CG1   . VAL F 3 43  ? 60.165 63.529  75.217 1.00 31.53  ? 43   VAL B CG1   1 
ATOM   4278 C  CG2   . VAL F 3 43  ? 62.582 64.025  75.686 1.00 31.57  ? 43   VAL B CG2   1 
ATOM   4279 N  N     . ALA F 3 44  ? 59.978 63.090  71.884 1.00 28.59  ? 44   ALA B N     1 
ATOM   4280 C  CA    . ALA F 3 44  ? 58.758 63.151  71.076 1.00 28.11  ? 44   ALA B CA    1 
ATOM   4281 C  C     . ALA F 3 44  ? 57.600 63.240  72.054 1.00 28.34  ? 44   ALA B C     1 
ATOM   4282 O  O     . ALA F 3 44  ? 56.640 63.973  71.832 1.00 25.82  ? 44   ALA B O     1 
ATOM   4283 C  CB    . ALA F 3 44  ? 58.620 61.901  70.218 1.00 26.63  ? 44   ALA B CB    1 
ATOM   4284 N  N     . THR F 3 45  ? 57.688 62.453  73.124 1.00 27.24  ? 45   THR B N     1 
ATOM   4285 C  CA    . THR F 3 45  ? 56.688 62.476  74.182 1.00 27.96  ? 45   THR B CA    1 
ATOM   4286 C  C     . THR F 3 45  ? 57.114 61.561  75.320 1.00 29.35  ? 45   THR B C     1 
ATOM   4287 O  O     . THR F 3 45  ? 58.040 60.768  75.167 1.00 31.23  ? 45   THR B O     1 
ATOM   4288 C  CB    . THR F 3 45  ? 55.303 62.031  73.692 1.00 28.38  ? 45   THR B CB    1 
ATOM   4289 O  OG1   . THR F 3 45  ? 54.328 62.430  74.658 1.00 28.93  ? 45   THR B OG1   1 
ATOM   4290 C  CG2   . THR F 3 45  ? 55.238 60.524  73.540 1.00 26.86  ? 45   THR B CG2   1 
ATOM   4291 N  N     . ALA F 3 46  ? 56.446 61.674  76.463 1.00 29.27  ? 46   ALA B N     1 
ATOM   4292 C  CA    . ALA F 3 46  ? 56.768 60.823  77.608 1.00 30.59  ? 46   ALA B CA    1 
ATOM   4293 C  C     . ALA F 3 46  ? 55.466 60.484  78.317 1.00 31.39  ? 46   ALA B C     1 
ATOM   4294 O  O     . ALA F 3 46  ? 54.491 61.221  78.176 1.00 29.47  ? 46   ALA B O     1 
ATOM   4295 C  CB    . ALA F 3 46  ? 57.708 61.553  78.560 1.00 29.17  ? 46   ALA B CB    1 
ATOM   4296 N  N     . ASN F 3 47  ? 55.432 59.377  79.062 1.00 32.08  ? 47   ASN B N     1 
ATOM   4297 C  CA    . ASN F 3 47  ? 54.201 59.034  79.773 1.00 35.53  ? 47   ASN B CA    1 
ATOM   4298 C  C     . ASN F 3 47  ? 54.027 59.987  80.946 1.00 37.19  ? 47   ASN B C     1 
ATOM   4299 O  O     . ASN F 3 47  ? 54.922 60.787  81.246 1.00 34.90  ? 47   ASN B O     1 
ATOM   4300 C  CB    . ASN F 3 47  ? 54.188 57.578  80.256 1.00 35.89  ? 47   ASN B CB    1 
ATOM   4301 C  CG    . ASN F 3 47  ? 55.339 57.246  81.184 1.00 39.40  ? 47   ASN B CG    1 
ATOM   4302 O  OD1   . ASN F 3 47  ? 55.903 58.120  81.844 1.00 37.83  ? 47   ASN B OD1   1 
ATOM   4303 N  ND2   . ASN F 3 47  ? 55.680 55.962  81.254 1.00 38.45  ? 47   ASN B ND2   1 
ATOM   4304 N  N     . TYR F 3 48  ? 52.880 59.912  81.608 1.00 38.46  ? 48   TYR B N     1 
ATOM   4305 C  CA    . TYR F 3 48  ? 52.606 60.826  82.702 1.00 41.07  ? 48   TYR B CA    1 
ATOM   4306 C  C     . TYR F 3 48  ? 53.541 60.753  83.894 1.00 41.88  ? 48   TYR B C     1 
ATOM   4307 O  O     . TYR F 3 48  ? 53.735 61.751  84.582 1.00 41.93  ? 48   TYR B O     1 
ATOM   4308 C  CB    . TYR F 3 48  ? 51.149 60.687  83.132 1.00 42.10  ? 48   TYR B CB    1 
ATOM   4309 C  CG    . TYR F 3 48  ? 50.223 61.284  82.099 1.00 44.97  ? 48   TYR B CG    1 
ATOM   4310 C  CD1   . TYR F 3 48  ? 49.964 60.625  80.893 1.00 44.03  ? 48   TYR B CD1   1 
ATOM   4311 C  CD2   . TYR F 3 48  ? 49.677 62.553  82.286 1.00 45.39  ? 48   TYR B CD2   1 
ATOM   4312 C  CE1   . TYR F 3 48  ? 49.191 61.220  79.898 1.00 44.61  ? 48   TYR B CE1   1 
ATOM   4313 C  CE2   . TYR F 3 48  ? 48.906 63.155  81.303 1.00 47.50  ? 48   TYR B CE2   1 
ATOM   4314 C  CZ    . TYR F 3 48  ? 48.669 62.486  80.111 1.00 46.92  ? 48   TYR B CZ    1 
ATOM   4315 O  OH    . TYR F 3 48  ? 47.919 63.118  79.145 1.00 48.47  ? 48   TYR B OH    1 
ATOM   4316 N  N     . GLU F 3 49  ? 54.132 59.588  84.137 1.00 43.51  ? 49   GLU B N     1 
ATOM   4317 C  CA    . GLU F 3 49  ? 55.066 59.456  85.248 1.00 44.91  ? 49   GLU B CA    1 
ATOM   4318 C  C     . GLU F 3 49  ? 56.207 60.443  85.002 1.00 43.75  ? 49   GLU B C     1 
ATOM   4319 O  O     . GLU F 3 49  ? 56.503 61.301  85.840 1.00 42.88  ? 49   GLU B O     1 
ATOM   4320 C  CB    . GLU F 3 49  ? 55.624 58.030  85.329 1.00 48.22  ? 49   GLU B CB    1 
ATOM   4321 C  CG    . GLU F 3 49  ? 54.590 56.949  85.666 1.00 56.63  ? 49   GLU B CG    1 
ATOM   4322 C  CD    . GLU F 3 49  ? 53.723 56.552  84.477 1.00 60.86  ? 49   GLU B CD    1 
ATOM   4323 O  OE1   . GLU F 3 49  ? 54.269 55.978  83.507 1.00 64.93  ? 49   GLU B OE1   1 
ATOM   4324 O  OE2   . GLU F 3 49  ? 52.501 56.813  84.509 1.00 62.66  ? 49   GLU B OE2   1 
ATOM   4325 N  N     . ALA F 3 50  ? 56.831 60.322  83.835 1.00 40.96  ? 50   ALA B N     1 
ATOM   4326 C  CA    . ALA F 3 50  ? 57.933 61.194  83.463 1.00 39.11  ? 50   ALA B CA    1 
ATOM   4327 C  C     . ALA F 3 50  ? 57.487 62.652  83.434 1.00 38.47  ? 50   ALA B C     1 
ATOM   4328 O  O     . ALA F 3 50  ? 58.255 63.558  83.757 1.00 38.79  ? 50   ALA B O     1 
ATOM   4329 C  CB    . ALA F 3 50  ? 58.481 60.783  82.106 1.00 38.09  ? 50   ALA B CB    1 
ATOM   4330 N  N     . ARG F 3 51  ? 56.239 62.883  83.053 1.00 37.02  ? 51   ARG B N     1 
ATOM   4331 C  CA    . ARG F 3 51  ? 55.734 64.244  82.995 1.00 38.28  ? 51   ARG B CA    1 
ATOM   4332 C  C     . ARG F 3 51  ? 55.691 64.911  84.355 1.00 39.73  ? 51   ARG B C     1 
ATOM   4333 O  O     . ARG F 3 51  ? 55.965 66.104  84.473 1.00 38.47  ? 51   ARG B O     1 
ATOM   4334 C  CB    . ARG F 3 51  ? 54.341 64.277  82.368 1.00 36.81  ? 51   ARG B CB    1 
ATOM   4335 C  CG    . ARG F 3 51  ? 54.360 64.725  80.930 1.00 36.83  ? 51   ARG B CG    1 
ATOM   4336 C  CD    . ARG F 3 51  ? 53.016 64.569  80.276 1.00 36.39  ? 51   ARG B CD    1 
ATOM   4337 N  NE    . ARG F 3 51  ? 53.087 63.634  79.159 1.00 34.24  ? 51   ARG B NE    1 
ATOM   4338 C  CZ    . ARG F 3 51  ? 52.139 63.527  78.239 1.00 36.60  ? 51   ARG B CZ    1 
ATOM   4339 N  NH1   . ARG F 3 51  ? 51.064 64.302  78.325 1.00 34.05  ? 51   ARG B NH1   1 
ATOM   4340 N  NH2   . ARG F 3 51  ? 52.266 62.665  77.232 1.00 33.80  ? 51   ARG B NH2   1 
ATOM   4341 N  N     . LYS F 3 52  ? 55.335 64.147  85.381 1.00 42.39  ? 52   LYS B N     1 
ATOM   4342 C  CA    . LYS F 3 52  ? 55.266 64.697  86.725 1.00 44.19  ? 52   LYS B CA    1 
ATOM   4343 C  C     . LYS F 3 52  ? 56.602 65.345  87.077 1.00 44.48  ? 52   LYS B C     1 
ATOM   4344 O  O     . LYS F 3 52  ? 56.650 66.335  87.807 1.00 45.12  ? 52   LYS B O     1 
ATOM   4345 C  CB    . LYS F 3 52  ? 54.906 63.594  87.730 1.00 44.94  ? 52   LYS B CB    1 
ATOM   4346 C  CG    . LYS F 3 52  ? 53.406 63.303  87.787 1.00 47.71  ? 52   LYS B CG    1 
ATOM   4347 C  CD    . LYS F 3 52  ? 53.053 62.169  88.741 1.00 52.07  ? 52   LYS B CD    1 
ATOM   4348 C  CE    . LYS F 3 52  ? 53.423 60.812  88.153 1.00 54.63  ? 52   LYS B CE    1 
ATOM   4349 N  NZ    . LYS F 3 52  ? 52.913 59.662  88.965 1.00 54.66  ? 52   LYS B NZ    1 
ATOM   4350 N  N     . PHE F 3 53  ? 57.678 64.807  86.515 1.00 43.19  ? 53   PHE B N     1 
ATOM   4351 C  CA    . PHE F 3 53  ? 59.014 65.326  86.770 1.00 43.53  ? 53   PHE B CA    1 
ATOM   4352 C  C     . PHE F 3 53  ? 59.518 66.351  85.755 1.00 44.41  ? 53   PHE B C     1 
ATOM   4353 O  O     . PHE F 3 53  ? 60.707 66.674  85.729 1.00 44.92  ? 53   PHE B O     1 
ATOM   4354 C  CB    . PHE F 3 53  ? 59.993 64.163  86.866 1.00 41.63  ? 53   PHE B CB    1 
ATOM   4355 C  CG    . PHE F 3 53  ? 59.743 63.275  88.045 1.00 42.68  ? 53   PHE B CG    1 
ATOM   4356 C  CD1   . PHE F 3 53  ? 60.111 63.683  89.327 1.00 41.50  ? 53   PHE B CD1   1 
ATOM   4357 C  CD2   . PHE F 3 53  ? 59.112 62.047  87.885 1.00 39.26  ? 53   PHE B CD2   1 
ATOM   4358 C  CE1   . PHE F 3 53  ? 59.854 62.877  90.433 1.00 39.62  ? 53   PHE B CE1   1 
ATOM   4359 C  CE2   . PHE F 3 53  ? 58.850 61.234  88.983 1.00 40.41  ? 53   PHE B CE2   1 
ATOM   4360 C  CZ    . PHE F 3 53  ? 59.221 61.648  90.260 1.00 39.01  ? 53   PHE B CZ    1 
ATOM   4361 N  N     . GLY F 3 54  ? 58.617 66.864  84.922 1.00 44.08  ? 54   GLY B N     1 
ATOM   4362 C  CA    . GLY F 3 54  ? 59.013 67.862  83.945 1.00 44.71  ? 54   GLY B CA    1 
ATOM   4363 C  C     . GLY F 3 54  ? 59.479 67.332  82.601 1.00 44.63  ? 54   GLY B C     1 
ATOM   4364 O  O     . GLY F 3 54  ? 59.691 68.112  81.677 1.00 44.83  ? 54   GLY B O     1 
ATOM   4365 N  N     . VAL F 3 55  ? 59.658 66.021  82.485 1.00 44.31  ? 55   VAL B N     1 
ATOM   4366 C  CA    . VAL F 3 55  ? 60.080 65.443  81.218 1.00 44.40  ? 55   VAL B CA    1 
ATOM   4367 C  C     . VAL F 3 55  ? 58.871 65.378  80.304 1.00 45.85  ? 55   VAL B C     1 
ATOM   4368 O  O     . VAL F 3 55  ? 57.917 64.642  80.561 1.00 46.61  ? 55   VAL B O     1 
ATOM   4369 C  CB    . VAL F 3 55  ? 60.649 64.027  81.391 1.00 43.47  ? 55   VAL B CB    1 
ATOM   4370 C  CG1   . VAL F 3 55  ? 60.876 63.393  80.027 1.00 43.20  ? 55   VAL B CG1   1 
ATOM   4371 C  CG2   . VAL F 3 55  ? 61.965 64.089  82.148 1.00 42.54  ? 55   VAL B CG2   1 
ATOM   4372 N  N     . LYS F 3 56  ? 58.913 66.162  79.236 1.00 46.94  ? 56   LYS B N     1 
ATOM   4373 C  CA    . LYS F 3 56  ? 57.817 66.213  78.281 1.00 47.03  ? 56   LYS B CA    1 
ATOM   4374 C  C     . LYS F 3 56  ? 58.318 66.448  76.863 1.00 45.20  ? 56   LYS B C     1 
ATOM   4375 O  O     . LYS F 3 56  ? 59.437 66.920  76.647 1.00 42.39  ? 56   LYS B O     1 
ATOM   4376 C  CB    . LYS F 3 56  ? 56.853 67.339  78.662 1.00 49.09  ? 56   LYS B CB    1 
ATOM   4377 C  CG    . LYS F 3 56  ? 57.505 68.710  78.706 1.00 51.47  ? 56   LYS B CG    1 
ATOM   4378 C  CD    . LYS F 3 56  ? 56.541 69.771  79.212 1.00 54.19  ? 56   LYS B CD    1 
ATOM   4379 C  CE    . LYS F 3 56  ? 57.247 71.110  79.382 1.00 55.63  ? 56   LYS B CE    1 
ATOM   4380 N  NZ    . LYS F 3 56  ? 56.344 72.171  79.929 1.00 57.86  ? 56   LYS B NZ    1 
ATOM   4381 N  N     . ALA F 3 57  ? 57.468 66.121  75.898 1.00 44.75  ? 57   ALA B N     1 
ATOM   4382 C  CA    . ALA F 3 57  ? 57.795 66.305  74.493 1.00 44.70  ? 57   ALA B CA    1 
ATOM   4383 C  C     . ALA F 3 57  ? 58.403 67.687  74.294 1.00 43.54  ? 57   ALA B C     1 
ATOM   4384 O  O     . ALA F 3 57  ? 58.016 68.640  74.966 1.00 43.19  ? 57   ALA B O     1 
ATOM   4385 C  CB    . ALA F 3 57  ? 56.535 66.173  73.651 1.00 45.41  ? 57   ALA B CB    1 
ATOM   4386 N  N     . GLY F 3 58  ? 59.365 67.786  73.386 1.00 42.02  ? 58   GLY B N     1 
ATOM   4387 C  CA    . GLY F 3 58  ? 59.977 69.069  73.102 1.00 42.03  ? 58   GLY B CA    1 
ATOM   4388 C  C     . GLY F 3 58  ? 61.310 69.388  73.752 1.00 41.70  ? 58   GLY B C     1 
ATOM   4389 O  O     . GLY F 3 58  ? 62.096 70.151  73.191 1.00 43.38  ? 58   GLY B O     1 
ATOM   4390 N  N     . ILE F 3 59  ? 61.584 68.828  74.925 1.00 39.89  ? 59   ILE B N     1 
ATOM   4391 C  CA    . ILE F 3 59  ? 62.849 69.121  75.591 1.00 38.08  ? 59   ILE B CA    1 
ATOM   4392 C  C     . ILE F 3 59  ? 63.973 68.230  75.086 1.00 36.80  ? 59   ILE B C     1 
ATOM   4393 O  O     . ILE F 3 59  ? 63.749 67.085  74.699 1.00 36.26  ? 59   ILE B O     1 
ATOM   4394 C  CB    . ILE F 3 59  ? 62.754 68.948  77.135 1.00 36.66  ? 59   ILE B CB    1 
ATOM   4395 C  CG1   . ILE F 3 59  ? 62.685 67.463  77.502 1.00 35.75  ? 59   ILE B CG1   1 
ATOM   4396 C  CG2   . ILE F 3 59  ? 61.524 69.678  77.666 1.00 37.96  ? 59   ILE B CG2   1 
ATOM   4397 C  CD1   . ILE F 3 59  ? 62.597 67.206  79.001 1.00 36.46  ? 59   ILE B CD1   1 
ATOM   4398 N  N     . PRO F 3 60  ? 65.205 68.750  75.085 1.00 35.78  ? 60   PRO B N     1 
ATOM   4399 C  CA    . PRO F 3 60  ? 66.326 67.942  74.617 1.00 35.29  ? 60   PRO B CA    1 
ATOM   4400 C  C     . PRO F 3 60  ? 66.398 66.665  75.440 1.00 35.44  ? 60   PRO B C     1 
ATOM   4401 O  O     . PRO F 3 60  ? 65.988 66.644  76.599 1.00 36.34  ? 60   PRO B O     1 
ATOM   4402 C  CB    . PRO F 3 60  ? 67.530 68.848  74.870 1.00 34.73  ? 60   PRO B CB    1 
ATOM   4403 C  CG    . PRO F 3 60  ? 66.958 70.213  74.719 1.00 35.78  ? 60   PRO B CG    1 
ATOM   4404 C  CD    . PRO F 3 60  ? 65.655 70.099  75.469 1.00 35.89  ? 60   PRO B CD    1 
ATOM   4405 N  N     . ILE F 3 61  ? 66.914 65.603  74.838 1.00 34.93  ? 61   ILE B N     1 
ATOM   4406 C  CA    . ILE F 3 61  ? 67.059 64.339  75.532 1.00 36.41  ? 61   ILE B CA    1 
ATOM   4407 C  C     . ILE F 3 61  ? 68.090 64.503  76.660 1.00 40.65  ? 61   ILE B C     1 
ATOM   4408 O  O     . ILE F 3 61  ? 68.021 63.824  77.695 1.00 38.74  ? 61   ILE B O     1 
ATOM   4409 C  CB    . ILE F 3 61  ? 67.537 63.252  74.560 1.00 34.50  ? 61   ILE B CB    1 
ATOM   4410 C  CG1   . ILE F 3 61  ? 66.521 63.105  73.417 1.00 34.01  ? 61   ILE B CG1   1 
ATOM   4411 C  CG2   . ILE F 3 61  ? 67.730 61.933  75.297 1.00 33.52  ? 61   ILE B CG2   1 
ATOM   4412 C  CD1   . ILE F 3 61  ? 67.019 62.249  72.261 1.00 31.27  ? 61   ILE B CD1   1 
ATOM   4413 N  N     . VAL F 3 62  ? 69.044 65.411  76.450 1.00 43.08  ? 62   VAL B N     1 
ATOM   4414 C  CA    . VAL F 3 62  ? 70.096 65.674  77.437 1.00 46.58  ? 62   VAL B CA    1 
ATOM   4415 C  C     . VAL F 3 62  ? 69.496 66.147  78.760 1.00 48.31  ? 62   VAL B C     1 
ATOM   4416 O  O     . VAL F 3 62  ? 69.863 65.649  79.828 1.00 48.33  ? 62   VAL B O     1 
ATOM   4417 C  CB    . VAL F 3 62  ? 71.108 66.730  76.906 1.00 45.88  ? 62   VAL B CB    1 
ATOM   4418 C  CG1   . VAL F 3 62  ? 72.064 67.143  78.002 1.00 46.72  ? 62   VAL B CG1   1 
ATOM   4419 C  CG2   . VAL F 3 62  ? 71.896 66.144  75.739 1.00 46.43  ? 62   VAL B CG2   1 
ATOM   4420 N  N     . GLU F 3 63  ? 68.570 67.099  78.681 1.00 49.72  ? 63   GLU B N     1 
ATOM   4421 C  CA    . GLU F 3 63  ? 67.901 67.626  79.864 1.00 52.42  ? 63   GLU B CA    1 
ATOM   4422 C  C     . GLU F 3 63  ? 67.102 66.517  80.545 1.00 51.79  ? 63   GLU B C     1 
ATOM   4423 O  O     . GLU F 3 63  ? 67.240 66.279  81.748 1.00 52.89  ? 63   GLU B O     1 
ATOM   4424 C  CB    . GLU F 3 63  ? 66.952 68.754  79.472 1.00 56.39  ? 63   GLU B CB    1 
ATOM   4425 C  CG    . GLU F 3 63  ? 67.587 69.823  78.609 1.00 64.12  ? 63   GLU B CG    1 
ATOM   4426 C  CD    . GLU F 3 63  ? 67.423 71.216  79.194 1.00 69.34  ? 63   GLU B CD    1 
ATOM   4427 O  OE1   . GLU F 3 63  ? 68.014 71.488  80.266 1.00 70.19  ? 63   GLU B OE1   1 
ATOM   4428 O  OE2   . GLU F 3 63  ? 66.699 72.035  78.581 1.00 71.35  ? 63   GLU B OE2   1 
ATOM   4429 N  N     . ALA F 3 64  ? 66.258 65.845  79.768 1.00 49.92  ? 64   ALA B N     1 
ATOM   4430 C  CA    . ALA F 3 64  ? 65.443 64.760  80.297 1.00 47.69  ? 64   ALA B CA    1 
ATOM   4431 C  C     . ALA F 3 64  ? 66.310 63.810  81.106 1.00 46.86  ? 64   ALA B C     1 
ATOM   4432 O  O     . ALA F 3 64  ? 65.928 63.382  82.190 1.00 45.95  ? 64   ALA B O     1 
ATOM   4433 C  CB    . ALA F 3 64  ? 64.774 64.009  79.166 1.00 45.61  ? 64   ALA B CB    1 
ATOM   4434 N  N     . LYS F 3 65  ? 67.485 63.486  80.583 1.00 46.12  ? 65   LYS B N     1 
ATOM   4435 C  CA    . LYS F 3 65  ? 68.375 62.576  81.283 1.00 48.35  ? 65   LYS B CA    1 
ATOM   4436 C  C     . LYS F 3 65  ? 68.957 63.154  82.575 1.00 50.31  ? 65   LYS B C     1 
ATOM   4437 O  O     . LYS F 3 65  ? 69.374 62.407  83.456 1.00 49.96  ? 65   LYS B O     1 
ATOM   4438 C  CB    . LYS F 3 65  ? 69.491 62.110  80.347 1.00 45.77  ? 65   LYS B CB    1 
ATOM   4439 C  CG    . LYS F 3 65  ? 68.972 61.202  79.252 1.00 45.97  ? 65   LYS B CG    1 
ATOM   4440 C  CD    . LYS F 3 65  ? 70.058 60.349  78.644 1.00 45.52  ? 65   LYS B CD    1 
ATOM   4441 C  CE    . LYS F 3 65  ? 69.451 59.257  77.789 1.00 45.43  ? 65   LYS B CE    1 
ATOM   4442 N  NZ    . LYS F 3 65  ? 70.454 58.240  77.374 1.00 47.97  ? 65   LYS B NZ    1 
ATOM   4443 N  N     . LYS F 3 66  ? 68.970 64.479  82.697 1.00 52.51  ? 66   LYS B N     1 
ATOM   4444 C  CA    . LYS F 3 66  ? 69.489 65.111  83.905 1.00 55.93  ? 66   LYS B CA    1 
ATOM   4445 C  C     . LYS F 3 66  ? 68.454 64.891  84.999 1.00 56.73  ? 66   LYS B C     1 
ATOM   4446 O  O     . LYS F 3 66  ? 68.785 64.494  86.117 1.00 56.46  ? 66   LYS B O     1 
ATOM   4447 C  CB    . LYS F 3 66  ? 69.676 66.619  83.703 1.00 57.74  ? 66   LYS B CB    1 
ATOM   4448 C  CG    . LYS F 3 66  ? 70.432 67.018  82.448 1.00 61.21  ? 66   LYS B CG    1 
ATOM   4449 C  CD    . LYS F 3 66  ? 71.937 67.094  82.647 1.00 63.45  ? 66   LYS B CD    1 
ATOM   4450 C  CE    . LYS F 3 66  ? 72.598 67.568  81.354 1.00 65.61  ? 66   LYS B CE    1 
ATOM   4451 N  NZ    . LYS F 3 66  ? 74.059 67.833  81.474 1.00 66.84  ? 66   LYS B NZ    1 
ATOM   4452 N  N     . ILE F 3 67  ? 67.195 65.148  84.650 1.00 57.43  ? 67   ILE B N     1 
ATOM   4453 C  CA    . ILE F 3 67  ? 66.069 65.009  85.568 1.00 56.50  ? 67   ILE B CA    1 
ATOM   4454 C  C     . ILE F 3 67  ? 65.736 63.568  85.937 1.00 57.22  ? 67   ILE B C     1 
ATOM   4455 O  O     . ILE F 3 67  ? 65.697 63.209  87.115 1.00 57.84  ? 67   ILE B O     1 
ATOM   4456 C  CB    . ILE F 3 67  ? 64.804 65.645  84.974 1.00 55.81  ? 67   ILE B CB    1 
ATOM   4457 C  CG1   . ILE F 3 67  ? 65.115 67.056  84.491 1.00 53.95  ? 67   ILE B CG1   1 
ATOM   4458 C  CG2   . ILE F 3 67  ? 63.699 65.675  86.014 1.00 56.80  ? 67   ILE B CG2   1 
ATOM   4459 C  CD1   . ILE F 3 67  ? 63.960 67.711  83.797 1.00 53.59  ? 67   ILE B CD1   1 
ATOM   4460 N  N     . LEU F 3 68  ? 65.490 62.744  84.926 1.00 57.91  ? 68   LEU B N     1 
ATOM   4461 C  CA    . LEU F 3 68  ? 65.141 61.350  85.148 1.00 57.04  ? 68   LEU B CA    1 
ATOM   4462 C  C     . LEU F 3 68  ? 66.166 60.415  84.531 1.00 57.08  ? 68   LEU B C     1 
ATOM   4463 O  O     . LEU F 3 68  ? 65.870 59.671  83.599 1.00 56.84  ? 68   LEU B O     1 
ATOM   4464 C  CB    . LEU F 3 68  ? 63.752 61.064  84.574 1.00 57.40  ? 68   LEU B CB    1 
ATOM   4465 C  CG    . LEU F 3 68  ? 62.626 61.880  85.210 1.00 56.71  ? 68   LEU B CG    1 
ATOM   4466 C  CD1   . LEU F 3 68  ? 61.298 61.546  84.554 1.00 54.76  ? 68   LEU B CD1   1 
ATOM   4467 C  CD2   . LEU F 3 68  ? 62.580 61.582  86.699 1.00 56.54  ? 68   LEU B CD2   1 
ATOM   4468 N  N     . PRO F 3 69  ? 67.392 60.439  85.062 1.00 57.25  ? 69   PRO B N     1 
ATOM   4469 C  CA    . PRO F 3 69  ? 68.528 59.627  84.628 1.00 56.88  ? 69   PRO B CA    1 
ATOM   4470 C  C     . PRO F 3 69  ? 68.215 58.146  84.451 1.00 56.30  ? 69   PRO B C     1 
ATOM   4471 O  O     . PRO F 3 69  ? 68.786 57.481  83.587 1.00 56.09  ? 69   PRO B O     1 
ATOM   4472 C  CB    . PRO F 3 69  ? 69.545 59.855  85.741 1.00 58.53  ? 69   PRO B CB    1 
ATOM   4473 C  CG    . PRO F 3 69  ? 69.276 61.263  86.139 1.00 58.21  ? 69   PRO B CG    1 
ATOM   4474 C  CD    . PRO F 3 69  ? 67.776 61.302  86.194 1.00 57.87  ? 69   PRO B CD    1 
ATOM   4475 N  N     . ASN F 3 70  ? 67.307 57.628  85.266 1.00 55.94  ? 70   ASN B N     1 
ATOM   4476 C  CA    . ASN F 3 70  ? 66.981 56.211  85.197 1.00 55.23  ? 70   ASN B CA    1 
ATOM   4477 C  C     . ASN F 3 70  ? 65.709 55.823  84.447 1.00 54.26  ? 70   ASN B C     1 
ATOM   4478 O  O     . ASN F 3 70  ? 65.432 54.634  84.277 1.00 54.10  ? 70   ASN B O     1 
ATOM   4479 C  CB    . ASN F 3 70  ? 66.953 55.640  86.611 1.00 57.19  ? 70   ASN B CB    1 
ATOM   4480 C  CG    . ASN F 3 70  ? 68.298 55.748  87.294 1.00 58.21  ? 70   ASN B CG    1 
ATOM   4481 O  OD1   . ASN F 3 70  ? 69.280 55.155  86.844 1.00 58.55  ? 70   ASN B OD1   1 
ATOM   4482 N  ND2   . ASN F 3 70  ? 68.358 56.518  88.377 1.00 57.97  ? 70   ASN B ND2   1 
ATOM   4483 N  N     . ALA F 3 71  ? 64.942 56.812  83.998 1.00 51.23  ? 71   ALA B N     1 
ATOM   4484 C  CA    . ALA F 3 71  ? 63.724 56.534  83.249 1.00 48.62  ? 71   ALA B CA    1 
ATOM   4485 C  C     . ALA F 3 71  ? 64.116 55.710  82.027 1.00 46.81  ? 71   ALA B C     1 
ATOM   4486 O  O     . ALA F 3 71  ? 65.291 55.650  81.670 1.00 47.20  ? 71   ALA B O     1 
ATOM   4487 C  CB    . ALA F 3 71  ? 63.065 57.843  82.818 1.00 47.52  ? 71   ALA B CB    1 
ATOM   4488 N  N     . VAL F 3 72  ? 63.148 55.067  81.385 1.00 43.55  ? 72   VAL B N     1 
ATOM   4489 C  CA    . VAL F 3 72  ? 63.456 54.269  80.205 1.00 41.54  ? 72   VAL B CA    1 
ATOM   4490 C  C     . VAL F 3 72  ? 63.382 55.137  78.949 1.00 39.79  ? 72   VAL B C     1 
ATOM   4491 O  O     . VAL F 3 72  ? 62.367 55.779  78.693 1.00 39.41  ? 72   VAL B O     1 
ATOM   4492 C  CB    . VAL F 3 72  ? 62.475 53.093  80.057 1.00 40.56  ? 72   VAL B CB    1 
ATOM   4493 C  CG1   . VAL F 3 72  ? 62.830 52.274  78.833 1.00 36.23  ? 72   VAL B CG1   1 
ATOM   4494 C  CG2   . VAL F 3 72  ? 62.516 52.230  81.307 1.00 41.85  ? 72   VAL B CG2   1 
ATOM   4495 N  N     . TYR F 3 73  ? 64.462 55.153  78.174 1.00 38.73  ? 73   TYR B N     1 
ATOM   4496 C  CA    . TYR F 3 73  ? 64.524 55.941  76.946 1.00 37.95  ? 73   TYR B CA    1 
ATOM   4497 C  C     . TYR F 3 73  ? 64.406 55.044  75.723 1.00 38.03  ? 73   TYR B C     1 
ATOM   4498 O  O     . TYR F 3 73  ? 65.234 54.164  75.496 1.00 39.19  ? 73   TYR B O     1 
ATOM   4499 C  CB    . TYR F 3 73  ? 65.828 56.739  76.920 1.00 37.33  ? 73   TYR B CB    1 
ATOM   4500 C  CG    . TYR F 3 73  ? 65.833 57.806  77.984 1.00 36.63  ? 73   TYR B CG    1 
ATOM   4501 C  CD1   . TYR F 3 73  ? 65.313 59.070  77.726 1.00 36.42  ? 73   TYR B CD1   1 
ATOM   4502 C  CD2   . TYR F 3 73  ? 66.245 57.517  79.283 1.00 37.19  ? 73   TYR B CD2   1 
ATOM   4503 C  CE1   . TYR F 3 73  ? 65.193 60.016  78.734 1.00 36.26  ? 73   TYR B CE1   1 
ATOM   4504 C  CE2   . TYR F 3 73  ? 66.129 58.457  80.301 1.00 36.08  ? 73   TYR B CE2   1 
ATOM   4505 C  CZ    . TYR F 3 73  ? 65.599 59.703  80.019 1.00 35.89  ? 73   TYR B CZ    1 
ATOM   4506 O  OH    . TYR F 3 73  ? 65.450 60.633  81.016 1.00 37.68  ? 73   TYR B OH    1 
ATOM   4507 N  N     . LEU F 3 74  ? 63.364 55.267  74.934 1.00 36.81  ? 74   LEU B N     1 
ATOM   4508 C  CA    . LEU F 3 74  ? 63.139 54.447  73.758 1.00 36.10  ? 74   LEU B CA    1 
ATOM   4509 C  C     . LEU F 3 74  ? 63.188 55.231  72.456 1.00 34.98  ? 74   LEU B C     1 
ATOM   4510 O  O     . LEU F 3 74  ? 62.747 56.380  72.380 1.00 34.97  ? 74   LEU B O     1 
ATOM   4511 C  CB    . LEU F 3 74  ? 61.789 53.736  73.886 1.00 38.85  ? 74   LEU B CB    1 
ATOM   4512 C  CG    . LEU F 3 74  ? 61.641 52.807  75.102 1.00 40.63  ? 74   LEU B CG    1 
ATOM   4513 C  CD1   . LEU F 3 74  ? 60.194 52.355  75.250 1.00 39.90  ? 74   LEU B CD1   1 
ATOM   4514 C  CD2   . LEU F 3 74  ? 62.572 51.607  74.938 1.00 40.78  ? 74   LEU B CD2   1 
ATOM   4515 N  N     . PRO F 3 75  ? 63.741 54.616  71.409 1.00 33.02  ? 75   PRO B N     1 
ATOM   4516 C  CA    . PRO F 3 75  ? 63.829 55.284  70.113 1.00 33.04  ? 75   PRO B CA    1 
ATOM   4517 C  C     . PRO F 3 75  ? 62.435 55.320  69.492 1.00 33.76  ? 75   PRO B C     1 
ATOM   4518 O  O     . PRO F 3 75  ? 61.709 54.323  69.528 1.00 32.62  ? 75   PRO B O     1 
ATOM   4519 C  CB    . PRO F 3 75  ? 64.801 54.398  69.347 1.00 32.66  ? 75   PRO B CB    1 
ATOM   4520 C  CG    . PRO F 3 75  ? 64.472 53.032  69.878 1.00 34.51  ? 75   PRO B CG    1 
ATOM   4521 C  CD    . PRO F 3 75  ? 64.352 53.277  71.358 1.00 32.30  ? 75   PRO B CD    1 
ATOM   4522 N  N     . MET F 3 76  ? 62.054 56.468  68.946 1.00 32.37  ? 76   MET B N     1 
ATOM   4523 C  CA    . MET F 3 76  ? 60.738 56.597  68.337 1.00 34.17  ? 76   MET B CA    1 
ATOM   4524 C  C     . MET F 3 76  ? 60.559 55.603  67.185 1.00 32.88  ? 76   MET B C     1 
ATOM   4525 O  O     . MET F 3 76  ? 61.415 55.487  66.311 1.00 33.69  ? 76   MET B O     1 
ATOM   4526 C  CB    . MET F 3 76  ? 60.536 58.022  67.824 1.00 35.85  ? 76   MET B CB    1 
ATOM   4527 C  CG    . MET F 3 76  ? 59.135 58.307  67.316 1.00 37.49  ? 76   MET B CG    1 
ATOM   4528 S  SD    . MET F 3 76  ? 59.121 59.749  66.276 1.00 39.40  ? 76   MET B SD    1 
ATOM   4529 C  CE    . MET F 3 76  ? 58.410 60.907  67.299 1.00 40.45  ? 76   MET B CE    1 
ATOM   4530 N  N     . ARG F 3 77  ? 59.442 54.884  67.202 1.00 32.37  ? 77   ARG B N     1 
ATOM   4531 C  CA    . ARG F 3 77  ? 59.120 53.907  66.163 1.00 31.89  ? 77   ARG B CA    1 
ATOM   4532 C  C     . ARG F 3 77  ? 57.799 54.306  65.510 1.00 31.86  ? 77   ARG B C     1 
ATOM   4533 O  O     . ARG F 3 77  ? 56.777 53.620  65.638 1.00 27.14  ? 77   ARG B O     1 
ATOM   4534 C  CB    . ARG F 3 77  ? 59.008 52.508  66.766 1.00 31.80  ? 77   ARG B CB    1 
ATOM   4535 C  CG    . ARG F 3 77  ? 60.334 51.963  67.272 1.00 34.27  ? 77   ARG B CG    1 
ATOM   4536 C  CD    . ARG F 3 77  ? 60.210 50.493  67.623 1.00 35.61  ? 77   ARG B CD    1 
ATOM   4537 N  NE    . ARG F 3 77  ? 59.334 50.280  68.770 1.00 37.55  ? 77   ARG B NE    1 
ATOM   4538 C  CZ    . ARG F 3 77  ? 58.961 49.081  69.202 1.00 38.09  ? 77   ARG B CZ    1 
ATOM   4539 N  NH1   . ARG F 3 77  ? 59.388 47.994  68.575 1.00 39.06  ? 77   ARG B NH1   1 
ATOM   4540 N  NH2   . ARG F 3 77  ? 58.172 48.968  70.258 1.00 37.71  ? 77   ARG B NH2   1 
ATOM   4541 N  N     . LYS F 3 78  ? 57.844 55.443  64.824 1.00 31.87  ? 78   LYS B N     1 
ATOM   4542 C  CA    . LYS F 3 78  ? 56.689 56.018  64.140 1.00 33.01  ? 78   LYS B CA    1 
ATOM   4543 C  C     . LYS F 3 78  ? 55.808 55.011  63.401 1.00 32.83  ? 78   LYS B C     1 
ATOM   4544 O  O     . LYS F 3 78  ? 54.605 54.950  63.644 1.00 32.56  ? 78   LYS B O     1 
ATOM   4545 C  CB    . LYS F 3 78  ? 57.167 57.096  63.165 1.00 32.77  ? 78   LYS B CB    1 
ATOM   4546 C  CG    . LYS F 3 78  ? 56.070 57.978  62.592 1.00 36.59  ? 78   LYS B CG    1 
ATOM   4547 C  CD    . LYS F 3 78  ? 55.395 58.777  63.679 1.00 37.16  ? 78   LYS B CD    1 
ATOM   4548 C  CE    . LYS F 3 78  ? 54.409 59.776  63.106 1.00 40.32  ? 78   LYS B CE    1 
ATOM   4549 N  NZ    . LYS F 3 78  ? 55.093 60.950  62.509 1.00 41.32  ? 78   LYS B NZ    1 
ATOM   4550 N  N     . GLU F 3 79  ? 56.406 54.231  62.503 1.00 31.77  ? 79   GLU B N     1 
ATOM   4551 C  CA    . GLU F 3 79  ? 55.662 53.245  61.723 1.00 34.66  ? 79   GLU B CA    1 
ATOM   4552 C  C     . GLU F 3 79  ? 54.805 52.351  62.621 1.00 33.27  ? 79   GLU B C     1 
ATOM   4553 O  O     . GLU F 3 79  ? 53.633 52.100  62.336 1.00 32.77  ? 79   GLU B O     1 
ATOM   4554 C  CB    . GLU F 3 79  ? 56.618 52.362  60.904 1.00 38.46  ? 79   GLU B CB    1 
ATOM   4555 C  CG    . GLU F 3 79  ? 57.977 52.986  60.611 1.00 46.48  ? 79   GLU B CG    1 
ATOM   4556 C  CD    . GLU F 3 79  ? 58.824 53.167  61.867 1.00 50.09  ? 79   GLU B CD    1 
ATOM   4557 O  OE1   . GLU F 3 79  ? 59.180 52.154  62.517 1.00 51.35  ? 79   GLU B OE1   1 
ATOM   4558 O  OE2   . GLU F 3 79  ? 59.126 54.331  62.205 1.00 51.71  ? 79   GLU B OE2   1 
ATOM   4559 N  N     . VAL F 3 80  ? 55.397 51.859  63.701 1.00 31.57  ? 80   VAL B N     1 
ATOM   4560 C  CA    . VAL F 3 80  ? 54.663 51.000  64.622 1.00 30.09  ? 80   VAL B CA    1 
ATOM   4561 C  C     . VAL F 3 80  ? 53.441 51.762  65.138 1.00 29.03  ? 80   VAL B C     1 
ATOM   4562 O  O     . VAL F 3 80  ? 52.315 51.247  65.134 1.00 26.85  ? 80   VAL B O     1 
ATOM   4563 C  CB    . VAL F 3 80  ? 55.550 50.584  65.828 1.00 29.71  ? 80   VAL B CB    1 
ATOM   4564 C  CG1   . VAL F 3 80  ? 54.741 49.751  66.814 1.00 27.98  ? 80   VAL B CG1   1 
ATOM   4565 C  CG2   . VAL F 3 80  ? 56.771 49.793  65.339 1.00 30.15  ? 80   VAL B CG2   1 
ATOM   4566 N  N     . TYR F 3 81  ? 53.668 53.000  65.564 1.00 28.34  ? 81   TYR B N     1 
ATOM   4567 C  CA    . TYR F 3 81  ? 52.592 53.816  66.106 1.00 28.23  ? 81   TYR B CA    1 
ATOM   4568 C  C     . TYR F 3 81  ? 51.517 54.117  65.057 1.00 27.84  ? 81   TYR B C     1 
ATOM   4569 O  O     . TYR F 3 81  ? 50.328 54.192  65.379 1.00 25.23  ? 81   TYR B O     1 
ATOM   4570 C  CB    . TYR F 3 81  ? 53.147 55.136  66.672 1.00 29.03  ? 81   TYR B CB    1 
ATOM   4571 C  CG    . TYR F 3 81  ? 54.402 54.994  67.516 1.00 27.94  ? 81   TYR B CG    1 
ATOM   4572 C  CD1   . TYR F 3 81  ? 54.596 53.891  68.346 1.00 29.40  ? 81   TYR B CD1   1 
ATOM   4573 C  CD2   . TYR F 3 81  ? 55.402 55.961  67.469 1.00 27.70  ? 81   TYR B CD2   1 
ATOM   4574 C  CE1   . TYR F 3 81  ? 55.768 53.755  69.105 1.00 30.89  ? 81   TYR B CE1   1 
ATOM   4575 C  CE2   . TYR F 3 81  ? 56.570 55.837  68.220 1.00 27.49  ? 81   TYR B CE2   1 
ATOM   4576 C  CZ    . TYR F 3 81  ? 56.750 54.735  69.035 1.00 30.49  ? 81   TYR B CZ    1 
ATOM   4577 O  OH    . TYR F 3 81  ? 57.912 54.616  69.774 1.00 29.25  ? 81   TYR B OH    1 
ATOM   4578 N  N     . GLN F 3 82  ? 51.938 54.281  63.807 1.00 27.92  ? 82   GLN B N     1 
ATOM   4579 C  CA    . GLN F 3 82  ? 51.010 54.593  62.727 1.00 29.49  ? 82   GLN B CA    1 
ATOM   4580 C  C     . GLN F 3 82  ? 50.073 53.436  62.437 1.00 29.30  ? 82   GLN B C     1 
ATOM   4581 O  O     . GLN F 3 82  ? 48.900 53.644  62.140 1.00 29.91  ? 82   GLN B O     1 
ATOM   4582 C  CB    . GLN F 3 82  ? 51.770 54.964  61.454 1.00 31.09  ? 82   GLN B CB    1 
ATOM   4583 C  CG    . GLN F 3 82  ? 50.864 55.330  60.286 1.00 35.80  ? 82   GLN B CG    1 
ATOM   4584 C  CD    . GLN F 3 82  ? 49.970 56.518  60.590 1.00 37.53  ? 82   GLN B CD    1 
ATOM   4585 O  OE1   . GLN F 3 82  ? 50.445 57.647  60.757 1.00 40.04  ? 82   GLN B OE1   1 
ATOM   4586 N  NE2   . GLN F 3 82  ? 48.666 56.270  60.667 1.00 37.72  ? 82   GLN B NE2   1 
ATOM   4587 N  N     . GLN F 3 83  ? 50.580 52.215  62.516 1.00 28.98  ? 83   GLN B N     1 
ATOM   4588 C  CA    . GLN F 3 83  ? 49.726 51.073  62.257 1.00 30.89  ? 83   GLN B CA    1 
ATOM   4589 C  C     . GLN F 3 83  ? 48.755 50.850  63.412 1.00 29.10  ? 83   GLN B C     1 
ATOM   4590 O  O     . GLN F 3 83  ? 47.595 50.527  63.197 1.00 30.55  ? 83   GLN B O     1 
ATOM   4591 C  CB    . GLN F 3 83  ? 50.578 49.836  61.959 1.00 33.80  ? 83   GLN B CB    1 
ATOM   4592 C  CG    . GLN F 3 83  ? 51.189 49.919  60.558 1.00 42.36  ? 83   GLN B CG    1 
ATOM   4593 C  CD    . GLN F 3 83  ? 51.956 48.676  60.159 1.00 48.74  ? 83   GLN B CD    1 
ATOM   4594 O  OE1   . GLN F 3 83  ? 52.975 48.354  60.750 1.00 52.51  ? 83   GLN B OE1   1 
ATOM   4595 N  NE2   . GLN F 3 83  ? 51.461 47.967  59.148 1.00 54.02  ? 83   GLN B NE2   1 
ATOM   4596 N  N     . VAL F 3 84  ? 49.209 51.046  64.643 1.00 28.41  ? 84   VAL B N     1 
ATOM   4597 C  CA    . VAL F 3 84  ? 48.307 50.880  65.770 1.00 27.03  ? 84   VAL B CA    1 
ATOM   4598 C  C     . VAL F 3 84  ? 47.209 51.937  65.638 1.00 26.68  ? 84   VAL B C     1 
ATOM   4599 O  O     . VAL F 3 84  ? 46.033 51.669  65.890 1.00 24.02  ? 84   VAL B O     1 
ATOM   4600 C  CB    . VAL F 3 84  ? 49.019 51.087  67.123 1.00 26.51  ? 84   VAL B CB    1 
ATOM   4601 C  CG1   . VAL F 3 84  ? 47.983 51.227  68.226 1.00 29.37  ? 84   VAL B CG1   1 
ATOM   4602 C  CG2   . VAL F 3 84  ? 49.921 49.903  67.429 1.00 29.79  ? 84   VAL B CG2   1 
ATOM   4603 N  N     . SER F 3 85  ? 47.602 53.137  65.230 1.00 25.00  ? 85   SER B N     1 
ATOM   4604 C  CA    . SER F 3 85  ? 46.655 54.235  65.070 1.00 24.86  ? 85   SER B CA    1 
ATOM   4605 C  C     . SER F 3 85  ? 45.581 53.929  64.038 1.00 25.60  ? 85   SER B C     1 
ATOM   4606 O  O     . SER F 3 85  ? 44.395 54.138  64.291 1.00 24.93  ? 85   SER B O     1 
ATOM   4607 C  CB    . SER F 3 85  ? 47.382 55.516  64.660 1.00 21.43  ? 85   SER B CB    1 
ATOM   4608 O  OG    . SER F 3 85  ? 46.443 56.518  64.329 1.00 21.46  ? 85   SER B OG    1 
ATOM   4609 N  N     . SER F 3 86  ? 46.000 53.450  62.871 1.00 26.23  ? 86   SER B N     1 
ATOM   4610 C  CA    . SER F 3 86  ? 45.058 53.125  61.802 1.00 28.60  ? 86   SER B CA    1 
ATOM   4611 C  C     . SER F 3 86  ? 44.032 52.106  62.275 1.00 28.96  ? 86   SER B C     1 
ATOM   4612 O  O     . SER F 3 86  ? 42.845 52.221  61.964 1.00 29.43  ? 86   SER B O     1 
ATOM   4613 C  CB    . SER F 3 86  ? 45.797 52.578  60.583 1.00 28.95  ? 86   SER B CB    1 
ATOM   4614 O  OG    . SER F 3 86  ? 46.555 53.603  59.968 1.00 34.44  ? 86   SER B OG    1 
ATOM   4615 N  N     . ARG F 3 87  ? 44.475 51.111  63.037 1.00 26.85  ? 87   ARG B N     1 
ATOM   4616 C  CA    . ARG F 3 87  ? 43.524 50.129  63.514 1.00 27.50  ? 87   ARG B CA    1 
ATOM   4617 C  C     . ARG F 3 87  ? 42.498 50.812  64.416 1.00 30.11  ? 87   ARG B C     1 
ATOM   4618 O  O     . ARG F 3 87  ? 41.300 50.507  64.354 1.00 29.68  ? 87   ARG B O     1 
ATOM   4619 C  CB    . ARG F 3 87  ? 44.230 48.997  64.268 1.00 29.09  ? 87   ARG B CB    1 
ATOM   4620 C  CG    . ARG F 3 87  ? 45.130 48.121  63.382 1.00 30.98  ? 87   ARG B CG    1 
ATOM   4621 C  CD    . ARG F 3 87  ? 45.305 46.724  63.981 1.00 32.53  ? 87   ARG B CD    1 
ATOM   4622 N  NE    . ARG F 3 87  ? 45.930 46.729  65.303 1.00 34.07  ? 87   ARG B NE    1 
ATOM   4623 C  CZ    . ARG F 3 87  ? 47.242 46.815  65.518 1.00 34.96  ? 87   ARG B CZ    1 
ATOM   4624 N  NH1   . ARG F 3 87  ? 48.088 46.904  64.497 1.00 33.10  ? 87   ARG B NH1   1 
ATOM   4625 N  NH2   . ARG F 3 87  ? 47.711 46.808  66.759 1.00 34.33  ? 87   ARG B NH2   1 
ATOM   4626 N  N     . ILE F 3 88  ? 42.957 51.743  65.250 1.00 27.48  ? 88   ILE B N     1 
ATOM   4627 C  CA    . ILE F 3 88  ? 42.047 52.440  66.150 1.00 27.98  ? 88   ILE B CA    1 
ATOM   4628 C  C     . ILE F 3 88  ? 41.071 53.321  65.367 1.00 27.63  ? 88   ILE B C     1 
ATOM   4629 O  O     . ILE F 3 88  ? 39.891 53.387  65.695 1.00 28.71  ? 88   ILE B O     1 
ATOM   4630 C  CB    . ILE F 3 88  ? 42.822 53.299  67.175 1.00 27.20  ? 88   ILE B CB    1 
ATOM   4631 C  CG1   . ILE F 3 88  ? 43.688 52.390  68.049 1.00 26.67  ? 88   ILE B CG1   1 
ATOM   4632 C  CG2   . ILE F 3 88  ? 41.856 54.077  68.038 1.00 24.71  ? 88   ILE B CG2   1 
ATOM   4633 C  CD1   . ILE F 3 88  ? 44.522 53.124  69.067 1.00 29.68  ? 88   ILE B CD1   1 
ATOM   4634 N  N     . MET F 3 89  ? 41.561 53.993  64.331 1.00 27.69  ? 89   MET B N     1 
ATOM   4635 C  CA    . MET F 3 89  ? 40.696 54.843  63.528 1.00 28.13  ? 89   MET B CA    1 
ATOM   4636 C  C     . MET F 3 89  ? 39.588 53.984  62.888 1.00 30.87  ? 89   MET B C     1 
ATOM   4637 O  O     . MET F 3 89  ? 38.432 54.417  62.802 1.00 30.39  ? 89   MET B O     1 
ATOM   4638 C  CB    . MET F 3 89  ? 41.509 55.582  62.449 1.00 25.89  ? 89   MET B CB    1 
ATOM   4639 C  CG    . MET F 3 89  ? 42.523 56.618  62.986 1.00 23.33  ? 89   MET B CG    1 
ATOM   4640 S  SD    . MET F 3 89  ? 41.855 57.764  64.230 1.00 27.86  ? 89   MET B SD    1 
ATOM   4641 C  CE    . MET F 3 89  ? 43.341 58.814  64.633 1.00 25.48  ? 89   MET B CE    1 
ATOM   4642 N  N     . ASN F 3 90  ? 39.928 52.768  62.459 1.00 30.86  ? 90   ASN B N     1 
ATOM   4643 C  CA    . ASN F 3 90  ? 38.925 51.898  61.858 1.00 33.20  ? 90   ASN B CA    1 
ATOM   4644 C  C     . ASN F 3 90  ? 37.846 51.514  62.865 1.00 33.64  ? 90   ASN B C     1 
ATOM   4645 O  O     . ASN F 3 90  ? 36.703 51.277  62.488 1.00 34.49  ? 90   ASN B O     1 
ATOM   4646 C  CB    . ASN F 3 90  ? 39.562 50.645  61.258 1.00 33.91  ? 90   ASN B CB    1 
ATOM   4647 C  CG    . ASN F 3 90  ? 40.294 50.935  59.970 1.00 36.15  ? 90   ASN B CG    1 
ATOM   4648 O  OD1   . ASN F 3 90  ? 39.899 51.822  59.219 1.00 39.35  ? 90   ASN B OD1   1 
ATOM   4649 N  ND2   . ASN F 3 90  ? 41.357 50.184  59.698 1.00 34.67  ? 90   ASN B ND2   1 
ATOM   4650 N  N     . LEU F 3 91  ? 38.200 51.453  64.145 1.00 32.82  ? 91   LEU B N     1 
ATOM   4651 C  CA    . LEU F 3 91  ? 37.208 51.133  65.163 1.00 31.81  ? 91   LEU B CA    1 
ATOM   4652 C  C     . LEU F 3 91  ? 36.250 52.315  65.313 1.00 32.62  ? 91   LEU B C     1 
ATOM   4653 O  O     . LEU F 3 91  ? 35.050 52.132  65.520 1.00 31.56  ? 91   LEU B O     1 
ATOM   4654 C  CB    . LEU F 3 91  ? 37.869 50.856  66.512 1.00 31.02  ? 91   LEU B CB    1 
ATOM   4655 C  CG    . LEU F 3 91  ? 38.798 49.647  66.598 1.00 32.18  ? 91   LEU B CG    1 
ATOM   4656 C  CD1   . LEU F 3 91  ? 39.438 49.626  67.978 1.00 28.37  ? 91   LEU B CD1   1 
ATOM   4657 C  CD2   . LEU F 3 91  ? 38.009 48.353  66.321 1.00 31.13  ? 91   LEU B CD2   1 
ATOM   4658 N  N     . LEU F 3 92  ? 36.782 53.530  65.207 1.00 32.75  ? 92   LEU B N     1 
ATOM   4659 C  CA    . LEU F 3 92  ? 35.953 54.720  65.336 1.00 34.30  ? 92   LEU B CA    1 
ATOM   4660 C  C     . LEU F 3 92  ? 34.943 54.832  64.192 1.00 35.55  ? 92   LEU B C     1 
ATOM   4661 O  O     . LEU F 3 92  ? 33.793 55.206  64.418 1.00 35.77  ? 92   LEU B O     1 
ATOM   4662 C  CB    . LEU F 3 92  ? 36.824 55.978  65.379 1.00 32.42  ? 92   LEU B CB    1 
ATOM   4663 C  CG    . LEU F 3 92  ? 37.756 56.135  66.587 1.00 33.46  ? 92   LEU B CG    1 
ATOM   4664 C  CD1   . LEU F 3 92  ? 38.557 57.424  66.444 1.00 31.05  ? 92   LEU B CD1   1 
ATOM   4665 C  CD2   . LEU F 3 92  ? 36.943 56.146  67.876 1.00 30.62  ? 92   LEU B CD2   1 
ATOM   4666 N  N     . ARG F 3 93  ? 35.373 54.508  62.973 1.00 36.55  ? 93   ARG B N     1 
ATOM   4667 C  CA    . ARG F 3 93  ? 34.494 54.573  61.806 1.00 41.10  ? 93   ARG B CA    1 
ATOM   4668 C  C     . ARG F 3 93  ? 33.201 53.791  62.034 1.00 42.11  ? 93   ARG B C     1 
ATOM   4669 O  O     . ARG F 3 93  ? 32.161 54.133  61.477 1.00 42.52  ? 93   ARG B O     1 
ATOM   4670 C  CB    . ARG F 3 93  ? 35.198 54.020  60.563 1.00 41.85  ? 93   ARG B CB    1 
ATOM   4671 C  CG    . ARG F 3 93  ? 36.433 54.793  60.127 1.00 44.28  ? 93   ARG B CG    1 
ATOM   4672 C  CD    . ARG F 3 93  ? 37.167 54.032  59.036 1.00 47.75  ? 93   ARG B CD    1 
ATOM   4673 N  NE    . ARG F 3 93  ? 38.581 54.386  58.972 1.00 49.41  ? 93   ARG B NE    1 
ATOM   4674 C  CZ    . ARG F 3 93  ? 39.049 55.481  58.389 1.00 49.94  ? 93   ARG B CZ    1 
ATOM   4675 N  NH1   . ARG F 3 93  ? 38.213 56.333  57.810 1.00 49.40  ? 93   ARG B NH1   1 
ATOM   4676 N  NH2   . ARG F 3 93  ? 40.352 55.725  58.393 1.00 49.38  ? 93   ARG B NH2   1 
ATOM   4677 N  N     . GLU F 3 94  ? 33.274 52.744  62.850 1.00 43.87  ? 94   GLU B N     1 
ATOM   4678 C  CA    . GLU F 3 94  ? 32.109 51.925  63.162 1.00 46.37  ? 94   GLU B CA    1 
ATOM   4679 C  C     . GLU F 3 94  ? 31.040 52.719  63.916 1.00 46.63  ? 94   GLU B C     1 
ATOM   4680 O  O     . GLU F 3 94  ? 29.892 52.289  64.002 1.00 45.64  ? 94   GLU B O     1 
ATOM   4681 C  CB    . GLU F 3 94  ? 32.527 50.710  63.994 1.00 48.20  ? 94   GLU B CB    1 
ATOM   4682 C  CG    . GLU F 3 94  ? 33.251 49.629  63.203 1.00 53.87  ? 94   GLU B CG    1 
ATOM   4683 C  CD    . GLU F 3 94  ? 33.781 48.511  64.092 1.00 59.00  ? 94   GLU B CD    1 
ATOM   4684 O  OE1   . GLU F 3 94  ? 33.085 48.149  65.070 1.00 60.72  ? 94   GLU B OE1   1 
ATOM   4685 O  OE2   . GLU F 3 94  ? 34.886 47.986  63.806 1.00 60.25  ? 94   GLU B OE2   1 
ATOM   4686 N  N     . TYR F 3 95  ? 31.416 53.879  64.454 1.00 46.16  ? 95   TYR B N     1 
ATOM   4687 C  CA    . TYR F 3 95  ? 30.479 54.714  65.203 1.00 45.00  ? 95   TYR B CA    1 
ATOM   4688 C  C     . TYR F 3 95  ? 29.939 55.907  64.419 1.00 44.73  ? 95   TYR B C     1 
ATOM   4689 O  O     . TYR F 3 95  ? 29.026 56.589  64.881 1.00 44.79  ? 95   TYR B O     1 
ATOM   4690 C  CB    . TYR F 3 95  ? 31.137 55.189  66.497 1.00 42.24  ? 95   TYR B CB    1 
ATOM   4691 C  CG    . TYR F 3 95  ? 31.500 54.041  67.400 1.00 42.04  ? 95   TYR B CG    1 
ATOM   4692 C  CD1   . TYR F 3 95  ? 30.539 53.435  68.207 1.00 42.74  ? 95   TYR B CD1   1 
ATOM   4693 C  CD2   . TYR F 3 95  ? 32.785 53.502  67.388 1.00 40.51  ? 95   TYR B CD2   1 
ATOM   4694 C  CE1   . TYR F 3 95  ? 30.844 52.318  68.972 1.00 39.10  ? 95   TYR B CE1   1 
ATOM   4695 C  CE2   . TYR F 3 95  ? 33.101 52.387  68.148 1.00 38.26  ? 95   TYR B CE2   1 
ATOM   4696 C  CZ    . TYR F 3 95  ? 32.127 51.800  68.936 1.00 39.22  ? 95   TYR B CZ    1 
ATOM   4697 O  OH    . TYR F 3 95  ? 32.433 50.685  69.676 1.00 38.96  ? 95   TYR B OH    1 
ATOM   4698 N  N     . SER F 3 96  ? 30.496 56.158  63.238 1.00 46.32  ? 96   SER B N     1 
ATOM   4699 C  CA    . SER F 3 96  ? 30.042 57.267  62.400 1.00 46.42  ? 96   SER B CA    1 
ATOM   4700 C  C     . SER F 3 96  ? 30.768 57.296  61.056 1.00 49.11  ? 96   SER B C     1 
ATOM   4701 O  O     . SER F 3 96  ? 31.915 56.864  60.950 1.00 49.58  ? 96   SER B O     1 
ATOM   4702 C  CB    . SER F 3 96  ? 30.247 58.596  63.129 1.00 44.78  ? 96   SER B CB    1 
ATOM   4703 O  OG    . SER F 3 96  ? 29.694 59.666  62.386 1.00 44.19  ? 96   SER B OG    1 
ATOM   4704 N  N     . GLU F 3 97  ? 30.088 57.809  60.033 1.00 51.26  ? 97   GLU B N     1 
ATOM   4705 C  CA    . GLU F 3 97  ? 30.642 57.905  58.686 1.00 53.38  ? 97   GLU B CA    1 
ATOM   4706 C  C     . GLU F 3 97  ? 31.336 59.251  58.555 1.00 53.51  ? 97   GLU B C     1 
ATOM   4707 O  O     . GLU F 3 97  ? 32.317 59.397  57.824 1.00 53.81  ? 97   GLU B O     1 
ATOM   4708 C  CB    . GLU F 3 97  ? 29.526 57.821  57.641 1.00 57.03  ? 97   GLU B CB    1 
ATOM   4709 C  CG    . GLU F 3 97  ? 28.261 57.128  58.127 1.00 62.90  ? 97   GLU B CG    1 
ATOM   4710 C  CD    . GLU F 3 97  ? 27.514 57.943  59.178 1.00 66.47  ? 97   GLU B CD    1 
ATOM   4711 O  OE1   . GLU F 3 97  ? 26.751 58.865  58.809 1.00 68.85  ? 97   GLU B OE1   1 
ATOM   4712 O  OE2   . GLU F 3 97  ? 27.703 57.666  60.381 1.00 68.65  ? 97   GLU B OE2   1 
ATOM   4713 N  N     . LYS F 3 98  ? 30.802 60.237  59.269 1.00 52.01  ? 98   LYS B N     1 
ATOM   4714 C  CA    . LYS F 3 98  ? 31.349 61.582  59.250 1.00 48.88  ? 98   LYS B CA    1 
ATOM   4715 C  C     . LYS F 3 98  ? 32.450 61.640  60.294 1.00 46.34  ? 98   LYS B C     1 
ATOM   4716 O  O     . LYS F 3 98  ? 32.206 61.935  61.465 1.00 44.46  ? 98   LYS B O     1 
ATOM   4717 C  CB    . LYS F 3 98  ? 30.242 62.589  59.560 1.00 50.93  ? 98   LYS B CB    1 
ATOM   4718 C  CG    . LYS F 3 98  ? 29.040 62.449  58.629 1.00 51.48  ? 98   LYS B CG    1 
ATOM   4719 C  CD    . LYS F 3 98  ? 27.912 63.391  59.008 1.00 52.73  ? 98   LYS B CD    1 
ATOM   4720 C  CE    . LYS F 3 98  ? 26.689 63.141  58.144 1.00 54.24  ? 98   LYS B CE    1 
ATOM   4721 N  NZ    . LYS F 3 98  ? 25.551 64.013  58.545 1.00 56.64  ? 98   LYS B NZ    1 
ATOM   4722 N  N     . ILE F 3 99  ? 33.665 61.338  59.853 1.00 42.80  ? 99   ILE B N     1 
ATOM   4723 C  CA    . ILE F 3 99  ? 34.824 61.329  60.730 1.00 40.55  ? 99   ILE B CA    1 
ATOM   4724 C  C     . ILE F 3 99  ? 35.968 62.132  60.126 1.00 37.97  ? 99   ILE B C     1 
ATOM   4725 O  O     . ILE F 3 99  ? 36.193 62.111  58.920 1.00 38.20  ? 99   ILE B O     1 
ATOM   4726 C  CB    . ILE F 3 99  ? 35.290 59.878  60.988 1.00 42.64  ? 99   ILE B CB    1 
ATOM   4727 C  CG1   . ILE F 3 99  ? 36.572 59.869  61.821 1.00 43.98  ? 99   ILE B CG1   1 
ATOM   4728 C  CG2   . ILE F 3 99  ? 35.516 59.165  59.668 1.00 42.70  ? 99   ILE B CG2   1 
ATOM   4729 C  CD1   . ILE F 3 99  ? 37.040 58.474  62.192 1.00 45.62  ? 99   ILE B CD1   1 
ATOM   4730 N  N     . GLU F 3 100 ? 36.677 62.860  60.974 1.00 35.48  ? 100  GLU B N     1 
ATOM   4731 C  CA    . GLU F 3 100 ? 37.804 63.660  60.522 1.00 35.16  ? 100  GLU B CA    1 
ATOM   4732 C  C     . GLU F 3 100 ? 39.072 63.252  61.269 1.00 35.05  ? 100  GLU B C     1 
ATOM   4733 O  O     . GLU F 3 100 ? 39.292 63.657  62.412 1.00 34.06  ? 100  GLU B O     1 
ATOM   4734 C  CB    . GLU F 3 100 ? 37.538 65.146  60.755 1.00 33.39  ? 100  GLU B CB    1 
ATOM   4735 C  CG    . GLU F 3 100 ? 38.681 66.031  60.301 1.00 33.54  ? 100  GLU B CG    1 
ATOM   4736 C  CD    . GLU F 3 100 ? 38.346 67.504  60.366 1.00 35.61  ? 100  GLU B CD    1 
ATOM   4737 O  OE1   . GLU F 3 100 ? 37.150 67.859  60.271 1.00 34.74  ? 100  GLU B OE1   1 
ATOM   4738 O  OE2   . GLU F 3 100 ? 39.284 68.314  60.493 1.00 37.11  ? 100  GLU B OE2   1 
ATOM   4739 N  N     . ILE F 3 101 ? 39.890 62.425  60.631 1.00 35.42  ? 101  ILE B N     1 
ATOM   4740 C  CA    . ILE F 3 101 ? 41.141 61.997  61.240 1.00 36.20  ? 101  ILE B CA    1 
ATOM   4741 C  C     . ILE F 3 101 ? 42.043 63.212  61.161 1.00 36.00  ? 101  ILE B C     1 
ATOM   4742 O  O     . ILE F 3 101 ? 42.461 63.609  60.077 1.00 37.85  ? 101  ILE B O     1 
ATOM   4743 C  CB    . ILE F 3 101 ? 41.740 60.818  60.467 1.00 36.35  ? 101  ILE B CB    1 
ATOM   4744 C  CG1   . ILE F 3 101 ? 40.802 59.615  60.602 1.00 35.95  ? 101  ILE B CG1   1 
ATOM   4745 C  CG2   . ILE F 3 101 ? 43.135 60.490  60.994 1.00 36.37  ? 101  ILE B CG2   1 
ATOM   4746 C  CD1   . ILE F 3 101 ? 41.166 58.438  59.729 1.00 37.76  ? 101  ILE B CD1   1 
ATOM   4747 N  N     . ALA F 3 102 ? 42.324 63.817  62.310 1.00 35.07  ? 102  ALA B N     1 
ATOM   4748 C  CA    . ALA F 3 102 ? 43.139 65.023  62.338 1.00 35.60  ? 102  ALA B CA    1 
ATOM   4749 C  C     . ALA F 3 102 ? 44.629 64.748  62.347 1.00 36.60  ? 102  ALA B C     1 
ATOM   4750 O  O     . ALA F 3 102 ? 45.378 65.372  61.598 1.00 37.78  ? 102  ALA B O     1 
ATOM   4751 C  CB    . ALA F 3 102 ? 42.764 65.880  63.538 1.00 31.01  ? 102  ALA B CB    1 
ATOM   4752 N  N     . SER F 3 103 ? 45.063 63.830  63.202 1.00 36.86  ? 103  SER B N     1 
ATOM   4753 C  CA    . SER F 3 103 ? 46.479 63.493  63.283 1.00 35.46  ? 103  SER B CA    1 
ATOM   4754 C  C     . SER F 3 103 ? 46.632 62.010  63.559 1.00 35.34  ? 103  SER B C     1 
ATOM   4755 O  O     . SER F 3 103 ? 45.659 61.251  63.520 1.00 32.63  ? 103  SER B O     1 
ATOM   4756 C  CB    . SER F 3 103 ? 47.167 64.292  64.391 1.00 34.48  ? 103  SER B CB    1 
ATOM   4757 O  OG    . SER F 3 103 ? 46.739 63.879  65.680 1.00 37.50  ? 103  SER B OG    1 
ATOM   4758 N  N     . ILE F 3 104 ? 47.862 61.604  63.846 1.00 34.15  ? 104  ILE B N     1 
ATOM   4759 C  CA    . ILE F 3 104 ? 48.152 60.212  64.132 1.00 31.76  ? 104  ILE B CA    1 
ATOM   4760 C  C     . ILE F 3 104 ? 47.433 59.772  65.411 1.00 31.80  ? 104  ILE B C     1 
ATOM   4761 O  O     . ILE F 3 104 ? 47.201 58.580  65.616 1.00 32.56  ? 104  ILE B O     1 
ATOM   4762 C  CB    . ILE F 3 104 ? 49.684 60.001  64.280 1.00 32.15  ? 104  ILE B CB    1 
ATOM   4763 C  CG1   . ILE F 3 104 ? 50.002 58.519  64.452 1.00 30.48  ? 104  ILE B CG1   1 
ATOM   4764 C  CG2   . ILE F 3 104 ? 50.219 60.808  65.460 1.00 29.27  ? 104  ILE B CG2   1 
ATOM   4765 C  CD1   . ILE F 3 104 ? 51.470 58.218  64.289 1.00 27.70  ? 104  ILE B CD1   1 
ATOM   4766 N  N     . ASP F 3 105 ? 47.054 60.722  66.263 1.00 28.69  ? 105  ASP B N     1 
ATOM   4767 C  CA    . ASP F 3 105 ? 46.388 60.328  67.493 1.00 30.07  ? 105  ASP B CA    1 
ATOM   4768 C  C     . ASP F 3 105 ? 45.077 61.048  67.834 1.00 29.90  ? 105  ASP B C     1 
ATOM   4769 O  O     . ASP F 3 105 ? 44.602 60.971  68.966 1.00 29.06  ? 105  ASP B O     1 
ATOM   4770 C  CB    . ASP F 3 105 ? 47.410 60.395  68.647 1.00 30.26  ? 105  ASP B CB    1 
ATOM   4771 C  CG    . ASP F 3 105 ? 47.249 61.609  69.525 1.00 30.27  ? 105  ASP B CG    1 
ATOM   4772 O  OD1   . ASP F 3 105 ? 47.034 62.712  68.999 1.00 30.00  ? 105  ASP B OD1   1 
ATOM   4773 O  OD2   . ASP F 3 105 ? 47.353 61.451  70.758 1.00 28.88  ? 105  ASP B OD2   1 
ATOM   4774 N  N     . GLU F 3 106 ? 44.470 61.702  66.843 1.00 28.75  ? 106  GLU B N     1 
ATOM   4775 C  CA    . GLU F 3 106 ? 43.216 62.435  67.056 1.00 30.87  ? 106  GLU B CA    1 
ATOM   4776 C  C     . GLU F 3 106 ? 42.232 62.245  65.920 1.00 29.20  ? 106  GLU B C     1 
ATOM   4777 O  O     . GLU F 3 106 ? 42.629 62.088  64.760 1.00 28.05  ? 106  GLU B O     1 
ATOM   4778 C  CB    . GLU F 3 106 ? 43.440 63.952  67.142 1.00 32.85  ? 106  GLU B CB    1 
ATOM   4779 C  CG    . GLU F 3 106 ? 44.490 64.422  68.098 1.00 39.72  ? 106  GLU B CG    1 
ATOM   4780 C  CD    . GLU F 3 106 ? 44.568 65.929  68.141 1.00 39.44  ? 106  GLU B CD    1 
ATOM   4781 O  OE1   . GLU F 3 106 ? 45.399 66.445  68.907 1.00 45.70  ? 106  GLU B OE1   1 
ATOM   4782 O  OE2   . GLU F 3 106 ? 43.796 66.597  67.416 1.00 39.10  ? 106  GLU B OE2   1 
ATOM   4783 N  N     . ALA F 3 107 ? 40.948 62.322  66.257 1.00 25.96  ? 107  ALA B N     1 
ATOM   4784 C  CA    . ALA F 3 107 ? 39.885 62.211  65.271 1.00 24.86  ? 107  ALA B CA    1 
ATOM   4785 C  C     . ALA F 3 107 ? 38.632 62.859  65.826 1.00 25.60  ? 107  ALA B C     1 
ATOM   4786 O  O     . ALA F 3 107 ? 38.396 62.838  67.040 1.00 23.73  ? 107  ALA B O     1 
ATOM   4787 C  CB    . ALA F 3 107 ? 39.615 60.749  64.931 1.00 25.32  ? 107  ALA B CB    1 
ATOM   4788 N  N     . TYR F 3 108 ? 37.851 63.454  64.929 1.00 25.99  ? 108  TYR B N     1 
ATOM   4789 C  CA    . TYR F 3 108 ? 36.586 64.103  65.273 1.00 28.51  ? 108  TYR B CA    1 
ATOM   4790 C  C     . TYR F 3 108 ? 35.480 63.306  64.614 1.00 30.05  ? 108  TYR B C     1 
ATOM   4791 O  O     . TYR F 3 108 ? 35.578 62.964  63.426 1.00 30.22  ? 108  TYR B O     1 
ATOM   4792 C  CB    . TYR F 3 108 ? 36.510 65.518  64.701 1.00 27.39  ? 108  TYR B CB    1 
ATOM   4793 C  CG    . TYR F 3 108 ? 37.500 66.495  65.264 1.00 28.85  ? 108  TYR B CG    1 
ATOM   4794 C  CD1   . TYR F 3 108 ? 37.174 67.294  66.359 1.00 28.64  ? 108  TYR B CD1   1 
ATOM   4795 C  CD2   . TYR F 3 108 ? 38.757 66.647  64.685 1.00 27.64  ? 108  TYR B CD2   1 
ATOM   4796 C  CE1   . TYR F 3 108 ? 38.083 68.230  66.861 1.00 28.19  ? 108  TYR B CE1   1 
ATOM   4797 C  CE2   . TYR F 3 108 ? 39.667 67.570  65.178 1.00 26.77  ? 108  TYR B CE2   1 
ATOM   4798 C  CZ    . TYR F 3 108 ? 39.324 68.360  66.265 1.00 26.84  ? 108  TYR B CZ    1 
ATOM   4799 O  OH    . TYR F 3 108 ? 40.223 69.286  66.749 1.00 29.35  ? 108  TYR B OH    1 
ATOM   4800 N  N     . LEU F 3 109 ? 34.427 63.018  65.370 1.00 31.45  ? 109  LEU B N     1 
ATOM   4801 C  CA    . LEU F 3 109 ? 33.289 62.296  64.823 1.00 31.50  ? 109  LEU B CA    1 
ATOM   4802 C  C     . LEU F 3 109 ? 32.057 63.178  64.922 1.00 33.35  ? 109  LEU B C     1 
ATOM   4803 O  O     . LEU F 3 109 ? 31.766 63.726  65.984 1.00 33.74  ? 109  LEU B O     1 
ATOM   4804 C  CB    . LEU F 3 109 ? 33.020 61.006  65.599 1.00 30.78  ? 109  LEU B CB    1 
ATOM   4805 C  CG    . LEU F 3 109 ? 33.940 59.803  65.429 1.00 30.73  ? 109  LEU B CG    1 
ATOM   4806 C  CD1   . LEU F 3 109 ? 35.374 60.175  65.775 1.00 32.53  ? 109  LEU B CD1   1 
ATOM   4807 C  CD2   . LEU F 3 109 ? 33.448 58.688  66.333 1.00 30.78  ? 109  LEU B CD2   1 
ATOM   4808 N  N     . ASP F 3 110 ? 31.353 63.351  63.811 1.00 34.47  ? 110  ASP B N     1 
ATOM   4809 C  CA    . ASP F 3 110 ? 30.117 64.117  63.843 1.00 35.26  ? 110  ASP B CA    1 
ATOM   4810 C  C     . ASP F 3 110 ? 29.097 63.038  64.179 1.00 35.28  ? 110  ASP B C     1 
ATOM   4811 O  O     . ASP F 3 110 ? 28.795 62.192  63.338 1.00 35.36  ? 110  ASP B O     1 
ATOM   4812 C  CB    . ASP F 3 110 ? 29.785 64.712  62.480 1.00 36.30  ? 110  ASP B CB    1 
ATOM   4813 C  CG    . ASP F 3 110 ? 28.471 65.472  62.492 1.00 38.15  ? 110  ASP B CG    1 
ATOM   4814 O  OD1   . ASP F 3 110 ? 27.511 64.991  63.130 1.00 38.46  ? 110  ASP B OD1   1 
ATOM   4815 O  OD2   . ASP F 3 110 ? 28.394 66.546  61.865 1.00 40.93  ? 110  ASP B OD2   1 
ATOM   4816 N  N     . ILE F 3 111 ? 28.587 63.049  65.407 1.00 35.14  ? 111  ILE B N     1 
ATOM   4817 C  CA    . ILE F 3 111 ? 27.633 62.035  65.823 1.00 35.67  ? 111  ILE B CA    1 
ATOM   4818 C  C     . ILE F 3 111 ? 26.203 62.546  65.929 1.00 38.40  ? 111  ILE B C     1 
ATOM   4819 O  O     . ILE F 3 111 ? 25.367 61.924  66.580 1.00 39.07  ? 111  ILE B O     1 
ATOM   4820 C  CB    . ILE F 3 111 ? 28.040 61.426  67.175 1.00 35.18  ? 111  ILE B CB    1 
ATOM   4821 C  CG1   . ILE F 3 111 ? 28.120 62.521  68.242 1.00 33.09  ? 111  ILE B CG1   1 
ATOM   4822 C  CG2   . ILE F 3 111 ? 29.373 60.702  67.025 1.00 34.97  ? 111  ILE B CG2   1 
ATOM   4823 C  CD1   . ILE F 3 111 ? 28.193 61.991  69.661 1.00 32.64  ? 111  ILE B CD1   1 
ATOM   4824 N  N     . SER F 3 112 ? 25.926 63.676  65.290 1.00 41.20  ? 112  SER B N     1 
ATOM   4825 C  CA    . SER F 3 112 ? 24.594 64.263  65.317 1.00 44.35  ? 112  SER B CA    1 
ATOM   4826 C  C     . SER F 3 112 ? 23.490 63.236  65.022 1.00 45.81  ? 112  SER B C     1 
ATOM   4827 O  O     . SER F 3 112 ? 22.571 63.058  65.820 1.00 46.17  ? 112  SER B O     1 
ATOM   4828 C  CB    . SER F 3 112 ? 24.519 65.414  64.310 1.00 45.13  ? 112  SER B CB    1 
ATOM   4829 O  OG    . SER F 3 112 ? 25.457 66.429  64.626 1.00 45.77  ? 112  SER B OG    1 
ATOM   4830 N  N     . ASP F 3 113 ? 23.594 62.555  63.885 1.00 47.13  ? 113  ASP B N     1 
ATOM   4831 C  CA    . ASP F 3 113 ? 22.605 61.556  63.489 1.00 48.06  ? 113  ASP B CA    1 
ATOM   4832 C  C     . ASP F 3 113 ? 22.754 60.239  64.242 1.00 48.56  ? 113  ASP B C     1 
ATOM   4833 O  O     . ASP F 3 113 ? 22.165 59.238  63.843 1.00 48.90  ? 113  ASP B O     1 
ATOM   4834 C  CB    . ASP F 3 113 ? 22.713 61.242  61.990 1.00 50.44  ? 113  ASP B CB    1 
ATOM   4835 C  CG    . ASP F 3 113 ? 22.738 62.482  61.118 1.00 53.77  ? 113  ASP B CG    1 
ATOM   4836 O  OD1   . ASP F 3 113 ? 22.007 63.455  61.415 1.00 57.06  ? 113  ASP B OD1   1 
ATOM   4837 O  OD2   . ASP F 3 113 ? 23.481 62.474  60.114 1.00 56.88  ? 113  ASP B OD2   1 
ATOM   4838 N  N     . LYS F 3 114 ? 23.529 60.221  65.321 1.00 47.78  ? 114  LYS B N     1 
ATOM   4839 C  CA    . LYS F 3 114 ? 23.735 58.973  66.055 1.00 48.01  ? 114  LYS B CA    1 
ATOM   4840 C  C     . LYS F 3 114 ? 23.228 58.996  67.488 1.00 48.04  ? 114  LYS B C     1 
ATOM   4841 O  O     . LYS F 3 114 ? 23.052 57.943  68.104 1.00 47.39  ? 114  LYS B O     1 
ATOM   4842 C  CB    . LYS F 3 114 ? 25.220 58.611  66.057 1.00 50.00  ? 114  LYS B CB    1 
ATOM   4843 C  CG    . LYS F 3 114 ? 25.834 58.563  64.678 1.00 52.08  ? 114  LYS B CG    1 
ATOM   4844 C  CD    . LYS F 3 114 ? 25.188 57.481  63.829 1.00 54.37  ? 114  LYS B CD    1 
ATOM   4845 C  CE    . LYS F 3 114 ? 25.786 57.463  62.437 1.00 54.72  ? 114  LYS B CE    1 
ATOM   4846 N  NZ    . LYS F 3 114 ? 25.253 56.337  61.620 1.00 56.77  ? 114  LYS B NZ    1 
ATOM   4847 N  N     . VAL F 3 115 ? 23.022 60.197  68.020 1.00 46.68  ? 115  VAL B N     1 
ATOM   4848 C  CA    . VAL F 3 115 ? 22.519 60.377  69.379 1.00 46.79  ? 115  VAL B CA    1 
ATOM   4849 C  C     . VAL F 3 115 ? 21.601 61.591  69.332 1.00 47.72  ? 115  VAL B C     1 
ATOM   4850 O  O     . VAL F 3 115 ? 21.751 62.441  68.459 1.00 46.74  ? 115  VAL B O     1 
ATOM   4851 C  CB    . VAL F 3 115 ? 23.666 60.645  70.379 1.00 45.56  ? 115  VAL B CB    1 
ATOM   4852 C  CG1   . VAL F 3 115 ? 24.627 59.472  70.397 1.00 43.83  ? 115  VAL B CG1   1 
ATOM   4853 C  CG2   . VAL F 3 115 ? 24.395 61.918  69.998 1.00 45.17  ? 115  VAL B CG2   1 
ATOM   4854 N  N     . ARG F 3 116 ? 20.652 61.686  70.255 1.00 49.83  ? 116  ARG B N     1 
ATOM   4855 C  CA    . ARG F 3 116 ? 19.744 62.830  70.227 1.00 52.45  ? 116  ARG B CA    1 
ATOM   4856 C  C     . ARG F 3 116 ? 20.046 63.876  71.293 1.00 51.33  ? 116  ARG B C     1 
ATOM   4857 O  O     . ARG F 3 116 ? 19.496 64.976  71.263 1.00 52.55  ? 116  ARG B O     1 
ATOM   4858 C  CB    . ARG F 3 116 ? 18.288 62.360  70.339 1.00 55.94  ? 116  ARG B CB    1 
ATOM   4859 C  CG    . ARG F 3 116 ? 17.897 61.843  71.701 1.00 61.44  ? 116  ARG B CG    1 
ATOM   4860 C  CD    . ARG F 3 116 ? 16.521 61.200  71.673 1.00 66.37  ? 116  ARG B CD    1 
ATOM   4861 N  NE    . ARG F 3 116 ? 16.146 60.686  72.988 1.00 70.58  ? 116  ARG B NE    1 
ATOM   4862 C  CZ    . ARG F 3 116 ? 15.023 60.019  73.240 1.00 72.59  ? 116  ARG B CZ    1 
ATOM   4863 N  NH1   . ARG F 3 116 ? 14.156 59.780  72.263 1.00 74.06  ? 116  ARG B NH1   1 
ATOM   4864 N  NH2   . ARG F 3 116 ? 14.767 59.588  74.469 1.00 73.50  ? 116  ARG B NH2   1 
ATOM   4865 N  N     . ASP F 3 117 ? 20.920 63.535  72.232 1.00 49.40  ? 117  ASP B N     1 
ATOM   4866 C  CA    . ASP F 3 117 ? 21.298 64.469  73.281 1.00 47.76  ? 117  ASP B CA    1 
ATOM   4867 C  C     . ASP F 3 117 ? 22.680 64.148  73.831 1.00 45.59  ? 117  ASP B C     1 
ATOM   4868 O  O     . ASP F 3 117 ? 23.255 63.106  73.515 1.00 44.01  ? 117  ASP B O     1 
ATOM   4869 C  CB    . ASP F 3 117 ? 20.261 64.466  74.413 1.00 49.13  ? 117  ASP B CB    1 
ATOM   4870 C  CG    . ASP F 3 117 ? 19.994 63.080  74.969 1.00 50.94  ? 117  ASP B CG    1 
ATOM   4871 O  OD1   . ASP F 3 117 ? 20.953 62.393  75.386 1.00 50.85  ? 117  ASP B OD1   1 
ATOM   4872 O  OD2   . ASP F 3 117 ? 18.809 62.682  74.998 1.00 52.95  ? 117  ASP B OD2   1 
ATOM   4873 N  N     . TYR F 3 118 ? 23.212 65.048  74.652 1.00 44.44  ? 118  TYR B N     1 
ATOM   4874 C  CA    . TYR F 3 118 ? 24.533 64.852  75.229 1.00 43.36  ? 118  TYR B CA    1 
ATOM   4875 C  C     . TYR F 3 118 ? 24.611 63.635  76.136 1.00 43.78  ? 118  TYR B C     1 
ATOM   4876 O  O     . TYR F 3 118 ? 25.678 63.032  76.276 1.00 40.99  ? 118  TYR B O     1 
ATOM   4877 C  CB    . TYR F 3 118 ? 24.979 66.106  75.983 1.00 42.96  ? 118  TYR B CB    1 
ATOM   4878 C  CG    . TYR F 3 118 ? 25.457 67.205  75.063 1.00 42.34  ? 118  TYR B CG    1 
ATOM   4879 C  CD1   . TYR F 3 118 ? 26.397 66.936  74.067 1.00 42.00  ? 118  TYR B CD1   1 
ATOM   4880 C  CD2   . TYR F 3 118 ? 24.989 68.512  75.189 1.00 41.83  ? 118  TYR B CD2   1 
ATOM   4881 C  CE1   . TYR F 3 118 ? 26.859 67.937  73.221 1.00 40.28  ? 118  TYR B CE1   1 
ATOM   4882 C  CE2   . TYR F 3 118 ? 25.453 69.526  74.343 1.00 41.17  ? 118  TYR B CE2   1 
ATOM   4883 C  CZ    . TYR F 3 118 ? 26.388 69.225  73.362 1.00 40.81  ? 118  TYR B CZ    1 
ATOM   4884 O  OH    . TYR F 3 118 ? 26.864 70.208  72.526 1.00 40.49  ? 118  TYR B OH    1 
ATOM   4885 N  N     . ARG F 3 119 ? 23.491 63.257  76.744 1.00 44.11  ? 119  ARG B N     1 
ATOM   4886 C  CA    . ARG F 3 119 ? 23.501 62.090  77.618 1.00 45.41  ? 119  ARG B CA    1 
ATOM   4887 C  C     . ARG F 3 119 ? 23.861 60.867  76.791 1.00 44.75  ? 119  ARG B C     1 
ATOM   4888 O  O     . ARG F 3 119 ? 24.697 60.063  77.196 1.00 46.20  ? 119  ARG B O     1 
ATOM   4889 C  CB    . ARG F 3 119 ? 22.141 61.875  78.279 1.00 47.67  ? 119  ARG B CB    1 
ATOM   4890 C  CG    . ARG F 3 119 ? 22.128 60.727  79.292 1.00 49.32  ? 119  ARG B CG    1 
ATOM   4891 C  CD    . ARG F 3 119 ? 20.710 60.462  79.794 1.00 51.96  ? 119  ARG B CD    1 
ATOM   4892 N  NE    . ARG F 3 119 ? 19.816 60.065  78.705 1.00 52.66  ? 119  ARG B NE    1 
ATOM   4893 C  CZ    . ARG F 3 119 ? 19.783 58.850  78.164 1.00 53.19  ? 119  ARG B CZ    1 
ATOM   4894 N  NH1   . ARG F 3 119 ? 20.592 57.894  78.611 1.00 50.67  ? 119  ARG B NH1   1 
ATOM   4895 N  NH2   . ARG F 3 119 ? 18.947 58.595  77.164 1.00 53.76  ? 119  ARG B NH2   1 
ATOM   4896 N  N     . GLU F 3 120 ? 23.223 60.724  75.635 1.00 45.06  ? 120  GLU B N     1 
ATOM   4897 C  CA    . GLU F 3 120 ? 23.514 59.596  74.752 1.00 46.64  ? 120  GLU B CA    1 
ATOM   4898 C  C     . GLU F 3 120 ? 24.922 59.757  74.196 1.00 44.72  ? 120  GLU B C     1 
ATOM   4899 O  O     . GLU F 3 120 ? 25.646 58.780  74.013 1.00 44.93  ? 120  GLU B O     1 
ATOM   4900 C  CB    . GLU F 3 120 ? 22.535 59.548  73.580 1.00 49.71  ? 120  GLU B CB    1 
ATOM   4901 C  CG    . GLU F 3 120 ? 21.120 59.146  73.936 1.00 54.92  ? 120  GLU B CG    1 
ATOM   4902 C  CD    . GLU F 3 120 ? 20.250 58.998  72.699 1.00 56.36  ? 120  GLU B CD    1 
ATOM   4903 O  OE1   . GLU F 3 120 ? 20.567 58.149  71.839 1.00 56.81  ? 120  GLU B OE1   1 
ATOM   4904 O  OE2   . GLU F 3 120 ? 19.255 59.733  72.582 1.00 59.40  ? 120  GLU B OE2   1 
ATOM   4905 N  N     . ALA F 3 121 ? 25.291 61.002  73.911 1.00 43.10  ? 121  ALA B N     1 
ATOM   4906 C  CA    . ALA F 3 121 ? 26.611 61.311  73.382 1.00 40.80  ? 121  ALA B CA    1 
ATOM   4907 C  C     . ALA F 3 121 ? 27.653 60.792  74.360 1.00 39.43  ? 121  ALA B C     1 
ATOM   4908 O  O     . ALA F 3 121 ? 28.598 60.112  73.978 1.00 39.26  ? 121  ALA B O     1 
ATOM   4909 C  CB    . ALA F 3 121 ? 26.763 62.815  73.209 1.00 40.58  ? 121  ALA B CB    1 
ATOM   4910 N  N     . TYR F 3 122 ? 27.452 61.110  75.632 1.00 38.63  ? 122  TYR B N     1 
ATOM   4911 C  CA    . TYR F 3 122 ? 28.355 60.705  76.695 1.00 38.45  ? 122  TYR B CA    1 
ATOM   4912 C  C     . TYR F 3 122 ? 28.446 59.193  76.822 1.00 40.24  ? 122  TYR B C     1 
ATOM   4913 O  O     . TYR F 3 122 ? 29.536 58.646  77.029 1.00 38.08  ? 122  TYR B O     1 
ATOM   4914 C  CB    . TYR F 3 122 ? 27.878 61.286  78.015 1.00 39.49  ? 122  TYR B CB    1 
ATOM   4915 C  CG    . TYR F 3 122 ? 28.716 60.883  79.196 1.00 39.76  ? 122  TYR B CG    1 
ATOM   4916 C  CD1   . TYR F 3 122 ? 29.802 61.657  79.600 1.00 41.54  ? 122  TYR B CD1   1 
ATOM   4917 C  CD2   . TYR F 3 122 ? 28.420 59.731  79.918 1.00 39.64  ? 122  TYR B CD2   1 
ATOM   4918 C  CE1   . TYR F 3 122 ? 30.571 61.295  80.697 1.00 41.43  ? 122  TYR B CE1   1 
ATOM   4919 C  CE2   . TYR F 3 122 ? 29.180 59.360  81.012 1.00 41.30  ? 122  TYR B CE2   1 
ATOM   4920 C  CZ    . TYR F 3 122 ? 30.252 60.146  81.398 1.00 41.48  ? 122  TYR B CZ    1 
ATOM   4921 O  OH    . TYR F 3 122 ? 30.992 59.786  82.496 1.00 43.23  ? 122  TYR B OH    1 
ATOM   4922 N  N     . ASN F 3 123 ? 27.298 58.522  76.725 1.00 39.93  ? 123  ASN B N     1 
ATOM   4923 C  CA    . ASN F 3 123 ? 27.266 57.069  76.825 1.00 39.06  ? 123  ASN B CA    1 
ATOM   4924 C  C     . ASN F 3 123 ? 27.996 56.460  75.637 1.00 37.97  ? 123  ASN B C     1 
ATOM   4925 O  O     . ASN F 3 123 ? 28.727 55.481  75.785 1.00 38.79  ? 123  ASN B O     1 
ATOM   4926 C  CB    . ASN F 3 123 ? 25.822 56.551  76.875 1.00 40.53  ? 123  ASN B CB    1 
ATOM   4927 C  CG    . ASN F 3 123 ? 25.127 56.886  78.182 1.00 42.03  ? 123  ASN B CG    1 
ATOM   4928 O  OD1   . ASN F 3 123 ? 25.710 56.748  79.262 1.00 43.13  ? 123  ASN B OD1   1 
ATOM   4929 N  ND2   . ASN F 3 123 ? 23.872 57.315  78.094 1.00 41.44  ? 123  ASN B ND2   1 
ATOM   4930 N  N     . LEU F 3 124 ? 27.797 57.036  74.457 1.00 36.05  ? 124  LEU B N     1 
ATOM   4931 C  CA    . LEU F 3 124 ? 28.475 56.545  73.265 1.00 35.67  ? 124  LEU B CA    1 
ATOM   4932 C  C     . LEU F 3 124 ? 29.980 56.705  73.493 1.00 35.47  ? 124  LEU B C     1 
ATOM   4933 O  O     . LEU F 3 124 ? 30.776 55.830  73.153 1.00 35.36  ? 124  LEU B O     1 
ATOM   4934 C  CB    . LEU F 3 124 ? 28.047 57.350  72.035 1.00 34.11  ? 124  LEU B CB    1 
ATOM   4935 C  CG    . LEU F 3 124 ? 28.750 56.978  70.726 1.00 35.74  ? 124  LEU B CG    1 
ATOM   4936 C  CD1   . LEU F 3 124 ? 28.572 55.492  70.453 1.00 35.34  ? 124  LEU B CD1   1 
ATOM   4937 C  CD2   . LEU F 3 124 ? 28.188 57.813  69.583 1.00 33.41  ? 124  LEU B CD2   1 
ATOM   4938 N  N     . GLY F 3 125 ? 30.355 57.831  74.085 1.00 35.39  ? 125  GLY B N     1 
ATOM   4939 C  CA    . GLY F 3 125 ? 31.755 58.086  74.362 1.00 35.24  ? 125  GLY B CA    1 
ATOM   4940 C  C     . GLY F 3 125 ? 32.361 56.995  75.220 1.00 34.34  ? 125  GLY B C     1 
ATOM   4941 O  O     . GLY F 3 125 ? 33.496 56.578  74.984 1.00 34.33  ? 125  GLY B O     1 
ATOM   4942 N  N     . LEU F 3 126 ? 31.608 56.525  76.212 1.00 34.50  ? 126  LEU B N     1 
ATOM   4943 C  CA    . LEU F 3 126 ? 32.095 55.473  77.102 1.00 35.39  ? 126  LEU B CA    1 
ATOM   4944 C  C     . LEU F 3 126 ? 32.182 54.180  76.332 1.00 35.71  ? 126  LEU B C     1 
ATOM   4945 O  O     . LEU F 3 126 ? 33.060 53.355  76.570 1.00 35.83  ? 126  LEU B O     1 
ATOM   4946 C  CB    . LEU F 3 126 ? 31.154 55.288  78.290 1.00 37.38  ? 126  LEU B CB    1 
ATOM   4947 C  CG    . LEU F 3 126 ? 31.065 56.461  79.263 1.00 39.78  ? 126  LEU B CG    1 
ATOM   4948 C  CD1   . LEU F 3 126 ? 29.878 56.255  80.200 1.00 40.82  ? 126  LEU B CD1   1 
ATOM   4949 C  CD2   . LEU F 3 126 ? 32.374 56.584  80.043 1.00 39.84  ? 126  LEU B CD2   1 
ATOM   4950 N  N     . GLU F 3 127 ? 31.252 54.016  75.403 1.00 35.84  ? 127  GLU B N     1 
ATOM   4951 C  CA    . GLU F 3 127 ? 31.200 52.834  74.569 1.00 37.83  ? 127  GLU B CA    1 
ATOM   4952 C  C     . GLU F 3 127 ? 32.479 52.756  73.738 1.00 36.52  ? 127  GLU B C     1 
ATOM   4953 O  O     . GLU F 3 127 ? 33.093 51.699  73.626 1.00 35.93  ? 127  GLU B O     1 
ATOM   4954 C  CB    . GLU F 3 127 ? 29.984 52.924  73.657 1.00 39.51  ? 127  GLU B CB    1 
ATOM   4955 C  CG    . GLU F 3 127 ? 29.399 51.592  73.263 1.00 44.58  ? 127  GLU B CG    1 
ATOM   4956 C  CD    . GLU F 3 127 ? 28.071 51.763  72.561 1.00 46.60  ? 127  GLU B CD    1 
ATOM   4957 O  OE1   . GLU F 3 127 ? 27.161 52.365  73.178 1.00 48.69  ? 127  GLU B OE1   1 
ATOM   4958 O  OE2   . GLU F 3 127 ? 27.941 51.311  71.400 1.00 46.57  ? 127  GLU B OE2   1 
ATOM   4959 N  N     . ILE F 3 128 ? 32.877 53.889  73.167 1.00 35.29  ? 128  ILE B N     1 
ATOM   4960 C  CA    . ILE F 3 128 ? 34.090 53.962  72.353 1.00 36.25  ? 128  ILE B CA    1 
ATOM   4961 C  C     . ILE F 3 128 ? 35.372 53.746  73.176 1.00 34.74  ? 128  ILE B C     1 
ATOM   4962 O  O     . ILE F 3 128 ? 36.282 53.054  72.732 1.00 35.93  ? 128  ILE B O     1 
ATOM   4963 C  CB    . ILE F 3 128 ? 34.168 55.316  71.617 1.00 35.80  ? 128  ILE B CB    1 
ATOM   4964 C  CG1   . ILE F 3 128 ? 33.016 55.414  70.607 1.00 34.57  ? 128  ILE B CG1   1 
ATOM   4965 C  CG2   . ILE F 3 128 ? 35.513 55.458  70.917 1.00 36.16  ? 128  ILE B CG2   1 
ATOM   4966 C  CD1   . ILE F 3 128 ? 32.873 56.776  69.967 1.00 30.18  ? 128  ILE B CD1   1 
ATOM   4967 N  N     . LYS F 3 129 ? 35.444 54.343  74.362 1.00 34.02  ? 129  LYS B N     1 
ATOM   4968 C  CA    . LYS F 3 129 ? 36.609 54.176  75.226 1.00 33.36  ? 129  LYS B CA    1 
ATOM   4969 C  C     . LYS F 3 129 ? 36.748 52.705  75.592 1.00 34.82  ? 129  LYS B C     1 
ATOM   4970 O  O     . LYS F 3 129 ? 37.859 52.165  75.613 1.00 34.01  ? 129  LYS B O     1 
ATOM   4971 C  CB    . LYS F 3 129 ? 36.465 55.023  76.505 1.00 33.29  ? 129  LYS B CB    1 
ATOM   4972 C  CG    . LYS F 3 129 ? 36.785 56.507  76.308 1.00 32.09  ? 129  LYS B CG    1 
ATOM   4973 C  CD    . LYS F 3 129 ? 36.355 57.366  77.497 1.00 33.34  ? 129  LYS B CD    1 
ATOM   4974 C  CE    . LYS F 3 129 ? 37.062 56.982  78.782 1.00 31.70  ? 129  LYS B CE    1 
ATOM   4975 N  NZ    . LYS F 3 129 ? 38.524 57.251  78.714 1.00 34.80  ? 129  LYS B NZ    1 
ATOM   4976 N  N     . ASN F 3 130 ? 35.621 52.051  75.874 1.00 35.12  ? 130  ASN B N     1 
ATOM   4977 C  CA    . ASN F 3 130 ? 35.649 50.637  76.230 1.00 38.18  ? 130  ASN B CA    1 
ATOM   4978 C  C     . ASN F 3 130 ? 36.073 49.770  75.058 1.00 37.19  ? 130  ASN B C     1 
ATOM   4979 O  O     . ASN F 3 130 ? 36.813 48.808  75.237 1.00 39.36  ? 130  ASN B O     1 
ATOM   4980 C  CB    . ASN F 3 130 ? 34.280 50.164  76.732 1.00 41.16  ? 130  ASN B CB    1 
ATOM   4981 C  CG    . ASN F 3 130 ? 33.924 50.740  78.093 1.00 44.69  ? 130  ASN B CG    1 
ATOM   4982 O  OD1   . ASN F 3 130 ? 34.733 50.713  79.024 1.00 47.07  ? 130  ASN B OD1   1 
ATOM   4983 N  ND2   . ASN F 3 130 ? 32.702 51.253  78.220 1.00 45.42  ? 130  ASN B ND2   1 
ATOM   4984 N  N     . LYS F 3 131 ? 35.602 50.108  73.862 1.00 36.70  ? 131  LYS B N     1 
ATOM   4985 C  CA    . LYS F 3 131 ? 35.938 49.348  72.655 1.00 36.87  ? 131  LYS B CA    1 
ATOM   4986 C  C     . LYS F 3 131 ? 37.428 49.384  72.341 1.00 35.73  ? 131  LYS B C     1 
ATOM   4987 O  O     . LYS F 3 131 ? 38.059 48.349  72.121 1.00 35.26  ? 131  LYS B O     1 
ATOM   4988 C  CB    . LYS F 3 131 ? 35.162 49.892  71.454 1.00 37.42  ? 131  LYS B CB    1 
ATOM   4989 C  CG    . LYS F 3 131 ? 35.609 49.325  70.112 1.00 41.29  ? 131  LYS B CG    1 
ATOM   4990 C  CD    . LYS F 3 131 ? 35.337 47.835  70.003 1.00 42.39  ? 131  LYS B CD    1 
ATOM   4991 C  CE    . LYS F 3 131 ? 33.854 47.561  69.862 1.00 45.30  ? 131  LYS B CE    1 
ATOM   4992 N  NZ    . LYS F 3 131 ? 33.567 46.100  69.769 1.00 49.89  ? 131  LYS B NZ    1 
ATOM   4993 N  N     . ILE F 3 132 ? 37.990 50.584  72.316 1.00 34.82  ? 132  ILE B N     1 
ATOM   4994 C  CA    . ILE F 3 132 ? 39.406 50.729  72.019 1.00 33.14  ? 132  ILE B CA    1 
ATOM   4995 C  C     . ILE F 3 132 ? 40.241 50.019  73.077 1.00 33.39  ? 132  ILE B C     1 
ATOM   4996 O  O     . ILE F 3 132 ? 41.197 49.317  72.750 1.00 32.43  ? 132  ILE B O     1 
ATOM   4997 C  CB    . ILE F 3 132 ? 39.785 52.217  71.923 1.00 31.95  ? 132  ILE B CB    1 
ATOM   4998 C  CG1   . ILE F 3 132 ? 39.012 52.857  70.759 1.00 30.79  ? 132  ILE B CG1   1 
ATOM   4999 C  CG2   . ILE F 3 132 ? 41.278 52.362  71.709 1.00 32.95  ? 132  ILE B CG2   1 
ATOM   5000 C  CD1   . ILE F 3 132 ? 39.127 54.373  70.672 1.00 29.72  ? 132  ILE B CD1   1 
ATOM   5001 N  N     . LEU F 3 133 ? 39.862 50.174  74.342 1.00 34.29  ? 133  LEU B N     1 
ATOM   5002 C  CA    . LEU F 3 133 ? 40.589 49.525  75.431 1.00 36.83  ? 133  LEU B CA    1 
ATOM   5003 C  C     . LEU F 3 133 ? 40.497 48.004  75.295 1.00 38.06  ? 133  LEU B C     1 
ATOM   5004 O  O     . LEU F 3 133 ? 41.470 47.281  75.504 1.00 37.24  ? 133  LEU B O     1 
ATOM   5005 C  CB    . LEU F 3 133 ? 40.017 49.951  76.785 1.00 36.55  ? 133  LEU B CB    1 
ATOM   5006 C  CG    . LEU F 3 133 ? 40.795 49.485  78.022 1.00 38.63  ? 133  LEU B CG    1 
ATOM   5007 C  CD1   . LEU F 3 133 ? 42.227 49.996  77.954 1.00 38.43  ? 133  LEU B CD1   1 
ATOM   5008 C  CD2   . LEU F 3 133 ? 40.118 49.996  79.280 1.00 37.92  ? 133  LEU B CD2   1 
ATOM   5009 N  N     . GLU F 3 134 ? 39.317 47.526  74.931 1.00 39.65  ? 134  GLU B N     1 
ATOM   5010 C  CA    . GLU F 3 134 ? 39.098 46.101  74.767 1.00 41.37  ? 134  GLU B CA    1 
ATOM   5011 C  C     . GLU F 3 134 ? 39.934 45.527  73.624 1.00 40.61  ? 134  GLU B C     1 
ATOM   5012 O  O     . GLU F 3 134 ? 40.623 44.521  73.794 1.00 40.25  ? 134  GLU B O     1 
ATOM   5013 C  CB    . GLU F 3 134 ? 37.616 45.842  74.496 1.00 45.23  ? 134  GLU B CB    1 
ATOM   5014 C  CG    . GLU F 3 134 ? 37.233 44.386  74.308 1.00 50.71  ? 134  GLU B CG    1 
ATOM   5015 C  CD    . GLU F 3 134 ? 35.800 44.232  73.816 1.00 55.02  ? 134  GLU B CD    1 
ATOM   5016 O  OE1   . GLU F 3 134 ? 35.540 44.520  72.627 1.00 57.24  ? 134  GLU B OE1   1 
ATOM   5017 O  OE2   . GLU F 3 134 ? 34.930 43.837  74.622 1.00 57.46  ? 134  GLU B OE2   1 
ATOM   5018 N  N     . LYS F 3 135 ? 39.890 46.183  72.469 1.00 38.49  ? 135  LYS B N     1 
ATOM   5019 C  CA    . LYS F 3 135 ? 40.598 45.697  71.294 1.00 37.85  ? 135  LYS B CA    1 
ATOM   5020 C  C     . LYS F 3 135 ? 42.093 45.977  71.163 1.00 37.69  ? 135  LYS B C     1 
ATOM   5021 O  O     . LYS F 3 135 ? 42.821 45.171  70.587 1.00 37.82  ? 135  LYS B O     1 
ATOM   5022 C  CB    . LYS F 3 135 ? 39.899 46.209  70.041 1.00 37.64  ? 135  LYS B CB    1 
ATOM   5023 C  CG    . LYS F 3 135 ? 38.429 45.860  69.977 1.00 39.81  ? 135  LYS B CG    1 
ATOM   5024 C  CD    . LYS F 3 135 ? 38.223 44.356  69.999 1.00 42.35  ? 135  LYS B CD    1 
ATOM   5025 C  CE    . LYS F 3 135 ? 36.752 44.013  69.883 1.00 44.14  ? 135  LYS B CE    1 
ATOM   5026 N  NZ    . LYS F 3 135 ? 36.528 42.552  69.831 1.00 45.30  ? 135  LYS B NZ    1 
ATOM   5027 N  N     . GLU F 3 136 ? 42.558 47.104  71.685 1.00 37.00  ? 136  GLU B N     1 
ATOM   5028 C  CA    . GLU F 3 136 ? 43.969 47.448  71.553 1.00 34.00  ? 136  GLU B CA    1 
ATOM   5029 C  C     . GLU F 3 136 ? 44.635 47.783  72.876 1.00 33.77  ? 136  GLU B C     1 
ATOM   5030 O  O     . GLU F 3 136 ? 45.827 48.086  72.908 1.00 31.89  ? 136  GLU B O     1 
ATOM   5031 C  CB    . GLU F 3 136 ? 44.117 48.650  70.624 1.00 33.51  ? 136  GLU B CB    1 
ATOM   5032 C  CG    . GLU F 3 136 ? 43.573 48.462  69.225 1.00 34.04  ? 136  GLU B CG    1 
ATOM   5033 C  CD    . GLU F 3 136 ? 44.387 47.480  68.410 1.00 35.74  ? 136  GLU B CD    1 
ATOM   5034 O  OE1   . GLU F 3 136 ? 45.606 47.356  68.662 1.00 36.48  ? 136  GLU B OE1   1 
ATOM   5035 O  OE2   . GLU F 3 136 ? 43.814 46.843  67.503 1.00 37.19  ? 136  GLU B OE2   1 
ATOM   5036 N  N     . LYS F 3 137 ? 43.863 47.744  73.958 1.00 34.53  ? 137  LYS B N     1 
ATOM   5037 C  CA    . LYS F 3 137 ? 44.380 48.071  75.286 1.00 35.52  ? 137  LYS B CA    1 
ATOM   5038 C  C     . LYS F 3 137 ? 44.978 49.482  75.334 1.00 34.28  ? 137  LYS B C     1 
ATOM   5039 O  O     . LYS F 3 137 ? 46.036 49.705  75.934 1.00 32.30  ? 137  LYS B O     1 
ATOM   5040 C  CB    . LYS F 3 137 ? 45.419 47.031  75.722 1.00 38.40  ? 137  LYS B CB    1 
ATOM   5041 C  CG    . LYS F 3 137 ? 44.806 45.658  75.955 1.00 44.72  ? 137  LYS B CG    1 
ATOM   5042 C  CD    . LYS F 3 137 ? 43.850 45.681  77.155 1.00 48.97  ? 137  LYS B CD    1 
ATOM   5043 C  CE    . LYS F 3 137 ? 42.662 44.736  76.963 1.00 50.66  ? 137  LYS B CE    1 
ATOM   5044 N  NZ    . LYS F 3 137 ? 43.092 43.349  76.626 1.00 53.84  ? 137  LYS B NZ    1 
ATOM   5045 N  N     . ILE F 3 138 ? 44.284 50.425  74.696 1.00 32.29  ? 138  ILE B N     1 
ATOM   5046 C  CA    . ILE F 3 138 ? 44.705 51.820  74.660 1.00 29.04  ? 138  ILE B CA    1 
ATOM   5047 C  C     . ILE F 3 138 ? 43.644 52.715  75.282 1.00 30.63  ? 138  ILE B C     1 
ATOM   5048 O  O     . ILE F 3 138 ? 42.467 52.657  74.908 1.00 30.01  ? 138  ILE B O     1 
ATOM   5049 C  CB    . ILE F 3 138 ? 44.947 52.294  73.207 1.00 28.95  ? 138  ILE B CB    1 
ATOM   5050 C  CG1   . ILE F 3 138 ? 46.184 51.610  72.630 1.00 27.52  ? 138  ILE B CG1   1 
ATOM   5051 C  CG2   . ILE F 3 138 ? 45.112 53.816  73.170 1.00 26.11  ? 138  ILE B CG2   1 
ATOM   5052 C  CD1   . ILE F 3 138 ? 47.497 52.117  73.210 1.00 26.57  ? 138  ILE B CD1   1 
ATOM   5053 N  N     . THR F 3 139 ? 44.055 53.540  76.239 1.00 31.32  ? 139  THR B N     1 
ATOM   5054 C  CA    . THR F 3 139 ? 43.121 54.456  76.877 1.00 30.61  ? 139  THR B CA    1 
ATOM   5055 C  C     . THR F 3 139 ? 43.171 55.760  76.086 1.00 29.85  ? 139  THR B C     1 
ATOM   5056 O  O     . THR F 3 139 ? 44.229 56.162  75.587 1.00 30.54  ? 139  THR B O     1 
ATOM   5057 C  CB    . THR F 3 139 ? 43.490 54.735  78.357 1.00 31.54  ? 139  THR B CB    1 
ATOM   5058 O  OG1   . THR F 3 139 ? 44.670 55.544  78.413 1.00 33.64  ? 139  THR B OG1   1 
ATOM   5059 C  CG2   . THR F 3 139 ? 43.740 53.422  79.107 1.00 30.03  ? 139  THR B CG2   1 
ATOM   5060 N  N     . VAL F 3 140 ? 42.027 56.419  75.973 1.00 27.73  ? 140  VAL B N     1 
ATOM   5061 C  CA    . VAL F 3 140 ? 41.942 57.657  75.213 1.00 27.66  ? 140  VAL B CA    1 
ATOM   5062 C  C     . VAL F 3 140 ? 41.044 58.632  75.949 1.00 28.44  ? 140  VAL B C     1 
ATOM   5063 O  O     . VAL F 3 140 ? 40.275 58.240  76.825 1.00 29.99  ? 140  VAL B O     1 
ATOM   5064 C  CB    . VAL F 3 140 ? 41.316 57.402  73.826 1.00 25.62  ? 140  VAL B CB    1 
ATOM   5065 C  CG1   . VAL F 3 140 ? 41.969 56.199  73.162 1.00 25.48  ? 140  VAL B CG1   1 
ATOM   5066 C  CG2   . VAL F 3 140 ? 39.831 57.160  73.978 1.00 25.49  ? 140  VAL B CG2   1 
ATOM   5067 N  N     . THR F 3 141 ? 41.122 59.902  75.584 1.00 27.21  ? 141  THR B N     1 
ATOM   5068 C  CA    . THR F 3 141 ? 40.279 60.889  76.219 1.00 27.44  ? 141  THR B CA    1 
ATOM   5069 C  C     . THR F 3 141 ? 39.263 61.361  75.195 1.00 27.75  ? 141  THR B C     1 
ATOM   5070 O  O     . THR F 3 141 ? 39.590 61.588  74.033 1.00 27.66  ? 141  THR B O     1 
ATOM   5071 C  CB    . THR F 3 141 ? 41.115 62.052  76.754 1.00 28.86  ? 141  THR B CB    1 
ATOM   5072 O  OG1   . THR F 3 141 ? 42.005 61.554  77.761 1.00 28.74  ? 141  THR B OG1   1 
ATOM   5073 C  CG2   . THR F 3 141 ? 40.225 63.127  77.348 1.00 27.89  ? 141  THR B CG2   1 
ATOM   5074 N  N     . VAL F 3 142 ? 38.019 61.484  75.639 1.00 27.79  ? 142  VAL B N     1 
ATOM   5075 C  CA    . VAL F 3 142 ? 36.924 61.889  74.775 1.00 27.99  ? 142  VAL B CA    1 
ATOM   5076 C  C     . VAL F 3 142 ? 36.395 63.276  75.117 1.00 28.84  ? 142  VAL B C     1 
ATOM   5077 O  O     . VAL F 3 142 ? 36.153 63.587  76.289 1.00 30.41  ? 142  VAL B O     1 
ATOM   5078 C  CB    . VAL F 3 142 ? 35.774 60.865  74.874 1.00 28.54  ? 142  VAL B CB    1 
ATOM   5079 C  CG1   . VAL F 3 142 ? 34.542 61.365  74.134 1.00 24.91  ? 142  VAL B CG1   1 
ATOM   5080 C  CG2   . VAL F 3 142 ? 36.245 59.524  74.317 1.00 24.94  ? 142  VAL B CG2   1 
ATOM   5081 N  N     . GLY F 3 143 ? 36.235 64.102  74.084 1.00 27.13  ? 143  GLY B N     1 
ATOM   5082 C  CA    . GLY F 3 143 ? 35.718 65.447  74.256 1.00 27.52  ? 143  GLY B CA    1 
ATOM   5083 C  C     . GLY F 3 143 ? 34.443 65.572  73.448 1.00 29.87  ? 143  GLY B C     1 
ATOM   5084 O  O     . GLY F 3 143 ? 34.433 65.240  72.266 1.00 30.78  ? 143  GLY B O     1 
ATOM   5085 N  N     . ILE F 3 144 ? 33.369 66.046  74.075 1.00 29.69  ? 144  ILE B N     1 
ATOM   5086 C  CA    . ILE F 3 144 ? 32.086 66.192  73.400 1.00 29.71  ? 144  ILE B CA    1 
ATOM   5087 C  C     . ILE F 3 144 ? 31.509 67.605  73.537 1.00 31.08  ? 144  ILE B C     1 
ATOM   5088 O  O     . ILE F 3 144 ? 31.467 68.164  74.635 1.00 32.03  ? 144  ILE B O     1 
ATOM   5089 C  CB    . ILE F 3 144 ? 31.061 65.186  73.982 1.00 29.92  ? 144  ILE B CB    1 
ATOM   5090 C  CG1   . ILE F 3 144 ? 31.573 63.757  73.802 1.00 31.03  ? 144  ILE B CG1   1 
ATOM   5091 C  CG2   . ILE F 3 144 ? 29.714 65.355  73.306 1.00 30.92  ? 144  ILE B CG2   1 
ATOM   5092 C  CD1   . ILE F 3 144 ? 30.681 62.690  74.441 1.00 31.50  ? 144  ILE B CD1   1 
ATOM   5093 N  N     . SER F 3 145 ? 31.071 68.182  72.421 1.00 31.05  ? 145  SER B N     1 
ATOM   5094 C  CA    . SER F 3 145 ? 30.465 69.511  72.438 1.00 33.19  ? 145  SER B CA    1 
ATOM   5095 C  C     . SER F 3 145 ? 29.791 69.836  71.105 1.00 32.84  ? 145  SER B C     1 
ATOM   5096 O  O     . SER F 3 145 ? 29.644 68.963  70.251 1.00 33.64  ? 145  SER B O     1 
ATOM   5097 C  CB    . SER F 3 145 ? 31.504 70.580  72.781 1.00 33.70  ? 145  SER B CB    1 
ATOM   5098 O  OG    . SER F 3 145 ? 30.862 71.813  73.064 1.00 34.56  ? 145  SER B OG    1 
ATOM   5099 N  N     . LYS F 3 146 ? 29.393 71.091  70.926 1.00 31.31  ? 146  LYS B N     1 
ATOM   5100 C  CA    . LYS F 3 146 ? 28.693 71.508  69.717 1.00 31.31  ? 146  LYS B CA    1 
ATOM   5101 C  C     . LYS F 3 146 ? 29.548 71.768  68.478 1.00 31.46  ? 146  LYS B C     1 
ATOM   5102 O  O     . LYS F 3 146 ? 29.014 71.915  67.378 1.00 29.67  ? 146  LYS B O     1 
ATOM   5103 C  CB    . LYS F 3 146 ? 27.837 72.744  70.014 1.00 32.54  ? 146  LYS B CB    1 
ATOM   5104 C  CG    . LYS F 3 146 ? 28.635 73.985  70.390 1.00 33.15  ? 146  LYS B CG    1 
ATOM   5105 C  CD    . LYS F 3 146 ? 27.741 75.073  70.994 1.00 35.03  ? 146  LYS B CD    1 
ATOM   5106 C  CE    . LYS F 3 146 ? 26.700 75.558  69.997 1.00 36.20  ? 146  LYS B CE    1 
ATOM   5107 N  NZ    . LYS F 3 146 ? 25.946 76.728  70.526 1.00 41.82  ? 146  LYS B NZ    1 
ATOM   5108 N  N     . ASN F 3 147 ? 30.862 71.863  68.648 1.00 29.96  ? 147  ASN B N     1 
ATOM   5109 C  CA    . ASN F 3 147 ? 31.740 72.068  67.501 1.00 29.11  ? 147  ASN B CA    1 
ATOM   5110 C  C     . ASN F 3 147 ? 33.119 71.504  67.786 1.00 28.25  ? 147  ASN B C     1 
ATOM   5111 O  O     . ASN F 3 147 ? 33.418 71.142  68.923 1.00 26.82  ? 147  ASN B O     1 
ATOM   5112 C  CB    . ASN F 3 147 ? 31.837 73.552  67.107 1.00 29.17  ? 147  ASN B CB    1 
ATOM   5113 C  CG    . ASN F 3 147 ? 32.413 74.422  68.203 1.00 31.08  ? 147  ASN B CG    1 
ATOM   5114 O  OD1   . ASN F 3 147 ? 33.461 74.118  68.774 1.00 32.25  ? 147  ASN B OD1   1 
ATOM   5115 N  ND2   . ASN F 3 147 ? 31.737 75.526  68.491 1.00 32.87  ? 147  ASN B ND2   1 
ATOM   5116 N  N     . LYS F 3 148 ? 33.953 71.437  66.752 1.00 27.02  ? 148  LYS B N     1 
ATOM   5117 C  CA    . LYS F 3 148 ? 35.302 70.883  66.881 1.00 28.08  ? 148  LYS B CA    1 
ATOM   5118 C  C     . LYS F 3 148 ? 36.174 71.523  67.954 1.00 26.82  ? 148  LYS B C     1 
ATOM   5119 O  O     . LYS F 3 148 ? 36.778 70.825  68.778 1.00 24.61  ? 148  LYS B O     1 
ATOM   5120 C  CB    . LYS F 3 148 ? 36.017 70.942  65.527 1.00 25.84  ? 148  LYS B CB    1 
ATOM   5121 C  CG    . LYS F 3 148 ? 35.435 69.948  64.526 1.00 31.37  ? 148  LYS B CG    1 
ATOM   5122 C  CD    . LYS F 3 148 ? 36.382 69.672  63.363 1.00 30.52  ? 148  LYS B CD    1 
ATOM   5123 C  CE    . LYS F 3 148 ? 36.429 70.832  62.392 1.00 32.77  ? 148  LYS B CE    1 
ATOM   5124 N  NZ    . LYS F 3 148 ? 37.267 70.469  61.210 1.00 34.22  ? 148  LYS B NZ    1 
ATOM   5125 N  N     . VAL F 3 149 ? 36.240 72.848  67.940 1.00 26.67  ? 149  VAL B N     1 
ATOM   5126 C  CA    . VAL F 3 149 ? 37.048 73.580  68.903 1.00 27.08  ? 149  VAL B CA    1 
ATOM   5127 C  C     . VAL F 3 149 ? 36.679 73.244  70.342 1.00 27.19  ? 149  VAL B C     1 
ATOM   5128 O  O     . VAL F 3 149 ? 37.533 72.854  71.132 1.00 28.85  ? 149  VAL B O     1 
ATOM   5129 C  CB    . VAL F 3 149 ? 36.923 75.097  68.677 1.00 25.69  ? 149  VAL B CB    1 
ATOM   5130 C  CG1   . VAL F 3 149 ? 37.717 75.854  69.730 1.00 25.95  ? 149  VAL B CG1   1 
ATOM   5131 C  CG2   . VAL F 3 149 ? 37.433 75.438  67.293 1.00 26.51  ? 149  VAL B CG2   1 
ATOM   5132 N  N     . PHE F 3 150 ? 35.409 73.375  70.695 1.00 28.23  ? 150  PHE B N     1 
ATOM   5133 C  CA    . PHE F 3 150 ? 35.023 73.068  72.067 1.00 27.73  ? 150  PHE B CA    1 
ATOM   5134 C  C     . PHE F 3 150 ? 35.071 71.578  72.390 1.00 27.25  ? 150  PHE B C     1 
ATOM   5135 O  O     . PHE F 3 150 ? 35.218 71.204  73.553 1.00 24.95  ? 150  PHE B O     1 
ATOM   5136 C  CB    . PHE F 3 150 ? 33.652 73.676  72.382 1.00 29.92  ? 150  PHE B CB    1 
ATOM   5137 C  CG    . PHE F 3 150 ? 33.710 75.157  72.650 1.00 30.51  ? 150  PHE B CG    1 
ATOM   5138 C  CD1   . PHE F 3 150 ? 34.223 75.632  73.853 1.00 32.02  ? 150  PHE B CD1   1 
ATOM   5139 C  CD2   . PHE F 3 150 ? 33.319 76.074  71.681 1.00 31.85  ? 150  PHE B CD2   1 
ATOM   5140 C  CE1   . PHE F 3 150 ? 34.349 76.997  74.087 1.00 33.01  ? 150  PHE B CE1   1 
ATOM   5141 C  CE2   . PHE F 3 150 ? 33.442 77.446  71.906 1.00 31.91  ? 150  PHE B CE2   1 
ATOM   5142 C  CZ    . PHE F 3 150 ? 33.959 77.906  73.111 1.00 32.62  ? 150  PHE B CZ    1 
ATOM   5143 N  N     . ALA F 3 151 ? 34.973 70.720  71.377 1.00 26.45  ? 151  ALA B N     1 
ATOM   5144 C  CA    . ALA F 3 151 ? 35.071 69.289  71.652 1.00 27.02  ? 151  ALA B CA    1 
ATOM   5145 C  C     . ALA F 3 151 ? 36.537 69.029  72.023 1.00 27.19  ? 151  ALA B C     1 
ATOM   5146 O  O     . ALA F 3 151 ? 36.838 68.225  72.908 1.00 26.33  ? 151  ALA B O     1 
ATOM   5147 C  CB    . ALA F 3 151 ? 34.677 68.477  70.435 1.00 24.58  ? 151  ALA B CB    1 
ATOM   5148 N  N     . LYS F 3 152 ? 37.446 69.729  71.350 1.00 27.48  ? 152  LYS B N     1 
ATOM   5149 C  CA    . LYS F 3 152 ? 38.869 69.576  71.633 1.00 27.90  ? 152  LYS B CA    1 
ATOM   5150 C  C     . LYS F 3 152 ? 39.196 70.136  73.021 1.00 27.57  ? 152  LYS B C     1 
ATOM   5151 O  O     . LYS F 3 152 ? 39.941 69.527  73.783 1.00 27.04  ? 152  LYS B O     1 
ATOM   5152 C  CB    . LYS F 3 152 ? 39.708 70.292  70.570 1.00 27.63  ? 152  LYS B CB    1 
ATOM   5153 C  CG    . LYS F 3 152 ? 41.206 70.186  70.797 1.00 28.19  ? 152  LYS B CG    1 
ATOM   5154 C  CD    . LYS F 3 152 ? 41.956 70.257  69.469 1.00 35.88  ? 152  LYS B CD    1 
ATOM   5155 C  CE    . LYS F 3 152 ? 43.371 69.704  69.604 1.00 39.37  ? 152  LYS B CE    1 
ATOM   5156 N  NZ    . LYS F 3 152 ? 43.419 68.391  70.319 1.00 44.51  ? 152  LYS B NZ    1 
ATOM   5157 N  N     . ILE F 3 153 ? 38.651 71.303  73.344 1.00 28.98  ? 153  ILE B N     1 
ATOM   5158 C  CA    . ILE F 3 153 ? 38.901 71.894  74.653 1.00 28.84  ? 153  ILE B CA    1 
ATOM   5159 C  C     . ILE F 3 153 ? 38.370 70.949  75.734 1.00 28.87  ? 153  ILE B C     1 
ATOM   5160 O  O     . ILE F 3 153 ? 38.985 70.792  76.782 1.00 28.19  ? 153  ILE B O     1 
ATOM   5161 C  CB    . ILE F 3 153 ? 38.229 73.280  74.769 1.00 28.97  ? 153  ILE B CB    1 
ATOM   5162 C  CG1   . ILE F 3 153 ? 39.005 74.276  73.911 1.00 28.70  ? 153  ILE B CG1   1 
ATOM   5163 C  CG2   . ILE F 3 153 ? 38.191 73.751  76.235 1.00 26.53  ? 153  ILE B CG2   1 
ATOM   5164 C  CD1   . ILE F 3 153 ? 38.331 75.622  73.764 1.00 30.21  ? 153  ILE B CD1   1 
ATOM   5165 N  N     . ALA F 3 154 ? 37.247 70.290  75.460 1.00 28.81  ? 154  ALA B N     1 
ATOM   5166 C  CA    . ALA F 3 154 ? 36.669 69.364  76.430 1.00 29.61  ? 154  ALA B CA    1 
ATOM   5167 C  C     . ALA F 3 154 ? 37.640 68.218  76.728 1.00 30.00  ? 154  ALA B C     1 
ATOM   5168 O  O     . ALA F 3 154 ? 37.853 67.851  77.888 1.00 29.70  ? 154  ALA B O     1 
ATOM   5169 C  CB    . ALA F 3 154 ? 35.344 68.818  75.907 1.00 26.55  ? 154  ALA B CB    1 
ATOM   5170 N  N     . ALA F 3 155 ? 38.235 67.657  75.683 1.00 29.93  ? 155  ALA B N     1 
ATOM   5171 C  CA    . ALA F 3 155 ? 39.180 66.565  75.858 1.00 29.95  ? 155  ALA B CA    1 
ATOM   5172 C  C     . ALA F 3 155 ? 40.411 67.065  76.610 1.00 31.20  ? 155  ALA B C     1 
ATOM   5173 O  O     . ALA F 3 155 ? 40.940 66.371  77.481 1.00 29.97  ? 155  ALA B O     1 
ATOM   5174 C  CB    . ALA F 3 155 ? 39.583 65.999  74.507 1.00 30.86  ? 155  ALA B CB    1 
ATOM   5175 N  N     . ASP F 3 156 ? 40.872 68.265  76.276 1.00 31.01  ? 156  ASP B N     1 
ATOM   5176 C  CA    . ASP F 3 156 ? 42.040 68.808  76.957 1.00 34.58  ? 156  ASP B CA    1 
ATOM   5177 C  C     . ASP F 3 156 ? 41.785 68.896  78.462 1.00 35.30  ? 156  ASP B C     1 
ATOM   5178 O  O     . ASP F 3 156 ? 42.657 68.567  79.254 1.00 35.62  ? 156  ASP B O     1 
ATOM   5179 C  CB    . ASP F 3 156 ? 42.409 70.193  76.405 1.00 34.38  ? 156  ASP B CB    1 
ATOM   5180 C  CG    . ASP F 3 156 ? 43.030 70.127  75.008 1.00 41.67  ? 156  ASP B CG    1 
ATOM   5181 O  OD1   . ASP F 3 156 ? 43.486 69.032  74.594 1.00 39.56  ? 156  ASP B OD1   1 
ATOM   5182 O  OD2   . ASP F 3 156 ? 43.075 71.180  74.327 1.00 43.95  ? 156  ASP B OD2   1 
ATOM   5183 N  N     . MET F 3 157 ? 40.589 69.327  78.856 1.00 35.94  ? 157  MET B N     1 
ATOM   5184 C  CA    . MET F 3 157 ? 40.267 69.437  80.276 1.00 38.86  ? 157  MET B CA    1 
ATOM   5185 C  C     . MET F 3 157 ? 40.173 68.084  80.975 1.00 39.84  ? 157  MET B C     1 
ATOM   5186 O  O     . MET F 3 157 ? 40.503 67.965  82.156 1.00 41.31  ? 157  MET B O     1 
ATOM   5187 C  CB    . MET F 3 157 ? 38.940 70.179  80.479 1.00 39.39  ? 157  MET B CB    1 
ATOM   5188 C  CG    . MET F 3 157 ? 38.948 71.643  80.066 1.00 42.53  ? 157  MET B CG    1 
ATOM   5189 S  SD    . MET F 3 157 ? 37.303 72.364  80.228 1.00 46.12  ? 157  MET B SD    1 
ATOM   5190 C  CE    . MET F 3 157 ? 36.379 71.255  79.217 1.00 51.37  ? 157  MET B CE    1 
ATOM   5191 N  N     . ALA F 3 158 ? 39.746 67.058  80.246 1.00 39.15  ? 158  ALA B N     1 
ATOM   5192 C  CA    . ALA F 3 158 ? 39.567 65.738  80.836 1.00 38.46  ? 158  ALA B CA    1 
ATOM   5193 C  C     . ALA F 3 158 ? 40.714 64.726  80.764 1.00 39.55  ? 158  ALA B C     1 
ATOM   5194 O  O     . ALA F 3 158 ? 40.640 63.673  81.402 1.00 38.15  ? 158  ALA B O     1 
ATOM   5195 C  CB    . ALA F 3 158 ? 38.303 65.109  80.269 1.00 37.22  ? 158  ALA B CB    1 
ATOM   5196 N  N     . LYS F 3 159 ? 41.775 65.007  80.018 1.00 39.26  ? 159  LYS B N     1 
ATOM   5197 C  CA    . LYS F 3 159 ? 42.839 64.015  79.946 1.00 41.45  ? 159  LYS B CA    1 
ATOM   5198 C  C     . LYS F 3 159 ? 43.687 63.961  81.217 1.00 41.46  ? 159  LYS B C     1 
ATOM   5199 O  O     . LYS F 3 159 ? 43.739 64.928  81.981 1.00 42.04  ? 159  LYS B O     1 
ATOM   5200 C  CB    . LYS F 3 159 ? 43.728 64.250  78.713 1.00 44.02  ? 159  LYS B CB    1 
ATOM   5201 C  CG    . LYS F 3 159 ? 44.461 65.570  78.674 1.00 46.28  ? 159  LYS B CG    1 
ATOM   5202 C  CD    . LYS F 3 159 ? 45.383 65.652  77.446 1.00 48.50  ? 159  LYS B CD    1 
ATOM   5203 C  CE    . LYS F 3 159 ? 44.612 65.510  76.130 1.00 49.37  ? 159  LYS B CE    1 
ATOM   5204 N  NZ    . LYS F 3 159 ? 45.449 65.773  74.913 1.00 46.17  ? 159  LYS B NZ    1 
ATOM   5205 N  N     . PRO F 3 160 ? 44.326 62.808  81.478 1.00 39.47  ? 160  PRO B N     1 
ATOM   5206 C  CA    . PRO F 3 160 ? 44.275 61.608  80.634 1.00 39.02  ? 160  PRO B CA    1 
ATOM   5207 C  C     . PRO F 3 160 ? 43.112 60.665  80.958 1.00 37.86  ? 160  PRO B C     1 
ATOM   5208 O  O     . PRO F 3 160 ? 42.376 60.872  81.923 1.00 37.25  ? 160  PRO B O     1 
ATOM   5209 C  CB    . PRO F 3 160 ? 45.630 60.960  80.880 1.00 39.50  ? 160  PRO B CB    1 
ATOM   5210 C  CG    . PRO F 3 160 ? 45.856 61.242  82.318 1.00 38.60  ? 160  PRO B CG    1 
ATOM   5211 C  CD    . PRO F 3 160 ? 45.398 62.682  82.486 1.00 40.56  ? 160  PRO B CD    1 
ATOM   5212 N  N     . ASN F 3 161 ? 42.966 59.628  80.139 1.00 37.49  ? 161  ASN B N     1 
ATOM   5213 C  CA    . ASN F 3 161 ? 41.911 58.631  80.293 1.00 37.39  ? 161  ASN B CA    1 
ATOM   5214 C  C     . ASN F 3 161 ? 40.615 59.218  80.824 1.00 36.33  ? 161  ASN B C     1 
ATOM   5215 O  O     . ASN F 3 161 ? 40.085 58.743  81.824 1.00 34.18  ? 161  ASN B O     1 
ATOM   5216 C  CB    . ASN F 3 161 ? 42.368 57.512  81.233 1.00 40.60  ? 161  ASN B CB    1 
ATOM   5217 C  CG    . ASN F 3 161 ? 41.451 56.298  81.184 1.00 41.62  ? 161  ASN B CG    1 
ATOM   5218 O  OD1   . ASN F 3 161 ? 40.503 56.251  80.400 1.00 42.73  ? 161  ASN B OD1   1 
ATOM   5219 N  ND2   . ASN F 3 161 ? 41.737 55.307  82.018 1.00 42.37  ? 161  ASN B ND2   1 
ATOM   5220 N  N     . GLY F 3 162 ? 40.095 60.239  80.153 1.00 35.57  ? 162  GLY B N     1 
ATOM   5221 C  CA    . GLY F 3 162 ? 38.863 60.843  80.626 1.00 34.66  ? 162  GLY B CA    1 
ATOM   5222 C  C     . GLY F 3 162 ? 37.787 60.985  79.576 1.00 34.55  ? 162  GLY B C     1 
ATOM   5223 O  O     . GLY F 3 162 ? 37.884 60.433  78.475 1.00 35.79  ? 162  GLY B O     1 
ATOM   5224 N  N     . ILE F 3 163 ? 36.744 61.723  79.933 1.00 32.82  ? 163  ILE B N     1 
ATOM   5225 C  CA    . ILE F 3 163 ? 35.634 61.986  79.033 1.00 33.73  ? 163  ILE B CA    1 
ATOM   5226 C  C     . ILE F 3 163 ? 34.839 63.139  79.611 1.00 34.43  ? 163  ILE B C     1 
ATOM   5227 O  O     . ILE F 3 163 ? 34.495 63.138  80.793 1.00 34.92  ? 163  ILE B O     1 
ATOM   5228 C  CB    . ILE F 3 163 ? 34.712 60.751  78.854 1.00 33.40  ? 163  ILE B CB    1 
ATOM   5229 C  CG1   . ILE F 3 163 ? 33.516 61.135  77.981 1.00 33.07  ? 163  ILE B CG1   1 
ATOM   5230 C  CG2   . ILE F 3 163 ? 34.256 60.215  80.213 1.00 34.54  ? 163  ILE B CG2   1 
ATOM   5231 C  CD1   . ILE F 3 163 ? 32.595 59.994  77.655 1.00 33.33  ? 163  ILE B CD1   1 
ATOM   5232 N  N     . LYS F 3 164 ? 34.569 64.138  78.782 1.00 35.21  ? 164  LYS B N     1 
ATOM   5233 C  CA    . LYS F 3 164 ? 33.823 65.294  79.239 1.00 35.68  ? 164  LYS B CA    1 
ATOM   5234 C  C     . LYS F 3 164 ? 32.950 65.907  78.161 1.00 36.93  ? 164  LYS B C     1 
ATOM   5235 O  O     . LYS F 3 164 ? 33.319 65.941  76.981 1.00 38.08  ? 164  LYS B O     1 
ATOM   5236 C  CB    . LYS F 3 164 ? 34.776 66.363  79.784 1.00 38.61  ? 164  LYS B CB    1 
ATOM   5237 C  CG    . LYS F 3 164 ? 34.073 67.682  80.099 1.00 41.99  ? 164  LYS B CG    1 
ATOM   5238 C  CD    . LYS F 3 164 ? 34.930 68.634  80.906 1.00 46.16  ? 164  LYS B CD    1 
ATOM   5239 C  CE    . LYS F 3 164 ? 34.146 69.902  81.220 1.00 49.23  ? 164  LYS B CE    1 
ATOM   5240 N  NZ    . LYS F 3 164 ? 32.838 69.596  81.877 1.00 48.55  ? 164  LYS B NZ    1 
ATOM   5241 N  N     . VAL F 3 165 ? 31.789 66.393  78.585 1.00 35.08  ? 165  VAL B N     1 
ATOM   5242 C  CA    . VAL F 3 165 ? 30.844 67.045  77.695 1.00 35.32  ? 165  VAL B CA    1 
ATOM   5243 C  C     . VAL F 3 165 ? 30.770 68.521  78.067 1.00 35.69  ? 165  VAL B C     1 
ATOM   5244 O  O     . VAL F 3 165 ? 30.695 68.857  79.244 1.00 35.80  ? 165  VAL B O     1 
ATOM   5245 C  CB    . VAL F 3 165 ? 29.414 66.465  77.850 1.00 34.65  ? 165  VAL B CB    1 
ATOM   5246 C  CG1   . VAL F 3 165 ? 28.427 67.303  77.050 1.00 33.69  ? 165  VAL B CG1   1 
ATOM   5247 C  CG2   . VAL F 3 165 ? 29.375 65.013  77.403 1.00 32.45  ? 165  VAL B CG2   1 
ATOM   5248 N  N     . ILE F 3 166 ? 30.817 69.398  77.070 1.00 35.74  ? 166  ILE B N     1 
ATOM   5249 C  CA    . ILE F 3 166 ? 30.682 70.830  77.315 1.00 37.64  ? 166  ILE B CA    1 
ATOM   5250 C  C     . ILE F 3 166 ? 29.377 71.211  76.618 1.00 38.08  ? 166  ILE B C     1 
ATOM   5251 O  O     . ILE F 3 166 ? 29.368 71.480  75.420 1.00 37.10  ? 166  ILE B O     1 
ATOM   5252 C  CB    . ILE F 3 166 ? 31.850 71.661  76.704 1.00 36.09  ? 166  ILE B CB    1 
ATOM   5253 C  CG1   . ILE F 3 166 ? 33.162 71.362  77.431 1.00 36.10  ? 166  ILE B CG1   1 
ATOM   5254 C  CG2   . ILE F 3 166 ? 31.557 73.150  76.831 1.00 36.87  ? 166  ILE B CG2   1 
ATOM   5255 C  CD1   . ILE F 3 166 ? 34.347 72.185  76.919 1.00 31.31  ? 166  ILE B CD1   1 
ATOM   5256 N  N     . ASP F 3 167 ? 28.276 71.206  77.367 1.00 40.76  ? 167  ASP B N     1 
ATOM   5257 C  CA    . ASP F 3 167 ? 26.966 71.536  76.806 1.00 43.68  ? 167  ASP B CA    1 
ATOM   5258 C  C     . ASP F 3 167 ? 26.878 73.005  76.396 1.00 45.79  ? 167  ASP B C     1 
ATOM   5259 O  O     . ASP F 3 167 ? 27.810 73.781  76.620 1.00 45.01  ? 167  ASP B O     1 
ATOM   5260 C  CB    . ASP F 3 167 ? 25.853 71.204  77.807 1.00 44.99  ? 167  ASP B CB    1 
ATOM   5261 C  CG    . ASP F 3 167 ? 25.969 71.998  79.094 1.00 46.85  ? 167  ASP B CG    1 
ATOM   5262 O  OD1   . ASP F 3 167 ? 25.999 73.243  79.021 1.00 46.24  ? 167  ASP B OD1   1 
ATOM   5263 O  OD2   . ASP F 3 167 ? 26.030 71.375  80.176 1.00 48.42  ? 167  ASP B OD2   1 
ATOM   5264 N  N     . ASP F 3 168 ? 25.752 73.387  75.804 1.00 47.42  ? 168  ASP B N     1 
ATOM   5265 C  CA    . ASP F 3 168 ? 25.574 74.756  75.342 1.00 50.58  ? 168  ASP B CA    1 
ATOM   5266 C  C     . ASP F 3 168 ? 25.746 75.825  76.412 1.00 50.74  ? 168  ASP B C     1 
ATOM   5267 O  O     . ASP F 3 168 ? 26.275 76.900  76.137 1.00 50.05  ? 168  ASP B O     1 
ATOM   5268 C  CB    . ASP F 3 168 ? 24.217 74.905  74.654 1.00 52.05  ? 168  ASP B CB    1 
ATOM   5269 C  CG    . ASP F 3 168 ? 24.125 74.087  73.379 1.00 54.62  ? 168  ASP B CG    1 
ATOM   5270 O  OD1   . ASP F 3 168 ? 25.169 73.896  72.714 1.00 56.13  ? 168  ASP B OD1   1 
ATOM   5271 O  OD2   . ASP F 3 168 ? 23.011 73.644  73.032 1.00 57.68  ? 168  ASP B OD2   1 
ATOM   5272 N  N     . GLU F 3 169 ? 25.310 75.539  77.631 1.00 52.06  ? 169  GLU B N     1 
ATOM   5273 C  CA    . GLU F 3 169 ? 25.457 76.514  78.696 1.00 52.83  ? 169  GLU B CA    1 
ATOM   5274 C  C     . GLU F 3 169 ? 26.923 76.706  79.057 1.00 51.34  ? 169  GLU B C     1 
ATOM   5275 O  O     . GLU F 3 169 ? 27.413 77.838  79.066 1.00 52.28  ? 169  GLU B O     1 
ATOM   5276 C  CB    . GLU F 3 169 ? 24.683 76.097  79.947 1.00 56.42  ? 169  GLU B CB    1 
ATOM   5277 C  CG    . GLU F 3 169 ? 24.866 77.079  81.101 1.00 61.16  ? 169  GLU B CG    1 
ATOM   5278 C  CD    . GLU F 3 169 ? 24.145 76.654  82.363 1.00 63.94  ? 169  GLU B CD    1 
ATOM   5279 O  OE1   . GLU F 3 169 ? 24.428 75.543  82.865 1.00 67.25  ? 169  GLU B OE1   1 
ATOM   5280 O  OE2   . GLU F 3 169 ? 23.299 77.434  82.856 1.00 65.54  ? 169  GLU B OE2   1 
ATOM   5281 N  N     . GLU F 3 170 ? 27.631 75.616  79.353 1.00 47.79  ? 170  GLU B N     1 
ATOM   5282 C  CA    . GLU F 3 170 ? 29.039 75.753  79.713 1.00 45.59  ? 170  GLU B CA    1 
ATOM   5283 C  C     . GLU F 3 170 ? 29.838 76.428  78.598 1.00 42.36  ? 170  GLU B C     1 
ATOM   5284 O  O     . GLU F 3 170 ? 30.829 77.108  78.871 1.00 41.13  ? 170  GLU B O     1 
ATOM   5285 C  CB    . GLU F 3 170 ? 29.668 74.401  80.074 1.00 47.34  ? 170  GLU B CB    1 
ATOM   5286 C  CG    . GLU F 3 170 ? 31.150 74.523  80.467 1.00 49.33  ? 170  GLU B CG    1 
ATOM   5287 C  CD    . GLU F 3 170 ? 31.707 73.286  81.154 1.00 51.61  ? 170  GLU B CD    1 
ATOM   5288 O  OE1   . GLU F 3 170 ? 31.177 72.174  80.930 1.00 52.41  ? 170  GLU B OE1   1 
ATOM   5289 O  OE2   . GLU F 3 170 ? 32.692 73.424  81.912 1.00 52.69  ? 170  GLU B OE2   1 
ATOM   5290 N  N     . VAL F 3 171 ? 29.409 76.248  77.348 1.00 38.96  ? 171  VAL B N     1 
ATOM   5291 C  CA    . VAL F 3 171 ? 30.090 76.889  76.227 1.00 37.23  ? 171  VAL B CA    1 
ATOM   5292 C  C     . VAL F 3 171 ? 29.949 78.403  76.405 1.00 38.23  ? 171  VAL B C     1 
ATOM   5293 O  O     . VAL F 3 171 ? 30.902 79.160  76.203 1.00 36.48  ? 171  VAL B O     1 
ATOM   5294 C  CB    . VAL F 3 171 ? 29.473 76.475  74.874 1.00 36.12  ? 171  VAL B CB    1 
ATOM   5295 C  CG1   . VAL F 3 171 ? 29.878 77.456  73.789 1.00 32.71  ? 171  VAL B CG1   1 
ATOM   5296 C  CG2   . VAL F 3 171 ? 29.945 75.073  74.501 1.00 35.63  ? 171  VAL B CG2   1 
ATOM   5297 N  N     . LYS F 3 172 ? 28.754 78.839  76.788 1.00 38.57  ? 172  LYS B N     1 
ATOM   5298 C  CA    . LYS F 3 172 ? 28.513 80.257  77.011 1.00 40.59  ? 172  LYS B CA    1 
ATOM   5299 C  C     . LYS F 3 172 ? 29.346 80.698  78.211 1.00 40.82  ? 172  LYS B C     1 
ATOM   5300 O  O     . LYS F 3 172 ? 29.832 81.828  78.266 1.00 42.25  ? 172  LYS B O     1 
ATOM   5301 C  CB    . LYS F 3 172 ? 27.022 80.507  77.266 1.00 42.28  ? 172  LYS B CB    1 
ATOM   5302 C  CG    . LYS F 3 172 ? 26.131 80.161  76.073 1.00 45.68  ? 172  LYS B CG    1 
ATOM   5303 C  CD    . LYS F 3 172 ? 24.655 80.132  76.444 1.00 49.03  ? 172  LYS B CD    1 
ATOM   5304 C  CE    . LYS F 3 172 ? 24.162 81.507  76.855 1.00 51.24  ? 172  LYS B CE    1 
ATOM   5305 N  NZ    . LYS F 3 172 ? 22.734 81.478  77.285 1.00 54.58  ? 172  LYS B NZ    1 
ATOM   5306 N  N     . ARG F 3 173 ? 29.523 79.801  79.173 1.00 40.90  ? 173  ARG B N     1 
ATOM   5307 C  CA    . ARG F 3 173 ? 30.316 80.131  80.345 1.00 42.00  ? 173  ARG B CA    1 
ATOM   5308 C  C     . ARG F 3 173 ? 31.791 80.230  79.957 1.00 41.77  ? 173  ARG B C     1 
ATOM   5309 O  O     . ARG F 3 173 ? 32.463 81.206  80.289 1.00 41.31  ? 173  ARG B O     1 
ATOM   5310 C  CB    . ARG F 3 173 ? 30.135 79.073  81.440 1.00 44.04  ? 173  ARG B CB    1 
ATOM   5311 C  CG    . ARG F 3 173 ? 30.919 79.376  82.718 1.00 49.30  ? 173  ARG B CG    1 
ATOM   5312 C  CD    . ARG F 3 173 ? 30.640 78.360  83.827 1.00 54.07  ? 173  ARG B CD    1 
ATOM   5313 N  NE    . ARG F 3 173 ? 31.253 77.062  83.562 1.00 58.87  ? 173  ARG B NE    1 
ATOM   5314 C  CZ    . ARG F 3 173 ? 32.552 76.803  83.694 1.00 61.14  ? 173  ARG B CZ    1 
ATOM   5315 N  NH1   . ARG F 3 173 ? 33.382 77.753  84.097 1.00 61.33  ? 173  ARG B NH1   1 
ATOM   5316 N  NH2   . ARG F 3 173 ? 33.025 75.595  83.414 1.00 62.02  ? 173  ARG B NH2   1 
ATOM   5317 N  N     . LEU F 3 174 ? 32.291 79.228  79.238 1.00 40.62  ? 174  LEU B N     1 
ATOM   5318 C  CA    . LEU F 3 174 ? 33.696 79.229  78.835 1.00 39.73  ? 174  LEU B CA    1 
ATOM   5319 C  C     . LEU F 3 174 ? 34.065 80.445  77.991 1.00 36.51  ? 174  LEU B C     1 
ATOM   5320 O  O     . LEU F 3 174 ? 35.183 80.948  78.075 1.00 33.17  ? 174  LEU B O     1 
ATOM   5321 C  CB    . LEU F 3 174 ? 34.039 77.942  78.078 1.00 40.30  ? 174  LEU B CB    1 
ATOM   5322 C  CG    . LEU F 3 174 ? 34.013 76.669  78.927 1.00 43.64  ? 174  LEU B CG    1 
ATOM   5323 C  CD1   . LEU F 3 174 ? 34.453 75.485  78.074 1.00 43.47  ? 174  LEU B CD1   1 
ATOM   5324 C  CD2   . LEU F 3 174 ? 34.929 76.824  80.140 1.00 43.25  ? 174  LEU B CD2   1 
ATOM   5325 N  N     . ILE F 3 175 ? 33.123 80.916  77.183 1.00 35.29  ? 175  ILE B N     1 
ATOM   5326 C  CA    . ILE F 3 175 ? 33.373 82.077  76.344 1.00 34.93  ? 175  ILE B CA    1 
ATOM   5327 C  C     . ILE F 3 175 ? 33.732 83.284  77.213 1.00 37.44  ? 175  ILE B C     1 
ATOM   5328 O  O     . ILE F 3 175 ? 34.486 84.166  76.794 1.00 35.61  ? 175  ILE B O     1 
ATOM   5329 C  CB    . ILE F 3 175 ? 32.141 82.387  75.478 1.00 33.71  ? 175  ILE B CB    1 
ATOM   5330 C  CG1   . ILE F 3 175 ? 32.078 81.391  74.311 1.00 31.90  ? 175  ILE B CG1   1 
ATOM   5331 C  CG2   . ILE F 3 175 ? 32.199 83.815  74.967 1.00 30.60  ? 175  ILE B CG2   1 
ATOM   5332 C  CD1   . ILE F 3 175 ? 30.801 81.457  73.509 1.00 29.84  ? 175  ILE B CD1   1 
ATOM   5333 N  N     . ARG F 3 176 ? 33.204 83.301  78.437 1.00 38.62  ? 176  ARG B N     1 
ATOM   5334 C  CA    . ARG F 3 176 ? 33.466 84.390  79.374 1.00 40.75  ? 176  ARG B CA    1 
ATOM   5335 C  C     . ARG F 3 176 ? 34.643 84.121  80.304 1.00 39.55  ? 176  ARG B C     1 
ATOM   5336 O  O     . ARG F 3 176 ? 35.386 85.033  80.650 1.00 40.40  ? 176  ARG B O     1 
ATOM   5337 C  CB    . ARG F 3 176 ? 32.218 84.672  80.236 1.00 42.95  ? 176  ARG B CB    1 
ATOM   5338 C  CG    . ARG F 3 176 ? 31.045 85.283  79.480 1.00 46.27  ? 176  ARG B CG    1 
ATOM   5339 C  CD    . ARG F 3 176 ? 29.907 85.721  80.401 1.00 50.07  ? 176  ARG B CD    1 
ATOM   5340 N  NE    . ARG F 3 176 ? 29.051 84.618  80.840 1.00 53.00  ? 176  ARG B NE    1 
ATOM   5341 C  CZ    . ARG F 3 176 ? 29.235 83.908  81.950 1.00 56.28  ? 176  ARG B CZ    1 
ATOM   5342 N  NH1   . ARG F 3 176 ? 30.253 84.169  82.764 1.00 57.83  ? 176  ARG B NH1   1 
ATOM   5343 N  NH2   . ARG F 3 176 ? 28.387 82.936  82.256 1.00 56.99  ? 176  ARG B NH2   1 
ATOM   5344 N  N     . GLU F 3 177 ? 34.830 82.867  80.691 1.00 39.94  ? 177  GLU B N     1 
ATOM   5345 C  CA    . GLU F 3 177 ? 35.881 82.536  81.645 1.00 40.68  ? 177  GLU B CA    1 
ATOM   5346 C  C     . GLU F 3 177 ? 37.141 81.838  81.146 1.00 39.85  ? 177  GLU B C     1 
ATOM   5347 O  O     . GLU F 3 177 ? 38.195 81.961  81.769 1.00 39.98  ? 177  GLU B O     1 
ATOM   5348 C  CB    . GLU F 3 177 ? 35.276 81.695  82.774 1.00 43.97  ? 177  GLU B CB    1 
ATOM   5349 C  CG    . GLU F 3 177 ? 33.859 82.097  83.149 1.00 48.08  ? 177  GLU B CG    1 
ATOM   5350 C  CD    . GLU F 3 177 ? 33.317 81.295  84.313 1.00 52.61  ? 177  GLU B CD    1 
ATOM   5351 O  OE1   . GLU F 3 177 ? 33.442 80.052  84.290 1.00 53.32  ? 177  GLU B OE1   1 
ATOM   5352 O  OE2   . GLU F 3 177 ? 32.759 81.908  85.251 1.00 56.17  ? 177  GLU B OE2   1 
ATOM   5353 N  N     . LEU F 3 178 ? 37.050 81.094  80.049 1.00 37.68  ? 178  LEU B N     1 
ATOM   5354 C  CA    . LEU F 3 178 ? 38.223 80.380  79.552 1.00 36.32  ? 178  LEU B CA    1 
ATOM   5355 C  C     . LEU F 3 178 ? 39.368 81.317  79.196 1.00 34.19  ? 178  LEU B C     1 
ATOM   5356 O  O     . LEU F 3 178 ? 39.159 82.306  78.509 1.00 33.32  ? 178  LEU B O     1 
ATOM   5357 C  CB    . LEU F 3 178 ? 37.864 79.536  78.320 1.00 34.87  ? 178  LEU B CB    1 
ATOM   5358 C  CG    . LEU F 3 178 ? 38.999 78.662  77.765 1.00 34.83  ? 178  LEU B CG    1 
ATOM   5359 C  CD1   . LEU F 3 178 ? 39.410 77.647  78.810 1.00 36.71  ? 178  LEU B CD1   1 
ATOM   5360 C  CD2   . LEU F 3 178 ? 38.557 77.947  76.512 1.00 34.82  ? 178  LEU B CD2   1 
ATOM   5361 N  N     . ASP F 3 179 ? 40.571 81.010  79.677 1.00 33.41  ? 179  ASP B N     1 
ATOM   5362 C  CA    . ASP F 3 179 ? 41.753 81.810  79.352 1.00 35.26  ? 179  ASP B CA    1 
ATOM   5363 C  C     . ASP F 3 179 ? 41.876 81.681  77.833 1.00 34.83  ? 179  ASP B C     1 
ATOM   5364 O  O     . ASP F 3 179 ? 41.978 80.568  77.304 1.00 33.99  ? 179  ASP B O     1 
ATOM   5365 C  CB    . ASP F 3 179 ? 43.000 81.219  80.028 1.00 39.01  ? 179  ASP B CB    1 
ATOM   5366 C  CG    . ASP F 3 179 ? 44.267 82.031  79.752 1.00 43.29  ? 179  ASP B CG    1 
ATOM   5367 O  OD1   . ASP F 3 179 ? 44.256 82.879  78.827 1.00 44.23  ? 179  ASP B OD1   1 
ATOM   5368 O  OD2   . ASP F 3 179 ? 45.284 81.808  80.453 1.00 45.79  ? 179  ASP B OD2   1 
ATOM   5369 N  N     . ILE F 3 180 ? 41.870 82.809  77.131 1.00 33.28  ? 180  ILE B N     1 
ATOM   5370 C  CA    . ILE F 3 180 ? 41.929 82.772  75.680 1.00 31.89  ? 180  ILE B CA    1 
ATOM   5371 C  C     . ILE F 3 180 ? 43.171 82.066  75.139 1.00 33.48  ? 180  ILE B C     1 
ATOM   5372 O  O     . ILE F 3 180 ? 43.155 81.524  74.031 1.00 31.66  ? 180  ILE B O     1 
ATOM   5373 C  CB    . ILE F 3 180 ? 41.812 84.194  75.087 1.00 30.93  ? 180  ILE B CB    1 
ATOM   5374 C  CG1   . ILE F 3 180 ? 41.320 84.097  73.638 1.00 29.96  ? 180  ILE B CG1   1 
ATOM   5375 C  CG2   . ILE F 3 180 ? 43.136 84.918  75.197 1.00 28.02  ? 180  ILE B CG2   1 
ATOM   5376 C  CD1   . ILE F 3 180 ? 40.770 85.388  73.074 1.00 31.14  ? 180  ILE B CD1   1 
ATOM   5377 N  N     . ALA F 3 181 ? 44.242 82.055  75.923 1.00 34.01  ? 181  ALA B N     1 
ATOM   5378 C  CA    . ALA F 3 181 ? 45.465 81.387  75.502 1.00 34.59  ? 181  ALA B CA    1 
ATOM   5379 C  C     . ALA F 3 181 ? 45.240 79.875  75.407 1.00 33.86  ? 181  ALA B C     1 
ATOM   5380 O  O     . ALA F 3 181 ? 46.037 79.166  74.815 1.00 34.13  ? 181  ALA B O     1 
ATOM   5381 C  CB    . ALA F 3 181 ? 46.584 81.685  76.482 1.00 35.94  ? 181  ALA B CB    1 
ATOM   5382 N  N     . ASP F 3 182 ? 44.151 79.385  75.984 1.00 34.41  ? 182  ASP B N     1 
ATOM   5383 C  CA    . ASP F 3 182 ? 43.860 77.954  75.944 1.00 35.33  ? 182  ASP B CA    1 
ATOM   5384 C  C     . ASP F 3 182 ? 43.020 77.552  74.739 1.00 33.22  ? 182  ASP B C     1 
ATOM   5385 O  O     . ASP F 3 182 ? 42.671 76.384  74.574 1.00 32.75  ? 182  ASP B O     1 
ATOM   5386 C  CB    . ASP F 3 182 ? 43.160 77.521  77.233 1.00 38.79  ? 182  ASP B CB    1 
ATOM   5387 C  CG    . ASP F 3 182 ? 44.045 77.683  78.447 1.00 43.59  ? 182  ASP B CG    1 
ATOM   5388 O  OD1   . ASP F 3 182 ? 45.118 77.043  78.481 1.00 46.50  ? 182  ASP B OD1   1 
ATOM   5389 O  OD2   . ASP F 3 182 ? 43.680 78.455  79.362 1.00 49.24  ? 182  ASP B OD2   1 
ATOM   5390 N  N     . VAL F 3 183 ? 42.689 78.526  73.902 1.00 30.96  ? 183  VAL B N     1 
ATOM   5391 C  CA    . VAL F 3 183 ? 41.920 78.249  72.695 1.00 30.60  ? 183  VAL B CA    1 
ATOM   5392 C  C     . VAL F 3 183 ? 42.859 77.710  71.621 1.00 29.02  ? 183  VAL B C     1 
ATOM   5393 O  O     . VAL F 3 183 ? 43.930 78.265  71.386 1.00 29.80  ? 183  VAL B O     1 
ATOM   5394 C  CB    . VAL F 3 183 ? 41.244 79.521  72.155 1.00 30.31  ? 183  VAL B CB    1 
ATOM   5395 C  CG1   . VAL F 3 183 ? 40.596 79.244  70.801 1.00 27.74  ? 183  VAL B CG1   1 
ATOM   5396 C  CG2   . VAL F 3 183 ? 40.210 80.007  73.154 1.00 31.81  ? 183  VAL B CG2   1 
ATOM   5397 N  N     . PRO F 3 184 ? 42.472 76.613  70.962 1.00 28.81  ? 184  PRO B N     1 
ATOM   5398 C  CA    . PRO F 3 184 ? 43.323 76.042  69.916 1.00 28.69  ? 184  PRO B CA    1 
ATOM   5399 C  C     . PRO F 3 184 ? 43.710 77.074  68.858 1.00 29.42  ? 184  PRO B C     1 
ATOM   5400 O  O     . PRO F 3 184 ? 42.864 77.842  68.375 1.00 28.43  ? 184  PRO B O     1 
ATOM   5401 C  CB    . PRO F 3 184 ? 42.453 74.923  69.343 1.00 29.46  ? 184  PRO B CB    1 
ATOM   5402 C  CG    . PRO F 3 184 ? 41.693 74.452  70.555 1.00 28.28  ? 184  PRO B CG    1 
ATOM   5403 C  CD    . PRO F 3 184 ? 41.295 75.760  71.212 1.00 27.56  ? 184  PRO B CD    1 
ATOM   5404 N  N     . GLY F 3 185 ? 44.994 77.091  68.504 1.00 29.30  ? 185  GLY B N     1 
ATOM   5405 C  CA    . GLY F 3 185 ? 45.464 78.026  67.497 1.00 30.03  ? 185  GLY B CA    1 
ATOM   5406 C  C     . GLY F 3 185 ? 46.034 79.302  68.080 1.00 30.31  ? 185  GLY B C     1 
ATOM   5407 O  O     . GLY F 3 185 ? 46.563 80.142  67.352 1.00 29.87  ? 185  GLY B O     1 
ATOM   5408 N  N     . ILE F 3 186 ? 45.912 79.465  69.391 1.00 29.17  ? 186  ILE B N     1 
ATOM   5409 C  CA    . ILE F 3 186 ? 46.453 80.648  70.043 1.00 31.84  ? 186  ILE B CA    1 
ATOM   5410 C  C     . ILE F 3 186 ? 47.763 80.262  70.718 1.00 31.92  ? 186  ILE B C     1 
ATOM   5411 O  O     . ILE F 3 186 ? 47.763 79.636  71.773 1.00 30.82  ? 186  ILE B O     1 
ATOM   5412 C  CB    . ILE F 3 186 ? 45.479 81.210  71.108 1.00 32.14  ? 186  ILE B CB    1 
ATOM   5413 C  CG1   . ILE F 3 186 ? 44.141 81.563  70.456 1.00 30.71  ? 186  ILE B CG1   1 
ATOM   5414 C  CG2   . ILE F 3 186 ? 46.067 82.452  71.745 1.00 31.19  ? 186  ILE B CG2   1 
ATOM   5415 C  CD1   . ILE F 3 186 ? 44.276 82.512  69.275 1.00 33.33  ? 186  ILE B CD1   1 
ATOM   5416 N  N     . GLY F 3 187 ? 48.877 80.627  70.090 1.00 33.19  ? 187  GLY B N     1 
ATOM   5417 C  CA    . GLY F 3 187 ? 50.181 80.311  70.645 1.00 34.17  ? 187  GLY B CA    1 
ATOM   5418 C  C     . GLY F 3 187 ? 50.705 81.437  71.513 1.00 35.68  ? 187  GLY B C     1 
ATOM   5419 O  O     . GLY F 3 187 ? 49.979 82.383  71.817 1.00 35.35  ? 187  GLY B O     1 
ATOM   5420 N  N     . ASN F 3 188 ? 51.966 81.334  71.915 1.00 36.99  ? 188  ASN B N     1 
ATOM   5421 C  CA    . ASN F 3 188 ? 52.592 82.344  72.756 1.00 37.35  ? 188  ASN B CA    1 
ATOM   5422 C  C     . ASN F 3 188 ? 52.618 83.717  72.120 1.00 36.42  ? 188  ASN B C     1 
ATOM   5423 O  O     . ASN F 3 188 ? 52.336 84.712  72.780 1.00 35.20  ? 188  ASN B O     1 
ATOM   5424 C  CB    . ASN F 3 188 ? 54.030 81.946  73.099 1.00 41.39  ? 188  ASN B CB    1 
ATOM   5425 C  CG    . ASN F 3 188 ? 54.100 80.735  74.004 1.00 45.70  ? 188  ASN B CG    1 
ATOM   5426 O  OD1   . ASN F 3 188 ? 53.345 80.626  74.976 1.00 48.71  ? 188  ASN B OD1   1 
ATOM   5427 N  ND2   . ASN F 3 188 ? 55.018 79.818  73.701 1.00 47.13  ? 188  ASN B ND2   1 
ATOM   5428 N  N     . ILE F 3 189 ? 52.963 83.778  70.840 1.00 35.49  ? 189  ILE B N     1 
ATOM   5429 C  CA    . ILE F 3 189 ? 53.038 85.065  70.162 1.00 35.52  ? 189  ILE B CA    1 
ATOM   5430 C  C     . ILE F 3 189 ? 51.684 85.742  70.071 1.00 34.50  ? 189  ILE B C     1 
ATOM   5431 O  O     . ILE F 3 189 ? 51.564 86.935  70.342 1.00 34.07  ? 189  ILE B O     1 
ATOM   5432 C  CB    . ILE F 3 189 ? 53.646 84.925  68.752 1.00 37.38  ? 189  ILE B CB    1 
ATOM   5433 C  CG1   . ILE F 3 189 ? 55.093 84.440  68.870 1.00 38.96  ? 189  ILE B CG1   1 
ATOM   5434 C  CG2   . ILE F 3 189 ? 53.607 86.265  68.028 1.00 38.29  ? 189  ILE B CG2   1 
ATOM   5435 C  CD1   . ILE F 3 189 ? 55.830 84.334  67.545 1.00 42.71  ? 189  ILE B CD1   1 
ATOM   5436 N  N     . THR F 3 190 ? 50.659 84.985  69.701 1.00 32.40  ? 190  THR B N     1 
ATOM   5437 C  CA    . THR F 3 190 ? 49.325 85.557  69.599 1.00 32.41  ? 190  THR B CA    1 
ATOM   5438 C  C     . THR F 3 190 ? 48.793 85.910  70.992 1.00 32.78  ? 190  THR B C     1 
ATOM   5439 O  O     . THR F 3 190 ? 48.228 86.983  71.198 1.00 31.70  ? 190  THR B O     1 
ATOM   5440 C  CB    . THR F 3 190 ? 48.356 84.571  68.920 1.00 32.87  ? 190  THR B CB    1 
ATOM   5441 O  OG1   . THR F 3 190 ? 48.893 84.174  67.648 1.00 32.73  ? 190  THR B OG1   1 
ATOM   5442 C  CG2   . THR F 3 190 ? 47.004 85.223  68.708 1.00 30.62  ? 190  THR B CG2   1 
ATOM   5443 N  N     . ALA F 3 191 ? 48.983 85.007  71.948 1.00 32.75  ? 191  ALA B N     1 
ATOM   5444 C  CA    . ALA F 3 191 ? 48.514 85.232  73.313 1.00 34.02  ? 191  ALA B CA    1 
ATOM   5445 C  C     . ALA F 3 191 ? 49.027 86.563  73.836 1.00 34.53  ? 191  ALA B C     1 
ATOM   5446 O  O     . ALA F 3 191 ? 48.291 87.327  74.456 1.00 33.47  ? 191  ALA B O     1 
ATOM   5447 C  CB    . ALA F 3 191 ? 48.989 84.101  74.219 1.00 33.84  ? 191  ALA B CB    1 
ATOM   5448 N  N     . GLU F 3 192 ? 50.299 86.832  73.569 1.00 36.45  ? 192  GLU B N     1 
ATOM   5449 C  CA    . GLU F 3 192 ? 50.943 88.053  74.013 1.00 38.16  ? 192  GLU B CA    1 
ATOM   5450 C  C     . GLU F 3 192 ? 50.338 89.278  73.354 1.00 38.80  ? 192  GLU B C     1 
ATOM   5451 O  O     . GLU F 3 192 ? 50.137 90.304  74.006 1.00 39.15  ? 192  GLU B O     1 
ATOM   5452 C  CB    . GLU F 3 192 ? 52.439 87.989  73.709 1.00 42.24  ? 192  GLU B CB    1 
ATOM   5453 C  CG    . GLU F 3 192 ? 53.281 88.890  74.590 1.00 50.13  ? 192  GLU B CG    1 
ATOM   5454 C  CD    . GLU F 3 192 ? 53.018 88.655  76.080 1.00 53.89  ? 192  GLU B CD    1 
ATOM   5455 O  OE1   . GLU F 3 192 ? 53.101 87.488  76.536 1.00 55.72  ? 192  GLU B OE1   1 
ATOM   5456 O  OE2   . GLU F 3 192 ? 52.726 89.639  76.795 1.00 55.34  ? 192  GLU B OE2   1 
ATOM   5457 N  N     . LYS F 3 193 ? 50.059 89.182  72.059 1.00 38.55  ? 193  LYS B N     1 
ATOM   5458 C  CA    . LYS F 3 193 ? 49.472 90.309  71.344 1.00 40.44  ? 193  LYS B CA    1 
ATOM   5459 C  C     . LYS F 3 193 ? 48.105 90.656  71.919 1.00 40.95  ? 193  LYS B C     1 
ATOM   5460 O  O     . LYS F 3 193 ? 47.779 91.832  72.083 1.00 42.16  ? 193  LYS B O     1 
ATOM   5461 C  CB    . LYS F 3 193 ? 49.350 89.997  69.853 1.00 41.73  ? 193  LYS B CB    1 
ATOM   5462 C  CG    . LYS F 3 193 ? 50.674 90.021  69.121 1.00 42.42  ? 193  LYS B CG    1 
ATOM   5463 C  CD    . LYS F 3 193 ? 50.506 89.597  67.681 1.00 45.05  ? 193  LYS B CD    1 
ATOM   5464 C  CE    . LYS F 3 193 ? 51.802 89.731  66.916 1.00 45.86  ? 193  LYS B CE    1 
ATOM   5465 N  NZ    . LYS F 3 193 ? 51.633 89.238  65.531 1.00 48.50  ? 193  LYS B NZ    1 
ATOM   5466 N  N     . LEU F 3 194 ? 47.312 89.634  72.234 1.00 40.69  ? 194  LEU B N     1 
ATOM   5467 C  CA    . LEU F 3 194 ? 45.986 89.837  72.810 1.00 40.55  ? 194  LEU B CA    1 
ATOM   5468 C  C     . LEU F 3 194 ? 46.120 90.424  74.214 1.00 42.29  ? 194  LEU B C     1 
ATOM   5469 O  O     . LEU F 3 194 ? 45.298 91.233  74.649 1.00 41.04  ? 194  LEU B O     1 
ATOM   5470 C  CB    . LEU F 3 194 ? 45.234 88.510  72.889 1.00 39.55  ? 194  LEU B CB    1 
ATOM   5471 C  CG    . LEU F 3 194 ? 44.876 87.843  71.563 1.00 37.77  ? 194  LEU B CG    1 
ATOM   5472 C  CD1   . LEU F 3 194 ? 44.390 86.429  71.837 1.00 36.27  ? 194  LEU B CD1   1 
ATOM   5473 C  CD2   . LEU F 3 194 ? 43.812 88.664  70.840 1.00 35.28  ? 194  LEU B CD2   1 
ATOM   5474 N  N     . LYS F 3 195 ? 47.160 89.994  74.918 1.00 43.92  ? 195  LYS B N     1 
ATOM   5475 C  CA    . LYS F 3 195 ? 47.434 90.465  76.267 1.00 45.52  ? 195  LYS B CA    1 
ATOM   5476 C  C     . LYS F 3 195 ? 47.660 91.976  76.210 1.00 45.05  ? 195  LYS B C     1 
ATOM   5477 O  O     . LYS F 3 195 ? 47.138 92.731  77.032 1.00 45.10  ? 195  LYS B O     1 
ATOM   5478 C  CB    . LYS F 3 195 ? 48.678 89.759  76.802 1.00 47.18  ? 195  LYS B CB    1 
ATOM   5479 C  CG    . LYS F 3 195 ? 48.871 89.856  78.298 1.00 52.38  ? 195  LYS B CG    1 
ATOM   5480 C  CD    . LYS F 3 195 ? 50.065 89.022  78.732 1.00 53.53  ? 195  LYS B CD    1 
ATOM   5481 C  CE    . LYS F 3 195 ? 50.256 89.069  80.232 1.00 57.37  ? 195  LYS B CE    1 
ATOM   5482 N  NZ    . LYS F 3 195 ? 51.445 88.281  80.674 1.00 59.30  ? 195  LYS B NZ    1 
ATOM   5483 N  N     . LYS F 3 196 ? 48.433 92.410  75.223 1.00 45.38  ? 196  LYS B N     1 
ATOM   5484 C  CA    . LYS F 3 196 ? 48.711 93.828  75.046 1.00 46.17  ? 196  LYS B CA    1 
ATOM   5485 C  C     . LYS F 3 196 ? 47.422 94.608  74.807 1.00 45.58  ? 196  LYS B C     1 
ATOM   5486 O  O     . LYS F 3 196 ? 47.349 95.799  75.095 1.00 46.79  ? 196  LYS B O     1 
ATOM   5487 C  CB    . LYS F 3 196 ? 49.663 94.052  73.865 1.00 48.30  ? 196  LYS B CB    1 
ATOM   5488 C  CG    . LYS F 3 196 ? 51.127 93.718  74.150 1.00 52.72  ? 196  LYS B CG    1 
ATOM   5489 C  CD    . LYS F 3 196 ? 52.028 94.173  73.000 1.00 56.34  ? 196  LYS B CD    1 
ATOM   5490 C  CE    . LYS F 3 196 ? 53.509 94.179  73.386 1.00 57.83  ? 196  LYS B CE    1 
ATOM   5491 N  NZ    . LYS F 3 196 ? 54.029 92.832  73.745 1.00 60.04  ? 196  LYS B NZ    1 
ATOM   5492 N  N     . LEU F 3 197 ? 46.403 93.936  74.284 1.00 43.46  ? 197  LEU B N     1 
ATOM   5493 C  CA    . LEU F 3 197 ? 45.131 94.591  74.002 1.00 41.39  ? 197  LEU B CA    1 
ATOM   5494 C  C     . LEU F 3 197 ? 44.113 94.464  75.137 1.00 38.67  ? 197  LEU B C     1 
ATOM   5495 O  O     . LEU F 3 197 ? 42.998 94.969  75.025 1.00 37.27  ? 197  LEU B O     1 
ATOM   5496 C  CB    . LEU F 3 197 ? 44.528 94.031  72.706 1.00 42.32  ? 197  LEU B CB    1 
ATOM   5497 C  CG    . LEU F 3 197 ? 45.251 94.358  71.396 1.00 45.42  ? 197  LEU B CG    1 
ATOM   5498 C  CD1   . LEU F 3 197 ? 44.601 93.603  70.249 1.00 45.06  ? 197  LEU B CD1   1 
ATOM   5499 C  CD2   . LEU F 3 197 ? 45.198 95.861  71.131 1.00 45.53  ? 197  LEU B CD2   1 
ATOM   5500 N  N     . GLY F 3 198 ? 44.493 93.795  76.222 1.00 36.86  ? 198  GLY B N     1 
ATOM   5501 C  CA    . GLY F 3 198 ? 43.578 93.628  77.341 1.00 35.53  ? 198  GLY B CA    1 
ATOM   5502 C  C     . GLY F 3 198 ? 42.547 92.539  77.093 1.00 36.34  ? 198  GLY B C     1 
ATOM   5503 O  O     . GLY F 3 198 ? 41.517 92.465  77.772 1.00 33.05  ? 198  GLY B O     1 
ATOM   5504 N  N     . ILE F 3 199 ? 42.822 91.689  76.105 1.00 35.80  ? 199  ILE B N     1 
ATOM   5505 C  CA    . ILE F 3 199 ? 41.919 90.597  75.768 1.00 35.64  ? 199  ILE B CA    1 
ATOM   5506 C  C     . ILE F 3 199 ? 42.424 89.328  76.443 1.00 35.70  ? 199  ILE B C     1 
ATOM   5507 O  O     . ILE F 3 199 ? 43.476 88.808  76.084 1.00 35.23  ? 199  ILE B O     1 
ATOM   5508 C  CB    . ILE F 3 199 ? 41.853 90.412  74.240 1.00 36.58  ? 199  ILE B CB    1 
ATOM   5509 C  CG1   . ILE F 3 199 ? 41.240 91.666  73.611 1.00 36.74  ? 199  ILE B CG1   1 
ATOM   5510 C  CG2   . ILE F 3 199 ? 41.045 89.182  73.887 1.00 36.02  ? 199  ILE B CG2   1 
ATOM   5511 C  CD1   . ILE F 3 199 ? 41.240 91.666  72.094 1.00 40.73  ? 199  ILE B CD1   1 
ATOM   5512 N  N     . ASN F 3 200 ? 41.679 88.857  77.441 1.00 36.88  ? 200  ASN B N     1 
ATOM   5513 C  CA    . ASN F 3 200 ? 42.041 87.655  78.194 1.00 37.85  ? 200  ASN B CA    1 
ATOM   5514 C  C     . ASN F 3 200 ? 41.042 86.528  77.994 1.00 36.19  ? 200  ASN B C     1 
ATOM   5515 O  O     . ASN F 3 200 ? 41.328 85.384  78.327 1.00 36.58  ? 200  ASN B O     1 
ATOM   5516 C  CB    . ASN F 3 200 ? 42.106 87.956  79.695 1.00 40.52  ? 200  ASN B CB    1 
ATOM   5517 C  CG    . ASN F 3 200 ? 43.245 88.881  80.059 1.00 44.03  ? 200  ASN B CG    1 
ATOM   5518 O  OD1   . ASN F 3 200 ? 44.420 88.525  79.923 1.00 47.30  ? 200  ASN B OD1   1 
ATOM   5519 N  ND2   . ASN F 3 200 ? 42.905 90.077  80.530 1.00 45.01  ? 200  ASN B ND2   1 
ATOM   5520 N  N     . LYS F 3 201 ? 39.867 86.862  77.472 1.00 35.59  ? 201  LYS B N     1 
ATOM   5521 C  CA    . LYS F 3 201 ? 38.812 85.879  77.253 1.00 35.56  ? 201  LYS B CA    1 
ATOM   5522 C  C     . LYS F 3 201 ? 38.175 86.087  75.883 1.00 34.95  ? 201  LYS B C     1 
ATOM   5523 O  O     . LYS F 3 201 ? 38.246 87.178  75.307 1.00 33.36  ? 201  LYS B O     1 
ATOM   5524 C  CB    . LYS F 3 201 ? 37.727 86.019  78.324 1.00 37.85  ? 201  LYS B CB    1 
ATOM   5525 C  CG    . LYS F 3 201 ? 38.225 86.127  79.757 1.00 39.86  ? 201  LYS B CG    1 
ATOM   5526 C  CD    . LYS F 3 201 ? 38.818 84.823  80.274 1.00 41.97  ? 201  LYS B CD    1 
ATOM   5527 C  CE    . LYS F 3 201 ? 39.169 84.949  81.751 1.00 42.32  ? 201  LYS B CE    1 
ATOM   5528 N  NZ    . LYS F 3 201 ? 39.785 83.708  82.297 1.00 41.76  ? 201  LYS B NZ    1 
ATOM   5529 N  N     . LEU F 3 202 ? 37.544 85.040  75.366 1.00 33.41  ? 202  LEU B N     1 
ATOM   5530 C  CA    . LEU F 3 202 ? 36.898 85.121  74.063 1.00 32.80  ? 202  LEU B CA    1 
ATOM   5531 C  C     . LEU F 3 202 ? 35.891 86.266  73.996 1.00 33.58  ? 202  LEU B C     1 
ATOM   5532 O  O     . LEU F 3 202 ? 35.840 87.007  73.007 1.00 32.66  ? 202  LEU B O     1 
ATOM   5533 C  CB    . LEU F 3 202 ? 36.192 83.803  73.740 1.00 30.20  ? 202  LEU B CB    1 
ATOM   5534 C  CG    . LEU F 3 202 ? 37.090 82.647  73.299 1.00 28.21  ? 202  LEU B CG    1 
ATOM   5535 C  CD1   . LEU F 3 202 ? 36.274 81.376  73.225 1.00 25.03  ? 202  LEU B CD1   1 
ATOM   5536 C  CD2   . LEU F 3 202 ? 37.718 82.970  71.954 1.00 26.11  ? 202  LEU B CD2   1 
ATOM   5537 N  N     . VAL F 3 203 ? 35.091 86.413  75.048 1.00 33.39  ? 203  VAL B N     1 
ATOM   5538 C  CA    . VAL F 3 203 ? 34.084 87.466  75.068 1.00 34.73  ? 203  VAL B CA    1 
ATOM   5539 C  C     . VAL F 3 203 ? 34.720 88.838  74.868 1.00 34.53  ? 203  VAL B C     1 
ATOM   5540 O  O     . VAL F 3 203 ? 34.093 89.741  74.309 1.00 34.09  ? 203  VAL B O     1 
ATOM   5541 C  CB    . VAL F 3 203 ? 33.274 87.454  76.396 1.00 36.55  ? 203  VAL B CB    1 
ATOM   5542 C  CG1   . VAL F 3 203 ? 34.171 87.823  77.571 1.00 36.94  ? 203  VAL B CG1   1 
ATOM   5543 C  CG2   . VAL F 3 203 ? 32.096 88.413  76.290 1.00 37.52  ? 203  VAL B CG2   1 
ATOM   5544 N  N     . ASP F 3 204 ? 35.971 88.990  75.300 1.00 33.73  ? 204  ASP B N     1 
ATOM   5545 C  CA    . ASP F 3 204 ? 36.661 90.267  75.152 1.00 35.09  ? 204  ASP B CA    1 
ATOM   5546 C  C     . ASP F 3 204 ? 36.836 90.700  73.695 1.00 36.12  ? 204  ASP B C     1 
ATOM   5547 O  O     . ASP F 3 204 ? 36.966 91.896  73.419 1.00 35.83  ? 204  ASP B O     1 
ATOM   5548 C  CB    . ASP F 3 204 ? 38.045 90.229  75.818 1.00 36.41  ? 204  ASP B CB    1 
ATOM   5549 C  CG    . ASP F 3 204 ? 37.975 90.024  77.324 1.00 37.98  ? 204  ASP B CG    1 
ATOM   5550 O  OD1   . ASP F 3 204 ? 36.939 90.368  77.930 1.00 39.20  ? 204  ASP B OD1   1 
ATOM   5551 O  OD2   . ASP F 3 204 ? 38.967 89.535  77.905 1.00 38.32  ? 204  ASP B OD2   1 
ATOM   5552 N  N     . THR F 3 205 ? 36.845 89.744  72.764 1.00 34.07  ? 205  THR B N     1 
ATOM   5553 C  CA    . THR F 3 205 ? 37.033 90.082  71.353 1.00 35.53  ? 205  THR B CA    1 
ATOM   5554 C  C     . THR F 3 205 ? 35.814 90.738  70.715 1.00 37.52  ? 205  THR B C     1 
ATOM   5555 O  O     . THR F 3 205 ? 35.899 91.278  69.612 1.00 39.05  ? 205  THR B O     1 
ATOM   5556 C  CB    . THR F 3 205 ? 37.417 88.836  70.518 1.00 34.88  ? 205  THR B CB    1 
ATOM   5557 O  OG1   . THR F 3 205 ? 36.356 87.871  70.564 1.00 30.58  ? 205  THR B OG1   1 
ATOM   5558 C  CG2   . THR F 3 205 ? 38.689 88.207  71.075 1.00 33.79  ? 205  THR B CG2   1 
ATOM   5559 N  N     . LEU F 3 206 ? 34.682 90.697  71.409 1.00 40.11  ? 206  LEU B N     1 
ATOM   5560 C  CA    . LEU F 3 206 ? 33.452 91.286  70.890 1.00 43.80  ? 206  LEU B CA    1 
ATOM   5561 C  C     . LEU F 3 206 ? 33.322 92.772  71.206 1.00 45.82  ? 206  LEU B C     1 
ATOM   5562 O  O     . LEU F 3 206 ? 32.600 93.497  70.523 1.00 47.53  ? 206  LEU B O     1 
ATOM   5563 C  CB    . LEU F 3 206 ? 32.239 90.551  71.457 1.00 43.16  ? 206  LEU B CB    1 
ATOM   5564 C  CG    . LEU F 3 206 ? 32.202 89.047  71.192 1.00 44.32  ? 206  LEU B CG    1 
ATOM   5565 C  CD1   . LEU F 3 206 ? 30.977 88.439  71.867 1.00 43.06  ? 206  LEU B CD1   1 
ATOM   5566 C  CD2   . LEU F 3 206 ? 32.184 88.800  69.688 1.00 42.38  ? 206  LEU B CD2   1 
ATOM   5567 N  N     . SER F 3 207 ? 34.015 93.229  72.239 1.00 46.85  ? 207  SER B N     1 
ATOM   5568 C  CA    . SER F 3 207 ? 33.934 94.632  72.618 1.00 48.48  ? 207  SER B CA    1 
ATOM   5569 C  C     . SER F 3 207 ? 35.040 95.471  71.997 1.00 48.17  ? 207  SER B C     1 
ATOM   5570 O  O     . SER F 3 207 ? 35.115 96.673  72.226 1.00 49.97  ? 207  SER B O     1 
ATOM   5571 C  CB    . SER F 3 207 ? 33.966 94.768  74.145 1.00 48.82  ? 207  SER B CB    1 
ATOM   5572 O  OG    . SER F 3 207 ? 35.143 94.193  74.683 1.00 52.83  ? 207  SER B OG    1 
ATOM   5573 N  N     . ILE F 3 208 ? 35.894 94.848  71.198 1.00 47.52  ? 208  ILE B N     1 
ATOM   5574 C  CA    . ILE F 3 208 ? 36.977 95.589  70.576 1.00 46.48  ? 208  ILE B CA    1 
ATOM   5575 C  C     . ILE F 3 208 ? 36.697 95.898  69.103 1.00 48.34  ? 208  ILE B C     1 
ATOM   5576 O  O     . ILE F 3 208 ? 36.025 95.137  68.412 1.00 47.68  ? 208  ILE B O     1 
ATOM   5577 C  CB    . ILE F 3 208 ? 38.311 94.817  70.698 1.00 44.13  ? 208  ILE B CB    1 
ATOM   5578 C  CG1   . ILE F 3 208 ? 39.471 95.724  70.284 1.00 42.44  ? 208  ILE B CG1   1 
ATOM   5579 C  CG2   . ILE F 3 208 ? 38.270 93.553  69.843 1.00 42.19  ? 208  ILE B CG2   1 
ATOM   5580 C  CD1   . ILE F 3 208 ? 40.827 95.070  70.401 1.00 41.14  ? 208  ILE B CD1   1 
ATOM   5581 N  N     . GLU F 3 209 ? 37.206 97.037  68.648 1.00 50.08  ? 209  GLU B N     1 
ATOM   5582 C  CA    . GLU F 3 209 ? 37.065 97.495  67.268 1.00 52.85  ? 209  GLU B CA    1 
ATOM   5583 C  C     . GLU F 3 209 ? 37.667 96.408  66.373 1.00 52.54  ? 209  GLU B C     1 
ATOM   5584 O  O     . GLU F 3 209 ? 38.823 96.050  66.549 1.00 51.74  ? 209  GLU B O     1 
ATOM   5585 C  CB    . GLU F 3 209 ? 37.860 98.788  67.122 1.00 57.77  ? 209  GLU B CB    1 
ATOM   5586 C  CG    . GLU F 3 209 ? 37.472 99.681  65.978 1.00 64.44  ? 209  GLU B CG    1 
ATOM   5587 C  CD    . GLU F 3 209 ? 38.247 100.985 66.018 1.00 69.83  ? 209  GLU B CD    1 
ATOM   5588 O  OE1   . GLU F 3 209 ? 39.496 100.932 65.921 1.00 72.27  ? 209  GLU B OE1   1 
ATOM   5589 O  OE2   . GLU F 3 209 ? 37.614 102.058 66.157 1.00 71.66  ? 209  GLU B OE2   1 
ATOM   5590 N  N     . PHE F 3 210 ? 36.906 95.891  65.413 1.00 52.00  ? 210  PHE B N     1 
ATOM   5591 C  CA    . PHE F 3 210 ? 37.422 94.826  64.551 1.00 51.89  ? 210  PHE B CA    1 
ATOM   5592 C  C     . PHE F 3 210 ? 38.780 95.089  63.907 1.00 52.41  ? 210  PHE B C     1 
ATOM   5593 O  O     . PHE F 3 210 ? 39.724 94.316  64.085 1.00 51.42  ? 210  PHE B O     1 
ATOM   5594 C  CB    . PHE F 3 210 ? 36.439 94.491  63.434 1.00 52.00  ? 210  PHE B CB    1 
ATOM   5595 C  CG    . PHE F 3 210 ? 36.902 93.362  62.558 1.00 54.08  ? 210  PHE B CG    1 
ATOM   5596 C  CD1   . PHE F 3 210 ? 36.778 92.040  62.981 1.00 55.01  ? 210  PHE B CD1   1 
ATOM   5597 C  CD2   . PHE F 3 210 ? 37.513 93.618  61.335 1.00 54.81  ? 210  PHE B CD2   1 
ATOM   5598 C  CE1   . PHE F 3 210 ? 37.258 90.986  62.198 1.00 55.62  ? 210  PHE B CE1   1 
ATOM   5599 C  CE2   . PHE F 3 210 ? 37.998 92.573  60.543 1.00 55.99  ? 210  PHE B CE2   1 
ATOM   5600 C  CZ    . PHE F 3 210 ? 37.869 91.253  60.977 1.00 55.76  ? 210  PHE B CZ    1 
ATOM   5601 N  N     . ASP F 3 211 ? 38.869 96.167  63.138 1.00 53.08  ? 211  ASP B N     1 
ATOM   5602 C  CA    . ASP F 3 211 ? 40.105 96.511  62.449 1.00 52.36  ? 211  ASP B CA    1 
ATOM   5603 C  C     . ASP F 3 211 ? 41.310 96.675  63.362 1.00 50.17  ? 211  ASP B C     1 
ATOM   5604 O  O     . ASP F 3 211 ? 42.449 96.580  62.911 1.00 50.56  ? 211  ASP B O     1 
ATOM   5605 C  CB    . ASP F 3 211 ? 39.885 97.763  61.605 1.00 55.30  ? 211  ASP B CB    1 
ATOM   5606 C  CG    . ASP F 3 211 ? 39.039 97.481  60.376 1.00 58.65  ? 211  ASP B CG    1 
ATOM   5607 O  OD1   . ASP F 3 211 ? 37.957 96.872  60.518 1.00 59.49  ? 211  ASP B OD1   1 
ATOM   5608 O  OD2   . ASP F 3 211 ? 39.458 97.863  59.264 1.00 61.87  ? 211  ASP B OD2   1 
ATOM   5609 N  N     . LYS F 3 212 ? 41.068 96.915  64.644 1.00 47.74  ? 212  LYS B N     1 
ATOM   5610 C  CA    . LYS F 3 212 ? 42.170 97.047  65.584 1.00 45.25  ? 212  LYS B CA    1 
ATOM   5611 C  C     . LYS F 3 212 ? 42.651 95.641  65.969 1.00 42.66  ? 212  LYS B C     1 
ATOM   5612 O  O     . LYS F 3 212 ? 43.852 95.386  66.069 1.00 40.03  ? 212  LYS B O     1 
ATOM   5613 C  CB    . LYS F 3 212 ? 41.722 97.821  66.824 1.00 47.20  ? 212  LYS B CB    1 
ATOM   5614 C  CG    . LYS F 3 212 ? 42.835 98.068  67.831 1.00 49.12  ? 212  LYS B CG    1 
ATOM   5615 C  CD    . LYS F 3 212 ? 42.357 98.946  68.979 1.00 52.14  ? 212  LYS B CD    1 
ATOM   5616 C  CE    . LYS F 3 212 ? 43.461 99.165  70.006 1.00 52.87  ? 212  LYS B CE    1 
ATOM   5617 N  NZ    . LYS F 3 212 ? 42.953 99.883  71.213 1.00 55.89  ? 212  LYS B NZ    1 
ATOM   5618 N  N     . LEU F 3 213 ? 41.704 94.732  66.183 1.00 39.90  ? 213  LEU B N     1 
ATOM   5619 C  CA    . LEU F 3 213 ? 42.028 93.353  66.531 1.00 37.44  ? 213  LEU B CA    1 
ATOM   5620 C  C     . LEU F 3 213 ? 42.716 92.786  65.296 1.00 37.54  ? 213  LEU B C     1 
ATOM   5621 O  O     . LEU F 3 213 ? 43.798 92.209  65.375 1.00 35.70  ? 213  LEU B O     1 
ATOM   5622 C  CB    . LEU F 3 213 ? 40.748 92.566  66.844 1.00 33.97  ? 213  LEU B CB    1 
ATOM   5623 C  CG    . LEU F 3 213 ? 40.863 91.058  67.104 1.00 31.89  ? 213  LEU B CG    1 
ATOM   5624 C  CD1   . LEU F 3 213 ? 41.833 90.787  68.248 1.00 31.55  ? 213  LEU B CD1   1 
ATOM   5625 C  CD2   . LEU F 3 213 ? 39.486 90.501  67.432 1.00 30.37  ? 213  LEU B CD2   1 
ATOM   5626 N  N     . LYS F 3 214 ? 42.082 92.981  64.148 1.00 38.83  ? 214  LYS B N     1 
ATOM   5627 C  CA    . LYS F 3 214 ? 42.625 92.514  62.883 1.00 41.47  ? 214  LYS B CA    1 
ATOM   5628 C  C     . LYS F 3 214 ? 44.039 93.052  62.686 1.00 41.64  ? 214  LYS B C     1 
ATOM   5629 O  O     . LYS F 3 214 ? 44.960 92.311  62.342 1.00 40.69  ? 214  LYS B O     1 
ATOM   5630 C  CB    . LYS F 3 214 ? 41.729 92.983  61.740 1.00 45.13  ? 214  LYS B CB    1 
ATOM   5631 C  CG    . LYS F 3 214 ? 42.218 92.621  60.351 1.00 48.91  ? 214  LYS B CG    1 
ATOM   5632 C  CD    . LYS F 3 214 ? 41.215 93.107  59.314 1.00 53.40  ? 214  LYS B CD    1 
ATOM   5633 C  CE    . LYS F 3 214 ? 41.606 92.713  57.894 1.00 55.11  ? 214  LYS B CE    1 
ATOM   5634 N  NZ    . LYS F 3 214 ? 40.558 93.130  56.915 1.00 54.95  ? 214  LYS B NZ    1 
ATOM   5635 N  N     . GLY F 3 215 ? 44.211 94.348  62.910 1.00 40.92  ? 215  GLY B N     1 
ATOM   5636 C  CA    . GLY F 3 215 ? 45.524 94.936  62.737 1.00 41.52  ? 215  GLY B CA    1 
ATOM   5637 C  C     . GLY F 3 215 ? 46.564 94.336  63.665 1.00 41.96  ? 215  GLY B C     1 
ATOM   5638 O  O     . GLY F 3 215 ? 47.756 94.310  63.349 1.00 42.21  ? 215  GLY B O     1 
ATOM   5639 N  N     . MET F 3 216 ? 46.112 93.836  64.807 1.00 40.61  ? 216  MET B N     1 
ATOM   5640 C  CA    . MET F 3 216 ? 47.016 93.259  65.789 1.00 41.52  ? 216  MET B CA    1 
ATOM   5641 C  C     . MET F 3 216 ? 47.346 91.773  65.607 1.00 39.29  ? 216  MET B C     1 
ATOM   5642 O  O     . MET F 3 216 ? 48.490 91.369  65.809 1.00 40.24  ? 216  MET B O     1 
ATOM   5643 C  CB    . MET F 3 216 ? 46.451 93.494  67.193 1.00 43.89  ? 216  MET B CB    1 
ATOM   5644 C  CG    . MET F 3 216 ? 47.321 92.975  68.331 1.00 49.79  ? 216  MET B CG    1 
ATOM   5645 S  SD    . MET F 3 216 ? 49.030 93.578  68.289 1.00 55.98  ? 216  MET B SD    1 
ATOM   5646 C  CE    . MET F 3 216 ? 48.807 95.277  67.713 1.00 53.00  ? 216  MET B CE    1 
ATOM   5647 N  N     . ILE F 3 217 ? 46.364 90.961  65.222 1.00 36.66  ? 217  ILE B N     1 
ATOM   5648 C  CA    . ILE F 3 217 ? 46.615 89.528  65.077 1.00 33.70  ? 217  ILE B CA    1 
ATOM   5649 C  C     . ILE F 3 217 ? 46.308 88.930  63.708 1.00 33.10  ? 217  ILE B C     1 
ATOM   5650 O  O     . ILE F 3 217 ? 46.438 87.722  63.517 1.00 32.69  ? 217  ILE B O     1 
ATOM   5651 C  CB    . ILE F 3 217 ? 45.827 88.713  66.131 1.00 31.55  ? 217  ILE B CB    1 
ATOM   5652 C  CG1   . ILE F 3 217 ? 44.324 88.813  65.859 1.00 30.81  ? 217  ILE B CG1   1 
ATOM   5653 C  CG2   . ILE F 3 217 ? 46.139 89.223  67.535 1.00 29.01  ? 217  ILE B CG2   1 
ATOM   5654 C  CD1   . ILE F 3 217 ? 43.493 87.854  66.692 1.00 27.81  ? 217  ILE B CD1   1 
ATOM   5655 N  N     . GLY F 3 218 ? 45.912 89.763  62.755 1.00 32.40  ? 218  GLY B N     1 
ATOM   5656 C  CA    . GLY F 3 218 ? 45.597 89.245  61.437 1.00 32.33  ? 218  GLY B CA    1 
ATOM   5657 C  C     . GLY F 3 218 ? 44.108 88.999  61.267 1.00 33.35  ? 218  GLY B C     1 
ATOM   5658 O  O     . GLY F 3 218 ? 43.398 88.669  62.225 1.00 31.68  ? 218  GLY B O     1 
ATOM   5659 N  N     . GLU F 3 219 ? 43.636 89.155  60.037 1.00 33.41  ? 219  GLU B N     1 
ATOM   5660 C  CA    . GLU F 3 219 ? 42.226 88.984  59.716 1.00 34.44  ? 219  GLU B CA    1 
ATOM   5661 C  C     . GLU F 3 219 ? 41.673 87.597  60.039 1.00 32.92  ? 219  GLU B C     1 
ATOM   5662 O  O     . GLU F 3 219 ? 40.593 87.469  60.633 1.00 33.48  ? 219  GLU B O     1 
ATOM   5663 C  CB    . GLU F 3 219 ? 42.003 89.304  58.234 1.00 36.50  ? 219  GLU B CB    1 
ATOM   5664 C  CG    . GLU F 3 219 ? 40.587 89.075  57.744 1.00 43.16  ? 219  GLU B CG    1 
ATOM   5665 C  CD    . GLU F 3 219 ? 40.327 89.761  56.418 1.00 47.66  ? 219  GLU B CD    1 
ATOM   5666 O  OE1   . GLU F 3 219 ? 41.082 89.503  55.454 1.00 50.14  ? 219  GLU B OE1   1 
ATOM   5667 O  OE2   . GLU F 3 219 ? 39.371 90.562  56.343 1.00 50.93  ? 219  GLU B OE2   1 
ATOM   5668 N  N     . ALA F 3 220 ? 42.414 86.562  59.655 1.00 30.48  ? 220  ALA B N     1 
ATOM   5669 C  CA    . ALA F 3 220 ? 41.983 85.189  59.889 1.00 28.23  ? 220  ALA B CA    1 
ATOM   5670 C  C     . ALA F 3 220 ? 41.834 84.828  61.363 1.00 28.06  ? 220  ALA B C     1 
ATOM   5671 O  O     . ALA F 3 220 ? 40.853 84.189  61.754 1.00 27.59  ? 220  ALA B O     1 
ATOM   5672 C  CB    . ALA F 3 220 ? 42.938 84.229  59.216 1.00 29.68  ? 220  ALA B CB    1 
ATOM   5673 N  N     . LYS F 3 221 ? 42.796 85.225  62.187 1.00 28.54  ? 221  LYS B N     1 
ATOM   5674 C  CA    . LYS F 3 221 ? 42.717 84.897  63.611 1.00 30.60  ? 221  LYS B CA    1 
ATOM   5675 C  C     . LYS F 3 221 ? 41.618 85.698  64.312 1.00 28.51  ? 221  LYS B C     1 
ATOM   5676 O  O     . LYS F 3 221 ? 40.917 85.170  65.165 1.00 28.40  ? 221  LYS B O     1 
ATOM   5677 C  CB    . LYS F 3 221 ? 44.066 85.139  64.299 1.00 34.28  ? 221  LYS B CB    1 
ATOM   5678 C  CG    . LYS F 3 221 ? 44.614 83.908  65.026 1.00 38.88  ? 221  LYS B CG    1 
ATOM   5679 C  CD    . LYS F 3 221 ? 46.065 83.650  64.634 1.00 40.77  ? 221  LYS B CD    1 
ATOM   5680 C  CE    . LYS F 3 221 ? 46.455 82.197  64.849 1.00 42.41  ? 221  LYS B CE    1 
ATOM   5681 N  NZ    . LYS F 3 221 ? 47.727 81.863  64.127 1.00 48.80  ? 221  LYS B NZ    1 
ATOM   5682 N  N     . ALA F 3 222 ? 41.468 86.966  63.948 1.00 27.90  ? 222  ALA B N     1 
ATOM   5683 C  CA    . ALA F 3 222 ? 40.429 87.795  64.552 1.00 30.61  ? 222  ALA B CA    1 
ATOM   5684 C  C     . ALA F 3 222 ? 39.062 87.215  64.209 1.00 30.41  ? 222  ALA B C     1 
ATOM   5685 O  O     . ALA F 3 222 ? 38.221 87.017  65.095 1.00 31.81  ? 222  ALA B O     1 
ATOM   5686 C  CB    . ALA F 3 222 ? 40.528 89.240  64.051 1.00 28.06  ? 222  ALA B CB    1 
ATOM   5687 N  N     . LYS F 3 223 ? 38.835 86.942  62.924 1.00 30.52  ? 223  LYS B N     1 
ATOM   5688 C  CA    . LYS F 3 223 ? 37.558 86.378  62.504 1.00 29.98  ? 223  LYS B CA    1 
ATOM   5689 C  C     . LYS F 3 223 ? 37.290 85.062  63.228 1.00 29.07  ? 223  LYS B C     1 
ATOM   5690 O  O     . LYS F 3 223 ? 36.152 84.760  63.578 1.00 27.51  ? 223  LYS B O     1 
ATOM   5691 C  CB    . LYS F 3 223 ? 37.534 86.152  60.983 1.00 32.92  ? 223  LYS B CB    1 
ATOM   5692 C  CG    . LYS F 3 223 ? 37.431 87.437  60.166 1.00 35.48  ? 223  LYS B CG    1 
ATOM   5693 C  CD    . LYS F 3 223 ? 37.407 87.154  58.662 1.00 39.49  ? 223  LYS B CD    1 
ATOM   5694 C  CE    . LYS F 3 223 ? 37.281 88.452  57.864 1.00 44.38  ? 223  LYS B CE    1 
ATOM   5695 N  NZ    . LYS F 3 223 ? 37.373 88.242  56.389 1.00 46.21  ? 223  LYS B NZ    1 
ATOM   5696 N  N     . TYR F 3 224 ? 38.348 84.289  63.455 1.00 27.69  ? 224  TYR B N     1 
ATOM   5697 C  CA    . TYR F 3 224 ? 38.244 83.000  64.138 1.00 26.78  ? 224  TYR B CA    1 
ATOM   5698 C  C     . TYR F 3 224 ? 37.781 83.139  65.589 1.00 25.87  ? 224  TYR B C     1 
ATOM   5699 O  O     . TYR F 3 224 ? 36.827 82.483  66.009 1.00 23.77  ? 224  TYR B O     1 
ATOM   5700 C  CB    . TYR F 3 224 ? 39.606 82.298  64.102 1.00 27.02  ? 224  TYR B CB    1 
ATOM   5701 C  CG    . TYR F 3 224 ? 39.727 81.081  64.990 1.00 26.91  ? 224  TYR B CG    1 
ATOM   5702 C  CD1   . TYR F 3 224 ? 38.946 79.948  64.770 1.00 26.06  ? 224  TYR B CD1   1 
ATOM   5703 C  CD2   . TYR F 3 224 ? 40.674 81.040  66.019 1.00 26.14  ? 224  TYR B CD2   1 
ATOM   5704 C  CE1   . TYR F 3 224 ? 39.111 78.799  65.551 1.00 25.37  ? 224  TYR B CE1   1 
ATOM   5705 C  CE2   . TYR F 3 224 ? 40.844 79.905  66.796 1.00 21.38  ? 224  TYR B CE2   1 
ATOM   5706 C  CZ    . TYR F 3 224 ? 40.065 78.789  66.562 1.00 24.89  ? 224  TYR B CZ    1 
ATOM   5707 O  OH    . TYR F 3 224 ? 40.233 77.672  67.351 1.00 22.53  ? 224  TYR B OH    1 
ATOM   5708 N  N     . LEU F 3 225 ? 38.467 83.981  66.359 1.00 24.63  ? 225  LEU B N     1 
ATOM   5709 C  CA    . LEU F 3 225 ? 38.114 84.183  67.766 1.00 26.03  ? 225  LEU B CA    1 
ATOM   5710 C  C     . LEU F 3 225 ? 36.708 84.776  67.939 1.00 26.33  ? 225  LEU B C     1 
ATOM   5711 O  O     . LEU F 3 225 ? 35.944 84.368  68.811 1.00 27.05  ? 225  LEU B O     1 
ATOM   5712 C  CB    . LEU F 3 225 ? 39.153 85.085  68.430 1.00 22.78  ? 225  LEU B CB    1 
ATOM   5713 C  CG    . LEU F 3 225 ? 40.551 84.457  68.517 1.00 24.36  ? 225  LEU B CG    1 
ATOM   5714 C  CD1   . LEU F 3 225 ? 41.535 85.472  69.068 1.00 22.97  ? 225  LEU B CD1   1 
ATOM   5715 C  CD2   . LEU F 3 225 ? 40.515 83.214  69.403 1.00 22.74  ? 225  LEU B CD2   1 
ATOM   5716 N  N     . ILE F 3 226 ? 36.371 85.737  67.095 1.00 28.62  ? 226  ILE B N     1 
ATOM   5717 C  CA    . ILE F 3 226 ? 35.060 86.365  67.144 1.00 29.44  ? 226  ILE B CA    1 
ATOM   5718 C  C     . ILE F 3 226 ? 33.960 85.339  66.881 1.00 29.45  ? 226  ILE B C     1 
ATOM   5719 O  O     . ILE F 3 226 ? 32.983 85.269  67.626 1.00 31.79  ? 226  ILE B O     1 
ATOM   5720 C  CB    . ILE F 3 226 ? 34.978 87.511  66.108 1.00 29.31  ? 226  ILE B CB    1 
ATOM   5721 C  CG1   . ILE F 3 226 ? 35.874 88.663  66.568 1.00 28.73  ? 226  ILE B CG1   1 
ATOM   5722 C  CG2   . ILE F 3 226 ? 33.533 87.982  65.929 1.00 33.37  ? 226  ILE B CG2   1 
ATOM   5723 C  CD1   . ILE F 3 226 ? 35.956 89.804  65.588 1.00 29.48  ? 226  ILE B CD1   1 
ATOM   5724 N  N     . SER F 3 227 ? 34.117 84.528  65.841 1.00 29.25  ? 227  SER B N     1 
ATOM   5725 C  CA    . SER F 3 227 ? 33.090 83.539  65.542 1.00 30.21  ? 227  SER B CA    1 
ATOM   5726 C  C     . SER F 3 227 ? 32.903 82.605  66.733 1.00 29.58  ? 227  SER B C     1 
ATOM   5727 O  O     . SER F 3 227 ? 31.794 82.136  66.990 1.00 29.75  ? 227  SER B O     1 
ATOM   5728 C  CB    . SER F 3 227 ? 33.443 82.738  64.287 1.00 30.59  ? 227  SER B CB    1 
ATOM   5729 O  OG    . SER F 3 227 ? 34.545 81.887  64.513 1.00 32.40  ? 227  SER B OG    1 
ATOM   5730 N  N     . LEU F 3 228 ? 33.981 82.333  67.465 1.00 28.60  ? 228  LEU B N     1 
ATOM   5731 C  CA    . LEU F 3 228 ? 33.880 81.474  68.640 1.00 28.06  ? 228  LEU B CA    1 
ATOM   5732 C  C     . LEU F 3 228 ? 33.157 82.255  69.738 1.00 28.35  ? 228  LEU B C     1 
ATOM   5733 O  O     . LEU F 3 228 ? 32.281 81.729  70.424 1.00 27.65  ? 228  LEU B O     1 
ATOM   5734 C  CB    . LEU F 3 228 ? 35.271 81.056  69.130 1.00 27.45  ? 228  LEU B CB    1 
ATOM   5735 C  CG    . LEU F 3 228 ? 35.975 79.950  68.341 1.00 27.67  ? 228  LEU B CG    1 
ATOM   5736 C  CD1   . LEU F 3 228 ? 37.419 79.809  68.819 1.00 28.24  ? 228  LEU B CD1   1 
ATOM   5737 C  CD2   . LEU F 3 228 ? 35.217 78.636  68.521 1.00 27.40  ? 228  LEU B CD2   1 
ATOM   5738 N  N     . ALA F 3 229 ? 33.526 83.520  69.891 1.00 28.61  ? 229  ALA B N     1 
ATOM   5739 C  CA    . ALA F 3 229 ? 32.910 84.371  70.900 1.00 31.83  ? 229  ALA B CA    1 
ATOM   5740 C  C     . ALA F 3 229 ? 31.412 84.522  70.649 1.00 32.05  ? 229  ALA B C     1 
ATOM   5741 O  O     . ALA F 3 229 ? 30.622 84.519  71.588 1.00 33.21  ? 229  ALA B O     1 
ATOM   5742 C  CB    . ALA F 3 229 ? 33.577 85.738  70.908 1.00 29.03  ? 229  ALA B CB    1 
ATOM   5743 N  N     . ARG F 3 230 ? 31.030 84.658  69.383 1.00 32.22  ? 230  ARG B N     1 
ATOM   5744 C  CA    . ARG F 3 230 ? 29.625 84.807  69.015 1.00 32.98  ? 230  ARG B CA    1 
ATOM   5745 C  C     . ARG F 3 230 ? 28.931 83.458  69.050 1.00 35.44  ? 230  ARG B C     1 
ATOM   5746 O  O     . ARG F 3 230 ? 27.725 83.365  68.828 1.00 35.55  ? 230  ARG B O     1 
ATOM   5747 C  CB    . ARG F 3 230 ? 29.506 85.389  67.604 1.00 32.88  ? 230  ARG B CB    1 
ATOM   5748 C  CG    . ARG F 3 230 ? 29.942 86.841  67.491 1.00 32.63  ? 230  ARG B CG    1 
ATOM   5749 C  CD    . ARG F 3 230 ? 29.939 87.309  66.047 1.00 33.74  ? 230  ARG B CD    1 
ATOM   5750 N  NE    . ARG F 3 230 ? 30.087 88.757  65.951 1.00 32.62  ? 230  ARG B NE    1 
ATOM   5751 C  CZ    . ARG F 3 230 ? 30.366 89.416  64.831 1.00 35.91  ? 230  ARG B CZ    1 
ATOM   5752 N  NH1   . ARG F 3 230 ? 30.540 88.766  63.687 1.00 35.39  ? 230  ARG B NH1   1 
ATOM   5753 N  NH2   . ARG F 3 230 ? 30.456 90.738  64.852 1.00 39.70  ? 230  ARG B NH2   1 
ATOM   5754 N  N     . ASP F 3 231 ? 29.703 82.413  69.333 1.00 36.61  ? 231  ASP B N     1 
ATOM   5755 C  CA    . ASP F 3 231 ? 29.185 81.054  69.364 1.00 37.23  ? 231  ASP B CA    1 
ATOM   5756 C  C     . ASP F 3 231 ? 28.611 80.744  67.986 1.00 36.78  ? 231  ASP B C     1 
ATOM   5757 O  O     . ASP F 3 231 ? 27.622 80.035  67.856 1.00 35.85  ? 231  ASP B O     1 
ATOM   5758 C  CB    . ASP F 3 231 ? 28.094 80.900  70.424 1.00 40.01  ? 231  ASP B CB    1 
ATOM   5759 C  CG    . ASP F 3 231 ? 27.766 79.445  70.710 1.00 43.00  ? 231  ASP B CG    1 
ATOM   5760 O  OD1   . ASP F 3 231 ? 28.296 78.562  70.002 1.00 45.27  ? 231  ASP B OD1   1 
ATOM   5761 O  OD2   . ASP F 3 231 ? 26.981 79.178  71.644 1.00 46.76  ? 231  ASP B OD2   1 
ATOM   5762 N  N     . GLU F 3 232 ? 29.253 81.294  66.961 1.00 38.20  ? 232  GLU B N     1 
ATOM   5763 C  CA    . GLU F 3 232 ? 28.845 81.099  65.574 1.00 39.32  ? 232  GLU B CA    1 
ATOM   5764 C  C     . GLU F 3 232 ? 29.860 80.252  64.799 1.00 41.75  ? 232  GLU B C     1 
ATOM   5765 O  O     . GLU F 3 232 ? 29.828 80.213  63.570 1.00 43.03  ? 232  GLU B O     1 
ATOM   5766 C  CB    . GLU F 3 232 ? 28.661 82.460  64.881 1.00 37.42  ? 232  GLU B CB    1 
ATOM   5767 C  CG    . GLU F 3 232 ? 27.347 83.164  65.238 1.00 38.17  ? 232  GLU B CG    1 
ATOM   5768 C  CD    . GLU F 3 232 ? 27.263 84.599  64.725 1.00 40.03  ? 232  GLU B CD    1 
ATOM   5769 O  OE1   . GLU F 3 232 ? 28.038 84.957  63.810 1.00 39.13  ? 232  GLU B OE1   1 
ATOM   5770 O  OE2   . GLU F 3 232 ? 26.408 85.367  65.232 1.00 37.98  ? 232  GLU B OE2   1 
ATOM   5771 N  N     . TYR F 3 233 ? 30.762 79.584  65.515 1.00 42.46  ? 233  TYR B N     1 
ATOM   5772 C  CA    . TYR F 3 233 ? 31.768 78.738  64.875 1.00 43.35  ? 233  TYR B CA    1 
ATOM   5773 C  C     . TYR F 3 233 ? 31.184 77.359  64.604 1.00 45.95  ? 233  TYR B C     1 
ATOM   5774 O  O     . TYR F 3 233 ? 30.720 76.681  65.527 1.00 44.81  ? 233  TYR B O     1 
ATOM   5775 C  CB    . TYR F 3 233 ? 32.996 78.574  65.777 1.00 40.97  ? 233  TYR B CB    1 
ATOM   5776 C  CG    . TYR F 3 233 ? 34.041 77.614  65.236 1.00 38.28  ? 233  TYR B CG    1 
ATOM   5777 C  CD1   . TYR F 3 233 ? 35.153 78.077  64.528 1.00 38.93  ? 233  TYR B CD1   1 
ATOM   5778 C  CD2   . TYR F 3 233 ? 33.907 76.237  65.417 1.00 39.24  ? 233  TYR B CD2   1 
ATOM   5779 C  CE1   . TYR F 3 233 ? 36.106 77.186  64.011 1.00 37.59  ? 233  TYR B CE1   1 
ATOM   5780 C  CE2   . TYR F 3 233 ? 34.847 75.339  64.903 1.00 40.04  ? 233  TYR B CE2   1 
ATOM   5781 C  CZ    . TYR F 3 233 ? 35.942 75.818  64.203 1.00 39.86  ? 233  TYR B CZ    1 
ATOM   5782 O  OH    . TYR F 3 233 ? 36.850 74.921  63.681 1.00 40.05  ? 233  TYR B OH    1 
ATOM   5783 N  N     . ASN F 3 234 ? 31.224 76.945  63.341 1.00 49.47  ? 234  ASN B N     1 
ATOM   5784 C  CA    . ASN F 3 234 ? 30.711 75.638  62.947 1.00 54.21  ? 234  ASN B CA    1 
ATOM   5785 C  C     . ASN F 3 234 ? 31.480 75.050  61.778 1.00 54.40  ? 234  ASN B C     1 
ATOM   5786 O  O     . ASN F 3 234 ? 30.977 75.029  60.659 1.00 57.25  ? 234  ASN B O     1 
ATOM   5787 C  CB    . ASN F 3 234 ? 29.251 75.736  62.534 1.00 58.54  ? 234  ASN B CB    1 
ATOM   5788 C  CG    . ASN F 3 234 ? 28.316 75.976  63.706 1.00 63.09  ? 234  ASN B CG    1 
ATOM   5789 O  OD1   . ASN F 3 234 ? 28.366 75.267  64.716 1.00 66.16  ? 234  ASN B OD1   1 
ATOM   5790 N  ND2   . ASN F 3 234 ? 27.416 76.946  63.552 1.00 66.71  ? 234  ASN B ND2   1 
ATOM   5791 N  N     . GLU F 3 235 ? 32.698 74.588  62.012 1.00 52.66  ? 235  GLU B N     1 
ATOM   5792 C  CA    . GLU F 3 235 ? 33.450 73.985  60.926 1.00 51.36  ? 235  GLU B CA    1 
ATOM   5793 C  C     . GLU F 3 235 ? 32.972 72.550  60.809 1.00 48.39  ? 235  GLU B C     1 
ATOM   5794 O  O     . GLU F 3 235 ? 32.861 71.833  61.802 1.00 45.42  ? 235  GLU B O     1 
ATOM   5795 C  CB    . GLU F 3 235 ? 34.952 74.035  61.206 1.00 54.57  ? 235  GLU B CB    1 
ATOM   5796 C  CG    . GLU F 3 235 ? 35.546 75.413  61.003 1.00 58.62  ? 235  GLU B CG    1 
ATOM   5797 C  CD    . GLU F 3 235 ? 35.467 75.865  59.559 1.00 62.30  ? 235  GLU B CD    1 
ATOM   5798 O  OE1   . GLU F 3 235 ? 36.184 75.282  58.715 1.00 64.42  ? 235  GLU B OE1   1 
ATOM   5799 O  OE2   . GLU F 3 235 ? 34.684 76.796  59.265 1.00 63.01  ? 235  GLU B OE2   1 
ATOM   5800 N  N     . PRO F 3 236 ? 32.660 72.114  59.587 1.00 46.55  ? 236  PRO B N     1 
ATOM   5801 C  CA    . PRO F 3 236 ? 32.188 70.743  59.402 1.00 44.97  ? 236  PRO B CA    1 
ATOM   5802 C  C     . PRO F 3 236 ? 33.280 69.687  59.543 1.00 43.28  ? 236  PRO B C     1 
ATOM   5803 O  O     . PRO F 3 236 ? 34.459 69.966  59.350 1.00 41.46  ? 236  PRO B O     1 
ATOM   5804 C  CB    . PRO F 3 236 ? 31.604 70.780  57.997 1.00 46.21  ? 236  PRO B CB    1 
ATOM   5805 C  CG    . PRO F 3 236 ? 32.528 71.740  57.296 1.00 46.30  ? 236  PRO B CG    1 
ATOM   5806 C  CD    . PRO F 3 236 ? 32.673 72.852  58.313 1.00 45.78  ? 236  PRO B CD    1 
ATOM   5807 N  N     . ILE F 3 237 ? 32.872 68.479  59.904 1.00 43.03  ? 237  ILE B N     1 
ATOM   5808 C  CA    . ILE F 3 237 ? 33.802 67.367  60.021 1.00 45.35  ? 237  ILE B CA    1 
ATOM   5809 C  C     . ILE F 3 237 ? 34.032 66.909  58.578 1.00 46.96  ? 237  ILE B C     1 
ATOM   5810 O  O     . ILE F 3 237 ? 33.124 66.367  57.940 1.00 47.06  ? 237  ILE B O     1 
ATOM   5811 C  CB    . ILE F 3 237 ? 33.194 66.205  60.840 1.00 43.53  ? 237  ILE B CB    1 
ATOM   5812 C  CG1   . ILE F 3 237 ? 33.228 66.535  62.339 1.00 44.66  ? 237  ILE B CG1   1 
ATOM   5813 C  CG2   . ILE F 3 237 ? 33.956 64.918  60.563 1.00 43.06  ? 237  ILE B CG2   1 
ATOM   5814 C  CD1   . ILE F 3 237 ? 32.411 67.749  62.744 1.00 45.58  ? 237  ILE B CD1   1 
ATOM   5815 N  N     . ARG F 3 238 ? 35.240 67.141  58.069 1.00 47.70  ? 238  ARG B N     1 
ATOM   5816 C  CA    . ARG F 3 238 ? 35.592 66.791  56.693 1.00 49.04  ? 238  ARG B CA    1 
ATOM   5817 C  C     . ARG F 3 238 ? 36.829 65.895  56.644 1.00 48.64  ? 238  ARG B C     1 
ATOM   5818 O  O     . ARG F 3 238 ? 37.666 65.933  57.541 1.00 46.67  ? 238  ARG B O     1 
ATOM   5819 C  CB    . ARG F 3 238 ? 35.892 68.070  55.918 1.00 52.70  ? 238  ARG B CB    1 
ATOM   5820 C  CG    . ARG F 3 238 ? 37.129 68.774  56.467 1.00 58.56  ? 238  ARG B CG    1 
ATOM   5821 C  CD    . ARG F 3 238 ? 37.179 70.249  56.126 1.00 63.96  ? 238  ARG B CD    1 
ATOM   5822 N  NE    . ARG F 3 238 ? 37.413 70.505  54.708 1.00 67.81  ? 238  ARG B NE    1 
ATOM   5823 C  CZ    . ARG F 3 238 ? 37.563 71.723  54.194 1.00 70.50  ? 238  ARG B CZ    1 
ATOM   5824 N  NH1   . ARG F 3 238 ? 37.502 72.789  54.985 1.00 72.22  ? 238  ARG B NH1   1 
ATOM   5825 N  NH2   . ARG F 3 238 ? 37.780 71.878  52.893 1.00 71.46  ? 238  ARG B NH2   1 
ATOM   5826 N  N     . THR F 3 239 ? 36.947 65.102  55.584 1.00 48.55  ? 239  THR B N     1 
ATOM   5827 C  CA    . THR F 3 239 ? 38.099 64.220  55.425 1.00 48.42  ? 239  THR B CA    1 
ATOM   5828 C  C     . THR F 3 239 ? 39.301 65.080  55.055 1.00 47.47  ? 239  THR B C     1 
ATOM   5829 O  O     . THR F 3 239 ? 39.238 65.872  54.122 1.00 46.97  ? 239  THR B O     1 
ATOM   5830 C  CB    . THR F 3 239 ? 37.868 63.185  54.298 1.00 48.15  ? 239  THR B CB    1 
ATOM   5831 O  OG1   . THR F 3 239 ? 36.707 62.401  54.600 1.00 48.72  ? 239  THR B OG1   1 
ATOM   5832 C  CG2   . THR F 3 239 ? 39.073 62.260  54.159 1.00 48.85  ? 239  THR B CG2   1 
ATOM   5833 N  N     . ARG F 3 240 ? 40.394 64.936  55.790 1.00 47.64  ? 240  ARG B N     1 
ATOM   5834 C  CA    . ARG F 3 240 ? 41.584 65.720  55.495 1.00 49.31  ? 240  ARG B CA    1 
ATOM   5835 C  C     . ARG F 3 240 ? 42.422 65.022  54.431 1.00 48.65  ? 240  ARG B C     1 
ATOM   5836 O  O     . ARG F 3 240 ? 42.531 63.800  54.419 1.00 50.21  ? 240  ARG B O     1 
ATOM   5837 C  CB    . ARG F 3 240 ? 42.415 65.931  56.769 1.00 50.52  ? 240  ARG B CB    1 
ATOM   5838 C  CG    . ARG F 3 240 ? 41.683 66.706  57.858 1.00 50.68  ? 240  ARG B CG    1 
ATOM   5839 C  CD    . ARG F 3 240 ? 42.596 67.068  59.033 1.00 52.13  ? 240  ARG B CD    1 
ATOM   5840 N  NE    . ARG F 3 240 ? 41.889 67.876  60.029 1.00 52.11  ? 240  ARG B NE    1 
ATOM   5841 C  CZ    . ARG F 3 240 ? 42.462 68.468  61.075 1.00 51.72  ? 240  ARG B CZ    1 
ATOM   5842 N  NH1   . ARG F 3 240 ? 43.769 68.351  61.280 1.00 51.44  ? 240  ARG B NH1   1 
ATOM   5843 N  NH2   . ARG F 3 240 ? 41.725 69.186  61.916 1.00 48.47  ? 240  ARG B NH2   1 
ATOM   5844 N  N     . VAL F 3 241 ? 42.996 65.802  53.525 1.00 48.41  ? 241  VAL B N     1 
ATOM   5845 C  CA    . VAL F 3 241 ? 43.829 65.246  52.467 1.00 48.00  ? 241  VAL B CA    1 
ATOM   5846 C  C     . VAL F 3 241 ? 45.232 65.811  52.604 1.00 46.66  ? 241  VAL B C     1 
ATOM   5847 O  O     . VAL F 3 241 ? 45.413 67.028  52.659 1.00 45.22  ? 241  VAL B O     1 
ATOM   5848 C  CB    . VAL F 3 241 ? 43.299 65.609  51.069 1.00 49.47  ? 241  VAL B CB    1 
ATOM   5849 C  CG1   . VAL F 3 241 ? 44.143 64.920  50.007 1.00 50.40  ? 241  VAL B CG1   1 
ATOM   5850 C  CG2   . VAL F 3 241 ? 41.841 65.197  50.939 1.00 50.54  ? 241  VAL B CG2   1 
ATOM   5851 N  N     . ARG F 3 242 ? 46.217 64.920  52.667 1.00 45.88  ? 242  ARG B N     1 
ATOM   5852 C  CA    . ARG F 3 242 ? 47.613 65.314  52.804 1.00 46.55  ? 242  ARG B CA    1 
ATOM   5853 C  C     . ARG F 3 242 ? 47.987 66.214  51.630 1.00 44.81  ? 242  ARG B C     1 
ATOM   5854 O  O     . ARG F 3 242 ? 47.614 65.942  50.492 1.00 45.89  ? 242  ARG B O     1 
ATOM   5855 C  CB    . ARG F 3 242 ? 48.495 64.063  52.828 1.00 49.89  ? 242  ARG B CB    1 
ATOM   5856 C  CG    . ARG F 3 242 ? 49.674 64.139  53.784 1.00 55.93  ? 242  ARG B CG    1 
ATOM   5857 C  CD    . ARG F 3 242 ? 50.386 62.793  53.868 1.00 59.58  ? 242  ARG B CD    1 
ATOM   5858 N  NE    . ARG F 3 242 ? 51.397 62.751  54.925 1.00 64.50  ? 242  ARG B NE    1 
ATOM   5859 C  CZ    . ARG F 3 242 ? 51.148 62.970  56.215 1.00 67.23  ? 242  ARG B CZ    1 
ATOM   5860 N  NH1   . ARG F 3 242 ? 49.916 63.255  56.623 1.00 69.11  ? 242  ARG B NH1   1 
ATOM   5861 N  NH2   . ARG F 3 242 ? 52.131 62.887  57.104 1.00 67.69  ? 242  ARG B NH2   1 
ATOM   5862 N  N     . LYS F 3 243 ? 48.725 67.283  51.895 1.00 42.12  ? 243  LYS B N     1 
ATOM   5863 C  CA    . LYS F 3 243 ? 49.096 68.200  50.829 1.00 41.90  ? 243  LYS B CA    1 
ATOM   5864 C  C     . LYS F 3 243 ? 50.590 68.313  50.559 1.00 41.44  ? 243  LYS B C     1 
ATOM   5865 O  O     . LYS F 3 243 ? 51.006 68.945  49.588 1.00 41.08  ? 243  LYS B O     1 
ATOM   5866 C  CB    . LYS F 3 243 ? 48.514 69.573  51.127 1.00 42.68  ? 243  LYS B CB    1 
ATOM   5867 C  CG    . LYS F 3 243 ? 47.015 69.531  51.296 1.00 43.39  ? 243  LYS B CG    1 
ATOM   5868 C  CD    . LYS F 3 243 ? 46.469 70.894  51.622 1.00 46.97  ? 243  LYS B CD    1 
ATOM   5869 C  CE    . LYS F 3 243 ? 44.968 70.831  51.822 1.00 46.72  ? 243  LYS B CE    1 
ATOM   5870 N  NZ    . LYS F 3 243 ? 44.429 72.184  52.097 1.00 50.90  ? 243  LYS B NZ    1 
ATOM   5871 N  N     . SER F 3 244 ? 51.397 67.708  51.420 1.00 39.65  ? 244  SER B N     1 
ATOM   5872 C  CA    . SER F 3 244 ? 52.837 67.737  51.244 1.00 38.30  ? 244  SER B CA    1 
ATOM   5873 C  C     . SER F 3 244 ? 53.424 66.589  52.037 1.00 38.66  ? 244  SER B C     1 
ATOM   5874 O  O     . SER F 3 244 ? 52.850 66.160  53.042 1.00 39.85  ? 244  SER B O     1 
ATOM   5875 C  CB    . SER F 3 244 ? 53.421 69.066  51.733 1.00 39.37  ? 244  SER B CB    1 
ATOM   5876 O  OG    . SER F 3 244 ? 53.461 69.135  53.150 1.00 39.98  ? 244  SER B OG    1 
ATOM   5877 N  N     . ILE F 3 245 ? 54.556 66.088  51.563 1.00 36.47  ? 245  ILE B N     1 
ATOM   5878 C  CA    . ILE F 3 245 ? 55.277 64.989  52.189 1.00 35.59  ? 245  ILE B CA    1 
ATOM   5879 C  C     . ILE F 3 245 ? 56.759 65.297  52.027 1.00 35.31  ? 245  ILE B C     1 
ATOM   5880 O  O     . ILE F 3 245 ? 57.194 65.720  50.956 1.00 32.17  ? 245  ILE B O     1 
ATOM   5881 C  CB    . ILE F 3 245 ? 54.988 63.645  51.490 1.00 37.51  ? 245  ILE B CB    1 
ATOM   5882 C  CG1   . ILE F 3 245 ? 53.559 63.199  51.786 1.00 40.50  ? 245  ILE B CG1   1 
ATOM   5883 C  CG2   . ILE F 3 245 ? 55.967 62.589  51.960 1.00 38.41  ? 245  ILE B CG2   1 
ATOM   5884 C  CD1   . ILE F 3 245 ? 53.178 61.923  51.079 1.00 42.76  ? 245  ILE B CD1   1 
ATOM   5885 N  N     . GLY F 3 246 ? 57.532 65.089  53.084 1.00 33.45  ? 246  GLY B N     1 
ATOM   5886 C  CA    . GLY F 3 246 ? 58.949 65.366  53.003 1.00 35.70  ? 246  GLY B CA    1 
ATOM   5887 C  C     . GLY F 3 246 ? 59.760 64.666  54.071 1.00 36.53  ? 246  GLY B C     1 
ATOM   5888 O  O     . GLY F 3 246 ? 59.253 63.807  54.794 1.00 36.71  ? 246  GLY B O     1 
ATOM   5889 N  N     . ARG F 3 247 ? 61.030 65.044  54.160 1.00 36.35  ? 247  ARG B N     1 
ATOM   5890 C  CA    . ARG F 3 247 ? 61.958 64.490  55.135 1.00 37.30  ? 247  ARG B CA    1 
ATOM   5891 C  C     . ARG F 3 247 ? 63.081 65.509  55.322 1.00 37.62  ? 247  ARG B C     1 
ATOM   5892 O  O     . ARG F 3 247 ? 63.624 66.020  54.343 1.00 35.62  ? 247  ARG B O     1 
ATOM   5893 C  CB    . ARG F 3 247 ? 62.548 63.182  54.609 1.00 41.04  ? 247  ARG B CB    1 
ATOM   5894 C  CG    . ARG F 3 247 ? 63.610 62.547  55.508 1.00 46.23  ? 247  ARG B CG    1 
ATOM   5895 C  CD    . ARG F 3 247 ? 62.999 61.638  56.571 1.00 49.84  ? 247  ARG B CD    1 
ATOM   5896 N  NE    . ARG F 3 247 ? 64.014 60.808  57.224 1.00 54.93  ? 247  ARG B NE    1 
ATOM   5897 C  CZ    . ARG F 3 247 ? 64.652 61.128  58.350 1.00 56.41  ? 247  ARG B CZ    1 
ATOM   5898 N  NH1   . ARG F 3 247 ? 64.386 62.266  58.974 1.00 57.71  ? 247  ARG B NH1   1 
ATOM   5899 N  NH2   . ARG F 3 247 ? 65.567 60.308  58.851 1.00 57.10  ? 247  ARG B NH2   1 
ATOM   5900 N  N     . ILE F 3 248 ? 63.415 65.814  56.573 1.00 36.03  ? 248  ILE B N     1 
ATOM   5901 C  CA    . ILE F 3 248 ? 64.491 66.755  56.881 1.00 35.53  ? 248  ILE B CA    1 
ATOM   5902 C  C     . ILE F 3 248 ? 65.411 66.025  57.849 1.00 35.68  ? 248  ILE B C     1 
ATOM   5903 O  O     . ILE F 3 248 ? 64.941 65.428  58.815 1.00 35.35  ? 248  ILE B O     1 
ATOM   5904 C  CB    . ILE F 3 248 ? 63.947 68.029  57.550 1.00 35.27  ? 248  ILE B CB    1 
ATOM   5905 C  CG1   . ILE F 3 248 ? 62.963 68.727  56.602 1.00 39.46  ? 248  ILE B CG1   1 
ATOM   5906 C  CG2   . ILE F 3 248 ? 65.096 68.971  57.899 1.00 33.44  ? 248  ILE B CG2   1 
ATOM   5907 C  CD1   . ILE F 3 248 ? 62.376 70.029  57.151 1.00 38.68  ? 248  ILE B CD1   1 
ATOM   5908 N  N     . VAL F 3 249 ? 66.712 66.051  57.589 1.00 35.07  ? 249  VAL B N     1 
ATOM   5909 C  CA    . VAL F 3 249 ? 67.651 65.343  58.449 1.00 35.50  ? 249  VAL B CA    1 
ATOM   5910 C  C     . VAL F 3 249 ? 68.712 66.223  59.073 1.00 36.46  ? 249  VAL B C     1 
ATOM   5911 O  O     . VAL F 3 249 ? 69.152 67.216  58.488 1.00 35.88  ? 249  VAL B O     1 
ATOM   5912 C  CB    . VAL F 3 249 ? 68.367 64.198  57.687 1.00 36.38  ? 249  VAL B CB    1 
ATOM   5913 C  CG1   . VAL F 3 249 ? 67.342 63.207  57.154 1.00 37.71  ? 249  VAL B CG1   1 
ATOM   5914 C  CG2   . VAL F 3 249 ? 69.196 64.763  56.552 1.00 37.51  ? 249  VAL B CG2   1 
ATOM   5915 N  N     . THR F 3 250 ? 69.120 65.842  60.274 1.00 37.18  ? 250  THR B N     1 
ATOM   5916 C  CA    . THR F 3 250 ? 70.146 66.568  61.004 1.00 38.56  ? 250  THR B CA    1 
ATOM   5917 C  C     . THR F 3 250 ? 71.500 66.053  60.548 1.00 39.18  ? 250  THR B C     1 
ATOM   5918 O  O     . THR F 3 250 ? 71.725 64.844  60.505 1.00 38.29  ? 250  THR B O     1 
ATOM   5919 C  CB    . THR F 3 250 ? 70.004 66.339  62.520 1.00 37.54  ? 250  THR B CB    1 
ATOM   5920 O  OG1   . THR F 3 250 ? 68.741 66.859  62.954 1.00 36.19  ? 250  THR B OG1   1 
ATOM   5921 C  CG2   . THR F 3 250 ? 71.130 67.029  63.279 1.00 36.33  ? 250  THR B CG2   1 
ATOM   5922 N  N     . MET F 3 251 ? 72.395 66.969  60.189 1.00 40.11  ? 251  MET B N     1 
ATOM   5923 C  CA    . MET F 3 251 ? 73.724 66.578  59.741 1.00 41.77  ? 251  MET B CA    1 
ATOM   5924 C  C     . MET F 3 251 ? 74.636 66.430  60.952 1.00 43.52  ? 251  MET B C     1 
ATOM   5925 O  O     . MET F 3 251 ? 74.441 67.099  61.967 1.00 43.06  ? 251  MET B O     1 
ATOM   5926 C  CB    . MET F 3 251 ? 74.302 67.624  58.778 1.00 39.83  ? 251  MET B CB    1 
ATOM   5927 C  CG    . MET F 3 251 ? 73.441 67.877  57.546 1.00 41.04  ? 251  MET B CG    1 
ATOM   5928 S  SD    . MET F 3 251 ? 74.223 68.988  56.353 1.00 38.38  ? 251  MET B SD    1 
ATOM   5929 C  CE    . MET F 3 251 ? 74.093 70.513  57.204 1.00 36.26  ? 251  MET B CE    1 
ATOM   5930 N  N     . LYS F 3 252 ? 75.623 65.546  60.833 1.00 46.14  ? 252  LYS B N     1 
ATOM   5931 C  CA    . LYS F 3 252 ? 76.583 65.297  61.901 1.00 48.36  ? 252  LYS B CA    1 
ATOM   5932 C  C     . LYS F 3 252 ? 77.173 66.599  62.436 1.00 49.12  ? 252  LYS B C     1 
ATOM   5933 O  O     . LYS F 3 252 ? 77.448 66.725  63.631 1.00 50.64  ? 252  LYS B O     1 
ATOM   5934 C  CB    . LYS F 3 252 ? 77.702 64.392  61.384 1.00 50.82  ? 252  LYS B CB    1 
ATOM   5935 C  CG    . LYS F 3 252 ? 77.339 62.914  61.328 1.00 53.22  ? 252  LYS B CG    1 
ATOM   5936 C  CD    . LYS F 3 252 ? 77.364 62.303  62.719 1.00 55.84  ? 252  LYS B CD    1 
ATOM   5937 C  CE    . LYS F 3 252 ? 78.738 62.470  63.363 1.00 57.05  ? 252  LYS B CE    1 
ATOM   5938 N  NZ    . LYS F 3 252 ? 78.790 61.941  64.756 1.00 57.97  ? 252  LYS B NZ    1 
ATOM   5939 N  N     . ARG F 3 253 ? 77.370 67.566  61.548 1.00 48.99  ? 253  ARG B N     1 
ATOM   5940 C  CA    . ARG F 3 253 ? 77.913 68.857  61.944 1.00 48.01  ? 253  ARG B CA    1 
ATOM   5941 C  C     . ARG F 3 253 ? 77.479 69.932  60.956 1.00 45.53  ? 253  ARG B C     1 
ATOM   5942 O  O     . ARG F 3 253 ? 77.344 69.669  59.761 1.00 43.19  ? 253  ARG B O     1 
ATOM   5943 C  CB    . ARG F 3 253 ? 79.443 68.790  62.027 1.00 51.34  ? 253  ARG B CB    1 
ATOM   5944 C  CG    . ARG F 3 253 ? 80.170 68.622  60.708 1.00 55.00  ? 253  ARG B CG    1 
ATOM   5945 C  CD    . ARG F 3 253 ? 81.119 69.797  60.498 1.00 62.30  ? 253  ARG B CD    1 
ATOM   5946 N  NE    . ARG F 3 253 ? 81.937 69.682  59.290 1.00 66.56  ? 253  ARG B NE    1 
ATOM   5947 C  CZ    . ARG F 3 253 ? 83.005 68.898  59.171 1.00 68.30  ? 253  ARG B CZ    1 
ATOM   5948 N  NH1   . ARG F 3 253 ? 83.400 68.146  60.190 1.00 69.39  ? 253  ARG B NH1   1 
ATOM   5949 N  NH2   . ARG F 3 253 ? 83.681 68.869  58.030 1.00 69.25  ? 253  ARG B NH2   1 
ATOM   5950 N  N     . ASN F 3 254 ? 77.250 71.139  61.462 1.00 43.10  ? 254  ASN B N     1 
ATOM   5951 C  CA    . ASN F 3 254 ? 76.813 72.241  60.619 1.00 43.63  ? 254  ASN B CA    1 
ATOM   5952 C  C     . ASN F 3 254 ? 77.799 72.458  59.480 1.00 44.33  ? 254  ASN B C     1 
ATOM   5953 O  O     . ASN F 3 254 ? 78.976 72.108  59.591 1.00 44.83  ? 254  ASN B O     1 
ATOM   5954 C  CB    . ASN F 3 254 ? 76.642 73.513  61.454 1.00 44.09  ? 254  ASN B CB    1 
ATOM   5955 C  CG    . ASN F 3 254 ? 75.705 73.307  62.648 1.00 44.07  ? 254  ASN B CG    1 
ATOM   5956 O  OD1   . ASN F 3 254 ? 74.891 72.380  62.665 1.00 42.02  ? 254  ASN B OD1   1 
ATOM   5957 N  ND2   . ASN F 3 254 ? 75.811 74.180  63.641 1.00 43.34  ? 254  ASN B ND2   1 
ATOM   5958 N  N     . SER F 3 255 ? 77.319 73.030  58.380 1.00 43.30  ? 255  SER B N     1 
ATOM   5959 C  CA    . SER F 3 255 ? 78.173 73.236  57.217 1.00 42.19  ? 255  SER B CA    1 
ATOM   5960 C  C     . SER F 3 255 ? 77.509 74.058  56.127 1.00 41.32  ? 255  SER B C     1 
ATOM   5961 O  O     . SER F 3 255 ? 76.307 74.309  56.165 1.00 41.48  ? 255  SER B O     1 
ATOM   5962 C  CB    . SER F 3 255 ? 78.559 71.868  56.634 1.00 41.94  ? 255  SER B CB    1 
ATOM   5963 O  OG    . SER F 3 255 ? 79.001 71.965  55.289 1.00 40.99  ? 255  SER B OG    1 
ATOM   5964 N  N     . ARG F 3 256 ? 78.311 74.497  55.164 1.00 40.16  ? 256  ARG B N     1 
ATOM   5965 C  CA    . ARG F 3 256 ? 77.784 75.218  54.022 1.00 40.13  ? 256  ARG B CA    1 
ATOM   5966 C  C     . ARG F 3 256 ? 78.568 74.777  52.800 1.00 38.72  ? 256  ARG B C     1 
ATOM   5967 O  O     . ARG F 3 256 ? 78.673 75.480  51.804 1.00 38.70  ? 256  ARG B O     1 
ATOM   5968 C  CB    . ARG F 3 256 ? 77.815 76.737  54.229 1.00 41.86  ? 256  ARG B CB    1 
ATOM   5969 C  CG    . ARG F 3 256 ? 79.129 77.375  54.545 1.00 46.67  ? 256  ARG B CG    1 
ATOM   5970 C  CD    . ARG F 3 256 ? 78.859 78.778  55.093 1.00 49.03  ? 256  ARG B CD    1 
ATOM   5971 N  NE    . ARG F 3 256 ? 77.527 79.256  54.719 1.00 50.40  ? 256  ARG B NE    1 
ATOM   5972 C  CZ    . ARG F 3 256 ? 77.235 79.885  53.584 1.00 49.95  ? 256  ARG B CZ    1 
ATOM   5973 N  NH1   . ARG F 3 256 ? 78.182 80.133  52.692 1.00 49.42  ? 256  ARG B NH1   1 
ATOM   5974 N  NH2   . ARG F 3 256 ? 75.985 80.245  53.331 1.00 48.25  ? 256  ARG B NH2   1 
ATOM   5975 N  N     . ASN F 3 257 ? 79.104 73.567  52.901 1.00 38.34  ? 257  ASN B N     1 
ATOM   5976 C  CA    . ASN F 3 257 ? 79.855 72.959  51.822 1.00 38.56  ? 257  ASN B CA    1 
ATOM   5977 C  C     . ASN F 3 257 ? 78.898 72.065  51.032 1.00 38.18  ? 257  ASN B C     1 
ATOM   5978 O  O     . ASN F 3 257 ? 78.403 71.056  51.546 1.00 36.30  ? 257  ASN B O     1 
ATOM   5979 C  CB    . ASN F 3 257 ? 81.005 72.129  52.382 1.00 39.39  ? 257  ASN B CB    1 
ATOM   5980 C  CG    . ASN F 3 257 ? 81.750 71.388  51.302 1.00 42.65  ? 257  ASN B CG    1 
ATOM   5981 O  OD1   . ASN F 3 257 ? 81.253 70.403  50.759 1.00 42.67  ? 257  ASN B OD1   1 
ATOM   5982 N  ND2   . ASN F 3 257 ? 82.944 71.872  50.962 1.00 42.99  ? 257  ASN B ND2   1 
ATOM   5983 N  N     . LEU F 3 258 ? 78.644 72.440  49.783 1.00 36.96  ? 258  LEU B N     1 
ATOM   5984 C  CA    . LEU F 3 258 ? 77.726 71.693  48.932 1.00 39.78  ? 258  LEU B CA    1 
ATOM   5985 C  C     . LEU F 3 258 ? 77.948 70.186  48.940 1.00 40.46  ? 258  LEU B C     1 
ATOM   5986 O  O     . LEU F 3 258 ? 77.003 69.418  49.102 1.00 39.69  ? 258  LEU B O     1 
ATOM   5987 C  CB    . LEU F 3 258 ? 77.794 72.198  47.491 1.00 39.43  ? 258  LEU B CB    1 
ATOM   5988 C  CG    . LEU F 3 258 ? 76.818 71.494  46.541 1.00 41.53  ? 258  LEU B CG    1 
ATOM   5989 C  CD1   . LEU F 3 258 ? 75.387 71.735  47.007 1.00 39.32  ? 258  LEU B CD1   1 
ATOM   5990 C  CD2   . LEU F 3 258 ? 77.002 72.021  45.129 1.00 40.79  ? 258  LEU B CD2   1 
ATOM   5991 N  N     . GLU F 3 259 ? 79.192 69.758  48.767 1.00 40.97  ? 259  GLU B N     1 
ATOM   5992 C  CA    . GLU F 3 259 ? 79.490 68.333  48.743 1.00 42.73  ? 259  GLU B CA    1 
ATOM   5993 C  C     . GLU F 3 259 ? 79.242 67.617  50.066 1.00 42.03  ? 259  GLU B C     1 
ATOM   5994 O  O     . GLU F 3 259 ? 78.914 66.429  50.088 1.00 41.24  ? 259  GLU B O     1 
ATOM   5995 C  CB    . GLU F 3 259 ? 80.931 68.112  48.281 1.00 45.81  ? 259  GLU B CB    1 
ATOM   5996 C  CG    . GLU F 3 259 ? 81.121 68.419  46.803 1.00 49.19  ? 259  GLU B CG    1 
ATOM   5997 C  CD    . GLU F 3 259 ? 80.123 67.671  45.931 1.00 52.56  ? 259  GLU B CD    1 
ATOM   5998 O  OE1   . GLU F 3 259 ? 80.056 66.425  46.030 1.00 54.17  ? 259  GLU B OE1   1 
ATOM   5999 O  OE2   . GLU F 3 259 ? 79.403 68.325  45.145 1.00 54.69  ? 259  GLU B OE2   1 
ATOM   6000 N  N     . GLU F 3 260 ? 79.388 68.341  51.167 1.00 40.42  ? 260  GLU B N     1 
ATOM   6001 C  CA    . GLU F 3 260 ? 79.175 67.773  52.489 1.00 39.68  ? 260  GLU B CA    1 
ATOM   6002 C  C     . GLU F 3 260 ? 77.688 67.575  52.729 1.00 38.05  ? 260  GLU B C     1 
ATOM   6003 O  O     . GLU F 3 260 ? 77.260 66.582  53.315 1.00 38.08  ? 260  GLU B O     1 
ATOM   6004 C  CB    . GLU F 3 260 ? 79.702 68.725  53.554 1.00 41.19  ? 260  GLU B CB    1 
ATOM   6005 C  CG    . GLU F 3 260 ? 80.683 68.121  54.513 1.00 44.74  ? 260  GLU B CG    1 
ATOM   6006 C  CD    . GLU F 3 260 ? 80.844 68.971  55.754 1.00 46.85  ? 260  GLU B CD    1 
ATOM   6007 O  OE1   . GLU F 3 260 ? 80.978 70.209  55.617 1.00 49.09  ? 260  GLU B OE1   1 
ATOM   6008 O  OE2   . GLU F 3 260 ? 80.841 68.400  56.863 1.00 47.49  ? 260  GLU B OE2   1 
ATOM   6009 N  N     . ILE F 3 261 ? 76.908 68.543  52.268 1.00 36.66  ? 261  ILE B N     1 
ATOM   6010 C  CA    . ILE F 3 261 ? 75.467 68.531  52.448 1.00 34.90  ? 261  ILE B CA    1 
ATOM   6011 C  C     . ILE F 3 261 ? 74.704 67.572  51.539 1.00 34.13  ? 261  ILE B C     1 
ATOM   6012 O  O     . ILE F 3 261 ? 73.679 67.022  51.936 1.00 32.83  ? 261  ILE B O     1 
ATOM   6013 C  CB    . ILE F 3 261 ? 74.912 69.956  52.270 1.00 34.50  ? 261  ILE B CB    1 
ATOM   6014 C  CG1   . ILE F 3 261 ? 75.565 70.882  53.298 1.00 34.13  ? 261  ILE B CG1   1 
ATOM   6015 C  CG2   . ILE F 3 261 ? 73.401 69.959  52.432 1.00 33.16  ? 261  ILE B CG2   1 
ATOM   6016 C  CD1   . ILE F 3 261 ? 75.150 72.334  53.190 1.00 35.71  ? 261  ILE B CD1   1 
ATOM   6017 N  N     . LYS F 3 262 ? 75.212 67.365  50.331 1.00 34.50  ? 262  LYS B N     1 
ATOM   6018 C  CA    . LYS F 3 262 ? 74.568 66.493  49.352 1.00 36.92  ? 262  LYS B CA    1 
ATOM   6019 C  C     . LYS F 3 262 ? 74.063 65.133  49.823 1.00 36.63  ? 262  LYS B C     1 
ATOM   6020 O  O     . LYS F 3 262 ? 72.906 64.779  49.585 1.00 38.32  ? 262  LYS B O     1 
ATOM   6021 C  CB    . LYS F 3 262 ? 75.493 66.268  48.155 1.00 35.80  ? 262  LYS B CB    1 
ATOM   6022 C  CG    . LYS F 3 262 ? 75.437 67.359  47.105 1.00 39.48  ? 262  LYS B CG    1 
ATOM   6023 C  CD    . LYS F 3 262 ? 76.243 66.952  45.886 1.00 40.75  ? 262  LYS B CD    1 
ATOM   6024 C  CE    . LYS F 3 262 ? 76.126 67.970  44.772 1.00 43.85  ? 262  LYS B CE    1 
ATOM   6025 N  NZ    . LYS F 3 262 ? 76.951 67.555  43.602 1.00 45.34  ? 262  LYS B NZ    1 
ATOM   6026 N  N     . PRO F 3 263 ? 74.921 64.345  50.485 1.00 36.89  ? 263  PRO B N     1 
ATOM   6027 C  CA    . PRO F 3 263 ? 74.480 63.023  50.947 1.00 35.79  ? 263  PRO B CA    1 
ATOM   6028 C  C     . PRO F 3 263 ? 73.224 63.040  51.808 1.00 36.55  ? 263  PRO B C     1 
ATOM   6029 O  O     . PRO F 3 263 ? 72.338 62.198  51.632 1.00 37.64  ? 263  PRO B O     1 
ATOM   6030 C  CB    . PRO F 3 263 ? 75.703 62.488  51.691 1.00 34.86  ? 263  PRO B CB    1 
ATOM   6031 C  CG    . PRO F 3 263 ? 76.855 63.158  50.969 1.00 35.21  ? 263  PRO B CG    1 
ATOM   6032 C  CD    . PRO F 3 263 ? 76.342 64.572  50.809 1.00 35.77  ? 263  PRO B CD    1 
ATOM   6033 N  N     . TYR F 3 264 ? 73.142 63.985  52.741 1.00 34.65  ? 264  TYR B N     1 
ATOM   6034 C  CA    . TYR F 3 264 ? 71.965 64.075  53.598 1.00 34.58  ? 264  TYR B CA    1 
ATOM   6035 C  C     . TYR F 3 264 ? 70.760 64.471  52.757 1.00 34.35  ? 264  TYR B C     1 
ATOM   6036 O  O     . TYR F 3 264 ? 69.661 63.934  52.925 1.00 34.15  ? 264  TYR B O     1 
ATOM   6037 C  CB    . TYR F 3 264 ? 72.172 65.125  54.681 1.00 34.39  ? 264  TYR B CB    1 
ATOM   6038 C  CG    . TYR F 3 264 ? 73.277 64.822  55.657 1.00 35.18  ? 264  TYR B CG    1 
ATOM   6039 C  CD1   . TYR F 3 264 ? 73.061 63.986  56.750 1.00 34.69  ? 264  TYR B CD1   1 
ATOM   6040 C  CD2   . TYR F 3 264 ? 74.528 65.419  55.521 1.00 35.15  ? 264  TYR B CD2   1 
ATOM   6041 C  CE1   . TYR F 3 264 ? 74.066 63.761  57.693 1.00 37.32  ? 264  TYR B CE1   1 
ATOM   6042 C  CE2   . TYR F 3 264 ? 75.539 65.201  56.455 1.00 36.41  ? 264  TYR B CE2   1 
ATOM   6043 C  CZ    . TYR F 3 264 ? 75.302 64.378  57.542 1.00 37.85  ? 264  TYR B CZ    1 
ATOM   6044 O  OH    . TYR F 3 264 ? 76.282 64.211  58.499 1.00 38.37  ? 264  TYR B OH    1 
ATOM   6045 N  N     . LEU F 3 265 ? 70.971 65.427  51.855 1.00 33.24  ? 265  LEU B N     1 
ATOM   6046 C  CA    . LEU F 3 265 ? 69.895 65.900  50.990 1.00 32.06  ? 265  LEU B CA    1 
ATOM   6047 C  C     . LEU F 3 265 ? 69.342 64.728  50.188 1.00 32.43  ? 265  LEU B C     1 
ATOM   6048 O  O     . LEU F 3 265 ? 68.134 64.501  50.160 1.00 32.19  ? 265  LEU B O     1 
ATOM   6049 C  CB    . LEU F 3 265 ? 70.410 66.991  50.034 1.00 30.60  ? 265  LEU B CB    1 
ATOM   6050 C  CG    . LEU F 3 265 ? 69.433 67.548  48.986 1.00 30.34  ? 265  LEU B CG    1 
ATOM   6051 C  CD1   . LEU F 3 265 ? 68.221 68.149  49.671 1.00 29.43  ? 265  LEU B CD1   1 
ATOM   6052 C  CD2   . LEU F 3 265 ? 70.130 68.603  48.132 1.00 30.17  ? 265  LEU B CD2   1 
ATOM   6053 N  N     . PHE F 3 266 ? 70.236 63.974  49.553 1.00 32.19  ? 266  PHE B N     1 
ATOM   6054 C  CA    . PHE F 3 266 ? 69.818 62.843  48.743 1.00 35.15  ? 266  PHE B CA    1 
ATOM   6055 C  C     . PHE F 3 266 ? 69.122 61.757  49.552 1.00 35.65  ? 266  PHE B C     1 
ATOM   6056 O  O     . PHE F 3 266 ? 68.203 61.100  49.055 1.00 35.42  ? 266  PHE B O     1 
ATOM   6057 C  CB    . PHE F 3 266 ? 71.017 62.262  47.987 1.00 34.72  ? 266  PHE B CB    1 
ATOM   6058 C  CG    . PHE F 3 266 ? 71.640 63.227  47.013 1.00 36.34  ? 266  PHE B CG    1 
ATOM   6059 C  CD1   . PHE F 3 266 ? 70.861 64.180  46.364 1.00 36.58  ? 266  PHE B CD1   1 
ATOM   6060 C  CD2   . PHE F 3 266 ? 72.990 63.147  46.700 1.00 35.97  ? 266  PHE B CD2   1 
ATOM   6061 C  CE1   . PHE F 3 266 ? 71.419 65.031  45.417 1.00 38.96  ? 266  PHE B CE1   1 
ATOM   6062 C  CE2   . PHE F 3 266 ? 73.558 63.995  45.753 1.00 35.62  ? 266  PHE B CE2   1 
ATOM   6063 C  CZ    . PHE F 3 266 ? 72.772 64.936  45.111 1.00 37.46  ? 266  PHE B CZ    1 
ATOM   6064 N  N     . ARG F 3 267 ? 69.546 61.577  50.800 1.00 36.10  ? 267  ARG B N     1 
ATOM   6065 C  CA    . ARG F 3 267 ? 68.936 60.569  51.653 1.00 35.04  ? 267  ARG B CA    1 
ATOM   6066 C  C     . ARG F 3 267 ? 67.515 61.017  51.954 1.00 33.47  ? 267  ARG B C     1 
ATOM   6067 O  O     . ARG F 3 267 ? 66.587 60.216  51.910 1.00 33.72  ? 267  ARG B O     1 
ATOM   6068 C  CB    . ARG F 3 267 ? 69.725 60.416  52.952 1.00 38.58  ? 267  ARG B CB    1 
ATOM   6069 C  CG    . ARG F 3 267 ? 69.577 59.055  53.631 1.00 43.64  ? 267  ARG B CG    1 
ATOM   6070 C  CD    . ARG F 3 267 ? 70.374 59.018  54.931 1.00 46.53  ? 267  ARG B CD    1 
ATOM   6071 N  NE    . ARG F 3 267 ? 71.754 59.453  54.726 1.00 48.87  ? 267  ARG B NE    1 
ATOM   6072 C  CZ    . ARG F 3 267 ? 72.498 60.041  55.659 1.00 51.54  ? 267  ARG B CZ    1 
ATOM   6073 N  NH1   . ARG F 3 267 ? 71.995 60.266  56.867 1.00 50.36  ? 267  ARG B NH1   1 
ATOM   6074 N  NH2   . ARG F 3 267 ? 73.742 60.420  55.381 1.00 54.39  ? 267  ARG B NH2   1 
ATOM   6075 N  N     . ALA F 3 268 ? 67.348 62.305  52.246 1.00 31.36  ? 268  ALA B N     1 
ATOM   6076 C  CA    . ALA F 3 268 ? 66.030 62.848  52.543 1.00 28.49  ? 268  ALA B CA    1 
ATOM   6077 C  C     . ALA F 3 268 ? 65.120 62.635  51.342 1.00 28.32  ? 268  ALA B C     1 
ATOM   6078 O  O     . ALA F 3 268 ? 63.957 62.286  51.489 1.00 27.31  ? 268  ALA B O     1 
ATOM   6079 C  CB    . ALA F 3 268 ? 66.124 64.342  52.875 1.00 24.85  ? 268  ALA B CB    1 
ATOM   6080 N  N     . ILE F 3 269 ? 65.650 62.857  50.148 1.00 30.71  ? 269  ILE B N     1 
ATOM   6081 C  CA    . ILE F 3 269 ? 64.864 62.668  48.933 1.00 32.91  ? 269  ILE B CA    1 
ATOM   6082 C  C     . ILE F 3 269 ? 64.467 61.202  48.778 1.00 34.74  ? 269  ILE B C     1 
ATOM   6083 O  O     . ILE F 3 269 ? 63.304 60.880  48.526 1.00 33.84  ? 269  ILE B O     1 
ATOM   6084 C  CB    . ILE F 3 269 ? 65.663 63.098  47.683 1.00 34.22  ? 269  ILE B CB    1 
ATOM   6085 C  CG1   . ILE F 3 269 ? 65.870 64.617  47.700 1.00 33.57  ? 269  ILE B CG1   1 
ATOM   6086 C  CG2   . ILE F 3 269 ? 64.944 62.650  46.406 1.00 31.72  ? 269  ILE B CG2   1 
ATOM   6087 C  CD1   . ILE F 3 269 ? 66.726 65.117  46.555 1.00 35.89  ? 269  ILE B CD1   1 
ATOM   6088 N  N     . GLU F 3 270 ? 65.443 60.319  48.942 1.00 36.38  ? 270  GLU B N     1 
ATOM   6089 C  CA    . GLU F 3 270 ? 65.210 58.895  48.799 1.00 39.34  ? 270  GLU B CA    1 
ATOM   6090 C  C     . GLU F 3 270 ? 64.058 58.450  49.689 1.00 39.61  ? 270  GLU B C     1 
ATOM   6091 O  O     . GLU F 3 270 ? 63.107 57.816  49.228 1.00 39.60  ? 270  GLU B O     1 
ATOM   6092 C  CB    . GLU F 3 270 ? 66.484 58.132  49.159 1.00 42.09  ? 270  GLU B CB    1 
ATOM   6093 C  CG    . GLU F 3 270 ? 66.586 56.763  48.523 1.00 48.74  ? 270  GLU B CG    1 
ATOM   6094 C  CD    . GLU F 3 270 ? 66.490 56.824  47.007 1.00 51.23  ? 270  GLU B CD    1 
ATOM   6095 O  OE1   . GLU F 3 270 ? 67.238 57.619  46.388 1.00 52.43  ? 270  GLU B OE1   1 
ATOM   6096 O  OE2   . GLU F 3 270 ? 65.665 56.074  46.436 1.00 52.84  ? 270  GLU B OE2   1 
ATOM   6097 N  N     . GLU F 3 271 ? 64.136 58.808  50.963 1.00 40.05  ? 271  GLU B N     1 
ATOM   6098 C  CA    . GLU F 3 271 ? 63.106 58.434  51.916 1.00 40.73  ? 271  GLU B CA    1 
ATOM   6099 C  C     . GLU F 3 271 ? 61.783 59.129  51.642 1.00 40.88  ? 271  GLU B C     1 
ATOM   6100 O  O     . GLU F 3 271 ? 60.718 58.546  51.863 1.00 42.02  ? 271  GLU B O     1 
ATOM   6101 C  CB    . GLU F 3 271 ? 63.591 58.725  53.335 1.00 41.67  ? 271  GLU B CB    1 
ATOM   6102 C  CG    . GLU F 3 271 ? 64.693 57.775  53.784 1.00 43.80  ? 271  GLU B CG    1 
ATOM   6103 C  CD    . GLU F 3 271 ? 65.288 58.155  55.119 1.00 44.66  ? 271  GLU B CD    1 
ATOM   6104 O  OE1   . GLU F 3 271 ? 64.521 58.561  56.014 1.00 46.68  ? 271  GLU B OE1   1 
ATOM   6105 O  OE2   . GLU F 3 271 ? 66.521 58.037  55.280 1.00 46.61  ? 271  GLU B OE2   1 
ATOM   6106 N  N     . SER F 3 272 ? 61.841 60.367  51.158 1.00 39.01  ? 272  SER B N     1 
ATOM   6107 C  CA    . SER F 3 272 ? 60.620 61.104  50.842 1.00 38.58  ? 272  SER B CA    1 
ATOM   6108 C  C     . SER F 3 272 ? 59.851 60.388  49.740 1.00 38.84  ? 272  SER B C     1 
ATOM   6109 O  O     . SER F 3 272 ? 58.630 60.257  49.809 1.00 36.91  ? 272  SER B O     1 
ATOM   6110 C  CB    . SER F 3 272 ? 60.939 62.524  50.366 1.00 38.06  ? 272  SER B CB    1 
ATOM   6111 O  OG    . SER F 3 272 ? 61.386 63.344  51.422 1.00 39.39  ? 272  SER B OG    1 
ATOM   6112 N  N     . TYR F 3 273 ? 60.572 59.936  48.718 1.00 40.91  ? 273  TYR B N     1 
ATOM   6113 C  CA    . TYR F 3 273 ? 59.943 59.248  47.602 1.00 45.04  ? 273  TYR B CA    1 
ATOM   6114 C  C     . TYR F 3 273 ? 59.303 57.940  48.015 1.00 46.34  ? 273  TYR B C     1 
ATOM   6115 O  O     . TYR F 3 273 ? 58.229 57.586  47.531 1.00 47.02  ? 273  TYR B O     1 
ATOM   6116 C  CB    . TYR F 3 273 ? 60.955 59.020  46.485 1.00 46.51  ? 273  TYR B CB    1 
ATOM   6117 C  CG    . TYR F 3 273 ? 60.847 60.080  45.434 1.00 48.66  ? 273  TYR B CG    1 
ATOM   6118 C  CD1   . TYR F 3 273 ? 60.031 59.902  44.314 1.00 49.04  ? 273  TYR B CD1   1 
ATOM   6119 C  CD2   . TYR F 3 273 ? 61.482 61.304  45.600 1.00 50.57  ? 273  TYR B CD2   1 
ATOM   6120 C  CE1   . TYR F 3 273 ? 59.848 60.928  43.390 1.00 49.43  ? 273  TYR B CE1   1 
ATOM   6121 C  CE2   . TYR F 3 273 ? 61.304 62.334  44.685 1.00 51.12  ? 273  TYR B CE2   1 
ATOM   6122 C  CZ    . TYR F 3 273 ? 60.488 62.141  43.588 1.00 49.72  ? 273  TYR B CZ    1 
ATOM   6123 O  OH    . TYR F 3 273 ? 60.313 63.176  42.707 1.00 50.66  ? 273  TYR B OH    1 
ATOM   6124 N  N     . TYR F 3 274 ? 59.965 57.223  48.911 1.00 47.59  ? 274  TYR B N     1 
ATOM   6125 C  CA    . TYR F 3 274 ? 59.425 55.973  49.404 1.00 50.17  ? 274  TYR B CA    1 
ATOM   6126 C  C     . TYR F 3 274 ? 58.076 56.274  50.057 1.00 50.05  ? 274  TYR B C     1 
ATOM   6127 O  O     . TYR F 3 274 ? 57.119 55.513  49.906 1.00 50.40  ? 274  TYR B O     1 
ATOM   6128 C  CB    . TYR F 3 274 ? 60.381 55.365  50.425 1.00 53.24  ? 274  TYR B CB    1 
ATOM   6129 C  CG    . TYR F 3 274 ? 59.770 54.289  51.293 1.00 58.54  ? 274  TYR B CG    1 
ATOM   6130 C  CD1   . TYR F 3 274 ? 59.408 53.049  50.761 1.00 60.19  ? 274  TYR B CD1   1 
ATOM   6131 C  CD2   . TYR F 3 274 ? 59.554 54.513  52.656 1.00 60.73  ? 274  TYR B CD2   1 
ATOM   6132 C  CE1   . TYR F 3 274 ? 58.845 52.055  51.566 1.00 62.29  ? 274  TYR B CE1   1 
ATOM   6133 C  CE2   . TYR F 3 274 ? 58.993 53.531  53.470 1.00 62.79  ? 274  TYR B CE2   1 
ATOM   6134 C  CZ    . TYR F 3 274 ? 58.641 52.304  52.920 1.00 63.61  ? 274  TYR B CZ    1 
ATOM   6135 O  OH    . TYR F 3 274 ? 58.091 51.329  53.723 1.00 65.84  ? 274  TYR B OH    1 
ATOM   6136 N  N     . LYS F 3 275 ? 58.001 57.397  50.768 1.00 49.24  ? 275  LYS B N     1 
ATOM   6137 C  CA    . LYS F 3 275 ? 56.767 57.786  51.446 1.00 48.72  ? 275  LYS B CA    1 
ATOM   6138 C  C     . LYS F 3 275 ? 55.685 58.307  50.499 1.00 48.07  ? 275  LYS B C     1 
ATOM   6139 O  O     . LYS F 3 275 ? 54.498 58.190  50.794 1.00 47.43  ? 275  LYS B O     1 
ATOM   6140 C  CB    . LYS F 3 275 ? 57.049 58.842  52.519 1.00 48.74  ? 275  LYS B CB    1 
ATOM   6141 C  CG    . LYS F 3 275 ? 58.089 58.433  53.562 1.00 50.21  ? 275  LYS B CG    1 
ATOM   6142 C  CD    . LYS F 3 275 ? 57.990 59.286  54.840 1.00 50.20  ? 275  LYS B CD    1 
ATOM   6143 C  CE    . LYS F 3 275 ? 57.755 60.771  54.541 1.00 49.52  ? 275  LYS B CE    1 
ATOM   6144 N  NZ    . LYS F 3 275 ? 57.714 61.628  55.772 1.00 46.19  ? 275  LYS B NZ    1 
ATOM   6145 N  N     . LEU F 3 276 ? 56.087 58.888  49.371 1.00 47.36  ? 276  LEU B N     1 
ATOM   6146 C  CA    . LEU F 3 276 ? 55.124 59.405  48.400 1.00 47.18  ? 276  LEU B CA    1 
ATOM   6147 C  C     . LEU F 3 276 ? 54.196 58.292  47.942 1.00 48.53  ? 276  LEU B C     1 
ATOM   6148 O  O     . LEU F 3 276 ? 52.986 58.486  47.827 1.00 46.29  ? 276  LEU B O     1 
ATOM   6149 C  CB    . LEU F 3 276 ? 55.850 60.002  47.198 1.00 44.67  ? 276  LEU B CB    1 
ATOM   6150 C  CG    . LEU F 3 276 ? 56.413 61.389  47.495 1.00 43.56  ? 276  LEU B CG    1 
ATOM   6151 C  CD1   . LEU F 3 276 ? 57.516 61.732  46.514 1.00 42.75  ? 276  LEU B CD1   1 
ATOM   6152 C  CD2   . LEU F 3 276 ? 55.279 62.404  47.451 1.00 41.46  ? 276  LEU B CD2   1 
ATOM   6153 N  N     . ASP F 3 277 ? 54.787 57.131  47.676 1.00 51.37  ? 277  ASP B N     1 
ATOM   6154 C  CA    . ASP F 3 277 ? 54.052 55.949  47.254 1.00 53.34  ? 277  ASP B CA    1 
ATOM   6155 C  C     . ASP F 3 277 ? 52.917 56.219  46.271 1.00 52.88  ? 277  ASP B C     1 
ATOM   6156 O  O     . ASP F 3 277 ? 51.784 56.491  46.671 1.00 54.44  ? 277  ASP B O     1 
ATOM   6157 C  CB    . ASP F 3 277 ? 53.490 55.237  48.482 1.00 56.45  ? 277  ASP B CB    1 
ATOM   6158 C  CG    . ASP F 3 277 ? 52.671 54.015  48.120 1.00 60.28  ? 277  ASP B CG    1 
ATOM   6159 O  OD1   . ASP F 3 277 ? 53.263 53.024  47.632 1.00 61.36  ? 277  ASP B OD1   1 
ATOM   6160 O  OD2   . ASP F 3 277 ? 51.436 54.050  48.318 1.00 62.33  ? 277  ASP B OD2   1 
ATOM   6161 N  N     . LYS F 3 278 ? 53.229 56.126  44.985 1.00 51.01  ? 278  LYS B N     1 
ATOM   6162 C  CA    . LYS F 3 278 ? 52.250 56.328  43.919 1.00 50.53  ? 278  LYS B CA    1 
ATOM   6163 C  C     . LYS F 3 278 ? 51.848 57.787  43.705 1.00 47.70  ? 278  LYS B C     1 
ATOM   6164 O  O     . LYS F 3 278 ? 51.458 58.167  42.601 1.00 47.61  ? 278  LYS B O     1 
ATOM   6165 C  CB    . LYS F 3 278 ? 50.999 55.468  44.166 1.00 52.30  ? 278  LYS B CB    1 
ATOM   6166 C  CG    . LYS F 3 278 ? 51.292 54.063  44.714 1.00 54.99  ? 278  LYS B CG    1 
ATOM   6167 C  CD    . LYS F 3 278 ? 52.391 53.342  43.930 1.00 57.66  ? 278  LYS B CD    1 
ATOM   6168 C  CE    . LYS F 3 278 ? 52.905 52.123  44.698 1.00 59.75  ? 278  LYS B CE    1 
ATOM   6169 N  NZ    . LYS F 3 278 ? 54.111 51.504  44.067 1.00 60.72  ? 278  LYS B NZ    1 
ATOM   6170 N  N     . ARG F 3 279 ? 51.931 58.607  44.745 1.00 45.20  ? 279  ARG B N     1 
ATOM   6171 C  CA    . ARG F 3 279 ? 51.588 60.019  44.590 1.00 43.12  ? 279  ARG B CA    1 
ATOM   6172 C  C     . ARG F 3 279 ? 52.704 60.723  43.836 1.00 40.19  ? 279  ARG B C     1 
ATOM   6173 O  O     . ARG F 3 279 ? 53.874 60.566  44.175 1.00 39.95  ? 279  ARG B O     1 
ATOM   6174 C  CB    . ARG F 3 279 ? 51.394 60.683  45.950 1.00 45.09  ? 279  ARG B CB    1 
ATOM   6175 C  CG    . ARG F 3 279 ? 49.984 60.565  46.480 1.00 48.76  ? 279  ARG B CG    1 
ATOM   6176 C  CD    . ARG F 3 279 ? 49.898 61.051  47.904 1.00 50.77  ? 279  ARG B CD    1 
ATOM   6177 N  NE    . ARG F 3 279 ? 50.738 60.229  48.763 1.00 54.85  ? 279  ARG B NE    1 
ATOM   6178 C  CZ    . ARG F 3 279 ? 50.763 60.321  50.085 1.00 57.05  ? 279  ARG B CZ    1 
ATOM   6179 N  NH1   . ARG F 3 279 ? 49.988 61.206  50.701 1.00 57.69  ? 279  ARG B NH1   1 
ATOM   6180 N  NH2   . ARG F 3 279 ? 51.564 59.530  50.789 1.00 58.32  ? 279  ARG B NH2   1 
ATOM   6181 N  N     . ILE F 3 280 ? 52.346 61.497  42.815 1.00 37.58  ? 280  ILE B N     1 
ATOM   6182 C  CA    . ILE F 3 280 ? 53.349 62.206  42.024 1.00 35.83  ? 280  ILE B CA    1 
ATOM   6183 C  C     . ILE F 3 280 ? 53.313 63.704  42.286 1.00 34.10  ? 280  ILE B C     1 
ATOM   6184 O  O     . ILE F 3 280 ? 52.310 64.365  42.019 1.00 34.68  ? 280  ILE B O     1 
ATOM   6185 C  CB    . ILE F 3 280 ? 53.146 61.966  40.513 1.00 35.73  ? 280  ILE B CB    1 
ATOM   6186 C  CG1   . ILE F 3 280 ? 53.129 60.463  40.219 1.00 36.88  ? 280  ILE B CG1   1 
ATOM   6187 C  CG2   . ILE F 3 280 ? 54.249 62.640  39.727 1.00 34.85  ? 280  ILE B CG2   1 
ATOM   6188 C  CD1   . ILE F 3 280 ? 54.357 59.724  40.711 1.00 39.99  ? 280  ILE B CD1   1 
ATOM   6189 N  N     . PRO F 3 281 ? 54.417 64.263  42.805 1.00 31.80  ? 281  PRO B N     1 
ATOM   6190 C  CA    . PRO F 3 281 ? 54.503 65.698  43.104 1.00 31.63  ? 281  PRO B CA    1 
ATOM   6191 C  C     . PRO F 3 281 ? 54.941 66.536  41.903 1.00 30.31  ? 281  PRO B C     1 
ATOM   6192 O  O     . PRO F 3 281 ? 55.759 66.091  41.093 1.00 28.90  ? 281  PRO B O     1 
ATOM   6193 C  CB    . PRO F 3 281 ? 55.547 65.742  44.209 1.00 30.57  ? 281  PRO B CB    1 
ATOM   6194 C  CG    . PRO F 3 281 ? 56.539 64.719  43.709 1.00 32.35  ? 281  PRO B CG    1 
ATOM   6195 C  CD    . PRO F 3 281 ? 55.631 63.563  43.265 1.00 29.86  ? 281  PRO B CD    1 
ATOM   6196 N  N     . LYS F 3 282 ? 54.400 67.746  41.795 1.00 29.41  ? 282  LYS B N     1 
ATOM   6197 C  CA    . LYS F 3 282 ? 54.783 68.648  40.718 1.00 29.84  ? 282  LYS B CA    1 
ATOM   6198 C  C     . LYS F 3 282 ? 55.652 69.743  41.318 1.00 28.98  ? 282  LYS B C     1 
ATOM   6199 O  O     . LYS F 3 282 ? 56.294 70.496  40.597 1.00 31.41  ? 282  LYS B O     1 
ATOM   6200 C  CB    . LYS F 3 282 ? 53.555 69.272  40.042 1.00 30.61  ? 282  LYS B CB    1 
ATOM   6201 C  CG    . LYS F 3 282 ? 52.658 68.257  39.349 1.00 33.98  ? 282  LYS B CG    1 
ATOM   6202 C  CD    . LYS F 3 282 ? 51.708 68.902  38.334 1.00 37.15  ? 282  LYS B CD    1 
ATOM   6203 C  CE    . LYS F 3 282 ? 50.769 69.932  38.962 1.00 39.79  ? 282  LYS B CE    1 
ATOM   6204 N  NZ    . LYS F 3 282 ? 49.894 69.323  40.003 1.00 41.75  ? 282  LYS B NZ    1 
ATOM   6205 N  N     . ALA F 3 283 ? 55.681 69.816  42.647 1.00 28.02  ? 283  ALA B N     1 
ATOM   6206 C  CA    . ALA F 3 283 ? 56.476 70.830  43.342 1.00 27.67  ? 283  ALA B CA    1 
ATOM   6207 C  C     . ALA F 3 283 ? 57.452 70.224  44.340 1.00 26.91  ? 283  ALA B C     1 
ATOM   6208 O  O     . ALA F 3 283 ? 57.145 69.240  45.013 1.00 28.37  ? 283  ALA B O     1 
ATOM   6209 C  CB    . ALA F 3 283 ? 55.557 71.816  44.056 1.00 26.34  ? 283  ALA B CB    1 
ATOM   6210 N  N     . ILE F 3 284 ? 58.635 70.816  44.425 1.00 27.18  ? 284  ILE B N     1 
ATOM   6211 C  CA    . ILE F 3 284 ? 59.660 70.352  45.343 1.00 27.83  ? 284  ILE B CA    1 
ATOM   6212 C  C     . ILE F 3 284 ? 60.256 71.552  46.041 1.00 28.94  ? 284  ILE B C     1 
ATOM   6213 O  O     . ILE F 3 284 ? 60.542 72.568  45.400 1.00 29.53  ? 284  ILE B O     1 
ATOM   6214 C  CB    . ILE F 3 284 ? 60.811 69.610  44.616 1.00 26.88  ? 284  ILE B CB    1 
ATOM   6215 C  CG1   . ILE F 3 284 ? 61.893 69.203  45.630 1.00 29.18  ? 284  ILE B CG1   1 
ATOM   6216 C  CG2   . ILE F 3 284 ? 61.425 70.506  43.557 1.00 28.71  ? 284  ILE B CG2   1 
ATOM   6217 C  CD1   . ILE F 3 284 ? 63.114 68.493  45.017 1.00 27.53  ? 284  ILE B CD1   1 
ATOM   6218 N  N     . HIS F 3 285 ? 60.437 71.445  47.351 1.00 27.96  ? 285  HIS B N     1 
ATOM   6219 C  CA    . HIS F 3 285 ? 61.037 72.534  48.108 1.00 28.86  ? 285  HIS B CA    1 
ATOM   6220 C  C     . HIS F 3 285 ? 62.211 71.992  48.899 1.00 27.77  ? 285  HIS B C     1 
ATOM   6221 O  O     . HIS F 3 285 ? 62.101 70.942  49.523 1.00 26.37  ? 285  HIS B O     1 
ATOM   6222 C  CB    . HIS F 3 285 ? 60.043 73.138  49.101 1.00 31.18  ? 285  HIS B CB    1 
ATOM   6223 C  CG    . HIS F 3 285 ? 58.859 73.788  48.468 1.00 34.45  ? 285  HIS B CG    1 
ATOM   6224 N  ND1   . HIS F 3 285 ? 57.825 73.070  47.908 1.00 37.90  ? 285  HIS B ND1   1 
ATOM   6225 C  CD2   . HIS F 3 285 ? 58.529 75.095  48.335 1.00 37.39  ? 285  HIS B CD2   1 
ATOM   6226 C  CE1   . HIS F 3 285 ? 56.905 73.905  47.458 1.00 38.17  ? 285  HIS B CE1   1 
ATOM   6227 N  NE2   . HIS F 3 285 ? 57.308 75.140  47.705 1.00 40.39  ? 285  HIS B NE2   1 
ATOM   6228 N  N     . VAL F 3 286 ? 63.341 72.689  48.852 1.00 27.78  ? 286  VAL B N     1 
ATOM   6229 C  CA    . VAL F 3 286 ? 64.492 72.280  49.638 1.00 26.52  ? 286  VAL B CA    1 
ATOM   6230 C  C     . VAL F 3 286 ? 64.333 73.109  50.896 1.00 27.86  ? 286  VAL B C     1 
ATOM   6231 O  O     . VAL F 3 286 ? 64.101 74.310  50.821 1.00 28.05  ? 286  VAL B O     1 
ATOM   6232 C  CB    . VAL F 3 286 ? 65.824 72.617  48.956 1.00 27.32  ? 286  VAL B CB    1 
ATOM   6233 C  CG1   . VAL F 3 286 ? 66.970 72.370  49.918 1.00 23.38  ? 286  VAL B CG1   1 
ATOM   6234 C  CG2   . VAL F 3 286 ? 66.005 71.730  47.729 1.00 28.47  ? 286  VAL B CG2   1 
ATOM   6235 N  N     . VAL F 3 287 ? 64.430 72.465  52.051 1.00 28.92  ? 287  VAL B N     1 
ATOM   6236 C  CA    . VAL F 3 287 ? 64.257 73.153  53.318 1.00 28.03  ? 287  VAL B CA    1 
ATOM   6237 C  C     . VAL F 3 287 ? 65.511 73.065  54.153 1.00 28.74  ? 287  VAL B C     1 
ATOM   6238 O  O     . VAL F 3 287 ? 66.033 71.978  54.399 1.00 28.45  ? 287  VAL B O     1 
ATOM   6239 C  CB    . VAL F 3 287 ? 63.076 72.546  54.108 1.00 29.43  ? 287  VAL B CB    1 
ATOM   6240 C  CG1   . VAL F 3 287 ? 62.910 73.261  55.441 1.00 29.75  ? 287  VAL B CG1   1 
ATOM   6241 C  CG2   . VAL F 3 287 ? 61.797 72.671  53.292 1.00 30.18  ? 287  VAL B CG2   1 
ATOM   6242 N  N     . ALA F 3 288 ? 65.992 74.219  54.593 1.00 28.45  ? 288  ALA B N     1 
ATOM   6243 C  CA    . ALA F 3 288 ? 67.192 74.268  55.403 1.00 30.19  ? 288  ALA B CA    1 
ATOM   6244 C  C     . ALA F 3 288 ? 66.966 74.953  56.754 1.00 31.54  ? 288  ALA B C     1 
ATOM   6245 O  O     . ALA F 3 288 ? 66.341 76.016  56.846 1.00 32.02  ? 288  ALA B O     1 
ATOM   6246 C  CB    . ALA F 3 288 ? 68.305 74.978  54.634 1.00 30.01  ? 288  ALA B CB    1 
ATOM   6247 N  N     . VAL F 3 289 ? 67.463 74.313  57.803 1.00 32.71  ? 289  VAL B N     1 
ATOM   6248 C  CA    . VAL F 3 289 ? 67.385 74.852  59.154 1.00 34.90  ? 289  VAL B CA    1 
ATOM   6249 C  C     . VAL F 3 289 ? 68.816 75.296  59.432 1.00 35.68  ? 289  VAL B C     1 
ATOM   6250 O  O     . VAL F 3 289 ? 69.737 74.478  59.418 1.00 35.46  ? 289  VAL B O     1 
ATOM   6251 C  CB    . VAL F 3 289 ? 66.988 73.775  60.178 1.00 34.23  ? 289  VAL B CB    1 
ATOM   6252 C  CG1   . VAL F 3 289 ? 66.941 74.382  61.565 1.00 37.78  ? 289  VAL B CG1   1 
ATOM   6253 C  CG2   . VAL F 3 289 ? 65.631 73.183  59.816 1.00 37.27  ? 289  VAL B CG2   1 
ATOM   6254 N  N     . THR F 3 290 ? 69.004 76.590  59.652 1.00 38.32  ? 290  THR B N     1 
ATOM   6255 C  CA    . THR F 3 290 ? 70.335 77.128  59.903 1.00 42.04  ? 290  THR B CA    1 
ATOM   6256 C  C     . THR F 3 290 ? 70.811 76.759  61.302 1.00 44.88  ? 290  THR B C     1 
ATOM   6257 O  O     . THR F 3 290 ? 70.040 76.232  62.104 1.00 44.85  ? 290  THR B O     1 
ATOM   6258 C  CB    . THR F 3 290 ? 70.342 78.653  59.744 1.00 42.74  ? 290  THR B CB    1 
ATOM   6259 O  OG1   . THR F 3 290 ? 69.301 79.221  60.548 1.00 44.06  ? 290  THR B OG1   1 
ATOM   6260 C  CG2   . THR F 3 290 ? 70.113 79.037  58.286 1.00 42.41  ? 290  THR B CG2   1 
ATOM   6261 N  N     . GLU F 3 291 ? 72.083 77.022  61.591 1.00 48.04  ? 291  GLU B N     1 
ATOM   6262 C  CA    . GLU F 3 291 ? 72.638 76.699  62.904 1.00 50.03  ? 291  GLU B CA    1 
ATOM   6263 C  C     . GLU F 3 291 ? 71.954 77.447  64.046 1.00 50.02  ? 291  GLU B C     1 
ATOM   6264 O  O     . GLU F 3 291 ? 71.899 76.945  65.167 1.00 49.90  ? 291  GLU B O     1 
ATOM   6265 C  CB    . GLU F 3 291 ? 74.145 76.967  62.934 1.00 51.77  ? 291  GLU B CB    1 
ATOM   6266 C  CG    . GLU F 3 291 ? 74.557 78.333  62.431 1.00 55.25  ? 291  GLU B CG    1 
ATOM   6267 C  CD    . GLU F 3 291 ? 76.051 78.570  62.581 1.00 58.94  ? 291  GLU B CD    1 
ATOM   6268 O  OE1   . GLU F 3 291 ? 76.593 79.401  61.817 1.00 60.32  ? 291  GLU B OE1   1 
ATOM   6269 O  OE2   . GLU F 3 291 ? 76.676 77.931  63.465 1.00 57.50  ? 291  GLU B OE2   1 
ATOM   6270 N  N     . ASP F 3 292 ? 71.441 78.645  63.773 1.00 50.66  ? 292  ASP B N     1 
ATOM   6271 C  CA    . ASP F 3 292 ? 70.746 79.406  64.804 1.00 51.42  ? 292  ASP B CA    1 
ATOM   6272 C  C     . ASP F 3 292 ? 69.286 78.946  64.804 1.00 50.54  ? 292  ASP B C     1 
ATOM   6273 O  O     . ASP F 3 292 ? 68.396 79.624  65.312 1.00 50.13  ? 292  ASP B O     1 
ATOM   6274 C  CB    . ASP F 3 292 ? 70.843 80.908  64.529 1.00 54.73  ? 292  ASP B CB    1 
ATOM   6275 C  CG    . ASP F 3 292 ? 70.085 81.324  63.290 1.00 58.82  ? 292  ASP B CG    1 
ATOM   6276 O  OD1   . ASP F 3 292 ? 70.376 80.785  62.202 1.00 62.14  ? 292  ASP B OD1   1 
ATOM   6277 O  OD2   . ASP F 3 292 ? 69.197 82.194  63.403 1.00 61.28  ? 292  ASP B OD2   1 
ATOM   6278 N  N     . LEU F 3 293 ? 69.069 77.779  64.199 1.00 49.17  ? 293  LEU B N     1 
ATOM   6279 C  CA    . LEU F 3 293 ? 67.758 77.123  64.099 1.00 48.29  ? 293  LEU B CA    1 
ATOM   6280 C  C     . LEU F 3 293 ? 66.646 77.816  63.306 1.00 47.58  ? 293  LEU B C     1 
ATOM   6281 O  O     . LEU F 3 293 ? 65.470 77.553  63.557 1.00 47.36  ? 293  LEU B O     1 
ATOM   6282 C  CB    . LEU F 3 293 ? 67.261 76.807  65.514 1.00 49.84  ? 293  LEU B CB    1 
ATOM   6283 C  CG    . LEU F 3 293 ? 68.186 75.926  66.361 1.00 49.89  ? 293  LEU B CG    1 
ATOM   6284 C  CD1   . LEU F 3 293 ? 67.382 75.345  67.505 1.00 51.22  ? 293  LEU B CD1   1 
ATOM   6285 C  CD2   . LEU F 3 293 ? 68.770 74.800  65.519 1.00 49.12  ? 293  LEU B CD2   1 
ATOM   6286 N  N     . ASP F 3 294 ? 67.016 78.632  62.322 1.00 47.04  ? 294  ASP B N     1 
ATOM   6287 C  CA    . ASP F 3 294 ? 66.045 79.379  61.543 1.00 46.06  ? 294  ASP B CA    1 
ATOM   6288 C  C     . ASP F 3 294 ? 65.538 78.581  60.329 1.00 44.39  ? 294  ASP B C     1 
ATOM   6289 O  O     . ASP F 3 294 ? 66.174 77.570  60.038 1.00 43.15  ? 294  ASP B O     1 
ATOM   6290 C  CB    . ASP F 3 294 ? 66.726 80.715  61.131 1.00 42.62  ? 294  ASP B CB    1 
ATOM   6291 C  CG    . ASP F 3 294 ? 65.766 81.737  60.613 1.00 43.33  ? 294  ASP B CG    1 
ATOM   6292 O  OD1   . ASP F 3 294 ? 64.673 81.347  60.193 1.00 38.61  ? 294  ASP B OD1   1 
ATOM   6293 O  OD2   . ASP F 3 294 ? 66.089 82.940  60.599 1.00 39.97  ? 294  ASP B OD2   1 
ATOM   6294 N  N     . ILE F 3 295 ? 64.495 78.954  59.633 1.00 42.73  ? 295  ILE B N     1 
ATOM   6295 C  CA    . ILE F 3 295 ? 64.211 78.015  58.553 1.00 42.61  ? 295  ILE B CA    1 
ATOM   6296 C  C     . ILE F 3 295 ? 64.174 78.761  57.250 1.00 41.82  ? 295  ILE B C     1 
ATOM   6297 O  O     . ILE F 3 295 ? 63.482 79.768  57.167 1.00 42.61  ? 295  ILE B O     1 
ATOM   6298 C  CB    . ILE F 3 295 ? 62.893 77.298  58.764 1.00 42.16  ? 295  ILE B CB    1 
ATOM   6299 C  CG1   . ILE F 3 295 ? 62.959 76.403  59.997 1.00 42.68  ? 295  ILE B CG1   1 
ATOM   6300 C  CG2   . ILE F 3 295 ? 62.503 76.513  57.534 1.00 42.01  ? 295  ILE B CG2   1 
ATOM   6301 C  CD1   . ILE F 3 295 ? 61.657 75.696  60.285 1.00 45.73  ? 295  ILE B CD1   1 
ATOM   6302 N  N     . VAL F 3 296 ? 64.895 78.274  56.243 1.00 39.67  ? 296  VAL B N     1 
ATOM   6303 C  CA    . VAL F 3 296 ? 64.913 78.895  54.927 1.00 37.61  ? 296  VAL B CA    1 
ATOM   6304 C  C     . VAL F 3 296 ? 64.487 77.835  53.916 1.00 35.09  ? 296  VAL B C     1 
ATOM   6305 O  O     . VAL F 3 296 ? 64.772 76.657  54.097 1.00 35.52  ? 296  VAL B O     1 
ATOM   6306 C  CB    . VAL F 3 296 ? 66.333 79.384  54.560 1.00 37.97  ? 296  VAL B CB    1 
ATOM   6307 C  CG1   . VAL F 3 296 ? 66.365 79.867  53.127 1.00 40.12  ? 296  VAL B CG1   1 
ATOM   6308 C  CG2   . VAL F 3 296 ? 66.755 80.510  55.490 1.00 41.04  ? 296  VAL B CG2   1 
ATOM   6309 N  N     . SER F 3 297 ? 63.796 78.234  52.857 1.00 33.28  ? 297  SER B N     1 
ATOM   6310 C  CA    . SER F 3 297 ? 63.401 77.255  51.864 1.00 31.82  ? 297  SER B CA    1 
ATOM   6311 C  C     . SER F 3 297 ? 63.296 77.845  50.471 1.00 31.46  ? 297  SER B C     1 
ATOM   6312 O  O     . SER F 3 297 ? 62.937 79.011  50.295 1.00 32.06  ? 297  SER B O     1 
ATOM   6313 C  CB    . SER F 3 297 ? 62.072 76.610  52.241 1.00 33.61  ? 297  SER B CB    1 
ATOM   6314 O  OG    . SER F 3 297 ? 61.014 77.539  52.121 1.00 37.22  ? 297  SER B OG    1 
ATOM   6315 N  N     . ARG F 3 298 ? 63.623 77.021  49.484 1.00 28.88  ? 298  ARG B N     1 
ATOM   6316 C  CA    . ARG F 3 298 ? 63.562 77.421  48.087 1.00 28.76  ? 298  ARG B CA    1 
ATOM   6317 C  C     . ARG F 3 298 ? 62.909 76.279  47.332 1.00 27.76  ? 298  ARG B C     1 
ATOM   6318 O  O     . ARG F 3 298 ? 63.344 75.127  47.422 1.00 26.19  ? 298  ARG B O     1 
ATOM   6319 C  CB    . ARG F 3 298 ? 64.966 77.680  47.542 1.00 28.86  ? 298  ARG B CB    1 
ATOM   6320 C  CG    . ARG F 3 298 ? 65.651 78.902  48.144 1.00 31.24  ? 298  ARG B CG    1 
ATOM   6321 C  CD    . ARG F 3 298 ? 64.911 80.181  47.788 1.00 32.00  ? 298  ARG B CD    1 
ATOM   6322 N  NE    . ARG F 3 298 ? 65.617 81.369  48.268 1.00 34.90  ? 298  ARG B NE    1 
ATOM   6323 C  CZ    . ARG F 3 298 ? 65.555 81.836  49.514 1.00 36.97  ? 298  ARG B CZ    1 
ATOM   6324 N  NH1   . ARG F 3 298 ? 64.811 81.227  50.432 1.00 36.61  ? 298  ARG B NH1   1 
ATOM   6325 N  NH2   . ARG F 3 298 ? 66.252 82.911  49.846 1.00 37.73  ? 298  ARG B NH2   1 
ATOM   6326 N  N     . GLY F 3 299 ? 61.856 76.595  46.595 1.00 25.74  ? 299  GLY B N     1 
ATOM   6327 C  CA    . GLY F 3 299 ? 61.172 75.553  45.867 1.00 30.15  ? 299  GLY B CA    1 
ATOM   6328 C  C     . GLY F 3 299 ? 60.962 75.861  44.406 1.00 32.66  ? 299  GLY B C     1 
ATOM   6329 O  O     . GLY F 3 299 ? 61.267 76.956  43.934 1.00 31.42  ? 299  GLY B O     1 
ATOM   6330 N  N     . ARG F 3 300 ? 60.451 74.867  43.687 1.00 34.53  ? 300  ARG B N     1 
ATOM   6331 C  CA    . ARG F 3 300 ? 60.168 75.003  42.272 1.00 35.90  ? 300  ARG B CA    1 
ATOM   6332 C  C     . ARG F 3 300 ? 59.007 74.101  41.890 1.00 36.32  ? 300  ARG B C     1 
ATOM   6333 O  O     . ARG F 3 300 ? 58.903 72.959  42.351 1.00 35.52  ? 300  ARG B O     1 
ATOM   6334 C  CB    . ARG F 3 300 ? 61.388 74.640  41.421 1.00 39.94  ? 300  ARG B CB    1 
ATOM   6335 C  CG    . ARG F 3 300 ? 61.074 74.705  39.931 1.00 46.20  ? 300  ARG B CG    1 
ATOM   6336 C  CD    . ARG F 3 300 ? 62.256 74.398  39.047 1.00 50.50  ? 300  ARG B CD    1 
ATOM   6337 N  NE    . ARG F 3 300 ? 61.858 74.437  37.641 1.00 55.79  ? 300  ARG B NE    1 
ATOM   6338 C  CZ    . ARG F 3 300 ? 62.656 74.136  36.621 1.00 57.57  ? 300  ARG B CZ    1 
ATOM   6339 N  NH1   . ARG F 3 300 ? 63.914 73.769  36.837 1.00 58.92  ? 300  ARG B NH1   1 
ATOM   6340 N  NH2   . ARG F 3 300 ? 62.193 74.200  35.379 1.00 59.15  ? 300  ARG B NH2   1 
ATOM   6341 N  N     . THR F 3 301 ? 58.133 74.628  41.044 1.00 35.43  ? 301  THR B N     1 
ATOM   6342 C  CA    . THR F 3 301 ? 56.973 73.896  40.579 1.00 35.79  ? 301  THR B CA    1 
ATOM   6343 C  C     . THR F 3 301 ? 57.106 73.605  39.083 1.00 36.33  ? 301  THR B C     1 
ATOM   6344 O  O     . THR F 3 301 ? 57.509 74.468  38.305 1.00 35.43  ? 301  THR B O     1 
ATOM   6345 C  CB    . THR F 3 301 ? 55.707 74.710  40.830 1.00 37.24  ? 301  THR B CB    1 
ATOM   6346 O  OG1   . THR F 3 301 ? 55.676 75.102  42.207 1.00 37.42  ? 301  THR B OG1   1 
ATOM   6347 C  CG2   . THR F 3 301 ? 54.460 73.889  40.504 1.00 36.74  ? 301  THR B CG2   1 
ATOM   6348 N  N     . PHE F 3 302 ? 56.784 72.377  38.693 1.00 36.82  ? 302  PHE B N     1 
ATOM   6349 C  CA    . PHE F 3 302 ? 56.853 71.972  37.296 1.00 37.58  ? 302  PHE B CA    1 
ATOM   6350 C  C     . PHE F 3 302 ? 55.445 71.740  36.750 1.00 37.42  ? 302  PHE B C     1 
ATOM   6351 O  O     . PHE F 3 302 ? 54.509 71.485  37.511 1.00 36.90  ? 302  PHE B O     1 
ATOM   6352 C  CB    . PHE F 3 302 ? 57.653 70.674  37.139 1.00 36.11  ? 302  PHE B CB    1 
ATOM   6353 C  CG    . PHE F 3 302 ? 59.080 70.774  37.588 1.00 37.07  ? 302  PHE B CG    1 
ATOM   6354 C  CD1   . PHE F 3 302 ? 59.406 70.738  38.941 1.00 36.32  ? 302  PHE B CD1   1 
ATOM   6355 C  CD2   . PHE F 3 302 ? 60.107 70.902  36.656 1.00 36.15  ? 302  PHE B CD2   1 
ATOM   6356 C  CE1   . PHE F 3 302 ? 60.734 70.827  39.358 1.00 35.41  ? 302  PHE B CE1   1 
ATOM   6357 C  CE2   . PHE F 3 302 ? 61.436 70.990  37.064 1.00 36.27  ? 302  PHE B CE2   1 
ATOM   6358 C  CZ    . PHE F 3 302 ? 61.749 70.953  38.418 1.00 35.58  ? 302  PHE B CZ    1 
ATOM   6359 N  N     . PRO F 3 303 ? 55.277 71.841  35.421 1.00 37.33  ? 303  PRO B N     1 
ATOM   6360 C  CA    . PRO F 3 303 ? 53.975 71.629  34.782 1.00 36.77  ? 303  PRO B CA    1 
ATOM   6361 C  C     . PRO F 3 303 ? 53.752 70.138  34.625 1.00 36.30  ? 303  PRO B C     1 
ATOM   6362 O  O     . PRO F 3 303 ? 52.808 69.702  33.973 1.00 38.94  ? 303  PRO B O     1 
ATOM   6363 C  CB    . PRO F 3 303 ? 54.131 72.337  33.443 1.00 36.56  ? 303  PRO B CB    1 
ATOM   6364 C  CG    . PRO F 3 303 ? 55.579 72.123  33.137 1.00 37.29  ? 303  PRO B CG    1 
ATOM   6365 C  CD    . PRO F 3 303 ? 56.244 72.401  34.460 1.00 36.89  ? 303  PRO B CD    1 
ATOM   6366 N  N     . HIS F 3 304 ? 54.643 69.362  35.233 1.00 35.00  ? 304  HIS B N     1 
ATOM   6367 C  CA    . HIS F 3 304 ? 54.579 67.910  35.188 1.00 32.10  ? 304  HIS B CA    1 
ATOM   6368 C  C     . HIS F 3 304 ? 55.049 67.328  36.510 1.00 32.69  ? 304  HIS B C     1 
ATOM   6369 O  O     . HIS F 3 304 ? 55.584 68.041  37.360 1.00 31.30  ? 304  HIS B O     1 
ATOM   6370 C  CB    . HIS F 3 304 ? 55.473 67.370  34.076 1.00 29.96  ? 304  HIS B CB    1 
ATOM   6371 C  CG    . HIS F 3 304 ? 56.910 67.763  34.214 1.00 29.82  ? 304  HIS B CG    1 
ATOM   6372 N  ND1   . HIS F 3 304 ? 57.439 68.883  33.609 1.00 32.98  ? 304  HIS B ND1   1 
ATOM   6373 C  CD2   . HIS F 3 304 ? 57.927 67.195  34.902 1.00 29.68  ? 304  HIS B CD2   1 
ATOM   6374 C  CE1   . HIS F 3 304 ? 58.720 68.988  33.916 1.00 29.08  ? 304  HIS B CE1   1 
ATOM   6375 N  NE2   . HIS F 3 304 ? 59.040 67.975  34.700 1.00 32.79  ? 304  HIS B NE2   1 
ATOM   6376 N  N     . GLY F 3 305 ? 54.854 66.022  36.670 1.00 33.21  ? 305  GLY B N     1 
ATOM   6377 C  CA    . GLY F 3 305 ? 55.276 65.356  37.886 1.00 32.93  ? 305  GLY B CA    1 
ATOM   6378 C  C     . GLY F 3 305 ? 56.789 65.339  37.960 1.00 32.63  ? 305  GLY B C     1 
ATOM   6379 O  O     . GLY F 3 305 ? 57.468 65.454  36.935 1.00 30.15  ? 305  GLY B O     1 
ATOM   6380 N  N     . ILE F 3 306 ? 57.322 65.190  39.167 1.00 30.55  ? 306  ILE B N     1 
ATOM   6381 C  CA    . ILE F 3 306 ? 58.768 65.174  39.353 1.00 29.52  ? 306  ILE B CA    1 
ATOM   6382 C  C     . ILE F 3 306 ? 59.291 63.758  39.538 1.00 29.45  ? 306  ILE B C     1 
ATOM   6383 O  O     . ILE F 3 306 ? 58.860 63.047  40.443 1.00 29.79  ? 306  ILE B O     1 
ATOM   6384 C  CB    . ILE F 3 306 ? 59.165 66.038  40.579 1.00 29.27  ? 306  ILE B CB    1 
ATOM   6385 C  CG1   . ILE F 3 306 ? 58.703 67.484  40.352 1.00 29.36  ? 306  ILE B CG1   1 
ATOM   6386 C  CG2   . ILE F 3 306 ? 60.668 65.975  40.810 1.00 25.94  ? 306  ILE B CG2   1 
ATOM   6387 C  CD1   . ILE F 3 306 ? 59.063 68.464  41.486 1.00 28.90  ? 306  ILE B CD1   1 
ATOM   6388 N  N     . SER F 3 307 ? 60.203 63.338  38.666 1.00 30.99  ? 307  SER B N     1 
ATOM   6389 C  CA    . SER F 3 307 ? 60.794 62.005  38.776 1.00 30.81  ? 307  SER B CA    1 
ATOM   6390 C  C     . SER F 3 307 ? 61.860 62.119  39.848 1.00 31.95  ? 307  SER B C     1 
ATOM   6391 O  O     . SER F 3 307 ? 62.328 63.218  40.135 1.00 32.60  ? 307  SER B O     1 
ATOM   6392 C  CB    . SER F 3 307 ? 61.461 61.586  37.465 1.00 30.30  ? 307  SER B CB    1 
ATOM   6393 O  OG    . SER F 3 307 ? 62.607 62.381  37.207 1.00 28.32  ? 307  SER B OG    1 
ATOM   6394 N  N     . LYS F 3 308 ? 62.254 60.995  40.433 1.00 34.27  ? 308  LYS B N     1 
ATOM   6395 C  CA    . LYS F 3 308 ? 63.275 61.028  41.472 1.00 36.63  ? 308  LYS B CA    1 
ATOM   6396 C  C     . LYS F 3 308 ? 64.564 61.634  40.924 1.00 36.25  ? 308  LYS B C     1 
ATOM   6397 O  O     . LYS F 3 308 ? 65.290 62.331  41.638 1.00 34.52  ? 308  LYS B O     1 
ATOM   6398 C  CB    . LYS F 3 308 ? 63.559 59.619  42.002 1.00 38.88  ? 308  LYS B CB    1 
ATOM   6399 C  CG    . LYS F 3 308 ? 64.528 59.601  43.181 1.00 41.96  ? 308  LYS B CG    1 
ATOM   6400 C  CD    . LYS F 3 308 ? 65.092 58.214  43.445 1.00 46.04  ? 308  LYS B CD    1 
ATOM   6401 C  CE    . LYS F 3 308 ? 64.009 57.222  43.842 1.00 48.62  ? 308  LYS B CE    1 
ATOM   6402 N  NZ    . LYS F 3 308 ? 64.574 55.850  44.020 1.00 50.44  ? 308  LYS B NZ    1 
ATOM   6403 N  N     . GLU F 3 309 ? 64.849 61.379  39.653 1.00 34.42  ? 309  GLU B N     1 
ATOM   6404 C  CA    . GLU F 3 309 ? 66.065 61.913  39.069 1.00 34.04  ? 309  GLU B CA    1 
ATOM   6405 C  C     . GLU F 3 309 ? 65.987 63.435  38.939 1.00 32.67  ? 309  GLU B C     1 
ATOM   6406 O  O     . GLU F 3 309 ? 66.997 64.133  39.063 1.00 31.36  ? 309  GLU B O     1 
ATOM   6407 C  CB    . GLU F 3 309 ? 66.338 61.253  37.715 1.00 37.27  ? 309  GLU B CB    1 
ATOM   6408 C  CG    . GLU F 3 309 ? 66.617 59.740  37.792 1.00 40.59  ? 309  GLU B CG    1 
ATOM   6409 C  CD    . GLU F 3 309 ? 65.346 58.885  37.937 1.00 46.03  ? 309  GLU B CD    1 
ATOM   6410 O  OE1   . GLU F 3 309 ? 64.222 59.449  37.913 1.00 44.28  ? 309  GLU B OE1   1 
ATOM   6411 O  OE2   . GLU F 3 309 ? 65.475 57.639  38.066 1.00 46.67  ? 309  GLU B OE2   1 
ATOM   6412 N  N     . THR F 3 310 ? 64.792 63.959  38.692 1.00 30.88  ? 310  THR B N     1 
ATOM   6413 C  CA    . THR F 3 310 ? 64.633 65.405  38.599 1.00 29.97  ? 310  THR B CA    1 
ATOM   6414 C  C     . THR F 3 310 ? 64.730 66.010  40.008 1.00 29.10  ? 310  THR B C     1 
ATOM   6415 O  O     . THR F 3 310 ? 65.292 67.085  40.188 1.00 30.11  ? 310  THR B O     1 
ATOM   6416 C  CB    . THR F 3 310 ? 63.295 65.780  37.970 1.00 29.48  ? 310  THR B CB    1 
ATOM   6417 O  OG1   . THR F 3 310 ? 63.311 65.416  36.586 1.00 33.94  ? 310  THR B OG1   1 
ATOM   6418 C  CG2   . THR F 3 310 ? 63.047 67.278  38.084 1.00 29.44  ? 310  THR B CG2   1 
ATOM   6419 N  N     . ALA F 3 311 ? 64.185 65.318  41.005 1.00 27.72  ? 311  ALA B N     1 
ATOM   6420 C  CA    . ALA F 3 311 ? 64.259 65.805  42.384 1.00 29.58  ? 311  ALA B CA    1 
ATOM   6421 C  C     . ALA F 3 311 ? 65.737 65.953  42.744 1.00 29.70  ? 311  ALA B C     1 
ATOM   6422 O  O     . ALA F 3 311 ? 66.160 66.969  43.294 1.00 29.94  ? 311  ALA B O     1 
ATOM   6423 C  CB    . ALA F 3 311 ? 63.587 64.822  43.334 1.00 25.68  ? 311  ALA B CB    1 
ATOM   6424 N  N     . TYR F 3 312 ? 66.518 64.932  42.415 1.00 29.53  ? 312  TYR B N     1 
ATOM   6425 C  CA    . TYR F 3 312 ? 67.947 64.947  42.688 1.00 32.42  ? 312  TYR B CA    1 
ATOM   6426 C  C     . TYR F 3 312 ? 68.617 66.174  42.086 1.00 31.77  ? 312  TYR B C     1 
ATOM   6427 O  O     . TYR F 3 312 ? 69.274 66.932  42.792 1.00 31.13  ? 312  TYR B O     1 
ATOM   6428 C  CB    . TYR F 3 312 ? 68.609 63.686  42.126 1.00 35.84  ? 312  TYR B CB    1 
ATOM   6429 C  CG    . TYR F 3 312 ? 68.763 62.540  43.108 1.00 40.87  ? 312  TYR B CG    1 
ATOM   6430 C  CD1   . TYR F 3 312 ? 69.984 62.300  43.743 1.00 44.74  ? 312  TYR B CD1   1 
ATOM   6431 C  CD2   . TYR F 3 312 ? 67.703 61.676  43.378 1.00 43.91  ? 312  TYR B CD2   1 
ATOM   6432 C  CE1   . TYR F 3 312 ? 70.146 61.222  44.620 1.00 45.98  ? 312  TYR B CE1   1 
ATOM   6433 C  CE2   . TYR F 3 312 ? 67.850 60.596  44.255 1.00 46.29  ? 312  TYR B CE2   1 
ATOM   6434 C  CZ    . TYR F 3 312 ? 69.071 60.375  44.870 1.00 47.89  ? 312  TYR B CZ    1 
ATOM   6435 O  OH    . TYR F 3 312 ? 69.217 59.308  45.728 1.00 50.12  ? 312  TYR B OH    1 
ATOM   6436 N  N     . SER F 3 313 ? 68.439 66.382  40.783 1.00 31.44  ? 313  SER B N     1 
ATOM   6437 C  CA    . SER F 3 313 ? 69.075 67.516  40.121 1.00 32.01  ? 313  SER B CA    1 
ATOM   6438 C  C     . SER F 3 313 ? 68.532 68.875  40.545 1.00 29.74  ? 313  SER B C     1 
ATOM   6439 O  O     . SER F 3 313 ? 69.295 69.802  40.816 1.00 27.49  ? 313  SER B O     1 
ATOM   6440 C  CB    . SER F 3 313 ? 68.972 67.376  38.601 1.00 32.20  ? 313  SER B CB    1 
ATOM   6441 O  OG    . SER F 3 313 ? 67.629 67.506  38.178 1.00 40.53  ? 313  SER B OG    1 
ATOM   6442 N  N     . GLU F 3 314 ? 67.214 69.005  40.605 1.00 30.57  ? 314  GLU B N     1 
ATOM   6443 C  CA    . GLU F 3 314 ? 66.632 70.277  41.000 1.00 30.97  ? 314  GLU B CA    1 
ATOM   6444 C  C     . GLU F 3 314 ? 66.930 70.641  42.464 1.00 31.01  ? 314  GLU B C     1 
ATOM   6445 O  O     . GLU F 3 314 ? 67.109 71.817  42.787 1.00 31.64  ? 314  GLU B O     1 
ATOM   6446 C  CB    . GLU F 3 314 ? 65.121 70.259  40.770 1.00 30.04  ? 314  GLU B CB    1 
ATOM   6447 C  CG    . GLU F 3 314 ? 64.486 71.613  40.983 1.00 35.79  ? 314  GLU B CG    1 
ATOM   6448 C  CD    . GLU F 3 314 ? 64.996 72.664  39.995 1.00 39.42  ? 314  GLU B CD    1 
ATOM   6449 O  OE1   . GLU F 3 314 ? 65.021 73.856  40.368 1.00 41.06  ? 314  GLU B OE1   1 
ATOM   6450 O  OE2   . GLU F 3 314 ? 65.355 72.304  38.850 1.00 37.48  ? 314  GLU B OE2   1 
ATOM   6451 N  N     . SER F 3 315 ? 66.993 69.647  43.349 1.00 29.37  ? 315  SER B N     1 
ATOM   6452 C  CA    . SER F 3 315 ? 67.251 69.939  44.761 1.00 29.19  ? 315  SER B CA    1 
ATOM   6453 C  C     . SER F 3 315 ? 68.611 70.596  44.943 1.00 28.35  ? 315  SER B C     1 
ATOM   6454 O  O     . SER F 3 315 ? 68.777 71.467  45.791 1.00 29.35  ? 315  SER B O     1 
ATOM   6455 C  CB    . SER F 3 315 ? 67.175 68.667  45.620 1.00 27.44  ? 315  SER B CB    1 
ATOM   6456 O  OG    . SER F 3 315 ? 68.350 67.881  45.512 1.00 28.68  ? 315  SER B OG    1 
ATOM   6457 N  N     . VAL F 3 316 ? 69.587 70.182  44.147 1.00 28.98  ? 316  VAL B N     1 
ATOM   6458 C  CA    . VAL F 3 316 ? 70.916 70.763  44.249 1.00 29.37  ? 316  VAL B CA    1 
ATOM   6459 C  C     . VAL F 3 316 ? 70.886 72.229  43.822 1.00 31.49  ? 316  VAL B C     1 
ATOM   6460 O  O     . VAL F 3 316 ? 71.576 73.062  44.409 1.00 32.28  ? 316  VAL B O     1 
ATOM   6461 C  CB    . VAL F 3 316 ? 71.925 69.978  43.392 1.00 30.52  ? 316  VAL B CB    1 
ATOM   6462 C  CG1   . VAL F 3 316 ? 73.278 70.695  43.368 1.00 30.82  ? 316  VAL B CG1   1 
ATOM   6463 C  CG2   . VAL F 3 316 ? 72.092 68.580  43.967 1.00 30.32  ? 316  VAL B CG2   1 
ATOM   6464 N  N     . LYS F 3 317 ? 70.076 72.546  42.814 1.00 32.88  ? 317  LYS B N     1 
ATOM   6465 C  CA    . LYS F 3 317 ? 69.953 73.923  42.335 1.00 33.76  ? 317  LYS B CA    1 
ATOM   6466 C  C     . LYS F 3 317 ? 69.325 74.807  43.418 1.00 32.77  ? 317  LYS B C     1 
ATOM   6467 O  O     . LYS F 3 317 ? 69.779 75.922  43.672 1.00 31.61  ? 317  LYS B O     1 
ATOM   6468 C  CB    . LYS F 3 317 ? 69.076 73.980  41.080 1.00 36.27  ? 317  LYS B CB    1 
ATOM   6469 C  CG    . LYS F 3 317 ? 69.545 73.103  39.931 1.00 39.10  ? 317  LYS B CG    1 
ATOM   6470 C  CD    . LYS F 3 317 ? 68.712 73.336  38.668 1.00 42.64  ? 317  LYS B CD    1 
ATOM   6471 C  CE    . LYS F 3 317 ? 69.214 72.479  37.512 1.00 46.90  ? 317  LYS B CE    1 
ATOM   6472 N  NZ    . LYS F 3 317 ? 68.489 72.748  36.236 1.00 49.51  ? 317  LYS B NZ    1 
ATOM   6473 N  N     . LEU F 3 318 ? 68.273 74.302  44.054 1.00 31.32  ? 318  LEU B N     1 
ATOM   6474 C  CA    . LEU F 3 318 ? 67.587 75.054  45.099 1.00 29.34  ? 318  LEU B CA    1 
ATOM   6475 C  C     . LEU F 3 318 ? 68.492 75.222  46.312 1.00 29.52  ? 318  LEU B C     1 
ATOM   6476 O  O     . LEU F 3 318 ? 68.452 76.253  46.985 1.00 29.88  ? 318  LEU B O     1 
ATOM   6477 C  CB    . LEU F 3 318 ? 66.288 74.342  45.497 1.00 27.20  ? 318  LEU B CB    1 
ATOM   6478 C  CG    . LEU F 3 318 ? 65.230 74.225  44.394 1.00 25.83  ? 318  LEU B CG    1 
ATOM   6479 C  CD1   . LEU F 3 318 ? 64.136 73.274  44.822 1.00 25.27  ? 318  LEU B CD1   1 
ATOM   6480 C  CD2   . LEU F 3 318 ? 64.650 75.596  44.076 1.00 25.23  ? 318  LEU B CD2   1 
ATOM   6481 N  N     . LEU F 3 319 ? 69.306 74.206  46.591 1.00 30.06  ? 319  LEU B N     1 
ATOM   6482 C  CA    . LEU F 3 319 ? 70.235 74.261  47.718 1.00 30.87  ? 319  LEU B CA    1 
ATOM   6483 C  C     . LEU F 3 319 ? 71.291 75.328  47.437 1.00 31.74  ? 319  LEU B C     1 
ATOM   6484 O  O     . LEU F 3 319 ? 71.658 76.098  48.328 1.00 31.89  ? 319  LEU B O     1 
ATOM   6485 C  CB    . LEU F 3 319 ? 70.924 72.903  47.939 1.00 29.18  ? 319  LEU B CB    1 
ATOM   6486 C  CG    . LEU F 3 319 ? 72.131 72.903  48.890 1.00 26.72  ? 319  LEU B CG    1 
ATOM   6487 C  CD1   . LEU F 3 319 ? 71.742 73.562  50.204 1.00 28.48  ? 319  LEU B CD1   1 
ATOM   6488 C  CD2   . LEU F 3 319 ? 72.620 71.489  49.134 1.00 25.10  ? 319  LEU B CD2   1 
ATOM   6489 N  N     . GLN F 3 320 ? 71.776 75.376  46.200 1.00 32.01  ? 320  GLN B N     1 
ATOM   6490 C  CA    . GLN F 3 320 ? 72.783 76.369  45.849 1.00 33.77  ? 320  GLN B CA    1 
ATOM   6491 C  C     . GLN F 3 320 ? 72.192 77.763  45.958 1.00 34.92  ? 320  GLN B C     1 
ATOM   6492 O  O     . GLN F 3 320 ? 72.903 78.722  46.230 1.00 34.45  ? 320  GLN B O     1 
ATOM   6493 C  CB    . GLN F 3 320 ? 73.321 76.135  44.433 1.00 35.24  ? 320  GLN B CB    1 
ATOM   6494 C  CG    . GLN F 3 320 ? 74.239 74.919  44.326 1.00 37.30  ? 320  GLN B CG    1 
ATOM   6495 C  CD    . GLN F 3 320 ? 75.148 74.970  43.113 1.00 38.39  ? 320  GLN B CD    1 
ATOM   6496 O  OE1   . GLN F 3 320 ? 74.693 74.901  41.972 1.00 39.74  ? 320  GLN B OE1   1 
ATOM   6497 N  NE2   . GLN F 3 320 ? 76.444 75.098  43.357 1.00 39.21  ? 320  GLN B NE2   1 
ATOM   6498 N  N     . LYS F 3 321 ? 70.883 77.873  45.755 1.00 34.72  ? 321  LYS B N     1 
ATOM   6499 C  CA    . LYS F 3 321 ? 70.224 79.167  45.851 1.00 34.85  ? 321  LYS B CA    1 
ATOM   6500 C  C     . LYS F 3 321 ? 70.170 79.576  47.331 1.00 34.46  ? 321  LYS B C     1 
ATOM   6501 O  O     . LYS F 3 321 ? 70.306 80.751  47.682 1.00 33.23  ? 321  LYS B O     1 
ATOM   6502 C  CB    . LYS F 3 321 ? 68.819 79.083  45.250 1.00 36.67  ? 321  LYS B CB    1 
ATOM   6503 C  CG    . LYS F 3 321 ? 68.227 80.438  44.908 1.00 40.60  ? 321  LYS B CG    1 
ATOM   6504 C  CD    . LYS F 3 321 ? 66.834 80.321  44.312 1.00 44.06  ? 321  LYS B CD    1 
ATOM   6505 C  CE    . LYS F 3 321 ? 66.842 79.535  43.015 1.00 44.33  ? 321  LYS B CE    1 
ATOM   6506 N  NZ    . LYS F 3 321 ? 65.449 79.338  42.510 1.00 47.11  ? 321  LYS B NZ    1 
ATOM   6507 N  N     . ILE F 3 322 ? 69.989 78.593  48.204 1.00 33.83  ? 322  ILE B N     1 
ATOM   6508 C  CA    . ILE F 3 322 ? 69.954 78.871  49.629 1.00 33.79  ? 322  ILE B CA    1 
ATOM   6509 C  C     . ILE F 3 322 ? 71.335 79.308  50.098 1.00 32.98  ? 322  ILE B C     1 
ATOM   6510 O  O     . ILE F 3 322 ? 71.467 80.260  50.859 1.00 32.34  ? 322  ILE B O     1 
ATOM   6511 C  CB    . ILE F 3 322 ? 69.507 77.632  50.437 1.00 33.32  ? 322  ILE B CB    1 
ATOM   6512 C  CG1   . ILE F 3 322 ? 68.041 77.317  50.116 1.00 33.65  ? 322  ILE B CG1   1 
ATOM   6513 C  CG2   . ILE F 3 322 ? 69.702 77.883  51.935 1.00 31.96  ? 322  ILE B CG2   1 
ATOM   6514 C  CD1   . ILE F 3 322 ? 67.422 76.241  50.984 1.00 34.12  ? 322  ILE B CD1   1 
ATOM   6515 N  N     . LEU F 3 323 ? 72.364 78.608  49.642 1.00 34.55  ? 323  LEU B N     1 
ATOM   6516 C  CA    . LEU F 3 323 ? 73.730 78.941  50.020 1.00 36.29  ? 323  LEU B CA    1 
ATOM   6517 C  C     . LEU F 3 323 ? 74.134 80.345  49.575 1.00 38.06  ? 323  LEU B C     1 
ATOM   6518 O  O     . LEU F 3 323 ? 74.844 81.037  50.296 1.00 37.84  ? 323  LEU B O     1 
ATOM   6519 C  CB    . LEU F 3 323 ? 74.697 77.912  49.439 1.00 35.91  ? 323  LEU B CB    1 
ATOM   6520 C  CG    . LEU F 3 323 ? 75.244 76.852  50.399 1.00 36.58  ? 323  LEU B CG    1 
ATOM   6521 C  CD1   . LEU F 3 323 ? 74.293 76.625  51.551 1.00 37.15  ? 323  LEU B CD1   1 
ATOM   6522 C  CD2   . LEU F 3 323 ? 75.484 75.565  49.637 1.00 34.18  ? 323  LEU B CD2   1 
ATOM   6523 N  N     . GLU F 3 324 ? 73.684 80.768  48.397 1.00 39.26  ? 324  GLU B N     1 
ATOM   6524 C  CA    . GLU F 3 324 ? 74.023 82.102  47.906 1.00 41.60  ? 324  GLU B CA    1 
ATOM   6525 C  C     . GLU F 3 324 ? 73.292 83.187  48.683 1.00 42.16  ? 324  GLU B C     1 
ATOM   6526 O  O     . GLU F 3 324 ? 73.898 84.137  49.169 1.00 40.83  ? 324  GLU B O     1 
ATOM   6527 C  CB    . GLU F 3 324 ? 73.638 82.281  46.437 1.00 41.45  ? 324  GLU B CB    1 
ATOM   6528 C  CG    . GLU F 3 324 ? 74.359 81.423  45.437 1.00 45.59  ? 324  GLU B CG    1 
ATOM   6529 C  CD    . GLU F 3 324 ? 74.054 81.865  44.011 1.00 46.86  ? 324  GLU B CD    1 
ATOM   6530 O  OE1   . GLU F 3 324 ? 74.397 81.130  43.067 1.00 47.62  ? 324  GLU B OE1   1 
ATOM   6531 O  OE2   . GLU F 3 324 ? 73.470 82.956  43.835 1.00 45.61  ? 324  GLU B OE2   1 
ATOM   6532 N  N     . GLU F 3 325 ? 71.976 83.035  48.778 1.00 43.36  ? 325  GLU B N     1 
ATOM   6533 C  CA    . GLU F 3 325 ? 71.119 84.011  49.437 1.00 44.03  ? 325  GLU B CA    1 
ATOM   6534 C  C     . GLU F 3 325 ? 71.181 84.053  50.955 1.00 44.28  ? 325  GLU B C     1 
ATOM   6535 O  O     . GLU F 3 325 ? 70.610 84.945  51.577 1.00 44.22  ? 325  GLU B O     1 
ATOM   6536 C  CB    . GLU F 3 325 ? 69.683 83.793  48.972 1.00 43.79  ? 325  GLU B CB    1 
ATOM   6537 C  CG    . GLU F 3 325 ? 69.513 84.066  47.494 1.00 46.77  ? 325  GLU B CG    1 
ATOM   6538 C  CD    . GLU F 3 325 ? 68.152 83.671  46.980 1.00 48.86  ? 325  GLU B CD    1 
ATOM   6539 O  OE1   . GLU F 3 325 ? 67.144 83.975  47.650 1.00 52.34  ? 325  GLU B OE1   1 
ATOM   6540 O  OE2   . GLU F 3 325 ? 68.086 83.064  45.895 1.00 52.17  ? 325  GLU B OE2   1 
ATOM   6541 N  N     . ASP F 3 326 ? 71.884 83.103  51.556 1.00 45.75  ? 326  ASP B N     1 
ATOM   6542 C  CA    . ASP F 3 326 ? 71.986 83.065  53.005 1.00 45.65  ? 326  ASP B CA    1 
ATOM   6543 C  C     . ASP F 3 326 ? 73.399 82.672  53.401 1.00 46.34  ? 326  ASP B C     1 
ATOM   6544 O  O     . ASP F 3 326 ? 73.910 81.648  52.958 1.00 46.20  ? 326  ASP B O     1 
ATOM   6545 C  CB    . ASP F 3 326 ? 70.979 82.065  53.564 1.00 46.91  ? 326  ASP B CB    1 
ATOM   6546 C  CG    . ASP F 3 326 ? 70.690 82.293  55.027 1.00 48.39  ? 326  ASP B CG    1 
ATOM   6547 O  OD1   . ASP F 3 326 ? 71.610 82.097  55.850 1.00 49.82  ? 326  ASP B OD1   1 
ATOM   6548 O  OD2   . ASP F 3 326 ? 69.542 82.674  55.347 1.00 48.24  ? 326  ASP B OD2   1 
ATOM   6549 N  N     . GLU F 3 327 ? 74.023 83.488  54.242 1.00 46.99  ? 327  GLU B N     1 
ATOM   6550 C  CA    . GLU F 3 327 ? 75.391 83.247  54.676 1.00 48.54  ? 327  GLU B CA    1 
ATOM   6551 C  C     . GLU F 3 327 ? 75.529 82.266  55.840 1.00 46.54  ? 327  GLU B C     1 
ATOM   6552 O  O     . GLU F 3 327 ? 76.604 81.715  56.069 1.00 44.88  ? 327  GLU B O     1 
ATOM   6553 C  CB    . GLU F 3 327 ? 76.048 84.584  55.043 1.00 52.64  ? 327  GLU B CB    1 
ATOM   6554 C  CG    . GLU F 3 327 ? 75.270 85.402  56.078 1.00 60.30  ? 327  GLU B CG    1 
ATOM   6555 C  CD    . GLU F 3 327 ? 75.819 86.818  56.253 1.00 65.28  ? 327  GLU B CD    1 
ATOM   6556 O  OE1   . GLU F 3 327 ? 76.997 86.964  56.653 1.00 67.88  ? 327  GLU B OE1   1 
ATOM   6557 O  OE2   . GLU F 3 327 ? 75.071 87.788  55.989 1.00 66.69  ? 327  GLU B OE2   1 
ATOM   6558 N  N     . ARG F 3 328 ? 74.441 82.035  56.564 1.00 46.57  ? 328  ARG B N     1 
ATOM   6559 C  CA    . ARG F 3 328 ? 74.478 81.135  57.712 1.00 44.49  ? 328  ARG B CA    1 
ATOM   6560 C  C     . ARG F 3 328 ? 74.788 79.678  57.387 1.00 43.64  ? 328  ARG B C     1 
ATOM   6561 O  O     . ARG F 3 328 ? 74.544 79.204  56.278 1.00 40.60  ? 328  ARG B O     1 
ATOM   6562 C  CB    . ARG F 3 328 ? 73.154 81.211  58.469 1.00 46.66  ? 328  ARG B CB    1 
ATOM   6563 C  CG    . ARG F 3 328 ? 72.941 82.526  59.189 1.00 48.10  ? 328  ARG B CG    1 
ATOM   6564 C  CD    . ARG F 3 328 ? 71.544 82.609  59.757 1.00 47.97  ? 328  ARG B CD    1 
ATOM   6565 N  NE    . ARG F 3 328 ? 70.548 82.614  58.693 1.00 49.67  ? 328  ARG B NE    1 
ATOM   6566 C  CZ    . ARG F 3 328 ? 69.242 82.737  58.897 1.00 49.43  ? 328  ARG B CZ    1 
ATOM   6567 N  NH1   . ARG F 3 328 ? 68.776 82.866  60.132 1.00 51.10  ? 328  ARG B NH1   1 
ATOM   6568 N  NH2   . ARG F 3 328 ? 68.403 82.731  57.871 1.00 47.97  ? 328  ARG B NH2   1 
ATOM   6569 N  N     . LYS F 3 329 ? 75.338 78.979  58.373 1.00 42.27  ? 329  LYS B N     1 
ATOM   6570 C  CA    . LYS F 3 329 ? 75.663 77.569  58.229 1.00 43.24  ? 329  LYS B CA    1 
ATOM   6571 C  C     . LYS F 3 329 ? 74.368 76.778  58.377 1.00 41.86  ? 329  LYS B C     1 
ATOM   6572 O  O     . LYS F 3 329 ? 73.458 77.193  59.100 1.00 40.17  ? 329  LYS B O     1 
ATOM   6573 C  CB    . LYS F 3 329 ? 76.647 77.114  59.317 1.00 45.46  ? 329  LYS B CB    1 
ATOM   6574 C  CG    . LYS F 3 329 ? 78.052 77.694  59.220 1.00 48.36  ? 329  LYS B CG    1 
ATOM   6575 C  CD    . LYS F 3 329 ? 79.000 76.891  60.106 1.00 51.59  ? 329  LYS B CD    1 
ATOM   6576 C  CE    . LYS F 3 329 ? 80.463 77.261  59.883 1.00 53.26  ? 329  LYS B CE    1 
ATOM   6577 N  NZ    . LYS F 3 329 ? 81.373 76.299  60.576 1.00 52.74  ? 329  LYS B NZ    1 
ATOM   6578 N  N     . ILE F 3 330 ? 74.302 75.637  57.701 1.00 39.42  ? 330  ILE B N     1 
ATOM   6579 C  CA    . ILE F 3 330 ? 73.128 74.783  57.752 1.00 37.94  ? 330  ILE B CA    1 
ATOM   6580 C  C     . ILE F 3 330 ? 73.342 73.613  58.724 1.00 38.91  ? 330  ILE B C     1 
ATOM   6581 O  O     . ILE F 3 330 ? 74.377 72.948  58.701 1.00 38.99  ? 330  ILE B O     1 
ATOM   6582 C  CB    . ILE F 3 330 ? 72.797 74.252  56.341 1.00 36.83  ? 330  ILE B CB    1 
ATOM   6583 C  CG1   . ILE F 3 330 ? 72.566 75.435  55.396 1.00 33.28  ? 330  ILE B CG1   1 
ATOM   6584 C  CG2   . ILE F 3 330 ? 71.569 73.364  56.388 1.00 35.76  ? 330  ILE B CG2   1 
ATOM   6585 C  CD1   . ILE F 3 330 ? 72.355 75.031  53.971 1.00 32.60  ? 330  ILE B CD1   1 
ATOM   6586 N  N     . ARG F 3 331 ? 72.345 73.382  59.575 1.00 37.85  ? 331  ARG B N     1 
ATOM   6587 C  CA    . ARG F 3 331 ? 72.361 72.330  60.589 1.00 37.05  ? 331  ARG B CA    1 
ATOM   6588 C  C     . ARG F 3 331 ? 71.487 71.155  60.156 1.00 36.45  ? 331  ARG B C     1 
ATOM   6589 O  O     . ARG F 3 331 ? 71.872 69.992  60.300 1.00 36.96  ? 331  ARG B O     1 
ATOM   6590 C  CB    . ARG F 3 331 ? 71.854 72.918  61.907 1.00 37.91  ? 331  ARG B CB    1 
ATOM   6591 C  CG    . ARG F 3 331 ? 71.549 71.946  63.030 1.00 38.89  ? 331  ARG B CG    1 
ATOM   6592 C  CD    . ARG F 3 331 ? 70.958 72.735  64.206 1.00 39.37  ? 331  ARG B CD    1 
ATOM   6593 N  NE    . ARG F 3 331 ? 70.456 71.891  65.286 1.00 43.19  ? 331  ARG B NE    1 
ATOM   6594 C  CZ    . ARG F 3 331 ? 71.205 71.387  66.260 1.00 43.41  ? 331  ARG B CZ    1 
ATOM   6595 N  NH1   . ARG F 3 331 ? 72.506 71.643  66.302 1.00 44.46  ? 331  ARG B NH1   1 
ATOM   6596 N  NH2   . ARG F 3 331 ? 70.652 70.618  67.191 1.00 44.10  ? 331  ARG B NH2   1 
ATOM   6597 N  N     . ARG F 3 332 ? 70.302 71.459  59.637 1.00 34.70  ? 332  ARG B N     1 
ATOM   6598 C  CA    . ARG F 3 332 ? 69.402 70.417  59.154 1.00 34.00  ? 332  ARG B CA    1 
ATOM   6599 C  C     . ARG F 3 332 ? 69.100 70.694  57.680 1.00 33.07  ? 332  ARG B C     1 
ATOM   6600 O  O     . ARG F 3 332 ? 68.979 71.852  57.265 1.00 30.90  ? 332  ARG B O     1 
ATOM   6601 C  CB    . ARG F 3 332 ? 68.101 70.397  59.965 1.00 35.60  ? 332  ARG B CB    1 
ATOM   6602 C  CG    . ARG F 3 332 ? 68.300 70.297  61.488 1.00 39.34  ? 332  ARG B CG    1 
ATOM   6603 C  CD    . ARG F 3 332 ? 66.966 70.172  62.229 1.00 39.92  ? 332  ARG B CD    1 
ATOM   6604 N  NE    . ARG F 3 332 ? 66.384 68.855  62.000 1.00 43.79  ? 332  ARG B NE    1 
ATOM   6605 C  CZ    . ARG F 3 332 ? 65.108 68.617  61.700 1.00 44.74  ? 332  ARG B CZ    1 
ATOM   6606 N  NH1   . ARG F 3 332 ? 64.230 69.608  61.586 1.00 42.89  ? 332  ARG B NH1   1 
ATOM   6607 N  NH2   . ARG F 3 332 ? 64.715 67.369  61.488 1.00 44.79  ? 332  ARG B NH2   1 
ATOM   6608 N  N     . ILE F 3 333 ? 68.991 69.631  56.890 1.00 30.49  ? 333  ILE B N     1 
ATOM   6609 C  CA    . ILE F 3 333 ? 68.708 69.765  55.471 1.00 29.42  ? 333  ILE B CA    1 
ATOM   6610 C  C     . ILE F 3 333 ? 67.702 68.717  55.010 1.00 29.92  ? 333  ILE B C     1 
ATOM   6611 O  O     . ILE F 3 333 ? 67.811 67.533  55.350 1.00 29.54  ? 333  ILE B O     1 
ATOM   6612 C  CB    . ILE F 3 333 ? 69.987 69.616  54.628 1.00 28.76  ? 333  ILE B CB    1 
ATOM   6613 C  CG1   . ILE F 3 333 ? 69.710 70.045  53.187 1.00 28.55  ? 333  ILE B CG1   1 
ATOM   6614 C  CG2   . ILE F 3 333 ? 70.471 68.179  54.659 1.00 26.67  ? 333  ILE B CG2   1 
ATOM   6615 C  CD1   . ILE F 3 333 ? 69.269 71.494  53.056 1.00 26.51  ? 333  ILE B CD1   1 
ATOM   6616 N  N     . GLY F 3 334 ? 66.723 69.147  54.228 1.00 29.45  ? 334  GLY B N     1 
ATOM   6617 C  CA    . GLY F 3 334 ? 65.733 68.201  53.761 1.00 30.24  ? 334  GLY B CA    1 
ATOM   6618 C  C     . GLY F 3 334 ? 64.961 68.674  52.552 1.00 29.83  ? 334  GLY B C     1 
ATOM   6619 O  O     . GLY F 3 334 ? 65.270 69.711  51.962 1.00 29.26  ? 334  GLY B O     1 
ATOM   6620 N  N     . VAL F 3 335 ? 63.943 67.906  52.186 1.00 29.18  ? 335  VAL B N     1 
ATOM   6621 C  CA    . VAL F 3 335 ? 63.129 68.241  51.039 1.00 31.09  ? 335  VAL B CA    1 
ATOM   6622 C  C     . VAL F 3 335 ? 61.650 68.088  51.370 1.00 32.67  ? 335  VAL B C     1 
ATOM   6623 O  O     . VAL F 3 335 ? 61.276 67.413  52.329 1.00 32.48  ? 335  VAL B O     1 
ATOM   6624 C  CB    . VAL F 3 335 ? 63.493 67.342  49.843 1.00 32.91  ? 335  VAL B CB    1 
ATOM   6625 C  CG1   . VAL F 3 335 ? 63.300 65.862  50.214 1.00 34.67  ? 335  VAL B CG1   1 
ATOM   6626 C  CG2   . VAL F 3 335 ? 62.643 67.696  48.654 1.00 35.07  ? 335  VAL B CG2   1 
ATOM   6627 N  N     . ARG F 3 336 ? 60.810 68.730  50.573 1.00 32.60  ? 336  ARG B N     1 
ATOM   6628 C  CA    . ARG F 3 336 ? 59.379 68.649  50.765 1.00 33.34  ? 336  ARG B CA    1 
ATOM   6629 C  C     . ARG F 3 336 ? 58.690 68.652  49.408 1.00 31.53  ? 336  ARG B C     1 
ATOM   6630 O  O     . ARG F 3 336 ? 58.986 69.499  48.566 1.00 30.77  ? 336  ARG B O     1 
ATOM   6631 C  CB    . ARG F 3 336 ? 58.909 69.830  51.586 1.00 38.30  ? 336  ARG B CB    1 
ATOM   6632 C  CG    . ARG F 3 336 ? 57.504 69.692  52.045 1.00 46.87  ? 336  ARG B CG    1 
ATOM   6633 C  CD    . ARG F 3 336 ? 57.210 70.775  53.029 1.00 56.06  ? 336  ARG B CD    1 
ATOM   6634 N  NE    . ARG F 3 336 ? 56.252 70.320  54.017 1.00 62.68  ? 336  ARG B NE    1 
ATOM   6635 C  CZ    . ARG F 3 336 ? 56.017 70.955  55.155 1.00 67.55  ? 336  ARG B CZ    1 
ATOM   6636 N  NH1   . ARG F 3 336 ? 56.674 72.073  55.444 1.00 69.77  ? 336  ARG B NH1   1 
ATOM   6637 N  NH2   . ARG F 3 336 ? 55.128 70.469  56.001 1.00 70.15  ? 336  ARG B NH2   1 
ATOM   6638 N  N     . PHE F 3 337 ? 57.774 67.707  49.212 1.00 30.01  ? 337  PHE B N     1 
ATOM   6639 C  CA    . PHE F 3 337 ? 57.039 67.558  47.958 1.00 28.68  ? 337  PHE B CA    1 
ATOM   6640 C  C     . PHE F 3 337 ? 55.545 67.896  48.076 1.00 30.71  ? 337  PHE B C     1 
ATOM   6641 O  O     . PHE F 3 337 ? 54.861 67.447  49.007 1.00 29.85  ? 337  PHE B O     1 
ATOM   6642 C  CB    . PHE F 3 337 ? 57.212 66.125  47.458 1.00 26.04  ? 337  PHE B CB    1 
ATOM   6643 C  CG    . PHE F 3 337 ? 58.631 65.773  47.123 1.00 27.38  ? 337  PHE B CG    1 
ATOM   6644 C  CD1   . PHE F 3 337 ? 59.207 66.214  45.932 1.00 27.90  ? 337  PHE B CD1   1 
ATOM   6645 C  CD2   . PHE F 3 337 ? 59.399 65.016  47.996 1.00 25.88  ? 337  PHE B CD2   1 
ATOM   6646 C  CE1   . PHE F 3 337 ? 60.535 65.906  45.614 1.00 26.85  ? 337  PHE B CE1   1 
ATOM   6647 C  CE2   . PHE F 3 337 ? 60.726 64.705  47.690 1.00 28.87  ? 337  PHE B CE2   1 
ATOM   6648 C  CZ    . PHE F 3 337 ? 61.294 65.153  46.493 1.00 27.71  ? 337  PHE B CZ    1 
ATOM   6649 N  N     . SER F 3 338 ? 55.037 68.668  47.116 1.00 29.63  ? 338  SER B N     1 
ATOM   6650 C  CA    . SER F 3 338 ? 53.639 69.070  47.133 1.00 29.12  ? 338  SER B CA    1 
ATOM   6651 C  C     . SER F 3 338 ? 52.994 69.143  45.748 1.00 30.36  ? 338  SER B C     1 
ATOM   6652 O  O     . SER F 3 338 ? 53.611 68.807  44.738 1.00 28.78  ? 338  SER B O     1 
ATOM   6653 C  CB    . SER F 3 338 ? 53.507 70.430  47.815 1.00 29.26  ? 338  SER B CB    1 
ATOM   6654 O  OG    . SER F 3 338 ? 54.149 71.442  47.055 1.00 29.32  ? 338  SER B OG    1 
ATOM   6655 N  N     . LYS F 3 339 ? 51.744 69.600  45.726 1.00 30.23  ? 339  LYS B N     1 
ATOM   6656 C  CA    . LYS F 3 339 ? 50.963 69.733  44.503 1.00 31.56  ? 339  LYS B CA    1 
ATOM   6657 C  C     . LYS F 3 339 ? 50.952 68.412  43.745 1.00 32.44  ? 339  LYS B C     1 
ATOM   6658 O  O     . LYS F 3 339 ? 51.436 68.317  42.618 1.00 30.10  ? 339  LYS B O     1 
ATOM   6659 C  CB    . LYS F 3 339 ? 51.537 70.852  43.633 1.00 33.67  ? 339  LYS B CB    1 
ATOM   6660 C  CG    . LYS F 3 339 ? 51.595 72.199  44.347 1.00 39.06  ? 339  LYS B CG    1 
ATOM   6661 C  CD    . LYS F 3 339 ? 52.046 73.312  43.417 1.00 41.82  ? 339  LYS B CD    1 
ATOM   6662 C  CE    . LYS F 3 339 ? 52.282 74.610  44.186 1.00 45.58  ? 339  LYS B CE    1 
ATOM   6663 N  NZ    . LYS F 3 339 ? 52.858 75.685  43.315 1.00 45.05  ? 339  LYS B NZ    1 
ATOM   6664 N  N     . PHE F 3 340 ? 50.392 67.392  44.387 1.00 34.43  ? 340  PHE B N     1 
ATOM   6665 C  CA    . PHE F 3 340 ? 50.317 66.057  43.810 1.00 36.74  ? 340  PHE B CA    1 
ATOM   6666 C  C     . PHE F 3 340 ? 49.348 65.998  42.641 1.00 38.98  ? 340  PHE B C     1 
ATOM   6667 O  O     . PHE F 3 340 ? 48.327 66.691  42.633 1.00 38.19  ? 340  PHE B O     1 
ATOM   6668 C  CB    . PHE F 3 340 ? 49.875 65.052  44.870 1.00 37.11  ? 340  PHE B CB    1 
ATOM   6669 C  CG    . PHE F 3 340 ? 50.663 65.131  46.143 1.00 39.14  ? 340  PHE B CG    1 
ATOM   6670 C  CD1   . PHE F 3 340 ? 52.038 64.927  46.138 1.00 39.08  ? 340  PHE B CD1   1 
ATOM   6671 C  CD2   . PHE F 3 340 ? 50.032 65.413  47.347 1.00 39.44  ? 340  PHE B CD2   1 
ATOM   6672 C  CE1   . PHE F 3 340 ? 52.777 65.002  47.315 1.00 39.25  ? 340  PHE B CE1   1 
ATOM   6673 C  CE2   . PHE F 3 340 ? 50.761 65.490  48.531 1.00 41.17  ? 340  PHE B CE2   1 
ATOM   6674 C  CZ    . PHE F 3 340 ? 52.135 65.285  48.515 1.00 40.06  ? 340  PHE B CZ    1 
ATOM   6675 N  N     . ILE F 3 341 ? 49.672 65.163  41.658 1.00 40.00  ? 341  ILE B N     1 
ATOM   6676 C  CA    . ILE F 3 341 ? 48.820 65.004  40.489 1.00 41.30  ? 341  ILE B CA    1 
ATOM   6677 C  C     . ILE F 3 341 ? 47.522 64.323  40.932 1.00 42.42  ? 341  ILE B C     1 
ATOM   6678 O  O     . ILE F 3 341 ? 47.617 63.357  41.723 1.00 41.89  ? 341  ILE B O     1 
ATOM   6679 C  CB    . ILE F 3 341 ? 49.509 64.126  39.412 1.00 40.80  ? 341  ILE B CB    1 
ATOM   6680 C  CG1   . ILE F 3 341 ? 50.784 64.809  38.912 1.00 39.74  ? 341  ILE B CG1   1 
ATOM   6681 C  CG2   . ILE F 3 341 ? 48.545 63.877  38.247 1.00 41.98  ? 341  ILE B CG2   1 
ATOM   6682 C  CD1   . ILE F 3 341 ? 51.552 64.001  37.869 1.00 40.45  ? 341  ILE B CD1   1 
HETATM 6683 CA CA    . CA  G 4 .   ? 51.097 12.580  36.726 1.00 36.96  ? 401  CA  A CA    1 
HETATM 6684 CA CA    . CA  H 4 .   ? 50.977 10.082  34.186 1.00 26.33  ? 402  CA  A CA    1 
HETATM 6685 CA CA    . CA  I 4 .   ? 49.738 25.232  32.127 1.00 52.22  ? 406  CA  A CA    1 
HETATM 6686 MG MG    . MG  J 5 .   ? 31.498 30.808  44.583 1.00 45.56  ? 407  MG  A MG    1 
HETATM 6687 P  PA    . TTP K 6 .   ? 48.240 12.465  34.364 1.00 34.31  ? 803  TTP A PA    1 
HETATM 6688 O  O1A   . TTP K 6 .   ? 48.055 13.688  34.771 1.00 33.93  ? 803  TTP A O1A   1 
HETATM 6689 O  O2A   . TTP K 6 .   ? 49.626 11.959  34.895 1.00 28.40  ? 803  TTP A O2A   1 
HETATM 6690 O  O3A   . TTP K 6 .   ? 47.096 11.378  33.717 1.00 34.16  ? 803  TTP A O3A   1 
HETATM 6691 P  PB    . TTP K 6 .   ? 47.839 10.223  32.806 1.00 29.40  ? 803  TTP A PB    1 
HETATM 6692 O  O1B   . TTP K 6 .   ? 46.764 9.421   32.008 1.00 32.00  ? 803  TTP A O1B   1 
HETATM 6693 O  O2B   . TTP K 6 .   ? 48.579 9.213   33.739 1.00 29.80  ? 803  TTP A O2B   1 
HETATM 6694 O  O3B   . TTP K 6 .   ? 49.172 10.818  32.155 1.00 38.94  ? 803  TTP A O3B   1 
HETATM 6695 P  PG    . TTP K 6 .   ? 50.021 10.916  30.817 1.00 33.19  ? 803  TTP A PG    1 
HETATM 6696 O  O1G   . TTP K 6 .   ? 51.251 11.374  31.644 1.00 37.64  ? 803  TTP A O1G   1 
HETATM 6697 O  O2G   . TTP K 6 .   ? 49.541 12.091  29.873 1.00 38.58  ? 803  TTP A O2G   1 
HETATM 6698 O  O3G   . TTP K 6 .   ? 50.459 9.591   30.095 1.00 33.57  ? 803  TTP A O3G   1 
HETATM 6699 O  "O5'" . TTP K 6 .   ? 47.323 12.058  35.582 1.00 30.83  ? 803  TTP A "O5'" 1 
HETATM 6700 C  "C5'" . TTP K 6 .   ? 47.490 10.686  36.442 1.00 30.60  ? 803  TTP A "C5'" 1 
HETATM 6701 C  "C4'" . TTP K 6 .   ? 46.211 9.907   36.726 1.00 31.28  ? 803  TTP A "C4'" 1 
HETATM 6702 O  "O4'" . TTP K 6 .   ? 45.269 10.531  37.605 1.00 30.60  ? 803  TTP A "O4'" 1 
HETATM 6703 C  "C3'" . TTP K 6 .   ? 45.452 9.484   35.432 1.00 30.85  ? 803  TTP A "C3'" 1 
HETATM 6704 O  "O3'" . TTP K 6 .   ? 45.765 8.129   35.131 1.00 31.34  ? 803  TTP A "O3'" 1 
HETATM 6705 C  "C2'" . TTP K 6 .   ? 43.999 9.738   35.712 1.00 31.40  ? 803  TTP A "C2'" 1 
HETATM 6706 C  "C1'" . TTP K 6 .   ? 43.982 10.491  37.024 1.00 32.29  ? 803  TTP A "C1'" 1 
HETATM 6707 N  N1    . TTP K 6 .   ? 43.426 11.865  36.547 1.00 32.60  ? 803  TTP A N1    1 
HETATM 6708 C  C2    . TTP K 6 .   ? 42.082 12.181  36.743 1.00 34.23  ? 803  TTP A C2    1 
HETATM 6709 O  O2    . TTP K 6 .   ? 41.331 11.377  37.310 1.00 32.89  ? 803  TTP A O2    1 
HETATM 6710 N  N3    . TTP K 6 .   ? 41.511 13.341  36.340 1.00 34.75  ? 803  TTP A N3    1 
HETATM 6711 C  C4    . TTP K 6 .   ? 42.244 14.299  35.690 1.00 35.27  ? 803  TTP A C4    1 
HETATM 6712 O  O4    . TTP K 6 .   ? 41.576 15.393  35.337 1.00 37.79  ? 803  TTP A O4    1 
HETATM 6713 C  C5    . TTP K 6 .   ? 43.669 14.108  35.442 1.00 37.12  ? 803  TTP A C5    1 
HETATM 6714 C  C5M   . TTP K 6 .   ? 44.225 14.784  34.972 1.00 38.43  ? 803  TTP A C5M   1 
HETATM 6715 C  C6    . TTP K 6 .   ? 44.191 12.853  35.890 1.00 33.30  ? 803  TTP A C6    1 
HETATM 6716 CA CA    . CA  L 4 .   ? 46.507 65.003  70.205 1.00 35.41  ? 403  CA  B CA    1 
HETATM 6717 CA CA    . CA  M 4 .   ? 47.248 62.521  72.624 1.00 26.32  ? 404  CA  B CA    1 
HETATM 6718 CA CA    . CA  N 4 .   ? 47.975 78.219  73.855 1.00 41.52  ? 405  CA  B CA    1 
HETATM 6719 MG MG    . MG  O 5 .   ? 64.789 84.034  59.200 1.00 53.18  ? 408  MG  B MG    1 
HETATM 6720 P  PA    . TTP P 6 .   ? 49.663 64.967  72.134 1.00 30.13  ? 804  TTP B PA    1 
HETATM 6721 O  O1A   . TTP P 6 .   ? 49.794 66.180  71.647 1.00 30.99  ? 804  TTP B O1A   1 
HETATM 6722 O  O2A   . TTP P 6 .   ? 48.257 64.420  71.720 1.00 25.05  ? 804  TTP B O2A   1 
HETATM 6723 O  O3A   . TTP P 6 .   ? 50.877 63.976  72.779 1.00 31.08  ? 804  TTP B O3A   1 
HETATM 6724 P  PB    . TTP P 6 .   ? 50.291 62.789  73.744 1.00 26.42  ? 804  TTP B PB    1 
HETATM 6725 O  O1B   . TTP P 6 .   ? 51.537 62.104  74.397 1.00 29.71  ? 804  TTP B O1B   1 
HETATM 6726 O  O2B   . TTP P 6 .   ? 49.502 61.737  72.880 1.00 24.44  ? 804  TTP B O2B   1 
HETATM 6727 O  O3B   . TTP P 6 .   ? 49.058 63.373  74.569 1.00 36.34  ? 804  TTP B O3B   1 
HETATM 6728 P  PG    . TTP P 6 .   ? 48.505 63.539  76.043 1.00 34.74  ? 804  TTP B PG    1 
HETATM 6729 O  O1G   . TTP P 6 .   ? 47.110 63.999  75.550 1.00 39.37  ? 804  TTP B O1G   1 
HETATM 6730 O  O2G   . TTP P 6 .   ? 49.164 64.736  76.812 1.00 38.01  ? 804  TTP B O2G   1 
HETATM 6731 O  O3G   . TTP P 6 .   ? 48.354 62.228  76.871 1.00 38.03  ? 804  TTP B O3G   1 
HETATM 6732 O  "O5'" . TTP P 6 .   ? 50.499 64.462  70.883 1.00 23.62  ? 804  TTP B "O5'" 1 
HETATM 6733 C  "C5'" . TTP P 6 .   ? 50.327 62.987  70.197 1.00 23.03  ? 804  TTP B "C5'" 1 
HETATM 6734 C  "C4'" . TTP P 6 .   ? 51.604 62.280  69.723 1.00 26.22  ? 804  TTP B "C4'" 1 
HETATM 6735 O  "O4'" . TTP P 6 .   ? 52.380 62.929  68.698 1.00 26.46  ? 804  TTP B "O4'" 1 
HETATM 6736 C  "C3'" . TTP P 6 .   ? 52.576 61.898  70.885 1.00 25.85  ? 804  TTP B "C3'" 1 
HETATM 6737 O  "O3'" . TTP P 6 .   ? 52.347 60.548  71.260 1.00 28.44  ? 804  TTP B "O3'" 1 
HETATM 6738 C  "C2'" . TTP P 6 .   ? 53.961 62.180  70.359 1.00 25.73  ? 804  TTP B "C2'" 1 
HETATM 6739 C  "C1'" . TTP P 6 .   ? 53.747 62.896  69.035 1.00 24.77  ? 804  TTP B "C1'" 1 
HETATM 6740 N  N1    . TTP P 6 .   ? 54.343 64.292  69.349 1.00 24.71  ? 804  TTP B N1    1 
HETATM 6741 C  C2    . TTP P 6 .   ? 55.607 64.667  68.889 1.00 24.38  ? 804  TTP B C2    1 
HETATM 6742 O  O2    . TTP P 6 .   ? 56.280 63.900  68.208 1.00 24.22  ? 804  TTP B O2    1 
HETATM 6743 N  N3    . TTP P 6 .   ? 56.178 65.867  69.158 1.00 26.91  ? 804  TTP B N3    1 
HETATM 6744 C  C4    . TTP P 6 .   ? 55.531 66.805  69.922 1.00 23.34  ? 804  TTP B C4    1 
HETATM 6745 O  O4    . TTP P 6 .   ? 56.190 67.925  70.117 1.00 27.27  ? 804  TTP B O4    1 
HETATM 6746 C  C5    . TTP P 6 .   ? 54.199 66.556  70.444 1.00 29.82  ? 804  TTP B C5    1 
HETATM 6747 C  C5M   . TTP P 6 .   ? 53.703 67.226  71.005 1.00 32.53  ? 804  TTP B C5M   1 
HETATM 6748 C  C6    . TTP P 6 .   ? 53.672 65.265  70.124 1.00 24.79  ? 804  TTP B C6    1 
HETATM 6749 O  O     . HOH Q 7 .   ? 48.218 37.612  59.587 1.00 47.96  ? 55   HOH C O     1 
HETATM 6750 O  O     . HOH Q 7 .   ? 47.103 43.599  63.344 1.00 34.56  ? 61   HOH C O     1 
HETATM 6751 O  O     . HOH Q 7 .   ? 43.089 25.902  36.939 1.00 40.89  ? 92   HOH C O     1 
HETATM 6752 O  O     . HOH Q 7 .   ? 32.162 33.548  51.235 1.00 66.69  ? 174  HOH C O     1 
HETATM 6753 O  O     . HOH Q 7 .   ? 42.347 17.132  42.823 1.00 57.26  ? 197  HOH C O     1 
HETATM 6754 O  O     . HOH Q 7 .   ? 50.627 37.543  60.560 1.00 62.50  ? 201  HOH C O     1 
HETATM 6755 O  O     . HOH Q 7 .   ? 45.494 14.829  38.194 1.00 60.23  ? 211  HOH C O     1 
HETATM 6756 O  O     . HOH Q 7 .   ? 40.753 25.667  52.640 1.00 48.82  ? 227  HOH C O     1 
HETATM 6757 O  O     . HOH Q 7 .   ? 33.545 27.881  62.416 1.00 50.34  ? 244  HOH C O     1 
HETATM 6758 O  O     . HOH Q 7 .   ? 38.639 21.248  39.162 1.00 68.86  ? 248  HOH C O     1 
HETATM 6759 O  O     . HOH Q 7 .   ? 40.120 34.981  37.715 1.00 46.53  ? 277  HOH C O     1 
HETATM 6760 O  O     . HOH Q 7 .   ? 39.743 33.324  47.400 1.00 53.99  ? 310  HOH C O     1 
HETATM 6761 O  O     . HOH Q 7 .   ? 36.133 33.485  56.330 1.00 69.84  ? 313  HOH C O     1 
HETATM 6762 O  O     . HOH Q 7 .   ? 36.206 28.076  43.725 1.00 56.55  ? 338  HOH C O     1 
HETATM 6763 O  O     . HOH Q 7 .   ? 44.838 17.278  38.935 1.00 63.02  ? 349  HOH C O     1 
HETATM 6764 O  O     . HOH Q 7 .   ? 35.833 30.558  55.816 1.00 61.87  ? 368  HOH C O     1 
HETATM 6765 O  O     . HOH Q 7 .   ? 57.135 45.010  66.272 1.00 54.26  ? 369  HOH C O     1 
HETATM 6766 O  O     . HOH Q 7 .   ? 31.804 33.298  46.793 1.00 55.00  ? 373  HOH C O     1 
HETATM 6767 O  O     . HOH R 7 .   ? 50.472 33.960  44.544 1.00 36.18  ? 18   HOH D O     1 
HETATM 6768 O  O     . HOH R 7 .   ? 28.815 9.896   43.485 1.00 37.85  ? 26   HOH D O     1 
HETATM 6769 O  O     . HOH R 7 .   ? 40.540 15.997  44.279 1.00 46.59  ? 63   HOH D O     1 
HETATM 6770 O  O     . HOH R 7 .   ? 44.624 43.313  64.328 1.00 37.65  ? 77   HOH D O     1 
HETATM 6771 O  O     . HOH R 7 .   ? 32.027 14.967  43.883 1.00 46.63  ? 86   HOH D O     1 
HETATM 6772 O  O     . HOH R 7 .   ? 47.076 18.785  45.532 1.00 38.33  ? 161  HOH D O     1 
HETATM 6773 O  O     . HOH R 7 .   ? 50.846 28.674  51.964 1.00 75.06  ? 199  HOH D O     1 
HETATM 6774 O  O     . HOH R 7 .   ? 36.963 18.542  35.694 1.00 53.61  ? 202  HOH D O     1 
HETATM 6775 O  O     . HOH R 7 .   ? 41.286 36.642  66.526 1.00 92.49  ? 203  HOH D O     1 
HETATM 6776 O  O     . HOH R 7 .   ? 45.609 39.476  52.031 1.00 62.66  ? 207  HOH D O     1 
HETATM 6777 O  O     . HOH R 7 .   ? 48.050 42.996  74.981 1.00 48.23  ? 243  HOH D O     1 
HETATM 6778 O  O     . HOH R 7 .   ? 54.531 40.094  69.907 1.00 50.45  ? 251  HOH D O     1 
HETATM 6779 O  O     . HOH R 7 .   ? 40.152 43.485  58.663 1.00 69.51  ? 259  HOH D O     1 
HETATM 6780 O  O     . HOH R 7 .   ? 38.653 17.465  43.295 1.00 53.24  ? 270  HOH D O     1 
HETATM 6781 O  O     . HOH R 7 .   ? 53.176 27.223  43.753 1.00 84.25  ? 275  HOH D O     1 
HETATM 6782 O  O     . HOH R 7 .   ? 50.844 16.660  51.504 1.00 60.92  ? 303  HOH D O     1 
HETATM 6783 O  O     . HOH R 7 .   ? 38.376 10.873  41.123 1.00 58.19  ? 316  HOH D O     1 
HETATM 6784 O  O     . HOH R 7 .   ? 43.961 35.123  68.293 1.00 57.25  ? 318  HOH D O     1 
HETATM 6785 O  O     . HOH R 7 .   ? 37.480 19.838  37.654 1.00 53.60  ? 347  HOH D O     1 
HETATM 6786 O  O     . HOH R 7 .   ? 41.531 34.553  66.461 1.00 57.16  ? 351  HOH D O     1 
HETATM 6787 O  O     . HOH R 7 .   ? 38.757 41.555  58.406 1.00 63.98  ? 356  HOH D O     1 
HETATM 6788 O  O     . HOH R 7 .   ? 41.182 38.658  66.886 1.00 68.36  ? 370  HOH D O     1 
HETATM 6789 O  O     . HOH R 7 .   ? 32.988 16.973  31.554 1.00 56.85  ? 371  HOH D O     1 
HETATM 6790 O  O     . HOH S 7 .   ? 63.323 78.758  44.583 1.00 28.05  ? 3    HOH E O     1 
HETATM 6791 O  O     . HOH S 7 .   ? 45.367 70.262  65.927 1.00 38.47  ? 15   HOH E O     1 
HETATM 6792 O  O     . HOH S 7 .   ? 37.490 95.705  44.201 1.00 43.69  ? 41   HOH E O     1 
HETATM 6793 O  O     . HOH S 7 .   ? 50.183 95.250  45.114 1.00 36.63  ? 45   HOH E O     1 
HETATM 6794 O  O     . HOH S 7 .   ? 45.360 87.915  47.237 1.00 42.80  ? 60   HOH E O     1 
HETATM 6795 O  O     . HOH S 7 .   ? 49.198 79.326  62.729 1.00 41.69  ? 69   HOH E O     1 
HETATM 6796 O  O     . HOH S 7 .   ? 41.259 92.793  40.616 1.00 44.78  ? 89   HOH E O     1 
HETATM 6797 O  O     . HOH S 7 .   ? 45.665 73.329  70.042 1.00 46.08  ? 101  HOH E O     1 
HETATM 6798 O  O     . HOH S 7 .   ? 58.075 78.390  61.644 1.00 40.09  ? 107  HOH E O     1 
HETATM 6799 O  O     . HOH S 7 .   ? 58.403 85.339  47.991 1.00 45.51  ? 112  HOH E O     1 
HETATM 6800 O  O     . HOH S 7 .   ? 57.833 77.968  53.555 1.00 42.08  ? 117  HOH E O     1 
HETATM 6801 O  O     . HOH S 7 .   ? 55.237 77.298  53.250 1.00 41.59  ? 118  HOH E O     1 
HETATM 6802 O  O     . HOH S 7 .   ? 49.900 77.177  72.621 1.00 38.33  ? 124  HOH E O     1 
HETATM 6803 O  O     . HOH S 7 .   ? 43.747 90.825  40.485 1.00 32.95  ? 130  HOH E O     1 
HETATM 6804 O  O     . HOH S 7 .   ? 58.162 76.741  59.681 1.00 35.94  ? 136  HOH E O     1 
HETATM 6805 O  O     . HOH S 7 .   ? 43.336 94.870  47.831 1.00 48.81  ? 162  HOH E O     1 
HETATM 6806 O  O     . HOH S 7 .   ? 45.222 89.902  48.655 1.00 37.09  ? 167  HOH E O     1 
HETATM 6807 O  O     . HOH S 7 .   ? 46.922 74.960  66.484 1.00 89.90  ? 170  HOH E O     1 
HETATM 6808 O  O     . HOH S 7 .   ? 51.503 85.291  40.842 1.00 51.51  ? 177  HOH E O     1 
HETATM 6809 O  O     . HOH S 7 .   ? 49.685 79.956  38.186 1.00 58.61  ? 276  HOH E O     1 
HETATM 6810 O  O     . HOH S 7 .   ? 40.833 95.550  41.061 1.00 51.79  ? 285  HOH E O     1 
HETATM 6811 O  O     . HOH S 7 .   ? 47.487 88.717  48.548 1.00 43.56  ? 286  HOH E O     1 
HETATM 6812 O  O     . HOH S 7 .   ? 58.201 85.452  52.832 1.00 58.04  ? 290  HOH E O     1 
HETATM 6813 O  O     . HOH S 7 .   ? 58.397 77.024  64.000 1.00 41.25  ? 304  HOH E O     1 
HETATM 6814 O  O     . HOH S 7 .   ? 47.353 96.229  46.216 1.00 49.17  ? 312  HOH E O     1 
HETATM 6815 O  O     . HOH S 7 .   ? 61.668 80.858  60.687 1.00 51.91  ? 315  HOH E O     1 
HETATM 6816 O  O     . HOH S 7 .   ? 51.119 80.526  47.830 1.00 42.03  ? 323  HOH E O     1 
HETATM 6817 O  O     . HOH S 7 .   ? 47.197 68.364  65.559 1.00 65.73  ? 324  HOH E O     1 
HETATM 6818 O  O     . HOH S 7 .   ? 46.214 91.189  46.612 1.00 51.51  ? 335  HOH E O     1 
HETATM 6819 O  O     . HOH S 7 .   ? 44.399 74.765  65.402 1.00 50.25  ? 354  HOH E O     1 
HETATM 6820 O  O     . HOH S 7 .   ? 43.126 90.228  48.265 1.00 52.80  ? 372  HOH E O     1 
HETATM 6821 O  O     . HOH S 7 .   ? 63.600 86.497  56.898 1.00 67.75  ? 374  HOH E O     1 
HETATM 6822 O  O     . HOH T 7 .   ? 69.369 67.584  67.852 1.00 34.43  ? 1    HOH F O     1 
HETATM 6823 O  O     . HOH T 7 .   ? 53.589 95.965  41.873 1.00 32.56  ? 10   HOH F O     1 
HETATM 6824 O  O     . HOH T 7 .   ? 43.343 93.570  35.461 1.00 33.10  ? 21   HOH F O     1 
HETATM 6825 O  O     . HOH T 7 .   ? 51.416 94.040  33.389 1.00 36.00  ? 31   HOH F O     1 
HETATM 6826 O  O     . HOH T 7 .   ? 69.036 62.633  61.644 1.00 47.78  ? 48   HOH F O     1 
HETATM 6827 O  O     . HOH T 7 .   ? 46.355 87.198  54.320 1.00 37.34  ? 54   HOH F O     1 
HETATM 6828 O  O     . HOH T 7 .   ? 41.628 82.170  55.740 1.00 48.73  ? 57   HOH F O     1 
HETATM 6829 O  O     . HOH T 7 .   ? 56.321 74.734  56.945 1.00 35.13  ? 64   HOH F O     1 
HETATM 6830 O  O     . HOH T 7 .   ? 60.560 92.195  38.424 1.00 43.44  ? 73   HOH F O     1 
HETATM 6831 O  O     . HOH T 7 .   ? 52.717 87.052  38.917 1.00 43.11  ? 76   HOH F O     1 
HETATM 6832 O  O     . HOH T 7 .   ? 57.165 95.933  43.623 1.00 34.90  ? 126  HOH F O     1 
HETATM 6833 O  O     . HOH T 7 .   ? 52.862 95.074  44.361 1.00 38.04  ? 171  HOH F O     1 
HETATM 6834 O  O     . HOH T 7 .   ? 55.703 67.818  54.566 1.00 54.29  ? 183  HOH F O     1 
HETATM 6835 O  O     . HOH T 7 .   ? 47.975 85.720  49.935 1.00 47.54  ? 186  HOH F O     1 
HETATM 6836 O  O     . HOH T 7 .   ? 59.795 63.488  64.593 1.00 54.81  ? 189  HOH F O     1 
HETATM 6837 O  O     . HOH T 7 .   ? 64.541 70.718  64.139 1.00 73.76  ? 191  HOH F O     1 
HETATM 6838 O  O     . HOH T 7 .   ? 52.405 95.184  35.534 1.00 46.83  ? 193  HOH F O     1 
HETATM 6839 O  O     . HOH T 7 .   ? 57.039 57.295  59.012 1.00 53.58  ? 264  HOH F O     1 
HETATM 6840 O  O     . HOH T 7 .   ? 57.028 63.624  63.406 1.00 57.35  ? 273  HOH F O     1 
HETATM 6841 O  O     . HOH T 7 .   ? 61.047 71.558  61.193 1.00 58.03  ? 279  HOH F O     1 
HETATM 6842 O  O     . HOH T 7 .   ? 58.369 71.298  58.218 1.00 51.48  ? 306  HOH F O     1 
HETATM 6843 O  O     . HOH T 7 .   ? 48.816 90.692  50.429 1.00 45.91  ? 314  HOH F O     1 
HETATM 6844 O  O     . HOH T 7 .   ? 49.846 93.498  60.193 1.00 53.62  ? 343  HOH F O     1 
HETATM 6845 O  O     . HOH T 7 .   ? 69.899 70.802  76.588 1.00 58.52  ? 355  HOH F O     1 
HETATM 6846 O  O     . HOH T 7 .   ? 62.494 70.100  64.885 1.00 56.99  ? 362  HOH F O     1 
HETATM 6847 O  O     . HOH U 7 .   ? 37.932 13.575  16.652 1.00 25.28  ? 804  HOH A O     1 
HETATM 6848 O  O     . HOH U 7 .   ? 58.832 1.327   33.382 1.00 23.35  ? 805  HOH A O     1 
HETATM 6849 O  O     . HOH U 7 .   ? 56.748 -3.227  45.082 1.00 29.48  ? 806  HOH A O     1 
HETATM 6850 O  O     . HOH U 7 .   ? 38.771 20.088  57.032 1.00 26.78  ? 807  HOH A O     1 
HETATM 6851 O  O     . HOH U 7 .   ? 34.475 4.694   17.995 1.00 31.47  ? 808  HOH A O     1 
HETATM 6852 O  O     . HOH U 7 .   ? 50.676 5.793   45.715 1.00 30.28  ? 809  HOH A O     1 
HETATM 6853 O  O     . HOH U 7 .   ? 69.958 18.729  28.729 1.00 33.87  ? 810  HOH A O     1 
HETATM 6854 O  O     . HOH U 7 .   ? 48.323 4.431   25.527 1.00 26.18  ? 811  HOH A O     1 
HETATM 6855 O  O     . HOH U 7 .   ? 56.566 11.145  49.776 1.00 34.30  ? 812  HOH A O     1 
HETATM 6856 O  O     . HOH U 7 .   ? 53.360 10.129  32.776 1.00 46.79  ? 813  HOH A O     1 
HETATM 6857 O  O     . HOH U 7 .   ? 52.708 1.642   27.389 1.00 44.71  ? 814  HOH A O     1 
HETATM 6858 O  O     . HOH U 7 .   ? 70.418 11.961  47.425 1.00 42.34  ? 815  HOH A O     1 
HETATM 6859 O  O     . HOH U 7 .   ? 55.185 -9.065  36.276 1.00 32.85  ? 816  HOH A O     1 
HETATM 6860 O  O     . HOH U 7 .   ? 55.419 -8.375  40.601 1.00 32.03  ? 817  HOH A O     1 
HETATM 6861 O  O     . HOH U 7 .   ? 38.011 0.226   43.282 1.00 46.28  ? 818  HOH A O     1 
HETATM 6862 O  O     . HOH U 7 .   ? 56.465 -4.759  42.388 1.00 31.52  ? 819  HOH A O     1 
HETATM 6863 O  O     . HOH U 7 .   ? 38.202 17.087  22.925 1.00 42.87  ? 820  HOH A O     1 
HETATM 6864 O  O     . HOH U 7 .   ? 53.161 9.589   30.310 1.00 42.49  ? 821  HOH A O     1 
HETATM 6865 O  O     . HOH U 7 .   ? 70.182 20.893  35.134 1.00 36.48  ? 822  HOH A O     1 
HETATM 6866 O  O     . HOH U 7 .   ? 32.569 -0.280  26.434 1.00 34.78  ? 823  HOH A O     1 
HETATM 6867 O  O     . HOH U 7 .   ? 40.964 -4.289  32.869 1.00 33.12  ? 824  HOH A O     1 
HETATM 6868 O  O     . HOH U 7 .   ? 38.650 -4.865  31.339 1.00 33.42  ? 825  HOH A O     1 
HETATM 6869 O  O     . HOH U 7 .   ? 31.713 27.720  59.493 1.00 34.41  ? 826  HOH A O     1 
HETATM 6870 O  O     . HOH U 7 .   ? 66.437 -2.532  36.335 1.00 33.58  ? 827  HOH A O     1 
HETATM 6871 O  O     . HOH U 7 .   ? 54.292 17.345  40.788 1.00 33.86  ? 828  HOH A O     1 
HETATM 6872 O  O     . HOH U 7 .   ? 55.698 21.218  30.942 1.00 34.83  ? 829  HOH A O     1 
HETATM 6873 O  O     . HOH U 7 .   ? 39.017 -6.457  25.227 1.00 38.77  ? 830  HOH A O     1 
HETATM 6874 O  O     . HOH U 7 .   ? 54.697 -3.315  47.673 1.00 38.63  ? 831  HOH A O     1 
HETATM 6875 O  O     . HOH U 7 .   ? 65.958 17.187  48.902 1.00 34.10  ? 832  HOH A O     1 
HETATM 6876 O  O     . HOH U 7 .   ? 51.385 -1.624  29.508 1.00 40.19  ? 833  HOH A O     1 
HETATM 6877 O  O     . HOH U 7 .   ? 37.216 -0.710  35.251 1.00 38.58  ? 834  HOH A O     1 
HETATM 6878 O  O     . HOH U 7 .   ? 57.229 20.580  40.192 1.00 32.92  ? 835  HOH A O     1 
HETATM 6879 O  O     . HOH U 7 .   ? 28.387 3.029   24.781 1.00 49.20  ? 836  HOH A O     1 
HETATM 6880 O  O     . HOH U 7 .   ? 28.534 12.741  30.174 1.00 42.50  ? 837  HOH A O     1 
HETATM 6881 O  O     . HOH U 7 .   ? 53.891 16.842  52.922 1.00 48.32  ? 838  HOH A O     1 
HETATM 6882 O  O     . HOH U 7 .   ? 32.519 5.584   38.115 1.00 41.96  ? 839  HOH A O     1 
HETATM 6883 O  O     . HOH U 7 .   ? 70.135 22.168  42.287 1.00 38.42  ? 840  HOH A O     1 
HETATM 6884 O  O     . HOH U 7 .   ? 45.761 19.682  57.967 1.00 42.15  ? 841  HOH A O     1 
HETATM 6885 O  O     . HOH U 7 .   ? 36.864 3.772   42.010 1.00 43.03  ? 842  HOH A O     1 
HETATM 6886 O  O     . HOH U 7 .   ? 48.496 12.346  57.569 1.00 43.67  ? 843  HOH A O     1 
HETATM 6887 O  O     . HOH U 7 .   ? 66.738 22.032  48.891 1.00 41.85  ? 844  HOH A O     1 
HETATM 6888 O  O     . HOH U 7 .   ? 53.914 3.067   48.637 1.00 43.19  ? 845  HOH A O     1 
HETATM 6889 O  O     . HOH U 7 .   ? 29.493 2.703   29.119 1.00 40.78  ? 846  HOH A O     1 
HETATM 6890 O  O     . HOH U 7 .   ? 71.459 26.172  34.877 1.00 37.20  ? 847  HOH A O     1 
HETATM 6891 O  O     . HOH U 7 .   ? 34.852 14.782  69.510 1.00 45.39  ? 848  HOH A O     1 
HETATM 6892 O  O     . HOH U 7 .   ? 56.909 31.340  45.982 1.00 40.20  ? 849  HOH A O     1 
HETATM 6893 O  O     . HOH U 7 .   ? 59.839 9.737   24.562 1.00 45.30  ? 850  HOH A O     1 
HETATM 6894 O  O     . HOH U 7 .   ? 49.425 -8.067  31.511 1.00 37.41  ? 851  HOH A O     1 
HETATM 6895 O  O     . HOH U 7 .   ? 33.292 -1.971  29.331 1.00 46.72  ? 852  HOH A O     1 
HETATM 6896 O  O     . HOH U 7 .   ? 76.653 16.237  35.387 1.00 40.29  ? 853  HOH A O     1 
HETATM 6897 O  O     . HOH U 7 .   ? 51.585 -5.674  37.347 1.00 38.35  ? 854  HOH A O     1 
HETATM 6898 O  O     . HOH U 7 .   ? 57.472 24.774  44.616 1.00 40.90  ? 855  HOH A O     1 
HETATM 6899 O  O     . HOH U 7 .   ? 42.689 16.893  37.639 1.00 45.95  ? 856  HOH A O     1 
HETATM 6900 O  O     . HOH U 7 .   ? 68.090 13.393  27.735 1.00 41.16  ? 857  HOH A O     1 
HETATM 6901 O  O     . HOH U 7 .   ? 35.533 8.320   66.541 1.00 47.13  ? 858  HOH A O     1 
HETATM 6902 O  O     . HOH U 7 .   ? 42.871 23.004  66.951 1.00 47.17  ? 859  HOH A O     1 
HETATM 6903 O  O     . HOH U 7 .   ? 29.180 25.188  62.938 1.00 46.62  ? 860  HOH A O     1 
HETATM 6904 O  O     . HOH U 7 .   ? 28.500 10.549  17.187 1.00 45.71  ? 861  HOH A O     1 
HETATM 6905 O  O     . HOH U 7 .   ? 60.522 30.133  30.021 1.00 42.39  ? 862  HOH A O     1 
HETATM 6906 O  O     . HOH U 7 .   ? 47.135 0.829   24.357 1.00 34.94  ? 863  HOH A O     1 
HETATM 6907 O  O     . HOH U 7 .   ? 26.624 10.337  23.847 1.00 47.86  ? 864  HOH A O     1 
HETATM 6908 O  O     . HOH U 7 .   ? 75.048 22.210  30.768 1.00 41.94  ? 865  HOH A O     1 
HETATM 6909 O  O     . HOH U 7 .   ? 39.190 6.483   61.771 1.00 39.63  ? 866  HOH A O     1 
HETATM 6910 O  O     . HOH U 7 .   ? 42.477 22.830  57.628 1.00 36.67  ? 867  HOH A O     1 
HETATM 6911 O  O     . HOH U 7 .   ? 65.210 -5.060  36.045 1.00 40.72  ? 868  HOH A O     1 
HETATM 6912 O  O     . HOH U 7 .   ? 31.777 1.168   23.078 1.00 36.59  ? 869  HOH A O     1 
HETATM 6913 O  O     . HOH U 7 .   ? 59.080 23.261  50.932 1.00 42.14  ? 870  HOH A O     1 
HETATM 6914 O  O     . HOH U 7 .   ? 55.500 40.692  25.153 1.00 42.51  ? 871  HOH A O     1 
HETATM 6915 O  O     . HOH U 7 .   ? 43.752 11.535  29.191 1.00 45.48  ? 872  HOH A O     1 
HETATM 6916 O  O     . HOH U 7 .   ? 66.521 9.342   26.004 1.00 49.75  ? 873  HOH A O     1 
HETATM 6917 O  O     . HOH U 7 .   ? 63.962 21.580  43.820 1.00 33.33  ? 874  HOH A O     1 
HETATM 6918 O  O     . HOH U 7 .   ? 46.451 5.805   60.021 1.00 62.98  ? 875  HOH A O     1 
HETATM 6919 O  O     . HOH U 7 .   ? 17.261 22.587  46.187 1.00 83.35  ? 876  HOH A O     1 
HETATM 6920 O  O     . HOH U 7 .   ? 59.230 2.654   31.187 1.00 30.91  ? 877  HOH A O     1 
HETATM 6921 O  O     . HOH U 7 .   ? 67.339 19.586  49.800 1.00 38.47  ? 878  HOH A O     1 
HETATM 6922 O  O     . HOH U 7 .   ? 52.004 4.936   48.050 1.00 49.11  ? 879  HOH A O     1 
HETATM 6923 O  O     . HOH U 7 .   ? 49.890 0.308   24.507 1.00 45.47  ? 880  HOH A O     1 
HETATM 6924 O  O     . HOH U 7 .   ? 45.560 11.781  65.363 1.00 74.91  ? 881  HOH A O     1 
HETATM 6925 O  O     . HOH U 7 .   ? 48.463 9.167   28.916 1.00 109.77 ? 882  HOH A O     1 
HETATM 6926 O  O     . HOH U 7 .   ? 76.999 13.551  33.136 1.00 55.23  ? 883  HOH A O     1 
HETATM 6927 O  O     . HOH U 7 .   ? 67.866 -1.930  39.099 1.00 56.42  ? 884  HOH A O     1 
HETATM 6928 O  O     . HOH U 7 .   ? 65.364 15.589  50.915 1.00 55.50  ? 885  HOH A O     1 
HETATM 6929 O  O     . HOH U 7 .   ? 59.341 -3.509  46.415 1.00 48.66  ? 886  HOH A O     1 
HETATM 6930 O  O     . HOH U 7 .   ? 41.239 11.895  47.966 1.00 70.48  ? 887  HOH A O     1 
HETATM 6931 O  O     . HOH U 7 .   ? 49.731 8.308   46.133 1.00 40.45  ? 888  HOH A O     1 
HETATM 6932 O  O     . HOH U 7 .   ? 38.244 3.419   44.154 1.00 81.30  ? 889  HOH A O     1 
HETATM 6933 O  O     . HOH U 7 .   ? 36.566 2.486   18.276 1.00 50.48  ? 890  HOH A O     1 
HETATM 6934 O  O     . HOH U 7 .   ? 33.419 29.930  43.650 1.00 56.07  ? 891  HOH A O     1 
HETATM 6935 O  O     . HOH U 7 .   ? 50.397 10.792  55.048 1.00 53.51  ? 892  HOH A O     1 
HETATM 6936 O  O     . HOH U 7 .   ? 49.208 13.283  38.019 1.00 38.53  ? 893  HOH A O     1 
HETATM 6937 O  O     . HOH U 7 .   ? 79.921 5.779   36.319 1.00 60.88  ? 894  HOH A O     1 
HETATM 6938 O  O     . HOH U 7 .   ? 38.396 0.734   36.736 1.00 84.09  ? 895  HOH A O     1 
HETATM 6939 O  O     . HOH U 7 .   ? 41.176 10.243  40.260 1.00 40.77  ? 896  HOH A O     1 
HETATM 6940 O  O     . HOH U 7 .   ? 43.192 -3.053  19.351 1.00 103.99 ? 897  HOH A O     1 
HETATM 6941 O  O     . HOH U 7 .   ? 61.828 35.114  44.149 1.00 42.95  ? 898  HOH A O     1 
HETATM 6942 O  O     . HOH U 7 .   ? 48.180 13.695  31.783 1.00 65.16  ? 899  HOH A O     1 
HETATM 6943 O  O     . HOH U 7 .   ? 27.650 16.065  40.187 1.00 60.77  ? 900  HOH A O     1 
HETATM 6944 O  O     . HOH U 7 .   ? 49.853 47.900  33.128 1.00 59.68  ? 901  HOH A O     1 
HETATM 6945 O  O     . HOH U 7 .   ? 45.648 42.263  43.460 1.00 50.56  ? 902  HOH A O     1 
HETATM 6946 O  O     . HOH U 7 .   ? 54.859 45.789  32.065 1.00 39.81  ? 903  HOH A O     1 
HETATM 6947 O  O     . HOH U 7 .   ? 57.489 21.330  42.631 1.00 48.18  ? 904  HOH A O     1 
HETATM 6948 O  O     . HOH U 7 .   ? 47.712 26.918  42.324 1.00 46.83  ? 905  HOH A O     1 
HETATM 6949 O  O     . HOH U 7 .   ? 45.292 1.311   22.612 1.00 82.21  ? 906  HOH A O     1 
HETATM 6950 O  O     . HOH U 7 .   ? 43.615 27.471  60.691 1.00 74.79  ? 907  HOH A O     1 
HETATM 6951 O  O     . HOH U 7 .   ? 48.122 10.078  21.413 1.00 46.42  ? 908  HOH A O     1 
HETATM 6952 O  O     . HOH U 7 .   ? 32.091 16.934  37.069 1.00 83.78  ? 909  HOH A O     1 
HETATM 6953 O  O     . HOH U 7 .   ? 30.046 27.861  61.526 1.00 47.92  ? 910  HOH A O     1 
HETATM 6954 O  O     . HOH U 7 .   ? 27.316 29.267  55.259 1.00 71.42  ? 911  HOH A O     1 
HETATM 6955 O  O     . HOH U 7 .   ? 74.113 16.171  49.360 1.00 49.80  ? 912  HOH A O     1 
HETATM 6956 O  O     . HOH U 7 .   ? 46.701 33.720  39.475 1.00 50.60  ? 913  HOH A O     1 
HETATM 6957 O  O     . HOH U 7 .   ? 43.224 14.474  23.427 1.00 42.20  ? 914  HOH A O     1 
HETATM 6958 O  O     . HOH U 7 .   ? 36.512 -4.136  21.833 1.00 56.33  ? 915  HOH A O     1 
HETATM 6959 O  O     . HOH U 7 .   ? 29.152 4.321   22.723 1.00 54.37  ? 916  HOH A O     1 
HETATM 6960 O  O     . HOH U 7 .   ? 64.023 27.375  46.132 1.00 52.92  ? 917  HOH A O     1 
HETATM 6961 O  O     . HOH U 7 .   ? 58.005 40.147  24.668 1.00 47.15  ? 918  HOH A O     1 
HETATM 6962 O  O     . HOH U 7 .   ? 28.379 8.989   65.447 1.00 69.14  ? 919  HOH A O     1 
HETATM 6963 O  O     . HOH U 7 .   ? 48.807 13.334  25.766 1.00 47.58  ? 920  HOH A O     1 
HETATM 6964 O  O     . HOH U 7 .   ? 64.582 30.173  44.690 1.00 81.30  ? 921  HOH A O     1 
HETATM 6965 O  O     . HOH U 7 .   ? 67.434 26.315  39.527 1.00 53.82  ? 922  HOH A O     1 
HETATM 6966 O  O     . HOH U 7 .   ? 78.561 10.405  37.655 1.00 84.96  ? 923  HOH A O     1 
HETATM 6967 O  O     . HOH U 7 .   ? 54.314 27.738  37.510 1.00 83.04  ? 924  HOH A O     1 
HETATM 6968 O  O     . HOH U 7 .   ? 56.724 20.773  28.046 1.00 53.63  ? 925  HOH A O     1 
HETATM 6969 O  O     . HOH U 7 .   ? 37.627 -8.619  27.815 1.00 56.64  ? 926  HOH A O     1 
HETATM 6970 O  O     . HOH U 7 .   ? 44.691 19.494  70.499 1.00 74.58  ? 927  HOH A O     1 
HETATM 6971 O  O     . HOH U 7 .   ? 23.664 19.319  64.687 1.00 39.64  ? 928  HOH A O     1 
HETATM 6972 O  O     . HOH U 7 .   ? 41.053 7.271   34.443 1.00 104.90 ? 929  HOH A O     1 
HETATM 6973 O  O     . HOH U 7 .   ? 42.292 17.462  33.777 1.00 45.47  ? 930  HOH A O     1 
HETATM 6974 O  O     . HOH U 7 .   ? 58.397 41.546  30.571 1.00 37.93  ? 931  HOH A O     1 
HETATM 6975 O  O     . HOH U 7 .   ? 49.236 12.800  60.102 1.00 48.39  ? 932  HOH A O     1 
HETATM 6976 O  O     . HOH U 7 .   ? 53.212 16.091  27.728 1.00 43.88  ? 933  HOH A O     1 
HETATM 6977 O  O     . HOH U 7 .   ? 18.467 32.339  53.439 1.00 41.55  ? 934  HOH A O     1 
HETATM 6978 O  O     . HOH U 7 .   ? 75.900 14.603  43.084 1.00 55.16  ? 935  HOH A O     1 
HETATM 6979 O  O     . HOH U 7 .   ? 33.670 18.844  37.565 1.00 77.70  ? 936  HOH A O     1 
HETATM 6980 O  O     . HOH U 7 .   ? 54.815 -10.789 32.096 1.00 56.20  ? 937  HOH A O     1 
HETATM 6981 O  O     . HOH U 7 .   ? 73.299 12.469  30.425 1.00 77.19  ? 938  HOH A O     1 
HETATM 6982 O  O     . HOH U 7 .   ? 59.571 0.837   28.631 1.00 44.55  ? 939  HOH A O     1 
HETATM 6983 O  O     . HOH U 7 .   ? 20.308 8.336   45.190 1.00 60.41  ? 940  HOH A O     1 
HETATM 6984 O  O     . HOH U 7 .   ? 24.436 26.387  61.751 1.00 46.27  ? 941  HOH A O     1 
HETATM 6985 O  O     . HOH U 7 .   ? 46.059 11.640  49.163 1.00 50.65  ? 942  HOH A O     1 
HETATM 6986 O  O     . HOH U 7 .   ? 51.143 14.612  35.360 1.00 39.56  ? 943  HOH A O     1 
HETATM 6987 O  O     . HOH U 7 .   ? 23.343 25.681  43.355 1.00 87.97  ? 944  HOH A O     1 
HETATM 6988 O  O     . HOH U 7 .   ? 58.402 42.097  25.535 1.00 57.06  ? 945  HOH A O     1 
HETATM 6989 O  O     . HOH U 7 .   ? 67.066 26.305  46.823 1.00 58.85  ? 946  HOH A O     1 
HETATM 6990 O  O     . HOH U 7 .   ? 47.123 15.216  36.126 1.00 58.49  ? 947  HOH A O     1 
HETATM 6991 O  O     . HOH U 7 .   ? 50.624 9.270   48.967 1.00 49.12  ? 948  HOH A O     1 
HETATM 6992 O  O     . HOH U 7 .   ? 58.587 -0.558  26.960 1.00 44.89  ? 949  HOH A O     1 
HETATM 6993 O  O     . HOH U 7 .   ? 55.535 46.418  34.017 1.00 53.42  ? 950  HOH A O     1 
HETATM 6994 O  O     . HOH U 7 .   ? 67.788 17.735  27.068 1.00 63.93  ? 951  HOH A O     1 
HETATM 6995 O  O     . HOH U 7 .   ? 56.977 39.870  31.181 1.00 68.50  ? 952  HOH A O     1 
HETATM 6996 O  O     . HOH V 7 .   ? 50.124 70.474  47.681 1.00 28.63  ? 805  HOH B O     1 
HETATM 6997 O  O     . HOH V 7 .   ? 46.641 67.014  71.106 1.00 29.35  ? 806  HOH B O     1 
HETATM 6998 O  O     . HOH V 7 .   ? 39.832 62.541  57.482 1.00 38.83  ? 807  HOH B O     1 
HETATM 6999 O  O     . HOH V 7 .   ? 45.459 85.975  61.402 1.00 40.86  ? 808  HOH B O     1 
HETATM 7000 O  O     . HOH V 7 .   ? 39.978 53.694  75.325 1.00 24.94  ? 809  HOH B O     1 
HETATM 7001 O  O     . HOH V 7 .   ? 76.309 64.815  42.400 1.00 38.98  ? 810  HOH B O     1 
HETATM 7002 O  O     . HOH V 7 .   ? 39.802 55.228  77.622 1.00 36.44  ? 811  HOH B O     1 
HETATM 7003 O  O     . HOH V 7 .   ? 37.088 82.697  76.635 1.00 33.18  ? 812  HOH B O     1 
HETATM 7004 O  O     . HOH V 7 .   ? 39.224 82.906  60.042 1.00 36.03  ? 813  HOH B O     1 
HETATM 7005 O  O     . HOH V 7 .   ? 34.110 86.030  62.358 1.00 29.83  ? 814  HOH B O     1 
HETATM 7006 O  O     . HOH V 7 .   ? 30.367 49.288  71.289 1.00 41.11  ? 815  HOH B O     1 
HETATM 7007 O  O     . HOH V 7 .   ? 71.477 61.241  69.113 1.00 33.28  ? 816  HOH B O     1 
HETATM 7008 O  O     . HOH V 7 .   ? 40.648 48.041  63.988 1.00 32.08  ? 817  HOH B O     1 
HETATM 7009 O  O     . HOH V 7 .   ? 66.374 70.241  37.473 1.00 39.77  ? 818  HOH B O     1 
HETATM 7010 O  O     . HOH V 7 .   ? 27.879 53.320  77.220 1.00 34.42  ? 819  HOH B O     1 
HETATM 7011 O  O     . HOH V 7 .   ? 44.156 44.341  66.826 1.00 43.61  ? 820  HOH B O     1 
HETATM 7012 O  O     . HOH V 7 .   ? 46.039 57.248  61.651 1.00 31.55  ? 821  HOH B O     1 
HETATM 7013 O  O     . HOH V 7 .   ? 73.332 74.753  65.404 1.00 46.67  ? 822  HOH B O     1 
HETATM 7014 O  O     . HOH V 7 .   ? 49.752 67.080  75.304 1.00 48.79  ? 823  HOH B O     1 
HETATM 7015 O  O     . HOH V 7 .   ? 44.022 80.161  82.876 1.00 40.81  ? 824  HOH B O     1 
HETATM 7016 O  O     . HOH V 7 .   ? 55.942 43.280  71.655 1.00 36.67  ? 825  HOH B O     1 
HETATM 7017 O  O     . HOH V 7 .   ? 32.827 72.397  64.235 1.00 39.29  ? 826  HOH B O     1 
HETATM 7018 O  O     . HOH V 7 .   ? 44.754 62.764  75.081 1.00 33.18  ? 827  HOH B O     1 
HETATM 7019 O  O     . HOH V 7 .   ? 41.263 46.466  66.386 1.00 34.73  ? 828  HOH B O     1 
HETATM 7020 O  O     . HOH V 7 .   ? 67.094 53.486  78.714 1.00 41.19  ? 829  HOH B O     1 
HETATM 7021 O  O     . HOH V 7 .   ? 28.757 70.706  80.123 1.00 39.96  ? 830  HOH B O     1 
HETATM 7022 O  O     . HOH V 7 .   ? 35.873 92.811  67.128 1.00 35.58  ? 831  HOH B O     1 
HETATM 7023 O  O     . HOH V 7 .   ? 35.746 80.561  62.022 1.00 44.84  ? 832  HOH B O     1 
HETATM 7024 O  O     . HOH V 7 .   ? 61.012 58.726  39.361 1.00 41.31  ? 833  HOH B O     1 
HETATM 7025 O  O     . HOH V 7 .   ? 49.809 61.801  41.971 1.00 39.70  ? 834  HOH B O     1 
HETATM 7026 O  O     . HOH V 7 .   ? 48.698 68.675  46.527 1.00 44.32  ? 835  HOH B O     1 
HETATM 7027 O  O     . HOH V 7 .   ? 25.831 77.468  73.284 1.00 45.29  ? 836  HOH B O     1 
HETATM 7028 O  O     . HOH V 7 .   ? 58.072 48.635  73.751 1.00 36.84  ? 837  HOH B O     1 
HETATM 7029 O  O     . HOH V 7 .   ? 42.473 43.176  68.956 1.00 38.53  ? 838  HOH B O     1 
HETATM 7030 O  O     . HOH V 7 .   ? 68.124 55.256  82.001 1.00 45.30  ? 839  HOH B O     1 
HETATM 7031 O  O     . HOH V 7 .   ? 55.906 62.630  65.593 1.00 41.76  ? 840  HOH B O     1 
HETATM 7032 O  O     . HOH V 7 .   ? 36.443 89.557  80.367 1.00 45.28  ? 841  HOH B O     1 
HETATM 7033 O  O     . HOH V 7 .   ? 53.149 79.024  71.433 1.00 45.79  ? 842  HOH B O     1 
HETATM 7034 O  O     . HOH V 7 .   ? 65.678 57.972  67.301 1.00 35.52  ? 843  HOH B O     1 
HETATM 7035 O  O     . HOH V 7 .   ? 78.681 64.563  54.183 1.00 38.56  ? 844  HOH B O     1 
HETATM 7036 O  O     . HOH V 7 .   ? 61.310 52.060  70.758 1.00 39.40  ? 845  HOH B O     1 
HETATM 7037 O  O     . HOH V 7 .   ? 42.530 53.613  59.378 1.00 35.80  ? 846  HOH B O     1 
HETATM 7038 O  O     . HOH V 7 .   ? 41.380 94.209  79.638 1.00 41.66  ? 847  HOH B O     1 
HETATM 7039 O  O     . HOH V 7 .   ? 69.698 65.972  73.825 1.00 39.35  ? 848  HOH B O     1 
HETATM 7040 O  O     . HOH V 7 .   ? 81.024 74.212  55.743 1.00 52.12  ? 849  HOH B O     1 
HETATM 7041 O  O     . HOH V 7 .   ? 46.736 54.453  80.601 1.00 48.91  ? 850  HOH B O     1 
HETATM 7042 O  O     . HOH V 7 .   ? 69.385 63.348  38.643 1.00 38.46  ? 851  HOH B O     1 
HETATM 7043 O  O     . HOH V 7 .   ? 60.064 43.056  79.204 1.00 44.94  ? 852  HOH B O     1 
HETATM 7044 O  O     . HOH V 7 .   ? 25.542 87.770  64.156 1.00 43.00  ? 853  HOH B O     1 
HETATM 7045 O  O     . HOH V 7 .   ? 72.762 59.823  50.379 1.00 48.40  ? 854  HOH B O     1 
HETATM 7046 O  O     . HOH V 7 .   ? 40.424 94.976  73.643 1.00 42.95  ? 855  HOH B O     1 
HETATM 7047 O  O     . HOH V 7 .   ? 53.917 73.986  46.815 1.00 38.09  ? 856  HOH B O     1 
HETATM 7048 O  O     . HOH V 7 .   ? 31.467 86.122  63.642 1.00 35.84  ? 857  HOH B O     1 
HETATM 7049 O  O     . HOH V 7 .   ? 69.346 56.469  75.707 1.00 46.28  ? 858  HOH B O     1 
HETATM 7050 O  O     . HOH V 7 .   ? 51.147 76.292  41.176 1.00 47.01  ? 859  HOH B O     1 
HETATM 7051 O  O     . HOH V 7 .   ? 42.027 47.970  61.098 1.00 45.98  ? 860  HOH B O     1 
HETATM 7052 O  O     . HOH V 7 .   ? 42.371 73.921  75.732 1.00 37.41  ? 861  HOH B O     1 
HETATM 7053 O  O     . HOH V 7 .   ? 55.769 69.764  71.907 1.00 45.17  ? 862  HOH B O     1 
HETATM 7054 O  O     . HOH V 7 .   ? 47.181 51.353  78.193 1.00 44.08  ? 863  HOH B O     1 
HETATM 7055 O  O     . HOH V 7 .   ? 26.423 75.989  60.792 1.00 79.30  ? 864  HOH B O     1 
HETATM 7056 O  O     . HOH V 7 .   ? 47.630 64.776  68.931 1.00 82.55  ? 865  HOH B O     1 
HETATM 7057 O  O     . HOH V 7 .   ? 27.560 72.765  73.228 1.00 50.79  ? 866  HOH B O     1 
HETATM 7058 O  O     . HOH V 7 .   ? 74.871 69.203  79.201 1.00 49.92  ? 867  HOH B O     1 
HETATM 7059 O  O     . HOH V 7 .   ? 76.942 62.983  44.349 1.00 49.34  ? 868  HOH B O     1 
HETATM 7060 O  O     . HOH V 7 .   ? 78.030 66.249  58.560 1.00 52.03  ? 869  HOH B O     1 
HETATM 7061 O  O     . HOH V 7 .   ? 38.150 94.051  74.629 1.00 37.34  ? 870  HOH B O     1 
HETATM 7062 O  O     . HOH V 7 .   ? 44.788 62.639  39.891 1.00 55.03  ? 871  HOH B O     1 
HETATM 7063 O  O     . HOH V 7 .   ? 65.538 65.430  88.143 1.00 85.14  ? 872  HOH B O     1 
HETATM 7064 O  O     . HOH V 7 .   ? 76.838 60.417  68.413 1.00 56.39  ? 873  HOH B O     1 
HETATM 7065 O  O     . HOH V 7 .   ? 39.843 53.664  79.895 1.00 51.34  ? 874  HOH B O     1 
HETATM 7066 O  O     . HOH V 7 .   ? 60.947 48.421  75.097 1.00 40.36  ? 875  HOH B O     1 
HETATM 7067 O  O     . HOH V 7 .   ? 44.497 56.365  59.680 1.00 40.35  ? 876  HOH B O     1 
HETATM 7068 O  O     . HOH V 7 .   ? 37.068 47.335  77.978 1.00 47.90  ? 877  HOH B O     1 
HETATM 7069 O  O     . HOH V 7 .   ? 46.528 67.101  47.443 1.00 48.72  ? 878  HOH B O     1 
HETATM 7070 O  O     . HOH V 7 .   ? 47.877 46.317  61.840 1.00 54.23  ? 879  HOH B O     1 
HETATM 7071 O  O     . HOH V 7 .   ? 64.407 82.483  56.936 1.00 59.57  ? 880  HOH B O     1 
HETATM 7072 O  O     . HOH V 7 .   ? 63.103 50.044  70.318 1.00 59.95  ? 881  HOH B O     1 
HETATM 7073 O  O     . HOH V 7 .   ? 57.841 60.743  41.125 1.00 53.87  ? 882  HOH B O     1 
HETATM 7074 O  O     . HOH V 7 .   ? 39.163 81.014  75.989 1.00 97.68  ? 883  HOH B O     1 
HETATM 7075 O  O     . HOH V 7 .   ? 42.064 64.420  75.103 1.00 98.76  ? 884  HOH B O     1 
HETATM 7076 O  O     . HOH V 7 .   ? 31.751 49.454  73.799 1.00 59.75  ? 885  HOH B O     1 
HETATM 7077 O  O     . HOH V 7 .   ? 26.450 73.688  82.211 1.00 53.21  ? 886  HOH B O     1 
HETATM 7078 O  O     . HOH V 7 .   ? 38.207 47.207  63.059 1.00 44.54  ? 887  HOH B O     1 
HETATM 7079 O  O     . HOH V 7 .   ? 54.792 71.756  82.178 1.00 58.41  ? 888  HOH B O     1 
HETATM 7080 O  O     . HOH V 7 .   ? 52.738 91.904  75.754 1.00 74.65  ? 889  HOH B O     1 
HETATM 7081 O  O     . HOH V 7 .   ? 46.839 61.679  74.940 1.00 84.42  ? 890  HOH B O     1 
HETATM 7082 O  O     . HOH V 7 .   ? 69.283 87.186  51.086 1.00 53.59  ? 891  HOH B O     1 
HETATM 7083 O  O     . HOH V 7 .   ? 38.740 51.516  56.760 1.00 44.77  ? 892  HOH B O     1 
HETATM 7084 O  O     . HOH V 7 .   ? 39.663 83.450  57.435 1.00 46.70  ? 893  HOH B O     1 
HETATM 7085 O  O     . HOH V 7 .   ? 46.893 87.111  80.703 1.00 58.09  ? 894  HOH B O     1 
HETATM 7086 O  O     . HOH V 7 .   ? 49.752 44.719  76.430 1.00 36.14  ? 895  HOH B O     1 
HETATM 7087 O  O     . HOH V 7 .   ? 52.609 53.764  82.811 1.00 49.83  ? 896  HOH B O     1 
HETATM 7088 O  O     . HOH V 7 .   ? 30.170 67.899  59.862 1.00 53.34  ? 897  HOH B O     1 
HETATM 7089 O  O     . HOH V 7 .   ? 29.037 90.718  68.127 1.00 49.95  ? 898  HOH B O     1 
HETATM 7090 O  O     . HOH V 7 .   ? 73.247 63.244  62.304 1.00 49.64  ? 899  HOH B O     1 
HETATM 7091 O  O     . HOH V 7 .   ? 81.919 75.634  57.955 1.00 60.90  ? 900  HOH B O     1 
HETATM 7092 O  O     . HOH V 7 .   ? 40.700 89.846  52.490 1.00 51.30  ? 901  HOH B O     1 
HETATM 7093 O  O     . HOH V 7 .   ? 34.810 45.992  67.219 1.00 53.12  ? 902  HOH B O     1 
HETATM 7094 O  O     . HOH V 7 .   ? 30.081 84.059  62.467 1.00 50.58  ? 903  HOH B O     1 
HETATM 7095 O  O     . HOH V 7 .   ? 25.660 67.326  60.994 1.00 53.18  ? 904  HOH B O     1 
HETATM 7096 O  O     . HOH V 7 .   ? 82.084 71.670  57.467 1.00 67.15  ? 905  HOH B O     1 
HETATM 7097 O  O     . HOH V 7 .   ? 32.285 85.698  83.910 1.00 59.91  ? 906  HOH B O     1 
HETATM 7098 O  O     . HOH V 7 .   ? 76.312 63.801  54.040 1.00 93.22  ? 907  HOH B O     1 
HETATM 7099 O  O     . HOH V 7 .   ? 52.973 58.249  60.076 1.00 58.06  ? 908  HOH B O     1 
HETATM 7100 O  O     . HOH V 7 .   ? 71.251 69.688  38.832 1.00 51.93  ? 909  HOH B O     1 
HETATM 7101 O  O     . HOH V 7 .   ? 51.997 72.539  37.746 1.00 44.76  ? 910  HOH B O     1 
HETATM 7102 O  O     . HOH V 7 .   ? 42.903 68.689  65.977 1.00 61.85  ? 911  HOH B O     1 
HETATM 7103 O  O     . HOH V 7 .   ? 22.563 69.192  67.190 1.00 59.01  ? 912  HOH B O     1 
HETATM 7104 O  O     . HOH V 7 .   ? 34.140 42.896  68.481 1.00 51.59  ? 913  HOH B O     1 
HETATM 7105 O  O     . HOH V 7 .   ? 17.648 60.277  75.552 1.00 57.25  ? 914  HOH B O     1 
HETATM 7106 O  O     . HOH V 7 .   ? 18.419 62.144  77.556 1.00 49.70  ? 915  HOH B O     1 
HETATM 7107 O  O     . HOH V 7 .   ? 53.392 88.927  69.989 1.00 43.53  ? 916  HOH B O     1 
HETATM 7108 O  O     . HOH V 7 .   ? 65.229 76.031  37.346 1.00 52.34  ? 917  HOH B O     1 
HETATM 7109 O  O     . HOH V 7 .   ? 58.552 46.493  71.817 1.00 45.93  ? 918  HOH B O     1 
HETATM 7110 O  O     . HOH V 7 .   ? 70.729 71.582  34.374 1.00 54.34  ? 919  HOH B O     1 
HETATM 7111 O  O     . HOH V 7 .   ? 46.884 46.392  70.831 1.00 42.37  ? 920  HOH B O     1 
HETATM 7112 O  O     . HOH V 7 .   ? 26.862 68.433  80.352 1.00 58.73  ? 921  HOH B O     1 
HETATM 7113 O  O     . HOH V 7 .   ? 40.504 95.658  67.814 1.00 91.72  ? 922  HOH B O     1 
HETATM 7114 O  O     . HOH V 7 .   ? 83.130 74.943  51.970 1.00 59.01  ? 923  HOH B O     1 
HETATM 7115 O  O     . HOH V 7 .   ? 54.708 64.636  76.537 1.00 44.83  ? 924  HOH B O     1 
HETATM 7116 O  O     . HOH V 7 .   ? 80.890 63.778  52.176 1.00 53.77  ? 925  HOH B O     1 
HETATM 7117 O  O     . HOH V 7 .   ? 27.118 74.555  62.691 1.00 52.31  ? 926  HOH B O     1 
HETATM 7118 O  O     . HOH V 7 .   ? 45.375 62.850  70.375 1.00 60.43  ? 927  HOH B O     1 
HETATM 7119 O  O     . HOH V 7 .   ? 23.040 71.675  75.518 1.00 38.08  ? 928  HOH B O     1 
HETATM 7120 O  O     . HOH V 7 .   ? 50.076 53.303  83.392 1.00 52.60  ? 929  HOH B O     1 
HETATM 7121 O  O     . HOH V 7 .   ? 75.605 69.768  68.381 1.00 41.27  ? 930  HOH B O     1 
HETATM 7122 O  O     . HOH V 7 .   ? 69.680 87.977  48.363 1.00 55.67  ? 931  HOH B O     1 
HETATM 7123 O  O     . HOH V 7 .   ? 65.905 85.503  59.698 1.00 57.15  ? 932  HOH B O     1 
HETATM 7124 O  O     . HOH V 7 .   ? 67.399 85.304  62.001 1.00 54.26  ? 933  HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DG  1   1801 1801 DG  G   C . n 
A 1 2   DG  2   1802 1802 DG  G   C . n 
A 1 3   DG  3   1803 1803 DG  G   C . n 
A 1 4   DG  4   1804 1804 DG  G   C . n 
A 1 5   DG  5   1805 1805 DG  G   C . n 
A 1 6   DA  6   1806 1806 DA  A   C . n 
A 1 7   DA  7   1807 1807 DA  A   C . n 
A 1 8   DG  8   1808 1808 DG  G   C . n 
A 1 9   DG  9   1809 1809 DG  G   C . n 
A 1 10  DA  10  1810 1810 DA  A   C . n 
A 1 11  DC  11  1811 1811 DC  C   C . n 
A 1 12  DT  12  1812 1812 DT  T   C . n 
A 1 13  DC  13  1813 1813 DC  C   C . n 
B 2 1   DT  1   1902 1902 DT  T   D . n 
B 2 2   DC  2   1903 1903 DC  C   D . n 
B 2 3   DA  3   1904 1904 DA  A   D . n 
B 2 4   DG  4   1905 1905 DG  G   D . n 
B 2 5   DT  5   1906 1906 DT  T   D . n 
B 2 6   DA  6   1907 1907 DA  A   D . n 
B 2 7   DG  7   1908 1908 DG  G   D . n 
B 2 8   DT  8   1909 1909 DT  T   D . n 
B 2 9   DC  9   1910 1910 DC  C   D . n 
B 2 10  DC  10  1911 1911 DC  C   D . n 
B 2 11  DT  11  1912 1912 DT  T   D . n 
B 2 12  DT  12  1913 1913 DT  T   D . n 
B 2 13  DC  13  1914 1914 DC  C   D . n 
B 2 14  DC  14  1915 1915 DC  C   D . n 
B 2 15  DC  15  1916 1916 DC  C   D . n 
B 2 16  DC  16  1917 1917 DC  C   D . n 
B 2 17  DC  17  1918 1918 DC  C   D . n 
C 1 1   DG  1   1801 1801 DG  G   E . n 
C 1 2   DG  2   1802 1802 DG  G   E . n 
C 1 3   DG  3   1803 1803 DG  G   E . n 
C 1 4   DG  4   1804 1804 DG  G   E . n 
C 1 5   DG  5   1805 1805 DG  G   E . n 
C 1 6   DA  6   1806 1806 DA  A   E . n 
C 1 7   DA  7   1807 1807 DA  A   E . n 
C 1 8   DG  8   1808 1808 DG  G   E . n 
C 1 9   DG  9   1809 1809 DG  G   E . n 
C 1 10  DA  10  1810 1810 DA  A   E . n 
C 1 11  DC  11  1811 1811 DC  C   E . n 
C 1 12  DT  12  1812 1812 DT  T   E . n 
C 1 13  DC  13  1813 1813 DC  C   E . n 
D 2 1   DT  1   1902 1902 DT  T   F . n 
D 2 2   DC  2   1903 1903 DC  C   F . n 
D 2 3   DA  3   1904 1904 DA  A   F . n 
D 2 4   DG  4   1905 1905 DG  G   F . n 
D 2 5   DT  5   1906 1906 DT  T   F . n 
D 2 6   DA  6   1907 1907 DA  A   F . n 
D 2 7   DG  7   1908 1908 DG  G   F . n 
D 2 8   DT  8   1909 1909 DT  T   F . n 
D 2 9   DC  9   1910 1910 DC  C   F . n 
D 2 10  DC  10  1911 1911 DC  C   F . n 
D 2 11  DT  11  1912 1912 DT  T   F . n 
D 2 12  DT  12  1913 1913 DT  T   F . n 
D 2 13  DC  13  1914 1914 DC  C   F . n 
D 2 14  DC  14  1915 1915 DC  C   F . n 
D 2 15  DC  15  1916 1916 DC  C   F . n 
D 2 16  DC  16  1917 1917 DC  C   F . n 
D 2 17  DC  17  1918 1918 DC  C   F . n 
E 3 1   MET 1   1    1    MET MET A . n 
E 3 2   ILE 2   2    2    ILE ILE A . n 
E 3 3   VAL 3   3    3    VAL VAL A . n 
E 3 4   LEU 4   4    4    LEU LEU A . n 
E 3 5   PHE 5   5    5    PHE PHE A . n 
E 3 6   VAL 6   6    6    VAL VAL A . n 
E 3 7   ASP 7   7    7    ASP ASP A . n 
E 3 8   PHE 8   8    8    PHE PHE A . n 
E 3 9   ASP 9   9    9    ASP ASP A . n 
E 3 10  TYR 10  10   10   TYR TYR A . n 
E 3 11  PHE 11  11   11   PHE PHE A . n 
E 3 12  TYR 12  12   12   TYR TYR A . n 
E 3 13  ALA 13  13   13   ALA ALA A . n 
E 3 14  GLN 14  14   14   GLN GLN A . n 
E 3 15  VAL 15  15   15   VAL VAL A . n 
E 3 16  GLU 16  16   16   GLU GLU A . n 
E 3 17  GLU 17  17   17   GLU GLU A . n 
E 3 18  VAL 18  18   18   VAL VAL A . n 
E 3 19  LEU 19  19   19   LEU LEU A . n 
E 3 20  ASN 20  20   20   ASN ASN A . n 
E 3 21  PRO 21  21   21   PRO PRO A . n 
E 3 22  SER 22  22   22   SER SER A . n 
E 3 23  LEU 23  23   23   LEU LEU A . n 
E 3 24  LYS 24  24   24   LYS LYS A . n 
E 3 25  GLY 25  25   25   GLY GLY A . n 
E 3 26  LYS 26  26   26   LYS LYS A . n 
E 3 27  PRO 27  27   27   PRO PRO A . n 
E 3 28  VAL 28  28   28   VAL VAL A . n 
E 3 29  VAL 29  29   29   VAL VAL A . n 
E 3 30  VAL 30  30   30   VAL VAL A . n 
E 3 31  CYS 31  31   31   CYS CYS A . n 
E 3 32  VAL 32  32   32   VAL VAL A . n 
E 3 33  PHE 33  33   33   PHE PHE A . n 
E 3 34  SER 34  34   34   SER SER A . n 
E 3 35  GLY 35  35   35   GLY GLY A . n 
E 3 36  ARG 36  36   36   ARG ARG A . n 
E 3 37  PHE 37  37   37   PHE PHE A . n 
E 3 38  GLU 38  38   38   GLU GLU A . n 
E 3 39  ASP 39  39   39   ASP ASP A . n 
E 3 40  SER 40  40   40   SER SER A . n 
E 3 41  GLY 41  41   41   GLY GLY A . n 
E 3 42  ALA 42  42   42   ALA ALA A . n 
E 3 43  VAL 43  43   43   VAL VAL A . n 
E 3 44  ALA 44  44   44   ALA ALA A . n 
E 3 45  THR 45  45   45   THR THR A . n 
E 3 46  ALA 46  46   46   ALA ALA A . n 
E 3 47  ASN 47  47   47   ASN ASN A . n 
E 3 48  TYR 48  48   48   TYR TYR A . n 
E 3 49  GLU 49  49   49   GLU GLU A . n 
E 3 50  ALA 50  50   50   ALA ALA A . n 
E 3 51  ARG 51  51   51   ARG ARG A . n 
E 3 52  LYS 52  52   52   LYS LYS A . n 
E 3 53  PHE 53  53   53   PHE PHE A . n 
E 3 54  GLY 54  54   54   GLY GLY A . n 
E 3 55  VAL 55  55   55   VAL VAL A . n 
E 3 56  LYS 56  56   56   LYS LYS A . n 
E 3 57  ALA 57  57   57   ALA ALA A . n 
E 3 58  GLY 58  58   58   GLY GLY A . n 
E 3 59  ILE 59  59   59   ILE ILE A . n 
E 3 60  PRO 60  60   60   PRO PRO A . n 
E 3 61  ILE 61  61   61   ILE ILE A . n 
E 3 62  VAL 62  62   62   VAL VAL A . n 
E 3 63  GLU 63  63   63   GLU GLU A . n 
E 3 64  ALA 64  64   64   ALA ALA A . n 
E 3 65  LYS 65  65   65   LYS LYS A . n 
E 3 66  LYS 66  66   66   LYS LYS A . n 
E 3 67  ILE 67  67   67   ILE ILE A . n 
E 3 68  LEU 68  68   68   LEU LEU A . n 
E 3 69  PRO 69  69   69   PRO PRO A . n 
E 3 70  ASN 70  70   70   ASN ASN A . n 
E 3 71  ALA 71  71   71   ALA ALA A . n 
E 3 72  VAL 72  72   72   VAL VAL A . n 
E 3 73  TYR 73  73   73   TYR TYR A . n 
E 3 74  LEU 74  74   74   LEU LEU A . n 
E 3 75  PRO 75  75   75   PRO PRO A . n 
E 3 76  MET 76  76   76   MET MET A . n 
E 3 77  ARG 77  77   77   ARG ARG A . n 
E 3 78  LYS 78  78   78   LYS LYS A . n 
E 3 79  GLU 79  79   79   GLU GLU A . n 
E 3 80  VAL 80  80   80   VAL VAL A . n 
E 3 81  TYR 81  81   81   TYR TYR A . n 
E 3 82  GLN 82  82   82   GLN GLN A . n 
E 3 83  GLN 83  83   83   GLN GLN A . n 
E 3 84  VAL 84  84   84   VAL VAL A . n 
E 3 85  SER 85  85   85   SER SER A . n 
E 3 86  SER 86  86   86   SER SER A . n 
E 3 87  ARG 87  87   87   ARG ARG A . n 
E 3 88  ILE 88  88   88   ILE ILE A . n 
E 3 89  MET 89  89   89   MET MET A . n 
E 3 90  ASN 90  90   90   ASN ASN A . n 
E 3 91  LEU 91  91   91   LEU LEU A . n 
E 3 92  LEU 92  92   92   LEU LEU A . n 
E 3 93  ARG 93  93   93   ARG ARG A . n 
E 3 94  GLU 94  94   94   GLU GLU A . n 
E 3 95  TYR 95  95   95   TYR TYR A . n 
E 3 96  SER 96  96   96   SER SER A . n 
E 3 97  GLU 97  97   97   GLU GLU A . n 
E 3 98  LYS 98  98   98   LYS LYS A . n 
E 3 99  ILE 99  99   99   ILE ILE A . n 
E 3 100 GLU 100 100  100  GLU GLU A . n 
E 3 101 ILE 101 101  101  ILE ILE A . n 
E 3 102 ALA 102 102  102  ALA ALA A . n 
E 3 103 SER 103 103  103  SER SER A . n 
E 3 104 ILE 104 104  104  ILE ILE A . n 
E 3 105 ASP 105 105  105  ASP ASP A . n 
E 3 106 GLU 106 106  106  GLU GLU A . n 
E 3 107 ALA 107 107  107  ALA ALA A . n 
E 3 108 TYR 108 108  108  TYR TYR A . n 
E 3 109 LEU 109 109  109  LEU LEU A . n 
E 3 110 ASP 110 110  110  ASP ASP A . n 
E 3 111 ILE 111 111  111  ILE ILE A . n 
E 3 112 SER 112 112  112  SER SER A . n 
E 3 113 ASP 113 113  113  ASP ASP A . n 
E 3 114 LYS 114 114  114  LYS LYS A . n 
E 3 115 VAL 115 115  115  VAL VAL A . n 
E 3 116 ARG 116 116  116  ARG ARG A . n 
E 3 117 ASP 117 117  117  ASP ASP A . n 
E 3 118 TYR 118 118  118  TYR TYR A . n 
E 3 119 ARG 119 119  119  ARG ARG A . n 
E 3 120 GLU 120 120  120  GLU GLU A . n 
E 3 121 ALA 121 121  121  ALA ALA A . n 
E 3 122 TYR 122 122  122  TYR TYR A . n 
E 3 123 ASN 123 123  123  ASN ASN A . n 
E 3 124 LEU 124 124  124  LEU LEU A . n 
E 3 125 GLY 125 125  125  GLY GLY A . n 
E 3 126 LEU 126 126  126  LEU LEU A . n 
E 3 127 GLU 127 127  127  GLU GLU A . n 
E 3 128 ILE 128 128  128  ILE ILE A . n 
E 3 129 LYS 129 129  129  LYS LYS A . n 
E 3 130 ASN 130 130  130  ASN ASN A . n 
E 3 131 LYS 131 131  131  LYS LYS A . n 
E 3 132 ILE 132 132  132  ILE ILE A . n 
E 3 133 LEU 133 133  133  LEU LEU A . n 
E 3 134 GLU 134 134  134  GLU GLU A . n 
E 3 135 LYS 135 135  135  LYS LYS A . n 
E 3 136 GLU 136 136  136  GLU GLU A . n 
E 3 137 LYS 137 137  137  LYS LYS A . n 
E 3 138 ILE 138 138  138  ILE ILE A . n 
E 3 139 THR 139 139  139  THR THR A . n 
E 3 140 VAL 140 140  140  VAL VAL A . n 
E 3 141 THR 141 141  141  THR THR A . n 
E 3 142 VAL 142 142  142  VAL VAL A . n 
E 3 143 GLY 143 143  143  GLY GLY A . n 
E 3 144 ILE 144 144  144  ILE ILE A . n 
E 3 145 SER 145 145  145  SER SER A . n 
E 3 146 LYS 146 146  146  LYS LYS A . n 
E 3 147 ASN 147 147  147  ASN ASN A . n 
E 3 148 LYS 148 148  148  LYS LYS A . n 
E 3 149 VAL 149 149  149  VAL VAL A . n 
E 3 150 PHE 150 150  150  PHE PHE A . n 
E 3 151 ALA 151 151  151  ALA ALA A . n 
E 3 152 LYS 152 152  152  LYS LYS A . n 
E 3 153 ILE 153 153  153  ILE ILE A . n 
E 3 154 ALA 154 154  154  ALA ALA A . n 
E 3 155 ALA 155 155  155  ALA ALA A . n 
E 3 156 ASP 156 156  156  ASP ASP A . n 
E 3 157 MET 157 157  157  MET MET A . n 
E 3 158 ALA 158 158  158  ALA ALA A . n 
E 3 159 LYS 159 159  159  LYS LYS A . n 
E 3 160 PRO 160 160  160  PRO PRO A . n 
E 3 161 ASN 161 161  161  ASN ASN A . n 
E 3 162 GLY 162 162  162  GLY GLY A . n 
E 3 163 ILE 163 163  163  ILE ILE A . n 
E 3 164 LYS 164 164  164  LYS LYS A . n 
E 3 165 VAL 165 165  165  VAL VAL A . n 
E 3 166 ILE 166 166  166  ILE ILE A . n 
E 3 167 ASP 167 167  167  ASP ASP A . n 
E 3 168 ASP 168 168  168  ASP ASP A . n 
E 3 169 GLU 169 169  169  GLU GLU A . n 
E 3 170 GLU 170 170  170  GLU GLU A . n 
E 3 171 VAL 171 171  171  VAL VAL A . n 
E 3 172 LYS 172 172  172  LYS LYS A . n 
E 3 173 ARG 173 173  173  ARG ARG A . n 
E 3 174 LEU 174 174  174  LEU LEU A . n 
E 3 175 ILE 175 175  175  ILE ILE A . n 
E 3 176 ARG 176 176  176  ARG ARG A . n 
E 3 177 GLU 177 177  177  GLU GLU A . n 
E 3 178 LEU 178 178  178  LEU LEU A . n 
E 3 179 ASP 179 179  179  ASP ASP A . n 
E 3 180 ILE 180 180  180  ILE ILE A . n 
E 3 181 ALA 181 181  181  ALA ALA A . n 
E 3 182 ASP 182 182  182  ASP ASP A . n 
E 3 183 VAL 183 183  183  VAL VAL A . n 
E 3 184 PRO 184 184  184  PRO PRO A . n 
E 3 185 GLY 185 185  185  GLY GLY A . n 
E 3 186 ILE 186 186  186  ILE ILE A . n 
E 3 187 GLY 187 187  187  GLY GLY A . n 
E 3 188 ASN 188 188  188  ASN ASN A . n 
E 3 189 ILE 189 189  189  ILE ILE A . n 
E 3 190 THR 190 190  190  THR THR A . n 
E 3 191 ALA 191 191  191  ALA ALA A . n 
E 3 192 GLU 192 192  192  GLU GLU A . n 
E 3 193 LYS 193 193  193  LYS LYS A . n 
E 3 194 LEU 194 194  194  LEU LEU A . n 
E 3 195 LYS 195 195  195  LYS LYS A . n 
E 3 196 LYS 196 196  196  LYS LYS A . n 
E 3 197 LEU 197 197  197  LEU LEU A . n 
E 3 198 GLY 198 198  198  GLY GLY A . n 
E 3 199 ILE 199 199  199  ILE ILE A . n 
E 3 200 ASN 200 200  200  ASN ASN A . n 
E 3 201 LYS 201 201  201  LYS LYS A . n 
E 3 202 LEU 202 202  202  LEU LEU A . n 
E 3 203 VAL 203 203  203  VAL VAL A . n 
E 3 204 ASP 204 204  204  ASP ASP A . n 
E 3 205 THR 205 205  205  THR THR A . n 
E 3 206 LEU 206 206  206  LEU LEU A . n 
E 3 207 SER 207 207  207  SER SER A . n 
E 3 208 ILE 208 208  208  ILE ILE A . n 
E 3 209 GLU 209 209  209  GLU GLU A . n 
E 3 210 PHE 210 210  210  PHE PHE A . n 
E 3 211 ASP 211 211  211  ASP ASP A . n 
E 3 212 LYS 212 212  212  LYS LYS A . n 
E 3 213 LEU 213 213  213  LEU LEU A . n 
E 3 214 LYS 214 214  214  LYS LYS A . n 
E 3 215 GLY 215 215  215  GLY GLY A . n 
E 3 216 MET 216 216  216  MET MET A . n 
E 3 217 ILE 217 217  217  ILE ILE A . n 
E 3 218 GLY 218 218  218  GLY GLY A . n 
E 3 219 GLU 219 219  219  GLU GLU A . n 
E 3 220 ALA 220 220  220  ALA ALA A . n 
E 3 221 LYS 221 221  221  LYS LYS A . n 
E 3 222 ALA 222 222  222  ALA ALA A . n 
E 3 223 LYS 223 223  223  LYS LYS A . n 
E 3 224 TYR 224 224  224  TYR TYR A . n 
E 3 225 LEU 225 225  225  LEU LEU A . n 
E 3 226 ILE 226 226  226  ILE ILE A . n 
E 3 227 SER 227 227  227  SER SER A . n 
E 3 228 LEU 228 228  228  LEU LEU A . n 
E 3 229 ALA 229 229  229  ALA ALA A . n 
E 3 230 ARG 230 230  230  ARG ARG A . n 
E 3 231 ASP 231 231  231  ASP ASP A . n 
E 3 232 GLU 232 232  232  GLU GLU A . n 
E 3 233 TYR 233 233  233  TYR TYR A . n 
E 3 234 ASN 234 234  234  ASN ASN A . n 
E 3 235 GLU 235 235  235  GLU GLU A . n 
E 3 236 PRO 236 236  236  PRO PRO A . n 
E 3 237 ILE 237 237  237  ILE ILE A . n 
E 3 238 ARG 238 238  238  ARG ARG A . n 
E 3 239 THR 239 239  239  THR THR A . n 
E 3 240 ARG 240 240  240  ARG ARG A . n 
E 3 241 VAL 241 241  241  VAL VAL A . n 
E 3 242 ARG 242 242  242  ARG ARG A . n 
E 3 243 LYS 243 243  243  LYS LYS A . n 
E 3 244 SER 244 244  244  SER SER A . n 
E 3 245 ILE 245 245  245  ILE ILE A . n 
E 3 246 GLY 246 246  246  GLY GLY A . n 
E 3 247 ARG 247 247  247  ARG ARG A . n 
E 3 248 ILE 248 248  248  ILE ILE A . n 
E 3 249 VAL 249 249  249  VAL VAL A . n 
E 3 250 THR 250 250  250  THR THR A . n 
E 3 251 MET 251 251  251  MET MET A . n 
E 3 252 LYS 252 252  252  LYS LYS A . n 
E 3 253 ARG 253 253  253  ARG ARG A . n 
E 3 254 ASN 254 254  254  ASN ASN A . n 
E 3 255 SER 255 255  255  SER SER A . n 
E 3 256 ARG 256 256  256  ARG ARG A . n 
E 3 257 ASN 257 257  257  ASN ASN A . n 
E 3 258 LEU 258 258  258  LEU LEU A . n 
E 3 259 GLU 259 259  259  GLU GLU A . n 
E 3 260 GLU 260 260  260  GLU GLU A . n 
E 3 261 ILE 261 261  261  ILE ILE A . n 
E 3 262 LYS 262 262  262  LYS LYS A . n 
E 3 263 PRO 263 263  263  PRO PRO A . n 
E 3 264 TYR 264 264  264  TYR TYR A . n 
E 3 265 LEU 265 265  265  LEU LEU A . n 
E 3 266 PHE 266 266  266  PHE PHE A . n 
E 3 267 ARG 267 267  267  ARG ARG A . n 
E 3 268 ALA 268 268  268  ALA ALA A . n 
E 3 269 ILE 269 269  269  ILE ILE A . n 
E 3 270 GLU 270 270  270  GLU GLU A . n 
E 3 271 GLU 271 271  271  GLU GLU A . n 
E 3 272 SER 272 272  272  SER SER A . n 
E 3 273 TYR 273 273  273  TYR TYR A . n 
E 3 274 TYR 274 274  274  TYR TYR A . n 
E 3 275 LYS 275 275  275  LYS LYS A . n 
E 3 276 LEU 276 276  276  LEU LEU A . n 
E 3 277 ASP 277 277  277  ASP ASP A . n 
E 3 278 LYS 278 278  278  LYS LYS A . n 
E 3 279 ARG 279 279  279  ARG ARG A . n 
E 3 280 ILE 280 280  280  ILE ILE A . n 
E 3 281 PRO 281 281  281  PRO PRO A . n 
E 3 282 LYS 282 282  282  LYS LYS A . n 
E 3 283 ALA 283 283  283  ALA ALA A . n 
E 3 284 ILE 284 284  284  ILE ILE A . n 
E 3 285 HIS 285 285  285  HIS HIS A . n 
E 3 286 VAL 286 286  286  VAL VAL A . n 
E 3 287 VAL 287 287  287  VAL VAL A . n 
E 3 288 ALA 288 288  288  ALA ALA A . n 
E 3 289 VAL 289 289  289  VAL VAL A . n 
E 3 290 THR 290 290  290  THR THR A . n 
E 3 291 GLU 291 291  291  GLU GLU A . n 
E 3 292 ASP 292 292  292  ASP ASP A . n 
E 3 293 LEU 293 293  293  LEU LEU A . n 
E 3 294 ASP 294 294  294  ASP ASP A . n 
E 3 295 ILE 295 295  295  ILE ILE A . n 
E 3 296 VAL 296 296  296  VAL VAL A . n 
E 3 297 SER 297 297  297  SER SER A . n 
E 3 298 ARG 298 298  298  ARG ARG A . n 
E 3 299 GLY 299 299  299  GLY GLY A . n 
E 3 300 ARG 300 300  300  ARG ARG A . n 
E 3 301 THR 301 301  301  THR THR A . n 
E 3 302 PHE 302 302  302  PHE PHE A . n 
E 3 303 PRO 303 303  303  PRO PRO A . n 
E 3 304 HIS 304 304  304  HIS HIS A . n 
E 3 305 GLY 305 305  305  GLY GLY A . n 
E 3 306 ILE 306 306  306  ILE ILE A . n 
E 3 307 SER 307 307  307  SER SER A . n 
E 3 308 LYS 308 308  308  LYS LYS A . n 
E 3 309 GLU 309 309  309  GLU GLU A . n 
E 3 310 THR 310 310  310  THR THR A . n 
E 3 311 ALA 311 311  311  ALA ALA A . n 
E 3 312 TYR 312 312  312  TYR TYR A . n 
E 3 313 SER 313 313  313  SER SER A . n 
E 3 314 GLU 314 314  314  GLU GLU A . n 
E 3 315 SER 315 315  315  SER SER A . n 
E 3 316 VAL 316 316  316  VAL VAL A . n 
E 3 317 LYS 317 317  317  LYS LYS A . n 
E 3 318 LEU 318 318  318  LEU LEU A . n 
E 3 319 LEU 319 319  319  LEU LEU A . n 
E 3 320 GLN 320 320  320  GLN GLN A . n 
E 3 321 LYS 321 321  321  LYS LYS A . n 
E 3 322 ILE 322 322  322  ILE ILE A . n 
E 3 323 LEU 323 323  323  LEU LEU A . n 
E 3 324 GLU 324 324  324  GLU GLU A . n 
E 3 325 GLU 325 325  325  GLU GLU A . n 
E 3 326 ASP 326 326  326  ASP ASP A . n 
E 3 327 GLU 327 327  327  GLU GLU A . n 
E 3 328 ARG 328 328  328  ARG ARG A . n 
E 3 329 LYS 329 329  329  LYS LYS A . n 
E 3 330 ILE 330 330  330  ILE ILE A . n 
E 3 331 ARG 331 331  331  ARG ARG A . n 
E 3 332 ARG 332 332  332  ARG ARG A . n 
E 3 333 ILE 333 333  333  ILE ILE A . n 
E 3 334 GLY 334 334  334  GLY GLY A . n 
E 3 335 VAL 335 335  335  VAL VAL A . n 
E 3 336 ARG 336 336  336  ARG ARG A . n 
E 3 337 PHE 337 337  337  PHE PHE A . n 
E 3 338 SER 338 338  338  SER SER A . n 
E 3 339 LYS 339 339  339  LYS LYS A . n 
E 3 340 PHE 340 340  340  PHE PHE A . n 
E 3 341 ILE 341 341  341  ILE ILE A . n 
E 3 342 GLU 342 342  ?    ?   ?   A . n 
E 3 343 ALA 343 343  ?    ?   ?   A . n 
E 3 344 ILE 344 344  ?    ?   ?   A . n 
E 3 345 GLY 345 345  ?    ?   ?   A . n 
E 3 346 LEU 346 346  ?    ?   ?   A . n 
E 3 347 ASP 347 347  ?    ?   ?   A . n 
E 3 348 LYS 348 348  ?    ?   ?   A . n 
E 3 349 PHE 349 349  ?    ?   ?   A . n 
E 3 350 PHE 350 350  ?    ?   ?   A . n 
E 3 351 ASP 351 351  ?    ?   ?   A . n 
E 3 352 THR 352 352  ?    ?   ?   A . n 
F 3 1   MET 1   1    1    MET MET B . n 
F 3 2   ILE 2   2    2    ILE ILE B . n 
F 3 3   VAL 3   3    3    VAL VAL B . n 
F 3 4   LEU 4   4    4    LEU LEU B . n 
F 3 5   PHE 5   5    5    PHE PHE B . n 
F 3 6   VAL 6   6    6    VAL VAL B . n 
F 3 7   ASP 7   7    7    ASP ASP B . n 
F 3 8   PHE 8   8    8    PHE PHE B . n 
F 3 9   ASP 9   9    9    ASP ASP B . n 
F 3 10  TYR 10  10   10   TYR TYR B . n 
F 3 11  PHE 11  11   11   PHE PHE B . n 
F 3 12  TYR 12  12   12   TYR TYR B . n 
F 3 13  ALA 13  13   13   ALA ALA B . n 
F 3 14  GLN 14  14   14   GLN GLN B . n 
F 3 15  VAL 15  15   15   VAL VAL B . n 
F 3 16  GLU 16  16   16   GLU GLU B . n 
F 3 17  GLU 17  17   17   GLU GLU B . n 
F 3 18  VAL 18  18   18   VAL VAL B . n 
F 3 19  LEU 19  19   19   LEU LEU B . n 
F 3 20  ASN 20  20   20   ASN ASN B . n 
F 3 21  PRO 21  21   21   PRO PRO B . n 
F 3 22  SER 22  22   22   SER SER B . n 
F 3 23  LEU 23  23   23   LEU LEU B . n 
F 3 24  LYS 24  24   24   LYS LYS B . n 
F 3 25  GLY 25  25   25   GLY GLY B . n 
F 3 26  LYS 26  26   26   LYS LYS B . n 
F 3 27  PRO 27  27   27   PRO PRO B . n 
F 3 28  VAL 28  28   28   VAL VAL B . n 
F 3 29  VAL 29  29   29   VAL VAL B . n 
F 3 30  VAL 30  30   30   VAL VAL B . n 
F 3 31  CYS 31  31   31   CYS CYS B . n 
F 3 32  VAL 32  32   32   VAL VAL B . n 
F 3 33  PHE 33  33   33   PHE PHE B . n 
F 3 34  SER 34  34   34   SER SER B . n 
F 3 35  GLY 35  35   35   GLY GLY B . n 
F 3 36  ARG 36  36   36   ARG ARG B . n 
F 3 37  PHE 37  37   37   PHE PHE B . n 
F 3 38  GLU 38  38   38   GLU GLU B . n 
F 3 39  ASP 39  39   39   ASP ASP B . n 
F 3 40  SER 40  40   40   SER SER B . n 
F 3 41  GLY 41  41   41   GLY GLY B . n 
F 3 42  ALA 42  42   42   ALA ALA B . n 
F 3 43  VAL 43  43   43   VAL VAL B . n 
F 3 44  ALA 44  44   44   ALA ALA B . n 
F 3 45  THR 45  45   45   THR THR B . n 
F 3 46  ALA 46  46   46   ALA ALA B . n 
F 3 47  ASN 47  47   47   ASN ASN B . n 
F 3 48  TYR 48  48   48   TYR TYR B . n 
F 3 49  GLU 49  49   49   GLU GLU B . n 
F 3 50  ALA 50  50   50   ALA ALA B . n 
F 3 51  ARG 51  51   51   ARG ARG B . n 
F 3 52  LYS 52  52   52   LYS LYS B . n 
F 3 53  PHE 53  53   53   PHE PHE B . n 
F 3 54  GLY 54  54   54   GLY GLY B . n 
F 3 55  VAL 55  55   55   VAL VAL B . n 
F 3 56  LYS 56  56   56   LYS LYS B . n 
F 3 57  ALA 57  57   57   ALA ALA B . n 
F 3 58  GLY 58  58   58   GLY GLY B . n 
F 3 59  ILE 59  59   59   ILE ILE B . n 
F 3 60  PRO 60  60   60   PRO PRO B . n 
F 3 61  ILE 61  61   61   ILE ILE B . n 
F 3 62  VAL 62  62   62   VAL VAL B . n 
F 3 63  GLU 63  63   63   GLU GLU B . n 
F 3 64  ALA 64  64   64   ALA ALA B . n 
F 3 65  LYS 65  65   65   LYS LYS B . n 
F 3 66  LYS 66  66   66   LYS LYS B . n 
F 3 67  ILE 67  67   67   ILE ILE B . n 
F 3 68  LEU 68  68   68   LEU LEU B . n 
F 3 69  PRO 69  69   69   PRO PRO B . n 
F 3 70  ASN 70  70   70   ASN ASN B . n 
F 3 71  ALA 71  71   71   ALA ALA B . n 
F 3 72  VAL 72  72   72   VAL VAL B . n 
F 3 73  TYR 73  73   73   TYR TYR B . n 
F 3 74  LEU 74  74   74   LEU LEU B . n 
F 3 75  PRO 75  75   75   PRO PRO B . n 
F 3 76  MET 76  76   76   MET MET B . n 
F 3 77  ARG 77  77   77   ARG ARG B . n 
F 3 78  LYS 78  78   78   LYS LYS B . n 
F 3 79  GLU 79  79   79   GLU GLU B . n 
F 3 80  VAL 80  80   80   VAL VAL B . n 
F 3 81  TYR 81  81   81   TYR TYR B . n 
F 3 82  GLN 82  82   82   GLN GLN B . n 
F 3 83  GLN 83  83   83   GLN GLN B . n 
F 3 84  VAL 84  84   84   VAL VAL B . n 
F 3 85  SER 85  85   85   SER SER B . n 
F 3 86  SER 86  86   86   SER SER B . n 
F 3 87  ARG 87  87   87   ARG ARG B . n 
F 3 88  ILE 88  88   88   ILE ILE B . n 
F 3 89  MET 89  89   89   MET MET B . n 
F 3 90  ASN 90  90   90   ASN ASN B . n 
F 3 91  LEU 91  91   91   LEU LEU B . n 
F 3 92  LEU 92  92   92   LEU LEU B . n 
F 3 93  ARG 93  93   93   ARG ARG B . n 
F 3 94  GLU 94  94   94   GLU GLU B . n 
F 3 95  TYR 95  95   95   TYR TYR B . n 
F 3 96  SER 96  96   96   SER SER B . n 
F 3 97  GLU 97  97   97   GLU GLU B . n 
F 3 98  LYS 98  98   98   LYS LYS B . n 
F 3 99  ILE 99  99   99   ILE ILE B . n 
F 3 100 GLU 100 100  100  GLU GLU B . n 
F 3 101 ILE 101 101  101  ILE ILE B . n 
F 3 102 ALA 102 102  102  ALA ALA B . n 
F 3 103 SER 103 103  103  SER SER B . n 
F 3 104 ILE 104 104  104  ILE ILE B . n 
F 3 105 ASP 105 105  105  ASP ASP B . n 
F 3 106 GLU 106 106  106  GLU GLU B . n 
F 3 107 ALA 107 107  107  ALA ALA B . n 
F 3 108 TYR 108 108  108  TYR TYR B . n 
F 3 109 LEU 109 109  109  LEU LEU B . n 
F 3 110 ASP 110 110  110  ASP ASP B . n 
F 3 111 ILE 111 111  111  ILE ILE B . n 
F 3 112 SER 112 112  112  SER SER B . n 
F 3 113 ASP 113 113  113  ASP ASP B . n 
F 3 114 LYS 114 114  114  LYS LYS B . n 
F 3 115 VAL 115 115  115  VAL VAL B . n 
F 3 116 ARG 116 116  116  ARG ARG B . n 
F 3 117 ASP 117 117  117  ASP ASP B . n 
F 3 118 TYR 118 118  118  TYR TYR B . n 
F 3 119 ARG 119 119  119  ARG ARG B . n 
F 3 120 GLU 120 120  120  GLU GLU B . n 
F 3 121 ALA 121 121  121  ALA ALA B . n 
F 3 122 TYR 122 122  122  TYR TYR B . n 
F 3 123 ASN 123 123  123  ASN ASN B . n 
F 3 124 LEU 124 124  124  LEU LEU B . n 
F 3 125 GLY 125 125  125  GLY GLY B . n 
F 3 126 LEU 126 126  126  LEU LEU B . n 
F 3 127 GLU 127 127  127  GLU GLU B . n 
F 3 128 ILE 128 128  128  ILE ILE B . n 
F 3 129 LYS 129 129  129  LYS LYS B . n 
F 3 130 ASN 130 130  130  ASN ASN B . n 
F 3 131 LYS 131 131  131  LYS LYS B . n 
F 3 132 ILE 132 132  132  ILE ILE B . n 
F 3 133 LEU 133 133  133  LEU LEU B . n 
F 3 134 GLU 134 134  134  GLU GLU B . n 
F 3 135 LYS 135 135  135  LYS LYS B . n 
F 3 136 GLU 136 136  136  GLU GLU B . n 
F 3 137 LYS 137 137  137  LYS LYS B . n 
F 3 138 ILE 138 138  138  ILE ILE B . n 
F 3 139 THR 139 139  139  THR THR B . n 
F 3 140 VAL 140 140  140  VAL VAL B . n 
F 3 141 THR 141 141  141  THR THR B . n 
F 3 142 VAL 142 142  142  VAL VAL B . n 
F 3 143 GLY 143 143  143  GLY GLY B . n 
F 3 144 ILE 144 144  144  ILE ILE B . n 
F 3 145 SER 145 145  145  SER SER B . n 
F 3 146 LYS 146 146  146  LYS LYS B . n 
F 3 147 ASN 147 147  147  ASN ASN B . n 
F 3 148 LYS 148 148  148  LYS LYS B . n 
F 3 149 VAL 149 149  149  VAL VAL B . n 
F 3 150 PHE 150 150  150  PHE PHE B . n 
F 3 151 ALA 151 151  151  ALA ALA B . n 
F 3 152 LYS 152 152  152  LYS LYS B . n 
F 3 153 ILE 153 153  153  ILE ILE B . n 
F 3 154 ALA 154 154  154  ALA ALA B . n 
F 3 155 ALA 155 155  155  ALA ALA B . n 
F 3 156 ASP 156 156  156  ASP ASP B . n 
F 3 157 MET 157 157  157  MET MET B . n 
F 3 158 ALA 158 158  158  ALA ALA B . n 
F 3 159 LYS 159 159  159  LYS LYS B . n 
F 3 160 PRO 160 160  160  PRO PRO B . n 
F 3 161 ASN 161 161  161  ASN ASN B . n 
F 3 162 GLY 162 162  162  GLY GLY B . n 
F 3 163 ILE 163 163  163  ILE ILE B . n 
F 3 164 LYS 164 164  164  LYS LYS B . n 
F 3 165 VAL 165 165  165  VAL VAL B . n 
F 3 166 ILE 166 166  166  ILE ILE B . n 
F 3 167 ASP 167 167  167  ASP ASP B . n 
F 3 168 ASP 168 168  168  ASP ASP B . n 
F 3 169 GLU 169 169  169  GLU GLU B . n 
F 3 170 GLU 170 170  170  GLU GLU B . n 
F 3 171 VAL 171 171  171  VAL VAL B . n 
F 3 172 LYS 172 172  172  LYS LYS B . n 
F 3 173 ARG 173 173  173  ARG ARG B . n 
F 3 174 LEU 174 174  174  LEU LEU B . n 
F 3 175 ILE 175 175  175  ILE ILE B . n 
F 3 176 ARG 176 176  176  ARG ARG B . n 
F 3 177 GLU 177 177  177  GLU GLU B . n 
F 3 178 LEU 178 178  178  LEU LEU B . n 
F 3 179 ASP 179 179  179  ASP ASP B . n 
F 3 180 ILE 180 180  180  ILE ILE B . n 
F 3 181 ALA 181 181  181  ALA ALA B . n 
F 3 182 ASP 182 182  182  ASP ASP B . n 
F 3 183 VAL 183 183  183  VAL VAL B . n 
F 3 184 PRO 184 184  184  PRO PRO B . n 
F 3 185 GLY 185 185  185  GLY GLY B . n 
F 3 186 ILE 186 186  186  ILE ILE B . n 
F 3 187 GLY 187 187  187  GLY GLY B . n 
F 3 188 ASN 188 188  188  ASN ASN B . n 
F 3 189 ILE 189 189  189  ILE ILE B . n 
F 3 190 THR 190 190  190  THR THR B . n 
F 3 191 ALA 191 191  191  ALA ALA B . n 
F 3 192 GLU 192 192  192  GLU GLU B . n 
F 3 193 LYS 193 193  193  LYS LYS B . n 
F 3 194 LEU 194 194  194  LEU LEU B . n 
F 3 195 LYS 195 195  195  LYS LYS B . n 
F 3 196 LYS 196 196  196  LYS LYS B . n 
F 3 197 LEU 197 197  197  LEU LEU B . n 
F 3 198 GLY 198 198  198  GLY GLY B . n 
F 3 199 ILE 199 199  199  ILE ILE B . n 
F 3 200 ASN 200 200  200  ASN ASN B . n 
F 3 201 LYS 201 201  201  LYS LYS B . n 
F 3 202 LEU 202 202  202  LEU LEU B . n 
F 3 203 VAL 203 203  203  VAL VAL B . n 
F 3 204 ASP 204 204  204  ASP ASP B . n 
F 3 205 THR 205 205  205  THR THR B . n 
F 3 206 LEU 206 206  206  LEU LEU B . n 
F 3 207 SER 207 207  207  SER SER B . n 
F 3 208 ILE 208 208  208  ILE ILE B . n 
F 3 209 GLU 209 209  209  GLU GLU B . n 
F 3 210 PHE 210 210  210  PHE PHE B . n 
F 3 211 ASP 211 211  211  ASP ASP B . n 
F 3 212 LYS 212 212  212  LYS LYS B . n 
F 3 213 LEU 213 213  213  LEU LEU B . n 
F 3 214 LYS 214 214  214  LYS LYS B . n 
F 3 215 GLY 215 215  215  GLY GLY B . n 
F 3 216 MET 216 216  216  MET MET B . n 
F 3 217 ILE 217 217  217  ILE ILE B . n 
F 3 218 GLY 218 218  218  GLY GLY B . n 
F 3 219 GLU 219 219  219  GLU GLU B . n 
F 3 220 ALA 220 220  220  ALA ALA B . n 
F 3 221 LYS 221 221  221  LYS LYS B . n 
F 3 222 ALA 222 222  222  ALA ALA B . n 
F 3 223 LYS 223 223  223  LYS LYS B . n 
F 3 224 TYR 224 224  224  TYR TYR B . n 
F 3 225 LEU 225 225  225  LEU LEU B . n 
F 3 226 ILE 226 226  226  ILE ILE B . n 
F 3 227 SER 227 227  227  SER SER B . n 
F 3 228 LEU 228 228  228  LEU LEU B . n 
F 3 229 ALA 229 229  229  ALA ALA B . n 
F 3 230 ARG 230 230  230  ARG ARG B . n 
F 3 231 ASP 231 231  231  ASP ASP B . n 
F 3 232 GLU 232 232  232  GLU GLU B . n 
F 3 233 TYR 233 233  233  TYR TYR B . n 
F 3 234 ASN 234 234  234  ASN ASN B . n 
F 3 235 GLU 235 235  235  GLU GLU B . n 
F 3 236 PRO 236 236  236  PRO PRO B . n 
F 3 237 ILE 237 237  237  ILE ILE B . n 
F 3 238 ARG 238 238  238  ARG ARG B . n 
F 3 239 THR 239 239  239  THR THR B . n 
F 3 240 ARG 240 240  240  ARG ARG B . n 
F 3 241 VAL 241 241  241  VAL VAL B . n 
F 3 242 ARG 242 242  242  ARG ARG B . n 
F 3 243 LYS 243 243  243  LYS LYS B . n 
F 3 244 SER 244 244  244  SER SER B . n 
F 3 245 ILE 245 245  245  ILE ILE B . n 
F 3 246 GLY 246 246  246  GLY GLY B . n 
F 3 247 ARG 247 247  247  ARG ARG B . n 
F 3 248 ILE 248 248  248  ILE ILE B . n 
F 3 249 VAL 249 249  249  VAL VAL B . n 
F 3 250 THR 250 250  250  THR THR B . n 
F 3 251 MET 251 251  251  MET MET B . n 
F 3 252 LYS 252 252  252  LYS LYS B . n 
F 3 253 ARG 253 253  253  ARG ARG B . n 
F 3 254 ASN 254 254  254  ASN ASN B . n 
F 3 255 SER 255 255  255  SER SER B . n 
F 3 256 ARG 256 256  256  ARG ARG B . n 
F 3 257 ASN 257 257  257  ASN ASN B . n 
F 3 258 LEU 258 258  258  LEU LEU B . n 
F 3 259 GLU 259 259  259  GLU GLU B . n 
F 3 260 GLU 260 260  260  GLU GLU B . n 
F 3 261 ILE 261 261  261  ILE ILE B . n 
F 3 262 LYS 262 262  262  LYS LYS B . n 
F 3 263 PRO 263 263  263  PRO PRO B . n 
F 3 264 TYR 264 264  264  TYR TYR B . n 
F 3 265 LEU 265 265  265  LEU LEU B . n 
F 3 266 PHE 266 266  266  PHE PHE B . n 
F 3 267 ARG 267 267  267  ARG ARG B . n 
F 3 268 ALA 268 268  268  ALA ALA B . n 
F 3 269 ILE 269 269  269  ILE ILE B . n 
F 3 270 GLU 270 270  270  GLU GLU B . n 
F 3 271 GLU 271 271  271  GLU GLU B . n 
F 3 272 SER 272 272  272  SER SER B . n 
F 3 273 TYR 273 273  273  TYR TYR B . n 
F 3 274 TYR 274 274  274  TYR TYR B . n 
F 3 275 LYS 275 275  275  LYS LYS B . n 
F 3 276 LEU 276 276  276  LEU LEU B . n 
F 3 277 ASP 277 277  277  ASP ASP B . n 
F 3 278 LYS 278 278  278  LYS LYS B . n 
F 3 279 ARG 279 279  279  ARG ARG B . n 
F 3 280 ILE 280 280  280  ILE ILE B . n 
F 3 281 PRO 281 281  281  PRO PRO B . n 
F 3 282 LYS 282 282  282  LYS LYS B . n 
F 3 283 ALA 283 283  283  ALA ALA B . n 
F 3 284 ILE 284 284  284  ILE ILE B . n 
F 3 285 HIS 285 285  285  HIS HIS B . n 
F 3 286 VAL 286 286  286  VAL VAL B . n 
F 3 287 VAL 287 287  287  VAL VAL B . n 
F 3 288 ALA 288 288  288  ALA ALA B . n 
F 3 289 VAL 289 289  289  VAL VAL B . n 
F 3 290 THR 290 290  290  THR THR B . n 
F 3 291 GLU 291 291  291  GLU GLU B . n 
F 3 292 ASP 292 292  292  ASP ASP B . n 
F 3 293 LEU 293 293  293  LEU LEU B . n 
F 3 294 ASP 294 294  294  ASP ASP B . n 
F 3 295 ILE 295 295  295  ILE ILE B . n 
F 3 296 VAL 296 296  296  VAL VAL B . n 
F 3 297 SER 297 297  297  SER SER B . n 
F 3 298 ARG 298 298  298  ARG ARG B . n 
F 3 299 GLY 299 299  299  GLY GLY B . n 
F 3 300 ARG 300 300  300  ARG ARG B . n 
F 3 301 THR 301 301  301  THR THR B . n 
F 3 302 PHE 302 302  302  PHE PHE B . n 
F 3 303 PRO 303 303  303  PRO PRO B . n 
F 3 304 HIS 304 304  304  HIS HIS B . n 
F 3 305 GLY 305 305  305  GLY GLY B . n 
F 3 306 ILE 306 306  306  ILE ILE B . n 
F 3 307 SER 307 307  307  SER SER B . n 
F 3 308 LYS 308 308  308  LYS LYS B . n 
F 3 309 GLU 309 309  309  GLU GLU B . n 
F 3 310 THR 310 310  310  THR THR B . n 
F 3 311 ALA 311 311  311  ALA ALA B . n 
F 3 312 TYR 312 312  312  TYR TYR B . n 
F 3 313 SER 313 313  313  SER SER B . n 
F 3 314 GLU 314 314  314  GLU GLU B . n 
F 3 315 SER 315 315  315  SER SER B . n 
F 3 316 VAL 316 316  316  VAL VAL B . n 
F 3 317 LYS 317 317  317  LYS LYS B . n 
F 3 318 LEU 318 318  318  LEU LEU B . n 
F 3 319 LEU 319 319  319  LEU LEU B . n 
F 3 320 GLN 320 320  320  GLN GLN B . n 
F 3 321 LYS 321 321  321  LYS LYS B . n 
F 3 322 ILE 322 322  322  ILE ILE B . n 
F 3 323 LEU 323 323  323  LEU LEU B . n 
F 3 324 GLU 324 324  324  GLU GLU B . n 
F 3 325 GLU 325 325  325  GLU GLU B . n 
F 3 326 ASP 326 326  326  ASP ASP B . n 
F 3 327 GLU 327 327  327  GLU GLU B . n 
F 3 328 ARG 328 328  328  ARG ARG B . n 
F 3 329 LYS 329 329  329  LYS LYS B . n 
F 3 330 ILE 330 330  330  ILE ILE B . n 
F 3 331 ARG 331 331  331  ARG ARG B . n 
F 3 332 ARG 332 332  332  ARG ARG B . n 
F 3 333 ILE 333 333  333  ILE ILE B . n 
F 3 334 GLY 334 334  334  GLY GLY B . n 
F 3 335 VAL 335 335  335  VAL VAL B . n 
F 3 336 ARG 336 336  336  ARG ARG B . n 
F 3 337 PHE 337 337  337  PHE PHE B . n 
F 3 338 SER 338 338  338  SER SER B . n 
F 3 339 LYS 339 339  339  LYS LYS B . n 
F 3 340 PHE 340 340  340  PHE PHE B . n 
F 3 341 ILE 341 341  341  ILE ILE B . n 
F 3 342 GLU 342 342  ?    ?   ?   B . n 
F 3 343 ALA 343 343  ?    ?   ?   B . n 
F 3 344 ILE 344 344  ?    ?   ?   B . n 
F 3 345 GLY 345 345  ?    ?   ?   B . n 
F 3 346 LEU 346 346  ?    ?   ?   B . n 
F 3 347 ASP 347 347  ?    ?   ?   B . n 
F 3 348 LYS 348 348  ?    ?   ?   B . n 
F 3 349 PHE 349 349  ?    ?   ?   B . n 
F 3 350 PHE 350 350  ?    ?   ?   B . n 
F 3 351 ASP 351 351  ?    ?   ?   B . n 
F 3 352 THR 352 352  ?    ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G 4 CA  1   401 401 CA  CA  A . 
H 4 CA  1   402 402 CA  CA  A . 
I 4 CA  1   406 406 CA  CA  A . 
J 5 MG  1   407 407 MG  MG  A . 
K 6 TTP 1   803 803 TTP TTP A . 
L 4 CA  1   403 403 CA  CA  B . 
M 4 CA  1   404 404 CA  CA  B . 
N 4 CA  1   405 405 CA  CA  B . 
O 5 MG  1   408 408 MG  MG  B . 
P 6 TTP 1   804 804 TTP TTP B . 
Q 7 HOH 1   55  55  HOH TIP C . 
Q 7 HOH 2   61  61  HOH TIP C . 
Q 7 HOH 3   92  92  HOH TIP C . 
Q 7 HOH 4   174 174 HOH TIP C . 
Q 7 HOH 5   197 197 HOH TIP C . 
Q 7 HOH 6   201 201 HOH TIP C . 
Q 7 HOH 7   211 211 HOH TIP C . 
Q 7 HOH 8   227 227 HOH TIP C . 
Q 7 HOH 9   244 244 HOH TIP C . 
Q 7 HOH 10  248 248 HOH TIP C . 
Q 7 HOH 11  277 277 HOH TIP C . 
Q 7 HOH 12  310 310 HOH TIP C . 
Q 7 HOH 13  313 313 HOH TIP C . 
Q 7 HOH 14  338 338 HOH TIP C . 
Q 7 HOH 15  349 349 HOH TIP C . 
Q 7 HOH 16  368 368 HOH TIP C . 
Q 7 HOH 17  369 369 HOH TIP C . 
Q 7 HOH 18  373 373 HOH TIP C . 
R 7 HOH 1   18  18  HOH TIP D . 
R 7 HOH 2   26  26  HOH TIP D . 
R 7 HOH 3   63  63  HOH TIP D . 
R 7 HOH 4   77  77  HOH TIP D . 
R 7 HOH 5   86  86  HOH TIP D . 
R 7 HOH 6   161 161 HOH TIP D . 
R 7 HOH 7   199 199 HOH TIP D . 
R 7 HOH 8   202 202 HOH TIP D . 
R 7 HOH 9   203 203 HOH TIP D . 
R 7 HOH 10  207 207 HOH TIP D . 
R 7 HOH 11  243 243 HOH TIP D . 
R 7 HOH 12  251 251 HOH TIP D . 
R 7 HOH 13  259 259 HOH TIP D . 
R 7 HOH 14  270 270 HOH TIP D . 
R 7 HOH 15  275 275 HOH TIP D . 
R 7 HOH 16  303 303 HOH TIP D . 
R 7 HOH 17  316 316 HOH TIP D . 
R 7 HOH 18  318 318 HOH TIP D . 
R 7 HOH 19  347 347 HOH TIP D . 
R 7 HOH 20  351 351 HOH TIP D . 
R 7 HOH 21  356 356 HOH TIP D . 
R 7 HOH 22  370 370 HOH TIP D . 
R 7 HOH 23  371 371 HOH TIP D . 
S 7 HOH 1   3   3   HOH TIP E . 
S 7 HOH 2   15  15  HOH TIP E . 
S 7 HOH 3   41  41  HOH TIP E . 
S 7 HOH 4   45  45  HOH TIP E . 
S 7 HOH 5   60  60  HOH TIP E . 
S 7 HOH 6   69  69  HOH TIP E . 
S 7 HOH 7   89  89  HOH TIP E . 
S 7 HOH 8   101 101 HOH TIP E . 
S 7 HOH 9   107 107 HOH TIP E . 
S 7 HOH 10  112 112 HOH TIP E . 
S 7 HOH 11  117 117 HOH TIP E . 
S 7 HOH 12  118 118 HOH TIP E . 
S 7 HOH 13  124 124 HOH TIP E . 
S 7 HOH 14  130 130 HOH TIP E . 
S 7 HOH 15  136 136 HOH TIP E . 
S 7 HOH 16  162 162 HOH TIP E . 
S 7 HOH 17  167 167 HOH TIP E . 
S 7 HOH 18  170 170 HOH TIP E . 
S 7 HOH 19  177 177 HOH TIP E . 
S 7 HOH 20  276 276 HOH TIP E . 
S 7 HOH 21  285 285 HOH TIP E . 
S 7 HOH 22  286 286 HOH TIP E . 
S 7 HOH 23  290 290 HOH TIP E . 
S 7 HOH 24  304 304 HOH TIP E . 
S 7 HOH 25  312 312 HOH TIP E . 
S 7 HOH 26  315 315 HOH TIP E . 
S 7 HOH 27  323 323 HOH TIP E . 
S 7 HOH 28  324 324 HOH TIP E . 
S 7 HOH 29  335 335 HOH TIP E . 
S 7 HOH 30  354 354 HOH TIP E . 
S 7 HOH 31  372 372 HOH TIP E . 
S 7 HOH 32  374 374 HOH TIP E . 
T 7 HOH 1   1   1   HOH TIP F . 
T 7 HOH 2   10  10  HOH TIP F . 
T 7 HOH 3   21  21  HOH TIP F . 
T 7 HOH 4   31  31  HOH TIP F . 
T 7 HOH 5   48  48  HOH TIP F . 
T 7 HOH 6   54  54  HOH TIP F . 
T 7 HOH 7   57  57  HOH TIP F . 
T 7 HOH 8   64  64  HOH TIP F . 
T 7 HOH 9   73  73  HOH TIP F . 
T 7 HOH 10  76  76  HOH TIP F . 
T 7 HOH 11  126 126 HOH TIP F . 
T 7 HOH 12  171 171 HOH TIP F . 
T 7 HOH 13  183 183 HOH TIP F . 
T 7 HOH 14  186 186 HOH TIP F . 
T 7 HOH 15  189 189 HOH TIP F . 
T 7 HOH 16  191 191 HOH TIP F . 
T 7 HOH 17  193 193 HOH TIP F . 
T 7 HOH 18  264 264 HOH TIP F . 
T 7 HOH 19  273 273 HOH TIP F . 
T 7 HOH 20  279 279 HOH TIP F . 
T 7 HOH 21  306 306 HOH TIP F . 
T 7 HOH 22  314 314 HOH TIP F . 
T 7 HOH 23  343 343 HOH TIP F . 
T 7 HOH 24  355 355 HOH TIP F . 
T 7 HOH 25  362 362 HOH TIP F . 
U 7 HOH 1   804 2   HOH TIP A . 
U 7 HOH 2   805 4   HOH TIP A . 
U 7 HOH 3   806 5   HOH TIP A . 
U 7 HOH 4   807 8   HOH TIP A . 
U 7 HOH 5   808 12  HOH TIP A . 
U 7 HOH 6   809 13  HOH TIP A . 
U 7 HOH 7   810 14  HOH TIP A . 
U 7 HOH 8   811 16  HOH TIP A . 
U 7 HOH 9   812 17  HOH TIP A . 
U 7 HOH 10  813 20  HOH TIP A . 
U 7 HOH 11  814 22  HOH TIP A . 
U 7 HOH 12  815 25  HOH TIP A . 
U 7 HOH 13  816 28  HOH TIP A . 
U 7 HOH 14  817 29  HOH TIP A . 
U 7 HOH 15  818 30  HOH TIP A . 
U 7 HOH 16  819 32  HOH TIP A . 
U 7 HOH 17  820 34  HOH TIP A . 
U 7 HOH 18  821 39  HOH TIP A . 
U 7 HOH 19  822 40  HOH TIP A . 
U 7 HOH 20  823 43  HOH TIP A . 
U 7 HOH 21  824 44  HOH TIP A . 
U 7 HOH 22  825 47  HOH TIP A . 
U 7 HOH 23  826 49  HOH TIP A . 
U 7 HOH 24  827 50  HOH TIP A . 
U 7 HOH 25  828 62  HOH TIP A . 
U 7 HOH 26  829 67  HOH TIP A . 
U 7 HOH 27  830 70  HOH TIP A . 
U 7 HOH 28  831 71  HOH TIP A . 
U 7 HOH 29  832 74  HOH TIP A . 
U 7 HOH 30  833 75  HOH TIP A . 
U 7 HOH 31  834 78  HOH TIP A . 
U 7 HOH 32  835 80  HOH TIP A . 
U 7 HOH 33  836 81  HOH TIP A . 
U 7 HOH 34  837 82  HOH TIP A . 
U 7 HOH 35  838 83  HOH TIP A . 
U 7 HOH 36  839 84  HOH TIP A . 
U 7 HOH 37  840 87  HOH TIP A . 
U 7 HOH 38  841 88  HOH TIP A . 
U 7 HOH 39  842 90  HOH TIP A . 
U 7 HOH 40  843 91  HOH TIP A . 
U 7 HOH 41  844 93  HOH TIP A . 
U 7 HOH 42  845 95  HOH TIP A . 
U 7 HOH 43  846 96  HOH TIP A . 
U 7 HOH 44  847 97  HOH TIP A . 
U 7 HOH 45  848 98  HOH TIP A . 
U 7 HOH 46  849 99  HOH TIP A . 
U 7 HOH 47  850 102 HOH TIP A . 
U 7 HOH 48  851 109 HOH TIP A . 
U 7 HOH 49  852 111 HOH TIP A . 
U 7 HOH 50  853 113 HOH TIP A . 
U 7 HOH 51  854 120 HOH TIP A . 
U 7 HOH 52  855 121 HOH TIP A . 
U 7 HOH 53  856 122 HOH TIP A . 
U 7 HOH 54  857 125 HOH TIP A . 
U 7 HOH 55  858 128 HOH TIP A . 
U 7 HOH 56  859 131 HOH TIP A . 
U 7 HOH 57  860 134 HOH TIP A . 
U 7 HOH 58  861 135 HOH TIP A . 
U 7 HOH 59  862 137 HOH TIP A . 
U 7 HOH 60  863 139 HOH TIP A . 
U 7 HOH 61  864 143 HOH TIP A . 
U 7 HOH 62  865 144 HOH TIP A . 
U 7 HOH 63  866 145 HOH TIP A . 
U 7 HOH 64  867 147 HOH TIP A . 
U 7 HOH 65  868 149 HOH TIP A . 
U 7 HOH 66  869 152 HOH TIP A . 
U 7 HOH 67  870 155 HOH TIP A . 
U 7 HOH 68  871 157 HOH TIP A . 
U 7 HOH 69  872 158 HOH TIP A . 
U 7 HOH 70  873 160 HOH TIP A . 
U 7 HOH 71  874 166 HOH TIP A . 
U 7 HOH 72  875 172 HOH TIP A . 
U 7 HOH 73  876 173 HOH TIP A . 
U 7 HOH 74  877 176 HOH TIP A . 
U 7 HOH 75  878 178 HOH TIP A . 
U 7 HOH 76  879 179 HOH TIP A . 
U 7 HOH 77  880 180 HOH TIP A . 
U 7 HOH 78  881 182 HOH TIP A . 
U 7 HOH 79  882 184 HOH TIP A . 
U 7 HOH 80  883 185 HOH TIP A . 
U 7 HOH 81  884 187 HOH TIP A . 
U 7 HOH 82  885 188 HOH TIP A . 
U 7 HOH 83  886 190 HOH TIP A . 
U 7 HOH 84  887 192 HOH TIP A . 
U 7 HOH 85  888 198 HOH TIP A . 
U 7 HOH 86  889 200 HOH TIP A . 
U 7 HOH 87  890 204 HOH TIP A . 
U 7 HOH 88  891 205 HOH TIP A . 
U 7 HOH 89  892 210 HOH TIP A . 
U 7 HOH 90  893 213 HOH TIP A . 
U 7 HOH 91  894 214 HOH TIP A . 
U 7 HOH 92  895 217 HOH TIP A . 
U 7 HOH 93  896 218 HOH TIP A . 
U 7 HOH 94  897 223 HOH TIP A . 
U 7 HOH 95  898 224 HOH TIP A . 
U 7 HOH 96  899 225 HOH TIP A . 
U 7 HOH 97  900 228 HOH TIP A . 
U 7 HOH 98  901 229 HOH TIP A . 
U 7 HOH 99  902 231 HOH TIP A . 
U 7 HOH 100 903 232 HOH TIP A . 
U 7 HOH 101 904 233 HOH TIP A . 
U 7 HOH 102 905 234 HOH TIP A . 
U 7 HOH 103 906 235 HOH TIP A . 
U 7 HOH 104 907 236 HOH TIP A . 
U 7 HOH 105 908 239 HOH TIP A . 
U 7 HOH 106 909 240 HOH TIP A . 
U 7 HOH 107 910 242 HOH TIP A . 
U 7 HOH 108 911 246 HOH TIP A . 
U 7 HOH 109 912 247 HOH TIP A . 
U 7 HOH 110 913 256 HOH TIP A . 
U 7 HOH 111 914 260 HOH TIP A . 
U 7 HOH 112 915 261 HOH TIP A . 
U 7 HOH 113 916 262 HOH TIP A . 
U 7 HOH 114 917 267 HOH TIP A . 
U 7 HOH 115 918 268 HOH TIP A . 
U 7 HOH 116 919 269 HOH TIP A . 
U 7 HOH 117 920 271 HOH TIP A . 
U 7 HOH 118 921 272 HOH TIP A . 
U 7 HOH 119 922 284 HOH TIP A . 
U 7 HOH 120 923 287 HOH TIP A . 
U 7 HOH 121 924 288 HOH TIP A . 
U 7 HOH 122 925 291 HOH TIP A . 
U 7 HOH 123 926 293 HOH TIP A . 
U 7 HOH 124 927 295 HOH TIP A . 
U 7 HOH 125 928 297 HOH TIP A . 
U 7 HOH 126 929 298 HOH TIP A . 
U 7 HOH 127 930 299 HOH TIP A . 
U 7 HOH 128 931 300 HOH TIP A . 
U 7 HOH 129 932 301 HOH TIP A . 
U 7 HOH 130 933 302 HOH TIP A . 
U 7 HOH 131 934 307 HOH TIP A . 
U 7 HOH 132 935 308 HOH TIP A . 
U 7 HOH 133 936 311 HOH TIP A . 
U 7 HOH 134 937 317 HOH TIP A . 
U 7 HOH 135 938 319 HOH TIP A . 
U 7 HOH 136 939 322 HOH TIP A . 
U 7 HOH 137 940 331 HOH TIP A . 
U 7 HOH 138 941 333 HOH TIP A . 
U 7 HOH 139 942 334 HOH TIP A . 
U 7 HOH 140 943 337 HOH TIP A . 
U 7 HOH 141 944 344 HOH TIP A . 
U 7 HOH 142 945 357 HOH TIP A . 
U 7 HOH 143 946 358 HOH TIP A . 
U 7 HOH 144 947 359 HOH TIP A . 
U 7 HOH 145 948 361 HOH TIP A . 
U 7 HOH 146 949 363 HOH TIP A . 
U 7 HOH 147 950 365 HOH TIP A . 
U 7 HOH 148 951 366 HOH TIP A . 
U 7 HOH 149 952 367 HOH TIP A . 
V 7 HOH 1   805 6   HOH TIP B . 
V 7 HOH 2   806 7   HOH TIP B . 
V 7 HOH 3   807 9   HOH TIP B . 
V 7 HOH 4   808 11  HOH TIP B . 
V 7 HOH 5   809 19  HOH TIP B . 
V 7 HOH 6   810 23  HOH TIP B . 
V 7 HOH 7   811 24  HOH TIP B . 
V 7 HOH 8   812 27  HOH TIP B . 
V 7 HOH 9   813 33  HOH TIP B . 
V 7 HOH 10  814 35  HOH TIP B . 
V 7 HOH 11  815 36  HOH TIP B . 
V 7 HOH 12  816 37  HOH TIP B . 
V 7 HOH 13  817 38  HOH TIP B . 
V 7 HOH 14  818 42  HOH TIP B . 
V 7 HOH 15  819 46  HOH TIP B . 
V 7 HOH 16  820 51  HOH TIP B . 
V 7 HOH 17  821 52  HOH TIP B . 
V 7 HOH 18  822 53  HOH TIP B . 
V 7 HOH 19  823 56  HOH TIP B . 
V 7 HOH 20  824 58  HOH TIP B . 
V 7 HOH 21  825 59  HOH TIP B . 
V 7 HOH 22  826 65  HOH TIP B . 
V 7 HOH 23  827 66  HOH TIP B . 
V 7 HOH 24  828 68  HOH TIP B . 
V 7 HOH 25  829 72  HOH TIP B . 
V 7 HOH 26  830 79  HOH TIP B . 
V 7 HOH 27  831 85  HOH TIP B . 
V 7 HOH 28  832 94  HOH TIP B . 
V 7 HOH 29  833 100 HOH TIP B . 
V 7 HOH 30  834 103 HOH TIP B . 
V 7 HOH 31  835 104 HOH TIP B . 
V 7 HOH 32  836 105 HOH TIP B . 
V 7 HOH 33  837 106 HOH TIP B . 
V 7 HOH 34  838 108 HOH TIP B . 
V 7 HOH 35  839 110 HOH TIP B . 
V 7 HOH 36  840 114 HOH TIP B . 
V 7 HOH 37  841 115 HOH TIP B . 
V 7 HOH 38  842 116 HOH TIP B . 
V 7 HOH 39  843 119 HOH TIP B . 
V 7 HOH 40  844 123 HOH TIP B . 
V 7 HOH 41  845 127 HOH TIP B . 
V 7 HOH 42  846 129 HOH TIP B . 
V 7 HOH 43  847 132 HOH TIP B . 
V 7 HOH 44  848 133 HOH TIP B . 
V 7 HOH 45  849 138 HOH TIP B . 
V 7 HOH 46  850 140 HOH TIP B . 
V 7 HOH 47  851 141 HOH TIP B . 
V 7 HOH 48  852 142 HOH TIP B . 
V 7 HOH 49  853 146 HOH TIP B . 
V 7 HOH 50  854 148 HOH TIP B . 
V 7 HOH 51  855 150 HOH TIP B . 
V 7 HOH 52  856 151 HOH TIP B . 
V 7 HOH 53  857 153 HOH TIP B . 
V 7 HOH 54  858 154 HOH TIP B . 
V 7 HOH 55  859 156 HOH TIP B . 
V 7 HOH 56  860 159 HOH TIP B . 
V 7 HOH 57  861 163 HOH TIP B . 
V 7 HOH 58  862 164 HOH TIP B . 
V 7 HOH 59  863 165 HOH TIP B . 
V 7 HOH 60  864 168 HOH TIP B . 
V 7 HOH 61  865 169 HOH TIP B . 
V 7 HOH 62  866 175 HOH TIP B . 
V 7 HOH 63  867 181 HOH TIP B . 
V 7 HOH 64  868 194 HOH TIP B . 
V 7 HOH 65  869 195 HOH TIP B . 
V 7 HOH 66  870 196 HOH TIP B . 
V 7 HOH 67  871 206 HOH TIP B . 
V 7 HOH 68  872 208 HOH TIP B . 
V 7 HOH 69  873 209 HOH TIP B . 
V 7 HOH 70  874 212 HOH TIP B . 
V 7 HOH 71  875 215 HOH TIP B . 
V 7 HOH 72  876 216 HOH TIP B . 
V 7 HOH 73  877 219 HOH TIP B . 
V 7 HOH 74  878 220 HOH TIP B . 
V 7 HOH 75  879 221 HOH TIP B . 
V 7 HOH 76  880 222 HOH TIP B . 
V 7 HOH 77  881 226 HOH TIP B . 
V 7 HOH 78  882 230 HOH TIP B . 
V 7 HOH 79  883 237 HOH TIP B . 
V 7 HOH 80  884 238 HOH TIP B . 
V 7 HOH 81  885 241 HOH TIP B . 
V 7 HOH 82  886 245 HOH TIP B . 
V 7 HOH 83  887 249 HOH TIP B . 
V 7 HOH 84  888 250 HOH TIP B . 
V 7 HOH 85  889 252 HOH TIP B . 
V 7 HOH 86  890 253 HOH TIP B . 
V 7 HOH 87  891 254 HOH TIP B . 
V 7 HOH 88  892 255 HOH TIP B . 
V 7 HOH 89  893 257 HOH TIP B . 
V 7 HOH 90  894 258 HOH TIP B . 
V 7 HOH 91  895 263 HOH TIP B . 
V 7 HOH 92  896 265 HOH TIP B . 
V 7 HOH 93  897 266 HOH TIP B . 
V 7 HOH 94  898 274 HOH TIP B . 
V 7 HOH 95  899 278 HOH TIP B . 
V 7 HOH 96  900 280 HOH TIP B . 
V 7 HOH 97  901 281 HOH TIP B . 
V 7 HOH 98  902 282 HOH TIP B . 
V 7 HOH 99  903 283 HOH TIP B . 
V 7 HOH 100 904 289 HOH TIP B . 
V 7 HOH 101 905 292 HOH TIP B . 
V 7 HOH 102 906 294 HOH TIP B . 
V 7 HOH 103 907 296 HOH TIP B . 
V 7 HOH 104 908 305 HOH TIP B . 
V 7 HOH 105 909 309 HOH TIP B . 
V 7 HOH 106 910 320 HOH TIP B . 
V 7 HOH 107 911 321 HOH TIP B . 
V 7 HOH 108 912 325 HOH TIP B . 
V 7 HOH 109 913 326 HOH TIP B . 
V 7 HOH 110 914 327 HOH TIP B . 
V 7 HOH 111 915 328 HOH TIP B . 
V 7 HOH 112 916 329 HOH TIP B . 
V 7 HOH 113 917 330 HOH TIP B . 
V 7 HOH 114 918 332 HOH TIP B . 
V 7 HOH 115 919 336 HOH TIP B . 
V 7 HOH 116 920 339 HOH TIP B . 
V 7 HOH 117 921 340 HOH TIP B . 
V 7 HOH 118 922 341 HOH TIP B . 
V 7 HOH 119 923 342 HOH TIP B . 
V 7 HOH 120 924 345 HOH TIP B . 
V 7 HOH 121 925 346 HOH TIP B . 
V 7 HOH 122 926 348 HOH TIP B . 
V 7 HOH 123 927 350 HOH TIP B . 
V 7 HOH 124 928 352 HOH TIP B . 
V 7 HOH 125 929 353 HOH TIP B . 
V 7 HOH 126 930 360 HOH TIP B . 
V 7 HOH 127 931 364 HOH TIP B . 
V 7 HOH 128 932 375 HOH TIP B . 
V 7 HOH 129 933 376 HOH TIP B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? trimeric 3 
2 author_defined_assembly ? trimeric 3 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,E,G,H,I,J,K,Q,R,U 
2 1 C,D,F,L,M,N,O,P,S,T,V 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1   OD2 ? E ASP 105 ? A ASP 105 ? 1_555 CA ? G CA . ? A CA 401 ? 1_555 OD1 ? E ASP 7   ? A ASP 7   ? 1_555 54.8  ? 
2   OD2 ? E ASP 105 ? A ASP 105 ? 1_555 CA ? G CA . ? A CA 401 ? 1_555 OD2 ? E ASP 7   ? A ASP 7   ? 1_555 99.1  ? 
3   OD1 ? E ASP 7   ? A ASP 7   ? 1_555 CA ? G CA . ? A CA 401 ? 1_555 OD2 ? E ASP 7   ? A ASP 7   ? 1_555 45.0  ? 
4   OD2 ? E ASP 105 ? A ASP 105 ? 1_555 CA ? G CA . ? A CA 401 ? 1_555 OD1 ? E ASP 105 ? A ASP 105 ? 1_555 41.1  ? 
5   OD1 ? E ASP 7   ? A ASP 7   ? 1_555 CA ? G CA . ? A CA 401 ? 1_555 OD1 ? E ASP 105 ? A ASP 105 ? 1_555 81.4  ? 
6   OD2 ? E ASP 7   ? A ASP 7   ? 1_555 CA ? G CA . ? A CA 401 ? 1_555 OD1 ? E ASP 105 ? A ASP 105 ? 1_555 122.8 ? 
7   OD2 ? E ASP 105 ? A ASP 105 ? 1_555 CA ? G CA . ? A CA 401 ? 1_555 OE1 ? E GLU 106 ? A GLU 106 ? 1_555 135.4 ? 
8   OD1 ? E ASP 7   ? A ASP 7   ? 1_555 CA ? G CA . ? A CA 401 ? 1_555 OE1 ? E GLU 106 ? A GLU 106 ? 1_555 110.4 ? 
9   OD2 ? E ASP 7   ? A ASP 7   ? 1_555 CA ? G CA . ? A CA 401 ? 1_555 OE1 ? E GLU 106 ? A GLU 106 ? 1_555 85.4  ? 
10  OD1 ? E ASP 105 ? A ASP 105 ? 1_555 CA ? G CA . ? A CA 401 ? 1_555 OE1 ? E GLU 106 ? A GLU 106 ? 1_555 99.9  ? 
11  OD2 ? E ASP 105 ? A ASP 105 ? 1_555 CA ? G CA . ? A CA 401 ? 1_555 O2A ? K TTP .   ? A TTP 803 ? 1_555 61.5  ? 
12  OD1 ? E ASP 7   ? A ASP 7   ? 1_555 CA ? G CA . ? A CA 401 ? 1_555 O2A ? K TTP .   ? A TTP 803 ? 1_555 80.5  ? 
13  OD2 ? E ASP 7   ? A ASP 7   ? 1_555 CA ? G CA . ? A CA 401 ? 1_555 O2A ? K TTP .   ? A TTP 803 ? 1_555 94.4  ? 
14  OD1 ? E ASP 105 ? A ASP 105 ? 1_555 CA ? G CA . ? A CA 401 ? 1_555 O2A ? K TTP .   ? A TTP 803 ? 1_555 94.5  ? 
15  OE1 ? E GLU 106 ? A GLU 106 ? 1_555 CA ? G CA . ? A CA 401 ? 1_555 O2A ? K TTP .   ? A TTP 803 ? 1_555 163.0 ? 
16  OD2 ? E ASP 105 ? A ASP 105 ? 1_555 CA ? G CA . ? A CA 401 ? 1_555 O   ? U HOH .   ? A HOH 893 ? 1_555 101.4 ? 
17  OD1 ? E ASP 7   ? A ASP 7   ? 1_555 CA ? G CA . ? A CA 401 ? 1_555 O   ? U HOH .   ? A HOH 893 ? 1_555 156.1 ? 
18  OD2 ? E ASP 7   ? A ASP 7   ? 1_555 CA ? G CA . ? A CA 401 ? 1_555 O   ? U HOH .   ? A HOH 893 ? 1_555 158.7 ? 
19  OD1 ? E ASP 105 ? A ASP 105 ? 1_555 CA ? G CA . ? A CA 401 ? 1_555 O   ? U HOH .   ? A HOH 893 ? 1_555 77.4  ? 
20  OE1 ? E GLU 106 ? A GLU 106 ? 1_555 CA ? G CA . ? A CA 401 ? 1_555 O   ? U HOH .   ? A HOH 893 ? 1_555 84.2  ? 
21  O2A ? K TTP .   ? A TTP 803 ? 1_555 CA ? G CA . ? A CA 401 ? 1_555 O   ? U HOH .   ? A HOH 893 ? 1_555 90.2  ? 
22  OD2 ? E ASP 105 ? A ASP 105 ? 1_555 CA ? G CA . ? A CA 401 ? 1_555 O   ? U HOH .   ? A HOH 943 ? 1_555 136.9 ? 
23  OD1 ? E ASP 7   ? A ASP 7   ? 1_555 CA ? G CA . ? A CA 401 ? 1_555 O   ? U HOH .   ? A HOH 943 ? 1_555 105.4 ? 
24  OD2 ? E ASP 7   ? A ASP 7   ? 1_555 CA ? G CA . ? A CA 401 ? 1_555 O   ? U HOH .   ? A HOH 943 ? 1_555 66.5  ? 
25  OD1 ? E ASP 105 ? A ASP 105 ? 1_555 CA ? G CA . ? A CA 401 ? 1_555 O   ? U HOH .   ? A HOH 943 ? 1_555 169.2 ? 
26  OE1 ? E GLU 106 ? A GLU 106 ? 1_555 CA ? G CA . ? A CA 401 ? 1_555 O   ? U HOH .   ? A HOH 943 ? 1_555 85.7  ? 
27  O2A ? K TTP .   ? A TTP 803 ? 1_555 CA ? G CA . ? A CA 401 ? 1_555 O   ? U HOH .   ? A HOH 943 ? 1_555 78.6  ? 
28  O   ? U HOH .   ? A HOH 893 ? 1_555 CA ? G CA . ? A CA 401 ? 1_555 O   ? U HOH .   ? A HOH 943 ? 1_555 94.2  ? 
29  O2B ? K TTP .   ? A TTP 803 ? 1_555 CA ? H CA . ? A CA 402 ? 1_555 O   ? E PHE 8   ? A PHE 8   ? 1_555 90.2  ? 
30  O2B ? K TTP .   ? A TTP 803 ? 1_555 CA ? H CA . ? A CA 402 ? 1_555 OD2 ? E ASP 105 ? A ASP 105 ? 1_555 79.4  ? 
31  O   ? E PHE 8   ? A PHE 8   ? 1_555 CA ? H CA . ? A CA 402 ? 1_555 OD2 ? E ASP 105 ? A ASP 105 ? 1_555 83.3  ? 
32  O2B ? K TTP .   ? A TTP 803 ? 1_555 CA ? H CA . ? A CA 402 ? 1_555 O3B ? K TTP .   ? A TTP 803 ? 1_555 50.9  ? 
33  O   ? E PHE 8   ? A PHE 8   ? 1_555 CA ? H CA . ? A CA 402 ? 1_555 O3B ? K TTP .   ? A TTP 803 ? 1_555 113.5 ? 
34  OD2 ? E ASP 105 ? A ASP 105 ? 1_555 CA ? H CA . ? A CA 402 ? 1_555 O3B ? K TTP .   ? A TTP 803 ? 1_555 125.6 ? 
35  O2B ? K TTP .   ? A TTP 803 ? 1_555 CA ? H CA . ? A CA 402 ? 1_555 O1G ? K TTP .   ? A TTP 803 ? 1_555 95.0  ? 
36  O   ? E PHE 8   ? A PHE 8   ? 1_555 CA ? H CA . ? A CA 402 ? 1_555 O1G ? K TTP .   ? A TTP 803 ? 1_555 107.0 ? 
37  OD2 ? E ASP 105 ? A ASP 105 ? 1_555 CA ? H CA . ? A CA 402 ? 1_555 O1G ? K TTP .   ? A TTP 803 ? 1_555 168.5 ? 
38  O3B ? K TTP .   ? A TTP 803 ? 1_555 CA ? H CA . ? A CA 402 ? 1_555 O1G ? K TTP .   ? A TTP 803 ? 1_555 45.8  ? 
39  O2B ? K TTP .   ? A TTP 803 ? 1_555 CA ? H CA . ? A CA 402 ? 1_555 O   ? U HOH .   ? A HOH 813 ? 1_555 135.6 ? 
40  O   ? E PHE 8   ? A PHE 8   ? 1_555 CA ? H CA . ? A CA 402 ? 1_555 O   ? U HOH .   ? A HOH 813 ? 1_555 69.7  ? 
41  OD2 ? E ASP 105 ? A ASP 105 ? 1_555 CA ? H CA . ? A CA 402 ? 1_555 O   ? U HOH .   ? A HOH 813 ? 1_555 133.2 ? 
42  O3B ? K TTP .   ? A TTP 803 ? 1_555 CA ? H CA . ? A CA 402 ? 1_555 O   ? U HOH .   ? A HOH 813 ? 1_555 100.4 ? 
43  O1G ? K TTP .   ? A TTP 803 ? 1_555 CA ? H CA . ? A CA 402 ? 1_555 O   ? U HOH .   ? A HOH 813 ? 1_555 57.2  ? 
44  O2B ? K TTP .   ? A TTP 803 ? 1_555 CA ? H CA . ? A CA 402 ? 1_555 OD1 ? E ASP 7   ? A ASP 7   ? 1_555 156.9 ? 
45  O   ? E PHE 8   ? A PHE 8   ? 1_555 CA ? H CA . ? A CA 402 ? 1_555 OD1 ? E ASP 7   ? A ASP 7   ? 1_555 93.4  ? 
46  OD2 ? E ASP 105 ? A ASP 105 ? 1_555 CA ? H CA . ? A CA 402 ? 1_555 OD1 ? E ASP 7   ? A ASP 7   ? 1_555 78.3  ? 
47  O3B ? K TTP .   ? A TTP 803 ? 1_555 CA ? H CA . ? A CA 402 ? 1_555 OD1 ? E ASP 7   ? A ASP 7   ? 1_555 144.4 ? 
48  O1G ? K TTP .   ? A TTP 803 ? 1_555 CA ? H CA . ? A CA 402 ? 1_555 OD1 ? E ASP 7   ? A ASP 7   ? 1_555 105.7 ? 
49  O   ? U HOH .   ? A HOH 813 ? 1_555 CA ? H CA . ? A CA 402 ? 1_555 OD1 ? E ASP 7   ? A ASP 7   ? 1_555 66.5  ? 
50  O2B ? K TTP .   ? A TTP 803 ? 1_555 CA ? H CA . ? A CA 402 ? 1_555 O2A ? K TTP .   ? A TTP 803 ? 1_555 78.1  ? 
51  O   ? E PHE 8   ? A PHE 8   ? 1_555 CA ? H CA . ? A CA 402 ? 1_555 O2A ? K TTP .   ? A TTP 803 ? 1_555 162.0 ? 
52  OD2 ? E ASP 105 ? A ASP 105 ? 1_555 CA ? H CA . ? A CA 402 ? 1_555 O2A ? K TTP .   ? A TTP 803 ? 1_555 81.1  ? 
53  O3B ? K TTP .   ? A TTP 803 ? 1_555 CA ? H CA . ? A CA 402 ? 1_555 O2A ? K TTP .   ? A TTP 803 ? 1_555 69.5  ? 
54  O1G ? K TTP .   ? A TTP 803 ? 1_555 CA ? H CA . ? A CA 402 ? 1_555 O2A ? K TTP .   ? A TTP 803 ? 1_555 87.9  ? 
55  O   ? U HOH .   ? A HOH 813 ? 1_555 CA ? H CA . ? A CA 402 ? 1_555 O2A ? K TTP .   ? A TTP 803 ? 1_555 128.1 ? 
56  OD1 ? E ASP 7   ? A ASP 7   ? 1_555 CA ? H CA . ? A CA 402 ? 1_555 O2A ? K TTP .   ? A TTP 803 ? 1_555 92.2  ? 
57  O   ? E ALA 181 ? A ALA 181 ? 1_555 CA ? I CA . ? A CA 406 ? 1_555 O   ? E ILE 186 ? A ILE 186 ? 1_555 97.9  ? 
58  O   ? U HOH .   ? A HOH 891 ? 1_555 MG ? J MG . ? A MG 407 ? 1_555 OD1 ? E ASP 294 ? A ASP 294 ? 1_555 66.6  ? 
59  O   ? U HOH .   ? A HOH 891 ? 1_555 MG ? J MG . ? A MG 407 ? 1_555 OD2 ? E ASP 294 ? A ASP 294 ? 1_555 103.9 ? 
60  OD1 ? E ASP 294 ? A ASP 294 ? 1_555 MG ? J MG . ? A MG 407 ? 1_555 OD2 ? E ASP 294 ? A ASP 294 ? 1_555 57.5  ? 
61  O2A ? P TTP .   ? B TTP 804 ? 1_555 CA ? L CA . ? B CA 403 ? 1_555 O   ? V HOH .   ? B HOH 865 ? 1_555 87.7  ? 
62  O2A ? P TTP .   ? B TTP 804 ? 1_555 CA ? L CA . ? B CA 403 ? 1_555 OD1 ? F ASP 7   ? B ASP 7   ? 1_555 107.0 ? 
63  O   ? V HOH .   ? B HOH 865 ? 1_555 CA ? L CA . ? B CA 403 ? 1_555 OD1 ? F ASP 7   ? B ASP 7   ? 1_555 159.1 ? 
64  O2A ? P TTP .   ? B TTP 804 ? 1_555 CA ? L CA . ? B CA 403 ? 1_555 O   ? V HOH .   ? B HOH 806 ? 1_555 85.4  ? 
65  O   ? V HOH .   ? B HOH 865 ? 1_555 CA ? L CA . ? B CA 403 ? 1_555 O   ? V HOH .   ? B HOH 806 ? 1_555 112.6 ? 
66  OD1 ? F ASP 7   ? B ASP 7   ? 1_555 CA ? L CA . ? B CA 403 ? 1_555 O   ? V HOH .   ? B HOH 806 ? 1_555 84.0  ? 
67  O2A ? P TTP .   ? B TTP 804 ? 1_555 CA ? L CA . ? B CA 403 ? 1_555 OE1 ? F GLU 106 ? B GLU 106 ? 1_555 152.9 ? 
68  O   ? V HOH .   ? B HOH 865 ? 1_555 CA ? L CA . ? B CA 403 ? 1_555 OE1 ? F GLU 106 ? B GLU 106 ? 1_555 88.8  ? 
69  OD1 ? F ASP 7   ? B ASP 7   ? 1_555 CA ? L CA . ? B CA 403 ? 1_555 OE1 ? F GLU 106 ? B GLU 106 ? 1_555 84.6  ? 
70  O   ? V HOH .   ? B HOH 806 ? 1_555 CA ? L CA . ? B CA 403 ? 1_555 OE1 ? F GLU 106 ? B GLU 106 ? 1_555 71.3  ? 
71  O2A ? P TTP .   ? B TTP 804 ? 1_555 CA ? L CA . ? B CA 403 ? 1_555 O   ? V HOH .   ? B HOH 927 ? 1_555 94.6  ? 
72  O   ? V HOH .   ? B HOH 865 ? 1_555 CA ? L CA . ? B CA 403 ? 1_555 O   ? V HOH .   ? B HOH 927 ? 1_555 103.8 ? 
73  OD1 ? F ASP 7   ? B ASP 7   ? 1_555 CA ? L CA . ? B CA 403 ? 1_555 O   ? V HOH .   ? B HOH 927 ? 1_555 61.1  ? 
74  O   ? V HOH .   ? B HOH 806 ? 1_555 CA ? L CA . ? B CA 403 ? 1_555 O   ? V HOH .   ? B HOH 927 ? 1_555 143.5 ? 
75  OE1 ? F GLU 106 ? B GLU 106 ? 1_555 CA ? L CA . ? B CA 403 ? 1_555 O   ? V HOH .   ? B HOH 927 ? 1_555 112.3 ? 
76  O2A ? P TTP .   ? B TTP 804 ? 1_555 CA ? L CA . ? B CA 403 ? 1_555 OD1 ? F ASP 105 ? B ASP 105 ? 1_555 86.1  ? 
77  O   ? V HOH .   ? B HOH 865 ? 1_555 CA ? L CA . ? B CA 403 ? 1_555 OD1 ? F ASP 105 ? B ASP 105 ? 1_555 54.2  ? 
78  OD1 ? F ASP 7   ? B ASP 7   ? 1_555 CA ? L CA . ? B CA 403 ? 1_555 OD1 ? F ASP 105 ? B ASP 105 ? 1_555 110.8 ? 
79  O   ? V HOH .   ? B HOH 806 ? 1_555 CA ? L CA . ? B CA 403 ? 1_555 OD1 ? F ASP 105 ? B ASP 105 ? 1_555 164.6 ? 
80  OE1 ? F GLU 106 ? B GLU 106 ? 1_555 CA ? L CA . ? B CA 403 ? 1_555 OD1 ? F ASP 105 ? B ASP 105 ? 1_555 113.2 ? 
81  O   ? V HOH .   ? B HOH 927 ? 1_555 CA ? L CA . ? B CA 403 ? 1_555 OD1 ? F ASP 105 ? B ASP 105 ? 1_555 50.1  ? 
82  O2A ? P TTP .   ? B TTP 804 ? 1_555 CA ? L CA . ? B CA 403 ? 1_555 OD2 ? F ASP 7   ? B ASP 7   ? 1_555 71.7  ? 
83  O   ? V HOH .   ? B HOH 865 ? 1_555 CA ? L CA . ? B CA 403 ? 1_555 OD2 ? F ASP 7   ? B ASP 7   ? 1_555 137.2 ? 
84  OD1 ? F ASP 7   ? B ASP 7   ? 1_555 CA ? L CA . ? B CA 403 ? 1_555 OD2 ? F ASP 7   ? B ASP 7   ? 1_555 42.0  ? 
85  O   ? V HOH .   ? B HOH 806 ? 1_555 CA ? L CA . ? B CA 403 ? 1_555 OD2 ? F ASP 7   ? B ASP 7   ? 1_555 102.9 ? 
86  OE1 ? F GLU 106 ? B GLU 106 ? 1_555 CA ? L CA . ? B CA 403 ? 1_555 OD2 ? F ASP 7   ? B ASP 7   ? 1_555 126.0 ? 
87  O   ? V HOH .   ? B HOH 927 ? 1_555 CA ? L CA . ? B CA 403 ? 1_555 OD2 ? F ASP 7   ? B ASP 7   ? 1_555 44.1  ? 
88  OD1 ? F ASP 105 ? B ASP 105 ? 1_555 CA ? L CA . ? B CA 403 ? 1_555 OD2 ? F ASP 7   ? B ASP 7   ? 1_555 86.5  ? 
89  O   ? V HOH .   ? B HOH 890 ? 1_555 CA ? M CA . ? B CA 404 ? 1_555 O   ? V HOH .   ? B HOH 927 ? 1_555 129.9 ? 
90  O   ? V HOH .   ? B HOH 890 ? 1_555 CA ? M CA . ? B CA 404 ? 1_555 O1G ? P TTP .   ? B TTP 804 ? 1_555 47.0  ? 
91  O   ? V HOH .   ? B HOH 927 ? 1_555 CA ? M CA . ? B CA 404 ? 1_555 O1G ? P TTP .   ? B TTP 804 ? 1_555 127.2 ? 
92  O   ? V HOH .   ? B HOH 890 ? 1_555 CA ? M CA . ? B CA 404 ? 1_555 O2A ? P TTP .   ? B TTP 804 ? 1_555 134.8 ? 
93  O   ? V HOH .   ? B HOH 927 ? 1_555 CA ? M CA . ? B CA 404 ? 1_555 O2A ? P TTP .   ? B TTP 804 ? 1_555 83.6  ? 
94  O1G ? P TTP .   ? B TTP 804 ? 1_555 CA ? M CA . ? B CA 404 ? 1_555 O2A ? P TTP .   ? B TTP 804 ? 1_555 89.8  ? 
95  O   ? V HOH .   ? B HOH 890 ? 1_555 CA ? M CA . ? B CA 404 ? 1_555 O2B ? P TTP .   ? B TTP 804 ? 1_555 86.8  ? 
96  O   ? V HOH .   ? B HOH 927 ? 1_555 CA ? M CA . ? B CA 404 ? 1_555 O2B ? P TTP .   ? B TTP 804 ? 1_555 135.7 ? 
97  O1G ? P TTP .   ? B TTP 804 ? 1_555 CA ? M CA . ? B CA 404 ? 1_555 O2B ? P TTP .   ? B TTP 804 ? 1_555 95.3  ? 
98  O2A ? P TTP .   ? B TTP 804 ? 1_555 CA ? M CA . ? B CA 404 ? 1_555 O2B ? P TTP .   ? B TTP 804 ? 1_555 84.3  ? 
99  O   ? V HOH .   ? B HOH 890 ? 1_555 CA ? M CA . ? B CA 404 ? 1_555 O3B ? P TTP .   ? B TTP 804 ? 1_555 64.1  ? 
100 O   ? V HOH .   ? B HOH 927 ? 1_555 CA ? M CA . ? B CA 404 ? 1_555 O3B ? P TTP .   ? B TTP 804 ? 1_555 155.6 ? 
101 O1G ? P TTP .   ? B TTP 804 ? 1_555 CA ? M CA . ? B CA 404 ? 1_555 O3B ? P TTP .   ? B TTP 804 ? 1_555 43.0  ? 
102 O2A ? P TTP .   ? B TTP 804 ? 1_555 CA ? M CA . ? B CA 404 ? 1_555 O3B ? P TTP .   ? B TTP 804 ? 1_555 75.0  ? 
103 O2B ? P TTP .   ? B TTP 804 ? 1_555 CA ? M CA . ? B CA 404 ? 1_555 O3B ? P TTP .   ? B TTP 804 ? 1_555 54.3  ? 
104 O   ? V HOH .   ? B HOH 890 ? 1_555 CA ? M CA . ? B CA 404 ? 1_555 OD2 ? F ASP 105 ? B ASP 105 ? 1_555 130.1 ? 
105 O   ? V HOH .   ? B HOH 927 ? 1_555 CA ? M CA . ? B CA 404 ? 1_555 OD2 ? F ASP 105 ? B ASP 105 ? 1_555 54.9  ? 
106 O1G ? P TTP .   ? B TTP 804 ? 1_555 CA ? M CA . ? B CA 404 ? 1_555 OD2 ? F ASP 105 ? B ASP 105 ? 1_555 176.9 ? 
107 O2A ? P TTP .   ? B TTP 804 ? 1_555 CA ? M CA . ? B CA 404 ? 1_555 OD2 ? F ASP 105 ? B ASP 105 ? 1_555 92.7  ? 
108 O2B ? P TTP .   ? B TTP 804 ? 1_555 CA ? M CA . ? B CA 404 ? 1_555 OD2 ? F ASP 105 ? B ASP 105 ? 1_555 83.4  ? 
109 O3B ? P TTP .   ? B TTP 804 ? 1_555 CA ? M CA . ? B CA 404 ? 1_555 OD2 ? F ASP 105 ? B ASP 105 ? 1_555 136.4 ? 
110 O   ? V HOH .   ? B HOH 890 ? 1_555 CA ? M CA . ? B CA 404 ? 1_555 O   ? F PHE 8   ? B PHE 8   ? 1_555 51.7  ? 
111 O   ? V HOH .   ? B HOH 927 ? 1_555 CA ? M CA . ? B CA 404 ? 1_555 O   ? F PHE 8   ? B PHE 8   ? 1_555 97.9  ? 
112 O1G ? P TTP .   ? B TTP 804 ? 1_555 CA ? M CA . ? B CA 404 ? 1_555 O   ? F PHE 8   ? B PHE 8   ? 1_555 98.4  ? 
113 O2A ? P TTP .   ? B TTP 804 ? 1_555 CA ? M CA . ? B CA 404 ? 1_555 O   ? F PHE 8   ? B PHE 8   ? 1_555 168.3 ? 
114 O2B ? P TTP .   ? B TTP 804 ? 1_555 CA ? M CA . ? B CA 404 ? 1_555 O   ? F PHE 8   ? B PHE 8   ? 1_555 86.6  ? 
115 O3B ? P TTP .   ? B TTP 804 ? 1_555 CA ? M CA . ? B CA 404 ? 1_555 O   ? F PHE 8   ? B PHE 8   ? 1_555 105.5 ? 
116 OD2 ? F ASP 105 ? B ASP 105 ? 1_555 CA ? M CA . ? B CA 404 ? 1_555 O   ? F PHE 8   ? B PHE 8   ? 1_555 78.9  ? 
117 O   ? V HOH .   ? B HOH 890 ? 1_555 CA ? M CA . ? B CA 404 ? 1_555 OD2 ? F ASP 7   ? B ASP 7   ? 1_555 87.7  ? 
118 O   ? V HOH .   ? B HOH 927 ? 1_555 CA ? M CA . ? B CA 404 ? 1_555 OD2 ? F ASP 7   ? B ASP 7   ? 1_555 50.0  ? 
119 O1G ? P TTP .   ? B TTP 804 ? 1_555 CA ? M CA . ? B CA 404 ? 1_555 OD2 ? F ASP 7   ? B ASP 7   ? 1_555 79.6  ? 
120 O2A ? P TTP .   ? B TTP 804 ? 1_555 CA ? M CA . ? B CA 404 ? 1_555 OD2 ? F ASP 7   ? B ASP 7   ? 1_555 98.3  ? 
121 O2B ? P TTP .   ? B TTP 804 ? 1_555 CA ? M CA . ? B CA 404 ? 1_555 OD2 ? F ASP 7   ? B ASP 7   ? 1_555 174.2 ? 
122 O3B ? P TTP .   ? B TTP 804 ? 1_555 CA ? M CA . ? B CA 404 ? 1_555 OD2 ? F ASP 7   ? B ASP 7   ? 1_555 121.3 ? 
123 OD2 ? F ASP 105 ? B ASP 105 ? 1_555 CA ? M CA . ? B CA 404 ? 1_555 OD2 ? F ASP 7   ? B ASP 7   ? 1_555 101.7 ? 
124 O   ? F PHE 8   ? B PHE 8   ? 1_555 CA ? M CA . ? B CA 404 ? 1_555 OD2 ? F ASP 7   ? B ASP 7   ? 1_555 91.5  ? 
125 O   ? S HOH .   ? E HOH 124 ? 1_555 CA ? N CA . ? B CA 405 ? 1_555 O   ? F ILE 186 ? B ILE 186 ? 1_555 83.8  ? 
126 O   ? S HOH .   ? E HOH 124 ? 1_555 CA ? N CA . ? B CA 405 ? 1_555 O   ? F ALA 181 ? B ALA 181 ? 1_555 174.2 ? 
127 O   ? F ILE 186 ? B ILE 186 ? 1_555 CA ? N CA . ? B CA 405 ? 1_555 O   ? F ALA 181 ? B ALA 181 ? 1_555 92.4  ? 
128 O   ? V HOH .   ? B HOH 880 ? 1_555 MG ? O MG . ? B MG 408 ? 1_555 OD2 ? F ASP 294 ? B ASP 294 ? 1_555 108.8 ? 
129 O   ? V HOH .   ? B HOH 880 ? 1_555 MG ? O MG . ? B MG 408 ? 1_555 O   ? V HOH .   ? B HOH 932 ? 1_555 136.4 ? 
130 OD2 ? F ASP 294 ? B ASP 294 ? 1_555 MG ? O MG . ? B MG 408 ? 1_555 O   ? V HOH .   ? B HOH 932 ? 1_555 82.6  ? 
131 O   ? V HOH .   ? B HOH 880 ? 1_555 MG ? O MG . ? B MG 408 ? 1_555 OD1 ? F ASP 294 ? B ASP 294 ? 1_555 75.7  ? 
132 OD2 ? F ASP 294 ? B ASP 294 ? 1_555 MG ? O MG . ? B MG 408 ? 1_555 OD1 ? F ASP 294 ? B ASP 294 ? 1_555 48.5  ? 
133 O   ? V HOH .   ? B HOH 932 ? 1_555 MG ? O MG . ? B MG 408 ? 1_555 OD1 ? F ASP 294 ? B ASP 294 ? 1_555 130.8 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-03-30 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2018-04-04 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Source and taxonomy'       
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Data collection'           
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            diffrn_source 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    4 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_diffrn_source.type' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000  'data collection' . ? 1 
SCALEPACK 'data scaling'    . ? 2 
CNS       refinement        . ? 3 
HKL-2000  'data reduction'  . ? 4 
CNS       phasing           . ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 O     D HOH 203  ? ? O D HOH 370 ? ? 2.05 
2  1 O6    D DG  1905 ? ? O D HOH 347 ? ? 2.07 
3  1 N7    F DG  1905 ? ? O F HOH 362 ? ? 2.08 
4  1 O     D HOH 203  ? ? O D HOH 351 ? ? 2.10 
5  1 O     B PHE 8    ? ? O B HOH 890 ? ? 2.11 
6  1 CG    B ASN 234  ? ? O B HOH 926 ? ? 2.12 
7  1 "O4'" F DT  1902 ? ? O F HOH 355 ? ? 2.12 
8  1 NZ    A LYS 164  ? ? O A HOH 951 ? ? 2.14 
9  1 O     B GLU 209  ? ? O B HOH 922 ? ? 2.14 
10 1 OD1   B ASP 105  ? ? O B HOH 865 ? ? 2.15 
11 1 O     E HOH 167  ? ? O E HOH 372 ? ? 2.16 
12 1 O     A HOH 903  ? ? O A HOH 950 ? ? 2.16 
13 1 OD1   B ASP 105  ? ? O B HOH 927 ? ? 2.16 
14 1 CB    A ASN 234  ? ? O A HOH 946 ? ? 2.16 
15 1 O     A HOH 918  ? ? O A HOH 945 ? ? 2.17 
16 1 "O3'" D DT  1913 ? ? O D HOH 356 ? ? 2.18 
17 1 "C4'" F DT  1902 ? ? O F HOH 355 ? ? 2.19 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 O   A HOH 897 ? ? 1_555 O A HOH 950 ? ? 3_645 2.14 
2 1 OE1 B GLU 324 ? ? 1_555 O B HOH 926 ? ? 4_566 2.18 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O3'" F DG 1905 ? ? P     F DT 1906 ? ? OP1   F DT 1906 ? ? 77.24  105.20 -27.96 2.20 Y 
2 1 "C5'" F DT 1906 ? ? "C4'" F DT 1906 ? ? "C3'" F DT 1906 ? ? 126.60 115.70 10.90  1.20 N 
3 1 "C5'" F DT 1906 ? ? "C4'" F DT 1906 ? ? "O4'" F DT 1906 ? ? 96.79  109.30 -12.51 1.90 N 
4 1 "C3'" F DA 1907 ? ? "C2'" F DA 1907 ? ? "C1'" F DA 1907 ? ? 97.44  102.40 -4.96  0.80 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 TYR A 10  ? ? 23.12   53.15   
2  1 ASN A 20  ? ? -150.03 82.14   
3  1 SER A 96  ? ? -172.82 139.26  
4  1 SER A 145 ? ? -169.48 -169.96 
5  1 ASN A 161 ? ? 39.80   61.14   
6  1 ASN A 234 ? ? -151.99 41.24   
7  1 ASP A 277 ? ? 60.59   -114.78 
8  1 TYR B 10  ? ? 24.82   55.47   
9  1 PHE B 11  ? ? -38.56  -70.23  
10 1 ASN B 20  ? ? -151.63 75.41   
11 1 PHE B 37  ? ? 164.92  146.35  
12 1 GLU B 38  ? ? -36.32  122.10  
13 1 LEU B 68  ? ? -118.23 65.86   
14 1 SER B 145 ? ? -168.40 -169.58 
15 1 ASN B 161 ? ? 34.35   54.81   
16 1 ARG B 256 ? ? -142.08 25.38   
17 1 ASP B 277 ? ? 40.02   92.54   
18 1 LYS B 278 ? ? 73.77   -27.23  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 D DT 1906 ? N1 ? B DT 5 N1 
2  1 Y 1 D DT 1906 ? C2 ? B DT 5 C2 
3  1 Y 1 D DT 1906 ? O2 ? B DT 5 O2 
4  1 Y 1 D DT 1906 ? N3 ? B DT 5 N3 
5  1 Y 1 D DT 1906 ? C4 ? B DT 5 C4 
6  1 Y 1 D DT 1906 ? O4 ? B DT 5 O4 
7  1 Y 1 D DT 1906 ? C5 ? B DT 5 C5 
8  1 Y 1 D DT 1906 ? C7 ? B DT 5 C7 
9  1 Y 1 D DT 1906 ? C6 ? B DT 5 C6 
10 1 Y 1 F DT 1906 ? N1 ? D DT 5 N1 
11 1 Y 1 F DT 1906 ? C2 ? D DT 5 C2 
12 1 Y 1 F DT 1906 ? O2 ? D DT 5 O2 
13 1 Y 1 F DT 1906 ? N3 ? D DT 5 N3 
14 1 Y 1 F DT 1906 ? C4 ? D DT 5 C4 
15 1 Y 1 F DT 1906 ? O4 ? D DT 5 O4 
16 1 Y 1 F DT 1906 ? C5 ? D DT 5 C5 
17 1 Y 1 F DT 1906 ? C7 ? D DT 5 C7 
18 1 Y 1 F DT 1906 ? C6 ? D DT 5 C6 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLU 342 ? E GLU 342 
2  1 Y 1 A ALA 343 ? E ALA 343 
3  1 Y 1 A ILE 344 ? E ILE 344 
4  1 Y 1 A GLY 345 ? E GLY 345 
5  1 Y 1 A LEU 346 ? E LEU 346 
6  1 Y 1 A ASP 347 ? E ASP 347 
7  1 Y 1 A LYS 348 ? E LYS 348 
8  1 Y 1 A PHE 349 ? E PHE 349 
9  1 Y 1 A PHE 350 ? E PHE 350 
10 1 Y 1 A ASP 351 ? E ASP 351 
11 1 Y 1 A THR 352 ? E THR 352 
12 1 Y 1 B GLU 342 ? F GLU 342 
13 1 Y 1 B ALA 343 ? F ALA 343 
14 1 Y 1 B ILE 344 ? F ILE 344 
15 1 Y 1 B GLY 345 ? F GLY 345 
16 1 Y 1 B LEU 346 ? F LEU 346 
17 1 Y 1 B ASP 347 ? F ASP 347 
18 1 Y 1 B LYS 348 ? F LYS 348 
19 1 Y 1 B PHE 349 ? F PHE 349 
20 1 Y 1 B PHE 350 ? F PHE 350 
21 1 Y 1 B ASP 351 ? F ASP 351 
22 1 Y 1 B THR 352 ? F THR 352 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1S0O 'double helix'        
1S0O 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DG 1  1_555 B DC 17 1_555 -0.161 -0.104 -0.410 -4.448  -5.166  -1.779 1  C_DG1801:DC1918_D C 1801 ? D 1918 ? 19 1 
1 A DG 2  1_555 B DC 16 1_555 -0.162 -0.120 -0.220 9.030   -2.890  2.813  2  C_DG1802:DC1917_D C 1802 ? D 1917 ? 19 1 
1 A DG 3  1_555 B DC 15 1_555 -0.254 -0.176 0.251  11.986  -4.864  -6.354 3  C_DG1803:DC1916_D C 1803 ? D 1916 ? 19 1 
1 A DG 4  1_555 B DC 14 1_555 -0.402 -0.181 -0.386 1.146   -5.126  0.658  4  C_DG1804:DC1915_D C 1804 ? D 1915 ? 19 1 
1 A DG 5  1_555 B DC 13 1_555 0.361  0.214  -0.642 -2.161  8.447   -1.016 5  C_DG1805:DC1914_D C 1805 ? D 1914 ? 19 1 
1 A DA 6  1_555 B DT 12 1_555 0.168  0.168  -0.200 -1.603  -6.306  0.253  6  C_DA1806:DT1913_D C 1806 ? D 1913 ? 20 1 
1 A DA 7  1_555 B DT 11 1_555 -0.082 0.038  0.150  -0.070  -10.717 10.169 7  C_DA1807:DT1912_D C 1807 ? D 1912 ? 20 1 
1 A DG 8  1_555 B DC 10 1_555 -0.129 0.153  -0.002 0.194   -3.217  6.750  8  C_DG1808:DC1911_D C 1808 ? D 1911 ? 19 1 
1 A DG 9  1_555 B DC 9  1_555 -0.292 0.067  -0.093 -2.508  -11.292 6.369  9  C_DG1809:DC1910_D C 1809 ? D 1910 ? 19 1 
1 A DA 10 1_555 B DT 8  1_555 0.433  -0.148 0.089  -3.821  -11.110 -0.400 10 C_DA1810:DT1909_D C 1810 ? D 1909 ? 20 1 
1 A DC 11 1_555 B DG 7  1_555 -0.072 -0.056 0.285  2.973   -6.065  2.358  11 C_DC1811:DG1908_D C 1811 ? D 1908 ? 19 1 
1 A DT 12 1_555 B DA 6  1_555 0.206  -0.047 0.178  19.935  0.944   5.474  12 C_DT1812:DA1907_D C 1812 ? D 1907 ? 20 1 
1 C DG 1  1_555 D DC 17 1_555 -0.107 -0.034 0.066  -0.748  -1.451  -4.486 13 E_DG1801:DC1918_F E 1801 ? F 1918 ? 19 1 
1 C DG 2  1_555 D DC 16 1_555 -0.287 -0.152 0.029  8.607   -6.312  0.462  14 E_DG1802:DC1917_F E 1802 ? F 1917 ? 19 1 
1 C DG 3  1_555 D DC 15 1_555 -0.103 -0.161 0.126  3.987   -8.183  -4.323 15 E_DG1803:DC1916_F E 1803 ? F 1916 ? 19 1 
1 C DG 4  1_555 D DC 14 1_555 -0.120 0.005  -0.205 2.112   -7.630  1.383  16 E_DG1804:DC1915_F E 1804 ? F 1915 ? 19 1 
1 C DG 5  1_555 D DC 13 1_555 0.077  -0.092 -0.114 2.796   -7.045  -2.102 17 E_DG1805:DC1914_F E 1805 ? F 1914 ? 19 1 
1 C DA 6  1_555 D DT 12 1_555 0.033  0.032  -0.228 1.222   -12.735 4.582  18 E_DA1806:DT1913_F E 1806 ? F 1913 ? 20 1 
1 C DA 7  1_555 D DT 11 1_555 0.326  -0.157 0.297  6.140   -10.993 0.054  19 E_DA1807:DT1912_F E 1807 ? F 1912 ? 20 1 
1 C DG 8  1_555 D DC 10 1_555 -0.026 -0.183 0.021  3.075   -8.499  1.641  20 E_DG1808:DC1911_F E 1808 ? F 1911 ? 19 1 
1 C DG 9  1_555 D DC 9  1_555 -0.235 -0.109 -0.226 -8.368  -10.158 2.523  21 E_DG1809:DC1910_F E 1809 ? F 1910 ? 19 1 
1 C DA 10 1_555 D DT 8  1_555 0.213  -0.004 -0.226 -4.325  -6.870  -1.776 22 E_DA1810:DT1909_F E 1810 ? F 1909 ? 20 1 
1 C DC 11 1_555 D DG 7  1_555 0.137  0.033  -0.005 4.938   -0.630  2.197  23 E_DC1811:DG1908_F E 1811 ? F 1908 ? 19 1 
1 C DT 12 1_555 D DA 6  1_555 -0.029 -0.187 -0.329 4.685   -8.854  1.966  24 E_DT1812:DA1907_F E 1812 ? F 1907 ? 20 1 
1 C DC 13 1_555 D DG 4  1_555 -0.199 -0.140 0.470  -15.343 1.103   -1.989 25 E_DC1813:DG1905_F E 1813 ? F 1905 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DG 1  1_555 B DC 17 1_555 A DG 2  1_555 B DC 16 1_555 0.913  0.483  3.117 -1.135 2.478  31.006 0.448  -1.908 3.111 4.624  
2.117   31.122 1  CC_DG1801DG1802:DC1917DC1918_DD C 1801 ? D 1918 ? C 1802 ? D 1917 ? 
1 A DG 2  1_555 B DC 16 1_555 A DG 3  1_555 B DC 15 1_555 -1.382 -0.409 3.200 -7.293 4.877  32.774 -1.498 1.179  3.328 8.455  
12.644  33.897 2  CC_DG1802DG1803:DC1916DC1917_DD C 1802 ? D 1917 ? C 1803 ? D 1916 ? 
1 A DG 3  1_555 B DC 15 1_555 A DG 4  1_555 B DC 14 1_555 1.222  -0.727 3.662 6.249  10.236 32.431 -3.006 -0.972 3.452 17.593 
-10.740 34.522 3  CC_DG1803DG1804:DC1915DC1916_DD C 1803 ? D 1916 ? C 1804 ? D 1915 ? 
1 A DG 4  1_555 B DC 14 1_555 A DG 5  1_555 B DC 13 1_555 -0.475 -1.023 3.445 2.940  10.682 26.656 -4.412 1.603  2.770 21.999 
-6.055  28.829 4  CC_DG1804DG1805:DC1914DC1915_DD C 1804 ? D 1915 ? C 1805 ? D 1914 ? 
1 A DG 5  1_555 B DC 13 1_555 A DA 6  1_555 B DT 12 1_555 -0.231 -0.035 3.277 -2.161 7.418  31.915 -1.340 0.037  3.197 13.250 
3.860   32.813 5  CC_DG1805DA1806:DT1913DC1914_DD C 1805 ? D 1914 ? C 1806 ? D 1913 ? 
1 A DA 6  1_555 B DT 12 1_555 A DA 7  1_555 B DT 11 1_555 0.249  -0.140 3.154 -1.401 9.060  30.008 -1.893 -0.715 2.972 17.005 
2.630   31.346 6  CC_DA1806DA1807:DT1912DT1913_DD C 1806 ? D 1913 ? C 1807 ? D 1912 ? 
1 A DA 7  1_555 B DT 11 1_555 A DG 8  1_555 B DC 10 1_555 -0.367 0.142  3.245 -0.205 8.608  33.962 -1.060 0.579  3.187 14.451 
0.345   35.005 7  CC_DA1807DG1808:DC1911DT1912_DD C 1807 ? D 1912 ? C 1808 ? D 1911 ? 
1 A DG 8  1_555 B DC 10 1_555 A DG 9  1_555 B DC 9  1_555 0.063  -0.558 3.397 0.953  4.501  32.248 -1.802 0.059  3.291 8.052  
-1.706  32.566 8  CC_DG1808DG1809:DC1910DC1911_DD C 1808 ? D 1911 ? C 1809 ? D 1910 ? 
1 A DG 9  1_555 B DC 9  1_555 A DA 10 1_555 B DT 8  1_555 -0.989 -0.309 3.344 -4.318 2.971  40.524 -0.781 0.927  3.397 4.268  
6.202   40.848 9  CC_DG1809DA1810:DT1909DC1910_DD C 1809 ? D 1910 ? C 1810 ? D 1909 ? 
1 A DA 10 1_555 B DT 8  1_555 A DC 11 1_555 B DG 7  1_555 0.202  -0.607 3.060 -1.845 2.190  26.059 -1.888 -0.908 2.979 4.838  
4.075   26.213 10 CC_DA1810DC1811:DG1908DT1909_DD C 1810 ? D 1909 ? C 1811 ? D 1908 ? 
1 A DC 11 1_555 B DG 7  1_555 A DT 12 1_555 B DA 6  1_555 0.494  -0.540 3.058 -0.124 -0.449 32.524 -0.890 -0.901 3.063 -0.802 
0.222   32.527 11 CC_DC1811DT1812:DA1907DG1908_DD C 1811 ? D 1908 ? C 1812 ? D 1907 ? 
1 C DG 1  1_555 D DC 17 1_555 C DG 2  1_555 D DC 16 1_555 0.846  0.035  3.179 1.434  2.514  30.347 -0.423 -1.329 3.207 4.788  
-2.732  30.482 12 EE_DG1801DG1802:DC1917DC1918_FF E 1801 ? F 1918 ? E 1802 ? F 1917 ? 
1 C DG 2  1_555 D DC 16 1_555 C DG 3  1_555 D DC 15 1_555 -1.408 -0.104 3.342 -5.279 3.524  37.264 -0.637 1.461  3.478 5.466  
8.188   37.782 13 EE_DG1802DG1803:DC1916DC1917_FF E 1802 ? F 1917 ? E 1803 ? F 1916 ? 
1 C DG 3  1_555 D DC 15 1_555 C DG 4  1_555 D DC 14 1_555 0.866  -0.249 3.380 3.921  6.785  33.799 -1.503 -0.825 3.345 11.479 
-6.634  34.669 14 EE_DG1803DG1804:DC1915DC1916_FF E 1803 ? F 1916 ? E 1804 ? F 1915 ? 
1 C DG 4  1_555 D DC 14 1_555 C DG 5  1_555 D DC 13 1_555 -0.451 -0.185 3.201 -1.572 9.802  32.640 -1.837 0.526  3.038 16.959 
2.720   34.077 15 EE_DG1804DG1805:DC1914DC1915_FF E 1804 ? F 1915 ? E 1805 ? F 1914 ? 
1 C DG 5  1_555 D DC 13 1_555 C DA 6  1_555 D DT 12 1_555 -0.425 0.108  3.211 -0.483 8.165  37.268 -0.855 0.591  3.169 12.591 
0.744   38.124 16 EE_DG1805DA1806:DT1913DC1914_FF E 1805 ? F 1914 ? E 1806 ? F 1913 ? 
1 C DA 6  1_555 D DT 12 1_555 C DA 7  1_555 D DT 11 1_555 0.008  0.121  3.144 -3.727 0.670  34.376 0.104  -0.567 3.128 1.130  
6.283   34.578 17 EE_DA1806DA1807:DT1912DT1913_FF E 1806 ? F 1913 ? E 1807 ? F 1912 ? 
1 C DA 7  1_555 D DT 11 1_555 C DG 8  1_555 D DC 10 1_555 0.003  -0.361 3.421 0.512  -0.319 37.216 -0.521 0.066  3.423 -0.500 
-0.802  37.221 18 EE_DA1807DG1808:DC1911DT1912_FF E 1807 ? F 1912 ? E 1808 ? F 1911 ? 
1 C DG 8  1_555 D DC 10 1_555 C DG 9  1_555 D DC 9  1_555 -0.038 -0.595 3.536 2.325  2.957  35.231 -1.445 0.429  3.467 4.868  
-3.828  35.425 19 EE_DG1808DG1809:DC1910DC1911_FF E 1808 ? F 1911 ? E 1809 ? F 1910 ? 
1 C DG 9  1_555 D DC 9  1_555 C DA 10 1_555 D DT 8  1_555 -0.364 0.070  3.246 -0.711 5.185  33.951 -0.689 0.506  3.228 8.815  
1.208   34.341 20 EE_DG1809DA1810:DT1909DC1910_FF E 1809 ? F 1910 ? E 1810 ? F 1909 ? 
1 C DA 10 1_555 D DT 8  1_555 C DC 11 1_555 D DG 7  1_555 0.940  -0.700 3.179 -3.789 0.542  31.422 -1.379 -2.391 3.035 0.995  
6.964   31.649 21 EE_DA1810DC1811:DG1908DT1909_FF E 1810 ? F 1909 ? E 1811 ? F 1908 ? 
1 C DC 11 1_555 D DG 7  1_555 C DT 12 1_555 D DA 6  1_555 0.176  -0.680 3.395 2.007  -1.902 28.754 -0.921 0.115  3.436 -3.819 
-4.030  28.884 22 EE_DC1811DT1812:DA1907DG1908_FF E 1811 ? F 1908 ? E 1812 ? F 1907 ? 
1 C DT 12 1_555 D DA 6  1_555 C DC 13 1_555 D DG 4  1_555 0.347  -0.890 3.952 -1.155 13.150 27.868 -4.635 -0.914 3.201 25.567 
2.245   30.780 23 EE_DT1812DC1813:DG1905DA1907_FF E 1812 ? F 1907 ? E 1813 ? F 1905 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'CALCIUM ION'               CA  
5 'MAGNESIUM ION'             MG  
6 "THYMIDINE-5'-TRIPHOSPHATE" TTP 
7 water                       HOH 
#