data_1S32
# 
_entry.id   1S32 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1S32         
NDB   PD0514       
RCSB  RCSB021304   
WWPDB D_1000021304 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1M1A 'Ligand Binding Alters The Structure and Dynamics Of Nucleosomal DNA'          unspecified 
PDB 1M19 'Ligand Binding Alters The Structure and Dynamics Of Nucleosomal DNA'          unspecified 
PDB 1M18 'Ligand Binding Alters The Structure and Dynamics Of Nucleosomal DNA'          unspecified 
PDB 1KX5 'X-Ray Structure Of The Nucleosome Core Particle, Ncp147, At 1.9 A Resolution' unspecified 
PDB 1KX3 'X-Ray Structure Of The Nucleosome Core Particle, Ncp146, At 2.0 A Resolution' unspecified 
PDB 1AOI 'X-Ray Structure Of The Nucleosome Core Particle At 2.8 A Resolution'          unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1S32 
_pdbx_database_status.recvd_initial_deposition_date   2004-01-12 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Edayathumangalam, R.S.' 1 
'Weyermann, P.'          2 
'Gottesfeld, J.M.'       3 
'Dervan, P.B.'           4 
'Luger, K.'              5 
# 
_citation.id                        primary 
_citation.title                     
;Molecular Recognition of the Nucleosomal 'Supergroove'
;
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            101 
_citation.page_first                6864 
_citation.page_last                 6869 
_citation.year                      2004 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15100411 
_citation.pdbx_database_id_DOI      10.1073/pnas.0401743101 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Edayathumangalam, R.S.' 1 
primary 'Weyermann, P.'          2 
primary 'Gottesfeld, J.M.'       3 
primary 'Dervan, P.B.'           4 
primary 'Luger, K.'              5 
# 
_cell.entry_id           1S32 
_cell.length_a           105.352 
_cell.length_b           109.717 
_cell.length_c           181.827 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1S32 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                19 
_symmetry.cell_setting                     ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     syn 'palindromic alpha-satellite 146 bp DNA fragment' 45054.844 2   ? ? ? ? 
2  polymer     man 'histone H3'                                      15303.930 2   ? ? ? ? 
3  polymer     man 'Histone H4'                                      11263.231 2   ? ? ? ? 
4  polymer     man 'histone H2A'                                     12941.095 2   ? ? ? ? 
5  polymer     man 'Histone H2B'                                     13524.752 2   ? ? ? ? 
6  non-polymer syn 'MANGANESE (II) ION'                              54.938    14  ? ? ? ? 
7  non-polymer syn '4-AMINO-(1-METHYLIMIDAZOLE)-2-CARBOXYLIC ACID'   141.128   4   ? ? ? ? 
8  non-polymer syn '4-AMINO-(1-METHYLPYRROLE)-2-CARBOXYLIC ACID'     140.140   12  ? ? ? ? 
9  non-polymer syn 'GAMMA-AMINO-BUTANOIC ACID'                       103.120   2   ? ? ? ? 
10 non-polymer syn BETA-ALANINE                                      89.093    2   ? ? ? ? 
11 non-polymer syn '3-AMINO-(DIMETHYLPROPYLAMINE)'                   102.178   2   ? ? ? ? 
12 non-polymer syn '2-(2-CARBAMOYLMETHOXY-ETHOXY)-ACETAMIDE'         176.170   1   ? ? ? ? 
13 non-polymer syn 'CHLORIDE ION'                                    35.453    4   ? ? ? ? 
14 water       nat water                                             18.015    888 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DA)(DA)(DT)(DA)(DT)(DC)(DC)(DA)(DC)(DC)(DT)(DG)(DC)(DA)(DG)(DA)(DT)
(DT)(DC)(DT)(DA)(DC)(DC)(DA)(DA)(DA)(DA)(DG)(DT)(DG)(DT)(DA)(DT)(DT)(DT)(DG)(DG)
(DA)(DA)(DA)(DC)(DT)(DG)(DC)(DT)(DC)(DC)(DA)(DT)(DC)(DA)(DA)(DA)(DA)(DG)(DG)(DC)
(DA)(DT)(DG)(DT)(DT)(DC)(DA)(DG)(DC)(DG)(DG)(DA)(DA)(DT)(DT)(DC)(DC)(DG)(DC)(DT)
(DG)(DA)(DA)(DC)(DA)(DT)(DG)(DC)(DC)(DT)(DT)(DT)(DT)(DG)(DA)(DT)(DG)(DG)(DA)(DG)
(DC)(DA)(DG)(DT)(DT)(DT)(DC)(DC)(DA)(DA)(DA)(DT)(DA)(DC)(DA)(DC)(DT)(DT)(DT)(DT)
(DG)(DG)(DT)(DA)(DG)(DA)(DA)(DT)(DC)(DT)(DG)(DC)(DA)(DG)(DG)(DT)(DG)(DG)(DA)(DT)
(DA)(DT)(DT)(DG)(DA)(DT)
;
;ATCAATATCCACCTGCAGATTCTACCAAAAGTGTATTTGGAAACTGCTCCATCAAAAGGCATGTTCAGCGGAATTCCGCT
GAACATGCCTTTTGATGGAGCAGTTTCCAAATACACTTTTGGTAGAATCTGCAGGTGGATATTGAT
;
I,J ? 
2 'polypeptide(L)'        no no 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
A,E ? 
3 'polypeptide(L)'        no no 
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
B,F ? 
4 'polypeptide(L)'        no no 
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
;
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
;
C,G ? 
5 'polypeptide(L)'        no no 
;AKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHY
NKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
;AKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHY
NKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
D,H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DA  n 
1 2   DT  n 
1 3   DC  n 
1 4   DA  n 
1 5   DA  n 
1 6   DT  n 
1 7   DA  n 
1 8   DT  n 
1 9   DC  n 
1 10  DC  n 
1 11  DA  n 
1 12  DC  n 
1 13  DC  n 
1 14  DT  n 
1 15  DG  n 
1 16  DC  n 
1 17  DA  n 
1 18  DG  n 
1 19  DA  n 
1 20  DT  n 
1 21  DT  n 
1 22  DC  n 
1 23  DT  n 
1 24  DA  n 
1 25  DC  n 
1 26  DC  n 
1 27  DA  n 
1 28  DA  n 
1 29  DA  n 
1 30  DA  n 
1 31  DG  n 
1 32  DT  n 
1 33  DG  n 
1 34  DT  n 
1 35  DA  n 
1 36  DT  n 
1 37  DT  n 
1 38  DT  n 
1 39  DG  n 
1 40  DG  n 
1 41  DA  n 
1 42  DA  n 
1 43  DA  n 
1 44  DC  n 
1 45  DT  n 
1 46  DG  n 
1 47  DC  n 
1 48  DT  n 
1 49  DC  n 
1 50  DC  n 
1 51  DA  n 
1 52  DT  n 
1 53  DC  n 
1 54  DA  n 
1 55  DA  n 
1 56  DA  n 
1 57  DA  n 
1 58  DG  n 
1 59  DG  n 
1 60  DC  n 
1 61  DA  n 
1 62  DT  n 
1 63  DG  n 
1 64  DT  n 
1 65  DT  n 
1 66  DC  n 
1 67  DA  n 
1 68  DG  n 
1 69  DC  n 
1 70  DG  n 
1 71  DG  n 
1 72  DA  n 
1 73  DA  n 
1 74  DT  n 
1 75  DT  n 
1 76  DC  n 
1 77  DC  n 
1 78  DG  n 
1 79  DC  n 
1 80  DT  n 
1 81  DG  n 
1 82  DA  n 
1 83  DA  n 
1 84  DC  n 
1 85  DA  n 
1 86  DT  n 
1 87  DG  n 
1 88  DC  n 
1 89  DC  n 
1 90  DT  n 
1 91  DT  n 
1 92  DT  n 
1 93  DT  n 
1 94  DG  n 
1 95  DA  n 
1 96  DT  n 
1 97  DG  n 
1 98  DG  n 
1 99  DA  n 
1 100 DG  n 
1 101 DC  n 
1 102 DA  n 
1 103 DG  n 
1 104 DT  n 
1 105 DT  n 
1 106 DT  n 
1 107 DC  n 
1 108 DC  n 
1 109 DA  n 
1 110 DA  n 
1 111 DA  n 
1 112 DT  n 
1 113 DA  n 
1 114 DC  n 
1 115 DA  n 
1 116 DC  n 
1 117 DT  n 
1 118 DT  n 
1 119 DT  n 
1 120 DT  n 
1 121 DG  n 
1 122 DG  n 
1 123 DT  n 
1 124 DA  n 
1 125 DG  n 
1 126 DA  n 
1 127 DA  n 
1 128 DT  n 
1 129 DC  n 
1 130 DT  n 
1 131 DG  n 
1 132 DC  n 
1 133 DA  n 
1 134 DG  n 
1 135 DG  n 
1 136 DT  n 
1 137 DG  n 
1 138 DG  n 
1 139 DA  n 
1 140 DT  n 
1 141 DA  n 
1 142 DT  n 
1 143 DT  n 
1 144 DG  n 
1 145 DA  n 
1 146 DT  n 
2 1   ALA n 
2 2   ARG n 
2 3   THR n 
2 4   LYS n 
2 5   GLN n 
2 6   THR n 
2 7   ALA n 
2 8   ARG n 
2 9   LYS n 
2 10  SER n 
2 11  THR n 
2 12  GLY n 
2 13  GLY n 
2 14  LYS n 
2 15  ALA n 
2 16  PRO n 
2 17  ARG n 
2 18  LYS n 
2 19  GLN n 
2 20  LEU n 
2 21  ALA n 
2 22  THR n 
2 23  LYS n 
2 24  ALA n 
2 25  ALA n 
2 26  ARG n 
2 27  LYS n 
2 28  SER n 
2 29  ALA n 
2 30  PRO n 
2 31  ALA n 
2 32  THR n 
2 33  GLY n 
2 34  GLY n 
2 35  VAL n 
2 36  LYS n 
2 37  LYS n 
2 38  PRO n 
2 39  HIS n 
2 40  ARG n 
2 41  TYR n 
2 42  ARG n 
2 43  PRO n 
2 44  GLY n 
2 45  THR n 
2 46  VAL n 
2 47  ALA n 
2 48  LEU n 
2 49  ARG n 
2 50  GLU n 
2 51  ILE n 
2 52  ARG n 
2 53  ARG n 
2 54  TYR n 
2 55  GLN n 
2 56  LYS n 
2 57  SER n 
2 58  THR n 
2 59  GLU n 
2 60  LEU n 
2 61  LEU n 
2 62  ILE n 
2 63  ARG n 
2 64  LYS n 
2 65  LEU n 
2 66  PRO n 
2 67  PHE n 
2 68  GLN n 
2 69  ARG n 
2 70  LEU n 
2 71  VAL n 
2 72  ARG n 
2 73  GLU n 
2 74  ILE n 
2 75  ALA n 
2 76  GLN n 
2 77  ASP n 
2 78  PHE n 
2 79  LYS n 
2 80  THR n 
2 81  ASP n 
2 82  LEU n 
2 83  ARG n 
2 84  PHE n 
2 85  GLN n 
2 86  SER n 
2 87  SER n 
2 88  ALA n 
2 89  VAL n 
2 90  MET n 
2 91  ALA n 
2 92  LEU n 
2 93  GLN n 
2 94  GLU n 
2 95  ALA n 
2 96  SER n 
2 97  GLU n 
2 98  ALA n 
2 99  TYR n 
2 100 LEU n 
2 101 VAL n 
2 102 ALA n 
2 103 LEU n 
2 104 PHE n 
2 105 GLU n 
2 106 ASP n 
2 107 THR n 
2 108 ASN n 
2 109 LEU n 
2 110 CYS n 
2 111 ALA n 
2 112 ILE n 
2 113 HIS n 
2 114 ALA n 
2 115 LYS n 
2 116 ARG n 
2 117 VAL n 
2 118 THR n 
2 119 ILE n 
2 120 MET n 
2 121 PRO n 
2 122 LYS n 
2 123 ASP n 
2 124 ILE n 
2 125 GLN n 
2 126 LEU n 
2 127 ALA n 
2 128 ARG n 
2 129 ARG n 
2 130 ILE n 
2 131 ARG n 
2 132 GLY n 
2 133 GLU n 
2 134 ARG n 
2 135 ALA n 
3 1   SER n 
3 2   GLY n 
3 3   ARG n 
3 4   GLY n 
3 5   LYS n 
3 6   GLY n 
3 7   GLY n 
3 8   LYS n 
3 9   GLY n 
3 10  LEU n 
3 11  GLY n 
3 12  LYS n 
3 13  GLY n 
3 14  GLY n 
3 15  ALA n 
3 16  LYS n 
3 17  ARG n 
3 18  HIS n 
3 19  ARG n 
3 20  LYS n 
3 21  VAL n 
3 22  LEU n 
3 23  ARG n 
3 24  ASP n 
3 25  ASN n 
3 26  ILE n 
3 27  GLN n 
3 28  GLY n 
3 29  ILE n 
3 30  THR n 
3 31  LYS n 
3 32  PRO n 
3 33  ALA n 
3 34  ILE n 
3 35  ARG n 
3 36  ARG n 
3 37  LEU n 
3 38  ALA n 
3 39  ARG n 
3 40  ARG n 
3 41  GLY n 
3 42  GLY n 
3 43  VAL n 
3 44  LYS n 
3 45  ARG n 
3 46  ILE n 
3 47  SER n 
3 48  GLY n 
3 49  LEU n 
3 50  ILE n 
3 51  TYR n 
3 52  GLU n 
3 53  GLU n 
3 54  THR n 
3 55  ARG n 
3 56  GLY n 
3 57  VAL n 
3 58  LEU n 
3 59  LYS n 
3 60  VAL n 
3 61  PHE n 
3 62  LEU n 
3 63  GLU n 
3 64  ASN n 
3 65  VAL n 
3 66  ILE n 
3 67  ARG n 
3 68  ASP n 
3 69  ALA n 
3 70  VAL n 
3 71  THR n 
3 72  TYR n 
3 73  THR n 
3 74  GLU n 
3 75  HIS n 
3 76  ALA n 
3 77  LYS n 
3 78  ARG n 
3 79  LYS n 
3 80  THR n 
3 81  VAL n 
3 82  THR n 
3 83  ALA n 
3 84  MET n 
3 85  ASP n 
3 86  VAL n 
3 87  VAL n 
3 88  TYR n 
3 89  ALA n 
3 90  LEU n 
3 91  LYS n 
3 92  ARG n 
3 93  GLN n 
3 94  GLY n 
3 95  ARG n 
3 96  THR n 
3 97  LEU n 
3 98  TYR n 
3 99  GLY n 
3 100 PHE n 
3 101 GLY n 
3 102 GLY n 
4 1   SER n 
4 2   GLY n 
4 3   ARG n 
4 4   GLY n 
4 5   LYS n 
4 6   GLN n 
4 7   GLY n 
4 8   GLY n 
4 9   LYS n 
4 10  THR n 
4 11  ARG n 
4 12  ALA n 
4 13  LYS n 
4 14  ALA n 
4 15  LYS n 
4 16  THR n 
4 17  ARG n 
4 18  SER n 
4 19  SER n 
4 20  ARG n 
4 21  ALA n 
4 22  GLY n 
4 23  LEU n 
4 24  GLN n 
4 25  PHE n 
4 26  PRO n 
4 27  VAL n 
4 28  GLY n 
4 29  ARG n 
4 30  VAL n 
4 31  HIS n 
4 32  ARG n 
4 33  LEU n 
4 34  LEU n 
4 35  ARG n 
4 36  LYS n 
4 37  GLY n 
4 38  ASN n 
4 39  TYR n 
4 40  ALA n 
4 41  GLU n 
4 42  ARG n 
4 43  VAL n 
4 44  GLY n 
4 45  ALA n 
4 46  GLY n 
4 47  ALA n 
4 48  PRO n 
4 49  VAL n 
4 50  TYR n 
4 51  LEU n 
4 52  ALA n 
4 53  ALA n 
4 54  VAL n 
4 55  LEU n 
4 56  GLU n 
4 57  TYR n 
4 58  LEU n 
4 59  THR n 
4 60  ALA n 
4 61  GLU n 
4 62  ILE n 
4 63  LEU n 
4 64  GLU n 
4 65  LEU n 
4 66  ALA n 
4 67  GLY n 
4 68  ASN n 
4 69  ALA n 
4 70  ALA n 
4 71  ARG n 
4 72  ASP n 
4 73  ASN n 
4 74  LYS n 
4 75  LYS n 
4 76  THR n 
4 77  ARG n 
4 78  ILE n 
4 79  ILE n 
4 80  PRO n 
4 81  ARG n 
4 82  HIS n 
4 83  LEU n 
4 84  GLN n 
4 85  LEU n 
4 86  ALA n 
4 87  VAL n 
4 88  ARG n 
4 89  ASN n 
4 90  ASP n 
4 91  GLU n 
4 92  GLU n 
4 93  LEU n 
4 94  ASN n 
4 95  LYS n 
4 96  LEU n 
4 97  LEU n 
4 98  GLY n 
4 99  ARG n 
4 100 VAL n 
4 101 THR n 
4 102 ILE n 
4 103 ALA n 
4 104 GLN n 
4 105 GLY n 
4 106 GLY n 
4 107 VAL n 
4 108 LEU n 
4 109 PRO n 
4 110 ASN n 
4 111 ILE n 
4 112 GLN n 
4 113 SER n 
4 114 VAL n 
4 115 LEU n 
4 116 LEU n 
4 117 PRO n 
4 118 LYS n 
4 119 LYS n 
5 1   ALA n 
5 2   LYS n 
5 3   SER n 
5 4   ALA n 
5 5   PRO n 
5 6   ALA n 
5 7   PRO n 
5 8   LYS n 
5 9   LYS n 
5 10  GLY n 
5 11  SER n 
5 12  LYS n 
5 13  LYS n 
5 14  ALA n 
5 15  VAL n 
5 16  THR n 
5 17  LYS n 
5 18  THR n 
5 19  GLN n 
5 20  LYS n 
5 21  LYS n 
5 22  ASP n 
5 23  GLY n 
5 24  LYS n 
5 25  LYS n 
5 26  ARG n 
5 27  ARG n 
5 28  LYS n 
5 29  THR n 
5 30  ARG n 
5 31  LYS n 
5 32  GLU n 
5 33  SER n 
5 34  TYR n 
5 35  ALA n 
5 36  ILE n 
5 37  TYR n 
5 38  VAL n 
5 39  TYR n 
5 40  LYS n 
5 41  VAL n 
5 42  LEU n 
5 43  LYS n 
5 44  GLN n 
5 45  VAL n 
5 46  HIS n 
5 47  PRO n 
5 48  ASP n 
5 49  THR n 
5 50  GLY n 
5 51  ILE n 
5 52  SER n 
5 53  SER n 
5 54  LYS n 
5 55  ALA n 
5 56  MET n 
5 57  SER n 
5 58  ILE n 
5 59  MET n 
5 60  ASN n 
5 61  SER n 
5 62  PHE n 
5 63  VAL n 
5 64  ASN n 
5 65  ASP n 
5 66  VAL n 
5 67  PHE n 
5 68  GLU n 
5 69  ARG n 
5 70  ILE n 
5 71  ALA n 
5 72  GLY n 
5 73  GLU n 
5 74  ALA n 
5 75  SER n 
5 76  ARG n 
5 77  LEU n 
5 78  ALA n 
5 79  HIS n 
5 80  TYR n 
5 81  ASN n 
5 82  LYS n 
5 83  ARG n 
5 84  SER n 
5 85  THR n 
5 86  ILE n 
5 87  THR n 
5 88  SER n 
5 89  ARG n 
5 90  GLU n 
5 91  ILE n 
5 92  GLN n 
5 93  THR n 
5 94  ALA n 
5 95  VAL n 
5 96  ARG n 
5 97  LEU n 
5 98  LEU n 
5 99  LEU n 
5 100 PRO n 
5 101 GLY n 
5 102 GLU n 
5 103 LEU n 
5 104 ALA n 
5 105 LYS n 
5 106 HIS n 
5 107 ALA n 
5 108 VAL n 
5 109 SER n 
5 110 GLU n 
5 111 GLY n 
5 112 THR n 
5 113 LYS n 
5 114 ALA n 
5 115 VAL n 
5 116 THR n 
5 117 LYS n 
5 118 TYR n 
5 119 THR n 
5 120 SER n 
5 121 ALA n 
5 122 LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
2 1 sample ? ? ? 'African clawed frog' Xenopus 'Histone H3'    ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 Escherichia ? ? ? ? ? 'BL21 DE3 pLysS' ? ? ? ? ? ? ? PLASMID ? ? ? pET-based ? ? 
3 1 sample ? ? ? 'African clawed frog' Xenopus 'Histone H4'    ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 Escherichia ? ? ? ? ? 'BL21 DE3 pLysS' ? ? ? ? ? ? ? PLASMID ? ? ? pET-based ? ? 
4 1 sample ? ? ? 'African clawed frog' Xenopus 'Histone H2A'   ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 Escherichia ? ? ? ? ? 'BL21 DE3 pLysS' ? ? ? ? ? ? ? PLASMID ? ? ? pET-based ? ? 
5 1 sample ? ? ? 'African clawed frog' Xenopus 'Histone H2B.1' ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 Escherichia ? ? ? ? ? 'BL21 DE3 pLysS' ? ? ? ? ? ? ? PLASMID ? ? ? pET-based ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 GB  CAD89679 30268544 2 
;MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK
TDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
1 ? 
2 UNP H4_HUMAN P02304   3 
;MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRK
TVTAMDVVYALKRQGRTLYGFGG
;
0 ? 
3 GB  CAD89676 30268540 4 
;MSGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRII
PRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK
;
1 ? 
4 GB  CAD89678 30268542 5 
;MAKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAH
YNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
1 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1S32 A 1 ? 135 ? 30268544 2 ? 136 ? 401  535  
2 1 1S32 E 1 ? 135 ? 30268544 2 ? 136 ? 601  735  
3 2 1S32 B 1 ? 102 ? P02304   1 ? 102 ? 1    102  
4 2 1S32 F 1 ? 102 ? P02304   1 ? 102 ? 201  302  
5 3 1S32 C 1 ? 118 ? 30268540 2 ? 119 ? 801  918  
6 3 1S32 G 1 ? 118 ? 30268540 2 ? 119 ? 1001 1118 
7 4 1S32 D 1 ? 122 ? 30268542 1 ? 123 ? 1201 1322 
8 4 1S32 H 1 ? 122 ? 30268542 1 ? 123 ? 1401 1522 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1S32 ? A ? ? GB  30268544 MET 1 'INTIATING METHIONINE' ? 1 
2 1S32 ? E ? ? GB  30268544 MET 1 'INTIATING METHIONINE' ? 2 
3 1S32 ? B ? ? UNP P02304   MET 0 'INTIATING METHIONINE' ? 3 
4 1S32 ? F ? ? UNP P02304   MET 0 'INTIATING METHIONINE' ? 4 
5 1S32 ? C ? ? GB  30268540 MET 1 'INTIATING METHIONINE' ? 5 
6 1S32 ? G ? ? GB  30268540 MET 1 'INTIATING METHIONINE' ? 6 
7 1S32 ? D ? ? GB  30268542 MET 1 'INTIATING METHIONINE' ? 7 
8 1S32 ? H ? ? GB  30268542 MET 1 'INTIATING METHIONINE' ? 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ABU non-polymer         . 'GAMMA-AMINO-BUTANOIC ACID'                     'GAMMA(AMINO)-BUTYRIC ACID' 'C4 H9 N O2'      103.120 
ALA 'L-peptide linking' y ALANINE                                         ?                           'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                        ?                           'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                      ?                           'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                 ?                           'C4 H7 N O4'      133.103 
BAL peptide-like        . BETA-ALANINE                                    ?                           'C3 H7 N O2'      89.093  
CL  non-polymer         . 'CHLORIDE ION'                                  ?                           'Cl -1'           35.453  
CYS 'L-peptide linking' y CYSTEINE                                        ?                           'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"            ?                           'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"             ?                           'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"            ?                           'C10 H14 N5 O7 P' 347.221 
DIB non-polymer         . '3-AMINO-(DIMETHYLPROPYLAMINE)'                 ?                           'C5 H14 N2'       102.178 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                    ?                           'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                                       ?                           'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                 ?                           'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                         ?                           'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                                       ?                           'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                           ?                           'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                      ?                           'C6 H13 N O2'     131.173 
IMT non-polymer         . '4-AMINO-(1-METHYLIMIDAZOLE)-2-CARBOXYLIC ACID' ?                           'C5 H7 N3 O2'     141.128 
LEU 'L-peptide linking' y LEUCINE                                         ?                           'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                          ?                           'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                                      ?                           'C5 H11 N O2 S'   149.211 
MN  non-polymer         . 'MANGANESE (II) ION'                            ?                           'Mn 2'            54.938  
OGG non-polymer         . '2-(2-CARBAMOYLMETHOXY-ETHOXY)-ACETAMIDE'       ?                           'C6 H12 N2 O4'    176.170 
PHE 'L-peptide linking' y PHENYLALANINE                                   ?                           'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                         ?                           'C5 H9 N O2'      115.130 
PYB non-polymer         . '4-AMINO-(1-METHYLPYRROLE)-2-CARBOXYLIC ACID'   ?                           'C6 H8 N2 O2'     140.140 
SER 'L-peptide linking' y SERINE                                          ?                           'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                                       ?                           'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE                                        ?                           'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                          ?                           'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1S32 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   58.56 
_exptl_crystal.description           ? 
_exptl_crystal.density_Matthews      2.99 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            292 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_details    
'Manganese chloride, potassium chloride, potassium cacodylate, pH 6.0, VAPOR DIFFUSION, SITTING DROP, temperature 292K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 'Manganese chloride'   ? ? ? 
1 2 1 'potassium chloride'   ? ? ? 
1 3 1 'potassium cacodylate' ? ? ? 
1 4 1 H2O                    ? ? ? 
1 5 2 'Manganese chloride'   ? ? ? 
1 6 2 'potassium chloride'   ? ? ? 
1 7 2 H2O                    ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210' 
_diffrn_detector.pdbx_collection_date   2002-05-25 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 5.0.2' 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   5.0.2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.1 
# 
_reflns.entry_id                     1S32 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            2.05 
_reflns.d_resolution_low             100 
_reflns.number_all                   ? 
_reflns.number_obs                   124523 
_reflns.percent_possible_obs         94.4 
_reflns.pdbx_Rmerge_I_obs            0.076 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        22.99 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.75 
_reflns.R_free_details               ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.05 
_reflns_shell.d_res_low              2.1 
_reflns_shell.percent_possible_all   54.1 
_reflns_shell.Rmerge_I_obs           0.353 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.04 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1S32 
_refine.ls_d_res_high                            2.05 
_refine.ls_d_res_low                             100 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_ls_sigma_I                          0 
_refine.ls_number_reflns_all                     124523 
_refine.ls_number_reflns_obs                     120181 
_refine.ls_number_reflns_R_free                  6050 
_refine.ls_percent_reflns_obs                    90.7 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.2194 
_refine.ls_R_factor_R_free                       0.2434 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB ENTRY 1AOI' 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            Random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             Anisotropic 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  
;THE STRUCTURE HAS SOME UNMODELLED POTENTIAL ALTERNATE AMINO ACID SIDE CHAIN CONFORMERS, SOLVENT ENTITIES AND SOME UNACCOUNTED SPURIOUS DENSITY.
;
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6203 
_refine_hist.pdbx_number_atoms_nucleic_acid   5980 
_refine_hist.pdbx_number_atoms_ligand         208 
_refine_hist.number_atoms_solvent             888 
_refine_hist.number_atoms_total               13279 
_refine_hist.d_res_high                       2.05 
_refine_hist.d_res_low                        100 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d  0.008 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d 1.099 ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1S32 
_struct.title                     
;Molecular Recognition of the Nucleosomal 'Supergroove'
;
_struct.pdbx_descriptor           'histone H3, H4, H2A, H2B/palindromic alpha-satellite 146 bp DNA/polyamide dimer clamp Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1S32 
_struct_keywords.pdbx_keywords   'STRUCTURAL PROTEIN/DNA' 
_struct_keywords.text            
;Nucleosome Core Particle (NCP), Pyrrole-Imidazole (Py-Im) hairpin polyamide, clamp, nucleosome dynamics, STRUCTURAL PROTEIN-DNA COMPLEX
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 1  ? 
C  N N 2  ? 
D  N N 3  ? 
E  N N 4  ? 
F  N N 5  ? 
G  N N 2  ? 
H  N N 3  ? 
I  N N 4  ? 
J  N N 5  ? 
K  N N 6  ? 
L  N N 6  ? 
M  N N 6  ? 
N  N N 6  ? 
O  N N 6  ? 
P  N N 6  ? 
Q  N N 6  ? 
R  N N 7  ? 
S  N N 8  ? 
T  N N 7  ? 
U  N N 8  ? 
V  N N 9  ? 
W  N N 8  ? 
X  N N 8  ? 
Y  N N 8  ? 
Z  N N 8  ? 
AA N N 10 ? 
BA N N 11 ? 
CA N N 7  ? 
DA N N 8  ? 
EA N N 7  ? 
FA N N 8  ? 
GA N N 9  ? 
HA N N 8  ? 
IA N N 8  ? 
JA N N 8  ? 
KA N N 8  ? 
LA N N 10 ? 
MA N N 11 ? 
NA N N 6  ? 
OA N N 6  ? 
PA N N 6  ? 
QA N N 6  ? 
RA N N 6  ? 
SA N N 6  ? 
TA N N 12 ? 
UA N N 13 ? 
VA N N 13 ? 
WA N N 6  ? 
XA N N 13 ? 
YA N N 13 ? 
ZA N N 14 ? 
AB N N 14 ? 
BB N N 14 ? 
CB N N 14 ? 
DB N N 14 ? 
EB N N 14 ? 
FB N N 14 ? 
GB N N 14 ? 
HB N N 14 ? 
IB N N 14 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY C 44  ? SER C 57  ? GLY A 444  SER A 457  1 ? 14 
HELX_P HELX_P2  2  ARG C 63  ? ASP C 77  ? ARG A 463  ASP A 477  1 ? 15 
HELX_P HELX_P3  3  GLN C 85  ? ALA C 114 ? GLN A 485  ALA A 514  1 ? 30 
HELX_P HELX_P4  4  MET C 120 ? ARG C 131 ? MET A 520  ARG A 531  1 ? 12 
HELX_P HELX_P5  5  ASP D 24  ? ILE D 29  ? ASP B 24   ILE B 29   5 ? 6  
HELX_P HELX_P6  6  THR D 30  ? GLY D 41  ? THR B 30   GLY B 41   1 ? 12 
HELX_P HELX_P7  7  LEU D 49  ? ALA D 76  ? LEU B 49   ALA B 76   1 ? 28 
HELX_P HELX_P8  8  THR D 82  ? GLN D 93  ? THR B 82   GLN B 93   1 ? 12 
HELX_P HELX_P9  9  THR E 16  ? GLY E 22  ? THR C 816  GLY C 822  1 ? 7  
HELX_P HELX_P10 10 PRO E 26  ? GLY E 37  ? PRO C 826  GLY C 837  1 ? 12 
HELX_P HELX_P11 11 ALA E 45  ? ASN E 73  ? ALA C 845  ASN C 873  1 ? 29 
HELX_P HELX_P12 12 ILE E 79  ? ASN E 89  ? ILE C 879  ASN C 889  1 ? 11 
HELX_P HELX_P13 13 ASP E 90  ? LEU E 97  ? ASP C 890  LEU C 897  1 ? 8  
HELX_P HELX_P14 14 GLN E 112 ? LEU E 116 ? GLN C 912  LEU C 916  5 ? 5  
HELX_P HELX_P15 15 TYR F 34  ? HIS F 46  ? TYR D 1234 HIS D 1246 1 ? 13 
HELX_P HELX_P16 16 SER F 52  ? ASN F 81  ? SER D 1252 ASN D 1281 1 ? 30 
HELX_P HELX_P17 17 THR F 87  ? LEU F 99  ? THR D 1287 LEU D 1299 1 ? 13 
HELX_P HELX_P18 18 PRO F 100 ? THR F 119 ? PRO D 1300 THR D 1319 1 ? 20 
HELX_P HELX_P19 19 GLY G 44  ? SER G 57  ? GLY E 644  SER E 657  1 ? 14 
HELX_P HELX_P20 20 ARG G 63  ? LYS G 79  ? ARG E 663  LYS E 679  1 ? 17 
HELX_P HELX_P21 21 GLN G 85  ? ALA G 114 ? GLN E 685  ALA E 714  1 ? 30 
HELX_P HELX_P22 22 MET G 120 ? ARG G 131 ? MET E 720  ARG E 731  1 ? 12 
HELX_P HELX_P23 23 ASP H 24  ? ILE H 29  ? ASP F 224  ILE F 229  5 ? 6  
HELX_P HELX_P24 24 THR H 30  ? GLY H 41  ? THR F 230  GLY F 241  1 ? 12 
HELX_P HELX_P25 25 LEU H 49  ? ALA H 76  ? LEU F 249  ALA F 276  1 ? 28 
HELX_P HELX_P26 26 THR H 82  ? GLN H 93  ? THR F 282  GLN F 293  1 ? 12 
HELX_P HELX_P27 27 THR I 16  ? GLY I 22  ? THR G 1016 GLY G 1022 1 ? 7  
HELX_P HELX_P28 28 PRO I 26  ? GLY I 37  ? PRO G 1026 GLY G 1037 1 ? 12 
HELX_P HELX_P29 29 ALA I 45  ? ASN I 73  ? ALA G 1045 ASN G 1073 1 ? 29 
HELX_P HELX_P30 30 ILE I 79  ? ASN I 89  ? ILE G 1079 ASN G 1089 1 ? 11 
HELX_P HELX_P31 31 ASP I 90  ? LEU I 97  ? ASP G 1090 LEU G 1097 1 ? 8  
HELX_P HELX_P32 32 GLN I 112 ? LEU I 116 ? GLN G 1112 LEU G 1116 5 ? 5  
HELX_P HELX_P33 33 TYR J 34  ? HIS J 46  ? TYR H 1434 HIS H 1446 1 ? 13 
HELX_P HELX_P34 34 SER J 52  ? ASN J 81  ? SER H 1452 ASN H 1481 1 ? 30 
HELX_P HELX_P35 35 THR J 87  ? LEU J 99  ? THR H 1487 LEU H 1499 1 ? 13 
HELX_P HELX_P36 36 PRO J 100 ? SER J 120 ? PRO H 1500 SER H 1520 1 ? 21 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ? ? A  DG  40  O6  ? ? ? 1_555 N  MN  .   MN ? ? I DG  40   I MN  2007 1_555 ? ? ? ? ? ? ?               2.216 ? 
metalc2   metalc ? ? G  ASP 77  OD1 ? ? ? 1_555 WA MN  .   MN ? ? E ASP 677  E MN  2001 1_555 ? ? ? ? ? ? ?               2.131 ? 
metalc3   metalc ? ? WA MN  .   MN  ? ? ? 1_555 FB HOH .   O  ? ? E MN  2001 E HOH 3394 1_555 ? ? ? ? ? ? ?               1.994 ? 
metalc4   metalc ? ? WA MN  .   MN  ? ? ? 1_555 FB HOH .   O  ? ? E MN  2001 E HOH 3393 1_555 ? ? ? ? ? ? ?               2.029 ? 
metalc5   metalc ? ? WA MN  .   MN  ? ? ? 1_555 GB HOH .   O  ? ? E MN  2001 F HOH 3392 1_555 ? ? ? ? ? ? ?               2.003 ? 
metalc6   metalc ? ? WA MN  .   MN  ? ? ? 1_555 FB HOH .   O  ? ? E MN  2001 E HOH 3391 1_555 ? ? ? ? ? ? ?               2.148 ? 
metalc7   metalc ? ? NA MN  .   MN  ? ? ? 1_555 AB HOH .   O  ? ? J MN  2002 J HOH 3397 1_555 ? ? ? ? ? ? ?               2.273 ? 
metalc8   metalc ? ? NA MN  .   MN  ? ? ? 1_555 ZA HOH .   O  ? ? J MN  2002 I HOH 3396 1_555 ? ? ? ? ? ? ?               2.176 ? 
metalc9   metalc ? ? NA MN  .   MN  ? ? ? 1_555 AB HOH .   O  ? ? J MN  2002 J HOH 3399 1_555 ? ? ? ? ? ? ?               2.193 ? 
metalc10  metalc ? ? NA MN  .   MN  ? ? ? 1_555 AB HOH .   O  ? ? J MN  2002 J HOH 3395 1_555 ? ? ? ? ? ? ?               2.071 ? 
metalc11  metalc ? ? NA MN  .   MN  ? ? ? 1_555 AB HOH .   O  ? ? J MN  2002 J HOH 3398 1_555 ? ? ? ? ? ? ?               2.365 ? 
metalc12  metalc ? ? K  MN  .   MN  ? ? ? 1_555 ZA HOH .   O  ? ? I MN  2003 I HOH 3400 1_555 ? ? ? ? ? ? ?               2.290 ? 
metalc13  metalc ? ? L  MN  .   MN  ? ? ? 1_555 ZA HOH .   O  ? ? I MN  2004 I HOH 3402 1_555 ? ? ? ? ? ? ?               2.284 ? 
metalc14  metalc ? ? L  MN  .   MN  ? ? ? 1_555 ZA HOH .   O  ? ? I MN  2004 I HOH 3403 1_555 ? ? ? ? ? ? ?               2.307 ? 
metalc15  metalc ? ? L  MN  .   MN  ? ? ? 1_555 ZA HOH .   O  ? ? I MN  2004 I HOH 3401 1_555 ? ? ? ? ? ? ?               2.317 ? 
metalc16  metalc ? ? OA MN  .   MN  ? ? ? 1_555 AB HOH .   O  ? ? J MN  2005 J HOH 3641 1_555 ? ? ? ? ? ? ?               2.422 ? 
metalc17  metalc ? ? M  MN  .   MN  ? ? ? 1_555 ZA HOH .   O  ? ? I MN  2006 I HOH 3832 1_555 ? ? ? ? ? ? ?               2.261 ? 
metalc18  metalc ? ? PA MN  .   MN  ? ? ? 1_555 AB HOH .   O  ? ? J MN  2008 J HOH 3047 1_555 ? ? ? ? ? ? ?               2.383 ? 
metalc19  metalc ? ? PA MN  .   MN  ? ? ? 1_555 AB HOH .   O  ? ? J MN  2008 J HOH 3411 1_555 ? ? ? ? ? ? ?               2.251 ? 
metalc20  metalc ? ? P  MN  .   MN  ? ? ? 1_555 AB HOH .   O  ? ? I MN  2012 J HOH 3833 1_555 ? ? ? ? ? ? ?               2.292 ? 
metalc21  metalc ? ? P  MN  .   MN  ? ? ? 1_555 AB HOH .   O  ? ? I MN  2012 J HOH 3820 1_555 ? ? ? ? ? ? ?               2.039 ? 
metalc22  metalc ? ? P  MN  .   MN  ? ? ? 1_555 ZA HOH .   O  ? ? I MN  2012 I HOH 3821 1_555 ? ? ? ? ? ? ?               2.040 ? 
metalc23  metalc ? ? P  MN  .   MN  ? ? ? 1_555 ZA HOH .   O  ? ? I MN  2012 I HOH 3827 1_555 ? ? ? ? ? ? ?               2.252 ? 
metalc24  metalc ? ? SA MN  .   MN  ? ? ? 1_555 AB HOH .   O  ? ? J MN  2013 J HOH 3499 1_555 ? ? ? ? ? ? ?               2.484 ? 
metalc25  metalc ? ? Q  MN  .   MN  ? ? ? 1_555 ZA HOH .   O  ? ? I MN  2014 I HOH 3233 1_555 ? ? ? ? ? ? ?               2.353 ? 
hydrog1   hydrog ? ? A  DA  1   N1  ? ? ? 1_555 B  DT  146 N3 ? ? I DA  1    J DT  292  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog2   hydrog ? ? A  DA  1   N6  ? ? ? 1_555 B  DT  146 O4 ? ? I DA  1    J DT  292  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog3   hydrog ? ? A  DT  2   N3  ? ? ? 1_555 B  DA  145 N1 ? ? I DT  2    J DA  291  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog4   hydrog ? ? A  DC  3   N4  ? ? ? 1_555 B  DG  144 O6 ? ? I DC  3    J DG  290  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog5   hydrog ? ? A  DA  4   N1  ? ? ? 1_555 B  DT  143 N3 ? ? I DA  4    J DT  289  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog6   hydrog ? ? A  DA  4   N6  ? ? ? 1_555 B  DT  143 O4 ? ? I DA  4    J DT  289  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog7   hydrog ? ? A  DA  5   N1  ? ? ? 1_555 B  DT  142 N3 ? ? I DA  5    J DT  288  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog8   hydrog ? ? A  DT  6   N3  ? ? ? 1_555 B  DA  141 N1 ? ? I DT  6    J DA  287  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog9   hydrog ? ? A  DT  6   O4  ? ? ? 1_555 B  DA  141 N6 ? ? I DT  6    J DA  287  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog10  hydrog ? ? A  DA  7   N1  ? ? ? 1_555 B  DT  140 N3 ? ? I DA  7    J DT  286  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog11  hydrog ? ? A  DA  7   N6  ? ? ? 1_555 B  DT  140 O4 ? ? I DA  7    J DT  286  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog12  hydrog ? ? A  DT  8   N3  ? ? ? 1_555 B  DA  139 N1 ? ? I DT  8    J DA  285  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog13  hydrog ? ? A  DT  8   O4  ? ? ? 1_555 B  DA  139 N6 ? ? I DT  8    J DA  285  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog14  hydrog ? ? A  DC  9   O2  ? ? ? 1_555 B  DG  138 N2 ? ? I DC  9    J DG  284  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog15  hydrog ? ? A  DC  10  N3  ? ? ? 1_555 B  DG  137 N1 ? ? I DC  10   J DG  283  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog16  hydrog ? ? A  DC  10  N4  ? ? ? 1_555 B  DG  137 O6 ? ? I DC  10   J DG  283  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog17  hydrog ? ? A  DC  10  O2  ? ? ? 1_555 B  DG  137 N2 ? ? I DC  10   J DG  283  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog18  hydrog ? ? A  DC  12  N4  ? ? ? 1_555 B  DG  135 O6 ? ? I DC  12   J DG  281  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog19  hydrog ? ? A  DC  13  O2  ? ? ? 1_555 B  DG  134 N2 ? ? I DC  13   J DG  280  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog20  hydrog ? ? A  DT  14  N3  ? ? ? 1_555 B  DA  133 N1 ? ? I DT  14   J DA  279  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog21  hydrog ? ? A  DT  14  O4  ? ? ? 1_555 B  DA  133 N6 ? ? I DT  14   J DA  279  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog22  hydrog ? ? A  DG  15  N1  ? ? ? 1_555 B  DC  132 O2 ? ? I DG  15   J DC  278  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog23  hydrog ? ? A  DC  16  N4  ? ? ? 1_555 B  DT  130 O4 ? ? I DC  16   J DT  276  1_555 ? ? ? ? ? ? 'DC-DT MISPAIR' ?     ? 
hydrog24  hydrog ? ? A  DC  16  N3  ? ? ? 1_555 B  DG  131 N1 ? ? I DC  16   J DG  277  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog25  hydrog ? ? A  DC  16  N4  ? ? ? 1_555 B  DG  131 O6 ? ? I DC  16   J DG  277  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog26  hydrog ? ? A  DC  16  O2  ? ? ? 1_555 B  DG  131 N2 ? ? I DC  16   J DG  277  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog27  hydrog ? ? A  DA  17  N1  ? ? ? 1_555 B  DT  130 N3 ? ? I DA  17   J DT  276  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog28  hydrog ? ? A  DA  17  N6  ? ? ? 1_555 B  DT  130 O4 ? ? I DA  17   J DT  276  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog29  hydrog ? ? A  DG  18  N1  ? ? ? 1_555 B  DC  129 N3 ? ? I DG  18   J DC  275  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog30  hydrog ? ? A  DA  19  N6  ? ? ? 1_555 B  DT  128 O4 ? ? I DA  19   J DT  274  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog31  hydrog ? ? A  DT  20  N3  ? ? ? 1_555 B  DA  127 N1 ? ? I DT  20   J DA  273  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog32  hydrog ? ? A  DT  21  N3  ? ? ? 1_555 B  DA  126 N1 ? ? I DT  21   J DA  272  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog33  hydrog ? ? A  DC  22  N3  ? ? ? 1_555 B  DG  125 N1 ? ? I DC  22   J DG  271  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog34  hydrog ? ? A  DC  22  N4  ? ? ? 1_555 B  DG  125 O6 ? ? I DC  22   J DG  271  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog35  hydrog ? ? A  DC  22  O2  ? ? ? 1_555 B  DG  125 N2 ? ? I DC  22   J DG  271  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog36  hydrog ? ? A  DT  23  O4  ? ? ? 1_555 B  DA  124 N6 ? ? I DT  23   J DA  270  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog37  hydrog ? ? A  DA  24  N1  ? ? ? 1_555 B  DT  123 N3 ? ? I DA  24   J DT  269  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog38  hydrog ? ? A  DC  25  N3  ? ? ? 1_555 B  DG  122 N1 ? ? I DC  25   J DG  268  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog39  hydrog ? ? A  DC  25  N4  ? ? ? 1_555 B  DG  122 O6 ? ? I DC  25   J DG  268  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog40  hydrog ? ? A  DC  25  O2  ? ? ? 1_555 B  DG  122 N2 ? ? I DC  25   J DG  268  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog41  hydrog ? ? A  DC  26  N3  ? ? ? 1_555 B  DG  121 N1 ? ? I DC  26   J DG  267  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog42  hydrog ? ? A  DC  26  N4  ? ? ? 1_555 B  DG  121 O6 ? ? I DC  26   J DG  267  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog43  hydrog ? ? A  DC  26  O2  ? ? ? 1_555 B  DG  121 N2 ? ? I DC  26   J DG  267  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog44  hydrog ? ? A  DA  27  N1  ? ? ? 1_555 B  DT  120 N3 ? ? I DA  27   J DT  266  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog45  hydrog ? ? A  DA  27  N6  ? ? ? 1_555 B  DT  120 O4 ? ? I DA  27   J DT  266  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog46  hydrog ? ? A  DA  29  N1  ? ? ? 1_555 B  DT  118 N3 ? ? I DA  29   J DT  264  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog47  hydrog ? ? A  DA  29  N6  ? ? ? 1_555 B  DT  118 O4 ? ? I DA  29   J DT  264  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog48  hydrog ? ? A  DA  30  N1  ? ? ? 1_555 B  DT  117 N3 ? ? I DA  30   J DT  263  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog49  hydrog ? ? A  DA  30  N6  ? ? ? 1_555 B  DT  117 O4 ? ? I DA  30   J DT  263  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog50  hydrog ? ? A  DG  31  N2  ? ? ? 1_555 B  DA  115 N1 ? ? I DG  31   J DA  261  1_555 ? ? ? ? ? ? 'DG-DA MISPAIR' ?     ? 
hydrog51  hydrog ? ? A  DG  31  N1  ? ? ? 1_555 B  DC  116 N3 ? ? I DG  31   J DC  262  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog52  hydrog ? ? A  DG  31  N2  ? ? ? 1_555 B  DC  116 O2 ? ? I DG  31   J DC  262  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog53  hydrog ? ? A  DG  31  O6  ? ? ? 1_555 B  DC  116 N4 ? ? I DG  31   J DC  262  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog54  hydrog ? ? A  DG  33  N1  ? ? ? 1_555 B  DC  114 N3 ? ? I DG  33   J DC  260  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog55  hydrog ? ? A  DG  33  N2  ? ? ? 1_555 B  DC  114 O2 ? ? I DG  33   J DC  260  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog56  hydrog ? ? A  DG  33  O6  ? ? ? 1_555 B  DC  114 N4 ? ? I DG  33   J DC  260  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog57  hydrog ? ? A  DT  34  O4  ? ? ? 1_555 B  DA  113 N6 ? ? I DT  34   J DA  259  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog58  hydrog ? ? A  DA  35  N1  ? ? ? 1_555 B  DT  112 N3 ? ? I DA  35   J DT  258  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog59  hydrog ? ? A  DA  35  N6  ? ? ? 1_555 B  DT  112 O4 ? ? I DA  35   J DT  258  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog60  hydrog ? ? A  DT  36  N3  ? ? ? 1_555 B  DA  111 N1 ? ? I DT  36   J DA  257  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog61  hydrog ? ? A  DT  36  O4  ? ? ? 1_555 B  DA  111 N6 ? ? I DT  36   J DA  257  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog62  hydrog ? ? A  DT  37  O4  ? ? ? 1_555 B  DA  109 N6 ? ? I DT  37   J DA  255  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog63  hydrog ? ? A  DT  37  N3  ? ? ? 1_555 B  DA  110 N1 ? ? I DT  37   J DA  256  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog64  hydrog ? ? A  DT  37  O4  ? ? ? 1_555 B  DA  110 N6 ? ? I DT  37   J DA  256  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog65  hydrog ? ? A  DT  38  O4  ? ? ? 1_555 B  DC  108 N4 ? ? I DT  38   J DC  254  1_555 ? ? ? ? ? ? 'DT-DC MISPAIR' ?     ? 
hydrog66  hydrog ? ? A  DT  38  N3  ? ? ? 1_555 B  DA  109 N1 ? ? I DT  38   J DA  255  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog67  hydrog ? ? A  DT  38  O4  ? ? ? 1_555 B  DA  109 N6 ? ? I DT  38   J DA  255  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog68  hydrog ? ? A  DG  39  N1  ? ? ? 1_555 B  DC  108 N3 ? ? I DG  39   J DC  254  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog69  hydrog ? ? A  DG  39  N2  ? ? ? 1_555 B  DC  108 O2 ? ? I DG  39   J DC  254  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog70  hydrog ? ? A  DG  39  O6  ? ? ? 1_555 B  DC  108 N4 ? ? I DG  39   J DC  254  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog71  hydrog ? ? A  DG  40  N1  ? ? ? 1_555 B  DC  107 N3 ? ? I DG  40   J DC  253  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog72  hydrog ? ? A  DG  40  N2  ? ? ? 1_555 B  DC  107 O2 ? ? I DG  40   J DC  253  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog73  hydrog ? ? A  DG  40  O6  ? ? ? 1_555 B  DC  107 N4 ? ? I DG  40   J DC  253  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog74  hydrog ? ? A  DA  41  N1  ? ? ? 1_555 B  DT  106 N3 ? ? I DA  41   J DT  252  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog75  hydrog ? ? A  DA  42  N1  ? ? ? 1_555 B  DT  105 N3 ? ? I DA  42   J DT  251  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog76  hydrog ? ? A  DA  42  N6  ? ? ? 1_555 B  DT  105 O4 ? ? I DA  42   J DT  251  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog77  hydrog ? ? A  DA  43  N1  ? ? ? 1_555 B  DT  104 N3 ? ? I DA  43   J DT  250  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog78  hydrog ? ? A  DA  43  N6  ? ? ? 1_555 B  DT  104 O4 ? ? I DA  43   J DT  250  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog79  hydrog ? ? A  DC  44  O2  ? ? ? 1_555 B  DG  103 N2 ? ? I DC  44   J DG  249  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog80  hydrog ? ? A  DT  45  N3  ? ? ? 1_555 B  DA  102 N1 ? ? I DT  45   J DA  248  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog81  hydrog ? ? A  DT  45  O4  ? ? ? 1_555 B  DA  102 N6 ? ? I DT  45   J DA  248  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog82  hydrog ? ? A  DG  46  N1  ? ? ? 1_555 B  DC  101 N3 ? ? I DG  46   J DC  247  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog83  hydrog ? ? A  DG  46  N2  ? ? ? 1_555 B  DC  101 O2 ? ? I DG  46   J DC  247  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog84  hydrog ? ? A  DG  46  O6  ? ? ? 1_555 B  DC  101 N4 ? ? I DG  46   J DC  247  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog85  hydrog ? ? A  DC  47  N3  ? ? ? 1_555 B  DG  100 N1 ? ? I DC  47   J DG  246  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog86  hydrog ? ? A  DC  47  N4  ? ? ? 1_555 B  DG  100 O6 ? ? I DC  47   J DG  246  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog87  hydrog ? ? A  DC  47  O2  ? ? ? 1_555 B  DG  100 N2 ? ? I DC  47   J DG  246  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog88  hydrog ? ? A  DT  48  N3  ? ? ? 1_555 B  DA  99  N1 ? ? I DT  48   J DA  245  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog89  hydrog ? ? A  DT  48  O4  ? ? ? 1_555 B  DA  99  N6 ? ? I DT  48   J DA  245  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog90  hydrog ? ? A  DC  49  N3  ? ? ? 1_555 B  DG  98  N1 ? ? I DC  49   J DG  244  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog91  hydrog ? ? A  DC  49  N4  ? ? ? 1_555 B  DG  98  O6 ? ? I DC  49   J DG  244  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog92  hydrog ? ? A  DC  49  O2  ? ? ? 1_555 B  DG  98  N2 ? ? I DC  49   J DG  244  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog93  hydrog ? ? A  DC  50  N3  ? ? ? 1_555 B  DG  97  N1 ? ? I DC  50   J DG  243  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog94  hydrog ? ? A  DC  50  N4  ? ? ? 1_555 B  DG  97  O6 ? ? I DC  50   J DG  243  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog95  hydrog ? ? A  DC  50  O2  ? ? ? 1_555 B  DG  97  N2 ? ? I DC  50   J DG  243  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog96  hydrog ? ? A  DA  51  N1  ? ? ? 1_555 B  DT  96  N3 ? ? I DA  51   J DT  242  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog97  hydrog ? ? A  DA  51  N6  ? ? ? 1_555 B  DT  96  O4 ? ? I DA  51   J DT  242  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog98  hydrog ? ? A  DT  52  N3  ? ? ? 1_555 B  DA  95  N1 ? ? I DT  52   J DA  241  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog99  hydrog ? ? A  DT  52  O4  ? ? ? 1_555 B  DA  95  N6 ? ? I DT  52   J DA  241  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog100 hydrog ? ? A  DC  53  N3  ? ? ? 1_555 B  DG  94  N1 ? ? I DC  53   J DG  240  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog101 hydrog ? ? A  DC  53  N4  ? ? ? 1_555 B  DG  94  O6 ? ? I DC  53   J DG  240  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog102 hydrog ? ? A  DC  53  O2  ? ? ? 1_555 B  DG  94  N2 ? ? I DC  53   J DG  240  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog103 hydrog ? ? A  DA  54  N1  ? ? ? 1_555 B  DT  93  N3 ? ? I DA  54   J DT  239  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog104 hydrog ? ? A  DA  54  N6  ? ? ? 1_555 B  DT  93  O4 ? ? I DA  54   J DT  239  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog105 hydrog ? ? A  DA  55  N1  ? ? ? 1_555 B  DT  92  N3 ? ? I DA  55   J DT  238  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog106 hydrog ? ? A  DA  55  N6  ? ? ? 1_555 B  DT  92  O4 ? ? I DA  55   J DT  238  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog107 hydrog ? ? A  DA  56  N1  ? ? ? 1_555 B  DT  91  N3 ? ? I DA  56   J DT  237  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog108 hydrog ? ? A  DA  56  N6  ? ? ? 1_555 B  DT  91  O4 ? ? I DA  56   J DT  237  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog109 hydrog ? ? A  DA  57  N1  ? ? ? 1_555 B  DT  90  N3 ? ? I DA  57   J DT  236  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog110 hydrog ? ? A  DA  57  N6  ? ? ? 1_555 B  DT  90  O4 ? ? I DA  57   J DT  236  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog111 hydrog ? ? A  DG  58  N1  ? ? ? 1_555 B  DC  89  N3 ? ? I DG  58   J DC  235  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog112 hydrog ? ? A  DG  58  N2  ? ? ? 1_555 B  DC  89  O2 ? ? I DG  58   J DC  235  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog113 hydrog ? ? A  DG  58  O6  ? ? ? 1_555 B  DC  89  N4 ? ? I DG  58   J DC  235  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog114 hydrog ? ? A  DG  59  N1  ? ? ? 1_555 B  DC  88  N3 ? ? I DG  59   J DC  234  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog115 hydrog ? ? A  DG  59  N2  ? ? ? 1_555 B  DC  88  O2 ? ? I DG  59   J DC  234  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog116 hydrog ? ? A  DG  59  O6  ? ? ? 1_555 B  DC  88  N4 ? ? I DG  59   J DC  234  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog117 hydrog ? ? A  DC  60  O2  ? ? ? 1_555 B  DG  87  N2 ? ? I DC  60   J DG  233  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog118 hydrog ? ? A  DA  61  N1  ? ? ? 1_555 B  DT  86  N3 ? ? I DA  61   J DT  232  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog119 hydrog ? ? A  DT  62  N3  ? ? ? 1_555 B  DA  85  N1 ? ? I DT  62   J DA  231  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog120 hydrog ? ? A  DT  62  O4  ? ? ? 1_555 B  DA  85  N6 ? ? I DT  62   J DA  231  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog121 hydrog ? ? A  DG  63  N1  ? ? ? 1_555 B  DC  84  N3 ? ? I DG  63   J DC  230  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog122 hydrog ? ? A  DG  63  N2  ? ? ? 1_555 B  DC  84  O2 ? ? I DG  63   J DC  230  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog123 hydrog ? ? A  DG  63  O6  ? ? ? 1_555 B  DC  84  N4 ? ? I DG  63   J DC  230  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog124 hydrog ? ? A  DT  64  N3  ? ? ? 1_555 B  DA  83  N1 ? ? I DT  64   J DA  229  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog125 hydrog ? ? A  DT  64  O4  ? ? ? 1_555 B  DA  83  N6 ? ? I DT  64   J DA  229  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog126 hydrog ? ? A  DT  65  N3  ? ? ? 1_555 B  DA  82  N1 ? ? I DT  65   J DA  228  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog127 hydrog ? ? A  DT  65  O4  ? ? ? 1_555 B  DA  82  N6 ? ? I DT  65   J DA  228  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog128 hydrog ? ? A  DC  66  N3  ? ? ? 1_555 B  DG  81  N1 ? ? I DC  66   J DG  227  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog129 hydrog ? ? A  DC  66  N4  ? ? ? 1_555 B  DG  81  O6 ? ? I DC  66   J DG  227  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog130 hydrog ? ? A  DC  66  O2  ? ? ? 1_555 B  DG  81  N2 ? ? I DC  66   J DG  227  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog131 hydrog ? ? A  DA  67  N1  ? ? ? 1_555 B  DT  80  N3 ? ? I DA  67   J DT  226  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog132 hydrog ? ? A  DA  67  N6  ? ? ? 1_555 B  DT  80  O4 ? ? I DA  67   J DT  226  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog133 hydrog ? ? A  DG  68  N1  ? ? ? 1_555 B  DC  79  N3 ? ? I DG  68   J DC  225  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog134 hydrog ? ? A  DG  68  N2  ? ? ? 1_555 B  DC  79  O2 ? ? I DG  68   J DC  225  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog135 hydrog ? ? A  DG  68  O6  ? ? ? 1_555 B  DC  79  N4 ? ? I DG  68   J DC  225  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog136 hydrog ? ? A  DC  69  N3  ? ? ? 1_555 B  DG  78  N1 ? ? I DC  69   J DG  224  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog137 hydrog ? ? A  DC  69  N4  ? ? ? 1_555 B  DG  78  O6 ? ? I DC  69   J DG  224  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog138 hydrog ? ? A  DC  69  O2  ? ? ? 1_555 B  DG  78  N2 ? ? I DC  69   J DG  224  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog139 hydrog ? ? A  DG  70  N1  ? ? ? 1_555 B  DC  77  N3 ? ? I DG  70   J DC  223  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog140 hydrog ? ? A  DG  70  N2  ? ? ? 1_555 B  DC  77  O2 ? ? I DG  70   J DC  223  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog141 hydrog ? ? A  DG  70  O6  ? ? ? 1_555 B  DC  77  N4 ? ? I DG  70   J DC  223  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog142 hydrog ? ? A  DG  71  N1  ? ? ? 1_555 B  DC  76  N3 ? ? I DG  71   J DC  222  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog143 hydrog ? ? A  DG  71  N2  ? ? ? 1_555 B  DC  76  O2 ? ? I DG  71   J DC  222  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog144 hydrog ? ? A  DG  71  O6  ? ? ? 1_555 B  DC  76  N4 ? ? I DG  71   J DC  222  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog145 hydrog ? ? A  DA  72  N1  ? ? ? 1_555 B  DT  75  N3 ? ? I DA  72   J DT  221  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog146 hydrog ? ? A  DA  72  N6  ? ? ? 1_555 B  DT  75  O4 ? ? I DA  72   J DT  221  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog147 hydrog ? ? A  DA  73  N1  ? ? ? 1_555 B  DT  74  N3 ? ? I DA  73   J DT  220  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog148 hydrog ? ? A  DA  73  N6  ? ? ? 1_555 B  DT  74  O4 ? ? I DA  73   J DT  220  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog149 hydrog ? ? A  DT  74  N3  ? ? ? 1_555 B  DA  73  N1 ? ? I DT  74   J DA  219  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog150 hydrog ? ? A  DT  74  O4  ? ? ? 1_555 B  DA  73  N6 ? ? I DT  74   J DA  219  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog151 hydrog ? ? A  DT  75  N3  ? ? ? 1_555 B  DA  72  N1 ? ? I DT  75   J DA  218  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog152 hydrog ? ? A  DT  75  O4  ? ? ? 1_555 B  DA  72  N6 ? ? I DT  75   J DA  218  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog153 hydrog ? ? A  DC  76  N3  ? ? ? 1_555 B  DG  71  N1 ? ? I DC  76   J DG  217  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog154 hydrog ? ? A  DC  76  N4  ? ? ? 1_555 B  DG  71  O6 ? ? I DC  76   J DG  217  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog155 hydrog ? ? A  DC  76  O2  ? ? ? 1_555 B  DG  71  N2 ? ? I DC  76   J DG  217  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog156 hydrog ? ? A  DC  77  N3  ? ? ? 1_555 B  DG  70  N1 ? ? I DC  77   J DG  216  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog157 hydrog ? ? A  DC  77  N4  ? ? ? 1_555 B  DG  70  O6 ? ? I DC  77   J DG  216  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog158 hydrog ? ? A  DC  77  O2  ? ? ? 1_555 B  DG  70  N2 ? ? I DC  77   J DG  216  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog159 hydrog ? ? A  DG  78  N1  ? ? ? 1_555 B  DC  69  N3 ? ? I DG  78   J DC  215  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog160 hydrog ? ? A  DG  78  N2  ? ? ? 1_555 B  DC  69  O2 ? ? I DG  78   J DC  215  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog161 hydrog ? ? A  DG  78  O6  ? ? ? 1_555 B  DC  69  N4 ? ? I DG  78   J DC  215  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog162 hydrog ? ? A  DC  79  N3  ? ? ? 1_555 B  DG  68  N1 ? ? I DC  79   J DG  214  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog163 hydrog ? ? A  DC  79  N4  ? ? ? 1_555 B  DG  68  O6 ? ? I DC  79   J DG  214  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog164 hydrog ? ? A  DC  79  O2  ? ? ? 1_555 B  DG  68  N2 ? ? I DC  79   J DG  214  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog165 hydrog ? ? A  DT  80  N3  ? ? ? 1_555 B  DA  67  N1 ? ? I DT  80   J DA  213  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog166 hydrog ? ? A  DT  80  O4  ? ? ? 1_555 B  DA  67  N6 ? ? I DT  80   J DA  213  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog167 hydrog ? ? A  DG  81  N1  ? ? ? 1_555 B  DC  66  N3 ? ? I DG  81   J DC  212  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog168 hydrog ? ? A  DG  81  N2  ? ? ? 1_555 B  DC  66  O2 ? ? I DG  81   J DC  212  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog169 hydrog ? ? A  DG  81  O6  ? ? ? 1_555 B  DC  66  N4 ? ? I DG  81   J DC  212  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog170 hydrog ? ? A  DA  82  N1  ? ? ? 1_555 B  DT  65  N3 ? ? I DA  82   J DT  211  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog171 hydrog ? ? A  DA  82  N6  ? ? ? 1_555 B  DT  65  O4 ? ? I DA  82   J DT  211  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog172 hydrog ? ? A  DA  83  N1  ? ? ? 1_555 B  DT  64  N3 ? ? I DA  83   J DT  210  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog173 hydrog ? ? A  DA  83  N6  ? ? ? 1_555 B  DT  64  O4 ? ? I DA  83   J DT  210  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog174 hydrog ? ? A  DC  84  N3  ? ? ? 1_555 B  DG  63  N1 ? ? I DC  84   J DG  209  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog175 hydrog ? ? A  DC  84  N4  ? ? ? 1_555 B  DG  63  O6 ? ? I DC  84   J DG  209  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog176 hydrog ? ? A  DC  84  O2  ? ? ? 1_555 B  DG  63  N2 ? ? I DC  84   J DG  209  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog177 hydrog ? ? A  DA  85  N1  ? ? ? 1_555 B  DT  62  N3 ? ? I DA  85   J DT  208  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog178 hydrog ? ? A  DA  85  N6  ? ? ? 1_555 B  DT  62  O4 ? ? I DA  85   J DT  208  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog179 hydrog ? ? A  DT  86  N3  ? ? ? 1_555 B  DA  61  N1 ? ? I DT  86   J DA  207  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog180 hydrog ? ? A  DT  86  O4  ? ? ? 1_555 B  DA  61  N6 ? ? I DT  86   J DA  207  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog181 hydrog ? ? A  DG  87  N1  ? ? ? 1_555 B  DC  60  N3 ? ? I DG  87   J DC  206  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog182 hydrog ? ? A  DG  87  N2  ? ? ? 1_555 B  DC  60  O2 ? ? I DG  87   J DC  206  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog183 hydrog ? ? A  DG  87  O6  ? ? ? 1_555 B  DC  60  N4 ? ? I DG  87   J DC  206  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog184 hydrog ? ? A  DC  88  N3  ? ? ? 1_555 B  DG  59  N1 ? ? I DC  88   J DG  205  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog185 hydrog ? ? A  DC  88  N4  ? ? ? 1_555 B  DG  59  O6 ? ? I DC  88   J DG  205  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog186 hydrog ? ? A  DC  88  O2  ? ? ? 1_555 B  DG  59  N2 ? ? I DC  88   J DG  205  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog187 hydrog ? ? A  DC  89  N3  ? ? ? 1_555 B  DG  58  N1 ? ? I DC  89   J DG  204  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog188 hydrog ? ? A  DC  89  N4  ? ? ? 1_555 B  DG  58  O6 ? ? I DC  89   J DG  204  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog189 hydrog ? ? A  DC  89  O2  ? ? ? 1_555 B  DG  58  N2 ? ? I DC  89   J DG  204  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog190 hydrog ? ? A  DT  90  N3  ? ? ? 1_555 B  DA  57  N1 ? ? I DT  90   J DA  203  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog191 hydrog ? ? A  DT  90  O4  ? ? ? 1_555 B  DA  57  N6 ? ? I DT  90   J DA  203  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog192 hydrog ? ? A  DT  91  N3  ? ? ? 1_555 B  DA  56  N1 ? ? I DT  91   J DA  202  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog193 hydrog ? ? A  DT  91  O4  ? ? ? 1_555 B  DA  56  N6 ? ? I DT  91   J DA  202  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog194 hydrog ? ? A  DT  92  N3  ? ? ? 1_555 B  DA  55  N1 ? ? I DT  92   J DA  201  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog195 hydrog ? ? A  DT  92  O4  ? ? ? 1_555 B  DA  55  N6 ? ? I DT  92   J DA  201  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog196 hydrog ? ? A  DT  93  N3  ? ? ? 1_555 B  DA  54  N1 ? ? I DT  93   J DA  200  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog197 hydrog ? ? A  DG  94  N1  ? ? ? 1_555 B  DC  53  N3 ? ? I DG  94   J DC  199  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog198 hydrog ? ? A  DG  94  N2  ? ? ? 1_555 B  DC  53  O2 ? ? I DG  94   J DC  199  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog199 hydrog ? ? A  DG  94  O6  ? ? ? 1_555 B  DC  53  N4 ? ? I DG  94   J DC  199  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog200 hydrog ? ? A  DA  95  N1  ? ? ? 1_555 B  DT  52  N3 ? ? I DA  95   J DT  198  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog201 hydrog ? ? A  DA  95  N6  ? ? ? 1_555 B  DT  52  O4 ? ? I DA  95   J DT  198  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog202 hydrog ? ? A  DT  96  N3  ? ? ? 1_555 B  DA  51  N1 ? ? I DT  96   J DA  197  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog203 hydrog ? ? A  DT  96  O4  ? ? ? 1_555 B  DA  51  N6 ? ? I DT  96   J DA  197  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog204 hydrog ? ? A  DG  97  N1  ? ? ? 1_555 B  DC  50  N3 ? ? I DG  97   J DC  196  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog205 hydrog ? ? A  DG  97  N2  ? ? ? 1_555 B  DC  50  O2 ? ? I DG  97   J DC  196  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog206 hydrog ? ? A  DG  97  O6  ? ? ? 1_555 B  DC  50  N4 ? ? I DG  97   J DC  196  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog207 hydrog ? ? A  DG  98  N1  ? ? ? 1_555 B  DC  49  N3 ? ? I DG  98   J DC  195  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog208 hydrog ? ? A  DG  98  N2  ? ? ? 1_555 B  DC  49  O2 ? ? I DG  98   J DC  195  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog209 hydrog ? ? A  DG  98  O6  ? ? ? 1_555 B  DC  49  N4 ? ? I DG  98   J DC  195  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog210 hydrog ? ? A  DA  99  N1  ? ? ? 1_555 B  DT  48  N3 ? ? I DA  99   J DT  194  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog211 hydrog ? ? A  DA  99  N6  ? ? ? 1_555 B  DT  48  O4 ? ? I DA  99   J DT  194  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog212 hydrog ? ? A  DG  100 N1  ? ? ? 1_555 B  DC  47  N3 ? ? I DG  100  J DC  193  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog213 hydrog ? ? A  DG  100 N2  ? ? ? 1_555 B  DC  47  O2 ? ? I DG  100  J DC  193  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog214 hydrog ? ? A  DG  100 O6  ? ? ? 1_555 B  DC  47  N4 ? ? I DG  100  J DC  193  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog215 hydrog ? ? A  DC  101 N3  ? ? ? 1_555 B  DG  46  N1 ? ? I DC  101  J DG  192  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog216 hydrog ? ? A  DC  101 N4  ? ? ? 1_555 B  DG  46  O6 ? ? I DC  101  J DG  192  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog217 hydrog ? ? A  DC  101 O2  ? ? ? 1_555 B  DG  46  N2 ? ? I DC  101  J DG  192  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog218 hydrog ? ? A  DA  102 N1  ? ? ? 1_555 B  DT  45  N3 ? ? I DA  102  J DT  191  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog219 hydrog ? ? A  DA  102 N6  ? ? ? 1_555 B  DT  45  O4 ? ? I DA  102  J DT  191  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog220 hydrog ? ? A  DG  103 N2  ? ? ? 1_555 B  DC  44  O2 ? ? I DG  103  J DC  190  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog221 hydrog ? ? A  DT  104 N3  ? ? ? 1_555 B  DA  43  N1 ? ? I DT  104  J DA  189  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog222 hydrog ? ? A  DT  106 N3  ? ? ? 1_555 B  DA  41  N1 ? ? I DT  106  J DA  187  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog223 hydrog ? ? A  DT  106 O4  ? ? ? 1_555 B  DA  41  N6 ? ? I DT  106  J DA  187  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog224 hydrog ? ? A  DC  107 N3  ? ? ? 1_555 B  DG  40  N1 ? ? I DC  107  J DG  186  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog225 hydrog ? ? A  DC  107 N4  ? ? ? 1_555 B  DG  40  O6 ? ? I DC  107  J DG  186  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog226 hydrog ? ? A  DC  107 O2  ? ? ? 1_555 B  DG  40  N2 ? ? I DC  107  J DG  186  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog227 hydrog ? ? A  DC  108 N3  ? ? ? 1_555 B  DG  39  N1 ? ? I DC  108  J DG  185  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog228 hydrog ? ? A  DC  108 N4  ? ? ? 1_555 B  DG  39  O6 ? ? I DC  108  J DG  185  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog229 hydrog ? ? A  DC  108 O2  ? ? ? 1_555 B  DG  39  N2 ? ? I DC  108  J DG  185  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog230 hydrog ? ? A  DA  109 N1  ? ? ? 1_555 B  DT  38  N3 ? ? I DA  109  J DT  184  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog231 hydrog ? ? A  DA  109 N6  ? ? ? 1_555 B  DT  38  O4 ? ? I DA  109  J DT  184  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog232 hydrog ? ? A  DA  110 N1  ? ? ? 1_555 B  DT  37  N3 ? ? I DA  110  J DT  183  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog233 hydrog ? ? A  DA  110 N6  ? ? ? 1_555 B  DT  37  O4 ? ? I DA  110  J DT  183  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog234 hydrog ? ? A  DA  111 N1  ? ? ? 1_555 B  DT  36  N3 ? ? I DA  111  J DT  182  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog235 hydrog ? ? A  DA  111 N6  ? ? ? 1_555 B  DT  36  O4 ? ? I DA  111  J DT  182  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog236 hydrog ? ? A  DT  112 N3  ? ? ? 1_555 B  DA  35  N1 ? ? I DT  112  J DA  181  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog237 hydrog ? ? A  DT  112 O4  ? ? ? 1_555 B  DA  35  N6 ? ? I DT  112  J DA  181  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog238 hydrog ? ? A  DA  113 N1  ? ? ? 1_555 B  DT  34  N3 ? ? I DA  113  J DT  180  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog239 hydrog ? ? A  DA  113 N6  ? ? ? 1_555 B  DT  34  O4 ? ? I DA  113  J DT  180  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog240 hydrog ? ? A  DC  114 N4  ? ? ? 1_555 B  DG  33  O6 ? ? I DC  114  J DG  179  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog241 hydrog ? ? A  DA  115 N1  ? ? ? 1_555 B  DT  32  N3 ? ? I DA  115  J DT  178  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog242 hydrog ? ? A  DA  115 N6  ? ? ? 1_555 B  DT  32  O4 ? ? I DA  115  J DT  178  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog243 hydrog ? ? A  DC  116 O2  ? ? ? 1_555 B  DG  31  N2 ? ? I DC  116  J DG  177  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog244 hydrog ? ? A  DT  117 N3  ? ? ? 1_555 B  DA  30  N1 ? ? I DT  117  J DA  176  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog245 hydrog ? ? A  DT  118 N3  ? ? ? 1_555 B  DA  29  N1 ? ? I DT  118  J DA  175  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog246 hydrog ? ? A  DT  118 O4  ? ? ? 1_555 B  DA  29  N6 ? ? I DT  118  J DA  175  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog247 hydrog ? ? A  DT  120 N3  ? ? ? 1_555 B  DA  27  N1 ? ? I DT  120  J DA  173  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog248 hydrog ? ? A  DT  120 O4  ? ? ? 1_555 B  DA  27  N6 ? ? I DT  120  J DA  173  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog249 hydrog ? ? A  DG  121 N1  ? ? ? 1_555 B  DC  26  N3 ? ? I DG  121  J DC  172  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog250 hydrog ? ? A  DG  122 N1  ? ? ? 1_555 B  DC  25  N3 ? ? I DG  122  J DC  171  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog251 hydrog ? ? A  DG  122 N2  ? ? ? 1_555 B  DC  25  O2 ? ? I DG  122  J DC  171  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog252 hydrog ? ? A  DG  122 O6  ? ? ? 1_555 B  DC  25  N4 ? ? I DG  122  J DC  171  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog253 hydrog ? ? A  DA  124 N1  ? ? ? 1_555 B  DT  23  N3 ? ? I DA  124  J DT  169  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog254 hydrog ? ? A  DA  124 N6  ? ? ? 1_555 B  DT  23  O4 ? ? I DA  124  J DT  169  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog255 hydrog ? ? A  DG  125 N2  ? ? ? 1_555 B  DC  22  N3 ? ? I DG  125  J DC  168  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog256 hydrog ? ? A  DG  125 N2  ? ? ? 1_555 B  DT  23  O2 ? ? I DG  125  J DT  169  1_555 ? ? ? ? ? ? 'DG-DT MISPAIR' ?     ? 
hydrog257 hydrog ? ? A  DA  127 N1  ? ? ? 1_555 B  DT  20  N3 ? ? I DA  127  J DT  166  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog258 hydrog ? ? A  DA  127 N6  ? ? ? 1_555 B  DT  20  O4 ? ? I DA  127  J DT  166  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog259 hydrog ? ? A  DC  129 O2  ? ? ? 1_555 B  DG  18  N2 ? ? I DC  129  J DG  164  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog260 hydrog ? ? A  DT  130 N3  ? ? ? 1_555 B  DC  16  N3 ? ? I DT  130  J DC  162  1_555 ? ? ? ? ? ? TYPE_18_PAIR    ?     ? 
hydrog261 hydrog ? ? A  DT  130 O4  ? ? ? 1_555 B  DC  16  N4 ? ? I DT  130  J DC  162  1_555 ? ? ? ? ? ? TYPE_18_PAIR    ?     ? 
hydrog262 hydrog ? ? A  DT  130 N3  ? ? ? 1_555 B  DA  17  N1 ? ? I DT  130  J DA  163  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog263 hydrog ? ? A  DT  130 O4  ? ? ? 1_555 B  DA  17  N6 ? ? I DT  130  J DA  163  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog264 hydrog ? ? A  DG  131 N1  ? ? ? 1_555 B  DC  16  N3 ? ? I DG  131  J DC  162  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog265 hydrog ? ? A  DG  131 N2  ? ? ? 1_555 B  DC  16  O2 ? ? I DG  131  J DC  162  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog266 hydrog ? ? A  DG  131 O6  ? ? ? 1_555 B  DC  16  N4 ? ? I DG  131  J DC  162  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog267 hydrog ? ? A  DC  132 N3  ? ? ? 1_555 B  DG  15  N1 ? ? I DC  132  J DG  161  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog268 hydrog ? ? A  DC  132 N4  ? ? ? 1_555 B  DG  15  O6 ? ? I DC  132  J DG  161  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog269 hydrog ? ? A  DC  132 O2  ? ? ? 1_555 B  DG  15  N2 ? ? I DC  132  J DG  161  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog270 hydrog ? ? A  DA  133 N1  ? ? ? 1_555 B  DT  14  N3 ? ? I DA  133  J DT  160  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog271 hydrog ? ? A  DA  133 N6  ? ? ? 1_555 B  DT  14  O4 ? ? I DA  133  J DT  160  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog272 hydrog ? ? A  DG  134 N1  ? ? ? 1_555 B  DC  13  N3 ? ? I DG  134  J DC  159  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog273 hydrog ? ? A  DG  134 N2  ? ? ? 1_555 B  DC  13  O2 ? ? I DG  134  J DC  159  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog274 hydrog ? ? A  DG  134 O6  ? ? ? 1_555 B  DC  13  N4 ? ? I DG  134  J DC  159  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog275 hydrog ? ? A  DG  135 N1  ? ? ? 1_555 B  DC  12  N3 ? ? I DG  135  J DC  158  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog276 hydrog ? ? A  DG  135 N2  ? ? ? 1_555 B  DC  12  O2 ? ? I DG  135  J DC  158  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog277 hydrog ? ? A  DG  135 O6  ? ? ? 1_555 B  DC  12  N4 ? ? I DG  135  J DC  158  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog278 hydrog ? ? A  DT  136 N3  ? ? ? 1_555 B  DA  11  N1 ? ? I DT  136  J DA  157  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog279 hydrog ? ? A  DT  136 O4  ? ? ? 1_555 B  DA  11  N6 ? ? I DT  136  J DA  157  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog280 hydrog ? ? A  DG  137 N1  ? ? ? 1_555 B  DC  10  N3 ? ? I DG  137  J DC  156  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog281 hydrog ? ? A  DG  137 N2  ? ? ? 1_555 B  DC  10  O2 ? ? I DG  137  J DC  156  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog282 hydrog ? ? A  DG  137 O6  ? ? ? 1_555 B  DC  10  N4 ? ? I DG  137  J DC  156  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog283 hydrog ? ? A  DG  138 N1  ? ? ? 1_555 B  DC  9   N3 ? ? I DG  138  J DC  155  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog284 hydrog ? ? A  DG  138 N2  ? ? ? 1_555 B  DC  9   O2 ? ? I DG  138  J DC  155  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog285 hydrog ? ? A  DG  138 O6  ? ? ? 1_555 B  DC  9   N4 ? ? I DG  138  J DC  155  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog286 hydrog ? ? A  DA  139 N1  ? ? ? 1_555 B  DT  8   N3 ? ? I DA  139  J DT  154  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog287 hydrog ? ? A  DA  139 N6  ? ? ? 1_555 B  DT  8   O4 ? ? I DA  139  J DT  154  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog288 hydrog ? ? A  DT  140 N3  ? ? ? 1_555 B  DA  7   N1 ? ? I DT  140  J DA  153  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog289 hydrog ? ? A  DT  140 O4  ? ? ? 1_555 B  DA  7   N6 ? ? I DT  140  J DA  153  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog290 hydrog ? ? A  DA  141 N1  ? ? ? 1_555 B  DT  6   N3 ? ? I DA  141  J DT  152  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog291 hydrog ? ? A  DA  141 N6  ? ? ? 1_555 B  DT  6   O4 ? ? I DA  141  J DT  152  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog292 hydrog ? ? A  DT  142 N3  ? ? ? 1_555 B  DA  5   N1 ? ? I DT  142  J DA  151  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog293 hydrog ? ? A  DT  142 O4  ? ? ? 1_555 B  DA  5   N6 ? ? I DT  142  J DA  151  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog294 hydrog ? ? A  DT  143 N3  ? ? ? 1_555 B  DA  4   N1 ? ? I DT  143  J DA  150  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog295 hydrog ? ? A  DT  143 O4  ? ? ? 1_555 B  DA  4   N6 ? ? I DT  143  J DA  150  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog296 hydrog ? ? A  DG  144 N1  ? ? ? 1_555 B  DC  3   N3 ? ? I DG  144  J DC  149  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog297 hydrog ? ? A  DG  144 N2  ? ? ? 1_555 B  DC  3   O2 ? ? I DG  144  J DC  149  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog298 hydrog ? ? A  DG  144 O6  ? ? ? 1_555 B  DC  3   N4 ? ? I DG  144  J DC  149  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog299 hydrog ? ? A  DA  145 N1  ? ? ? 1_555 B  DT  2   N3 ? ? I DA  145  J DT  148  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog300 hydrog ? ? A  DA  145 N6  ? ? ? 1_555 B  DT  2   O4 ? ? I DA  145  J DT  148  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog301 hydrog ? ? A  DT  146 N3  ? ? ? 1_555 B  DA  1   N1 ? ? I DT  146  J DA  147  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog302 hydrog ? ? A  DT  146 O4  ? ? ? 1_555 B  DA  1   N6 ? ? I DT  146  J DA  147  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
E ? 2 ? 
F ? 2 ? 
G ? 2 ? 
H ? 2 ? 
I ? 2 ? 
J ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel 
B 1 2 ? parallel 
C 1 2 ? parallel 
D 1 2 ? parallel 
E 1 2 ? parallel 
F 1 2 ? parallel 
G 1 2 ? parallel 
H 1 2 ? parallel 
I 1 2 ? parallel 
J 1 2 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG C 83  ? PHE C 84  ? ARG A 483  PHE A 484  
A 2 THR D 80  ? VAL D 81  ? THR B 80   VAL B 81   
B 1 THR C 118 ? ILE C 119 ? THR A 518  ILE A 519  
B 2 ARG D 45  ? ILE D 46  ? ARG B 45   ILE B 46   
C 1 THR D 96  ? TYR D 98  ? THR B 96   TYR B 98   
C 2 VAL I 100 ? ILE I 102 ? VAL G 1100 ILE G 1102 
D 1 ARG E 42  ? VAL E 43  ? ARG C 842  VAL C 843  
D 2 THR F 85  ? ILE F 86  ? THR D 1285 ILE D 1286 
E 1 ARG E 77  ? ILE E 78  ? ARG C 877  ILE C 878  
E 2 GLY F 50  ? ILE F 51  ? GLY D 1250 ILE D 1251 
F 1 VAL E 100 ? ILE E 102 ? VAL C 900  ILE C 902  
F 2 THR H 96  ? TYR H 98  ? THR F 296  TYR F 298  
G 1 ARG G 83  ? PHE G 84  ? ARG E 683  PHE E 684  
G 2 THR H 80  ? VAL H 81  ? THR F 280  VAL F 281  
H 1 THR G 118 ? ILE G 119 ? THR E 718  ILE E 719  
H 2 ARG H 45  ? ILE H 46  ? ARG F 245  ILE F 246  
I 1 ARG I 42  ? VAL I 43  ? ARG G 1042 VAL G 1043 
I 2 THR J 85  ? ILE J 86  ? THR H 1485 ILE H 1486 
J 1 ARG I 77  ? ILE I 78  ? ARG G 1077 ILE G 1078 
J 2 GLY J 50  ? ILE J 51  ? GLY H 1450 ILE H 1451 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG C 83  ? N ARG A 483  O VAL D 81  ? O VAL B 81   
B 1 2 N ILE C 119 ? N ILE A 519  O ARG D 45  ? O ARG B 45   
C 1 2 N TYR D 98  ? N TYR B 98   O THR I 101 ? O THR G 1101 
D 1 2 N ARG E 42  ? N ARG C 842  O ILE F 86  ? O ILE D 1286 
E 1 2 N ILE E 78  ? N ILE C 878  O GLY F 50  ? O GLY D 1250 
F 1 2 N THR E 101 ? N THR C 901  O TYR H 98  ? O TYR F 298  
G 1 2 N ARG G 83  ? N ARG E 683  O VAL H 81  ? O VAL F 281  
H 1 2 N ILE G 119 ? N ILE E 719  O ARG H 45  ? O ARG F 245  
I 1 2 N ARG I 42  ? N ARG G 1042 O ILE J 86  ? O ILE H 1486 
J 1 2 N ILE I 78  ? N ILE G 1078 O GLY J 50  ? O GLY H 1450 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MN E 2001'  
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MN J 2002'  
AC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MN I 2003'  
AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MN I 2004'  
AC5 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MN J 2005'  
AC6 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MN I 2006'  
AC7 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MN I 2007'  
AC8 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MN J 2008'  
AC9 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MN I 2009'  
BC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MN J 2010'  
BC2 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MN J 2011'  
BC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MN I 2012'  
BC4 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MN J 2013'  
BC5 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MN I 2014'  
BC6 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL E 2015'  
BC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CL G 2016'  
BC8 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL A 2017'  
BC9 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL D 2018'  
CC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE IMT I 1601' 
CC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE PYB I 1602' 
CC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE IMT I 1603' 
CC4 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE PYB I 1604' 
CC5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ABU I 1605' 
CC6 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE PYB I 1606' 
CC7 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE PYB I 1607' 
CC8 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE PYB I 1608' 
CC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE PYB I 1609' 
DC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE BAL I 1610' 
DC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE DIB I 1611' 
DC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE IMT I 1621' 
DC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE PYB I 1622' 
DC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE IMT I 1623' 
DC6 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE PYB I 1624' 
DC7 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ABU I 1625' 
DC8 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE PYB I 1626' 
DC9 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE PYB I 1627' 
EC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE PYB I 1628' 
EC2 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE PYB I 1629' 
EC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE BAL I 1630' 
EC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE DIB I 1631' 
EC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE OGG J 1700' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 6 VAL F  45  ? VAL D 1245 . ? 3_644 ? 
2   AC1 6 ASP G  77  ? ASP E 677  . ? 1_555 ? 
3   AC1 6 HOH FB .   ? HOH E 3391 . ? 1_555 ? 
4   AC1 6 HOH FB .   ? HOH E 3393 . ? 1_555 ? 
5   AC1 6 HOH FB .   ? HOH E 3394 . ? 1_555 ? 
6   AC1 6 HOH GB .   ? HOH F 3392 . ? 1_555 ? 
7   AC2 6 HOH ZA .   ? HOH I 3396 . ? 1_555 ? 
8   AC2 6 DG  B  100 ? DG  J 246  . ? 1_555 ? 
9   AC2 6 HOH AB .   ? HOH J 3395 . ? 1_555 ? 
10  AC2 6 HOH AB .   ? HOH J 3397 . ? 1_555 ? 
11  AC2 6 HOH AB .   ? HOH J 3398 . ? 1_555 ? 
12  AC2 6 HOH AB .   ? HOH J 3399 . ? 1_555 ? 
13  AC3 3 DG  A  70  ? DG  I 70   . ? 1_555 ? 
14  AC3 3 DG  A  71  ? DG  I 71   . ? 1_555 ? 
15  AC3 3 HOH ZA .   ? HOH I 3400 . ? 1_555 ? 
16  AC4 4 DG  A  134 ? DG  I 134  . ? 1_555 ? 
17  AC4 4 HOH ZA .   ? HOH I 3401 . ? 1_555 ? 
18  AC4 4 HOH ZA .   ? HOH I 3402 . ? 1_555 ? 
19  AC4 4 HOH ZA .   ? HOH I 3403 . ? 1_555 ? 
20  AC5 2 DG  B  134 ? DG  J 280  . ? 1_555 ? 
21  AC5 2 HOH AB .   ? HOH J 3641 . ? 1_555 ? 
22  AC6 3 DG  A  100 ? DG  I 100  . ? 1_555 ? 
23  AC6 3 HOH ZA .   ? HOH I 3526 . ? 1_555 ? 
24  AC6 3 HOH ZA .   ? HOH I 3832 . ? 1_555 ? 
25  AC7 3 DG  A  39  ? DG  I 39   . ? 1_555 ? 
26  AC7 3 DG  A  40  ? DG  I 40   . ? 1_555 ? 
27  AC7 3 HOH ZA .   ? HOH I 3153 . ? 1_555 ? 
28  AC8 4 DT  B  120 ? DT  J 266  . ? 1_555 ? 
29  AC8 4 DG  B  121 ? DG  J 267  . ? 1_555 ? 
30  AC8 4 HOH AB .   ? HOH J 3047 . ? 1_555 ? 
31  AC8 4 HOH AB .   ? HOH J 3411 . ? 1_555 ? 
32  AC9 1 DG  A  121 ? DG  I 121  . ? 1_555 ? 
33  BC1 2 DG  B  71  ? DG  J 217  . ? 1_555 ? 
34  BC1 2 HOH AB .   ? HOH J 3491 . ? 1_555 ? 
35  BC2 1 DG  B  81  ? DG  J 227  . ? 1_555 ? 
36  BC3 4 HOH ZA .   ? HOH I 3821 . ? 1_555 ? 
37  BC3 4 HOH AB .   ? HOH J 3295 . ? 1_555 ? 
38  BC3 4 HOH AB .   ? HOH J 3820 . ? 1_555 ? 
39  BC3 4 HOH AB .   ? HOH J 3833 . ? 1_555 ? 
40  BC4 3 DG  B  39  ? DG  J 185  . ? 1_555 ? 
41  BC4 3 DG  B  40  ? DG  J 186  . ? 1_555 ? 
42  BC4 3 HOH AB .   ? HOH J 3499 . ? 1_555 ? 
43  BC5 3 DG  A  137 ? DG  I 137  . ? 1_555 ? 
44  BC5 3 DG  A  138 ? DG  I 138  . ? 1_555 ? 
45  BC5 3 HOH ZA .   ? HOH I 3233 . ? 1_555 ? 
46  BC6 2 PRO G  121 ? PRO E 721  . ? 1_555 ? 
47  BC6 2 LYS G  122 ? LYS E 722  . ? 1_555 ? 
48  BC7 6 GLY I  44  ? GLY G 1044 . ? 1_555 ? 
49  BC7 6 ALA I  45  ? ALA G 1045 . ? 1_555 ? 
50  BC7 6 GLY I  46  ? GLY G 1046 . ? 1_555 ? 
51  BC7 6 ALA I  47  ? ALA G 1047 . ? 1_555 ? 
52  BC7 6 THR J  87  ? THR H 1487 . ? 1_555 ? 
53  BC7 6 SER J  88  ? SER H 1488 . ? 1_555 ? 
54  BC8 2 PRO C  121 ? PRO A 521  . ? 1_555 ? 
55  BC8 2 LYS C  122 ? LYS A 522  . ? 1_555 ? 
56  BC9 4 GLY E  46  ? GLY C 846  . ? 1_555 ? 
57  BC9 4 ALA E  47  ? ALA C 847  . ? 1_555 ? 
58  BC9 4 THR F  87  ? THR D 1287 . ? 1_555 ? 
59  BC9 4 SER F  88  ? SER D 1288 . ? 1_555 ? 
60  CC1 5 DG  A  31  ? DG  I 31   . ? 1_555 ? 
61  CC1 5 DT  A  32  ? DT  I 32   . ? 1_555 ? 
62  CC1 5 PYB S  .   ? PYB I 1602 . ? 1_555 ? 
63  CC1 5 PYB Y  .   ? PYB I 1608 . ? 1_555 ? 
64  CC1 5 PYB Z  .   ? PYB I 1609 . ? 1_555 ? 
65  CC2 6 DT  A  32  ? DT  I 32   . ? 1_555 ? 
66  CC2 6 DG  A  33  ? DG  I 33   . ? 1_555 ? 
67  CC2 6 IMT R  .   ? IMT I 1601 . ? 1_555 ? 
68  CC2 6 IMT T  .   ? IMT I 1603 . ? 1_555 ? 
69  CC2 6 PYB X  .   ? PYB I 1607 . ? 1_555 ? 
70  CC2 6 PYB Y  .   ? PYB I 1608 . ? 1_555 ? 
71  CC3 5 DG  A  33  ? DG  I 33   . ? 1_555 ? 
72  CC3 5 DT  A  34  ? DT  I 34   . ? 1_555 ? 
73  CC3 5 DA  A  35  ? DA  I 35   . ? 1_555 ? 
74  CC3 5 PYB S  .   ? PYB I 1602 . ? 1_555 ? 
75  CC3 5 PYB U  .   ? PYB I 1604 . ? 1_555 ? 
76  CC4 7 DT  A  34  ? DT  I 34   . ? 1_555 ? 
77  CC4 7 DA  A  35  ? DA  I 35   . ? 1_555 ? 
78  CC4 7 DT  A  36  ? DT  I 36   . ? 1_555 ? 
79  CC4 7 IMT T  .   ? IMT I 1603 . ? 1_555 ? 
80  CC4 7 ABU V  .   ? ABU I 1605 . ? 1_555 ? 
81  CC4 7 PYB W  .   ? PYB I 1606 . ? 1_555 ? 
82  CC4 7 HOH ZA .   ? HOH I 3243 . ? 1_555 ? 
83  CC5 5 PYB U  .   ? PYB I 1604 . ? 1_555 ? 
84  CC5 5 PYB W  .   ? PYB I 1606 . ? 1_555 ? 
85  CC5 5 DA  B  113 ? DA  J 259  . ? 1_555 ? 
86  CC5 5 DC  B  114 ? DC  J 260  . ? 1_555 ? 
87  CC5 5 OGG TA .   ? OGG J 1700 . ? 1_555 ? 
88  CC6 7 PYB U  .   ? PYB I 1604 . ? 1_555 ? 
89  CC6 7 ABU V  .   ? ABU I 1605 . ? 1_555 ? 
90  CC6 7 PYB X  .   ? PYB I 1607 . ? 1_555 ? 
91  CC6 7 DA  B  113 ? DA  J 259  . ? 1_555 ? 
92  CC6 7 DC  B  114 ? DC  J 260  . ? 1_555 ? 
93  CC6 7 DA  B  115 ? DA  J 261  . ? 1_555 ? 
94  CC6 7 OGG TA .   ? OGG J 1700 . ? 1_555 ? 
95  CC7 5 PYB S  .   ? PYB I 1602 . ? 1_555 ? 
96  CC7 5 PYB W  .   ? PYB I 1606 . ? 1_555 ? 
97  CC7 5 PYB Y  .   ? PYB I 1608 . ? 1_555 ? 
98  CC7 5 DC  B  114 ? DC  J 260  . ? 1_555 ? 
99  CC7 5 DA  B  115 ? DA  J 261  . ? 1_555 ? 
100 CC8 7 IMT R  .   ? IMT I 1601 . ? 1_555 ? 
101 CC8 7 PYB S  .   ? PYB I 1602 . ? 1_555 ? 
102 CC8 7 PYB X  .   ? PYB I 1607 . ? 1_555 ? 
103 CC8 7 PYB Z  .   ? PYB I 1609 . ? 1_555 ? 
104 CC8 7 DA  B  115 ? DA  J 261  . ? 1_555 ? 
105 CC8 7 DC  B  116 ? DC  J 262  . ? 1_555 ? 
106 CC8 7 DT  B  117 ? DT  J 263  . ? 1_555 ? 
107 CC9 6 DG  A  31  ? DG  I 31   . ? 1_555 ? 
108 CC9 6 IMT R  .   ? IMT I 1601 . ? 1_555 ? 
109 CC9 6 PYB Y  .   ? PYB I 1608 . ? 1_555 ? 
110 CC9 6 BAL AA .   ? BAL I 1610 . ? 1_555 ? 
111 CC9 6 DC  B  116 ? DC  J 262  . ? 1_555 ? 
112 CC9 6 DT  B  117 ? DT  J 263  . ? 1_555 ? 
113 DC1 5 DA  A  30  ? DA  I 30   . ? 1_555 ? 
114 DC1 5 DG  A  31  ? DG  I 31   . ? 1_555 ? 
115 DC1 5 PYB Z  .   ? PYB I 1609 . ? 1_555 ? 
116 DC1 5 DIB BA .   ? DIB I 1611 . ? 1_555 ? 
117 DC1 5 DT  B  117 ? DT  J 263  . ? 1_555 ? 
118 DC2 5 DA  A  29  ? DA  I 29   . ? 1_555 ? 
119 DC2 5 DA  A  30  ? DA  I 30   . ? 1_555 ? 
120 DC2 5 BAL AA .   ? BAL I 1610 . ? 1_555 ? 
121 DC2 5 DT  B  119 ? DT  J 265  . ? 1_555 ? 
122 DC2 5 DT  B  120 ? DT  J 266  . ? 1_555 ? 
123 DC3 4 PYB DA .   ? PYB I 1622 . ? 1_555 ? 
124 DC3 4 PYB JA .   ? PYB I 1628 . ? 1_555 ? 
125 DC3 4 PYB KA .   ? PYB I 1629 . ? 1_555 ? 
126 DC3 4 DT  B  32  ? DT  J 178  . ? 1_555 ? 
127 DC4 6 IMT CA .   ? IMT I 1621 . ? 1_555 ? 
128 DC4 6 IMT EA .   ? IMT I 1623 . ? 1_555 ? 
129 DC4 6 PYB IA .   ? PYB I 1627 . ? 1_555 ? 
130 DC4 6 PYB JA .   ? PYB I 1628 . ? 1_555 ? 
131 DC4 6 DT  B  32  ? DT  J 178  . ? 1_555 ? 
132 DC4 6 DG  B  33  ? DG  J 179  . ? 1_555 ? 
133 DC5 6 PYB DA .   ? PYB I 1622 . ? 1_555 ? 
134 DC5 6 PYB FA .   ? PYB I 1624 . ? 1_555 ? 
135 DC5 6 PYB IA .   ? PYB I 1627 . ? 1_555 ? 
136 DC5 6 DG  B  33  ? DG  J 179  . ? 1_555 ? 
137 DC5 6 DT  B  34  ? DT  J 180  . ? 1_555 ? 
138 DC5 6 DA  B  35  ? DA  J 181  . ? 1_555 ? 
139 DC6 7 DA  A  113 ? DA  I 113  . ? 1_555 ? 
140 DC6 7 IMT EA .   ? IMT I 1623 . ? 1_555 ? 
141 DC6 7 ABU GA .   ? ABU I 1625 . ? 1_555 ? 
142 DC6 7 PYB HA .   ? PYB I 1626 . ? 1_555 ? 
143 DC6 7 DT  B  34  ? DT  J 180  . ? 1_555 ? 
144 DC6 7 DA  B  35  ? DA  J 181  . ? 1_555 ? 
145 DC6 7 DT  B  36  ? DT  J 182  . ? 1_555 ? 
146 DC7 5 DA  A  113 ? DA  I 113  . ? 1_555 ? 
147 DC7 5 PYB FA .   ? PYB I 1624 . ? 1_555 ? 
148 DC7 5 PYB HA .   ? PYB I 1626 . ? 1_555 ? 
149 DC7 5 DA  B  35  ? DA  J 181  . ? 1_555 ? 
150 DC7 5 OGG TA .   ? OGG J 1700 . ? 1_555 ? 
151 DC8 7 DA  A  113 ? DA  I 113  . ? 1_555 ? 
152 DC8 7 DC  A  114 ? DC  I 114  . ? 1_555 ? 
153 DC8 7 DA  A  115 ? DA  I 115  . ? 1_555 ? 
154 DC8 7 PYB FA .   ? PYB I 1624 . ? 1_555 ? 
155 DC8 7 ABU GA .   ? ABU I 1625 . ? 1_555 ? 
156 DC8 7 PYB IA .   ? PYB I 1627 . ? 1_555 ? 
157 DC8 7 OGG TA .   ? OGG J 1700 . ? 1_555 ? 
158 DC9 7 DC  A  114 ? DC  I 114  . ? 1_555 ? 
159 DC9 7 DA  A  115 ? DA  I 115  . ? 1_555 ? 
160 DC9 7 DC  A  116 ? DC  I 116  . ? 1_555 ? 
161 DC9 7 PYB DA .   ? PYB I 1622 . ? 1_555 ? 
162 DC9 7 IMT EA .   ? IMT I 1623 . ? 1_555 ? 
163 DC9 7 PYB HA .   ? PYB I 1626 . ? 1_555 ? 
164 DC9 7 PYB JA .   ? PYB I 1628 . ? 1_555 ? 
165 EC1 7 DA  A  115 ? DA  I 115  . ? 1_555 ? 
166 EC1 7 DC  A  116 ? DC  I 116  . ? 1_555 ? 
167 EC1 7 DT  A  117 ? DT  I 117  . ? 1_555 ? 
168 EC1 7 IMT CA .   ? IMT I 1621 . ? 1_555 ? 
169 EC1 7 PYB DA .   ? PYB I 1622 . ? 1_555 ? 
170 EC1 7 PYB IA .   ? PYB I 1627 . ? 1_555 ? 
171 EC1 7 PYB KA .   ? PYB I 1629 . ? 1_555 ? 
172 EC2 8 LYS I  13  ? LYS G 1013 . ? 1_555 ? 
173 EC2 8 DC  A  116 ? DC  I 116  . ? 1_555 ? 
174 EC2 8 DT  A  117 ? DT  I 117  . ? 1_555 ? 
175 EC2 8 DT  A  118 ? DT  I 118  . ? 1_555 ? 
176 EC2 8 IMT CA .   ? IMT I 1621 . ? 1_555 ? 
177 EC2 8 PYB JA .   ? PYB I 1628 . ? 1_555 ? 
178 EC2 8 BAL LA .   ? BAL I 1630 . ? 1_555 ? 
179 EC2 8 DG  B  31  ? DG  J 177  . ? 1_555 ? 
180 EC3 5 ALA I  14  ? ALA G 1014 . ? 1_555 ? 
181 EC3 5 PYB KA .   ? PYB I 1629 . ? 1_555 ? 
182 EC3 5 DIB MA .   ? DIB I 1631 . ? 1_555 ? 
183 EC3 5 DA  B  30  ? DA  J 176  . ? 1_555 ? 
184 EC3 5 DG  B  31  ? DG  J 177  . ? 1_555 ? 
185 EC4 5 DT  A  119 ? DT  I 119  . ? 1_555 ? 
186 EC4 5 DT  A  120 ? DT  I 120  . ? 1_555 ? 
187 EC4 5 BAL LA .   ? BAL I 1630 . ? 1_555 ? 
188 EC4 5 DA  B  29  ? DA  J 175  . ? 1_555 ? 
189 EC4 5 DA  B  30  ? DA  J 176  . ? 1_555 ? 
190 EC5 6 DA  A  113 ? DA  I 113  . ? 1_555 ? 
191 EC5 6 ABU V  .   ? ABU I 1605 . ? 1_555 ? 
192 EC5 6 PYB W  .   ? PYB I 1606 . ? 1_555 ? 
193 EC5 6 ABU GA .   ? ABU I 1625 . ? 1_555 ? 
194 EC5 6 PYB HA .   ? PYB I 1626 . ? 1_555 ? 
195 EC5 6 DA  B  113 ? DA  J 259  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1S32 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1S32 
_atom_sites.fract_transf_matrix[1][1]   0.009492 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009114 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005500 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
MN 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     O  "O5'" . DA  A  1  1   ? 51.155  54.223 -93.851 1.00 135.80 ? 1    DA  I "O5'" 1 
ATOM   2     C  "C5'" . DA  A  1  1   ? 50.335  54.630 -94.948 1.00 136.46 ? 1    DA  I "C5'" 1 
ATOM   3     C  "C4'" . DA  A  1  1   ? 49.016  53.894 -94.949 1.00 136.84 ? 1    DA  I "C4'" 1 
ATOM   4     O  "O4'" . DA  A  1  1   ? 49.271  52.469 -95.005 1.00 137.33 ? 1    DA  I "O4'" 1 
ATOM   5     C  "C3'" . DA  A  1  1   ? 48.172  54.118 -93.694 1.00 137.08 ? 1    DA  I "C3'" 1 
ATOM   6     O  "O3'" . DA  A  1  1   ? 46.780  54.103 -94.025 1.00 136.92 ? 1    DA  I "O3'" 1 
ATOM   7     C  "C2'" . DA  A  1  1   ? 48.509  52.915 -92.836 1.00 137.57 ? 1    DA  I "C2'" 1 
ATOM   8     C  "C1'" . DA  A  1  1   ? 48.691  51.828 -93.879 1.00 137.55 ? 1    DA  I "C1'" 1 
ATOM   9     N  N9    . DA  A  1  1   ? 49.580  50.741 -93.468 1.00 137.55 ? 1    DA  I N9    1 
ATOM   10    C  C8    . DA  A  1  1   ? 50.863  50.835 -92.988 1.00 137.66 ? 1    DA  I C8    1 
ATOM   11    N  N7    . DA  A  1  1   ? 51.404  49.677 -92.693 1.00 137.61 ? 1    DA  I N7    1 
ATOM   12    C  C5    . DA  A  1  1   ? 50.411  48.758 -93.002 1.00 137.49 ? 1    DA  I C5    1 
ATOM   13    C  C6    . DA  A  1  1   ? 50.360  47.356 -92.916 1.00 137.20 ? 1    DA  I C6    1 
ATOM   14    N  N6    . DA  A  1  1   ? 51.368  46.604 -92.471 1.00 137.22 ? 1    DA  I N6    1 
ATOM   15    N  N1    . DA  A  1  1   ? 49.221  46.744 -93.307 1.00 136.97 ? 1    DA  I N1    1 
ATOM   16    C  C2    . DA  A  1  1   ? 48.210  47.498 -93.751 1.00 137.01 ? 1    DA  I C2    1 
ATOM   17    N  N3    . DA  A  1  1   ? 48.136  48.821 -93.878 1.00 137.20 ? 1    DA  I N3    1 
ATOM   18    C  C4    . DA  A  1  1   ? 49.283  49.399 -93.483 1.00 137.42 ? 1    DA  I C4    1 
ATOM   19    P  P     . DT  A  1  2   ? 45.715  54.788 -93.034 1.00 136.84 ? 2    DT  I P     1 
ATOM   20    O  OP1   . DT  A  1  2   ? 45.610  56.229 -93.381 1.00 136.99 ? 2    DT  I OP1   1 
ATOM   21    O  OP2   . DT  A  1  2   ? 46.067  54.391 -91.646 1.00 136.78 ? 2    DT  I OP2   1 
ATOM   22    O  "O5'" . DT  A  1  2   ? 44.339  54.082 -93.411 1.00 135.56 ? 2    DT  I "O5'" 1 
ATOM   23    C  "C5'" . DT  A  1  2   ? 43.964  53.904 -94.773 1.00 133.74 ? 2    DT  I "C5'" 1 
ATOM   24    C  "C4'" . DT  A  1  2   ? 43.233  52.593 -94.945 1.00 132.61 ? 2    DT  I "C4'" 1 
ATOM   25    O  "O4'" . DT  A  1  2   ? 44.121  51.498 -94.609 1.00 132.45 ? 2    DT  I "O4'" 1 
ATOM   26    C  "C3'" . DT  A  1  2   ? 42.001  52.422 -94.055 1.00 131.64 ? 2    DT  I "C3'" 1 
ATOM   27    O  "O3'" . DT  A  1  2   ? 40.991  51.709 -94.777 1.00 130.38 ? 2    DT  I "O3'" 1 
ATOM   28    C  "C2'" . DT  A  1  2   ? 42.521  51.579 -92.906 1.00 131.86 ? 2    DT  I "C2'" 1 
ATOM   29    C  "C1'" . DT  A  1  2   ? 43.517  50.682 -93.616 1.00 132.18 ? 2    DT  I "C1'" 1 
ATOM   30    N  N1    . DT  A  1  2   ? 44.586  50.129 -92.758 1.00 132.14 ? 2    DT  I N1    1 
ATOM   31    C  C2    . DT  A  1  2   ? 44.782  48.764 -92.770 1.00 131.75 ? 2    DT  I C2    1 
ATOM   32    O  O2    . DT  A  1  2   ? 44.112  47.999 -93.444 1.00 131.70 ? 2    DT  I O2    1 
ATOM   33    N  N3    . DT  A  1  2   ? 45.797  48.325 -91.956 1.00 131.26 ? 2    DT  I N3    1 
ATOM   34    C  C4    . DT  A  1  2   ? 46.610  49.093 -91.146 1.00 131.50 ? 2    DT  I C4    1 
ATOM   35    O  O4    . DT  A  1  2   ? 47.485  48.555 -90.472 1.00 131.09 ? 2    DT  I O4    1 
ATOM   36    C  C5    . DT  A  1  2   ? 46.342  50.513 -91.174 1.00 131.67 ? 2    DT  I C5    1 
ATOM   37    C  C7    . DT  A  1  2   ? 47.163  51.421 -90.314 1.00 131.63 ? 2    DT  I C7    1 
ATOM   38    C  C6    . DT  A  1  2   ? 45.360  50.955 -91.971 1.00 132.00 ? 2    DT  I C6    1 
ATOM   39    P  P     . DC  A  1  3   ? 39.529  51.518 -94.136 1.00 129.46 ? 3    DC  I P     1 
ATOM   40    O  OP1   . DC  A  1  3   ? 38.512  51.960 -95.125 1.00 129.65 ? 3    DC  I OP1   1 
ATOM   41    O  OP2   . DC  A  1  3   ? 39.547  52.126 -92.780 1.00 129.65 ? 3    DC  I OP2   1 
ATOM   42    O  "O5'" . DC  A  1  3   ? 39.402  49.941 -93.970 1.00 127.11 ? 3    DC  I "O5'" 1 
ATOM   43    C  "C5'" . DC  A  1  3   ? 40.481  49.188 -93.429 1.00 123.33 ? 3    DC  I "C5'" 1 
ATOM   44    C  "C4'" . DC  A  1  3   ? 40.002  47.829 -92.979 1.00 120.50 ? 3    DC  I "C4'" 1 
ATOM   45    O  "O4'" . DC  A  1  3   ? 41.116  47.153 -92.350 1.00 119.93 ? 3    DC  I "O4'" 1 
ATOM   46    C  "C3'" . DC  A  1  3   ? 38.897  47.880 -91.926 1.00 118.29 ? 3    DC  I "C3'" 1 
ATOM   47    O  "O3'" . DC  A  1  3   ? 38.023  46.758 -92.065 1.00 114.65 ? 3    DC  I "O3'" 1 
ATOM   48    C  "C2'" . DC  A  1  3   ? 39.653  47.817 -90.613 1.00 118.65 ? 3    DC  I "C2'" 1 
ATOM   49    C  "C1'" . DC  A  1  3   ? 40.880  46.987 -90.958 1.00 119.01 ? 3    DC  I "C1'" 1 
ATOM   50    N  N1    . DC  A  1  3   ? 42.106  47.388 -90.246 1.00 118.06 ? 3    DC  I N1    1 
ATOM   51    C  C2    . DC  A  1  3   ? 42.407  48.753 -90.107 1.00 117.70 ? 3    DC  I C2    1 
ATOM   52    O  O2    . DC  A  1  3   ? 41.646  49.595 -90.605 1.00 118.33 ? 3    DC  I O2    1 
ATOM   53    N  N3    . DC  A  1  3   ? 43.523  49.117 -89.438 1.00 116.92 ? 3    DC  I N3    1 
ATOM   54    C  C4    . DC  A  1  3   ? 44.324  48.184 -88.925 1.00 116.41 ? 3    DC  I C4    1 
ATOM   55    N  N4    . DC  A  1  3   ? 45.413  48.587 -88.268 1.00 116.14 ? 3    DC  I N4    1 
ATOM   56    C  C5    . DC  A  1  3   ? 44.046  46.797 -89.060 1.00 116.68 ? 3    DC  I C5    1 
ATOM   57    C  C6    . DC  A  1  3   ? 42.939  46.445 -89.720 1.00 116.94 ? 3    DC  I C6    1 
ATOM   58    P  P     . DA  A  1  4   ? 36.637  46.728 -91.256 1.00 112.35 ? 4    DA  I P     1 
ATOM   59    O  OP1   . DA  A  1  4   ? 35.535  46.495 -92.222 1.00 112.59 ? 4    DA  I OP1   1 
ATOM   60    O  OP2   . DA  A  1  4   ? 36.608  47.928 -90.378 1.00 112.42 ? 4    DA  I OP2   1 
ATOM   61    O  "O5'" . DA  A  1  4   ? 36.769  45.440 -90.332 1.00 108.96 ? 4    DA  I "O5'" 1 
ATOM   62    C  "C5'" . DA  A  1  4   ? 37.188  44.196 -90.882 1.00 102.91 ? 4    DA  I "C5'" 1 
ATOM   63    C  "C4'" . DA  A  1  4   ? 37.711  43.291 -89.792 1.00 98.53  ? 4    DA  I "C4'" 1 
ATOM   64    O  "O4'" . DA  A  1  4   ? 38.904  43.865 -89.205 1.00 96.22  ? 4    DA  I "O4'" 1 
ATOM   65    C  "C3'" . DA  A  1  4   ? 36.746  43.052 -88.631 1.00 96.08  ? 4    DA  I "C3'" 1 
ATOM   66    O  "O3'" . DA  A  1  4   ? 36.920  41.716 -88.165 1.00 94.47  ? 4    DA  I "O3'" 1 
ATOM   67    C  "C2'" . DA  A  1  4   ? 37.235  44.025 -87.573 1.00 95.07  ? 4    DA  I "C2'" 1 
ATOM   68    C  "C1'" . DA  A  1  4   ? 38.734  43.982 -87.801 1.00 93.77  ? 4    DA  I "C1'" 1 
ATOM   69    N  N9    . DA  A  1  4   ? 39.468  45.166 -87.356 1.00 91.27  ? 4    DA  I N9    1 
ATOM   70    C  C8    . DA  A  1  4   ? 39.100  46.485 -87.440 1.00 90.09  ? 4    DA  I C8    1 
ATOM   71    N  N7    . DA  A  1  4   ? 39.992  47.315 -86.954 1.00 89.30  ? 4    DA  I N7    1 
ATOM   72    C  C5    . DA  A  1  4   ? 41.017  46.485 -86.518 1.00 88.67  ? 4    DA  I C5    1 
ATOM   73    C  C6    . DA  A  1  4   ? 42.257  46.748 -85.908 1.00 87.29  ? 4    DA  I C6    1 
ATOM   74    N  N6    . DA  A  1  4   ? 42.697  47.974 -85.613 1.00 85.73  ? 4    DA  I N6    1 
ATOM   75    N  N1    . DA  A  1  4   ? 43.042  45.692 -85.605 1.00 86.65  ? 4    DA  I N1    1 
ATOM   76    C  C2    . DA  A  1  4   ? 42.604  44.463 -85.896 1.00 86.67  ? 4    DA  I C2    1 
ATOM   77    N  N3    . DA  A  1  4   ? 41.463  44.088 -86.465 1.00 87.52  ? 4    DA  I N3    1 
ATOM   78    C  C4    . DA  A  1  4   ? 40.705  45.159 -86.757 1.00 89.52  ? 4    DA  I C4    1 
ATOM   79    P  P     . DA  A  1  5   ? 35.683  40.922 -87.524 1.00 94.36  ? 5    DA  I P     1 
ATOM   80    O  OP1   . DA  A  1  5   ? 35.131  40.012 -88.559 1.00 93.92  ? 5    DA  I OP1   1 
ATOM   81    O  OP2   . DA  A  1  5   ? 34.793  41.901 -86.849 1.00 94.39  ? 5    DA  I OP2   1 
ATOM   82    O  "O5'" . DA  A  1  5   ? 36.377  40.029 -86.405 1.00 94.14  ? 5    DA  I "O5'" 1 
ATOM   83    C  "C5'" . DA  A  1  5   ? 37.529  39.248 -86.716 1.00 91.94  ? 5    DA  I "C5'" 1 
ATOM   84    C  "C4'" . DA  A  1  5   ? 38.429  39.133 -85.508 1.00 89.91  ? 5    DA  I "C4'" 1 
ATOM   85    O  "O4'" . DA  A  1  5   ? 39.126  40.380 -85.260 1.00 88.08  ? 5    DA  I "O4'" 1 
ATOM   86    C  "C3'" . DA  A  1  5   ? 37.697  38.791 -84.212 1.00 89.06  ? 5    DA  I "C3'" 1 
ATOM   87    O  "O3'" . DA  A  1  5   ? 38.468  37.850 -83.462 1.00 88.83  ? 5    DA  I "O3'" 1 
ATOM   88    C  "C2'" . DA  A  1  5   ? 37.612  40.129 -83.498 1.00 86.96  ? 5    DA  I "C2'" 1 
ATOM   89    C  "C1'" . DA  A  1  5   ? 38.913  40.786 -83.917 1.00 86.49  ? 5    DA  I "C1'" 1 
ATOM   90    N  N9    . DA  A  1  5   ? 38.911  42.248 -83.884 1.00 84.72  ? 5    DA  I N9    1 
ATOM   91    C  C8    . DA  A  1  5   ? 37.930  43.105 -84.315 1.00 84.64  ? 5    DA  I C8    1 
ATOM   92    N  N7    . DA  A  1  5   ? 38.229  44.373 -84.160 1.00 83.66  ? 5    DA  I N7    1 
ATOM   93    C  C5    . DA  A  1  5   ? 39.491  44.350 -83.585 1.00 83.59  ? 5    DA  I C5    1 
ATOM   94    C  C6    . DA  A  1  5   ? 40.364  45.376 -83.171 1.00 82.90  ? 5    DA  I C6    1 
ATOM   95    N  N6    . DA  A  1  5   ? 40.083  46.676 -83.274 1.00 82.23  ? 5    DA  I N6    1 
ATOM   96    N  N1    . DA  A  1  5   ? 41.550  45.014 -82.637 1.00 83.16  ? 5    DA  I N1    1 
ATOM   97    C  C2    . DA  A  1  5   ? 41.829  43.707 -82.526 1.00 83.97  ? 5    DA  I C2    1 
ATOM   98    N  N3    . DA  A  1  5   ? 41.091  42.652 -82.876 1.00 84.12  ? 5    DA  I N3    1 
ATOM   99    C  C4    . DA  A  1  5   ? 39.922  43.047 -83.407 1.00 84.07  ? 5    DA  I C4    1 
ATOM   100   P  P     . DT  A  1  6   ? 37.817  37.124 -82.186 1.00 89.61  ? 6    DT  I P     1 
ATOM   101   O  OP1   . DT  A  1  6   ? 38.097  35.665 -82.273 1.00 89.96  ? 6    DT  I OP1   1 
ATOM   102   O  OP2   . DT  A  1  6   ? 36.415  37.600 -82.059 1.00 89.59  ? 6    DT  I OP2   1 
ATOM   103   O  "O5'" . DT  A  1  6   ? 38.644  37.737 -80.976 1.00 87.90  ? 6    DT  I "O5'" 1 
ATOM   104   C  "C5'" . DT  A  1  6   ? 39.042  39.099 -81.015 1.00 85.03  ? 6    DT  I "C5'" 1 
ATOM   105   C  "C4'" . DT  A  1  6   ? 40.026  39.396 -79.913 1.00 82.02  ? 6    DT  I "C4'" 1 
ATOM   106   O  "O4'" . DT  A  1  6   ? 40.420  40.779 -80.046 1.00 81.63  ? 6    DT  I "O4'" 1 
ATOM   107   C  "C3'" . DT  A  1  6   ? 39.436  39.259 -78.514 1.00 81.08  ? 6    DT  I "C3'" 1 
ATOM   108   O  "O3'" . DT  A  1  6   ? 40.446  38.819 -77.605 1.00 79.97  ? 6    DT  I "O3'" 1 
ATOM   109   C  "C2'" . DT  A  1  6   ? 38.966  40.665 -78.197 1.00 80.56  ? 6    DT  I "C2'" 1 
ATOM   110   C  "C1'" . DT  A  1  6   ? 39.968  41.537 -78.934 1.00 80.69  ? 6    DT  I "C1'" 1 
ATOM   111   N  N1    . DT  A  1  6   ? 39.394  42.794 -79.452 1.00 80.09  ? 6    DT  I N1    1 
ATOM   112   C  C2    . DT  A  1  6   ? 40.144  43.945 -79.361 1.00 79.22  ? 6    DT  I C2    1 
ATOM   113   O  O2    . DT  A  1  6   ? 41.268  43.972 -78.893 1.00 78.79  ? 6    DT  I O2    1 
ATOM   114   N  N3    . DT  A  1  6   ? 39.528  45.070 -79.848 1.00 79.21  ? 6    DT  I N3    1 
ATOM   115   C  C4    . DT  A  1  6   ? 38.271  45.154 -80.413 1.00 79.58  ? 6    DT  I C4    1 
ATOM   116   O  O4    . DT  A  1  6   ? 37.855  46.234 -80.815 1.00 79.64  ? 6    DT  I O4    1 
ATOM   117   C  C5    . DT  A  1  6   ? 37.542  43.907 -80.483 1.00 80.13  ? 6    DT  I C5    1 
ATOM   118   C  C7    . DT  A  1  6   ? 36.169  43.900 -81.078 1.00 80.27  ? 6    DT  I C7    1 
ATOM   119   C  C6    . DT  A  1  6   ? 38.132  42.805 -80.007 1.00 79.77  ? 6    DT  I C6    1 
ATOM   120   P  P     . DA  A  1  7   ? 40.114  38.693 -76.039 1.00 79.53  ? 7    DA  I P     1 
ATOM   121   O  OP1   . DA  A  1  7   ? 40.419  37.308 -75.597 1.00 78.97  ? 7    DA  I OP1   1 
ATOM   122   O  OP2   . DA  A  1  7   ? 38.762  39.261 -75.801 1.00 80.32  ? 7    DA  I OP2   1 
ATOM   123   O  "O5'" . DA  A  1  7   ? 41.174  39.670 -75.375 1.00 77.67  ? 7    DA  I "O5'" 1 
ATOM   124   C  "C5'" . DA  A  1  7   ? 42.492  39.758 -75.896 1.00 77.64  ? 7    DA  I "C5'" 1 
ATOM   125   C  "C4'" . DA  A  1  7   ? 43.142  41.038 -75.433 1.00 77.36  ? 7    DA  I "C4'" 1 
ATOM   126   O  "O4'" . DA  A  1  7   ? 42.464  42.166 -76.033 1.00 76.84  ? 7    DA  I "O4'" 1 
ATOM   127   C  "C3'" . DA  A  1  7   ? 43.065  41.252 -73.924 1.00 77.58  ? 7    DA  I "C3'" 1 
ATOM   128   O  "O3'" . DA  A  1  7   ? 44.279  41.846 -73.458 1.00 79.31  ? 7    DA  I "O3'" 1 
ATOM   129   C  "C2'" . DA  A  1  7   ? 41.880  42.188 -73.762 1.00 76.76  ? 7    DA  I "C2'" 1 
ATOM   130   C  "C1'" . DA  A  1  7   ? 41.950  43.025 -75.026 1.00 76.28  ? 7    DA  I "C1'" 1 
ATOM   131   N  N9    . DA  A  1  7   ? 40.659  43.532 -75.488 1.00 74.38  ? 7    DA  I N9    1 
ATOM   132   C  C8    . DA  A  1  7   ? 39.522  42.812 -75.751 1.00 74.58  ? 7    DA  I C8    1 
ATOM   133   N  N7    . DA  A  1  7   ? 38.518  43.543 -76.171 1.00 74.71  ? 7    DA  I N7    1 
ATOM   134   C  C5    . DA  A  1  7   ? 39.029  44.833 -76.183 1.00 73.81  ? 7    DA  I C5    1 
ATOM   135   C  C6    . DA  A  1  7   ? 38.463  46.070 -76.535 1.00 73.36  ? 7    DA  I C6    1 
ATOM   136   N  N6    . DA  A  1  7   ? 37.211  46.212 -76.977 1.00 72.37  ? 7    DA  I N6    1 
ATOM   137   N  N1    . DA  A  1  7   ? 39.238  47.171 -76.422 1.00 72.62  ? 7    DA  I N1    1 
ATOM   138   C  C2    . DA  A  1  7   ? 40.495  47.024 -75.988 1.00 73.17  ? 7    DA  I C2    1 
ATOM   139   N  N3    . DA  A  1  7   ? 41.142  45.914 -75.635 1.00 72.67  ? 7    DA  I N3    1 
ATOM   140   C  C4    . DA  A  1  7   ? 40.344  44.841 -75.757 1.00 73.32  ? 7    DA  I C4    1 
ATOM   141   P  P     . DT  A  1  8   ? 44.433  42.233 -71.907 1.00 81.16  ? 8    DT  I P     1 
ATOM   142   O  OP1   . DT  A  1  8   ? 45.860  42.097 -71.527 1.00 82.26  ? 8    DT  I OP1   1 
ATOM   143   O  OP2   . DT  A  1  8   ? 43.390  41.503 -71.138 1.00 81.03  ? 8    DT  I OP2   1 
ATOM   144   O  "O5'" . DT  A  1  8   ? 44.085  43.782 -71.901 1.00 83.40  ? 8    DT  I "O5'" 1 
ATOM   145   C  "C5'" . DT  A  1  8   ? 44.806  44.673 -72.742 1.00 86.83  ? 8    DT  I "C5'" 1 
ATOM   146   C  "C4'" . DT  A  1  8   ? 44.476  46.100 -72.383 1.00 89.28  ? 8    DT  I "C4'" 1 
ATOM   147   O  "O4'" . DT  A  1  8   ? 43.202  46.485 -72.951 1.00 88.43  ? 8    DT  I "O4'" 1 
ATOM   148   C  "C3'" . DT  A  1  8   ? 44.367  46.337 -70.879 1.00 91.64  ? 8    DT  I "C3'" 1 
ATOM   149   O  "O3'" . DT  A  1  8   ? 45.006  47.568 -70.560 1.00 95.99  ? 8    DT  I "O3'" 1 
ATOM   150   C  "C2'" . DT  A  1  8   ? 42.866  46.391 -70.635 1.00 89.43  ? 8    DT  I "C2'" 1 
ATOM   151   C  "C1'" . DT  A  1  8   ? 42.345  46.980 -71.935 1.00 87.27  ? 8    DT  I "C1'" 1 
ATOM   152   N  N1    . DT  A  1  8   ? 40.963  46.607 -72.294 1.00 84.81  ? 8    DT  I N1    1 
ATOM   153   C  C2    . DT  A  1  8   ? 40.134  47.595 -72.783 1.00 83.84  ? 8    DT  I C2    1 
ATOM   154   O  O2    . DT  A  1  8   ? 40.486  48.755 -72.918 1.00 83.23  ? 8    DT  I O2    1 
ATOM   155   N  N3    . DT  A  1  8   ? 38.871  47.171 -73.113 1.00 83.42  ? 8    DT  I N3    1 
ATOM   156   C  C4    . DT  A  1  8   ? 38.365  45.888 -73.007 1.00 83.80  ? 8    DT  I C4    1 
ATOM   157   O  O4    . DT  A  1  8   ? 37.207  45.654 -73.353 1.00 83.25  ? 8    DT  I O4    1 
ATOM   158   C  C5    . DT  A  1  8   ? 39.286  44.904 -72.480 1.00 83.27  ? 8    DT  I C5    1 
ATOM   159   C  C7    . DT  A  1  8   ? 38.827  43.487 -72.331 1.00 83.03  ? 8    DT  I C7    1 
ATOM   160   C  C6    . DT  A  1  8   ? 40.521  45.309 -72.151 1.00 83.35  ? 8    DT  I C6    1 
ATOM   161   P  P     . DC  A  1  9   ? 45.076  48.060 -69.037 1.00 99.79  ? 9    DC  I P     1 
ATOM   162   O  OP1   . DC  A  1  9   ? 46.500  48.366 -68.726 1.00 98.83  ? 9    DC  I OP1   1 
ATOM   163   O  OP2   . DC  A  1  9   ? 44.318  47.115 -68.175 1.00 99.30  ? 9    DC  I OP2   1 
ATOM   164   O  "O5'" . DC  A  1  9   ? 44.279  49.430 -69.105 1.00 101.62 ? 9    DC  I "O5'" 1 
ATOM   165   C  "C5'" . DC  A  1  9   ? 44.434  50.294 -70.227 1.00 103.82 ? 9    DC  I "C5'" 1 
ATOM   166   C  "C4'" . DC  A  1  9   ? 43.407  51.396 -70.165 1.00 105.55 ? 9    DC  I "C4'" 1 
ATOM   167   O  "O4'" . DC  A  1  9   ? 42.119  50.903 -70.607 1.00 104.97 ? 9    DC  I "O4'" 1 
ATOM   168   C  "C3'" . DC  A  1  9   ? 43.205  51.910 -68.743 1.00 107.37 ? 9    DC  I "C3'" 1 
ATOM   169   O  "O3'" . DC  A  1  9   ? 43.120  53.332 -68.726 1.00 110.96 ? 9    DC  I "O3'" 1 
ATOM   170   C  "C2'" . DC  A  1  9   ? 41.902  51.264 -68.304 1.00 105.53 ? 9    DC  I "C2'" 1 
ATOM   171   C  "C1'" . DC  A  1  9   ? 41.138  51.132 -69.609 1.00 103.93 ? 9    DC  I "C1'" 1 
ATOM   172   N  N1    . DC  A  1  9   ? 40.184  50.012 -69.651 1.00 102.26 ? 9    DC  I N1    1 
ATOM   173   C  C2    . DC  A  1  9   ? 38.867  50.265 -70.044 1.00 101.26 ? 9    DC  I C2    1 
ATOM   174   O  O2    . DC  A  1  9   ? 38.542  51.423 -70.336 1.00 101.50 ? 9    DC  I O2    1 
ATOM   175   N  N3    . DC  A  1  9   ? 37.983  49.242 -70.095 1.00 100.24 ? 9    DC  I N3    1 
ATOM   176   C  C4    . DC  A  1  9   ? 38.372  48.009 -69.768 1.00 99.81  ? 9    DC  I C4    1 
ATOM   177   N  N4    . DC  A  1  9   ? 37.466  47.031 -69.833 1.00 98.91  ? 9    DC  I N4    1 
ATOM   178   C  C5    . DC  A  1  9   ? 39.707  47.723 -69.361 1.00 100.11 ? 9    DC  I C5    1 
ATOM   179   C  C6    . DC  A  1  9   ? 40.572  48.744 -69.317 1.00 101.30 ? 9    DC  I C6    1 
ATOM   180   P  P     . DC  A  1  10  ? 42.925  54.084 -67.328 1.00 113.36 ? 10   DC  I P     1 
ATOM   181   O  OP1   . DC  A  1  10  ? 43.253  55.516 -67.539 1.00 113.20 ? 10   DC  I OP1   1 
ATOM   182   O  OP2   . DC  A  1  10  ? 43.636  53.315 -66.274 1.00 112.99 ? 10   DC  I OP2   1 
ATOM   183   O  "O5'" . DC  A  1  10  ? 41.362  53.944 -67.085 1.00 114.85 ? 10   DC  I "O5'" 1 
ATOM   184   C  "C5'" . DC  A  1  10  ? 40.438  54.678 -67.881 1.00 118.13 ? 10   DC  I "C5'" 1 
ATOM   185   C  "C4'" . DC  A  1  10  ? 39.143  54.834 -67.127 1.00 120.50 ? 10   DC  I "C4'" 1 
ATOM   186   O  "O4'" . DC  A  1  10  ? 38.232  53.757 -67.453 1.00 120.36 ? 10   DC  I "O4'" 1 
ATOM   187   C  "C3'" . DC  A  1  10  ? 39.362  54.776 -65.615 1.00 122.28 ? 10   DC  I "C3'" 1 
ATOM   188   O  "O3'" . DC  A  1  10  ? 38.559  55.751 -64.952 1.00 124.68 ? 10   DC  I "O3'" 1 
ATOM   189   C  "C2'" . DC  A  1  10  ? 38.918  53.371 -65.255 1.00 121.88 ? 10   DC  I "C2'" 1 
ATOM   190   C  "C1'" . DC  A  1  10  ? 37.803  53.132 -66.258 1.00 121.11 ? 10   DC  I "C1'" 1 
ATOM   191   N  N1    . DC  A  1  10  ? 37.523  51.719 -66.552 1.00 120.98 ? 10   DC  I N1    1 
ATOM   192   C  C2    . DC  A  1  10  ? 36.289  51.381 -67.123 1.00 121.05 ? 10   DC  I C2    1 
ATOM   193   O  O2    . DC  A  1  10  ? 35.483  52.285 -67.395 1.00 120.75 ? 10   DC  I O2    1 
ATOM   194   N  N3    . DC  A  1  10  ? 36.007  50.081 -67.363 1.00 121.22 ? 10   DC  I N3    1 
ATOM   195   C  C4    . DC  A  1  10  ? 36.904  49.138 -67.062 1.00 121.58 ? 10   DC  I C4    1 
ATOM   196   N  N4    . DC  A  1  10  ? 36.578  47.866 -67.303 1.00 122.13 ? 10   DC  I N4    1 
ATOM   197   C  C5    . DC  A  1  10  ? 38.174  49.456 -66.497 1.00 121.32 ? 10   DC  I C5    1 
ATOM   198   C  C6    . DC  A  1  10  ? 38.439  50.746 -66.263 1.00 121.12 ? 10   DC  I C6    1 
ATOM   199   P  P     . DA  A  1  11  ? 39.265  56.901 -64.079 1.00 125.77 ? 11   DA  I P     1 
ATOM   200   O  OP1   . DA  A  1  11  ? 40.318  57.531 -64.919 1.00 125.08 ? 11   DA  I OP1   1 
ATOM   201   O  OP2   . DA  A  1  11  ? 39.626  56.340 -62.751 1.00 125.40 ? 11   DA  I OP2   1 
ATOM   202   O  "O5'" . DA  A  1  11  ? 38.091  57.954 -63.877 1.00 125.71 ? 11   DA  I "O5'" 1 
ATOM   203   C  "C5'" . DA  A  1  11  ? 37.299  58.372 -64.984 1.00 126.07 ? 11   DA  I "C5'" 1 
ATOM   204   C  "C4'" . DA  A  1  11  ? 35.864  57.945 -64.787 1.00 126.81 ? 11   DA  I "C4'" 1 
ATOM   205   O  "O4'" . DA  A  1  11  ? 35.717  56.522 -65.026 1.00 126.48 ? 11   DA  I "O4'" 1 
ATOM   206   C  "C3'" . DA  A  1  11  ? 35.322  58.198 -63.378 1.00 127.44 ? 11   DA  I "C3'" 1 
ATOM   207   O  "O3'" . DA  A  1  11  ? 33.978  58.676 -63.450 1.00 128.07 ? 11   DA  I "O3'" 1 
ATOM   208   C  "C2'" . DA  A  1  11  ? 35.337  56.819 -62.746 1.00 127.56 ? 11   DA  I "C2'" 1 
ATOM   209   C  "C1'" . DA  A  1  11  ? 35.015  55.941 -63.938 1.00 127.39 ? 11   DA  I "C1'" 1 
ATOM   210   N  N9    . DA  A  1  11  ? 35.444  54.549 -63.795 1.00 127.65 ? 11   DA  I N9    1 
ATOM   211   C  C8    . DA  A  1  11  ? 36.598  54.077 -63.219 1.00 127.91 ? 11   DA  I C8    1 
ATOM   212   N  N7    . DA  A  1  11  ? 36.692  52.768 -63.216 1.00 127.72 ? 11   DA  I N7    1 
ATOM   213   C  C5    . DA  A  1  11  ? 35.521  52.349 -63.833 1.00 127.43 ? 11   DA  I C5    1 
ATOM   214   C  C6    . DA  A  1  11  ? 35.012  51.070 -64.131 1.00 127.21 ? 11   DA  I C6    1 
ATOM   215   N  N6    . DA  A  1  11  ? 35.646  49.932 -63.834 1.00 127.14 ? 11   DA  I N6    1 
ATOM   216   N  N1    . DA  A  1  11  ? 33.813  51.000 -64.751 1.00 126.67 ? 11   DA  I N1    1 
ATOM   217   C  C2    . DA  A  1  11  ? 33.178  52.140 -65.047 1.00 126.35 ? 11   DA  I C2    1 
ATOM   218   N  N3    . DA  A  1  11  ? 33.551  53.398 -64.818 1.00 126.59 ? 11   DA  I N3    1 
ATOM   219   C  C4    . DA  A  1  11  ? 34.745  53.435 -64.201 1.00 127.36 ? 11   DA  I C4    1 
ATOM   220   P  P     . DC  A  1  12  ? 33.187  59.041 -62.100 1.00 127.89 ? 12   DC  I P     1 
ATOM   221   O  OP1   . DC  A  1  12  ? 32.713  60.439 -62.248 1.00 128.05 ? 12   DC  I OP1   1 
ATOM   222   O  OP2   . DC  A  1  12  ? 34.017  58.669 -60.926 1.00 127.45 ? 12   DC  I OP2   1 
ATOM   223   O  "O5'" . DC  A  1  12  ? 31.921  58.077 -62.151 1.00 127.57 ? 12   DC  I "O5'" 1 
ATOM   224   C  "C5'" . DC  A  1  12  ? 31.095  58.026 -63.311 1.00 127.21 ? 12   DC  I "C5'" 1 
ATOM   225   C  "C4'" . DC  A  1  12  ? 30.032  56.965 -63.149 1.00 127.49 ? 12   DC  I "C4'" 1 
ATOM   226   O  "O4'" . DC  A  1  12  ? 30.615  55.643 -63.275 1.00 127.28 ? 12   DC  I "O4'" 1 
ATOM   227   C  "C3'" . DC  A  1  12  ? 29.322  56.987 -61.794 1.00 127.83 ? 12   DC  I "C3'" 1 
ATOM   228   O  "O3'" . DC  A  1  12  ? 27.925  56.735 -61.964 1.00 128.97 ? 12   DC  I "O3'" 1 
ATOM   229   C  "C2'" . DC  A  1  12  ? 29.961  55.832 -61.046 1.00 127.31 ? 12   DC  I "C2'" 1 
ATOM   230   C  "C1'" . DC  A  1  12  ? 30.201  54.849 -62.173 1.00 126.48 ? 12   DC  I "C1'" 1 
ATOM   231   N  N1    . DC  A  1  12  ? 31.235  53.835 -61.908 1.00 125.27 ? 12   DC  I N1    1 
ATOM   232   C  C2    . DC  A  1  12  ? 30.939  52.494 -62.168 1.00 124.38 ? 12   DC  I C2    1 
ATOM   233   O  O2    . DC  A  1  12  ? 29.826  52.206 -62.631 1.00 124.38 ? 12   DC  I O2    1 
ATOM   234   N  N3    . DC  A  1  12  ? 31.868  51.548 -61.909 1.00 123.55 ? 12   DC  I N3    1 
ATOM   235   C  C4    . DC  A  1  12  ? 33.053  51.898 -61.410 1.00 123.32 ? 12   DC  I C4    1 
ATOM   236   N  N4    . DC  A  1  12  ? 33.935  50.930 -61.159 1.00 122.82 ? 12   DC  I N4    1 
ATOM   237   C  C5    . DC  A  1  12  ? 33.387  53.258 -61.143 1.00 123.76 ? 12   DC  I C5    1 
ATOM   238   C  C6    . DC  A  1  12  ? 32.458  54.186 -61.407 1.00 124.60 ? 12   DC  I C6    1 
ATOM   239   P  P     . DC  A  1  13  ? 26.998  56.504 -60.675 1.00 129.39 ? 13   DC  I P     1 
ATOM   240   O  OP1   . DC  A  1  13  ? 25.603  56.829 -61.064 1.00 129.93 ? 13   DC  I OP1   1 
ATOM   241   O  OP2   . DC  A  1  13  ? 27.623  57.203 -59.523 1.00 129.02 ? 13   DC  I OP2   1 
ATOM   242   O  "O5'" . DC  A  1  13  ? 27.080  54.933 -60.425 1.00 129.69 ? 13   DC  I "O5'" 1 
ATOM   243   C  "C5'" . DC  A  1  13  ? 26.390  54.026 -61.281 1.00 130.55 ? 13   DC  I "C5'" 1 
ATOM   244   C  "C4'" . DC  A  1  13  ? 26.099  52.738 -60.549 1.00 131.40 ? 13   DC  I "C4'" 1 
ATOM   245   O  "O4'" . DC  A  1  13  ? 27.320  51.976 -60.382 1.00 131.32 ? 13   DC  I "O4'" 1 
ATOM   246   C  "C3'" . DC  A  1  13  ? 25.521  52.927 -59.145 1.00 131.95 ? 13   DC  I "C3'" 1 
ATOM   247   O  "O3'" . DC  A  1  13  ? 24.514  51.943 -58.887 1.00 133.13 ? 13   DC  I "O3'" 1 
ATOM   248   C  "C2'" . DC  A  1  13  ? 26.719  52.703 -58.242 1.00 131.62 ? 13   DC  I "C2'" 1 
ATOM   249   C  "C1'" . DC  A  1  13  ? 27.494  51.649 -59.012 1.00 130.98 ? 13   DC  I "C1'" 1 
ATOM   250   N  N1    . DC  A  1  13  ? 28.939  51.609 -58.729 1.00 130.14 ? 13   DC  I N1    1 
ATOM   251   C  C2    . DC  A  1  13  ? 29.594  50.374 -58.765 1.00 129.51 ? 13   DC  I C2    1 
ATOM   252   O  O2    . DC  A  1  13  ? 28.941  49.357 -59.046 1.00 129.18 ? 13   DC  I O2    1 
ATOM   253   N  N3    . DC  A  1  13  ? 30.918  50.319 -58.497 1.00 128.91 ? 13   DC  I N3    1 
ATOM   254   C  C4    . DC  A  1  13  ? 31.585  51.436 -58.203 1.00 128.93 ? 13   DC  I C4    1 
ATOM   255   N  N4    . DC  A  1  13  ? 32.889  51.334 -57.944 1.00 128.75 ? 13   DC  I N4    1 
ATOM   256   C  C5    . DC  A  1  13  ? 30.944  52.708 -58.162 1.00 129.33 ? 13   DC  I C5    1 
ATOM   257   C  C6    . DC  A  1  13  ? 29.632  52.748 -58.429 1.00 129.73 ? 13   DC  I C6    1 
ATOM   258   P  P     . DT  A  1  14  ? 23.784  51.906 -57.453 1.00 133.91 ? 14   DT  I P     1 
ATOM   259   O  OP1   . DT  A  1  14  ? 22.348  51.602 -57.685 1.00 133.78 ? 14   DT  I OP1   1 
ATOM   260   O  OP2   . DT  A  1  14  ? 24.163  53.129 -56.694 1.00 133.33 ? 14   DT  I OP2   1 
ATOM   261   O  "O5'" . DT  A  1  14  ? 24.434  50.641 -56.734 1.00 133.87 ? 14   DT  I "O5'" 1 
ATOM   262   C  "C5'" . DT  A  1  14  ? 24.292  49.334 -57.290 1.00 133.39 ? 14   DT  I "C5'" 1 
ATOM   263   C  "C4'" . DT  A  1  14  ? 24.837  48.299 -56.335 1.00 133.00 ? 14   DT  I "C4'" 1 
ATOM   264   O  "O4'" . DT  A  1  14  ? 26.278  48.418 -56.250 1.00 132.82 ? 14   DT  I "O4'" 1 
ATOM   265   C  "C3'" . DT  A  1  14  ? 24.315  48.433 -54.904 1.00 132.94 ? 14   DT  I "C3'" 1 
ATOM   266   O  "O3'" . DT  A  1  14  ? 24.134  47.135 -54.332 1.00 132.59 ? 14   DT  I "O3'" 1 
ATOM   267   C  "C2'" . DT  A  1  14  ? 25.438  49.168 -54.194 1.00 132.86 ? 14   DT  I "C2'" 1 
ATOM   268   C  "C1'" . DT  A  1  14  ? 26.667  48.617 -54.899 1.00 132.57 ? 14   DT  I "C1'" 1 
ATOM   269   N  N1    . DT  A  1  14  ? 27.854  49.498 -54.891 1.00 131.73 ? 14   DT  I N1    1 
ATOM   270   C  C2    . DT  A  1  14  ? 29.079  48.919 -55.127 1.00 131.33 ? 14   DT  I C2    1 
ATOM   271   O  O2    . DT  A  1  14  ? 29.222  47.726 -55.339 1.00 131.10 ? 14   DT  I O2    1 
ATOM   272   N  N3    . DT  A  1  14  ? 30.139  49.790 -55.104 1.00 131.23 ? 14   DT  I N3    1 
ATOM   273   C  C4    . DT  A  1  14  ? 30.097  51.151 -54.874 1.00 131.56 ? 14   DT  I C4    1 
ATOM   274   O  O4    . DT  A  1  14  ? 31.137  51.807 -54.889 1.00 131.51 ? 14   DT  I O4    1 
ATOM   275   C  C5    . DT  A  1  14  ? 28.779  51.694 -54.630 1.00 131.55 ? 14   DT  I C5    1 
ATOM   276   C  C7    . DT  A  1  14  ? 28.635  53.159 -54.363 1.00 131.63 ? 14   DT  I C7    1 
ATOM   277   C  C6    . DT  A  1  14  ? 27.738  50.852 -54.652 1.00 131.50 ? 14   DT  I C6    1 
ATOM   278   P  P     . DG  A  1  15  ? 22.770  46.784 -53.558 1.00 132.43 ? 15   DG  I P     1 
ATOM   279   O  OP1   . DG  A  1  15  ? 21.689  46.714 -54.575 1.00 132.18 ? 15   DG  I OP1   1 
ATOM   280   O  OP2   . DG  A  1  15  ? 22.627  47.701 -52.397 1.00 132.15 ? 15   DG  I OP2   1 
ATOM   281   O  "O5'" . DG  A  1  15  ? 23.029  45.313 -53.007 1.00 131.17 ? 15   DG  I "O5'" 1 
ATOM   282   C  "C5'" . DG  A  1  15  ? 23.321  44.241 -53.901 1.00 129.48 ? 15   DG  I "C5'" 1 
ATOM   283   C  "C4'" . DG  A  1  15  ? 24.468  43.411 -53.370 1.00 128.32 ? 15   DG  I "C4'" 1 
ATOM   284   O  "O4'" . DG  A  1  15  ? 25.682  44.201 -53.375 1.00 128.11 ? 15   DG  I "O4'" 1 
ATOM   285   C  "C3'" . DG  A  1  15  ? 24.297  42.910 -51.936 1.00 127.62 ? 15   DG  I "C3'" 1 
ATOM   286   O  "O3'" . DG  A  1  15  ? 24.831  41.588 -51.814 1.00 126.07 ? 15   DG  I "O3'" 1 
ATOM   287   C  "C2'" . DG  A  1  15  ? 25.119  43.892 -51.121 1.00 127.69 ? 15   DG  I "C2'" 1 
ATOM   288   C  "C1'" . DG  A  1  15  ? 26.252  44.227 -52.073 1.00 127.61 ? 15   DG  I "C1'" 1 
ATOM   289   N  N9    . DG  A  1  15  ? 26.841  45.547 -51.868 1.00 127.20 ? 15   DG  I N9    1 
ATOM   290   C  C8    . DG  A  1  15  ? 26.171  46.734 -51.689 1.00 127.18 ? 15   DG  I C8    1 
ATOM   291   N  N7    . DG  A  1  15  ? 26.970  47.756 -51.540 1.00 127.00 ? 15   DG  I N7    1 
ATOM   292   C  C5    . DG  A  1  15  ? 28.244  47.213 -51.625 1.00 126.74 ? 15   DG  I C5    1 
ATOM   293   C  C6    . DG  A  1  15  ? 29.516  47.837 -51.543 1.00 126.17 ? 15   DG  I C6    1 
ATOM   294   O  O6    . DG  A  1  15  ? 29.778  49.035 -51.383 1.00 125.35 ? 15   DG  I O6    1 
ATOM   295   N  N1    . DG  A  1  15  ? 30.548  46.912 -51.672 1.00 126.00 ? 15   DG  I N1    1 
ATOM   296   C  C2    . DG  A  1  15  ? 30.380  45.561 -51.861 1.00 126.19 ? 15   DG  I C2    1 
ATOM   297   N  N2    . DG  A  1  15  ? 31.502  44.831 -51.957 1.00 125.74 ? 15   DG  I N2    1 
ATOM   298   N  N3    . DG  A  1  15  ? 29.200  44.968 -51.947 1.00 126.31 ? 15   DG  I N3    1 
ATOM   299   C  C4    . DG  A  1  15  ? 28.183  45.848 -51.821 1.00 126.93 ? 15   DG  I C4    1 
ATOM   300   P  P     . DC  A  1  16  ? 24.858  40.872 -50.378 1.00 125.34 ? 16   DC  I P     1 
ATOM   301   O  OP1   . DC  A  1  16  ? 24.869  39.406 -50.609 1.00 125.20 ? 16   DC  I OP1   1 
ATOM   302   O  OP2   . DC  A  1  16  ? 23.797  41.477 -49.530 1.00 125.27 ? 16   DC  I OP2   1 
ATOM   303   O  "O5'" . DC  A  1  16  ? 26.272  41.288 -49.775 1.00 124.53 ? 16   DC  I "O5'" 1 
ATOM   304   C  "C5'" . DC  A  1  16  ? 27.477  40.731 -50.295 1.00 122.27 ? 16   DC  I "C5'" 1 
ATOM   305   C  "C4'" . DC  A  1  16  ? 28.625  40.997 -49.350 1.00 120.54 ? 16   DC  I "C4'" 1 
ATOM   306   O  "O4'" . DC  A  1  16  ? 28.980  42.401 -49.379 1.00 120.21 ? 16   DC  I "O4'" 1 
ATOM   307   C  "C3'" . DC  A  1  16  ? 28.329  40.666 -47.886 1.00 119.53 ? 16   DC  I "C3'" 1 
ATOM   308   O  "O3'" . DC  A  1  16  ? 29.497  40.121 -47.278 1.00 118.28 ? 16   DC  I "O3'" 1 
ATOM   309   C  "C2'" . DC  A  1  16  ? 28.029  42.024 -47.279 1.00 119.80 ? 16   DC  I "C2'" 1 
ATOM   310   C  "C1'" . DC  A  1  16  ? 28.974  42.917 -48.058 1.00 119.91 ? 16   DC  I "C1'" 1 
ATOM   311   N  N1    . DC  A  1  16  ? 28.594  44.337 -48.122 1.00 119.81 ? 16   DC  I N1    1 
ATOM   312   C  C2    . DC  A  1  16  ? 29.599  45.299 -48.010 1.00 119.97 ? 16   DC  I C2    1 
ATOM   313   O  O2    . DC  A  1  16  ? 30.770  44.924 -47.868 1.00 120.29 ? 16   DC  I O2    1 
ATOM   314   N  N3    . DC  A  1  16  ? 29.271  46.610 -48.060 1.00 119.81 ? 16   DC  I N3    1 
ATOM   315   C  C4    . DC  A  1  16  ? 27.998  46.972 -48.219 1.00 119.68 ? 16   DC  I C4    1 
ATOM   316   N  N4    . DC  A  1  16  ? 27.721  48.277 -48.265 1.00 119.40 ? 16   DC  I N4    1 
ATOM   317   C  C5    . DC  A  1  16  ? 26.951  46.012 -48.338 1.00 119.83 ? 16   DC  I C5    1 
ATOM   318   C  C6    . DC  A  1  16  ? 27.291  44.717 -48.285 1.00 119.76 ? 16   DC  I C6    1 
ATOM   319   P  P     . DA  A  1  17  ? 29.398  38.752 -46.448 1.00 117.67 ? 17   DA  I P     1 
ATOM   320   O  OP1   . DA  A  1  17  ? 28.761  37.737 -47.324 1.00 117.87 ? 17   DA  I OP1   1 
ATOM   321   O  OP2   . DA  A  1  17  ? 28.811  39.048 -45.116 1.00 117.69 ? 17   DA  I OP2   1 
ATOM   322   O  "O5'" . DA  A  1  17  ? 30.921  38.339 -46.253 1.00 116.72 ? 17   DA  I "O5'" 1 
ATOM   323   C  "C5'" . DA  A  1  17  ? 31.832  38.402 -47.347 1.00 114.72 ? 17   DA  I "C5'" 1 
ATOM   324   C  "C4'" . DA  A  1  17  ? 32.973  39.339 -47.023 1.00 113.23 ? 17   DA  I "C4'" 1 
ATOM   325   O  "O4'" . DA  A  1  17  ? 32.483  40.701 -46.929 1.00 112.95 ? 17   DA  I "O4'" 1 
ATOM   326   C  "C3'" . DA  A  1  17  ? 33.672  39.049 -45.695 1.00 112.17 ? 17   DA  I "C3'" 1 
ATOM   327   O  "O3'" . DA  A  1  17  ? 35.081  39.246 -45.833 1.00 110.20 ? 17   DA  I "O3'" 1 
ATOM   328   C  "C2'" . DA  A  1  17  ? 33.077  40.077 -44.750 1.00 112.17 ? 17   DA  I "C2'" 1 
ATOM   329   C  "C1'" . DA  A  1  17  ? 32.832  41.260 -45.670 1.00 112.37 ? 17   DA  I "C1'" 1 
ATOM   330   N  N9    . DA  A  1  17  ? 31.740  42.136 -45.245 1.00 112.21 ? 17   DA  I N9    1 
ATOM   331   C  C8    . DA  A  1  17  ? 30.509  41.772 -44.759 1.00 112.07 ? 17   DA  I C8    1 
ATOM   332   N  N7    . DA  A  1  17  ? 29.737  42.787 -44.458 1.00 112.34 ? 17   DA  I N7    1 
ATOM   333   C  C5    . DA  A  1  17  ? 30.510  43.897 -44.767 1.00 112.18 ? 17   DA  I C5    1 
ATOM   334   C  C6    . DA  A  1  17  ? 30.263  45.281 -44.673 1.00 112.09 ? 17   DA  I C6    1 
ATOM   335   N  N6    . DA  A  1  17  ? 29.118  45.801 -44.224 1.00 111.99 ? 17   DA  I N6    1 
ATOM   336   N  N1    . DA  A  1  17  ? 31.246  46.122 -45.061 1.00 111.65 ? 17   DA  I N1    1 
ATOM   337   C  C2    . DA  A  1  17  ? 32.394  45.600 -45.510 1.00 112.20 ? 17   DA  I C2    1 
ATOM   338   N  N3    . DA  A  1  17  ? 32.745  44.321 -45.646 1.00 112.03 ? 17   DA  I N3    1 
ATOM   339   C  C4    . DA  A  1  17  ? 31.747  43.511 -45.252 1.00 112.16 ? 17   DA  I C4    1 
ATOM   340   P  P     . DG  A  1  18  ? 36.073  38.768 -44.662 1.00 108.89 ? 18   DG  I P     1 
ATOM   341   O  OP1   . DG  A  1  18  ? 37.075  37.855 -45.271 1.00 108.28 ? 18   DG  I OP1   1 
ATOM   342   O  OP2   . DG  A  1  18  ? 35.266  38.309 -43.501 1.00 108.57 ? 18   DG  I OP2   1 
ATOM   343   O  "O5'" . DG  A  1  18  ? 36.815  40.112 -44.251 1.00 105.57 ? 18   DG  I "O5'" 1 
ATOM   344   C  "C5'" . DG  A  1  18  ? 37.272  41.006 -45.253 1.00 101.32 ? 18   DG  I "C5'" 1 
ATOM   345   C  "C4'" . DG  A  1  18  ? 37.409  42.399 -44.688 1.00 98.53  ? 18   DG  I "C4'" 1 
ATOM   346   O  "O4'" . DG  A  1  18  ? 36.103  42.968 -44.422 1.00 97.97  ? 18   DG  I "O4'" 1 
ATOM   347   C  "C3'" . DG  A  1  18  ? 38.190  42.488 -43.377 1.00 96.72  ? 18   DG  I "C3'" 1 
ATOM   348   O  "O3'" . DG  A  1  18  ? 39.072  43.609 -43.441 1.00 93.89  ? 18   DG  I "O3'" 1 
ATOM   349   C  "C2'" . DG  A  1  18  ? 37.107  42.696 -42.331 1.00 96.51  ? 18   DG  I "C2'" 1 
ATOM   350   C  "C1'" . DG  A  1  18  ? 36.064  43.485 -43.100 1.00 97.00  ? 18   DG  I "C1'" 1 
ATOM   351   N  N9    . DG  A  1  18  ? 34.697  43.350 -42.601 1.00 96.99  ? 18   DG  I N9    1 
ATOM   352   C  C8    . DG  A  1  18  ? 34.058  42.188 -42.236 1.00 96.97  ? 18   DG  I C8    1 
ATOM   353   N  N7    . DG  A  1  18  ? 32.830  42.381 -41.836 1.00 96.45  ? 18   DG  I N7    1 
ATOM   354   C  C5    . DG  A  1  18  ? 32.645  43.753 -41.942 1.00 96.37  ? 18   DG  I C5    1 
ATOM   355   C  C6    . DG  A  1  18  ? 31.507  44.551 -41.657 1.00 96.35  ? 18   DG  I C6    1 
ATOM   356   O  O6    . DG  A  1  18  ? 30.398  44.191 -41.247 1.00 97.03  ? 18   DG  I O6    1 
ATOM   357   N  N1    . DG  A  1  18  ? 31.750  45.897 -41.902 1.00 95.83  ? 18   DG  I N1    1 
ATOM   358   C  C2    . DG  A  1  18  ? 32.933  46.413 -42.368 1.00 95.76  ? 18   DG  I C2    1 
ATOM   359   N  N2    . DG  A  1  18  ? 32.968  47.743 -42.540 1.00 95.44  ? 18   DG  I N2    1 
ATOM   360   N  N3    . DG  A  1  18  ? 34.001  45.680 -42.644 1.00 95.78  ? 18   DG  I N3    1 
ATOM   361   C  C4    . DG  A  1  18  ? 33.788  44.368 -42.409 1.00 96.25  ? 18   DG  I C4    1 
ATOM   362   P  P     . DA  A  1  19  ? 39.978  43.991 -42.175 1.00 91.19  ? 19   DA  I P     1 
ATOM   363   O  OP1   . DA  A  1  19  ? 41.351  44.228 -42.687 1.00 91.23  ? 19   DA  I OP1   1 
ATOM   364   O  OP2   . DA  A  1  19  ? 39.757  43.002 -41.093 1.00 91.18  ? 19   DA  I OP2   1 
ATOM   365   O  "O5'" . DA  A  1  19  ? 39.367  45.387 -41.724 1.00 92.52  ? 19   DA  I "O5'" 1 
ATOM   366   C  "C5'" . DA  A  1  19  ? 39.042  46.369 -42.702 1.00 95.26  ? 19   DA  I "C5'" 1 
ATOM   367   C  "C4'" . DA  A  1  19  ? 38.325  47.535 -42.066 1.00 97.33  ? 19   DA  I "C4'" 1 
ATOM   368   O  "O4'" . DA  A  1  19  ? 36.971  47.173 -41.701 1.00 97.13  ? 19   DA  I "O4'" 1 
ATOM   369   C  "C3'" . DA  A  1  19  ? 38.978  48.077 -40.798 1.00 98.75  ? 19   DA  I "C3'" 1 
ATOM   370   O  "O3'" . DA  A  1  19  ? 38.943  49.500 -40.841 1.00 102.10 ? 19   DA  I "O3'" 1 
ATOM   371   C  "C2'" . DA  A  1  19  ? 38.090  47.541 -39.686 1.00 97.74  ? 19   DA  I "C2'" 1 
ATOM   372   C  "C1'" . DA  A  1  19  ? 36.729  47.536 -40.353 1.00 97.66  ? 19   DA  I "C1'" 1 
ATOM   373   N  N9    . DA  A  1  19  ? 35.758  46.588 -39.802 1.00 98.38  ? 19   DA  I N9    1 
ATOM   374   C  C8    . DA  A  1  19  ? 35.924  45.249 -39.542 1.00 98.69  ? 19   DA  I C8    1 
ATOM   375   N  N7    . DA  A  1  19  ? 34.848  44.664 -39.072 1.00 98.34  ? 19   DA  I N7    1 
ATOM   376   C  C5    . DA  A  1  19  ? 33.912  45.688 -39.012 1.00 99.08  ? 19   DA  I C5    1 
ATOM   377   C  C6    . DA  A  1  19  ? 32.562  45.719 -38.603 1.00 99.52  ? 19   DA  I C6    1 
ATOM   378   N  N6    . DA  A  1  19  ? 31.892  44.648 -38.166 1.00 99.07  ? 19   DA  I N6    1 
ATOM   379   N  N1    . DA  A  1  19  ? 31.915  46.904 -38.664 1.00 98.90  ? 19   DA  I N1    1 
ATOM   380   C  C2    . DA  A  1  19  ? 32.581  47.975 -39.112 1.00 98.84  ? 19   DA  I C2    1 
ATOM   381   N  N3    . DA  A  1  19  ? 33.843  48.072 -39.528 1.00 99.10  ? 19   DA  I N3    1 
ATOM   382   C  C4    . DA  A  1  19  ? 34.461  46.880 -39.452 1.00 98.83  ? 19   DA  I C4    1 
ATOM   383   P  P     . DT  A  1  20  ? 39.564  50.349 -39.634 1.00 104.94 ? 20   DT  I P     1 
ATOM   384   O  OP1   . DT  A  1  20  ? 40.273  51.516 -40.211 1.00 105.04 ? 20   DT  I OP1   1 
ATOM   385   O  OP2   . DT  A  1  20  ? 40.293  49.412 -38.744 1.00 104.65 ? 20   DT  I OP2   1 
ATOM   386   O  "O5'" . DT  A  1  20  ? 38.268  50.889 -38.887 1.00 107.98 ? 20   DT  I "O5'" 1 
ATOM   387   C  "C5'" . DT  A  1  20  ? 37.275  51.602 -39.617 1.00 112.72 ? 20   DT  I "C5'" 1 
ATOM   388   C  "C4'" . DT  A  1  20  ? 36.154  52.033 -38.703 1.00 116.32 ? 20   DT  I "C4'" 1 
ATOM   389   O  "O4'" . DT  A  1  20  ? 35.323  50.900 -38.352 1.00 116.64 ? 20   DT  I "O4'" 1 
ATOM   390   C  "C3'" . DT  A  1  20  ? 36.605  52.661 -37.385 1.00 118.77 ? 20   DT  I "C3'" 1 
ATOM   391   O  "O3'" . DT  A  1  20  ? 35.801  53.810 -37.111 1.00 122.68 ? 20   DT  I "O3'" 1 
ATOM   392   C  "C2'" . DT  A  1  20  ? 36.355  51.562 -36.365 1.00 118.09 ? 20   DT  I "C2'" 1 
ATOM   393   C  "C1'" . DT  A  1  20  ? 35.142  50.864 -36.948 1.00 117.34 ? 20   DT  I "C1'" 1 
ATOM   394   N  N1    . DT  A  1  20  ? 34.968  49.454 -36.547 1.00 117.33 ? 20   DT  I N1    1 
ATOM   395   C  C2    . DT  A  1  20  ? 33.697  49.029 -36.225 1.00 117.65 ? 20   DT  I C2    1 
ATOM   396   O  O2    . DT  A  1  20  ? 32.721  49.763 -36.253 1.00 118.15 ? 20   DT  I O2    1 
ATOM   397   N  N3    . DT  A  1  20  ? 33.608  47.706 -35.869 1.00 117.31 ? 20   DT  I N3    1 
ATOM   398   C  C4    . DT  A  1  20  ? 34.637  46.787 -35.804 1.00 117.13 ? 20   DT  I C4    1 
ATOM   399   O  O4    . DT  A  1  20  ? 34.402  45.629 -35.470 1.00 116.60 ? 20   DT  I O4    1 
ATOM   400   C  C5    . DT  A  1  20  ? 35.944  47.301 -36.152 1.00 117.31 ? 20   DT  I C5    1 
ATOM   401   C  C7    . DT  A  1  20  ? 37.121  46.378 -36.108 1.00 117.07 ? 20   DT  I C7    1 
ATOM   402   C  C6    . DT  A  1  20  ? 36.043  48.591 -36.501 1.00 117.34 ? 20   DT  I C6    1 
ATOM   403   P  P     . DT  A  1  21  ? 35.974  54.594 -35.723 1.00 125.92 ? 21   DT  I P     1 
ATOM   404   O  OP1   . DT  A  1  21  ? 35.828  56.047 -35.993 1.00 125.63 ? 21   DT  I OP1   1 
ATOM   405   O  OP2   . DT  A  1  21  ? 37.205  54.092 -35.060 1.00 125.91 ? 21   DT  I OP2   1 
ATOM   406   O  "O5'" . DT  A  1  21  ? 34.713  54.104 -34.886 1.00 128.25 ? 21   DT  I "O5'" 1 
ATOM   407   C  "C5'" . DT  A  1  21  ? 33.398  54.227 -35.425 1.00 132.49 ? 21   DT  I "C5'" 1 
ATOM   408   C  "C4'" . DT  A  1  21  ? 32.369  53.876 -34.378 1.00 135.66 ? 21   DT  I "C4'" 1 
ATOM   409   O  "O4'" . DT  A  1  21  ? 32.296  52.439 -34.210 1.00 135.91 ? 21   DT  I "O4'" 1 
ATOM   410   C  "C3'" . DT  A  1  21  ? 32.674  54.455 -32.997 1.00 137.93 ? 21   DT  I "C3'" 1 
ATOM   411   O  "O3'" . DT  A  1  21  ? 31.468  54.928 -32.382 1.00 141.59 ? 21   DT  I "O3'" 1 
ATOM   412   C  "C2'" . DT  A  1  21  ? 33.255  53.269 -32.247 1.00 137.30 ? 21   DT  I "C2'" 1 
ATOM   413   C  "C1'" . DT  A  1  21  ? 32.489  52.103 -32.847 1.00 136.37 ? 21   DT  I "C1'" 1 
ATOM   414   N  N1    . DT  A  1  21  ? 33.182  50.798 -32.793 1.00 136.42 ? 21   DT  I N1    1 
ATOM   415   C  C2    . DT  A  1  21  ? 32.407  49.658 -32.765 1.00 136.37 ? 21   DT  I C2    1 
ATOM   416   O  O2    . DT  A  1  21  ? 31.187  49.680 -32.787 1.00 136.30 ? 21   DT  I O2    1 
ATOM   417   N  N3    . DT  A  1  21  ? 33.117  48.484 -32.712 1.00 136.38 ? 21   DT  I N3    1 
ATOM   418   C  C4    . DT  A  1  21  ? 34.491  48.338 -32.685 1.00 136.59 ? 21   DT  I C4    1 
ATOM   419   O  O4    . DT  A  1  21  ? 34.984  47.215 -32.632 1.00 136.82 ? 21   DT  I O4    1 
ATOM   420   C  C5    . DT  A  1  21  ? 35.243  49.575 -32.719 1.00 136.51 ? 21   DT  I C5    1 
ATOM   421   C  C7    . DT  A  1  21  ? 36.738  49.517 -32.696 1.00 136.17 ? 21   DT  I C7    1 
ATOM   422   C  C6    . DT  A  1  21  ? 34.559  50.726 -32.770 1.00 136.54 ? 21   DT  I C6    1 
ATOM   423   P  P     . DC  A  1  22  ? 31.497  56.265 -31.483 1.00 144.25 ? 22   DC  I P     1 
ATOM   424   O  OP1   . DC  A  1  22  ? 30.171  56.927 -31.592 1.00 144.55 ? 22   DC  I OP1   1 
ATOM   425   O  OP2   . DC  A  1  22  ? 32.727  57.021 -31.838 1.00 143.98 ? 22   DC  I OP2   1 
ATOM   426   O  "O5'" . DC  A  1  22  ? 31.658  55.709 -30.000 1.00 145.67 ? 22   DC  I "O5'" 1 
ATOM   427   C  "C5'" . DC  A  1  22  ? 31.884  54.321 -29.787 1.00 148.24 ? 22   DC  I "C5'" 1 
ATOM   428   C  "C4'" . DC  A  1  22  ? 31.004  53.797 -28.679 1.00 150.05 ? 22   DC  I "C4'" 1 
ATOM   429   O  "O4'" . DC  A  1  22  ? 30.863  52.370 -28.851 1.00 150.42 ? 22   DC  I "O4'" 1 
ATOM   430   C  "C3'" . DC  A  1  22  ? 31.579  53.992 -27.279 1.00 151.35 ? 22   DC  I "C3'" 1 
ATOM   431   O  "O3'" . DC  A  1  22  ? 30.515  54.106 -26.328 1.00 153.14 ? 22   DC  I "O3'" 1 
ATOM   432   C  "C2'" . DC  A  1  22  ? 32.352  52.706 -27.059 1.00 151.32 ? 22   DC  I "C2'" 1 
ATOM   433   C  "C1'" . DC  A  1  22  ? 31.481  51.684 -27.773 1.00 150.98 ? 22   DC  I "C1'" 1 
ATOM   434   N  N1    . DC  A  1  22  ? 32.213  50.540 -28.338 1.00 151.08 ? 22   DC  I N1    1 
ATOM   435   C  C2    . DC  A  1  22  ? 31.483  49.438 -28.788 1.00 150.96 ? 22   DC  I C2    1 
ATOM   436   O  O2    . DC  A  1  22  ? 30.244  49.463 -28.701 1.00 150.71 ? 22   DC  I O2    1 
ATOM   437   N  N3    . DC  A  1  22  ? 32.143  48.376 -29.307 1.00 150.96 ? 22   DC  I N3    1 
ATOM   438   C  C4    . DC  A  1  22  ? 33.477  48.393 -29.384 1.00 150.77 ? 22   DC  I C4    1 
ATOM   439   N  N4    . DC  A  1  22  ? 34.088  47.325 -29.902 1.00 150.43 ? 22   DC  I N4    1 
ATOM   440   C  C5    . DC  A  1  22  ? 34.244  49.505 -28.935 1.00 150.77 ? 22   DC  I C5    1 
ATOM   441   C  C6    . DC  A  1  22  ? 33.578  50.548 -28.424 1.00 150.95 ? 22   DC  I C6    1 
ATOM   442   P  P     . DT  A  1  23  ? 30.854  54.194 -24.760 1.00 154.07 ? 23   DT  I P     1 
ATOM   443   O  OP1   . DT  A  1  23  ? 31.418  55.539 -24.479 1.00 154.08 ? 23   DT  I OP1   1 
ATOM   444   O  OP2   . DT  A  1  23  ? 31.629  52.983 -24.389 1.00 154.06 ? 23   DT  I OP2   1 
ATOM   445   O  "O5'" . DT  A  1  23  ? 29.431  54.090 -24.051 1.00 154.61 ? 23   DT  I "O5'" 1 
ATOM   446   C  "C5'" . DT  A  1  23  ? 28.381  53.292 -24.601 1.00 155.51 ? 23   DT  I "C5'" 1 
ATOM   447   C  "C4'" . DT  A  1  23  ? 28.198  52.035 -23.781 1.00 156.39 ? 23   DT  I "C4'" 1 
ATOM   448   O  "O4'" . DT  A  1  23  ? 28.862  50.906 -24.406 1.00 156.58 ? 23   DT  I "O4'" 1 
ATOM   449   C  "C3'" . DT  A  1  23  ? 28.763  52.118 -22.358 1.00 156.91 ? 23   DT  I "C3'" 1 
ATOM   450   O  "O3'" . DT  A  1  23  ? 27.928  51.413 -21.434 1.00 157.45 ? 23   DT  I "O3'" 1 
ATOM   451   C  "C2'" . DT  A  1  23  ? 30.068  51.356 -22.474 1.00 157.08 ? 23   DT  I "C2'" 1 
ATOM   452   C  "C1'" . DT  A  1  23  ? 29.631  50.253 -23.411 1.00 156.73 ? 23   DT  I "C1'" 1 
ATOM   453   N  N1    . DT  A  1  23  ? 30.715  49.494 -24.057 1.00 156.51 ? 23   DT  I N1    1 
ATOM   454   C  C2    . DT  A  1  23  ? 30.492  48.158 -24.299 1.00 156.40 ? 23   DT  I C2    1 
ATOM   455   O  O2    . DT  A  1  23  ? 29.436  47.602 -24.041 1.00 156.24 ? 23   DT  I O2    1 
ATOM   456   N  N3    . DT  A  1  23  ? 31.554  47.494 -24.856 1.00 156.44 ? 23   DT  I N3    1 
ATOM   457   C  C4    . DT  A  1  23  ? 32.787  48.022 -25.190 1.00 156.41 ? 23   DT  I C4    1 
ATOM   458   O  O4    . DT  A  1  23  ? 33.653  47.296 -25.672 1.00 156.50 ? 23   DT  I O4    1 
ATOM   459   C  C5    . DT  A  1  23  ? 32.945  49.434 -24.924 1.00 156.22 ? 23   DT  I C5    1 
ATOM   460   C  C7    . DT  A  1  23  ? 34.245  50.094 -25.258 1.00 155.96 ? 23   DT  I C7    1 
ATOM   461   C  C6    . DT  A  1  23  ? 31.913  50.091 -24.383 1.00 156.28 ? 23   DT  I C6    1 
ATOM   462   P  P     . DA  A  1  24  ? 28.474  51.096 -19.952 1.00 157.62 ? 24   DA  I P     1 
ATOM   463   O  OP1   . DA  A  1  24  ? 27.314  50.740 -19.098 1.00 157.65 ? 24   DA  I OP1   1 
ATOM   464   O  OP2   . DA  A  1  24  ? 29.353  52.230 -19.564 1.00 157.50 ? 24   DA  I OP2   1 
ATOM   465   O  "O5'" . DA  A  1  24  ? 29.387  49.796 -20.121 1.00 157.35 ? 24   DA  I "O5'" 1 
ATOM   466   C  "C5'" . DA  A  1  24  ? 28.798  48.513 -20.346 1.00 156.81 ? 24   DA  I "C5'" 1 
ATOM   467   C  "C4'" . DA  A  1  24  ? 29.761  47.402 -19.982 1.00 156.64 ? 24   DA  I "C4'" 1 
ATOM   468   O  "O4'" . DA  A  1  24  ? 30.860  47.339 -20.925 1.00 157.15 ? 24   DA  I "O4'" 1 
ATOM   469   C  "C3'" . DA  A  1  24  ? 30.401  47.468 -18.591 1.00 156.25 ? 24   DA  I "C3'" 1 
ATOM   470   O  "O3'" . DA  A  1  24  ? 30.445  46.150 -18.025 1.00 154.79 ? 24   DA  I "O3'" 1 
ATOM   471   C  "C2'" . DA  A  1  24  ? 31.816  47.933 -18.883 1.00 156.72 ? 24   DA  I "C2'" 1 
ATOM   472   C  "C1'" . DA  A  1  24  ? 32.081  47.242 -20.206 1.00 157.32 ? 24   DA  I "C1'" 1 
ATOM   473   N  N9    . DA  A  1  24  ? 33.142  47.834 -21.021 1.00 157.94 ? 24   DA  I N9    1 
ATOM   474   C  C8    . DA  A  1  24  ? 33.400  49.163 -21.254 1.00 158.10 ? 24   DA  I C8    1 
ATOM   475   N  N7    . DA  A  1  24  ? 34.432  49.373 -22.035 1.00 158.19 ? 24   DA  I N7    1 
ATOM   476   C  C5    . DA  A  1  24  ? 34.886  48.096 -22.338 1.00 158.24 ? 24   DA  I C5    1 
ATOM   477   C  C6    . DA  A  1  24  ? 35.956  47.634 -23.127 1.00 158.25 ? 24   DA  I C6    1 
ATOM   478   N  N6    . DA  A  1  24  ? 36.797  48.439 -23.781 1.00 158.27 ? 24   DA  I N6    1 
ATOM   479   N  N1    . DA  A  1  24  ? 36.134  46.297 -23.221 1.00 158.10 ? 24   DA  I N1    1 
ATOM   480   C  C2    . DA  A  1  24  ? 35.292  45.490 -22.564 1.00 158.05 ? 24   DA  I C2    1 
ATOM   481   N  N3    . DA  A  1  24  ? 34.253  45.804 -21.792 1.00 158.13 ? 24   DA  I N3    1 
ATOM   482   C  C4    . DA  A  1  24  ? 34.102  47.139 -21.720 1.00 158.15 ? 24   DA  I C4    1 
ATOM   483   P  P     . DC  A  1  25  ? 30.999  45.936 -16.530 1.00 153.48 ? 25   DC  I P     1 
ATOM   484   O  OP1   . DC  A  1  25  ? 30.204  44.854 -15.894 1.00 153.24 ? 25   DC  I OP1   1 
ATOM   485   O  OP2   . DC  A  1  25  ? 31.076  47.271 -15.880 1.00 153.33 ? 25   DC  I OP2   1 
ATOM   486   O  "O5'" . DC  A  1  25  ? 32.488  45.406 -16.739 1.00 151.84 ? 25   DC  I "O5'" 1 
ATOM   487   C  "C5'" . DC  A  1  25  ? 32.793  44.011 -16.670 1.00 149.30 ? 25   DC  I "C5'" 1 
ATOM   488   C  "C4'" . DC  A  1  25  ? 34.240  43.815 -16.280 1.00 147.41 ? 25   DC  I "C4'" 1 
ATOM   489   O  "O4'" . DC  A  1  25  ? 35.084  44.365 -17.321 1.00 146.84 ? 25   DC  I "O4'" 1 
ATOM   490   C  "C3'" . DC  A  1  25  ? 34.633  44.547 -14.992 1.00 146.47 ? 25   DC  I "C3'" 1 
ATOM   491   O  "O3'" . DC  A  1  25  ? 35.698  43.868 -14.312 1.00 145.17 ? 25   DC  I "O3'" 1 
ATOM   492   C  "C2'" . DC  A  1  25  ? 35.200  45.849 -15.522 1.00 146.39 ? 25   DC  I "C2'" 1 
ATOM   493   C  "C1'" . DC  A  1  25  ? 35.934  45.345 -16.753 1.00 146.24 ? 25   DC  I "C1'" 1 
ATOM   494   N  N1    . DC  A  1  25  ? 36.251  46.343 -17.787 1.00 145.51 ? 25   DC  I N1    1 
ATOM   495   C  C2    . DC  A  1  25  ? 36.940  45.925 -18.930 1.00 144.91 ? 25   DC  I C2    1 
ATOM   496   O  O2    . DC  A  1  25  ? 37.216  44.723 -19.058 1.00 144.32 ? 25   DC  I O2    1 
ATOM   497   N  N3    . DC  A  1  25  ? 37.286  46.838 -19.865 1.00 144.67 ? 25   DC  I N3    1 
ATOM   498   C  C4    . DC  A  1  25  ? 36.962  48.122 -19.695 1.00 144.82 ? 25   DC  I C4    1 
ATOM   499   N  N4    . DC  A  1  25  ? 37.342  48.992 -20.633 1.00 144.52 ? 25   DC  I N4    1 
ATOM   500   C  C5    . DC  A  1  25  ? 36.238  48.572 -18.553 1.00 145.03 ? 25   DC  I C5    1 
ATOM   501   C  C6    . DC  A  1  25  ? 35.904  47.657 -17.634 1.00 145.30 ? 25   DC  I C6    1 
ATOM   502   P  P     . DC  A  1  26  ? 35.570  42.307 -13.943 1.00 144.04 ? 26   DC  I P     1 
ATOM   503   O  OP1   . DC  A  1  26  ? 34.190  41.832 -14.216 1.00 143.58 ? 26   DC  I OP1   1 
ATOM   504   O  OP2   . DC  A  1  26  ? 36.149  42.141 -12.584 1.00 143.97 ? 26   DC  I OP2   1 
ATOM   505   O  "O5'" . DC  A  1  26  ? 36.566  41.618 -14.979 1.00 143.02 ? 26   DC  I "O5'" 1 
ATOM   506   C  "C5'" . DC  A  1  26  ? 37.271  42.415 -15.931 1.00 140.70 ? 26   DC  I "C5'" 1 
ATOM   507   C  "C4'" . DC  A  1  26  ? 38.762  42.327 -15.698 1.00 138.73 ? 26   DC  I "C4'" 1 
ATOM   508   O  "O4'" . DC  A  1  26  ? 39.408  43.351 -16.494 1.00 138.20 ? 26   DC  I "O4'" 1 
ATOM   509   C  "C3'" . DC  A  1  26  ? 39.190  42.598 -14.257 1.00 137.64 ? 26   DC  I "C3'" 1 
ATOM   510   O  "O3'" . DC  A  1  26  ? 40.368  41.846 -13.966 1.00 136.65 ? 26   DC  I "O3'" 1 
ATOM   511   C  "C2'" . DC  A  1  26  ? 39.514  44.079 -14.263 1.00 137.42 ? 26   DC  I "C2'" 1 
ATOM   512   C  "C1'" . DC  A  1  26  ? 40.094  44.270 -15.653 1.00 137.50 ? 26   DC  I "C1'" 1 
ATOM   513   N  N1    . DC  A  1  26  ? 39.910  45.621 -16.212 1.00 137.30 ? 26   DC  I N1    1 
ATOM   514   C  C2    . DC  A  1  26  ? 40.475  45.913 -17.454 1.00 137.06 ? 26   DC  I C2    1 
ATOM   515   O  O2    . DC  A  1  26  ? 41.105  45.025 -18.047 1.00 137.10 ? 26   DC  I O2    1 
ATOM   516   N  N3    . DC  A  1  26  ? 40.321  47.153 -17.977 1.00 136.79 ? 26   DC  I N3    1 
ATOM   517   C  C4    . DC  A  1  26  ? 39.631  48.078 -17.307 1.00 136.36 ? 26   DC  I C4    1 
ATOM   518   N  N4    . DC  A  1  26  ? 39.502  49.286 -17.861 1.00 135.79 ? 26   DC  I N4    1 
ATOM   519   C  C5    . DC  A  1  26  ? 39.042  47.807 -16.040 1.00 136.49 ? 26   DC  I C5    1 
ATOM   520   C  C6    . DC  A  1  26  ? 39.204  46.576 -15.534 1.00 136.99 ? 26   DC  I C6    1 
ATOM   521   P  P     . DA  A  1  27  ? 40.356  40.779 -12.769 1.00 135.96 ? 27   DA  I P     1 
ATOM   522   O  OP1   . DA  A  1  27  ? 39.141  39.943 -12.943 1.00 136.22 ? 27   DA  I OP1   1 
ATOM   523   O  OP2   . DA  A  1  27  ? 40.575  41.502 -11.491 1.00 136.06 ? 27   DA  I OP2   1 
ATOM   524   O  "O5'" . DA  A  1  27  ? 41.631  39.873 -13.065 1.00 135.03 ? 27   DA  I "O5'" 1 
ATOM   525   C  "C5'" . DA  A  1  27  ? 41.760  39.187 -14.308 1.00 133.26 ? 27   DA  I "C5'" 1 
ATOM   526   C  "C4'" . DA  A  1  27  ? 43.018  39.626 -15.020 1.00 131.90 ? 27   DA  I "C4'" 1 
ATOM   527   O  "O4'" . DA  A  1  27  ? 42.918  41.031 -15.365 1.00 131.67 ? 27   DA  I "O4'" 1 
ATOM   528   C  "C3'" . DA  A  1  27  ? 44.301  39.487 -14.200 1.00 131.13 ? 27   DA  I "C3'" 1 
ATOM   529   O  "O3'" . DA  A  1  27  ? 45.371  39.101 -15.061 1.00 130.42 ? 27   DA  I "O3'" 1 
ATOM   530   C  "C2'" . DA  A  1  27  ? 44.540  40.895 -13.688 1.00 131.07 ? 27   DA  I "C2'" 1 
ATOM   531   C  "C1'" . DA  A  1  27  ? 44.039  41.732 -14.848 1.00 131.47 ? 27   DA  I "C1'" 1 
ATOM   532   N  N9    . DA  A  1  27  ? 43.608  43.082 -14.484 1.00 131.76 ? 27   DA  I N9    1 
ATOM   533   C  C8    . DA  A  1  27  ? 42.999  43.492 -13.324 1.00 131.93 ? 27   DA  I C8    1 
ATOM   534   N  N7    . DA  A  1  27  ? 42.745  44.777 -13.285 1.00 132.10 ? 27   DA  I N7    1 
ATOM   535   C  C5    . DA  A  1  27  ? 43.215  45.248 -14.503 1.00 131.84 ? 27   DA  I C5    1 
ATOM   536   C  C6    . DA  A  1  27  ? 43.241  46.533 -15.075 1.00 131.82 ? 27   DA  I C6    1 
ATOM   537   N  N6    . DA  A  1  27  ? 42.771  47.626 -14.470 1.00 131.64 ? 27   DA  I N6    1 
ATOM   538   N  N1    . DA  A  1  27  ? 43.776  46.659 -16.309 1.00 131.76 ? 27   DA  I N1    1 
ATOM   539   C  C2    . DA  A  1  27  ? 44.250  45.564 -16.916 1.00 131.69 ? 27   DA  I C2    1 
ATOM   540   N  N3    . DA  A  1  27  ? 44.286  44.306 -16.481 1.00 131.70 ? 27   DA  I N3    1 
ATOM   541   C  C4    . DA  A  1  27  ? 43.746  44.214 -15.253 1.00 131.90 ? 27   DA  I C4    1 
ATOM   542   P  P     . DA  A  1  28  ? 46.761  38.595 -14.435 1.00 130.30 ? 28   DA  I P     1 
ATOM   543   O  OP1   . DA  A  1  28  ? 46.732  37.109 -14.417 1.00 130.55 ? 28   DA  I OP1   1 
ATOM   544   O  OP2   . DA  A  1  28  ? 47.024  39.342 -13.177 1.00 130.16 ? 28   DA  I OP2   1 
ATOM   545   O  "O5'" . DA  A  1  28  ? 47.831  39.057 -15.517 1.00 128.38 ? 28   DA  I "O5'" 1 
ATOM   546   C  "C5'" . DA  A  1  28  ? 47.460  39.179 -16.886 1.00 125.46 ? 28   DA  I "C5'" 1 
ATOM   547   C  "C4'" . DA  A  1  28  ? 48.042  40.440 -17.481 1.00 122.92 ? 28   DA  I "C4'" 1 
ATOM   548   O  "O4'" . DA  A  1  28  ? 47.430  41.604 -16.872 1.00 122.39 ? 28   DA  I "O4'" 1 
ATOM   549   C  "C3'" . DA  A  1  28  ? 49.548  40.600 -17.285 1.00 121.25 ? 28   DA  I "C3'" 1 
ATOM   550   O  "O3'" . DA  A  1  28  ? 50.117  41.175 -18.464 1.00 118.67 ? 28   DA  I "O3'" 1 
ATOM   551   C  "C2'" . DA  A  1  28  ? 49.645  41.555 -16.108 1.00 121.49 ? 28   DA  I "C2'" 1 
ATOM   552   C  "C1'" . DA  A  1  28  ? 48.430  42.443 -16.314 1.00 121.95 ? 28   DA  I "C1'" 1 
ATOM   553   N  N9    . DA  A  1  28  ? 47.887  43.030 -15.087 1.00 122.31 ? 28   DA  I N9    1 
ATOM   554   C  C8    . DA  A  1  28  ? 47.700  42.419 -13.872 1.00 122.43 ? 28   DA  I C8    1 
ATOM   555   N  N7    . DA  A  1  28  ? 47.182  43.205 -12.959 1.00 122.33 ? 28   DA  I N7    1 
ATOM   556   C  C5    . DA  A  1  28  ? 47.018  44.416 -13.616 1.00 122.17 ? 28   DA  I C5    1 
ATOM   557   C  C6    . DA  A  1  28  ? 46.512  45.659 -13.196 1.00 122.07 ? 28   DA  I C6    1 
ATOM   558   N  N6    . DA  A  1  28  ? 46.055  45.895 -11.966 1.00 122.17 ? 28   DA  I N6    1 
ATOM   559   N  N1    . DA  A  1  28  ? 46.490  46.665 -14.096 1.00 122.01 ? 28   DA  I N1    1 
ATOM   560   C  C2    . DA  A  1  28  ? 46.946  46.428 -15.331 1.00 122.06 ? 28   DA  I C2    1 
ATOM   561   N  N3    . DA  A  1  28  ? 47.442  45.304 -15.846 1.00 122.36 ? 28   DA  I N3    1 
ATOM   562   C  C4    . DA  A  1  28  ? 47.451  44.324 -14.926 1.00 122.30 ? 28   DA  I C4    1 
ATOM   563   P  P     . DA  A  1  29  ? 51.702  41.102 -18.703 1.00 116.80 ? 29   DA  I P     1 
ATOM   564   O  OP1   . DA  A  1  29  ? 51.951  40.604 -20.082 1.00 116.97 ? 29   DA  I OP1   1 
ATOM   565   O  OP2   . DA  A  1  29  ? 52.306  40.397 -17.545 1.00 116.84 ? 29   DA  I OP2   1 
ATOM   566   O  "O5'" . DA  A  1  29  ? 52.139  42.628 -18.633 1.00 114.30 ? 29   DA  I "O5'" 1 
ATOM   567   C  "C5'" . DA  A  1  29  ? 51.447  43.518 -17.774 1.00 110.95 ? 29   DA  I "C5'" 1 
ATOM   568   C  "C4'" . DA  A  1  29  ? 51.816  44.947 -18.082 1.00 108.56 ? 29   DA  I "C4'" 1 
ATOM   569   O  "O4'" . DA  A  1  29  ? 51.110  45.780 -17.137 1.00 108.68 ? 29   DA  I "O4'" 1 
ATOM   570   C  "C3'" . DA  A  1  29  ? 53.293  45.251 -17.870 1.00 106.87 ? 29   DA  I "C3'" 1 
ATOM   571   O  "O3'" . DA  A  1  29  ? 53.679  46.349 -18.698 1.00 103.95 ? 29   DA  I "O3'" 1 
ATOM   572   C  "C2'" . DA  A  1  29  ? 53.350  45.624 -16.402 1.00 107.62 ? 29   DA  I "C2'" 1 
ATOM   573   C  "C1'" . DA  A  1  29  ? 52.006  46.297 -16.163 1.00 108.37 ? 29   DA  I "C1'" 1 
ATOM   574   N  N9    . DA  A  1  29  ? 51.432  46.007 -14.849 1.00 108.31 ? 29   DA  I N9    1 
ATOM   575   C  C8    . DA  A  1  29  ? 51.616  44.881 -14.084 1.00 108.38 ? 29   DA  I C8    1 
ATOM   576   N  N7    . DA  A  1  29  ? 50.963  44.902 -12.948 1.00 108.54 ? 29   DA  I N7    1 
ATOM   577   C  C5    . DA  A  1  29  ? 50.306  46.125 -12.966 1.00 108.43 ? 29   DA  I C5    1 
ATOM   578   C  C6    . DA  A  1  29  ? 49.447  46.747 -12.048 1.00 108.09 ? 29   DA  I C6    1 
ATOM   579   N  N6    . DA  A  1  29  ? 49.086  46.200 -10.887 1.00 108.41 ? 29   DA  I N6    1 
ATOM   580   N  N1    . DA  A  1  29  ? 48.963  47.966 -12.369 1.00 107.66 ? 29   DA  I N1    1 
ATOM   581   C  C2    . DA  A  1  29  ? 49.324  48.511 -13.535 1.00 107.74 ? 29   DA  I C2    1 
ATOM   582   N  N3    . DA  A  1  29  ? 50.123  48.026 -14.480 1.00 107.80 ? 29   DA  I N3    1 
ATOM   583   C  C4    . DA  A  1  29  ? 50.587  46.815 -14.130 1.00 108.16 ? 29   DA  I C4    1 
ATOM   584   P  P     . DA  A  1  30  ? 55.233  46.615 -18.999 1.00 101.59 ? 30   DA  I P     1 
ATOM   585   O  OP1   . DA  A  1  30  ? 55.433  46.526 -20.465 1.00 102.16 ? 30   DA  I OP1   1 
ATOM   586   O  OP2   . DA  A  1  30  ? 56.043  45.766 -18.093 1.00 101.23 ? 30   DA  I OP2   1 
ATOM   587   O  "O5'" . DA  A  1  30  ? 55.439  48.128 -18.560 1.00 99.16  ? 30   DA  I "O5'" 1 
ATOM   588   C  "C5'" . DA  A  1  30  ? 54.517  49.127 -18.967 1.00 95.04  ? 30   DA  I "C5'" 1 
ATOM   589   C  "C4'" . DA  A  1  30  ? 54.386  50.178 -17.891 1.00 93.53  ? 30   DA  I "C4'" 1 
ATOM   590   O  "O4'" . DA  A  1  30  ? 53.764  49.602 -16.715 1.00 92.35  ? 30   DA  I "O4'" 1 
ATOM   591   C  "C3'" . DA  A  1  30  ? 55.702  50.795 -17.410 1.00 92.27  ? 30   DA  I "C3'" 1 
ATOM   592   O  "O3'" . DA  A  1  30  ? 55.511  52.194 -17.191 1.00 91.09  ? 30   DA  I "O3'" 1 
ATOM   593   C  "C2'" . DA  A  1  30  ? 55.942  50.107 -16.077 1.00 91.74  ? 30   DA  I "C2'" 1 
ATOM   594   C  "C1'" . DA  A  1  30  ? 54.519  49.965 -15.573 1.00 92.05  ? 30   DA  I "C1'" 1 
ATOM   595   N  N9    . DA  A  1  30  ? 54.286  48.963 -14.532 1.00 91.65  ? 30   DA  I N9    1 
ATOM   596   C  C8    . DA  A  1  30  ? 54.757  47.677 -14.461 1.00 91.63  ? 30   DA  I C8    1 
ATOM   597   N  N7    . DA  A  1  30  ? 54.346  47.021 -13.402 1.00 90.98  ? 30   DA  I N7    1 
ATOM   598   C  C5    . DA  A  1  30  ? 53.555  47.940 -12.726 1.00 90.87  ? 30   DA  I C5    1 
ATOM   599   C  C6    . DA  A  1  30  ? 52.823  47.862 -11.526 1.00 90.18  ? 30   DA  I C6    1 
ATOM   600   N  N6    . DA  A  1  30  ? 52.759  46.768 -10.765 1.00 89.34  ? 30   DA  I N6    1 
ATOM   601   N  N1    . DA  A  1  30  ? 52.146  48.960 -11.131 1.00 89.37  ? 30   DA  I N1    1 
ATOM   602   C  C2    . DA  A  1  30  ? 52.203  50.055 -11.895 1.00 90.30  ? 30   DA  I C2    1 
ATOM   603   N  N3    . DA  A  1  30  ? 52.850  50.252 -13.041 1.00 90.90  ? 30   DA  I N3    1 
ATOM   604   C  C4    . DA  A  1  30  ? 53.515  49.142 -13.408 1.00 91.18  ? 30   DA  I C4    1 
ATOM   605   P  P     . DG  A  1  31  ? 56.766  53.190 -17.248 1.00 90.15  ? 31   DG  I P     1 
ATOM   606   O  OP1   . DG  A  1  31  ? 56.597  54.101 -18.408 1.00 90.66  ? 31   DG  I OP1   1 
ATOM   607   O  OP2   . DG  A  1  31  ? 57.991  52.360 -17.135 1.00 90.08  ? 31   DG  I OP2   1 
ATOM   608   O  "O5'" . DG  A  1  31  ? 56.624  54.054 -15.917 1.00 93.03  ? 31   DG  I "O5'" 1 
ATOM   609   C  "C5'" . DG  A  1  31  ? 55.615  55.059 -15.795 1.00 96.08  ? 31   DG  I "C5'" 1 
ATOM   610   C  "C4'" . DG  A  1  31  ? 55.629  55.646 -14.402 1.00 98.08  ? 31   DG  I "C4'" 1 
ATOM   611   O  "O4'" . DG  A  1  31  ? 55.154  54.667 -13.450 1.00 97.75  ? 31   DG  I "O4'" 1 
ATOM   612   C  "C3'" . DG  A  1  31  ? 57.014  56.062 -13.917 1.00 99.68  ? 31   DG  I "C3'" 1 
ATOM   613   O  "O3'" . DG  A  1  31  ? 56.912  57.225 -13.099 1.00 103.18 ? 31   DG  I "O3'" 1 
ATOM   614   C  "C2'" . DG  A  1  31  ? 57.469  54.867 -13.100 1.00 98.50  ? 31   DG  I "C2'" 1 
ATOM   615   C  "C1'" . DG  A  1  31  ? 56.167  54.369 -12.500 1.00 97.99  ? 31   DG  I "C1'" 1 
ATOM   616   N  N9    . DG  A  1  31  ? 56.123  52.932 -12.249 1.00 98.04  ? 31   DG  I N9    1 
ATOM   617   C  C8    . DG  A  1  31  ? 56.187  51.928 -13.184 1.00 97.93  ? 31   DG  I C8    1 
ATOM   618   N  N7    . DG  A  1  31  ? 56.095  50.735 -12.663 1.00 98.01  ? 31   DG  I N7    1 
ATOM   619   C  C5    . DG  A  1  31  ? 55.969  50.964 -11.300 1.00 98.22  ? 31   DG  I C5    1 
ATOM   620   C  C6    . DG  A  1  31  ? 55.826  50.050 -10.225 1.00 98.15  ? 31   DG  I C6    1 
ATOM   621   O  O6    . DG  A  1  31  ? 55.773  48.817 -10.264 1.00 97.93  ? 31   DG  I O6    1 
ATOM   622   N  N1    . DG  A  1  31  ? 55.738  50.709 -9.003  1.00 98.32  ? 31   DG  I N1    1 
ATOM   623   C  C2    . DG  A  1  31  ? 55.778  52.070 -8.835  1.00 98.70  ? 31   DG  I C2    1 
ATOM   624   N  N2    . DG  A  1  31  ? 55.684  52.513 -7.574  1.00 99.44  ? 31   DG  I N2    1 
ATOM   625   N  N3    . DG  A  1  31  ? 55.902  52.934 -9.829  1.00 98.53  ? 31   DG  I N3    1 
ATOM   626   C  C4    . DG  A  1  31  ? 55.993  52.315 -11.026 1.00 98.34  ? 31   DG  I C4    1 
ATOM   627   P  P     . DT  A  1  32  ? 58.137  58.255 -13.034 1.00 106.60 ? 32   DT  I P     1 
ATOM   628   O  OP1   . DT  A  1  32  ? 57.652  59.551 -13.569 1.00 106.92 ? 32   DT  I OP1   1 
ATOM   629   O  OP2   . DT  A  1  32  ? 59.334  57.612 -13.633 1.00 106.90 ? 32   DT  I OP2   1 
ATOM   630   O  "O5'" . DT  A  1  32  ? 58.396  58.433 -11.475 1.00 110.01 ? 32   DT  I "O5'" 1 
ATOM   631   C  "C5'" . DT  A  1  32  ? 57.393  58.990 -10.634 1.00 113.67 ? 32   DT  I "C5'" 1 
ATOM   632   C  "C4'" . DT  A  1  32  ? 57.667  58.647 -9.189  1.00 115.85 ? 32   DT  I "C4'" 1 
ATOM   633   O  "O4'" . DT  A  1  32  ? 57.504  57.225 -8.985  1.00 115.95 ? 32   DT  I "O4'" 1 
ATOM   634   C  "C3'" . DT  A  1  32  ? 59.070  58.983 -8.682  1.00 117.27 ? 32   DT  I "C3'" 1 
ATOM   635   O  "O3'" . DT  A  1  32  ? 58.969  59.559 -7.380  1.00 119.63 ? 32   DT  I "O3'" 1 
ATOM   636   C  "C2'" . DT  A  1  32  ? 59.757  57.627 -8.608  1.00 116.92 ? 32   DT  I "C2'" 1 
ATOM   637   C  "C1'" . DT  A  1  32  ? 58.600  56.717 -8.252  1.00 116.42 ? 32   DT  I "C1'" 1 
ATOM   638   N  N1    . DT  A  1  32  ? 58.765  55.294 -8.612  1.00 116.80 ? 32   DT  I N1    1 
ATOM   639   C  C2    . DT  A  1  32  ? 58.407  54.342 -7.681  1.00 116.91 ? 32   DT  I C2    1 
ATOM   640   O  O2    . DT  A  1  32  ? 57.968  54.619 -6.579  1.00 117.32 ? 32   DT  I O2    1 
ATOM   641   N  N3    . DT  A  1  32  ? 58.584  53.045 -8.090  1.00 117.05 ? 32   DT  I N3    1 
ATOM   642   C  C4    . DT  A  1  32  ? 59.072  52.612 -9.307  1.00 117.17 ? 32   DT  I C4    1 
ATOM   643   O  O4    . DT  A  1  32  ? 59.173  51.409 -9.532  1.00 116.87 ? 32   DT  I O4    1 
ATOM   644   C  C5    . DT  A  1  32  ? 59.430  53.663 -10.236 1.00 117.24 ? 32   DT  I C5    1 
ATOM   645   C  C7    . DT  A  1  32  ? 59.970  53.290 -11.580 1.00 117.06 ? 32   DT  I C7    1 
ATOM   646   C  C6    . DT  A  1  32  ? 59.261  54.934 -9.846  1.00 117.27 ? 32   DT  I C6    1 
ATOM   647   P  P     . DG  A  1  33  ? 60.299  59.837 -6.528  1.00 121.40 ? 33   DG  I P     1 
ATOM   648   O  OP1   . DG  A  1  33  ? 60.123  61.124 -5.812  1.00 121.74 ? 33   DG  I OP1   1 
ATOM   649   O  OP2   . DG  A  1  33  ? 61.466  59.653 -7.427  1.00 121.60 ? 33   DG  I OP2   1 
ATOM   650   O  "O5'" . DG  A  1  33  ? 60.299  58.658 -5.459  1.00 122.77 ? 33   DG  I "O5'" 1 
ATOM   651   C  "C5'" . DG  A  1  33  ? 59.264  58.563 -4.483  1.00 125.15 ? 33   DG  I "C5'" 1 
ATOM   652   C  "C4'" . DG  A  1  33  ? 59.683  57.631 -3.372  1.00 126.90 ? 33   DG  I "C4'" 1 
ATOM   653   O  "O4'" . DG  A  1  33  ? 59.637  56.261 -3.837  1.00 127.12 ? 33   DG  I "O4'" 1 
ATOM   654   C  "C3'" . DG  A  1  33  ? 61.111  57.867 -2.884  1.00 128.06 ? 33   DG  I "C3'" 1 
ATOM   655   O  "O3'" . DG  A  1  33  ? 61.191  57.704 -1.465  1.00 129.93 ? 33   DG  I "O3'" 1 
ATOM   656   C  "C2'" . DG  A  1  33  ? 61.911  56.799 -3.610  1.00 127.66 ? 33   DG  I "C2'" 1 
ATOM   657   C  "C1'" . DG  A  1  33  ? 60.916  55.655 -3.715  1.00 127.29 ? 33   DG  I "C1'" 1 
ATOM   658   N  N9    . DG  A  1  33  ? 61.106  54.788 -4.875  1.00 126.97 ? 33   DG  I N9    1 
ATOM   659   C  C8    . DG  A  1  33  ? 61.414  55.175 -6.156  1.00 126.83 ? 33   DG  I C8    1 
ATOM   660   N  N7    . DG  A  1  33  ? 61.500  54.173 -6.987  1.00 126.82 ? 33   DG  I N7    1 
ATOM   661   C  C5    . DG  A  1  33  ? 61.236  53.055 -6.208  1.00 126.64 ? 33   DG  I C5    1 
ATOM   662   C  C6    . DG  A  1  33  ? 61.182  51.681 -6.559  1.00 126.60 ? 33   DG  I C6    1 
ATOM   663   O  O6    . DG  A  1  33  ? 61.356  51.161 -7.666  1.00 126.68 ? 33   DG  I O6    1 
ATOM   664   N  N1    . DG  A  1  33  ? 60.886  50.884 -5.460  1.00 126.48 ? 33   DG  I N1    1 
ATOM   665   C  C2    . DG  A  1  33  ? 60.668  51.344 -4.188  1.00 126.39 ? 33   DG  I C2    1 
ATOM   666   N  N2    . DG  A  1  33  ? 60.400  50.413 -3.263  1.00 126.31 ? 33   DG  I N2    1 
ATOM   667   N  N3    . DG  A  1  33  ? 60.709  52.622 -3.847  1.00 126.47 ? 33   DG  I N3    1 
ATOM   668   C  C4    . DG  A  1  33  ? 60.998  53.416 -4.900  1.00 126.70 ? 33   DG  I C4    1 
ATOM   669   P  P     . DT  A  1  34  ? 62.372  58.430 -0.652  1.00 130.81 ? 34   DT  I P     1 
ATOM   670   O  OP1   . DT  A  1  34  ? 62.264  58.044 0.777   1.00 130.91 ? 34   DT  I OP1   1 
ATOM   671   O  OP2   . DT  A  1  34  ? 62.360  59.867 -1.027  1.00 130.73 ? 34   DT  I OP2   1 
ATOM   672   O  "O5'" . DT  A  1  34  ? 63.689  57.773 -1.260  1.00 131.80 ? 34   DT  I "O5'" 1 
ATOM   673   C  "C5'" . DT  A  1  34  ? 64.583  57.034 -0.438  1.00 133.00 ? 34   DT  I "C5'" 1 
ATOM   674   C  "C4'" . DT  A  1  34  ? 63.892  55.807 0.112   1.00 133.96 ? 34   DT  I "C4'" 1 
ATOM   675   O  "O4'" . DT  A  1  34  ? 63.314  55.034 -0.969  1.00 134.56 ? 34   DT  I "O4'" 1 
ATOM   676   C  "C3'" . DT  A  1  34  ? 64.825  54.862 0.862   1.00 134.26 ? 34   DT  I "C3'" 1 
ATOM   677   O  "O3'" . DT  A  1  34  ? 64.198  54.350 2.036   1.00 133.55 ? 34   DT  I "O3'" 1 
ATOM   678   C  "C2'" . DT  A  1  34  ? 65.094  53.750 -0.133  1.00 134.59 ? 34   DT  I "C2'" 1 
ATOM   679   C  "C1'" . DT  A  1  34  ? 63.820  53.705 -0.954  1.00 134.89 ? 34   DT  I "C1'" 1 
ATOM   680   N  N1    . DT  A  1  34  ? 64.049  53.293 -2.351  1.00 135.25 ? 34   DT  I N1    1 
ATOM   681   C  C2    . DT  A  1  34  ? 63.657  52.031 -2.735  1.00 135.39 ? 34   DT  I C2    1 
ATOM   682   O  O2    . DT  A  1  34  ? 63.119  51.241 -1.977  1.00 135.42 ? 34   DT  I O2    1 
ATOM   683   N  N3    . DT  A  1  34  ? 63.918  51.726 -4.047  1.00 135.64 ? 34   DT  I N3    1 
ATOM   684   C  C4    . DT  A  1  34  ? 64.519  52.537 -4.991  1.00 135.76 ? 34   DT  I C4    1 
ATOM   685   O  O4    . DT  A  1  34  ? 64.693  52.123 -6.132  1.00 135.95 ? 34   DT  I O4    1 
ATOM   686   C  C5    . DT  A  1  34  ? 64.902  53.850 -4.520  1.00 135.79 ? 34   DT  I C5    1 
ATOM   687   C  C7    . DT  A  1  34  ? 65.559  54.801 -5.471  1.00 135.43 ? 34   DT  I C7    1 
ATOM   688   C  C6    . DT  A  1  34  ? 64.649  54.157 -3.242  1.00 135.63 ? 34   DT  I C6    1 
ATOM   689   P  P     . DA  A  1  35  ? 65.107  53.942 3.291   1.00 132.91 ? 35   DA  I P     1 
ATOM   690   O  OP1   . DA  A  1  35  ? 64.223  53.539 4.413   1.00 133.48 ? 35   DA  I OP1   1 
ATOM   691   O  OP2   . DA  A  1  35  ? 66.099  55.031 3.487   1.00 133.11 ? 35   DA  I OP2   1 
ATOM   692   O  "O5'" . DA  A  1  35  ? 65.882  52.651 2.779   1.00 131.64 ? 35   DA  I "O5'" 1 
ATOM   693   C  "C5'" . DA  A  1  35  ? 65.235  51.387 2.756   1.00 129.62 ? 35   DA  I "C5'" 1 
ATOM   694   C  "C4'" . DA  A  1  35  ? 66.164  50.334 2.203   1.00 128.43 ? 35   DA  I "C4'" 1 
ATOM   695   O  "O4'" . DA  A  1  35  ? 66.242  50.423 0.758   1.00 128.42 ? 35   DA  I "O4'" 1 
ATOM   696   C  "C3'" . DA  A  1  35  ? 67.602  50.391 2.716   1.00 127.25 ? 35   DA  I "C3'" 1 
ATOM   697   O  "O3'" . DA  A  1  35  ? 68.043  49.067 3.023   1.00 125.29 ? 35   DA  I "O3'" 1 
ATOM   698   C  "C2'" . DA  A  1  35  ? 68.374  50.966 1.540   1.00 127.47 ? 35   DA  I "C2'" 1 
ATOM   699   C  "C1'" . DA  A  1  35  ? 67.602  50.415 0.356   1.00 127.89 ? 35   DA  I "C1'" 1 
ATOM   700   N  N9    . DA  A  1  35  ? 67.716  51.197 -0.877  1.00 127.73 ? 35   DA  I N9    1 
ATOM   701   C  C8    . DA  A  1  35  ? 67.906  52.551 -1.010  1.00 127.63 ? 35   DA  I C8    1 
ATOM   702   N  N7    . DA  A  1  35  ? 67.968  52.958 -2.254  1.00 127.38 ? 35   DA  I N7    1 
ATOM   703   C  C5    . DA  A  1  35  ? 67.809  51.794 -2.993  1.00 127.54 ? 35   DA  I C5    1 
ATOM   704   C  C6    . DA  A  1  35  ? 67.783  51.549 -4.378  1.00 127.36 ? 35   DA  I C6    1 
ATOM   705   N  N6    . DA  A  1  35  ? 67.922  52.503 -5.302  1.00 127.04 ? 35   DA  I N6    1 
ATOM   706   N  N1    . DA  A  1  35  ? 67.606  50.273 -4.786  1.00 127.15 ? 35   DA  I N1    1 
ATOM   707   C  C2    . DA  A  1  35  ? 67.469  49.317 -3.859  1.00 127.36 ? 35   DA  I C2    1 
ATOM   708   N  N3    . DA  A  1  35  ? 67.478  49.422 -2.531  1.00 127.61 ? 35   DA  I N3    1 
ATOM   709   C  C4    . DA  A  1  35  ? 67.653  50.702 -2.158  1.00 127.66 ? 35   DA  I C4    1 
ATOM   710   P  P     . DT  A  1  36  ? 69.591  48.793 3.341   1.00 124.05 ? 36   DT  I P     1 
ATOM   711   O  OP1   . DT  A  1  36  ? 69.669  47.777 4.422   1.00 124.07 ? 36   DT  I OP1   1 
ATOM   712   O  OP2   . DT  A  1  36  ? 70.273  50.103 3.511   1.00 124.18 ? 36   DT  I OP2   1 
ATOM   713   O  "O5'" . DT  A  1  36  ? 70.112  48.124 1.995   1.00 123.01 ? 36   DT  I "O5'" 1 
ATOM   714   C  "C5'" . DT  A  1  36  ? 69.465  46.967 1.472   1.00 119.87 ? 36   DT  I "C5'" 1 
ATOM   715   C  "C4'" . DT  A  1  36  ? 70.302  46.349 0.378   1.00 117.29 ? 36   DT  I "C4'" 1 
ATOM   716   O  "O4'" . DT  A  1  36  ? 70.170  47.114 -0.844  1.00 116.76 ? 36   DT  I "O4'" 1 
ATOM   717   C  "C3'" . DT  A  1  36  ? 71.796  46.293 0.692   1.00 115.89 ? 36   DT  I "C3'" 1 
ATOM   718   O  "O3'" . DT  A  1  36  ? 72.334  45.030 0.301   1.00 113.47 ? 36   DT  I "O3'" 1 
ATOM   719   C  "C2'" . DT  A  1  36  ? 72.378  47.421 -0.142  1.00 115.92 ? 36   DT  I "C2'" 1 
ATOM   720   C  "C1'" . DT  A  1  36  ? 71.456  47.440 -1.344  1.00 116.79 ? 36   DT  I "C1'" 1 
ATOM   721   N  N1    . DT  A  1  36  ? 71.363  48.745 -2.029  1.00 117.33 ? 36   DT  I N1    1 
ATOM   722   C  C2    . DT  A  1  36  ? 71.329  48.754 -3.407  1.00 117.57 ? 36   DT  I C2    1 
ATOM   723   O  O2    . DT  A  1  36  ? 71.372  47.739 -4.083  1.00 117.79 ? 36   DT  I O2    1 
ATOM   724   N  N3    . DT  A  1  36  ? 71.245  50.003 -3.970  1.00 117.40 ? 36   DT  I N3    1 
ATOM   725   C  C4    . DT  A  1  36  ? 71.198  51.215 -3.309  1.00 117.65 ? 36   DT  I C4    1 
ATOM   726   O  O4    . DT  A  1  36  ? 71.121  52.259 -3.952  1.00 117.27 ? 36   DT  I O4    1 
ATOM   727   C  C5    . DT  A  1  36  ? 71.243  51.133 -1.866  1.00 117.86 ? 36   DT  I C5    1 
ATOM   728   C  C7    . DT  A  1  36  ? 71.211  52.397 -1.066  1.00 117.71 ? 36   DT  I C7    1 
ATOM   729   C  C6    . DT  A  1  36  ? 71.317  49.918 -1.306  1.00 117.56 ? 36   DT  I C6    1 
ATOM   730   P  P     . DT  A  1  37  ? 73.921  44.851 0.157   1.00 112.17 ? 37   DT  I P     1 
ATOM   731   O  OP1   . DT  A  1  37  ? 74.250  43.440 0.486   1.00 111.82 ? 37   DT  I OP1   1 
ATOM   732   O  OP2   . DT  A  1  37  ? 74.600  45.955 0.884   1.00 112.05 ? 37   DT  I OP2   1 
ATOM   733   O  "O5'" . DT  A  1  37  ? 74.149  45.064 -1.401  1.00 110.78 ? 37   DT  I "O5'" 1 
ATOM   734   C  "C5'" . DT  A  1  37  ? 73.281  44.439 -2.341  1.00 107.45 ? 37   DT  I "C5'" 1 
ATOM   735   C  "C4'" . DT  A  1  37  ? 73.869  44.523 -3.728  1.00 105.06 ? 37   DT  I "C4'" 1 
ATOM   736   O  "O4'" . DT  A  1  37  ? 73.687  45.852 -4.270  1.00 104.72 ? 37   DT  I "O4'" 1 
ATOM   737   C  "C3'" . DT  A  1  37  ? 75.368  44.240 -3.772  1.00 103.28 ? 37   DT  I "C3'" 1 
ATOM   738   O  "O3'" . DT  A  1  37  ? 75.674  43.424 -4.897  1.00 100.35 ? 37   DT  I "O3'" 1 
ATOM   739   C  "C2'" . DT  A  1  37  ? 75.989  45.619 -3.910  1.00 103.46 ? 37   DT  I "C2'" 1 
ATOM   740   C  "C1'" . DT  A  1  37  ? 74.934  46.376 -4.694  1.00 104.65 ? 37   DT  I "C1'" 1 
ATOM   741   N  N1    . DT  A  1  37  ? 74.914  47.833 -4.461  1.00 105.16 ? 37   DT  I N1    1 
ATOM   742   C  C2    . DT  A  1  37  ? 74.978  48.662 -5.557  1.00 105.46 ? 37   DT  I C2    1 
ATOM   743   O  O2    . DT  A  1  37  ? 75.066  48.248 -6.702  1.00 105.81 ? 37   DT  I O2    1 
ATOM   744   N  N3    . DT  A  1  37  ? 74.939  50.002 -5.263  1.00 105.53 ? 37   DT  I N3    1 
ATOM   745   C  C4    . DT  A  1  37  ? 74.851  50.582 -4.013  1.00 105.41 ? 37   DT  I C4    1 
ATOM   746   O  O4    . DT  A  1  37  ? 74.822  51.806 -3.907  1.00 105.17 ? 37   DT  I O4    1 
ATOM   747   C  C5    . DT  A  1  37  ? 74.799  49.653 -2.906  1.00 105.41 ? 37   DT  I C5    1 
ATOM   748   C  C7    . DT  A  1  37  ? 74.717  50.189 -1.512  1.00 105.17 ? 37   DT  I C7    1 
ATOM   749   C  C6    . DT  A  1  37  ? 74.829  48.342 -3.183  1.00 105.34 ? 37   DT  I C6    1 
ATOM   750   P  P     . DT  A  1  38  ? 77.180  42.933 -5.132  1.00 98.68  ? 38   DT  I P     1 
ATOM   751   O  OP1   . DT  A  1  38  ? 77.115  41.516 -5.574  1.00 98.17  ? 38   DT  I OP1   1 
ATOM   752   O  OP2   . DT  A  1  38  ? 77.987  43.293 -3.940  1.00 98.41  ? 38   DT  I OP2   1 
ATOM   753   O  "O5'" . DT  A  1  38  ? 77.656  43.832 -6.358  1.00 97.08  ? 38   DT  I "O5'" 1 
ATOM   754   C  "C5'" . DT  A  1  38  ? 76.835  43.959 -7.518  1.00 92.31  ? 38   DT  I "C5'" 1 
ATOM   755   C  "C4'" . DT  A  1  38  ? 77.477  44.885 -8.523  1.00 89.23  ? 38   DT  I "C4'" 1 
ATOM   756   O  "O4'" . DT  A  1  38  ? 77.303  46.272 -8.141  1.00 88.53  ? 38   DT  I "O4'" 1 
ATOM   757   C  "C3'" . DT  A  1  38  ? 78.979  44.677 -8.714  1.00 87.41  ? 38   DT  I "C3'" 1 
ATOM   758   O  "O3'" . DT  A  1  38  ? 79.294  44.764 -10.105 1.00 84.37  ? 38   DT  I "O3'" 1 
ATOM   759   C  "C2'" . DT  A  1  38  ? 79.587  45.855 -7.973  1.00 87.56  ? 38   DT  I "C2'" 1 
ATOM   760   C  "C1'" . DT  A  1  38  ? 78.552  46.932 -8.237  1.00 88.11  ? 38   DT  I "C1'" 1 
ATOM   761   N  N1    . DT  A  1  38  ? 78.545  48.072 -7.302  1.00 88.52  ? 38   DT  I N1    1 
ATOM   762   C  C2    . DT  A  1  38  ? 78.359  49.329 -7.834  1.00 88.64  ? 38   DT  I C2    1 
ATOM   763   O  O2    . DT  A  1  38  ? 78.214  49.532 -9.028  1.00 88.20  ? 38   DT  I O2    1 
ATOM   764   N  N3    . DT  A  1  38  ? 78.354  50.346 -6.914  1.00 88.85  ? 38   DT  I N3    1 
ATOM   765   C  C4    . DT  A  1  38  ? 78.517  50.237 -5.548  1.00 88.97  ? 38   DT  I C4    1 
ATOM   766   O  O4    . DT  A  1  38  ? 78.486  51.245 -4.848  1.00 89.16  ? 38   DT  I O4    1 
ATOM   767   C  C5    . DT  A  1  38  ? 78.716  48.889 -5.055  1.00 88.56  ? 38   DT  I C5    1 
ATOM   768   C  C7    . DT  A  1  38  ? 78.911  48.674 -3.588  1.00 87.39  ? 38   DT  I C7    1 
ATOM   769   C  C6    . DT  A  1  38  ? 78.717  47.887 -5.946  1.00 88.59  ? 38   DT  I C6    1 
ATOM   770   P  P     . DG  A  1  39  ? 79.637  43.429 -10.928 1.00 80.73  ? 39   DG  I P     1 
ATOM   771   O  OP1   . DG  A  1  39  ? 78.631  42.396 -10.580 1.00 80.47  ? 39   DG  I OP1   1 
ATOM   772   O  OP2   . DG  A  1  39  ? 81.079  43.140 -10.747 1.00 81.72  ? 39   DG  I OP2   1 
ATOM   773   O  "O5'" . DG  A  1  39  ? 79.405  43.865 -12.440 1.00 80.80  ? 39   DG  I "O5'" 1 
ATOM   774   C  "C5'" . DG  A  1  39  ? 78.101  44.196 -12.906 1.00 78.95  ? 39   DG  I "C5'" 1 
ATOM   775   C  "C4'" . DG  A  1  39  ? 78.135  45.505 -13.658 1.00 77.98  ? 39   DG  I "C4'" 1 
ATOM   776   O  "O4'" . DG  A  1  39  ? 78.478  46.570 -12.742 1.00 77.75  ? 39   DG  I "O4'" 1 
ATOM   777   C  "C3'" . DG  A  1  39  ? 79.163  45.571 -14.787 1.00 76.75  ? 39   DG  I "C3'" 1 
ATOM   778   O  "O3'" . DG  A  1  39  ? 78.629  46.334 -15.873 1.00 74.71  ? 39   DG  I "O3'" 1 
ATOM   779   C  "C2'" . DG  A  1  39  ? 80.341  46.283 -14.147 1.00 78.01  ? 39   DG  I "C2'" 1 
ATOM   780   C  "C1'" . DG  A  1  39  ? 79.669  47.223 -13.158 1.00 79.44  ? 39   DG  I "C1'" 1 
ATOM   781   N  N9    . DG  A  1  39  ? 80.459  47.495 -11.960 1.00 82.04  ? 39   DG  I N9    1 
ATOM   782   C  C8    . DG  A  1  39  ? 81.227  46.598 -11.256 1.00 82.58  ? 39   DG  I C8    1 
ATOM   783   N  N7    . DG  A  1  39  ? 81.802  47.125 -10.209 1.00 83.18  ? 39   DG  I N7    1 
ATOM   784   C  C5    . DG  A  1  39  ? 81.394  48.451 -10.223 1.00 83.23  ? 39   DG  I C5    1 
ATOM   785   C  C6    . DG  A  1  39  ? 81.695  49.512 -9.331  1.00 83.41  ? 39   DG  I C6    1 
ATOM   786   O  O6    . DG  A  1  39  ? 82.401  49.489 -8.316  1.00 83.47  ? 39   DG  I O6    1 
ATOM   787   N  N1    . DG  A  1  39  ? 81.076  50.694 -9.718  1.00 83.36  ? 39   DG  I N1    1 
ATOM   788   C  C2    . DG  A  1  39  ? 80.269  50.840 -10.817 1.00 83.37  ? 39   DG  I C2    1 
ATOM   789   N  N2    . DG  A  1  39  ? 79.764  52.064 -11.016 1.00 83.46  ? 39   DG  I N2    1 
ATOM   790   N  N3    . DG  A  1  39  ? 79.978  49.859 -11.656 1.00 83.35  ? 39   DG  I N3    1 
ATOM   791   C  C4    . DG  A  1  39  ? 80.571  48.700 -11.301 1.00 82.98  ? 39   DG  I C4    1 
ATOM   792   P  P     . DG  A  1  40  ? 79.384  46.348 -17.291 1.00 72.27  ? 40   DG  I P     1 
ATOM   793   O  OP1   . DG  A  1  40  ? 78.366  46.654 -18.326 1.00 73.08  ? 40   DG  I OP1   1 
ATOM   794   O  OP2   . DG  A  1  40  ? 80.184  45.105 -17.392 1.00 71.41  ? 40   DG  I OP2   1 
ATOM   795   O  "O5'" . DG  A  1  40  ? 80.379  47.588 -17.181 1.00 73.72  ? 40   DG  I "O5'" 1 
ATOM   796   C  "C5'" . DG  A  1  40  ? 79.867  48.913 -17.037 1.00 76.59  ? 40   DG  I "C5'" 1 
ATOM   797   C  "C4'" . DG  A  1  40  ? 80.992  49.896 -16.801 1.00 78.75  ? 40   DG  I "C4'" 1 
ATOM   798   O  "O4'" . DG  A  1  40  ? 81.550  49.739 -15.473 1.00 79.12  ? 40   DG  I "O4'" 1 
ATOM   799   C  "C3'" . DG  A  1  40  ? 82.172  49.787 -17.767 1.00 80.06  ? 40   DG  I "C3'" 1 
ATOM   800   O  "O3'" . DG  A  1  40  ? 82.653  51.101 -18.041 1.00 83.09  ? 40   DG  I "O3'" 1 
ATOM   801   C  "C2'" . DG  A  1  40  ? 83.216  49.051 -16.947 1.00 79.74  ? 40   DG  I "C2'" 1 
ATOM   802   C  "C1'" . DG  A  1  40  ? 82.961  49.657 -15.583 1.00 79.81  ? 40   DG  I "C1'" 1 
ATOM   803   N  N9    . DG  A  1  40  ? 83.474  48.927 -14.427 1.00 80.00  ? 40   DG  I N9    1 
ATOM   804   C  C8    . DG  A  1  40  ? 83.820  47.599 -14.348 1.00 80.10  ? 40   DG  I C8    1 
ATOM   805   N  N7    . DG  A  1  40  ? 84.261  47.254 -13.168 1.00 79.64  ? 40   DG  I N7    1 
ATOM   806   C  C5    . DG  A  1  40  ? 84.201  48.424 -12.424 1.00 80.46  ? 40   DG  I C5    1 
ATOM   807   C  C6    . DG  A  1  40  ? 84.550  48.676 -11.070 1.00 81.06  ? 40   DG  I C6    1 
ATOM   808   O  O6    . DG  A  1  40  ? 84.998  47.887 -10.228 1.00 81.96  ? 40   DG  I O6    1 
ATOM   809   N  N1    . DG  A  1  40  ? 84.328  50.005 -10.725 1.00 80.52  ? 40   DG  I N1    1 
ATOM   810   C  C2    . DG  A  1  40  ? 83.836  50.970 -11.569 1.00 80.93  ? 40   DG  I C2    1 
ATOM   811   N  N2    . DG  A  1  40  ? 83.695  52.197 -11.052 1.00 80.37  ? 40   DG  I N2    1 
ATOM   812   N  N3    . DG  A  1  40  ? 83.509  50.749 -12.830 1.00 80.36  ? 40   DG  I N3    1 
ATOM   813   C  C4    . DG  A  1  40  ? 83.715  49.464 -13.187 1.00 80.36  ? 40   DG  I C4    1 
ATOM   814   P  P     . DA  A  1  41  ? 82.704  51.635 -19.550 1.00 85.40  ? 41   DA  I P     1 
ATOM   815   O  OP1   . DA  A  1  41  ? 81.358  51.417 -20.133 1.00 85.96  ? 41   DA  I OP1   1 
ATOM   816   O  OP2   . DA  A  1  41  ? 83.901  51.068 -20.221 1.00 85.70  ? 41   DA  I OP2   1 
ATOM   817   O  "O5'" . DA  A  1  41  ? 82.923  53.200 -19.375 1.00 87.77  ? 41   DA  I "O5'" 1 
ATOM   818   C  "C5'" . DA  A  1  41  ? 81.917  54.007 -18.771 1.00 92.40  ? 41   DA  I "C5'" 1 
ATOM   819   C  "C4'" . DA  A  1  41  ? 82.544  55.029 -17.851 1.00 95.23  ? 41   DA  I "C4'" 1 
ATOM   820   O  "O4'" . DA  A  1  41  ? 83.087  54.383 -16.674 1.00 95.31  ? 41   DA  I "O4'" 1 
ATOM   821   C  "C3'" . DA  A  1  41  ? 83.692  55.830 -18.460 1.00 96.89  ? 41   DA  I "C3'" 1 
ATOM   822   O  "O3'" . DA  A  1  41  ? 83.601  57.188 -18.023 1.00 100.46 ? 41   DA  I "O3'" 1 
ATOM   823   C  "C2'" . DA  A  1  41  ? 84.930  55.149 -17.903 1.00 96.03  ? 41   DA  I "C2'" 1 
ATOM   824   C  "C1'" . DA  A  1  41  ? 84.463  54.706 -16.528 1.00 95.08  ? 41   DA  I "C1'" 1 
ATOM   825   N  N9    . DA  A  1  41  ? 85.144  53.525 -15.997 1.00 94.87  ? 41   DA  I N9    1 
ATOM   826   C  C8    . DA  A  1  41  ? 85.362  52.321 -16.624 1.00 94.38  ? 41   DA  I C8    1 
ATOM   827   N  N7    . DA  A  1  41  ? 85.981  51.439 -15.877 1.00 93.93  ? 41   DA  I N7    1 
ATOM   828   C  C5    . DA  A  1  41  ? 86.191  52.108 -14.678 1.00 94.35  ? 41   DA  I C5    1 
ATOM   829   C  C6    . DA  A  1  41  ? 86.798  51.719 -13.470 1.00 93.85  ? 41   DA  I C6    1 
ATOM   830   N  N6    . DA  A  1  41  ? 87.322  50.509 -13.259 1.00 93.66  ? 41   DA  I N6    1 
ATOM   831   N  N1    . DA  A  1  41  ? 86.850  52.626 -12.473 1.00 93.59  ? 41   DA  I N1    1 
ATOM   832   C  C2    . DA  A  1  41  ? 86.321  53.837 -12.681 1.00 94.21  ? 41   DA  I C2    1 
ATOM   833   N  N3    . DA  A  1  41  ? 85.721  54.321 -13.766 1.00 94.82  ? 41   DA  I N3    1 
ATOM   834   C  C4    . DA  A  1  41  ? 85.687  53.396 -14.741 1.00 94.68  ? 41   DA  I C4    1 
ATOM   835   P  P     . DA  A  1  42  ? 84.822  58.194 -18.286 1.00 103.19 ? 42   DA  I P     1 
ATOM   836   O  OP1   . DA  A  1  42  ? 84.349  59.572 -18.006 1.00 103.53 ? 42   DA  I OP1   1 
ATOM   837   O  OP2   . DA  A  1  42  ? 85.409  57.872 -19.614 1.00 103.42 ? 42   DA  I OP2   1 
ATOM   838   O  "O5'" . DA  A  1  42  ? 85.870  57.795 -17.157 1.00 105.16 ? 42   DA  I "O5'" 1 
ATOM   839   C  "C5'" . DA  A  1  42  ? 85.633  58.143 -15.796 1.00 108.14 ? 42   DA  I "C5'" 1 
ATOM   840   C  "C4'" . DA  A  1  42  ? 86.941  58.229 -15.049 1.00 110.04 ? 42   DA  I "C4'" 1 
ATOM   841   O  "O4'" . DA  A  1  42  ? 87.381  56.911 -14.640 1.00 110.08 ? 42   DA  I "O4'" 1 
ATOM   842   C  "C3'" . DA  A  1  42  ? 88.079  58.825 -15.877 1.00 111.27 ? 42   DA  I "C3'" 1 
ATOM   843   O  "O3'" . DA  A  1  42  ? 88.862  59.713 -15.081 1.00 113.31 ? 42   DA  I "O3'" 1 
ATOM   844   C  "C2'" . DA  A  1  42  ? 88.897  57.610 -16.277 1.00 111.08 ? 42   DA  I "C2'" 1 
ATOM   845   C  "C1'" . DA  A  1  42  ? 88.711  56.695 -15.082 1.00 110.97 ? 42   DA  I "C1'" 1 
ATOM   846   N  N9    . DA  A  1  42  ? 88.864  55.271 -15.378 1.00 111.44 ? 42   DA  I N9    1 
ATOM   847   C  C8    . DA  A  1  42  ? 88.548  54.611 -16.539 1.00 111.61 ? 42   DA  I C8    1 
ATOM   848   N  N7    . DA  A  1  42  ? 88.810  53.327 -16.505 1.00 111.99 ? 42   DA  I N7    1 
ATOM   849   C  C5    . DA  A  1  42  ? 89.331  53.126 -15.234 1.00 111.66 ? 42   DA  I C5    1 
ATOM   850   C  C6    . DA  A  1  42  ? 89.803  51.976 -14.574 1.00 111.42 ? 42   DA  I C6    1 
ATOM   851   N  N6    . DA  A  1  42  ? 89.826  50.761 -15.126 1.00 110.95 ? 42   DA  I N6    1 
ATOM   852   N  N1    . DA  A  1  42  ? 90.256  52.118 -13.310 1.00 111.34 ? 42   DA  I N1    1 
ATOM   853   C  C2    . DA  A  1  42  ? 90.232  53.335 -12.755 1.00 111.32 ? 42   DA  I C2    1 
ATOM   854   N  N3    . DA  A  1  42  ? 89.813  54.489 -13.271 1.00 111.61 ? 42   DA  I N3    1 
ATOM   855   C  C4    . DA  A  1  42  ? 89.369  54.314 -14.528 1.00 111.67 ? 42   DA  I C4    1 
ATOM   856   P  P     . DA  A  1  43  ? 89.972  60.637 -15.781 1.00 114.61 ? 43   DA  I P     1 
ATOM   857   O  OP1   . DA  A  1  43  ? 89.686  62.055 -15.442 1.00 114.31 ? 43   DA  I OP1   1 
ATOM   858   O  OP2   . DA  A  1  43  ? 90.071  60.226 -17.206 1.00 114.81 ? 43   DA  I OP2   1 
ATOM   859   O  "O5'" . DA  A  1  43  ? 91.316  60.202 -15.050 1.00 114.31 ? 43   DA  I "O5'" 1 
ATOM   860   C  "C5'" . DA  A  1  43  ? 91.402  60.224 -13.630 1.00 114.03 ? 43   DA  I "C5'" 1 
ATOM   861   C  "C4'" . DA  A  1  43  ? 92.660  59.523 -13.177 1.00 113.82 ? 43   DA  I "C4'" 1 
ATOM   862   O  "O4'" . DA  A  1  43  ? 92.513  58.088 -13.319 1.00 113.72 ? 43   DA  I "O4'" 1 
ATOM   863   C  "C3'" . DA  A  1  43  ? 93.903  59.906 -13.980 1.00 113.53 ? 43   DA  I "C3'" 1 
ATOM   864   O  "O3'" . DA  A  1  43  ? 95.023  60.059 -13.107 1.00 113.08 ? 43   DA  I "O3'" 1 
ATOM   865   C  "C2'" . DA  A  1  43  ? 94.104  58.722 -14.910 1.00 113.23 ? 43   DA  I "C2'" 1 
ATOM   866   C  "C1'" . DA  A  1  43  ? 93.606  57.568 -14.061 1.00 113.18 ? 43   DA  I "C1'" 1 
ATOM   867   N  N9    . DA  A  1  43  ? 93.134  56.411 -14.823 1.00 112.33 ? 43   DA  I N9    1 
ATOM   868   C  C8    . DA  A  1  43  ? 92.374  56.404 -15.967 1.00 112.01 ? 43   DA  I C8    1 
ATOM   869   N  N7    . DA  A  1  43  ? 92.124  55.202 -16.427 1.00 111.52 ? 43   DA  I N7    1 
ATOM   870   C  C5    . DA  A  1  43  ? 92.759  54.360 -15.524 1.00 111.41 ? 43   DA  I C5    1 
ATOM   871   C  C6    . DA  A  1  43  ? 92.872  52.961 -15.454 1.00 111.10 ? 43   DA  I C6    1 
ATOM   872   N  N6    . DA  A  1  43  ? 92.332  52.128 -16.346 1.00 111.32 ? 43   DA  I N6    1 
ATOM   873   N  N1    . DA  A  1  43  ? 93.569  52.438 -14.423 1.00 110.81 ? 43   DA  I N1    1 
ATOM   874   C  C2    . DA  A  1  43  ? 94.115  53.272 -13.533 1.00 110.91 ? 43   DA  I C2    1 
ATOM   875   N  N3    . DA  A  1  43  ? 94.084  54.602 -13.493 1.00 111.26 ? 43   DA  I N3    1 
ATOM   876   C  C4    . DA  A  1  43  ? 93.381  55.090 -14.529 1.00 111.64 ? 43   DA  I C4    1 
ATOM   877   P  P     . DC  A  1  44  ? 96.478  60.340 -13.723 1.00 112.58 ? 44   DC  I P     1 
ATOM   878   O  OP1   . DC  A  1  44  ? 97.192  61.254 -12.792 1.00 112.82 ? 44   DC  I OP1   1 
ATOM   879   O  OP2   . DC  A  1  44  ? 96.320  60.722 -15.150 1.00 111.94 ? 44   DC  I OP2   1 
ATOM   880   O  "O5'" . DC  A  1  44  ? 97.176  58.913 -13.651 1.00 111.60 ? 44   DC  I "O5'" 1 
ATOM   881   C  "C5'" . DC  A  1  44  ? 97.279  58.227 -12.408 1.00 111.21 ? 44   DC  I "C5'" 1 
ATOM   882   C  "C4'" . DC  A  1  44  ? 98.142  56.998 -12.562 1.00 110.89 ? 44   DC  I "C4'" 1 
ATOM   883   O  "O4'" . DC  A  1  44  ? 97.412  55.959 -13.260 1.00 110.80 ? 44   DC  I "O4'" 1 
ATOM   884   C  "C3'" . DC  A  1  44  ? 99.420  57.234 -13.367 1.00 110.61 ? 44   DC  I "C3'" 1 
ATOM   885   O  "O3'" . DC  A  1  44  ? 100.505 56.515 -12.780 1.00 110.35 ? 44   DC  I "O3'" 1 
ATOM   886   C  "C2'" . DC  A  1  44  ? 99.086  56.656 -14.730 1.00 110.33 ? 44   DC  I "C2'" 1 
ATOM   887   C  "C1'" . DC  A  1  44  ? 98.189  55.494 -14.351 1.00 110.14 ? 44   DC  I "C1'" 1 
ATOM   888   N  N1    . DC  A  1  44  ? 97.273  55.036 -15.408 1.00 109.53 ? 44   DC  I N1    1 
ATOM   889   C  C2    . DC  A  1  44  ? 96.999  53.669 -15.508 1.00 109.06 ? 44   DC  I C2    1 
ATOM   890   O  O2    . DC  A  1  44  ? 97.518  52.893 -14.691 1.00 108.62 ? 44   DC  I O2    1 
ATOM   891   N  N3    . DC  A  1  44  ? 96.177  53.228 -16.487 1.00 108.83 ? 44   DC  I N3    1 
ATOM   892   C  C4    . DC  A  1  44  ? 95.634  54.097 -17.342 1.00 108.90 ? 44   DC  I C4    1 
ATOM   893   N  N4    . DC  A  1  44  ? 94.836  53.616 -18.297 1.00 108.45 ? 44   DC  I N4    1 
ATOM   894   C  C5    . DC  A  1  44  ? 95.887  55.498 -17.256 1.00 109.00 ? 44   DC  I C5    1 
ATOM   895   C  C6    . DC  A  1  44  ? 96.704  55.920 -16.283 1.00 109.28 ? 44   DC  I C6    1 
ATOM   896   P  P     . DT  A  1  45  ? 101.888 56.382 -13.581 1.00 110.10 ? 45   DT  I P     1 
ATOM   897   O  OP1   . DT  A  1  45  ? 102.961 56.069 -12.602 1.00 110.22 ? 45   DT  I OP1   1 
ATOM   898   O  OP2   . DT  A  1  45  ? 102.013 57.575 -14.460 1.00 109.47 ? 45   DT  I OP2   1 
ATOM   899   O  "O5'" . DT  A  1  45  ? 101.665 55.104 -14.503 1.00 109.71 ? 45   DT  I "O5'" 1 
ATOM   900   C  "C5'" . DT  A  1  45  ? 101.631 53.797 -13.935 1.00 108.98 ? 45   DT  I "C5'" 1 
ATOM   901   C  "C4'" . DT  A  1  45  ? 102.000 52.766 -14.976 1.00 108.57 ? 45   DT  I "C4'" 1 
ATOM   902   O  "O4'" . DT  A  1  45  ? 100.906 52.561 -15.902 1.00 108.50 ? 45   DT  I "O4'" 1 
ATOM   903   C  "C3'" . DT  A  1  45  ? 103.214 53.134 -15.829 1.00 108.14 ? 45   DT  I "C3'" 1 
ATOM   904   O  "O3'" . DT  A  1  45  ? 103.978 51.958 -16.088 1.00 107.72 ? 45   DT  I "O3'" 1 
ATOM   905   C  "C2'" . DT  A  1  45  ? 102.588 53.628 -17.122 1.00 107.79 ? 45   DT  I "C2'" 1 
ATOM   906   C  "C1'" . DT  A  1  45  ? 101.381 52.716 -17.230 1.00 107.53 ? 45   DT  I "C1'" 1 
ATOM   907   N  N1    . DT  A  1  45  ? 100.265 53.207 -18.061 1.00 106.55 ? 45   DT  I N1    1 
ATOM   908   C  C2    . DT  A  1  45  ? 99.411  52.266 -18.582 1.00 106.23 ? 45   DT  I C2    1 
ATOM   909   O  O2    . DT  A  1  45  ? 99.541  51.069 -18.381 1.00 105.84 ? 45   DT  I O2    1 
ATOM   910   N  N3    . DT  A  1  45  ? 98.393  52.776 -19.348 1.00 106.16 ? 45   DT  I N3    1 
ATOM   911   C  C4    . DT  A  1  45  ? 98.150  54.105 -19.636 1.00 106.22 ? 45   DT  I C4    1 
ATOM   912   O  O4    . DT  A  1  45  ? 97.191  54.414 -20.339 1.00 105.90 ? 45   DT  I O4    1 
ATOM   913   C  C5    . DT  A  1  45  ? 99.087  55.041 -19.056 1.00 106.09 ? 45   DT  I C5    1 
ATOM   914   C  C7    . DT  A  1  45  ? 98.905  56.503 -19.317 1.00 105.67 ? 45   DT  I C7    1 
ATOM   915   C  C6    . DT  A  1  45  ? 100.085 54.552 -18.307 1.00 106.07 ? 45   DT  I C6    1 
ATOM   916   P  P     . DG  A  1  46  ? 105.508 51.884 -15.616 1.00 107.08 ? 46   DG  I P     1 
ATOM   917   O  OP1   . DG  A  1  46  ? 105.533 52.212 -14.169 1.00 107.70 ? 46   DG  I OP1   1 
ATOM   918   O  OP2   . DG  A  1  46  ? 106.330 52.675 -16.566 1.00 107.43 ? 46   DG  I OP2   1 
ATOM   919   O  "O5'" . DG  A  1  46  ? 105.874 50.344 -15.788 1.00 106.42 ? 46   DG  I "O5'" 1 
ATOM   920   C  "C5'" . DG  A  1  46  ? 105.188 49.349 -15.033 1.00 105.02 ? 46   DG  I "C5'" 1 
ATOM   921   C  "C4'" . DG  A  1  46  ? 104.711 48.237 -15.939 1.00 104.03 ? 46   DG  I "C4'" 1 
ATOM   922   O  "O4'" . DG  A  1  46  ? 103.680 48.726 -16.830 1.00 104.08 ? 46   DG  I "O4'" 1 
ATOM   923   C  "C3'" . DG  A  1  46  ? 105.783 47.622 -16.837 1.00 103.40 ? 46   DG  I "C3'" 1 
ATOM   924   O  "O3'" . DG  A  1  46  ? 105.555 46.215 -16.943 1.00 102.01 ? 46   DG  I "O3'" 1 
ATOM   925   C  "C2'" . DG  A  1  46  ? 105.547 48.300 -18.176 1.00 103.15 ? 46   DG  I "C2'" 1 
ATOM   926   C  "C1'" . DG  A  1  46  ? 104.039 48.458 -18.179 1.00 103.44 ? 46   DG  I "C1'" 1 
ATOM   927   N  N9    . DG  A  1  46  ? 103.527 49.550 -19.003 1.00 102.95 ? 46   DG  I N9    1 
ATOM   928   C  C8    . DG  A  1  46  ? 103.856 50.882 -18.917 1.00 102.80 ? 46   DG  I C8    1 
ATOM   929   N  N7    . DG  A  1  46  ? 103.199 51.629 -19.763 1.00 102.48 ? 46   DG  I N7    1 
ATOM   930   C  C5    . DG  A  1  46  ? 102.393 50.736 -20.456 1.00 102.11 ? 46   DG  I C5    1 
ATOM   931   C  C6    . DG  A  1  46  ? 101.448 50.963 -21.493 1.00 101.32 ? 46   DG  I C6    1 
ATOM   932   O  O6    . DG  A  1  46  ? 101.116 52.033 -22.014 1.00 100.07 ? 46   DG  I O6    1 
ATOM   933   N  N1    . DG  A  1  46  ? 100.860 49.776 -21.916 1.00 101.09 ? 46   DG  I N1    1 
ATOM   934   C  C2    . DG  A  1  46  ? 101.136 48.531 -21.405 1.00 101.63 ? 46   DG  I C2    1 
ATOM   935   N  N2    . DG  A  1  46  ? 100.464 47.506 -21.952 1.00 101.06 ? 46   DG  I N2    1 
ATOM   936   N  N3    . DG  A  1  46  ? 102.006 48.307 -20.432 1.00 101.86 ? 46   DG  I N3    1 
ATOM   937   C  C4    . DG  A  1  46  ? 102.593 49.447 -20.008 1.00 102.40 ? 46   DG  I C4    1 
ATOM   938   P  P     . DC  A  1  47  ? 106.710 45.264 -17.522 1.00 101.51 ? 47   DC  I P     1 
ATOM   939   O  OP1   . DC  A  1  47  ? 106.740 44.014 -16.720 1.00 100.61 ? 47   DC  I OP1   1 
ATOM   940   O  OP2   . DC  A  1  47  ? 107.944 46.081 -17.664 1.00 101.15 ? 47   DC  I OP2   1 
ATOM   941   O  "O5'" . DC  A  1  47  ? 106.193 44.899 -18.980 1.00 100.68 ? 47   DC  I "O5'" 1 
ATOM   942   C  "C5'" . DC  A  1  47  ? 104.975 44.185 -19.160 1.00 98.44  ? 47   DC  I "C5'" 1 
ATOM   943   C  "C4'" . DC  A  1  47  ? 104.650 44.083 -20.630 1.00 96.68  ? 47   DC  I "C4'" 1 
ATOM   944   O  "O4'" . DC  A  1  47  ? 104.255 45.379 -21.139 1.00 95.63  ? 47   DC  I "O4'" 1 
ATOM   945   C  "C3'" . DC  A  1  47  ? 105.829 43.631 -21.489 1.00 96.20  ? 47   DC  I "C3'" 1 
ATOM   946   O  "O3'" . DC  A  1  47  ? 105.360 42.779 -22.527 1.00 96.76  ? 47   DC  I "O3'" 1 
ATOM   947   C  "C2'" . DC  A  1  47  ? 106.344 44.928 -22.084 1.00 95.52  ? 47   DC  I "C2'" 1 
ATOM   948   C  "C1'" . DC  A  1  47  ? 105.058 45.713 -22.258 1.00 94.81  ? 47   DC  I "C1'" 1 
ATOM   949   N  N1    . DC  A  1  47  ? 105.213 47.174 -22.285 1.00 94.02  ? 47   DC  I N1    1 
ATOM   950   C  C2    . DC  A  1  47  ? 104.354 47.920 -23.092 1.00 93.50  ? 47   DC  I C2    1 
ATOM   951   O  O2    . DC  A  1  47  ? 103.484 47.328 -23.745 1.00 93.14  ? 47   DC  I O2    1 
ATOM   952   N  N3    . DC  A  1  47  ? 104.490 49.263 -23.140 1.00 93.31  ? 47   DC  I N3    1 
ATOM   953   C  C4    . DC  A  1  47  ? 105.435 49.863 -22.416 1.00 93.27  ? 47   DC  I C4    1 
ATOM   954   N  N4    . DC  A  1  47  ? 105.536 51.192 -22.498 1.00 92.74  ? 47   DC  I N4    1 
ATOM   955   C  C5    . DC  A  1  47  ? 106.321 49.127 -21.577 1.00 93.54  ? 47   DC  I C5    1 
ATOM   956   C  C6    . DC  A  1  47  ? 106.176 47.797 -21.543 1.00 93.62  ? 47   DC  I C6    1 
ATOM   957   P  P     . DT  A  1  48  ? 105.941 41.293 -22.654 1.00 97.21  ? 48   DT  I P     1 
ATOM   958   O  OP1   . DT  A  1  48  ? 105.380 40.476 -21.546 1.00 97.21  ? 48   DT  I OP1   1 
ATOM   959   O  OP2   . DT  A  1  48  ? 107.413 41.400 -22.824 1.00 97.42  ? 48   DT  I OP2   1 
ATOM   960   O  "O5'" . DT  A  1  48  ? 105.324 40.772 -24.022 1.00 96.72  ? 48   DT  I "O5'" 1 
ATOM   961   C  "C5'" . DT  A  1  48  ? 105.343 41.594 -25.182 1.00 94.72  ? 48   DT  I "C5'" 1 
ATOM   962   C  "C4'" . DT  A  1  48  ? 103.934 41.991 -25.555 1.00 92.32  ? 48   DT  I "C4'" 1 
ATOM   963   O  "O4'" . DT  A  1  48  ? 103.748 43.397 -25.279 1.00 92.53  ? 48   DT  I "O4'" 1 
ATOM   964   C  "C3'" . DT  A  1  48  ? 103.636 41.815 -27.037 1.00 90.33  ? 48   DT  I "C3'" 1 
ATOM   965   O  "O3'" . DT  A  1  48  ? 102.282 41.411 -27.229 1.00 86.44  ? 48   DT  I "O3'" 1 
ATOM   966   C  "C2'" . DT  A  1  48  ? 103.911 43.185 -27.625 1.00 91.29  ? 48   DT  I "C2'" 1 
ATOM   967   C  "C1'" . DT  A  1  48  ? 103.610 44.140 -26.483 1.00 91.86  ? 48   DT  I "C1'" 1 
ATOM   968   N  N1    . DT  A  1  48  ? 104.562 45.258 -26.416 1.00 92.70  ? 48   DT  I N1    1 
ATOM   969   C  C2    . DT  A  1  48  ? 104.143 46.511 -26.798 1.00 93.30  ? 48   DT  I C2    1 
ATOM   970   O  O2    . DT  A  1  48  ? 103.019 46.745 -27.209 1.00 93.49  ? 48   DT  I O2    1 
ATOM   971   N  N3    . DT  A  1  48  ? 105.097 47.489 -26.682 1.00 93.90  ? 48   DT  I N3    1 
ATOM   972   C  C4    . DT  A  1  48  ? 106.395 47.342 -26.234 1.00 94.30  ? 48   DT  I C4    1 
ATOM   973   O  O4    . DT  A  1  48  ? 107.136 48.321 -26.175 1.00 94.78  ? 48   DT  I O4    1 
ATOM   974   C  C5    . DT  A  1  48  ? 106.768 45.998 -25.862 1.00 94.15  ? 48   DT  I C5    1 
ATOM   975   C  C7    . DT  A  1  48  ? 108.157 45.738 -25.373 1.00 94.14  ? 48   DT  I C7    1 
ATOM   976   C  C6    . DT  A  1  48  ? 105.846 45.037 -25.971 1.00 93.30  ? 48   DT  I C6    1 
ATOM   977   P  P     . DC  A  1  49  ? 101.917 40.463 -28.467 1.00 82.32  ? 49   DC  I P     1 
ATOM   978   O  OP1   . DC  A  1  49  ? 100.539 39.957 -28.286 1.00 82.91  ? 49   DC  I OP1   1 
ATOM   979   O  OP2   . DC  A  1  49  ? 103.038 39.502 -28.610 1.00 83.97  ? 49   DC  I OP2   1 
ATOM   980   O  "O5'" . DC  A  1  49  ? 101.947 41.456 -29.708 1.00 80.39  ? 49   DC  I "O5'" 1 
ATOM   981   C  "C5'" . DC  A  1  49  ? 101.062 42.569 -29.764 1.00 76.51  ? 49   DC  I "C5'" 1 
ATOM   982   C  "C4'" . DC  A  1  49  ? 101.554 43.580 -30.772 1.00 74.62  ? 49   DC  I "C4'" 1 
ATOM   983   O  "O4'" . DC  A  1  49  ? 102.690 44.316 -30.261 1.00 75.48  ? 49   DC  I "O4'" 1 
ATOM   984   C  "C3'" . DC  A  1  49  ? 102.005 42.992 -32.110 1.00 72.64  ? 49   DC  I "C3'" 1 
ATOM   985   O  "O3'" . DC  A  1  49  ? 101.665 43.914 -33.143 1.00 68.10  ? 49   DC  I "O3'" 1 
ATOM   986   C  "C2'" . DC  A  1  49  ? 103.516 42.979 -31.978 1.00 74.58  ? 49   DC  I "C2'" 1 
ATOM   987   C  "C1'" . DC  A  1  49  ? 103.722 44.283 -31.235 1.00 77.34  ? 49   DC  I "C1'" 1 
ATOM   988   N  N1    . DC  A  1  49  ? 105.012 44.460 -30.551 1.00 79.30  ? 49   DC  I N1    1 
ATOM   989   C  C2    . DC  A  1  49  ? 105.425 45.758 -30.253 1.00 80.48  ? 49   DC  I C2    1 
ATOM   990   O  O2    . DC  A  1  49  ? 104.707 46.705 -30.604 1.00 79.03  ? 49   DC  I O2    1 
ATOM   991   N  N3    . DC  A  1  49  ? 106.592 45.948 -29.597 1.00 82.23  ? 49   DC  I N3    1 
ATOM   992   C  C4    . DC  A  1  49  ? 107.339 44.898 -29.249 1.00 82.78  ? 49   DC  I C4    1 
ATOM   993   N  N4    . DC  A  1  49  ? 108.475 45.133 -28.588 1.00 84.75  ? 49   DC  I N4    1 
ATOM   994   C  C5    . DC  A  1  49  ? 106.952 43.562 -29.559 1.00 81.71  ? 49   DC  I C5    1 
ATOM   995   C  C6    . DC  A  1  49  ? 105.792 43.390 -30.205 1.00 80.57  ? 49   DC  I C6    1 
ATOM   996   P  P     . DC  A  1  50  ? 100.287 43.746 -33.945 1.00 63.32  ? 50   DC  I P     1 
ATOM   997   O  OP1   . DC  A  1  50  ? 99.187  43.671 -32.952 1.00 60.30  ? 50   DC  I OP1   1 
ATOM   998   O  OP2   . DC  A  1  50  ? 100.461 42.655 -34.938 1.00 62.87  ? 50   DC  I OP2   1 
ATOM   999   O  "O5'" . DC  A  1  50  ? 100.167 45.127 -34.720 1.00 62.53  ? 50   DC  I "O5'" 1 
ATOM   1000  C  "C5'" . DC  A  1  50  ? 99.652  46.278 -34.065 1.00 62.97  ? 50   DC  I "C5'" 1 
ATOM   1001  C  "C4'" . DC  A  1  50  ? 100.381 47.514 -34.535 1.00 63.51  ? 50   DC  I "C4'" 1 
ATOM   1002  O  "O4'" . DC  A  1  50  ? 101.678 47.623 -33.896 1.00 66.29  ? 50   DC  I "O4'" 1 
ATOM   1003  C  "C3'" . DC  A  1  50  ? 100.634 47.571 -36.040 1.00 62.83  ? 50   DC  I "C3'" 1 
ATOM   1004  O  "O3'" . DC  A  1  50  ? 100.357 48.886 -36.507 1.00 61.32  ? 50   DC  I "O3'" 1 
ATOM   1005  C  "C2'" . DC  A  1  50  ? 102.115 47.257 -36.167 1.00 65.80  ? 50   DC  I "C2'" 1 
ATOM   1006  C  "C1'" . DC  A  1  50  ? 102.688 47.817 -34.872 1.00 67.54  ? 50   DC  I "C1'" 1 
ATOM   1007  N  N1    . DC  A  1  50  ? 103.912 47.143 -34.393 1.00 69.92  ? 50   DC  I N1    1 
ATOM   1008  C  C2    . DC  A  1  50  ? 104.964 47.921 -33.863 1.00 71.26  ? 50   DC  I C2    1 
ATOM   1009  O  O2    . DC  A  1  50  ? 104.840 49.154 -33.813 1.00 70.81  ? 50   DC  I O2    1 
ATOM   1010  N  N3    . DC  A  1  50  ? 106.083 47.303 -33.423 1.00 71.86  ? 50   DC  I N3    1 
ATOM   1011  C  C4    . DC  A  1  50  ? 106.185 45.973 -33.499 1.00 73.34  ? 50   DC  I C4    1 
ATOM   1012  N  N4    . DC  A  1  50  ? 107.307 45.404 -33.054 1.00 73.92  ? 50   DC  I N4    1 
ATOM   1013  C  C5    . DC  A  1  50  ? 105.140 45.164 -34.035 1.00 71.98  ? 50   DC  I C5    1 
ATOM   1014  C  C6    . DC  A  1  50  ? 104.032 45.784 -34.462 1.00 70.57  ? 50   DC  I C6    1 
ATOM   1015  P  P     . DA  A  1  51  ? 100.239 49.166 -38.079 1.00 61.03  ? 51   DA  I P     1 
ATOM   1016  O  OP1   . DA  A  1  51  ? 98.911  49.767 -38.349 1.00 60.94  ? 51   DA  I OP1   1 
ATOM   1017  O  OP2   . DA  A  1  51  ? 100.651 47.936 -38.798 1.00 61.26  ? 51   DA  I OP2   1 
ATOM   1018  O  "O5'" . DA  A  1  51  ? 101.321 50.308 -38.311 1.00 64.13  ? 51   DA  I "O5'" 1 
ATOM   1019  C  "C5'" . DA  A  1  51  ? 101.294 51.489 -37.511 1.00 69.42  ? 51   DA  I "C5'" 1 
ATOM   1020  C  "C4'" . DA  A  1  51  ? 102.534 52.316 -37.750 1.00 73.89  ? 51   DA  I "C4'" 1 
ATOM   1021  O  "O4'" . DA  A  1  51  ? 103.691 51.640 -37.207 1.00 74.24  ? 51   DA  I "O4'" 1 
ATOM   1022  C  "C3'" . DA  A  1  51  ? 102.849 52.583 -39.219 1.00 76.21  ? 51   DA  I "C3'" 1 
ATOM   1023  O  "O3'" . DA  A  1  51  ? 103.331 53.921 -39.352 1.00 81.11  ? 51   DA  I "O3'" 1 
ATOM   1024  C  "C2'" . DA  A  1  51  ? 103.915 51.553 -39.547 1.00 75.23  ? 51   DA  I "C2'" 1 
ATOM   1025  C  "C1'" . DA  A  1  51  ? 104.650 51.400 -38.226 1.00 75.79  ? 51   DA  I "C1'" 1 
ATOM   1026  N  N9    . DA  A  1  51  ? 105.212 50.070 -37.995 1.00 77.35  ? 51   DA  I N9    1 
ATOM   1027  C  C8    . DA  A  1  51  ? 104.695 48.859 -38.382 1.00 78.23  ? 51   DA  I C8    1 
ATOM   1028  N  N7    . DA  A  1  51  ? 105.419 47.831 -38.011 1.00 78.89  ? 51   DA  I N7    1 
ATOM   1029  C  C5    . DA  A  1  51  ? 106.488 48.402 -37.336 1.00 79.34  ? 51   DA  I C5    1 
ATOM   1030  C  C6    . DA  A  1  51  ? 107.612 47.844 -36.698 1.00 80.23  ? 51   DA  I C6    1 
ATOM   1031  N  N6    . DA  A  1  51  ? 107.850 46.530 -36.630 1.00 79.49  ? 51   DA  I N6    1 
ATOM   1032  N  N1    . DA  A  1  51  ? 108.493 48.694 -36.125 1.00 80.26  ? 51   DA  I N1    1 
ATOM   1033  C  C2    . DA  A  1  51  ? 108.253 50.010 -36.193 1.00 80.40  ? 51   DA  I C2    1 
ATOM   1034  N  N3    . DA  A  1  51  ? 107.235 50.654 -36.763 1.00 80.02  ? 51   DA  I N3    1 
ATOM   1035  C  C4    . DA  A  1  51  ? 106.377 49.782 -37.323 1.00 79.46  ? 51   DA  I C4    1 
ATOM   1036  P  P     . DT  A  1  52  ? 103.890 54.434 -40.763 1.00 85.41  ? 52   DT  I P     1 
ATOM   1037  O  OP1   . DT  A  1  52  ? 103.733 55.910 -40.795 1.00 84.41  ? 52   DT  I OP1   1 
ATOM   1038  O  OP2   . DT  A  1  52  ? 103.294 53.605 -41.843 1.00 85.18  ? 52   DT  I OP2   1 
ATOM   1039  O  "O5'" . DT  A  1  52  ? 105.441 54.090 -40.670 1.00 87.97  ? 52   DT  I "O5'" 1 
ATOM   1040  C  "C5'" . DT  A  1  52  ? 106.223 54.593 -39.591 1.00 90.16  ? 52   DT  I "C5'" 1 
ATOM   1041  C  "C4'" . DT  A  1  52  ? 107.678 54.244 -39.788 1.00 91.88  ? 52   DT  I "C4'" 1 
ATOM   1042  O  "O4'" . DT  A  1  52  ? 107.958 52.887 -39.364 1.00 91.30  ? 52   DT  I "O4'" 1 
ATOM   1043  C  "C3'" . DT  A  1  52  ? 108.174 54.356 -41.230 1.00 93.29  ? 52   DT  I "C3'" 1 
ATOM   1044  O  "O3'" . DT  A  1  52  ? 109.443 55.001 -41.240 1.00 97.62  ? 52   DT  I "O3'" 1 
ATOM   1045  C  "C2'" . DT  A  1  52  ? 108.335 52.908 -41.660 1.00 91.98  ? 52   DT  I "C2'" 1 
ATOM   1046  C  "C1'" . DT  A  1  52  ? 108.739 52.250 -40.356 1.00 90.78  ? 52   DT  I "C1'" 1 
ATOM   1047  N  N1    . DT  A  1  52  ? 108.500 50.799 -40.268 1.00 90.35  ? 52   DT  I N1    1 
ATOM   1048  C  C2    . DT  A  1  52  ? 109.391 50.049 -39.536 1.00 90.33  ? 52   DT  I C2    1 
ATOM   1049  O  O2    . DT  A  1  52  ? 110.344 50.534 -38.949 1.00 90.65  ? 52   DT  I O2    1 
ATOM   1050  N  N3    . DT  A  1  52  ? 109.123 48.704 -39.512 1.00 90.22  ? 52   DT  I N3    1 
ATOM   1051  C  C4    . DT  A  1  52  ? 108.075 48.051 -40.127 1.00 90.12  ? 52   DT  I C4    1 
ATOM   1052  O  O4    . DT  A  1  52  ? 107.963 46.834 -40.016 1.00 90.25  ? 52   DT  I O4    1 
ATOM   1053  C  C5    . DT  A  1  52  ? 107.173 48.899 -40.871 1.00 90.29  ? 52   DT  I C5    1 
ATOM   1054  C  C7    . DT  A  1  52  ? 106.002 48.280 -41.566 1.00 89.88  ? 52   DT  I C7    1 
ATOM   1055  C  C6    . DT  A  1  52  ? 107.428 50.213 -40.904 1.00 90.25  ? 52   DT  I C6    1 
ATOM   1056  P  P     . DC  A  1  53  ? 109.932 55.779 -42.552 1.00 99.73  ? 53   DC  I P     1 
ATOM   1057  O  OP1   . DC  A  1  53  ? 110.007 57.218 -42.195 1.00 99.84  ? 53   DC  I OP1   1 
ATOM   1058  O  OP2   . DC  A  1  53  ? 109.110 55.350 -43.709 1.00 99.84  ? 53   DC  I OP2   1 
ATOM   1059  O  "O5'" . DC  A  1  53  ? 111.409 55.226 -42.752 1.00 102.70 ? 53   DC  I "O5'" 1 
ATOM   1060  C  "C5'" . DC  A  1  53  ? 112.328 55.213 -41.663 1.00 107.89 ? 53   DC  I "C5'" 1 
ATOM   1061  C  "C4'" . DC  A  1  53  ? 113.422 54.203 -41.917 1.00 111.80 ? 53   DC  I "C4'" 1 
ATOM   1062  O  "O4'" . DC  A  1  53  ? 112.973 52.858 -41.609 1.00 112.13 ? 53   DC  I "O4'" 1 
ATOM   1063  C  "C3'" . DC  A  1  53  ? 113.910 54.170 -43.366 1.00 114.14 ? 53   DC  I "C3'" 1 
ATOM   1064  O  "O3'" . DC  A  1  53  ? 115.333 54.066 -43.404 1.00 117.33 ? 53   DC  I "O3'" 1 
ATOM   1065  C  "C2'" . DC  A  1  53  ? 113.290 52.899 -43.917 1.00 113.81 ? 53   DC  I "C2'" 1 
ATOM   1066  C  "C1'" . DC  A  1  53  ? 113.305 52.006 -42.691 1.00 113.21 ? 53   DC  I "C1'" 1 
ATOM   1067  N  N1    . DC  A  1  53  ? 112.355 50.880 -42.712 1.00 113.52 ? 53   DC  I N1    1 
ATOM   1068  C  C2    . DC  A  1  53  ? 112.582 49.800 -41.853 1.00 113.69 ? 53   DC  I C2    1 
ATOM   1069  O  O2    . DC  A  1  53  ? 113.552 49.842 -41.081 1.00 114.19 ? 53   DC  I O2    1 
ATOM   1070  N  N3    . DC  A  1  53  ? 111.739 48.741 -41.884 1.00 113.56 ? 53   DC  I N3    1 
ATOM   1071  C  C4    . DC  A  1  53  ? 110.700 48.741 -42.722 1.00 113.38 ? 53   DC  I C4    1 
ATOM   1072  N  N4    . DC  A  1  53  ? 109.899 47.672 -42.726 1.00 112.79 ? 53   DC  I N4    1 
ATOM   1073  C  C5    . DC  A  1  53  ? 110.435 49.835 -43.595 1.00 113.15 ? 53   DC  I C5    1 
ATOM   1074  C  C6    . DC  A  1  53  ? 111.279 50.875 -43.557 1.00 113.38 ? 53   DC  I C6    1 
ATOM   1075  P  P     . DA  A  1  54  ? 116.115 54.392 -44.766 1.00 119.52 ? 54   DA  I P     1 
ATOM   1076  O  OP1   . DA  A  1  54  ? 116.964 55.589 -44.539 1.00 119.76 ? 54   DA  I OP1   1 
ATOM   1077  O  OP2   . DA  A  1  54  ? 115.125 54.396 -45.874 1.00 119.57 ? 54   DA  I OP2   1 
ATOM   1078  O  "O5'" . DA  A  1  54  ? 117.059 53.125 -44.949 1.00 120.80 ? 54   DA  I "O5'" 1 
ATOM   1079  C  "C5'" . DA  A  1  54  ? 117.900 52.683 -43.884 1.00 123.16 ? 54   DA  I "C5'" 1 
ATOM   1080  C  "C4'" . DA  A  1  54  ? 118.430 51.302 -44.183 1.00 124.85 ? 54   DA  I "C4'" 1 
ATOM   1081  O  "O4'" . DA  A  1  54  ? 117.344 50.347 -44.112 1.00 125.16 ? 54   DA  I "O4'" 1 
ATOM   1082  C  "C3'" . DA  A  1  54  ? 119.029 51.159 -45.582 1.00 126.03 ? 54   DA  I "C3'" 1 
ATOM   1083  O  "O3'" . DA  A  1  54  ? 120.153 50.277 -45.545 1.00 127.60 ? 54   DA  I "O3'" 1 
ATOM   1084  C  "C2'" . DA  A  1  54  ? 117.895 50.548 -46.384 1.00 125.95 ? 54   DA  I "C2'" 1 
ATOM   1085  C  "C1'" . DA  A  1  54  ? 117.207 49.670 -45.353 1.00 125.79 ? 54   DA  I "C1'" 1 
ATOM   1086  N  N9    . DA  A  1  54  ? 115.779 49.463 -45.593 1.00 125.86 ? 54   DA  I N9    1 
ATOM   1087  C  C8    . DA  A  1  54  ? 114.879 50.336 -46.154 1.00 126.18 ? 54   DA  I C8    1 
ATOM   1088  N  N7    . DA  A  1  54  ? 113.659 49.863 -46.227 1.00 126.08 ? 54   DA  I N7    1 
ATOM   1089  C  C5    . DA  A  1  54  ? 113.761 48.593 -45.678 1.00 125.82 ? 54   DA  I C5    1 
ATOM   1090  C  C6    . DA  A  1  54  ? 112.814 47.581 -45.459 1.00 125.74 ? 54   DA  I C6    1 
ATOM   1091  N  N6    . DA  A  1  54  ? 111.523 47.695 -45.776 1.00 125.84 ? 54   DA  I N6    1 
ATOM   1092  N  N1    . DA  A  1  54  ? 113.244 46.432 -44.894 1.00 125.60 ? 54   DA  I N1    1 
ATOM   1093  C  C2    . DA  A  1  54  ? 114.538 46.321 -44.571 1.00 125.34 ? 54   DA  I C2    1 
ATOM   1094  N  N3    . DA  A  1  54  ? 115.522 47.203 -44.722 1.00 125.31 ? 54   DA  I N3    1 
ATOM   1095  C  C4    . DA  A  1  54  ? 115.062 48.332 -45.288 1.00 125.68 ? 54   DA  I C4    1 
ATOM   1096  P  P     . DA  A  1  55  ? 121.124 50.163 -46.820 1.00 128.59 ? 55   DA  I P     1 
ATOM   1097  O  OP1   . DA  A  1  55  ? 122.466 50.659 -46.424 1.00 128.85 ? 55   DA  I OP1   1 
ATOM   1098  O  OP2   . DA  A  1  55  ? 120.433 50.773 -47.985 1.00 128.70 ? 55   DA  I OP2   1 
ATOM   1099  O  "O5'" . DA  A  1  55  ? 121.222 48.592 -47.061 1.00 128.91 ? 55   DA  I "O5'" 1 
ATOM   1100  C  "C5'" . DA  A  1  55  ? 121.417 47.704 -45.963 1.00 129.05 ? 55   DA  I "C5'" 1 
ATOM   1101  C  "C4'" . DA  A  1  55  ? 120.936 46.315 -46.315 1.00 129.19 ? 55   DA  I "C4'" 1 
ATOM   1102  O  "O4'" . DA  A  1  55  ? 119.492 46.299 -46.438 1.00 129.19 ? 55   DA  I "O4'" 1 
ATOM   1103  C  "C3'" . DA  A  1  55  ? 121.480 45.763 -47.633 1.00 129.33 ? 55   DA  I "C3'" 1 
ATOM   1104  O  "O3'" . DA  A  1  55  ? 121.768 44.371 -47.484 1.00 129.52 ? 55   DA  I "O3'" 1 
ATOM   1105  C  "C2'" . DA  A  1  55  ? 120.322 45.953 -48.596 1.00 129.15 ? 55   DA  I "C2'" 1 
ATOM   1106  C  "C1'" . DA  A  1  55  ? 119.130 45.725 -47.686 1.00 128.86 ? 55   DA  I "C1'" 1 
ATOM   1107  N  N9    . DA  A  1  55  ? 117.882 46.346 -48.133 1.00 128.18 ? 55   DA  I N9    1 
ATOM   1108  C  C8    . DA  A  1  55  ? 117.711 47.544 -48.782 1.00 127.79 ? 55   DA  I C8    1 
ATOM   1109  N  N7    . DA  A  1  55  ? 116.460 47.822 -49.060 1.00 127.46 ? 55   DA  I N7    1 
ATOM   1110  C  C5    . DA  A  1  55  ? 115.757 46.734 -48.559 1.00 127.29 ? 55   DA  I C5    1 
ATOM   1111  C  C6    . DA  A  1  55  ? 114.386 46.419 -48.539 1.00 126.46 ? 55   DA  I C6    1 
ATOM   1112  N  N6    . DA  A  1  55  ? 113.438 47.203 -49.057 1.00 125.49 ? 55   DA  I N6    1 
ATOM   1113  N  N1    . DA  A  1  55  ? 114.018 45.254 -47.964 1.00 126.32 ? 55   DA  I N1    1 
ATOM   1114  C  C2    . DA  A  1  55  ? 114.969 44.466 -47.446 1.00 126.78 ? 55   DA  I C2    1 
ATOM   1115  N  N3    . DA  A  1  55  ? 116.286 44.652 -47.402 1.00 127.28 ? 55   DA  I N3    1 
ATOM   1116  C  C4    . DA  A  1  55  ? 116.620 45.818 -47.983 1.00 127.72 ? 55   DA  I C4    1 
ATOM   1117  P  P     . DA  A  1  56  ? 122.569 43.594 -48.637 1.00 129.70 ? 56   DA  I P     1 
ATOM   1118  O  OP1   . DA  A  1  56  ? 123.843 43.096 -48.061 1.00 129.81 ? 56   DA  I OP1   1 
ATOM   1119  O  OP2   . DA  A  1  56  ? 122.597 44.460 -49.846 1.00 129.70 ? 56   DA  I OP2   1 
ATOM   1120  O  "O5'" . DA  A  1  56  ? 121.639 42.339 -48.942 1.00 129.52 ? 56   DA  I "O5'" 1 
ATOM   1121  C  "C5'" . DA  A  1  56  ? 121.188 41.498 -47.883 1.00 128.59 ? 56   DA  I "C5'" 1 
ATOM   1122  C  "C4'" . DA  A  1  56  ? 120.036 40.639 -48.350 1.00 127.91 ? 56   DA  I "C4'" 1 
ATOM   1123  O  "O4'" . DA  A  1  56  ? 118.849 41.449 -48.541 1.00 127.93 ? 56   DA  I "O4'" 1 
ATOM   1124  C  "C3'" . DA  A  1  56  ? 120.273 39.913 -49.674 1.00 127.08 ? 56   DA  I "C3'" 1 
ATOM   1125  O  "O3'" . DA  A  1  56  ? 119.754 38.583 -49.593 1.00 124.97 ? 56   DA  I "O3'" 1 
ATOM   1126  C  "C2'" . DA  A  1  56  ? 119.495 40.744 -50.679 1.00 127.23 ? 56   DA  I "C2'" 1 
ATOM   1127  C  "C1'" . DA  A  1  56  ? 118.331 41.249 -49.848 1.00 127.74 ? 56   DA  I "C1'" 1 
ATOM   1128  N  N9    . DA  A  1  56  ? 117.771 42.519 -50.312 1.00 127.96 ? 56   DA  I N9    1 
ATOM   1129  C  C8    . DA  A  1  56  ? 118.443 43.680 -50.606 1.00 128.14 ? 56   DA  I C8    1 
ATOM   1130  N  N7    . DA  A  1  56  ? 117.664 44.657 -51.004 1.00 128.10 ? 56   DA  I N7    1 
ATOM   1131  C  C5    . DA  A  1  56  ? 116.391 44.103 -50.969 1.00 128.08 ? 56   DA  I C5    1 
ATOM   1132  C  C6    . DA  A  1  56  ? 115.121 44.626 -51.277 1.00 127.81 ? 56   DA  I C6    1 
ATOM   1133  N  N6    . DA  A  1  56  ? 114.914 45.877 -51.697 1.00 127.43 ? 56   DA  I N6    1 
ATOM   1134  N  N1    . DA  A  1  56  ? 114.055 43.809 -51.136 1.00 127.60 ? 56   DA  I N1    1 
ATOM   1135  C  C2    . DA  A  1  56  ? 114.260 42.556 -50.712 1.00 127.76 ? 56   DA  I C2    1 
ATOM   1136  N  N3    . DA  A  1  56  ? 115.402 41.949 -50.392 1.00 128.00 ? 56   DA  I N3    1 
ATOM   1137  C  C4    . DA  A  1  56  ? 116.442 42.787 -50.544 1.00 128.15 ? 56   DA  I C4    1 
ATOM   1138  P  P     . DA  A  1  57  ? 119.680 37.672 -50.913 1.00 123.34 ? 57   DA  I P     1 
ATOM   1139  O  OP1   . DA  A  1  57  ? 120.028 36.275 -50.539 1.00 123.02 ? 57   DA  I OP1   1 
ATOM   1140  O  OP2   . DA  A  1  57  ? 120.437 38.353 -51.997 1.00 123.23 ? 57   DA  I OP2   1 
ATOM   1141  O  "O5'" . DA  A  1  57  ? 118.134 37.719 -51.286 1.00 120.79 ? 57   DA  I "O5'" 1 
ATOM   1142  C  "C5'" . DA  A  1  57  ? 117.147 37.446 -50.296 1.00 115.57 ? 57   DA  I "C5'" 1 
ATOM   1143  C  "C4'" . DA  A  1  57  ? 115.775 37.402 -50.925 1.00 111.51 ? 57   DA  I "C4'" 1 
ATOM   1144  O  "O4'" . DA  A  1  57  ? 115.354 38.739 -51.288 1.00 110.20 ? 57   DA  I "O4'" 1 
ATOM   1145  C  "C3'" . DA  A  1  57  ? 115.704 36.569 -52.203 1.00 109.11 ? 57   DA  I "C3'" 1 
ATOM   1146  O  "O3'" . DA  A  1  57  ? 114.490 35.821 -52.224 1.00 106.57 ? 57   DA  I "O3'" 1 
ATOM   1147  C  "C2'" . DA  A  1  57  ? 115.716 37.612 -53.307 1.00 108.49 ? 57   DA  I "C2'" 1 
ATOM   1148  C  "C1'" . DA  A  1  57  ? 114.987 38.775 -52.658 1.00 108.47 ? 57   DA  I "C1'" 1 
ATOM   1149  N  N9    . DA  A  1  57  ? 115.339 40.094 -53.183 1.00 106.93 ? 57   DA  I N9    1 
ATOM   1150  C  C8    . DA  A  1  57  ? 116.591 40.634 -53.337 1.00 106.78 ? 57   DA  I C8    1 
ATOM   1151  N  N7    . DA  A  1  57  ? 116.586 41.849 -53.830 1.00 106.45 ? 57   DA  I N7    1 
ATOM   1152  C  C5    . DA  A  1  57  ? 115.239 42.129 -54.014 1.00 106.32 ? 57   DA  I C5    1 
ATOM   1153  C  C6    . DA  A  1  57  ? 114.563 43.262 -54.509 1.00 106.08 ? 57   DA  I C6    1 
ATOM   1154  N  N6    . DA  A  1  57  ? 115.178 44.370 -54.927 1.00 105.85 ? 57   DA  I N6    1 
ATOM   1155  N  N1    . DA  A  1  57  ? 113.214 43.215 -54.560 1.00 105.35 ? 57   DA  I N1    1 
ATOM   1156  C  C2    . DA  A  1  57  ? 112.597 42.105 -54.144 1.00 105.12 ? 57   DA  I C2    1 
ATOM   1157  N  N3    . DA  A  1  57  ? 113.118 40.979 -53.662 1.00 105.67 ? 57   DA  I N3    1 
ATOM   1158  C  C4    . DA  A  1  57  ? 114.460 41.055 -53.622 1.00 106.39 ? 57   DA  I C4    1 
ATOM   1159  P  P     . DG  A  1  58  ? 114.354 34.557 -53.202 1.00 104.79 ? 58   DG  I P     1 
ATOM   1160  O  OP1   . DG  A  1  58  ? 113.749 33.437 -52.434 1.00 104.84 ? 58   DG  I OP1   1 
ATOM   1161  O  OP2   . DG  A  1  58  ? 115.659 34.362 -53.884 1.00 104.49 ? 58   DG  I OP2   1 
ATOM   1162  O  "O5'" . DG  A  1  58  ? 113.307 35.055 -54.289 1.00 102.96 ? 58   DG  I "O5'" 1 
ATOM   1163  C  "C5'" . DG  A  1  58  ? 112.049 35.590 -53.892 1.00 98.44  ? 58   DG  I "C5'" 1 
ATOM   1164  C  "C4'" . DG  A  1  58  ? 111.394 36.296 -55.056 1.00 95.83  ? 58   DG  I "C4'" 1 
ATOM   1165  O  "O4'" . DG  A  1  58  ? 112.024 37.576 -55.301 1.00 95.48  ? 58   DG  I "O4'" 1 
ATOM   1166  C  "C3'" . DG  A  1  58  ? 111.463 35.531 -56.377 1.00 93.66  ? 58   DG  I "C3'" 1 
ATOM   1167  O  "O3'" . DG  A  1  58  ? 110.246 35.728 -57.091 1.00 89.55  ? 58   DG  I "O3'" 1 
ATOM   1168  C  "C2'" . DG  A  1  58  ? 112.594 36.225 -57.115 1.00 94.42  ? 58   DG  I "C2'" 1 
ATOM   1169  C  "C1'" . DG  A  1  58  ? 112.390 37.658 -56.668 1.00 95.41  ? 58   DG  I "C1'" 1 
ATOM   1170  N  N9    . DG  A  1  58  ? 113.557 38.527 -56.774 1.00 96.04  ? 58   DG  I N9    1 
ATOM   1171  C  C8    . DG  A  1  58  ? 114.870 38.207 -56.522 1.00 96.25  ? 58   DG  I C8    1 
ATOM   1172  N  N7    . DG  A  1  58  ? 115.682 39.216 -56.687 1.00 96.47  ? 58   DG  I N7    1 
ATOM   1173  C  C5    . DG  A  1  58  ? 114.856 40.261 -57.077 1.00 96.28  ? 58   DG  I C5    1 
ATOM   1174  C  C6    . DG  A  1  58  ? 115.163 41.611 -57.394 1.00 96.62  ? 58   DG  I C6    1 
ATOM   1175  O  O6    . DG  A  1  58  ? 116.265 42.173 -57.393 1.00 96.97  ? 58   DG  I O6    1 
ATOM   1176  N  N1    . DG  A  1  58  ? 114.020 42.328 -57.735 1.00 96.78  ? 58   DG  I N1    1 
ATOM   1177  C  C2    . DG  A  1  58  ? 112.747 41.816 -57.769 1.00 96.40  ? 58   DG  I C2    1 
ATOM   1178  N  N2    . DG  A  1  58  ? 111.775 42.668 -58.120 1.00 96.18  ? 58   DG  I N2    1 
ATOM   1179  N  N3    . DG  A  1  58  ? 112.448 40.562 -57.479 1.00 95.98  ? 58   DG  I N3    1 
ATOM   1180  C  C4    . DG  A  1  58  ? 113.542 39.849 -57.142 1.00 96.11  ? 58   DG  I C4    1 
ATOM   1181  P  P     . DG  A  1  59  ? 109.167 34.545 -57.159 1.00 86.54  ? 59   DG  I P     1 
ATOM   1182  O  OP1   . DG  A  1  59  ? 109.062 33.963 -55.798 1.00 85.89  ? 59   DG  I OP1   1 
ATOM   1183  O  OP2   . DG  A  1  59  ? 109.493 33.666 -58.310 1.00 86.81  ? 59   DG  I OP2   1 
ATOM   1184  O  "O5'" . DG  A  1  59  ? 107.811 35.316 -57.470 1.00 84.94  ? 59   DG  I "O5'" 1 
ATOM   1185  C  "C5'" . DG  A  1  59  ? 107.262 36.220 -56.519 1.00 81.09  ? 59   DG  I "C5'" 1 
ATOM   1186  C  "C4'" . DG  A  1  59  ? 106.786 37.479 -57.204 1.00 79.03  ? 59   DG  I "C4'" 1 
ATOM   1187  O  "O4'" . DG  A  1  59  ? 107.914 38.214 -57.729 1.00 79.21  ? 59   DG  I "O4'" 1 
ATOM   1188  C  "C3'" . DG  A  1  59  ? 105.833 37.275 -58.382 1.00 77.61  ? 59   DG  I "C3'" 1 
ATOM   1189  O  "O3'" . DG  A  1  59  ? 104.861 38.326 -58.364 1.00 73.64  ? 59   DG  I "O3'" 1 
ATOM   1190  C  "C2'" . DG  A  1  59  ? 106.742 37.419 -59.590 1.00 78.33  ? 59   DG  I "C2'" 1 
ATOM   1191  C  "C1'" . DG  A  1  59  ? 107.711 38.481 -59.109 1.00 80.62  ? 59   DG  I "C1'" 1 
ATOM   1192  N  N9    . DG  A  1  59  ? 109.019 38.486 -59.754 1.00 83.35  ? 59   DG  I N9    1 
ATOM   1193  C  C8    . DG  A  1  59  ? 109.806 37.399 -60.053 1.00 84.37  ? 59   DG  I C8    1 
ATOM   1194  N  N7    . DG  A  1  59  ? 110.956 37.729 -60.577 1.00 85.33  ? 59   DG  I N7    1 
ATOM   1195  C  C5    . DG  A  1  59  ? 110.921 39.116 -60.639 1.00 85.37  ? 59   DG  I C5    1 
ATOM   1196  C  C6    . DG  A  1  59  ? 111.894 40.040 -61.101 1.00 86.15  ? 59   DG  I C6    1 
ATOM   1197  O  O6    . DG  A  1  59  ? 113.025 39.811 -61.546 1.00 86.27  ? 59   DG  I O6    1 
ATOM   1198  N  N1    . DG  A  1  59  ? 111.443 41.353 -60.996 1.00 86.57  ? 59   DG  I N1    1 
ATOM   1199  C  C2    . DG  A  1  59  ? 110.218 41.730 -60.501 1.00 86.80  ? 59   DG  I C2    1 
ATOM   1200  N  N2    . DG  A  1  59  ? 109.963 43.051 -60.485 1.00 86.07  ? 59   DG  I N2    1 
ATOM   1201  N  N3    . DG  A  1  59  ? 109.308 40.878 -60.055 1.00 85.95  ? 59   DG  I N3    1 
ATOM   1202  C  C4    . DG  A  1  59  ? 109.725 39.597 -60.154 1.00 84.69  ? 59   DG  I C4    1 
ATOM   1203  P  P     . DC  A  1  60  ? 103.593 38.267 -59.344 1.00 68.88  ? 60   DC  I P     1 
ATOM   1204  O  OP1   . DC  A  1  60  ? 102.408 38.552 -58.502 1.00 70.65  ? 60   DC  I OP1   1 
ATOM   1205  O  OP2   . DC  A  1  60  ? 103.643 37.026 -60.151 1.00 68.32  ? 60   DC  I OP2   1 
ATOM   1206  O  "O5'" . DC  A  1  60  ? 103.810 39.515 -60.300 1.00 69.47  ? 60   DC  I "O5'" 1 
ATOM   1207  C  "C5'" . DC  A  1  60  ? 104.044 40.810 -59.755 1.00 71.48  ? 60   DC  I "C5'" 1 
ATOM   1208  C  "C4'" . DC  A  1  60  ? 104.512 41.752 -60.839 1.00 73.39  ? 60   DC  I "C4'" 1 
ATOM   1209  O  "O4'" . DC  A  1  60  ? 105.833 41.378 -61.300 1.00 73.75  ? 60   DC  I "O4'" 1 
ATOM   1210  C  "C3'" . DC  A  1  60  ? 103.629 41.755 -62.084 1.00 74.03  ? 60   DC  I "C3'" 1 
ATOM   1211  O  "O3'" . DC  A  1  60  ? 103.651 43.056 -62.648 1.00 74.93  ? 60   DC  I "O3'" 1 
ATOM   1212  C  "C2'" . DC  A  1  60  ? 104.363 40.824 -63.028 1.00 74.13  ? 60   DC  I "C2'" 1 
ATOM   1213  C  "C1'" . DC  A  1  60  ? 105.798 41.184 -62.708 1.00 73.71  ? 60   DC  I "C1'" 1 
ATOM   1214  N  N1    . DC  A  1  60  ? 106.797 40.163 -63.053 1.00 73.05  ? 60   DC  I N1    1 
ATOM   1215  C  C2    . DC  A  1  60  ? 108.035 40.586 -63.539 1.00 73.40  ? 60   DC  I C2    1 
ATOM   1216  O  O2    . DC  A  1  60  ? 108.237 41.806 -63.678 1.00 72.46  ? 60   DC  I O2    1 
ATOM   1217  N  N3    . DC  A  1  60  ? 108.974 39.663 -63.843 1.00 73.26  ? 60   DC  I N3    1 
ATOM   1218  C  C4    . DC  A  1  60  ? 108.710 38.364 -63.680 1.00 74.56  ? 60   DC  I C4    1 
ATOM   1219  N  N4    . DC  A  1  60  ? 109.670 37.484 -63.981 1.00 75.23  ? 60   DC  I N4    1 
ATOM   1220  C  C5    . DC  A  1  60  ? 107.450 37.906 -63.198 1.00 72.96  ? 60   DC  I C5    1 
ATOM   1221  C  C6    . DC  A  1  60  ? 106.532 38.832 -62.899 1.00 72.45  ? 60   DC  I C6    1 
ATOM   1222  P  P     . DA  A  1  61  ? 102.295 43.719 -63.159 1.00 74.60  ? 61   DA  I P     1 
ATOM   1223  O  OP1   . DA  A  1  61  ? 101.665 44.373 -61.994 1.00 74.73  ? 61   DA  I OP1   1 
ATOM   1224  O  OP2   . DA  A  1  61  ? 101.545 42.700 -63.928 1.00 76.07  ? 61   DA  I OP2   1 
ATOM   1225  O  "O5'" . DA  A  1  61  ? 102.805 44.846 -64.152 1.00 76.77  ? 61   DA  I "O5'" 1 
ATOM   1226  C  "C5'" . DA  A  1  61  ? 103.767 45.801 -63.719 1.00 78.39  ? 61   DA  I "C5'" 1 
ATOM   1227  C  "C4'" . DA  A  1  61  ? 104.635 46.219 -64.880 1.00 80.11  ? 61   DA  I "C4'" 1 
ATOM   1228  O  "O4'" . DA  A  1  61  ? 105.518 45.129 -65.238 1.00 79.45  ? 61   DA  I "O4'" 1 
ATOM   1229  C  "C3'" . DA  A  1  61  ? 103.840 46.559 -66.137 1.00 81.17  ? 61   DA  I "C3'" 1 
ATOM   1230  O  "O3'" . DA  A  1  61  ? 104.387 47.713 -66.770 1.00 84.69  ? 61   DA  I "O3'" 1 
ATOM   1231  C  "C2'" . DA  A  1  61  ? 103.977 45.318 -67.003 1.00 79.52  ? 61   DA  I "C2'" 1 
ATOM   1232  C  "C1'" . DA  A  1  61  ? 105.324 44.748 -66.591 1.00 78.95  ? 61   DA  I "C1'" 1 
ATOM   1233  N  N9    . DA  A  1  61  ? 105.397 43.289 -66.645 1.00 79.62  ? 61   DA  I N9    1 
ATOM   1234  C  C8    . DA  A  1  61  ? 104.369 42.388 -66.509 1.00 79.43  ? 61   DA  I C8    1 
ATOM   1235  N  N7    . DA  A  1  61  ? 104.749 41.135 -66.585 1.00 79.30  ? 61   DA  I N7    1 
ATOM   1236  C  C5    . DA  A  1  61  ? 106.120 41.216 -66.787 1.00 80.62  ? 61   DA  I C5    1 
ATOM   1237  C  C6    . DA  A  1  61  ? 107.114 40.231 -66.945 1.00 81.14  ? 61   DA  I C6    1 
ATOM   1238  N  N6    . DA  A  1  61  ? 106.869 38.919 -66.927 1.00 80.83  ? 61   DA  I N6    1 
ATOM   1239  N  N1    . DA  A  1  61  ? 108.386 40.648 -67.126 1.00 81.89  ? 61   DA  I N1    1 
ATOM   1240  C  C2    . DA  A  1  61  ? 108.632 41.964 -67.146 1.00 81.96  ? 61   DA  I C2    1 
ATOM   1241  N  N3    . DA  A  1  61  ? 107.786 42.982 -67.012 1.00 81.56  ? 61   DA  I N3    1 
ATOM   1242  C  C4    . DA  A  1  61  ? 106.531 42.536 -66.832 1.00 80.73  ? 61   DA  I C4    1 
ATOM   1243  P  P     . DT  A  1  62  ? 103.742 48.245 -68.138 1.00 87.47  ? 62   DT  I P     1 
ATOM   1244  O  OP1   . DT  A  1  62  ? 104.145 49.663 -68.309 1.00 86.82  ? 62   DT  I OP1   1 
ATOM   1245  O  OP2   . DT  A  1  62  ? 102.300 47.886 -68.142 1.00 86.11  ? 62   DT  I OP2   1 
ATOM   1246  O  "O5'" . DT  A  1  62  ? 104.474 47.360 -69.241 1.00 88.48  ? 62   DT  I "O5'" 1 
ATOM   1247  C  "C5'" . DT  A  1  62  ? 105.891 47.422 -69.402 1.00 90.37  ? 62   DT  I "C5'" 1 
ATOM   1248  C  "C4'" . DT  A  1  62  ? 106.301 46.744 -70.688 1.00 91.72  ? 62   DT  I "C4'" 1 
ATOM   1249  O  "O4'" . DT  A  1  62  ? 106.562 45.334 -70.487 1.00 91.35  ? 62   DT  I "O4'" 1 
ATOM   1250  C  "C3'" . DT  A  1  62  ? 105.251 46.836 -71.794 1.00 92.67  ? 62   DT  I "C3'" 1 
ATOM   1251  O  "O3'" . DT  A  1  62  ? 105.861 47.175 -73.032 1.00 94.49  ? 62   DT  I "O3'" 1 
ATOM   1252  C  "C2'" . DT  A  1  62  ? 104.683 45.429 -71.867 1.00 92.24  ? 62   DT  I "C2'" 1 
ATOM   1253  C  "C1'" . DT  A  1  62  ? 105.882 44.584 -71.479 1.00 91.49  ? 62   DT  I "C1'" 1 
ATOM   1254  N  N1    . DT  A  1  62  ? 105.562 43.257 -70.912 1.00 92.16  ? 62   DT  I N1    1 
ATOM   1255  C  C2    . DT  A  1  62  ? 106.588 42.350 -70.785 1.00 92.53  ? 62   DT  I C2    1 
ATOM   1256  O  O2    . DT  A  1  62  ? 107.739 42.600 -71.094 1.00 93.42  ? 62   DT  I O2    1 
ATOM   1257  N  N3    . DT  A  1  62  ? 106.217 41.131 -70.278 1.00 92.21  ? 62   DT  I N3    1 
ATOM   1258  C  C4    . DT  A  1  62  ? 104.952 40.739 -69.890 1.00 91.10  ? 62   DT  I C4    1 
ATOM   1259  O  O4    . DT  A  1  62  ? 104.769 39.604 -69.463 1.00 90.32  ? 62   DT  I O4    1 
ATOM   1260  C  C5    . DT  A  1  62  ? 103.926 41.743 -70.034 1.00 91.21  ? 62   DT  I C5    1 
ATOM   1261  C  C7    . DT  A  1  62  ? 102.526 41.409 -69.624 1.00 91.14  ? 62   DT  I C7    1 
ATOM   1262  C  C6    . DT  A  1  62  ? 104.276 42.936 -70.532 1.00 91.30  ? 62   DT  I C6    1 
ATOM   1263  P  P     . DG  A  1  63  ? 104.980 47.862 -74.180 1.00 96.44  ? 63   DG  I P     1 
ATOM   1264  O  OP1   . DG  A  1  63  ? 105.461 49.255 -74.353 1.00 96.53  ? 63   DG  I OP1   1 
ATOM   1265  O  OP2   . DG  A  1  63  ? 103.548 47.612 -73.865 1.00 96.16  ? 63   DG  I OP2   1 
ATOM   1266  O  "O5'" . DG  A  1  63  ? 105.372 47.027 -75.476 1.00 96.91  ? 63   DG  I "O5'" 1 
ATOM   1267  C  "C5'" . DG  A  1  63  ? 106.739 46.880 -75.847 1.00 97.99  ? 63   DG  I "C5'" 1 
ATOM   1268  C  "C4'" . DG  A  1  63  ? 106.905 45.718 -76.797 1.00 98.53  ? 63   DG  I "C4'" 1 
ATOM   1269  O  "O4'" . DG  A  1  63  ? 106.700 44.468 -76.096 1.00 98.45  ? 63   DG  I "O4'" 1 
ATOM   1270  C  "C3'" . DG  A  1  63  ? 105.936 45.715 -77.978 1.00 98.68  ? 63   DG  I "C3'" 1 
ATOM   1271  O  "O3'" . DG  A  1  63  ? 106.641 45.368 -79.173 1.00 99.10  ? 63   DG  I "O3'" 1 
ATOM   1272  C  "C2'" . DG  A  1  63  ? 104.906 44.665 -77.594 1.00 98.28  ? 63   DG  I "C2'" 1 
ATOM   1273  C  "C1'" . DG  A  1  63  ? 105.706 43.690 -76.746 1.00 98.16  ? 63   DG  I "C1'" 1 
ATOM   1274  N  N9    . DG  A  1  63  ? 104.922 43.024 -75.709 1.00 97.66  ? 63   DG  I N9    1 
ATOM   1275  C  C8    . DG  A  1  63  ? 104.040 43.620 -74.841 1.00 97.61  ? 63   DG  I C8    1 
ATOM   1276  N  N7    . DG  A  1  63  ? 103.491 42.777 -74.009 1.00 97.50  ? 63   DG  I N7    1 
ATOM   1277  C  C5    . DG  A  1  63  ? 104.041 41.549 -74.347 1.00 97.19  ? 63   DG  I C5    1 
ATOM   1278  C  C6    . DG  A  1  63  ? 103.830 40.261 -73.785 1.00 97.27  ? 63   DG  I C6    1 
ATOM   1279  O  O6    . DG  A  1  63  ? 103.096 39.940 -72.843 1.00 96.76  ? 63   DG  I O6    1 
ATOM   1280  N  N1    . DG  A  1  63  ? 104.588 39.291 -74.432 1.00 97.07  ? 63   DG  I N1    1 
ATOM   1281  C  C2    . DG  A  1  63  ? 105.440 39.527 -75.482 1.00 97.05  ? 63   DG  I C2    1 
ATOM   1282  N  N2    . DG  A  1  63  ? 106.078 38.454 -75.970 1.00 96.59  ? 63   DG  I N2    1 
ATOM   1283  N  N3    . DG  A  1  63  ? 105.651 40.723 -76.012 1.00 96.62  ? 63   DG  I N3    1 
ATOM   1284  C  C4    . DG  A  1  63  ? 104.923 41.681 -75.400 1.00 97.02  ? 63   DG  I C4    1 
ATOM   1285  P  P     . DT  A  1  64  ? 105.827 44.991 -80.503 1.00 99.46  ? 64   DT  I P     1 
ATOM   1286  O  OP1   . DT  A  1  64  ? 106.598 45.479 -81.675 1.00 99.90  ? 64   DT  I OP1   1 
ATOM   1287  O  OP2   . DT  A  1  64  ? 104.410 45.413 -80.331 1.00 99.47  ? 64   DT  I OP2   1 
ATOM   1288  O  "O5'" . DT  A  1  64  ? 105.899 43.403 -80.497 1.00 98.59  ? 64   DT  I "O5'" 1 
ATOM   1289  C  "C5'" . DT  A  1  64  ? 107.148 42.748 -80.294 1.00 97.06  ? 64   DT  I "C5'" 1 
ATOM   1290  C  "C4'" . DT  A  1  64  ? 107.061 41.317 -80.761 1.00 96.50  ? 64   DT  I "C4'" 1 
ATOM   1291  O  "O4'" . DT  A  1  64  ? 106.407 40.502 -79.759 1.00 95.98  ? 64   DT  I "O4'" 1 
ATOM   1292  C  "C3'" . DT  A  1  64  ? 106.252 41.155 -82.044 1.00 96.19  ? 64   DT  I "C3'" 1 
ATOM   1293  O  "O3'" . DT  A  1  64  ? 106.880 40.205 -82.904 1.00 95.82  ? 64   DT  I "O3'" 1 
ATOM   1294  C  "C2'" . DT  A  1  64  ? 104.902 40.658 -81.553 1.00 96.13  ? 64   DT  I "C2'" 1 
ATOM   1295  C  "C1'" . DT  A  1  64  ? 105.269 39.859 -80.313 1.00 95.59  ? 64   DT  I "C1'" 1 
ATOM   1296  N  N1    . DT  A  1  64  ? 104.221 39.820 -79.270 1.00 94.48  ? 64   DT  I N1    1 
ATOM   1297  C  C2    . DT  A  1  64  ? 103.940 38.610 -78.678 1.00 93.85  ? 64   DT  I C2    1 
ATOM   1298  O  O2    . DT  A  1  64  ? 104.503 37.572 -78.984 1.00 93.37  ? 64   DT  I O2    1 
ATOM   1299  N  N3    . DT  A  1  64  ? 102.967 38.659 -77.710 1.00 93.24  ? 64   DT  I N3    1 
ATOM   1300  C  C4    . DT  A  1  64  ? 102.260 39.770 -77.292 1.00 93.02  ? 64   DT  I C4    1 
ATOM   1301  O  O4    . DT  A  1  64  ? 101.415 39.662 -76.411 1.00 92.60  ? 64   DT  I O4    1 
ATOM   1302  C  C5    . DT  A  1  64  ? 102.599 41.002 -77.961 1.00 93.35  ? 64   DT  I C5    1 
ATOM   1303  C  C7    . DT  A  1  64  ? 101.879 42.257 -77.577 1.00 92.23  ? 64   DT  I C7    1 
ATOM   1304  C  C6    . DT  A  1  64  ? 103.551 40.967 -78.903 1.00 93.78  ? 64   DT  I C6    1 
ATOM   1305  P  P     . DT  A  1  65  ? 106.155 39.770 -84.266 1.00 95.88  ? 65   DT  I P     1 
ATOM   1306  O  OP1   . DT  A  1  65  ? 107.201 39.466 -85.279 1.00 95.96  ? 65   DT  I OP1   1 
ATOM   1307  O  OP2   . DT  A  1  65  ? 105.106 40.782 -84.566 1.00 95.26  ? 65   DT  I OP2   1 
ATOM   1308  O  "O5'" . DT  A  1  65  ? 105.435 38.411 -83.866 1.00 93.85  ? 65   DT  I "O5'" 1 
ATOM   1309  C  "C5'" . DT  A  1  65  ? 106.193 37.326 -83.344 1.00 90.43  ? 65   DT  I "C5'" 1 
ATOM   1310  C  "C4'" . DT  A  1  65  ? 105.330 36.092 -83.248 1.00 88.12  ? 65   DT  I "C4'" 1 
ATOM   1311  O  "O4'" . DT  A  1  65  ? 104.426 36.205 -82.123 1.00 87.14  ? 65   DT  I "O4'" 1 
ATOM   1312  C  "C3'" . DT  A  1  65  ? 104.456 35.850 -84.477 1.00 87.11  ? 65   DT  I "C3'" 1 
ATOM   1313  O  "O3'" . DT  A  1  65  ? 104.447 34.457 -84.785 1.00 86.10  ? 65   DT  I "O3'" 1 
ATOM   1314  C  "C2'" . DT  A  1  65  ? 103.083 36.331 -84.037 1.00 86.20  ? 65   DT  I "C2'" 1 
ATOM   1315  C  "C1'" . DT  A  1  65  ? 103.091 36.003 -82.553 1.00 85.59  ? 65   DT  I "C1'" 1 
ATOM   1316  N  N1    . DT  A  1  65  ? 102.214 36.836 -81.704 1.00 83.77  ? 65   DT  I N1    1 
ATOM   1317  C  C2    . DT  A  1  65  ? 101.699 36.263 -80.559 1.00 82.19  ? 65   DT  I C2    1 
ATOM   1318  O  O2    . DT  A  1  65  ? 101.918 35.108 -80.232 1.00 80.97  ? 65   DT  I O2    1 
ATOM   1319  N  N3    . DT  A  1  65  ? 100.912 37.095 -79.807 1.00 81.08  ? 65   DT  I N3    1 
ATOM   1320  C  C4    . DT  A  1  65  ? 100.586 38.406 -80.077 1.00 81.42  ? 65   DT  I C4    1 
ATOM   1321  O  O4    . DT  A  1  65  ? 99.866  39.027 -79.301 1.00 80.49  ? 65   DT  I O4    1 
ATOM   1322  C  C5    . DT  A  1  65  ? 101.147 38.943 -81.298 1.00 81.92  ? 65   DT  I C5    1 
ATOM   1323  C  C7    . DT  A  1  65  ? 100.837 40.357 -81.675 1.00 81.80  ? 65   DT  I C7    1 
ATOM   1324  C  C6    . DT  A  1  65  ? 101.924 38.142 -82.040 1.00 82.71  ? 65   DT  I C6    1 
ATOM   1325  P  P     . DC  A  1  66  ? 103.727 33.942 -86.122 1.00 85.18  ? 66   DC  I P     1 
ATOM   1326  O  OP1   . DC  A  1  66  ? 104.601 32.924 -86.762 1.00 83.97  ? 66   DC  I OP1   1 
ATOM   1327  O  OP2   . DC  A  1  66  ? 103.295 35.136 -86.894 1.00 84.77  ? 66   DC  I OP2   1 
ATOM   1328  O  "O5'" . DC  A  1  66  ? 102.427 33.212 -85.565 1.00 83.99  ? 66   DC  I "O5'" 1 
ATOM   1329  C  "C5'" . DC  A  1  66  ? 102.531 32.250 -84.516 1.00 81.79  ? 66   DC  I "C5'" 1 
ATOM   1330  C  "C4'" . DC  A  1  66  ? 101.160 31.903 -83.984 1.00 79.87  ? 66   DC  I "C4'" 1 
ATOM   1331  O  "O4'" . DC  A  1  66  ? 100.625 32.996 -83.195 1.00 77.91  ? 66   DC  I "O4'" 1 
ATOM   1332  C  "C3'" . DC  A  1  66  ? 100.121 31.612 -85.070 1.00 78.49  ? 66   DC  I "C3'" 1 
ATOM   1333  O  "O3'" . DC  A  1  66  ? 99.278  30.555 -84.632 1.00 78.31  ? 66   DC  I "O3'" 1 
ATOM   1334  C  "C2'" . DC  A  1  66  ? 99.304  32.890 -85.113 1.00 77.93  ? 66   DC  I "C2'" 1 
ATOM   1335  C  "C1'" . DC  A  1  66  ? 99.312  33.275 -83.646 1.00 77.22  ? 66   DC  I "C1'" 1 
ATOM   1336  N  N1    . DC  A  1  66  ? 98.997  34.681 -83.343 1.00 75.45  ? 66   DC  I N1    1 
ATOM   1337  C  C2    . DC  A  1  66  ? 98.475  34.991 -82.079 1.00 74.22  ? 66   DC  I C2    1 
ATOM   1338  O  O2    . DC  A  1  66  ? 98.341  34.083 -81.247 1.00 72.15  ? 66   DC  I O2    1 
ATOM   1339  N  N3    . DC  A  1  66  ? 98.136  36.267 -81.799 1.00 73.34  ? 66   DC  I N3    1 
ATOM   1340  C  C4    . DC  A  1  66  ? 98.306  37.219 -82.719 1.00 74.08  ? 66   DC  I C4    1 
ATOM   1341  N  N4    . DC  A  1  66  ? 97.943  38.462 -82.403 1.00 73.77  ? 66   DC  I N4    1 
ATOM   1342  C  C5    . DC  A  1  66  ? 98.853  36.936 -84.006 1.00 74.09  ? 66   DC  I C5    1 
ATOM   1343  C  C6    . DC  A  1  66  ? 99.185  35.666 -84.272 1.00 74.53  ? 66   DC  I C6    1 
ATOM   1344  P  P     . DA  A  1  67  ? 99.444  29.093 -85.260 1.00 77.97  ? 67   DA  I P     1 
ATOM   1345  O  OP1   . DA  A  1  67  ? 100.897 28.790 -85.313 1.00 79.38  ? 67   DA  I OP1   1 
ATOM   1346  O  OP2   . DA  A  1  67  ? 98.634  29.030 -86.500 1.00 78.12  ? 67   DA  I OP2   1 
ATOM   1347  O  "O5'" . DA  A  1  67  ? 98.788  28.154 -84.154 1.00 77.06  ? 67   DA  I "O5'" 1 
ATOM   1348  C  "C5'" . DA  A  1  67  ? 99.357  28.065 -82.846 1.00 74.39  ? 67   DA  I "C5'" 1 
ATOM   1349  C  "C4'" . DA  A  1  67  ? 98.268  28.014 -81.799 1.00 71.93  ? 67   DA  I "C4'" 1 
ATOM   1350  O  "O4'" . DA  A  1  67  ? 97.658  29.315 -81.633 1.00 70.89  ? 67   DA  I "O4'" 1 
ATOM   1351  C  "C3'" . DA  A  1  67  ? 97.126  27.054 -82.116 1.00 70.23  ? 67   DA  I "C3'" 1 
ATOM   1352  O  "O3'" . DA  A  1  67  ? 96.691  26.429 -80.912 1.00 69.60  ? 67   DA  I "O3'" 1 
ATOM   1353  C  "C2'" . DA  A  1  67  ? 96.050  27.960 -82.690 1.00 69.43  ? 67   DA  I "C2'" 1 
ATOM   1354  C  "C1'" . DA  A  1  67  ? 96.270  29.262 -81.938 1.00 69.08  ? 67   DA  I "C1'" 1 
ATOM   1355  N  N9    . DA  A  1  67  ? 95.953  30.468 -82.703 1.00 68.33  ? 67   DA  I N9    1 
ATOM   1356  C  C8    . DA  A  1  67  ? 96.149  30.686 -84.044 1.00 67.38  ? 67   DA  I C8    1 
ATOM   1357  N  N7    . DA  A  1  67  ? 95.839  31.899 -84.434 1.00 67.42  ? 67   DA  I N7    1 
ATOM   1358  C  C5    . DA  A  1  67  ? 95.395  32.519 -83.276 1.00 66.50  ? 67   DA  I C5    1 
ATOM   1359  C  C6    . DA  A  1  67  ? 94.940  33.821 -83.018 1.00 66.51  ? 67   DA  I C6    1 
ATOM   1360  N  N6    . DA  A  1  67  ? 94.882  34.780 -83.944 1.00 66.37  ? 67   DA  I N6    1 
ATOM   1361  N  N1    . DA  A  1  67  ? 94.552  34.113 -81.758 1.00 66.05  ? 67   DA  I N1    1 
ATOM   1362  C  C2    . DA  A  1  67  ? 94.636  33.157 -80.824 1.00 66.16  ? 67   DA  I C2    1 
ATOM   1363  N  N3    . DA  A  1  67  ? 95.064  31.902 -80.939 1.00 66.31  ? 67   DA  I N3    1 
ATOM   1364  C  C4    . DA  A  1  67  ? 95.435  31.642 -82.206 1.00 67.59  ? 67   DA  I C4    1 
ATOM   1365  P  P     . DG  A  1  68  ? 95.544  25.315 -80.968 1.00 68.67  ? 68   DG  I P     1 
ATOM   1366  O  OP1   . DG  A  1  68  ? 95.762  24.367 -79.848 1.00 67.97  ? 68   DG  I OP1   1 
ATOM   1367  O  OP2   . DG  A  1  68  ? 95.474  24.806 -82.361 1.00 70.55  ? 68   DG  I OP2   1 
ATOM   1368  O  "O5'" . DG  A  1  68  ? 94.215  26.151 -80.703 1.00 69.36  ? 68   DG  I "O5'" 1 
ATOM   1369  C  "C5'" . DG  A  1  68  ? 94.038  26.885 -79.494 1.00 66.49  ? 68   DG  I "C5'" 1 
ATOM   1370  C  "C4'" . DG  A  1  68  ? 92.733  27.642 -79.537 1.00 66.36  ? 68   DG  I "C4'" 1 
ATOM   1371  O  "O4'" . DG  A  1  68  ? 92.827  28.770 -80.442 1.00 65.75  ? 68   DG  I "O4'" 1 
ATOM   1372  C  "C3'" . DG  A  1  68  ? 91.552  26.807 -80.032 1.00 66.56  ? 68   DG  I "C3'" 1 
ATOM   1373  O  "O3'" . DG  A  1  68  ? 90.377  27.233 -79.356 1.00 67.84  ? 68   DG  I "O3'" 1 
ATOM   1374  C  "C2'" . DG  A  1  68  ? 91.426  27.230 -81.483 1.00 65.60  ? 68   DG  I "C2'" 1 
ATOM   1375  C  "C1'" . DG  A  1  68  ? 91.747  28.703 -81.359 1.00 65.84  ? 68   DG  I "C1'" 1 
ATOM   1376  N  N9    . DG  A  1  68  ? 92.144  29.372 -82.592 1.00 66.27  ? 68   DG  I N9    1 
ATOM   1377  C  C8    . DG  A  1  68  ? 92.713  28.809 -83.708 1.00 66.59  ? 68   DG  I C8    1 
ATOM   1378  N  N7    . DG  A  1  68  ? 92.931  29.674 -84.662 1.00 68.23  ? 68   DG  I N7    1 
ATOM   1379  C  C5    . DG  A  1  68  ? 92.481  30.880 -84.142 1.00 67.24  ? 68   DG  I C5    1 
ATOM   1380  C  C6    . DG  A  1  68  ? 92.452  32.183 -84.717 1.00 68.29  ? 68   DG  I C6    1 
ATOM   1381  O  O6    . DG  A  1  68  ? 92.832  32.544 -85.841 1.00 69.61  ? 68   DG  I O6    1 
ATOM   1382  N  N1    . DG  A  1  68  ? 91.912  33.117 -83.836 1.00 68.23  ? 68   DG  I N1    1 
ATOM   1383  C  C2    . DG  A  1  68  ? 91.459  32.837 -82.569 1.00 67.22  ? 68   DG  I C2    1 
ATOM   1384  N  N2    . DG  A  1  68  ? 90.975  33.875 -81.870 1.00 65.97  ? 68   DG  I N2    1 
ATOM   1385  N  N3    . DG  A  1  68  ? 91.479  31.631 -82.027 1.00 65.69  ? 68   DG  I N3    1 
ATOM   1386  C  C4    . DG  A  1  68  ? 91.999  30.710 -82.862 1.00 66.14  ? 68   DG  I C4    1 
ATOM   1387  P  P     . DC  A  1  69  ? 89.763  26.344 -78.173 1.00 67.59  ? 69   DC  I P     1 
ATOM   1388  O  OP1   . DC  A  1  69  ? 90.859  25.950 -77.253 1.00 66.48  ? 69   DC  I OP1   1 
ATOM   1389  O  OP2   . DC  A  1  69  ? 88.898  25.300 -78.787 1.00 67.62  ? 69   DC  I OP2   1 
ATOM   1390  O  "O5'" . DC  A  1  69  ? 88.858  27.407 -77.411 1.00 66.08  ? 69   DC  I "O5'" 1 
ATOM   1391  C  "C5'" . DC  A  1  69  ? 89.454  28.573 -76.844 1.00 61.03  ? 69   DC  I "C5'" 1 
ATOM   1392  C  "C4'" . DC  A  1  69  ? 88.652  29.805 -77.194 1.00 59.62  ? 69   DC  I "C4'" 1 
ATOM   1393  O  "O4'" . DC  A  1  69  ? 88.959  30.293 -78.524 1.00 58.98  ? 69   DC  I "O4'" 1 
ATOM   1394  C  "C3'" . DC  A  1  69  ? 87.133  29.636 -77.129 1.00 57.05  ? 69   DC  I "C3'" 1 
ATOM   1395  O  "O3'" . DC  A  1  69  ? 86.574  30.721 -76.402 1.00 54.09  ? 69   DC  I "O3'" 1 
ATOM   1396  C  "C2'" . DC  A  1  69  ? 86.698  29.704 -78.583 1.00 56.70  ? 69   DC  I "C2'" 1 
ATOM   1397  C  "C1'" . DC  A  1  69  ? 87.754  30.605 -79.209 1.00 57.66  ? 69   DC  I "C1'" 1 
ATOM   1398  N  N1    . DC  A  1  69  ? 87.972  30.363 -80.651 1.00 57.34  ? 69   DC  I N1    1 
ATOM   1399  C  C2    . DC  A  1  69  ? 88.024  31.458 -81.530 1.00 57.32  ? 69   DC  I C2    1 
ATOM   1400  O  O2    . DC  A  1  69  ? 87.890  32.607 -81.080 1.00 57.64  ? 69   DC  I O2    1 
ATOM   1401  N  N3    . DC  A  1  69  ? 88.221  31.233 -82.851 1.00 58.72  ? 69   DC  I N3    1 
ATOM   1402  C  C4    . DC  A  1  69  ? 88.364  29.984 -83.302 1.00 58.68  ? 69   DC  I C4    1 
ATOM   1403  N  N4    . DC  A  1  69  ? 88.566  29.808 -84.613 1.00 61.02  ? 69   DC  I N4    1 
ATOM   1404  C  C5    . DC  A  1  69  ? 88.311  28.857 -82.433 1.00 57.61  ? 69   DC  I C5    1 
ATOM   1405  C  C6    . DC  A  1  69  ? 88.118  29.090 -81.129 1.00 57.14  ? 69   DC  I C6    1 
ATOM   1406  P  P     . DG  A  1  70  ? 85.067  30.628 -75.858 1.00 50.75  ? 70   DG  I P     1 
ATOM   1407  O  OP1   . DG  A  1  70  ? 85.109  30.943 -74.408 1.00 52.42  ? 70   DG  I OP1   1 
ATOM   1408  O  OP2   . DG  A  1  70  ? 84.452  29.363 -76.317 1.00 50.52  ? 70   DG  I OP2   1 
ATOM   1409  O  "O5'" . DG  A  1  70  ? 84.368  31.842 -76.603 1.00 51.02  ? 70   DG  I "O5'" 1 
ATOM   1410  C  "C5'" . DG  A  1  70  ? 84.931  33.145 -76.511 1.00 53.78  ? 70   DG  I "C5'" 1 
ATOM   1411  C  "C4'" . DG  A  1  70  ? 84.295  34.058 -77.529 1.00 58.44  ? 70   DG  I "C4'" 1 
ATOM   1412  O  "O4'" . DG  A  1  70  ? 84.689  33.653 -78.863 1.00 57.38  ? 70   DG  I "O4'" 1 
ATOM   1413  C  "C3'" . DG  A  1  70  ? 82.768  34.043 -77.510 1.00 60.29  ? 70   DG  I "C3'" 1 
ATOM   1414  O  "O3'" . DG  A  1  70  ? 82.292  35.372 -77.713 1.00 65.27  ? 70   DG  I "O3'" 1 
ATOM   1415  C  "C2'" . DG  A  1  70  ? 82.408  33.136 -78.674 1.00 58.69  ? 70   DG  I "C2'" 1 
ATOM   1416  C  "C1'" . DG  A  1  70  ? 83.541  33.395 -79.654 1.00 57.02  ? 70   DG  I "C1'" 1 
ATOM   1417  N  N9    . DG  A  1  70  ? 83.852  32.282 -80.548 1.00 55.81  ? 70   DG  I N9    1 
ATOM   1418  C  C8    . DG  A  1  70  ? 83.810  30.940 -80.255 1.00 56.09  ? 70   DG  I C8    1 
ATOM   1419  N  N7    . DG  A  1  70  ? 84.149  30.182 -81.266 1.00 56.17  ? 70   DG  I N7    1 
ATOM   1420  C  C5    . DG  A  1  70  ? 84.437  31.078 -82.289 1.00 54.45  ? 70   DG  I C5    1 
ATOM   1421  C  C6    . DG  A  1  70  ? 84.873  30.845 -83.630 1.00 52.96  ? 70   DG  I C6    1 
ATOM   1422  O  O6    . DG  A  1  70  ? 85.115  29.766 -84.188 1.00 51.58  ? 70   DG  I O6    1 
ATOM   1423  N  N1    . DG  A  1  70  ? 85.026  32.035 -84.330 1.00 49.89  ? 70   DG  I N1    1 
ATOM   1424  C  C2    . DG  A  1  70  ? 84.795  33.289 -83.819 1.00 53.16  ? 70   DG  I C2    1 
ATOM   1425  N  N2    . DG  A  1  70  ? 84.969  34.314 -84.668 1.00 50.26  ? 70   DG  I N2    1 
ATOM   1426  N  N3    . DG  A  1  70  ? 84.410  33.523 -82.567 1.00 54.76  ? 70   DG  I N3    1 
ATOM   1427  C  C4    . DG  A  1  70  ? 84.250  32.379 -81.866 1.00 54.88  ? 70   DG  I C4    1 
ATOM   1428  P  P     . DG  A  1  71  ? 80.764  35.737 -77.382 1.00 70.38  ? 71   DG  I P     1 
ATOM   1429  O  OP1   . DG  A  1  71  ? 80.779  37.030 -76.646 1.00 70.24  ? 71   DG  I OP1   1 
ATOM   1430  O  OP2   . DG  A  1  71  ? 80.077  34.554 -76.795 1.00 68.85  ? 71   DG  I OP2   1 
ATOM   1431  O  "O5'" . DG  A  1  71  ? 80.134  35.985 -78.820 1.00 69.49  ? 71   DG  I "O5'" 1 
ATOM   1432  C  "C5'" . DG  A  1  71  ? 80.707  36.944 -79.700 1.00 69.61  ? 71   DG  I "C5'" 1 
ATOM   1433  C  "C4'" . DG  A  1  71  ? 80.223  36.699 -81.108 1.00 70.20  ? 71   DG  I "C4'" 1 
ATOM   1434  O  "O4'" . DG  A  1  71  ? 80.825  35.497 -81.645 1.00 68.54  ? 71   DG  I "O4'" 1 
ATOM   1435  C  "C3'" . DG  A  1  71  ? 78.710  36.491 -81.212 1.00 71.02  ? 71   DG  I "C3'" 1 
ATOM   1436  O  "O3'" . DG  A  1  71  ? 78.261  37.039 -82.445 1.00 72.63  ? 71   DG  I "O3'" 1 
ATOM   1437  C  "C2'" . DG  A  1  71  ? 78.584  34.983 -81.304 1.00 69.23  ? 71   DG  I "C2'" 1 
ATOM   1438  C  "C1'" . DG  A  1  71  ? 79.790  34.691 -82.166 1.00 68.36  ? 71   DG  I "C1'" 1 
ATOM   1439  N  N9    . DG  A  1  71  ? 80.248  33.311 -82.207 1.00 66.48  ? 71   DG  I N9    1 
ATOM   1440  C  C8    . DG  A  1  71  ? 80.172  32.357 -81.222 1.00 66.54  ? 71   DG  I C8    1 
ATOM   1441  N  N7    . DG  A  1  71  ? 80.625  31.195 -81.604 1.00 65.89  ? 71   DG  I N7    1 
ATOM   1442  C  C5    . DG  A  1  71  ? 81.035  31.404 -82.913 1.00 66.62  ? 71   DG  I C5    1 
ATOM   1443  C  C6    . DG  A  1  71  ? 81.608  30.512 -83.852 1.00 66.52  ? 71   DG  I C6    1 
ATOM   1444  O  O6    . DG  A  1  71  ? 81.887  29.317 -83.710 1.00 66.24  ? 71   DG  I O6    1 
ATOM   1445  N  N1    . DG  A  1  71  ? 81.867  31.145 -85.064 1.00 66.13  ? 71   DG  I N1    1 
ATOM   1446  C  C2    . DG  A  1  71  ? 81.617  32.467 -85.334 1.00 67.27  ? 71   DG  I C2    1 
ATOM   1447  N  N2    . DG  A  1  71  ? 81.948  32.901 -86.557 1.00 67.56  ? 71   DG  I N2    1 
ATOM   1448  N  N3    . DG  A  1  71  ? 81.084  33.305 -84.467 1.00 66.78  ? 71   DG  I N3    1 
ATOM   1449  C  C4    . DG  A  1  71  ? 80.819  32.709 -83.289 1.00 66.72  ? 71   DG  I C4    1 
ATOM   1450  P  P     . DA  A  1  72  ? 77.037  38.071 -82.468 1.00 74.09  ? 72   DA  I P     1 
ATOM   1451  O  OP1   . DA  A  1  72  ? 77.395  39.276 -81.675 1.00 72.26  ? 72   DA  I OP1   1 
ATOM   1452  O  OP2   . DA  A  1  72  ? 75.793  37.322 -82.157 1.00 72.71  ? 72   DA  I OP2   1 
ATOM   1453  O  "O5'" . DA  A  1  72  ? 76.992  38.488 -84.000 1.00 74.76  ? 72   DA  I "O5'" 1 
ATOM   1454  C  "C5'" . DA  A  1  72  ? 78.188  38.863 -84.679 1.00 75.89  ? 72   DA  I "C5'" 1 
ATOM   1455  C  "C4'" . DA  A  1  72  ? 78.219  38.240 -86.054 1.00 76.74  ? 72   DA  I "C4'" 1 
ATOM   1456  O  "O4'" . DA  A  1  72  ? 78.668  36.866 -85.988 1.00 74.52  ? 72   DA  I "O4'" 1 
ATOM   1457  C  "C3'" . DA  A  1  72  ? 76.860  38.212 -86.752 1.00 78.18  ? 72   DA  I "C3'" 1 
ATOM   1458  O  "O3'" . DA  A  1  72  ? 77.014  38.573 -88.123 1.00 82.31  ? 72   DA  I "O3'" 1 
ATOM   1459  C  "C2'" . DA  A  1  72  ? 76.418  36.765 -86.614 1.00 76.02  ? 72   DA  I "C2'" 1 
ATOM   1460  C  "C1'" . DA  A  1  72  ? 77.739  36.021 -86.646 1.00 73.83  ? 72   DA  I "C1'" 1 
ATOM   1461  N  N9    . DA  A  1  72  ? 77.741  34.732 -85.954 1.00 72.39  ? 72   DA  I N9    1 
ATOM   1462  C  C8    . DA  A  1  72  ? 77.343  34.463 -84.668 1.00 71.30  ? 72   DA  I C8    1 
ATOM   1463  N  N7    . DA  A  1  72  ? 77.496  33.208 -84.318 1.00 70.20  ? 72   DA  I N7    1 
ATOM   1464  C  C5    . DA  A  1  72  ? 78.023  32.607 -85.452 1.00 69.68  ? 72   DA  I C5    1 
ATOM   1465  C  C6    . DA  A  1  72  ? 78.418  31.282 -85.729 1.00 68.57  ? 72   DA  I C6    1 
ATOM   1466  N  N6    . DA  A  1  72  ? 78.339  30.283 -84.846 1.00 65.78  ? 72   DA  I N6    1 
ATOM   1467  N  N1    . DA  A  1  72  ? 78.905  31.015 -86.961 1.00 68.15  ? 72   DA  I N1    1 
ATOM   1468  C  C2    . DA  A  1  72  ? 78.984  32.015 -87.846 1.00 68.89  ? 72   DA  I C2    1 
ATOM   1469  N  N3    . DA  A  1  72  ? 78.648  33.299 -87.705 1.00 69.80  ? 72   DA  I N3    1 
ATOM   1470  C  C4    . DA  A  1  72  ? 78.171  33.532 -86.471 1.00 70.91  ? 72   DA  I C4    1 
ATOM   1471  P  P     . DA  A  1  73  ? 75.718  38.897 -89.007 1.00 83.51  ? 73   DA  I P     1 
ATOM   1472  O  OP1   . DA  A  1  73  ? 76.073  39.990 -89.944 1.00 83.93  ? 73   DA  I OP1   1 
ATOM   1473  O  OP2   . DA  A  1  73  ? 74.561  39.061 -88.090 1.00 84.49  ? 73   DA  I OP2   1 
ATOM   1474  O  "O5'" . DA  A  1  73  ? 75.521  37.556 -89.835 1.00 83.83  ? 73   DA  I "O5'" 1 
ATOM   1475  C  "C5'" . DA  A  1  73  ? 76.548  37.102 -90.710 1.00 85.14  ? 73   DA  I "C5'" 1 
ATOM   1476  C  "C4'" . DA  A  1  73  ? 76.093  35.870 -91.452 1.00 85.86  ? 73   DA  I "C4'" 1 
ATOM   1477  O  "O4'" . DA  A  1  73  ? 76.293  34.686 -90.644 1.00 84.78  ? 73   DA  I "O4'" 1 
ATOM   1478  C  "C3'" . DA  A  1  73  ? 74.616  35.886 -91.844 1.00 86.66  ? 73   DA  I "C3'" 1 
ATOM   1479  O  "O3'" . DA  A  1  73  ? 74.460  35.435 -93.193 1.00 88.60  ? 73   DA  I "O3'" 1 
ATOM   1480  C  "C2'" . DA  A  1  73  ? 73.972  34.934 -90.850 1.00 85.25  ? 73   DA  I "C2'" 1 
ATOM   1481  C  "C1'" . DA  A  1  73  ? 75.088  33.944 -90.556 1.00 84.18  ? 73   DA  I "C1'" 1 
ATOM   1482  N  N9    . DA  A  1  73  ? 75.029  33.350 -89.219 1.00 83.18  ? 73   DA  I N9    1 
ATOM   1483  C  C8    . DA  A  1  73  ? 74.650  33.961 -88.050 1.00 82.70  ? 73   DA  I C8    1 
ATOM   1484  N  N7    . DA  A  1  73  ? 74.693  33.173 -87.003 1.00 82.29  ? 73   DA  I N7    1 
ATOM   1485  C  C5    . DA  A  1  73  ? 75.132  31.961 -87.517 1.00 81.59  ? 73   DA  I C5    1 
ATOM   1486  C  C6    . DA  A  1  73  ? 75.385  30.717 -86.915 1.00 81.22  ? 73   DA  I C6    1 
ATOM   1487  N  N6    . DA  A  1  73  ? 75.223  30.480 -85.614 1.00 80.87  ? 73   DA  I N6    1 
ATOM   1488  N  N1    . DA  A  1  73  ? 75.817  29.710 -87.706 1.00 81.14  ? 73   DA  I N1    1 
ATOM   1489  C  C2    . DA  A  1  73  ? 75.980  29.951 -89.011 1.00 81.00  ? 73   DA  I C2    1 
ATOM   1490  N  N3    . DA  A  1  73  ? 75.774  31.076 -89.694 1.00 81.94  ? 73   DA  I N3    1 
ATOM   1491  C  C4    . DA  A  1  73  ? 75.345  32.055 -88.879 1.00 81.78  ? 73   DA  I C4    1 
ATOM   1492  P  P     . DT  A  1  74  ? 72.988  35.198 -93.790 1.00 89.38  ? 74   DT  I P     1 
ATOM   1493  O  OP1   . DT  A  1  74  ? 73.008  35.536 -95.237 1.00 89.63  ? 74   DT  I OP1   1 
ATOM   1494  O  OP2   . DT  A  1  74  ? 72.011  35.867 -92.891 1.00 89.33  ? 74   DT  I OP2   1 
ATOM   1495  O  "O5'" . DT  A  1  74  ? 72.813  33.626 -93.647 1.00 87.37  ? 74   DT  I "O5'" 1 
ATOM   1496  C  "C5'" . DT  A  1  74  ? 73.842  32.756 -94.098 1.00 85.93  ? 74   DT  I "C5'" 1 
ATOM   1497  C  "C4'" . DT  A  1  74  ? 73.398  31.321 -93.974 1.00 85.52  ? 74   DT  I "C4'" 1 
ATOM   1498  O  "O4'" . DT  A  1  74  ? 73.556  30.850 -92.612 1.00 84.92  ? 74   DT  I "O4'" 1 
ATOM   1499  C  "C3'" . DT  A  1  74  ? 71.933  31.093 -94.344 1.00 85.85  ? 74   DT  I "C3'" 1 
ATOM   1500  O  "O3'" . DT  A  1  74  ? 71.820  29.946 -95.184 1.00 87.20  ? 74   DT  I "O3'" 1 
ATOM   1501  C  "C2'" . DT  A  1  74  ? 71.259  30.850 -93.005 1.00 84.82  ? 74   DT  I "C2'" 1 
ATOM   1502  C  "C1'" . DT  A  1  74  ? 72.368  30.196 -92.201 1.00 83.88  ? 74   DT  I "C1'" 1 
ATOM   1503  N  N1    . DT  A  1  74  ? 72.242  30.337 -90.732 1.00 81.69  ? 74   DT  I N1    1 
ATOM   1504  C  C2    . DT  A  1  74  ? 72.487  29.227 -89.950 1.00 79.94  ? 74   DT  I C2    1 
ATOM   1505  O  O2    . DT  A  1  74  ? 72.810  28.144 -90.409 1.00 79.83  ? 74   DT  I O2    1 
ATOM   1506  N  N3    . DT  A  1  74  ? 72.336  29.433 -88.601 1.00 79.26  ? 74   DT  I N3    1 
ATOM   1507  C  C4    . DT  A  1  74  ? 71.969  30.607 -87.970 1.00 79.26  ? 74   DT  I C4    1 
ATOM   1508  O  O4    . DT  A  1  74  ? 71.865  30.637 -86.747 1.00 79.15  ? 74   DT  I O4    1 
ATOM   1509  C  C5    . DT  A  1  74  ? 71.731  31.732 -88.849 1.00 79.30  ? 74   DT  I C5    1 
ATOM   1510  C  C7    . DT  A  1  74  ? 71.325  33.045 -88.257 1.00 78.27  ? 74   DT  I C7    1 
ATOM   1511  C  C6    . DT  A  1  74  ? 71.882  31.544 -90.167 1.00 80.49  ? 74   DT  I C6    1 
ATOM   1512  P  P     . DT  A  1  75  ? 70.378  29.487 -95.715 1.00 89.00  ? 75   DT  I P     1 
ATOM   1513  O  OP1   . DT  A  1  75  ? 70.540  29.040 -97.124 1.00 89.15  ? 75   DT  I OP1   1 
ATOM   1514  O  OP2   . DT  A  1  75  ? 69.392  30.553 -95.387 1.00 87.82  ? 75   DT  I OP2   1 
ATOM   1515  O  "O5'" . DT  A  1  75  ? 70.070  28.211 -94.817 1.00 88.30  ? 75   DT  I "O5'" 1 
ATOM   1516  C  "C5'" . DT  A  1  75  ? 71.023  27.157 -94.731 1.00 87.72  ? 75   DT  I "C5'" 1 
ATOM   1517  C  "C4'" . DT  A  1  75  ? 70.466  26.015 -93.918 1.00 87.44  ? 75   DT  I "C4'" 1 
ATOM   1518  O  "O4'" . DT  A  1  75  ? 70.545  26.317 -92.503 1.00 86.37  ? 75   DT  I "O4'" 1 
ATOM   1519  C  "C3'" . DT  A  1  75  ? 68.999  25.708 -94.216 1.00 87.21  ? 75   DT  I "C3'" 1 
ATOM   1520  O  "O3'" . DT  A  1  75  ? 68.803  24.298 -94.313 1.00 88.23  ? 75   DT  I "O3'" 1 
ATOM   1521  C  "C2'" . DT  A  1  75  ? 68.263  26.281 -93.016 1.00 85.85  ? 75   DT  I "C2'" 1 
ATOM   1522  C  "C1'" . DT  A  1  75  ? 69.280  26.113 -91.898 1.00 84.53  ? 75   DT  I "C1'" 1 
ATOM   1523  N  N1    . DT  A  1  75  ? 69.149  27.074 -90.780 1.00 81.41  ? 75   DT  I N1    1 
ATOM   1524  C  C2    . DT  A  1  75  ? 69.377  26.620 -89.498 1.00 79.59  ? 75   DT  I C2    1 
ATOM   1525  O  O2    . DT  A  1  75  ? 69.700  25.473 -89.245 1.00 78.59  ? 75   DT  I O2    1 
ATOM   1526  N  N3    . DT  A  1  75  ? 69.217  27.566 -88.518 1.00 77.72  ? 75   DT  I N3    1 
ATOM   1527  C  C4    . DT  A  1  75  ? 68.868  28.891 -88.687 1.00 78.37  ? 75   DT  I C4    1 
ATOM   1528  O  O4    . DT  A  1  75  ? 68.760  29.626 -87.708 1.00 76.44  ? 75   DT  I O4    1 
ATOM   1529  C  C5    . DT  A  1  75  ? 68.654  29.301 -90.057 1.00 78.26  ? 75   DT  I C5    1 
ATOM   1530  C  C7    . DT  A  1  75  ? 68.281  30.722 -90.340 1.00 78.27  ? 75   DT  I C7    1 
ATOM   1531  C  C6    . DT  A  1  75  ? 68.803  28.385 -91.020 1.00 79.76  ? 75   DT  I C6    1 
ATOM   1532  P  P     . DC  A  1  76  ? 67.474  23.731 -95.013 1.00 89.31  ? 76   DC  I P     1 
ATOM   1533  O  OP1   . DC  A  1  76  ? 67.857  22.617 -95.921 1.00 88.23  ? 76   DC  I OP1   1 
ATOM   1534  O  OP2   . DC  A  1  76  ? 66.716  24.893 -95.552 1.00 88.04  ? 76   DC  I OP2   1 
ATOM   1535  O  "O5'" . DC  A  1  76  ? 66.655  23.130 -93.788 1.00 88.40  ? 76   DC  I "O5'" 1 
ATOM   1536  C  "C5'" . DC  A  1  76  ? 67.194  22.065 -93.005 1.00 86.51  ? 76   DC  I "C5'" 1 
ATOM   1537  C  "C4'" . DC  A  1  76  ? 66.337  21.830 -91.785 1.00 85.14  ? 76   DC  I "C4'" 1 
ATOM   1538  O  "O4'" . DC  A  1  76  ? 66.555  22.871 -90.798 1.00 82.66  ? 76   DC  I "O4'" 1 
ATOM   1539  C  "C3'" . DC  A  1  76  ? 64.832  21.822 -92.069 1.00 84.71  ? 76   DC  I "C3'" 1 
ATOM   1540  O  "O3'" . DC  A  1  76  ? 64.207  20.850 -91.236 1.00 86.95  ? 76   DC  I "O3'" 1 
ATOM   1541  C  "C2'" . DC  A  1  76  ? 64.394  23.198 -91.606 1.00 83.27  ? 76   DC  I "C2'" 1 
ATOM   1542  C  "C1'" . DC  A  1  76  ? 65.294  23.376 -90.398 1.00 80.76  ? 76   DC  I "C1'" 1 
ATOM   1543  N  N1    . DC  A  1  76  ? 65.471  24.752 -89.913 1.00 76.67  ? 76   DC  I N1    1 
ATOM   1544  C  C2    . DC  A  1  76  ? 65.912  24.939 -88.601 1.00 74.49  ? 76   DC  I C2    1 
ATOM   1545  O  O2    . DC  A  1  76  ? 66.180  23.942 -87.913 1.00 71.14  ? 76   DC  I O2    1 
ATOM   1546  N  N3    . DC  A  1  76  ? 66.034  26.195 -88.116 1.00 73.60  ? 76   DC  I N3    1 
ATOM   1547  C  C4    . DC  A  1  76  ? 65.739  27.240 -88.893 1.00 74.40  ? 76   DC  I C4    1 
ATOM   1548  N  N4    . DC  A  1  76  ? 65.848  28.463 -88.366 1.00 73.61  ? 76   DC  I N4    1 
ATOM   1549  C  C5    . DC  A  1  76  ? 65.312  27.078 -90.244 1.00 75.05  ? 76   DC  I C5    1 
ATOM   1550  C  C6    . DC  A  1  76  ? 65.195  25.827 -90.709 1.00 75.53  ? 76   DC  I C6    1 
ATOM   1551  P  P     . DC  A  1  77  ? 63.725  19.457 -91.861 1.00 88.17  ? 77   DC  I P     1 
ATOM   1552  O  OP1   . DC  A  1  77  ? 64.759  19.007 -92.829 1.00 89.09  ? 77   DC  I OP1   1 
ATOM   1553  O  OP2   . DC  A  1  77  ? 62.320  19.626 -92.305 1.00 88.26  ? 77   DC  I OP2   1 
ATOM   1554  O  "O5'" . DC  A  1  77  ? 63.749  18.471 -90.614 1.00 85.64  ? 77   DC  I "O5'" 1 
ATOM   1555  C  "C5'" . DC  A  1  77  ? 64.965  18.225 -89.913 1.00 82.29  ? 77   DC  I "C5'" 1 
ATOM   1556  C  "C4'" . DC  A  1  77  ? 64.747  18.378 -88.427 1.00 79.98  ? 77   DC  I "C4'" 1 
ATOM   1557  O  "O4'" . DC  A  1  77  ? 64.614  19.775 -88.066 1.00 78.49  ? 77   DC  I "O4'" 1 
ATOM   1558  C  "C3'" . DC  A  1  77  ? 63.489  17.688 -87.907 1.00 79.31  ? 77   DC  I "C3'" 1 
ATOM   1559  O  "O3'" . DC  A  1  77  ? 63.775  17.085 -86.648 1.00 79.63  ? 77   DC  I "O3'" 1 
ATOM   1560  C  "C2'" . DC  A  1  77  ? 62.495  18.829 -87.756 1.00 77.42  ? 77   DC  I "C2'" 1 
ATOM   1561  C  "C1'" . DC  A  1  77  ? 63.401  19.980 -87.356 1.00 75.51  ? 77   DC  I "C1'" 1 
ATOM   1562  N  N1    . DC  A  1  77  ? 62.911  21.331 -87.684 1.00 72.27  ? 77   DC  I N1    1 
ATOM   1563  C  C2    . DC  A  1  77  ? 63.015  22.342 -86.713 1.00 70.31  ? 77   DC  I C2    1 
ATOM   1564  O  O2    . DC  A  1  77  ? 63.472  22.060 -85.596 1.00 68.13  ? 77   DC  I O2    1 
ATOM   1565  N  N3    . DC  A  1  77  ? 62.615  23.594 -87.018 1.00 67.57  ? 77   DC  I N3    1 
ATOM   1566  C  C4    . DC  A  1  77  ? 62.119  23.858 -88.228 1.00 68.40  ? 77   DC  I C4    1 
ATOM   1567  N  N4    . DC  A  1  77  ? 61.757  25.115 -88.492 1.00 67.97  ? 77   DC  I N4    1 
ATOM   1568  C  C5    . DC  A  1  77  ? 61.977  22.847 -89.223 1.00 68.99  ? 77   DC  I C5    1 
ATOM   1569  C  C6    . DC  A  1  77  ? 62.380  21.608 -88.911 1.00 70.52  ? 77   DC  I C6    1 
ATOM   1570  P  P     . DG  A  1  78  ? 62.835  15.909 -86.103 1.00 80.94  ? 78   DG  I P     1 
ATOM   1571  O  OP1   . DG  A  1  78  ? 63.697  14.831 -85.554 1.00 80.77  ? 78   DG  I OP1   1 
ATOM   1572  O  OP2   . DG  A  1  78  ? 61.855  15.595 -87.175 1.00 81.95  ? 78   DG  I OP2   1 
ATOM   1573  O  "O5'" . DG  A  1  78  ? 62.041  16.600 -84.911 1.00 79.27  ? 78   DG  I "O5'" 1 
ATOM   1574  C  "C5'" . DG  A  1  78  ? 62.734  17.316 -83.891 1.00 76.17  ? 78   DG  I "C5'" 1 
ATOM   1575  C  "C4'" . DG  A  1  78  ? 61.778  18.231 -83.165 1.00 73.71  ? 78   DG  I "C4'" 1 
ATOM   1576  O  "O4'" . DG  A  1  78  ? 61.459  19.388 -83.979 1.00 72.90  ? 78   DG  I "O4'" 1 
ATOM   1577  C  "C3'" . DG  A  1  78  ? 60.439  17.570 -82.829 1.00 73.01  ? 78   DG  I "C3'" 1 
ATOM   1578  O  "O3'" . DG  A  1  78  ? 59.981  18.047 -81.568 1.00 70.96  ? 78   DG  I "O3'" 1 
ATOM   1579  C  "C2'" . DG  A  1  78  ? 59.517  18.116 -83.904 1.00 72.77  ? 78   DG  I "C2'" 1 
ATOM   1580  C  "C1'" . DG  A  1  78  ? 60.049  19.528 -84.017 1.00 72.48  ? 78   DG  I "C1'" 1 
ATOM   1581  N  N9    . DG  A  1  78  ? 59.682  20.253 -85.228 1.00 72.13  ? 78   DG  I N9    1 
ATOM   1582  C  C8    . DG  A  1  78  ? 59.367  19.722 -86.453 1.00 72.00  ? 78   DG  I C8    1 
ATOM   1583  N  N7    . DG  A  1  78  ? 59.068  20.629 -87.342 1.00 72.11  ? 78   DG  I N7    1 
ATOM   1584  C  C5    . DG  A  1  78  ? 59.196  21.832 -86.664 1.00 71.63  ? 78   DG  I C5    1 
ATOM   1585  C  C6    . DG  A  1  78  ? 59.001  23.163 -87.112 1.00 72.23  ? 78   DG  I C6    1 
ATOM   1586  O  O6    . DG  A  1  78  ? 58.671  23.559 -88.237 1.00 72.69  ? 78   DG  I O6    1 
ATOM   1587  N  N1    . DG  A  1  78  ? 59.235  24.084 -86.094 1.00 71.65  ? 78   DG  I N1    1 
ATOM   1588  C  C2    . DG  A  1  78  ? 59.610  23.767 -84.813 1.00 70.79  ? 78   DG  I C2    1 
ATOM   1589  N  N2    . DG  A  1  78  ? 59.791  24.802 -83.976 1.00 69.73  ? 78   DG  I N2    1 
ATOM   1590  N  N3    . DG  A  1  78  ? 59.795  22.529 -84.384 1.00 70.88  ? 78   DG  I N3    1 
ATOM   1591  C  C4    . DG  A  1  78  ? 59.573  21.618 -85.357 1.00 71.95  ? 78   DG  I C4    1 
ATOM   1592  P  P     . DC  A  1  79  ? 60.171  17.148 -80.256 1.00 71.10  ? 79   DC  I P     1 
ATOM   1593  O  OP1   . DC  A  1  79  ? 61.515  16.515 -80.335 1.00 68.74  ? 79   DC  I OP1   1 
ATOM   1594  O  OP2   . DC  A  1  79  ? 58.960  16.306 -80.071 1.00 68.41  ? 79   DC  I OP2   1 
ATOM   1595  O  "O5'" . DC  A  1  79  ? 60.222  18.235 -79.095 1.00 66.74  ? 79   DC  I "O5'" 1 
ATOM   1596  C  "C5'" . DC  A  1  79  ? 61.270  19.199 -79.060 1.00 61.25  ? 79   DC  I "C5'" 1 
ATOM   1597  C  "C4'" . DC  A  1  79  ? 60.713  20.557 -78.703 1.00 58.24  ? 79   DC  I "C4'" 1 
ATOM   1598  O  "O4'" . DC  A  1  79  ? 60.075  21.188 -79.837 1.00 55.36  ? 79   DC  I "O4'" 1 
ATOM   1599  C  "C3'" . DC  A  1  79  ? 59.668  20.536 -77.593 1.00 56.92  ? 79   DC  I "C3'" 1 
ATOM   1600  O  "O3'" . DC  A  1  79  ? 59.860  21.685 -76.784 1.00 57.56  ? 79   DC  I "O3'" 1 
ATOM   1601  C  "C2'" . DC  A  1  79  ? 58.353  20.640 -78.347 1.00 56.94  ? 79   DC  I "C2'" 1 
ATOM   1602  C  "C1'" . DC  A  1  79  ? 58.736  21.532 -79.513 1.00 55.00  ? 79   DC  I "C1'" 1 
ATOM   1603  N  N1    . DC  A  1  79  ? 57.932  21.380 -80.736 1.00 56.11  ? 79   DC  I N1    1 
ATOM   1604  C  C2    . DC  A  1  79  ? 57.613  22.532 -81.478 1.00 56.14  ? 79   DC  I C2    1 
ATOM   1605  O  O2    . DC  A  1  79  ? 57.941  23.643 -81.035 1.00 54.12  ? 79   DC  I O2    1 
ATOM   1606  N  N3    . DC  A  1  79  ? 56.952  22.403 -82.652 1.00 55.95  ? 79   DC  I N3    1 
ATOM   1607  C  C4    . DC  A  1  79  ? 56.589  21.193 -83.082 1.00 57.61  ? 79   DC  I C4    1 
ATOM   1608  N  N4    . DC  A  1  79  ? 55.959  21.115 -84.258 1.00 58.20  ? 79   DC  I N4    1 
ATOM   1609  C  C5    . DC  A  1  79  ? 56.862  20.006 -82.328 1.00 56.43  ? 79   DC  I C5    1 
ATOM   1610  C  C6    . DC  A  1  79  ? 57.527  20.146 -81.171 1.00 56.04  ? 79   DC  I C6    1 
ATOM   1611  P  P     . DT  A  1  80  ? 59.384  21.667 -75.261 1.00 58.24  ? 80   DT  I P     1 
ATOM   1612  O  OP1   . DT  A  1  80  ? 60.601  21.659 -74.427 1.00 53.68  ? 80   DT  I OP1   1 
ATOM   1613  O  OP2   . DT  A  1  80  ? 58.371  20.591 -75.099 1.00 57.84  ? 80   DT  I OP2   1 
ATOM   1614  O  "O5'" . DT  A  1  80  ? 58.627  23.060 -75.123 1.00 53.87  ? 80   DT  I "O5'" 1 
ATOM   1615  C  "C5'" . DT  A  1  80  ? 59.091  24.202 -75.827 1.00 48.46  ? 80   DT  I "C5'" 1 
ATOM   1616  C  "C4'" . DT  A  1  80  ? 57.924  25.061 -76.256 1.00 45.33  ? 80   DT  I "C4'" 1 
ATOM   1617  O  "O4'" . DT  A  1  80  ? 57.286  24.537 -77.450 1.00 44.97  ? 80   DT  I "O4'" 1 
ATOM   1618  C  "C3'" . DT  A  1  80  ? 56.825  25.221 -75.202 1.00 43.18  ? 80   DT  I "C3'" 1 
ATOM   1619  O  "O3'" . DT  A  1  80  ? 56.486  26.596 -75.102 1.00 39.41  ? 80   DT  I "O3'" 1 
ATOM   1620  C  "C2'" . DT  A  1  80  ? 55.662  24.427 -75.769 1.00 45.00  ? 80   DT  I "C2'" 1 
ATOM   1621  C  "C1'" . DT  A  1  80  ? 55.877  24.546 -77.273 1.00 47.32  ? 80   DT  I "C1'" 1 
ATOM   1622  N  N1    . DT  A  1  80  ? 55.294  23.434 -78.076 1.00 47.56  ? 80   DT  I N1    1 
ATOM   1623  C  C2    . DT  A  1  80  ? 54.854  23.700 -79.364 1.00 48.15  ? 80   DT  I C2    1 
ATOM   1624  O  O2    . DT  A  1  80  ? 54.872  24.804 -79.870 1.00 43.14  ? 80   DT  I O2    1 
ATOM   1625  N  N3    . DT  A  1  80  ? 54.369  22.610 -80.037 1.00 50.59  ? 80   DT  I N3    1 
ATOM   1626  C  C4    . DT  A  1  80  ? 54.254  21.324 -79.564 1.00 51.32  ? 80   DT  I C4    1 
ATOM   1627  O  O4    . DT  A  1  80  ? 53.802  20.451 -80.287 1.00 56.05  ? 80   DT  I O4    1 
ATOM   1628  C  C5    . DT  A  1  80  ? 54.697  21.120 -78.205 1.00 51.85  ? 80   DT  I C5    1 
ATOM   1629  C  C7    . DT  A  1  80  ? 54.577  19.752 -77.606 1.00 49.83  ? 80   DT  I C7    1 
ATOM   1630  C  C6    . DT  A  1  80  ? 55.196  22.169 -77.541 1.00 46.66  ? 80   DT  I C6    1 
ATOM   1631  P  P     . DG  A  1  81  ? 55.444  27.099 -73.995 1.00 37.95  ? 81   DG  I P     1 
ATOM   1632  O  OP1   . DG  A  1  81  ? 56.216  27.951 -73.067 1.00 38.89  ? 81   DG  I OP1   1 
ATOM   1633  O  OP2   . DG  A  1  81  ? 54.626  25.994 -73.447 1.00 39.62  ? 81   DG  I OP2   1 
ATOM   1634  O  "O5'" . DG  A  1  81  ? 54.493  28.035 -74.860 1.00 39.73  ? 81   DG  I "O5'" 1 
ATOM   1635  C  "C5'" . DG  A  1  81  ? 55.064  28.948 -75.802 1.00 36.94  ? 81   DG  I "C5'" 1 
ATOM   1636  C  "C4'" . DG  A  1  81  ? 53.984  29.570 -76.653 1.00 39.91  ? 81   DG  I "C4'" 1 
ATOM   1637  O  "O4'" . DG  A  1  81  ? 53.455  28.599 -77.590 1.00 38.65  ? 81   DG  I "O4'" 1 
ATOM   1638  C  "C3'" . DG  A  1  81  ? 52.778  30.107 -75.886 1.00 38.32  ? 81   DG  I "C3'" 1 
ATOM   1639  O  "O3'" . DG  A  1  81  ? 52.292  31.249 -76.596 1.00 38.37  ? 81   DG  I "O3'" 1 
ATOM   1640  C  "C2'" . DG  A  1  81  ? 51.793  28.952 -75.943 1.00 36.57  ? 81   DG  I "C2'" 1 
ATOM   1641  C  "C1'" . DG  A  1  81  ? 52.093  28.317 -77.297 1.00 38.90  ? 81   DG  I "C1'" 1 
ATOM   1642  N  N9    . DG  A  1  81  ? 51.939  26.867 -77.355 1.00 42.38  ? 81   DG  I N9    1 
ATOM   1643  C  C8    . DG  A  1  81  ? 52.216  25.948 -76.367 1.00 43.45  ? 81   DG  I C8    1 
ATOM   1644  N  N7    . DG  A  1  81  ? 52.022  24.713 -76.749 1.00 45.13  ? 81   DG  I N7    1 
ATOM   1645  C  C5    . DG  A  1  81  ? 51.577  24.827 -78.060 1.00 45.18  ? 81   DG  I C5    1 
ATOM   1646  C  C6    . DG  A  1  81  ? 51.209  23.825 -79.001 1.00 47.33  ? 81   DG  I C6    1 
ATOM   1647  O  O6    . DG  A  1  81  ? 51.210  22.600 -78.857 1.00 44.87  ? 81   DG  I O6    1 
ATOM   1648  N  N1    . DG  A  1  81  ? 50.814  24.382 -80.216 1.00 45.15  ? 81   DG  I N1    1 
ATOM   1649  C  C2    . DG  A  1  81  ? 50.783  25.729 -80.491 1.00 46.77  ? 81   DG  I C2    1 
ATOM   1650  N  N2    . DG  A  1  81  ? 50.367  26.080 -81.713 1.00 45.24  ? 81   DG  I N2    1 
ATOM   1651  N  N3    . DG  A  1  81  ? 51.134  26.668 -79.626 1.00 45.18  ? 81   DG  I N3    1 
ATOM   1652  C  C4    . DG  A  1  81  ? 51.513  26.150 -78.442 1.00 43.60  ? 81   DG  I C4    1 
ATOM   1653  P  P     . DA  A  1  82  ? 51.065  32.101 -76.018 1.00 40.22  ? 82   DA  I P     1 
ATOM   1654  O  OP1   . DA  A  1  82  ? 51.368  33.524 -76.332 1.00 41.27  ? 82   DA  I OP1   1 
ATOM   1655  O  OP2   . DA  A  1  82  ? 50.766  31.706 -74.631 1.00 39.28  ? 82   DA  I OP2   1 
ATOM   1656  O  "O5'" . DA  A  1  82  ? 49.847  31.653 -76.941 1.00 40.65  ? 82   DA  I "O5'" 1 
ATOM   1657  C  "C5'" . DA  A  1  82  ? 49.896  31.886 -78.345 1.00 40.36  ? 82   DA  I "C5'" 1 
ATOM   1658  C  "C4'" . DA  A  1  82  ? 48.646  31.366 -79.012 1.00 41.22  ? 82   DA  I "C4'" 1 
ATOM   1659  O  "O4'" . DA  A  1  82  ? 48.669  29.925 -79.096 1.00 41.92  ? 82   DA  I "O4'" 1 
ATOM   1660  C  "C3'" . DA  A  1  82  ? 47.333  31.738 -78.324 1.00 41.90  ? 82   DA  I "C3'" 1 
ATOM   1661  O  "O3'" . DA  A  1  82  ? 46.424  32.158 -79.333 1.00 42.46  ? 82   DA  I "O3'" 1 
ATOM   1662  C  "C2'" . DA  A  1  82  ? 46.882  30.438 -77.675 1.00 39.73  ? 82   DA  I "C2'" 1 
ATOM   1663  C  "C1'" . DA  A  1  82  ? 47.454  29.388 -78.613 1.00 42.94  ? 82   DA  I "C1'" 1 
ATOM   1664  N  N9    . DA  A  1  82  ? 47.766  28.097 -78.002 1.00 44.95  ? 82   DA  I N9    1 
ATOM   1665  C  C8    . DA  A  1  82  ? 48.245  27.858 -76.744 1.00 46.47  ? 82   DA  I C8    1 
ATOM   1666  N  N7    . DA  A  1  82  ? 48.451  26.588 -76.488 1.00 47.66  ? 82   DA  I N7    1 
ATOM   1667  C  C5    . DA  A  1  82  ? 48.078  25.945 -77.657 1.00 48.67  ? 82   DA  I C5    1 
ATOM   1668  C  C6    . DA  A  1  82  ? 48.065  24.583 -78.032 1.00 49.19  ? 82   DA  I C6    1 
ATOM   1669  N  N6    . DA  A  1  82  ? 48.469  23.591 -77.234 1.00 47.46  ? 82   DA  I N6    1 
ATOM   1670  N  N1    . DA  A  1  82  ? 47.625  24.277 -79.271 1.00 47.32  ? 82   DA  I N1    1 
ATOM   1671  C  C2    . DA  A  1  82  ? 47.240  25.277 -80.076 1.00 48.27  ? 82   DA  I C2    1 
ATOM   1672  N  N3    . DA  A  1  82  ? 47.217  26.593 -79.842 1.00 48.05  ? 82   DA  I N3    1 
ATOM   1673  C  C4    . DA  A  1  82  ? 47.650  26.862 -78.600 1.00 47.15  ? 82   DA  I C4    1 
ATOM   1674  P  P     . DA  A  1  83  ? 44.998  32.759 -78.932 1.00 42.71  ? 83   DA  I P     1 
ATOM   1675  O  OP1   . DA  A  1  83  ? 44.721  33.820 -79.940 1.00 44.44  ? 83   DA  I OP1   1 
ATOM   1676  O  OP2   . DA  A  1  83  ? 44.952  33.092 -77.481 1.00 43.21  ? 83   DA  I OP2   1 
ATOM   1677  O  "O5'" . DA  A  1  83  ? 44.049  31.524 -79.223 1.00 43.63  ? 83   DA  I "O5'" 1 
ATOM   1678  C  "C5'" . DA  A  1  83  ? 44.048  30.940 -80.521 1.00 48.42  ? 83   DA  I "C5'" 1 
ATOM   1679  C  "C4'" . DA  A  1  83  ? 43.116  29.758 -80.565 1.00 52.23  ? 83   DA  I "C4'" 1 
ATOM   1680  O  "O4'" . DA  A  1  83  ? 43.735  28.606 -79.947 1.00 52.72  ? 83   DA  I "O4'" 1 
ATOM   1681  C  "C3'" . DA  A  1  83  ? 41.790  29.979 -79.840 1.00 54.67  ? 83   DA  I "C3'" 1 
ATOM   1682  O  "O3'" . DA  A  1  83  ? 40.728  29.534 -80.682 1.00 60.02  ? 83   DA  I "O3'" 1 
ATOM   1683  C  "C2'" . DA  A  1  83  ? 41.918  29.123 -78.589 1.00 52.79  ? 83   DA  I "C2'" 1 
ATOM   1684  C  "C1'" . DA  A  1  83  ? 42.816  27.998 -79.065 1.00 52.69  ? 83   DA  I "C1'" 1 
ATOM   1685  N  N9    . DA  A  1  83  ? 43.582  27.317 -78.023 1.00 53.63  ? 83   DA  I N9    1 
ATOM   1686  C  C8    . DA  A  1  83  ? 44.126  27.854 -76.882 1.00 54.26  ? 83   DA  I C8    1 
ATOM   1687  N  N7    . DA  A  1  83  ? 44.762  26.980 -76.140 1.00 54.49  ? 83   DA  I N7    1 
ATOM   1688  C  C5    . DA  A  1  83  ? 44.623  25.786 -76.833 1.00 53.59  ? 83   DA  I C5    1 
ATOM   1689  C  C6    . DA  A  1  83  ? 45.062  24.471 -76.562 1.00 53.68  ? 83   DA  I C6    1 
ATOM   1690  N  N6    . DA  A  1  83  ? 45.765  24.128 -75.480 1.00 50.36  ? 83   DA  I N6    1 
ATOM   1691  N  N1    . DA  A  1  83  ? 44.747  23.509 -77.456 1.00 53.97  ? 83   DA  I N1    1 
ATOM   1692  C  C2    . DA  A  1  83  ? 44.048  23.850 -78.545 1.00 55.54  ? 83   DA  I C2    1 
ATOM   1693  N  N3    . DA  A  1  83  ? 43.580  25.047 -78.910 1.00 55.24  ? 83   DA  I N3    1 
ATOM   1694  C  C4    . DA  A  1  83  ? 43.902  25.980 -77.998 1.00 54.07  ? 83   DA  I C4    1 
ATOM   1695  P  P     . DC  A  1  84  ? 39.203  29.795 -80.255 1.00 62.02  ? 84   DC  I P     1 
ATOM   1696  O  OP1   . DC  A  1  84  ? 38.484  30.228 -81.476 1.00 64.54  ? 84   DC  I OP1   1 
ATOM   1697  O  OP2   . DC  A  1  84  ? 39.146  30.640 -79.037 1.00 60.95  ? 84   DC  I OP2   1 
ATOM   1698  O  "O5'" . DC  A  1  84  ? 38.720  28.330 -79.875 1.00 64.24  ? 84   DC  I "O5'" 1 
ATOM   1699  C  "C5'" . DC  A  1  84  ? 39.079  27.223 -80.701 1.00 66.64  ? 84   DC  I "C5'" 1 
ATOM   1700  C  "C4'" . DC  A  1  84  ? 38.632  25.933 -80.060 1.00 69.12  ? 84   DC  I "C4'" 1 
ATOM   1701  O  "O4'" . DC  A  1  84  ? 39.641  25.389 -79.169 1.00 69.29  ? 84   DC  I "O4'" 1 
ATOM   1702  C  "C3'" . DC  A  1  84  ? 37.355  26.075 -79.233 1.00 70.92  ? 84   DC  I "C3'" 1 
ATOM   1703  O  "O3'" . DC  A  1  84  ? 36.482  24.996 -79.535 1.00 74.00  ? 84   DC  I "O3'" 1 
ATOM   1704  C  "C2'" . DC  A  1  84  ? 37.845  25.965 -77.799 1.00 70.19  ? 84   DC  I "C2'" 1 
ATOM   1705  C  "C1'" . DC  A  1  84  ? 39.024  25.018 -77.949 1.00 69.22  ? 84   DC  I "C1'" 1 
ATOM   1706  N  N1    . DC  A  1  84  ? 40.033  25.083 -76.872 1.00 67.74  ? 84   DC  I N1    1 
ATOM   1707  C  C2    . DC  A  1  84  ? 40.735  23.914 -76.532 1.00 66.85  ? 84   DC  I C2    1 
ATOM   1708  O  O2    . DC  A  1  84  ? 40.511  22.874 -77.163 1.00 65.99  ? 84   DC  I O2    1 
ATOM   1709  N  N3    . DC  A  1  84  ? 41.638  23.951 -75.525 1.00 65.07  ? 84   DC  I N3    1 
ATOM   1710  C  C4    . DC  A  1  84  ? 41.858  25.092 -74.868 1.00 65.23  ? 84   DC  I C4    1 
ATOM   1711  N  N4    . DC  A  1  84  ? 42.752  25.077 -73.874 1.00 62.43  ? 84   DC  I N4    1 
ATOM   1712  C  C5    . DC  A  1  84  ? 41.169  26.299 -75.200 1.00 65.55  ? 84   DC  I C5    1 
ATOM   1713  C  C6    . DC  A  1  84  ? 40.275  26.249 -76.201 1.00 66.97  ? 84   DC  I C6    1 
ATOM   1714  P  P     . DA  A  1  85  ? 34.919  25.116 -79.202 1.00 73.84  ? 85   DA  I P     1 
ATOM   1715  O  OP1   . DA  A  1  85  ? 34.197  25.464 -80.453 1.00 75.58  ? 85   DA  I OP1   1 
ATOM   1716  O  OP2   . DA  A  1  85  ? 34.750  25.965 -77.995 1.00 74.20  ? 85   DA  I OP2   1 
ATOM   1717  O  "O5'" . DA  A  1  85  ? 34.563  23.617 -78.818 1.00 72.83  ? 85   DA  I "O5'" 1 
ATOM   1718  C  "C5'" . DA  A  1  85  ? 35.158  22.541 -79.531 1.00 70.67  ? 85   DA  I "C5'" 1 
ATOM   1719  C  "C4'" . DA  A  1  85  ? 35.217  21.316 -78.654 1.00 71.16  ? 85   DA  I "C4'" 1 
ATOM   1720  O  "O4'" . DA  A  1  85  ? 36.311  21.417 -77.710 1.00 69.18  ? 85   DA  I "O4'" 1 
ATOM   1721  C  "C3'" . DA  A  1  85  ? 33.950  21.109 -77.827 1.00 71.36  ? 85   DA  I "C3'" 1 
ATOM   1722  O  "O3'" . DA  A  1  85  ? 33.603  19.726 -77.829 1.00 73.20  ? 85   DA  I "O3'" 1 
ATOM   1723  C  "C2'" . DA  A  1  85  ? 34.341  21.594 -76.440 1.00 68.98  ? 85   DA  I "C2'" 1 
ATOM   1724  C  "C1'" . DA  A  1  85  ? 35.830  21.285 -76.379 1.00 67.78  ? 85   DA  I "C1'" 1 
ATOM   1725  N  N9    . DA  A  1  85  ? 36.609  22.196 -75.535 1.00 65.79  ? 85   DA  I N9    1 
ATOM   1726  C  C8    . DA  A  1  85  ? 36.532  23.567 -75.494 1.00 64.61  ? 85   DA  I C8    1 
ATOM   1727  N  N7    . DA  A  1  85  ? 37.371  24.120 -74.653 1.00 63.12  ? 85   DA  I N7    1 
ATOM   1728  C  C5    . DA  A  1  85  ? 38.044  23.043 -74.095 1.00 62.60  ? 85   DA  I C5    1 
ATOM   1729  C  C6    . DA  A  1  85  ? 39.067  22.964 -73.130 1.00 61.56  ? 85   DA  I C6    1 
ATOM   1730  N  N6    . DA  A  1  85  ? 39.595  24.032 -72.528 1.00 56.67  ? 85   DA  I N6    1 
ATOM   1731  N  N1    . DA  A  1  85  ? 39.529  21.735 -72.798 1.00 60.76  ? 85   DA  I N1    1 
ATOM   1732  C  C2    . DA  A  1  85  ? 38.984  20.665 -73.397 1.00 62.61  ? 85   DA  I C2    1 
ATOM   1733  N  N3    . DA  A  1  85  ? 38.012  20.611 -74.315 1.00 62.20  ? 85   DA  I N3    1 
ATOM   1734  C  C4    . DA  A  1  85  ? 37.583  21.849 -74.626 1.00 63.78  ? 85   DA  I C4    1 
ATOM   1735  P  P     . DT  A  1  86  ? 32.247  19.243 -77.121 1.00 73.46  ? 86   DT  I P     1 
ATOM   1736  O  OP1   . DT  A  1  86  ? 31.732  18.092 -77.912 1.00 73.82  ? 86   DT  I OP1   1 
ATOM   1737  O  OP2   . DT  A  1  86  ? 31.374  20.421 -76.878 1.00 71.66  ? 86   DT  I OP2   1 
ATOM   1738  O  "O5'" . DT  A  1  86  ? 32.770  18.700 -75.721 1.00 73.36  ? 86   DT  I "O5'" 1 
ATOM   1739  C  "C5'" . DT  A  1  86  ? 33.811  17.730 -75.684 1.00 70.35  ? 86   DT  I "C5'" 1 
ATOM   1740  C  "C4'" . DT  A  1  86  ? 34.156  17.383 -74.257 1.00 68.97  ? 86   DT  I "C4'" 1 
ATOM   1741  O  "O4'" . DT  A  1  86  ? 35.005  18.399 -73.667 1.00 67.64  ? 86   DT  I "O4'" 1 
ATOM   1742  C  "C3'" . DT  A  1  86  ? 32.949  17.229 -73.330 1.00 67.54  ? 86   DT  I "C3'" 1 
ATOM   1743  O  "O3'" . DT  A  1  86  ? 33.112  16.036 -72.559 1.00 66.94  ? 86   DT  I "O3'" 1 
ATOM   1744  C  "C2'" . DT  A  1  86  ? 33.016  18.470 -72.451 1.00 66.52  ? 86   DT  I "C2'" 1 
ATOM   1745  C  "C1'" . DT  A  1  86  ? 34.514  18.718 -72.378 1.00 66.82  ? 86   DT  I "C1'" 1 
ATOM   1746  N  N1    . DT  A  1  86  ? 34.957  20.093 -72.041 1.00 66.60  ? 86   DT  I N1    1 
ATOM   1747  C  C2    . DT  A  1  86  ? 36.118  20.228 -71.294 1.00 66.32  ? 86   DT  I C2    1 
ATOM   1748  O  O2    . DT  A  1  86  ? 36.779  19.278 -70.903 1.00 65.40  ? 86   DT  I O2    1 
ATOM   1749  N  N3    . DT  A  1  86  ? 36.478  21.524 -71.023 1.00 65.32  ? 86   DT  I N3    1 
ATOM   1750  C  C4    . DT  A  1  86  ? 35.823  22.672 -71.411 1.00 65.58  ? 86   DT  I C4    1 
ATOM   1751  O  O4    . DT  A  1  86  ? 36.278  23.768 -71.095 1.00 64.39  ? 86   DT  I O4    1 
ATOM   1752  C  C5    . DT  A  1  86  ? 34.614  22.463 -72.186 1.00 66.13  ? 86   DT  I C5    1 
ATOM   1753  C  C7    . DT  A  1  86  ? 33.836  23.654 -72.650 1.00 64.63  ? 86   DT  I C7    1 
ATOM   1754  C  C6    . DT  A  1  86  ? 34.246  21.199 -72.457 1.00 65.70  ? 86   DT  I C6    1 
ATOM   1755  P  P     . DG  A  1  87  ? 31.868  15.426 -71.747 1.00 64.77  ? 87   DG  I P     1 
ATOM   1756  O  OP1   . DG  A  1  87  ? 31.837  13.969 -71.993 1.00 63.91  ? 87   DG  I OP1   1 
ATOM   1757  O  OP2   . DG  A  1  87  ? 30.663  16.252 -72.014 1.00 64.13  ? 87   DG  I OP2   1 
ATOM   1758  O  "O5'" . DG  A  1  87  ? 32.270  15.663 -70.224 1.00 64.66  ? 87   DG  I "O5'" 1 
ATOM   1759  C  "C5'" . DG  A  1  87  ? 33.525  15.213 -69.722 1.00 63.47  ? 87   DG  I "C5'" 1 
ATOM   1760  C  "C4'" . DG  A  1  87  ? 33.799  15.840 -68.376 1.00 64.16  ? 87   DG  I "C4'" 1 
ATOM   1761  O  "O4'" . DG  A  1  87  ? 34.220  17.221 -68.513 1.00 63.11  ? 87   DG  I "O4'" 1 
ATOM   1762  C  "C3'" . DG  A  1  87  ? 32.590  15.856 -67.438 1.00 63.75  ? 87   DG  I "C3'" 1 
ATOM   1763  O  "O3'" . DG  A  1  87  ? 33.030  15.599 -66.111 1.00 63.50  ? 87   DG  I "O3'" 1 
ATOM   1764  C  "C2'" . DG  A  1  87  ? 32.121  17.296 -67.511 1.00 65.11  ? 87   DG  I "C2'" 1 
ATOM   1765  C  "C1'" . DG  A  1  87  ? 33.455  18.004 -67.617 1.00 65.51  ? 87   DG  I "C1'" 1 
ATOM   1766  N  N9    . DG  A  1  87  ? 33.424  19.375 -68.111 1.00 68.06  ? 87   DG  I N9    1 
ATOM   1767  C  C8    . DG  A  1  87  ? 32.553  19.929 -69.018 1.00 68.71  ? 87   DG  I C8    1 
ATOM   1768  N  N7    . DG  A  1  87  ? 32.777  21.198 -69.232 1.00 69.50  ? 87   DG  I N7    1 
ATOM   1769  C  C5    . DG  A  1  87  ? 33.866  21.495 -68.423 1.00 68.56  ? 87   DG  I C5    1 
ATOM   1770  C  C6    . DG  A  1  87  ? 34.563  22.714 -68.230 1.00 68.92  ? 87   DG  I C6    1 
ATOM   1771  O  O6    . DG  A  1  87  ? 34.355  23.812 -68.757 1.00 68.06  ? 87   DG  I O6    1 
ATOM   1772  N  N1    . DG  A  1  87  ? 35.605  22.570 -67.314 1.00 70.17  ? 87   DG  I N1    1 
ATOM   1773  C  C2    . DG  A  1  87  ? 35.935  21.401 -66.668 1.00 70.42  ? 87   DG  I C2    1 
ATOM   1774  N  N2    . DG  A  1  87  ? 36.971  21.462 -65.806 1.00 66.96  ? 87   DG  I N2    1 
ATOM   1775  N  N3    . DG  A  1  87  ? 35.295  20.256 -66.849 1.00 68.83  ? 87   DG  I N3    1 
ATOM   1776  C  C4    . DG  A  1  87  ? 34.279  20.378 -67.730 1.00 68.63  ? 87   DG  I C4    1 
ATOM   1777  P  P     . DC  A  1  88  ? 33.350  14.098 -65.661 1.00 62.04  ? 88   DC  I P     1 
ATOM   1778  O  OP1   . DC  A  1  88  ? 33.906  13.365 -66.826 1.00 57.25  ? 88   DC  I OP1   1 
ATOM   1779  O  OP2   . DC  A  1  88  ? 32.150  13.573 -64.959 1.00 62.27  ? 88   DC  I OP2   1 
ATOM   1780  O  "O5'" . DC  A  1  88  ? 34.508  14.287 -64.587 1.00 64.60  ? 88   DC  I "O5'" 1 
ATOM   1781  C  "C5'" . DC  A  1  88  ? 35.866  14.450 -64.994 1.00 66.24  ? 88   DC  I "C5'" 1 
ATOM   1782  C  "C4'" . DC  A  1  88  ? 36.563  15.429 -64.079 1.00 67.29  ? 88   DC  I "C4'" 1 
ATOM   1783  O  "O4'" . DC  A  1  88  ? 36.098  16.774 -64.332 1.00 67.34  ? 88   DC  I "O4'" 1 
ATOM   1784  C  "C3'" . DC  A  1  88  ? 36.322  15.185 -62.590 1.00 67.57  ? 88   DC  I "C3'" 1 
ATOM   1785  O  "O3'" . DC  A  1  88  ? 37.480  15.624 -61.892 1.00 67.33  ? 88   DC  I "O3'" 1 
ATOM   1786  C  "C2'" . DC  A  1  88  ? 35.191  16.148 -62.276 1.00 69.40  ? 88   DC  I "C2'" 1 
ATOM   1787  C  "C1'" . DC  A  1  88  ? 35.613  17.331 -63.121 1.00 70.38  ? 88   DC  I "C1'" 1 
ATOM   1788  N  N1    . DC  A  1  88  ? 34.582  18.323 -63.459 1.00 72.60  ? 88   DC  I N1    1 
ATOM   1789  C  C2    . DC  A  1  88  ? 34.908  19.677 -63.343 1.00 73.70  ? 88   DC  I C2    1 
ATOM   1790  O  O2    . DC  A  1  88  ? 36.021  19.985 -62.901 1.00 74.11  ? 88   DC  I O2    1 
ATOM   1791  N  N3    . DC  A  1  88  ? 34.006  20.612 -63.712 1.00 74.33  ? 88   DC  I N3    1 
ATOM   1792  C  C4    . DC  A  1  88  ? 32.814  20.238 -64.177 1.00 75.38  ? 88   DC  I C4    1 
ATOM   1793  N  N4    . DC  A  1  88  ? 31.970  21.199 -64.568 1.00 75.26  ? 88   DC  I N4    1 
ATOM   1794  C  C5    . DC  A  1  88  ? 32.438  18.864 -64.272 1.00 74.52  ? 88   DC  I C5    1 
ATOM   1795  C  C6    . DC  A  1  88  ? 33.345  17.947 -63.902 1.00 73.80  ? 88   DC  I C6    1 
ATOM   1796  P  P     . DC  A  1  89  ? 38.325  14.600 -60.997 1.00 66.04  ? 89   DC  I P     1 
ATOM   1797  O  OP1   . DC  A  1  89  ? 39.432  14.061 -61.825 1.00 63.44  ? 89   DC  I OP1   1 
ATOM   1798  O  OP2   . DC  A  1  89  ? 37.392  13.666 -60.321 1.00 67.13  ? 89   DC  I OP2   1 
ATOM   1799  O  "O5'" . DC  A  1  89  ? 38.945  15.570 -59.898 1.00 63.12  ? 89   DC  I "O5'" 1 
ATOM   1800  C  "C5'" . DC  A  1  89  ? 39.569  16.793 -60.285 1.00 60.23  ? 89   DC  I "C5'" 1 
ATOM   1801  C  "C4'" . DC  A  1  89  ? 39.124  17.921 -59.385 1.00 58.18  ? 89   DC  I "C4'" 1 
ATOM   1802  O  "O4'" . DC  A  1  89  ? 37.834  18.451 -59.771 1.00 57.63  ? 89   DC  I "O4'" 1 
ATOM   1803  C  "C3'" . DC  A  1  89  ? 39.005  17.567 -57.902 1.00 58.21  ? 89   DC  I "C3'" 1 
ATOM   1804  O  "O3'" . DC  A  1  89  ? 39.432  18.691 -57.148 1.00 58.78  ? 89   DC  I "O3'" 1 
ATOM   1805  C  "C2'" . DC  A  1  89  ? 37.504  17.461 -57.705 1.00 59.47  ? 89   DC  I "C2'" 1 
ATOM   1806  C  "C1'" . DC  A  1  89  ? 37.047  18.593 -58.600 1.00 59.58  ? 89   DC  I "C1'" 1 
ATOM   1807  N  N1    . DC  A  1  89  ? 35.627  18.584 -58.986 1.00 63.30  ? 89   DC  I N1    1 
ATOM   1808  C  C2    . DC  A  1  89  ? 35.025  19.794 -59.366 1.00 64.35  ? 89   DC  I C2    1 
ATOM   1809  O  O2    . DC  A  1  89  ? 35.701  20.836 -59.346 1.00 62.56  ? 89   DC  I O2    1 
ATOM   1810  N  N3    . DC  A  1  89  ? 33.725  19.795 -59.743 1.00 65.28  ? 89   DC  I N3    1 
ATOM   1811  C  C4    . DC  A  1  89  ? 33.030  18.654 -59.745 1.00 66.06  ? 89   DC  I C4    1 
ATOM   1812  N  N4    . DC  A  1  89  ? 31.755  18.700 -60.140 1.00 66.45  ? 89   DC  I N4    1 
ATOM   1813  C  C5    . DC  A  1  89  ? 33.613  17.414 -59.347 1.00 64.64  ? 89   DC  I C5    1 
ATOM   1814  C  C6    . DC  A  1  89  ? 34.901  17.424 -58.981 1.00 63.98  ? 89   DC  I C6    1 
ATOM   1815  P  P     . DT  A  1  90  ? 40.757  18.608 -56.258 1.00 55.20  ? 90   DT  I P     1 
ATOM   1816  O  OP1   . DT  A  1  90  ? 41.855  18.104 -57.108 1.00 54.18  ? 90   DT  I OP1   1 
ATOM   1817  O  OP2   . DT  A  1  90  ? 40.404  17.897 -55.006 1.00 55.99  ? 90   DT  I OP2   1 
ATOM   1818  O  "O5'" . DT  A  1  90  ? 41.022  20.144 -55.960 1.00 53.84  ? 90   DT  I "O5'" 1 
ATOM   1819  C  "C5'" . DT  A  1  90  ? 41.268  21.027 -57.045 1.00 52.63  ? 90   DT  I "C5'" 1 
ATOM   1820  C  "C4'" . DT  A  1  90  ? 40.395  22.254 -56.944 1.00 50.03  ? 90   DT  I "C4'" 1 
ATOM   1821  O  "O4'" . DT  A  1  90  ? 39.005  21.926 -57.197 1.00 50.64  ? 90   DT  I "O4'" 1 
ATOM   1822  C  "C3'" . DT  A  1  90  ? 40.439  22.964 -55.591 1.00 49.20  ? 90   DT  I "C3'" 1 
ATOM   1823  O  "O3'" . DT  A  1  90  ? 40.668  24.359 -55.785 1.00 41.21  ? 90   DT  I "O3'" 1 
ATOM   1824  C  "C2'" . DT  A  1  90  ? 39.062  22.707 -54.995 1.00 49.48  ? 90   DT  I "C2'" 1 
ATOM   1825  C  "C1'" . DT  A  1  90  ? 38.182  22.555 -56.225 1.00 52.44  ? 90   DT  I "C1'" 1 
ATOM   1826  N  N1    . DT  A  1  90  ? 36.970  21.716 -56.026 1.00 57.73  ? 90   DT  I N1    1 
ATOM   1827  C  C2    . DT  A  1  90  ? 35.735  22.245 -56.372 1.00 59.54  ? 90   DT  I C2    1 
ATOM   1828  O  O2    . DT  A  1  90  ? 35.585  23.369 -56.829 1.00 58.30  ? 90   DT  I O2    1 
ATOM   1829  N  N3    . DT  A  1  90  ? 34.673  21.402 -56.157 1.00 61.01  ? 90   DT  I N3    1 
ATOM   1830  C  C4    . DT  A  1  90  ? 34.710  20.123 -55.638 1.00 62.11  ? 90   DT  I C4    1 
ATOM   1831  O  O4    . DT  A  1  90  ? 33.672  19.490 -55.504 1.00 63.52  ? 90   DT  I O4    1 
ATOM   1832  C  C5    . DT  A  1  90  ? 36.023  19.635 -55.289 1.00 61.73  ? 90   DT  I C5    1 
ATOM   1833  C  C7    . DT  A  1  90  ? 36.152  18.263 -54.703 1.00 60.34  ? 90   DT  I C7    1 
ATOM   1834  C  C6    . DT  A  1  90  ? 37.076  20.442 -55.503 1.00 59.26  ? 90   DT  I C6    1 
ATOM   1835  P  P     . DT  A  1  91  ? 40.872  25.307 -54.518 1.00 43.19  ? 91   DT  I P     1 
ATOM   1836  O  OP1   . DT  A  1  91  ? 41.877  26.332 -54.901 1.00 45.10  ? 91   DT  I OP1   1 
ATOM   1837  O  OP2   . DT  A  1  91  ? 41.119  24.446 -53.331 1.00 43.99  ? 91   DT  I OP2   1 
ATOM   1838  O  "O5'" . DT  A  1  91  ? 39.456  26.013 -54.348 1.00 46.33  ? 91   DT  I "O5'" 1 
ATOM   1839  C  "C5'" . DT  A  1  91  ? 38.862  26.693 -55.454 1.00 49.59  ? 91   DT  I "C5'" 1 
ATOM   1840  C  "C4'" . DT  A  1  91  ? 37.459  27.141 -55.114 1.00 53.36  ? 91   DT  I "C4'" 1 
ATOM   1841  O  "O4'" . DT  A  1  91  ? 36.537  26.022 -55.093 1.00 54.25  ? 91   DT  I "O4'" 1 
ATOM   1842  C  "C3'" . DT  A  1  91  ? 37.303  27.850 -53.770 1.00 56.87  ? 91   DT  I "C3'" 1 
ATOM   1843  O  "O3'" . DT  A  1  91  ? 36.532  29.034 -53.956 1.00 60.43  ? 91   DT  I "O3'" 1 
ATOM   1844  C  "C2'" . DT  A  1  91  ? 36.549  26.845 -52.912 1.00 55.83  ? 91   DT  I "C2'" 1 
ATOM   1845  C  "C1'" . DT  A  1  91  ? 35.714  26.109 -53.941 1.00 55.60  ? 91   DT  I "C1'" 1 
ATOM   1846  N  N1    . DT  A  1  91  ? 35.281  24.737 -53.579 1.00 57.48  ? 91   DT  I N1    1 
ATOM   1847  C  C2    . DT  A  1  91  ? 34.006  24.345 -53.952 1.00 58.32  ? 91   DT  I C2    1 
ATOM   1848  O  O2    . DT  A  1  91  ? 33.223  25.080 -54.537 1.00 59.62  ? 91   DT  I O2    1 
ATOM   1849  N  N3    . DT  A  1  91  ? 33.679  23.054 -53.614 1.00 57.12  ? 91   DT  I N3    1 
ATOM   1850  C  C4    . DT  A  1  91  ? 34.476  22.135 -52.956 1.00 57.81  ? 91   DT  I C4    1 
ATOM   1851  O  O4    . DT  A  1  91  ? 34.053  21.001 -52.741 1.00 55.60  ? 91   DT  I O4    1 
ATOM   1852  C  C5    . DT  A  1  91  ? 35.792  22.616 -52.575 1.00 56.61  ? 91   DT  I C5    1 
ATOM   1853  C  C7    . DT  A  1  91  ? 36.716  21.693 -51.841 1.00 53.28  ? 91   DT  I C7    1 
ATOM   1854  C  C6    . DT  A  1  91  ? 36.123  23.876 -52.902 1.00 56.20  ? 91   DT  I C6    1 
ATOM   1855  P  P     . DT  A  1  92  ? 36.394  30.088 -52.758 1.00 63.93  ? 92   DT  I P     1 
ATOM   1856  O  OP1   . DT  A  1  92  ? 36.495  31.452 -53.336 1.00 63.89  ? 92   DT  I OP1   1 
ATOM   1857  O  OP2   . DT  A  1  92  ? 37.305  29.683 -51.661 1.00 64.83  ? 92   DT  I OP2   1 
ATOM   1858  O  "O5'" . DT  A  1  92  ? 34.904  29.856 -52.264 1.00 68.16  ? 92   DT  I "O5'" 1 
ATOM   1859  C  "C5'" . DT  A  1  92  ? 33.826  29.901 -53.191 1.00 72.41  ? 92   DT  I "C5'" 1 
ATOM   1860  C  "C4'" . DT  A  1  92  ? 32.532  29.554 -52.496 1.00 75.69  ? 92   DT  I "C4'" 1 
ATOM   1861  O  "O4'" . DT  A  1  92  ? 32.381  28.120 -52.366 1.00 74.41  ? 92   DT  I "O4'" 1 
ATOM   1862  C  "C3'" . DT  A  1  92  ? 32.413  30.130 -51.085 1.00 77.99  ? 92   DT  I "C3'" 1 
ATOM   1863  O  "O3'" . DT  A  1  92  ? 31.101  30.644 -50.898 1.00 83.37  ? 92   DT  I "O3'" 1 
ATOM   1864  C  "C2'" . DT  A  1  92  ? 32.632  28.923 -50.188 1.00 76.30  ? 92   DT  I "C2'" 1 
ATOM   1865  C  "C1'" . DT  A  1  92  ? 32.030  27.813 -51.028 1.00 74.76  ? 92   DT  I "C1'" 1 
ATOM   1866  N  N1    . DT  A  1  92  ? 32.508  26.451 -50.734 1.00 73.86  ? 92   DT  I N1    1 
ATOM   1867  C  C2    . DT  A  1  92  ? 31.633  25.417 -50.963 1.00 74.02  ? 92   DT  I C2    1 
ATOM   1868  O  O2    . DT  A  1  92  ? 30.502  25.588 -51.382 1.00 75.33  ? 92   DT  I O2    1 
ATOM   1869  N  N3    . DT  A  1  92  ? 32.130  24.168 -50.680 1.00 72.59  ? 92   DT  I N3    1 
ATOM   1870  C  C4    . DT  A  1  92  ? 33.386  23.860 -50.197 1.00 71.99  ? 92   DT  I C4    1 
ATOM   1871  O  O4    . DT  A  1  92  ? 33.689  22.688 -49.988 1.00 70.68  ? 92   DT  I O4    1 
ATOM   1872  C  C5    . DT  A  1  92  ? 34.256  24.998 -49.975 1.00 71.90  ? 92   DT  I C5    1 
ATOM   1873  C  C7    . DT  A  1  92  ? 35.636  24.765 -49.450 1.00 70.65  ? 92   DT  I C7    1 
ATOM   1874  C  C6    . DT  A  1  92  ? 33.780  26.220 -50.252 1.00 72.96  ? 92   DT  I C6    1 
ATOM   1875  P  P     . DT  A  1  93  ? 30.849  31.821 -49.841 1.00 87.62  ? 93   DT  I P     1 
ATOM   1876  O  OP1   . DT  A  1  93  ? 30.545  33.066 -50.589 1.00 86.47  ? 93   DT  I OP1   1 
ATOM   1877  O  OP2   . DT  A  1  93  ? 31.956  31.814 -48.853 1.00 87.45  ? 93   DT  I OP2   1 
ATOM   1878  O  "O5'" . DT  A  1  93  ? 29.526  31.330 -49.116 1.00 90.70  ? 93   DT  I "O5'" 1 
ATOM   1879  C  "C5'" . DT  A  1  93  ? 28.468  30.750 -49.874 1.00 95.40  ? 93   DT  I "C5'" 1 
ATOM   1880  C  "C4'" . DT  A  1  93  ? 27.736  29.723 -49.045 1.00 98.08  ? 93   DT  I "C4'" 1 
ATOM   1881  O  "O4'" . DT  A  1  93  ? 28.448  28.459 -49.013 1.00 97.47  ? 93   DT  I "O4'" 1 
ATOM   1882  C  "C3'" . DT  A  1  93  ? 27.546  30.140 -47.586 1.00 100.32 ? 93   DT  I "C3'" 1 
ATOM   1883  O  "O3'" . DT  A  1  93  ? 26.235  29.771 -47.157 1.00 105.05 ? 93   DT  I "O3'" 1 
ATOM   1884  C  "C2'" . DT  A  1  93  ? 28.591  29.314 -46.858 1.00 98.83  ? 93   DT  I "C2'" 1 
ATOM   1885  C  "C1'" . DT  A  1  93  ? 28.533  28.032 -47.664 1.00 97.35  ? 93   DT  I "C1'" 1 
ATOM   1886  N  N1    . DT  A  1  93  ? 29.680  27.113 -47.526 1.00 96.62  ? 93   DT  I N1    1 
ATOM   1887  C  C2    . DT  A  1  93  ? 29.443  25.770 -47.697 1.00 96.22  ? 93   DT  I C2    1 
ATOM   1888  O  O2    . DT  A  1  93  ? 28.343  25.319 -47.967 1.00 96.57  ? 93   DT  I O2    1 
ATOM   1889  N  N3    . DT  A  1  93  ? 30.549  24.969 -47.542 1.00 95.41  ? 93   DT  I N3    1 
ATOM   1890  C  C4    . DT  A  1  93  ? 31.838  25.371 -47.245 1.00 95.02  ? 93   DT  I C4    1 
ATOM   1891  O  O4    . DT  A  1  93  ? 32.733  24.536 -47.135 1.00 92.99  ? 93   DT  I O4    1 
ATOM   1892  C  C5    . DT  A  1  93  ? 32.013  26.796 -47.087 1.00 95.56  ? 93   DT  I C5    1 
ATOM   1893  C  C7    . DT  A  1  93  ? 33.373  27.333 -46.773 1.00 96.06  ? 93   DT  I C7    1 
ATOM   1894  C  C6    . DT  A  1  93  ? 30.939  27.581 -47.231 1.00 96.21  ? 93   DT  I C6    1 
ATOM   1895  P  P     . DG  A  1  94  ? 25.581  30.496 -45.883 1.00 108.80 ? 94   DG  I P     1 
ATOM   1896  O  OP1   . DG  A  1  94  ? 24.110  30.570 -46.106 1.00 108.26 ? 94   DG  I OP1   1 
ATOM   1897  O  OP2   . DG  A  1  94  ? 26.352  31.743 -45.628 1.00 108.26 ? 94   DG  I OP2   1 
ATOM   1898  O  "O5'" . DG  A  1  94  ? 25.864  29.480 -44.688 1.00 109.44 ? 94   DG  I "O5'" 1 
ATOM   1899  C  "C5'" . DG  A  1  94  ? 26.592  28.277 -44.917 1.00 111.25 ? 94   DG  I "C5'" 1 
ATOM   1900  C  "C4'" . DG  A  1  94  ? 25.984  27.144 -44.130 1.00 112.38 ? 94   DG  I "C4'" 1 
ATOM   1901  O  "O4'" . DG  A  1  94  ? 26.700  25.922 -44.433 1.00 112.33 ? 94   DG  I "O4'" 1 
ATOM   1902  C  "C3'" . DG  A  1  94  ? 26.091  27.342 -42.622 1.00 113.59 ? 94   DG  I "C3'" 1 
ATOM   1903  O  "O3'" . DG  A  1  94  ? 24.903  26.885 -41.980 1.00 115.82 ? 94   DG  I "O3'" 1 
ATOM   1904  C  "C2'" . DG  A  1  94  ? 27.298  26.508 -42.234 1.00 113.35 ? 94   DG  I "C2'" 1 
ATOM   1905  C  "C1'" . DG  A  1  94  ? 27.305  25.389 -43.265 1.00 112.48 ? 94   DG  I "C1'" 1 
ATOM   1906  N  N9    . DG  A  1  94  ? 28.653  24.950 -43.619 1.00 111.91 ? 94   DG  I N9    1 
ATOM   1907  C  C8    . DG  A  1  94  ? 29.721  25.752 -43.943 1.00 111.60 ? 94   DG  I C8    1 
ATOM   1908  N  N7    . DG  A  1  94  ? 30.814  25.081 -44.181 1.00 111.01 ? 94   DG  I N7    1 
ATOM   1909  C  C5    . DG  A  1  94  ? 30.446  23.754 -44.013 1.00 110.87 ? 94   DG  I C5    1 
ATOM   1910  C  C6    . DG  A  1  94  ? 31.214  22.567 -44.133 1.00 110.41 ? 94   DG  I C6    1 
ATOM   1911  O  O6    . DG  A  1  94  ? 32.411  22.449 -44.415 1.00 109.82 ? 94   DG  I O6    1 
ATOM   1912  N  N1    . DG  A  1  94  ? 30.448  21.435 -43.879 1.00 110.58 ? 94   DG  I N1    1 
ATOM   1913  C  C2    . DG  A  1  94  ? 29.115  21.441 -43.549 1.00 110.97 ? 94   DG  I C2    1 
ATOM   1914  N  N2    . DG  A  1  94  ? 28.553  20.239 -43.342 1.00 110.77 ? 94   DG  I N2    1 
ATOM   1915  N  N3    . DG  A  1  94  ? 28.387  22.542 -43.430 1.00 110.95 ? 94   DG  I N3    1 
ATOM   1916  C  C4    . DG  A  1  94  ? 29.112  23.654 -43.674 1.00 111.23 ? 94   DG  I C4    1 
ATOM   1917  P  P     . DA  A  1  95  ? 24.746  27.048 -40.390 1.00 117.28 ? 95   DA  I P     1 
ATOM   1918  O  OP1   . DA  A  1  95  ? 23.350  27.465 -40.096 1.00 117.11 ? 95   DA  I OP1   1 
ATOM   1919  O  OP2   . DA  A  1  95  ? 25.880  27.872 -39.896 1.00 117.24 ? 95   DA  I OP2   1 
ATOM   1920  O  "O5'" . DA  A  1  95  ? 24.944  25.560 -39.868 1.00 117.01 ? 95   DA  I "O5'" 1 
ATOM   1921  C  "C5'" . DA  A  1  95  ? 24.276  24.480 -40.510 1.00 116.99 ? 95   DA  I "C5'" 1 
ATOM   1922  C  "C4'" . DA  A  1  95  ? 24.805  23.166 -39.993 1.00 117.41 ? 95   DA  I "C4'" 1 
ATOM   1923  O  "O4'" . DA  A  1  95  ? 26.103  22.874 -40.570 1.00 117.84 ? 95   DA  I "O4'" 1 
ATOM   1924  C  "C3'" . DA  A  1  95  ? 25.000  23.150 -38.478 1.00 117.65 ? 95   DA  I "C3'" 1 
ATOM   1925  O  "O3'" . DA  A  1  95  ? 24.578  21.897 -37.949 1.00 117.56 ? 95   DA  I "O3'" 1 
ATOM   1926  C  "C2'" . DA  A  1  95  ? 26.501  23.309 -38.313 1.00 117.95 ? 95   DA  I "C2'" 1 
ATOM   1927  C  "C1'" . DA  A  1  95  ? 27.022  22.575 -39.532 1.00 117.77 ? 95   DA  I "C1'" 1 
ATOM   1928  N  N9    . DA  A  1  95  ? 28.360  22.978 -39.969 1.00 117.48 ? 95   DA  I N9    1 
ATOM   1929  C  C8    . DA  A  1  95  ? 28.843  24.247 -40.184 1.00 117.21 ? 95   DA  I C8    1 
ATOM   1930  N  N7    . DA  A  1  95  ? 30.098  24.277 -40.564 1.00 116.73 ? 95   DA  I N7    1 
ATOM   1931  C  C5    . DA  A  1  95  ? 30.466  22.940 -40.604 1.00 116.85 ? 95   DA  I C5    1 
ATOM   1932  C  C6    . DA  A  1  95  ? 31.674  22.300 -40.936 1.00 116.65 ? 95   DA  I C6    1 
ATOM   1933  N  N6    . DA  A  1  95  ? 32.780  22.949 -41.305 1.00 116.58 ? 95   DA  I N6    1 
ATOM   1934  N  N1    . DA  A  1  95  ? 31.706  20.951 -40.876 1.00 116.46 ? 95   DA  I N1    1 
ATOM   1935  C  C2    . DA  A  1  95  ? 30.597  20.299 -40.509 1.00 116.62 ? 95   DA  I C2    1 
ATOM   1936  N  N3    . DA  A  1  95  ? 29.404  20.786 -40.175 1.00 116.88 ? 95   DA  I N3    1 
ATOM   1937  C  C4    . DA  A  1  95  ? 29.405  22.129 -40.243 1.00 116.95 ? 95   DA  I C4    1 
ATOM   1938  P  P     . DT  A  1  96  ? 24.479  21.703 -36.362 1.00 117.07 ? 96   DT  I P     1 
ATOM   1939  O  OP1   . DT  A  1  96  ? 23.147  21.124 -36.052 1.00 117.02 ? 96   DT  I OP1   1 
ATOM   1940  O  OP2   . DT  A  1  96  ? 24.897  22.976 -35.719 1.00 117.00 ? 96   DT  I OP2   1 
ATOM   1941  O  "O5'" . DT  A  1  96  ? 25.594  20.610 -36.065 1.00 116.21 ? 96   DT  I "O5'" 1 
ATOM   1942  C  "C5'" . DT  A  1  96  ? 25.517  19.318 -36.656 1.00 115.29 ? 96   DT  I "C5'" 1 
ATOM   1943  C  "C4'" . DT  A  1  96  ? 26.623  18.444 -36.118 1.00 114.91 ? 96   DT  I "C4'" 1 
ATOM   1944  O  "O4'" . DT  A  1  96  ? 27.886  18.797 -36.735 1.00 114.79 ? 96   DT  I "O4'" 1 
ATOM   1945  C  "C3'" . DT  A  1  96  ? 26.828  18.601 -34.611 1.00 114.76 ? 96   DT  I "C3'" 1 
ATOM   1946  O  "O3'" . DT  A  1  96  ? 27.150  17.340 -34.032 1.00 113.98 ? 96   DT  I "O3'" 1 
ATOM   1947  C  "C2'" . DT  A  1  96  ? 28.028  19.525 -34.519 1.00 114.82 ? 96   DT  I "C2'" 1 
ATOM   1948  C  "C1'" . DT  A  1  96  ? 28.838  19.083 -35.723 1.00 114.49 ? 96   DT  I "C1'" 1 
ATOM   1949  N  N1    . DT  A  1  96  ? 29.786  20.085 -36.247 1.00 113.68 ? 96   DT  I N1    1 
ATOM   1950  C  C2    . DT  A  1  96  ? 30.927  19.619 -36.854 1.00 113.11 ? 96   DT  I C2    1 
ATOM   1951  O  O2    . DT  A  1  96  ? 31.168  18.431 -36.991 1.00 112.55 ? 96   DT  I O2    1 
ATOM   1952  N  N3    . DT  A  1  96  ? 31.780  20.598 -37.298 1.00 112.96 ? 96   DT  I N3    1 
ATOM   1953  C  C4    . DT  A  1  96  ? 31.606  21.964 -37.199 1.00 113.02 ? 96   DT  I C4    1 
ATOM   1954  O  O4    . DT  A  1  96  ? 32.465  22.722 -37.638 1.00 112.69 ? 96   DT  I O4    1 
ATOM   1955  C  C5    . DT  A  1  96  ? 30.379  22.385 -36.559 1.00 113.10 ? 96   DT  I C5    1 
ATOM   1956  C  C7    . DT  A  1  96  ? 30.099  23.847 -36.412 1.00 112.54 ? 96   DT  I C7    1 
ATOM   1957  C  C6    . DT  A  1  96  ? 29.541  21.436 -36.123 1.00 113.46 ? 96   DT  I C6    1 
ATOM   1958  P  P     . DG  A  1  97  ? 26.911  17.099 -32.464 1.00 113.30 ? 97   DG  I P     1 
ATOM   1959  O  OP1   . DG  A  1  97  ? 25.502  16.672 -32.264 1.00 113.67 ? 97   DG  I OP1   1 
ATOM   1960  O  OP2   . DG  A  1  97  ? 27.434  18.282 -31.733 1.00 112.51 ? 97   DG  I OP2   1 
ATOM   1961  O  "O5'" . DG  A  1  97  ? 27.857  15.860 -32.154 1.00 111.66 ? 97   DG  I "O5'" 1 
ATOM   1962  C  "C5'" . DG  A  1  97  ? 28.066  14.854 -33.140 1.00 108.63 ? 97   DG  I "C5'" 1 
ATOM   1963  C  "C4'" . DG  A  1  97  ? 29.529  14.486 -33.201 1.00 106.70 ? 97   DG  I "C4'" 1 
ATOM   1964  O  "O4'" . DG  A  1  97  ? 30.297  15.557 -33.804 1.00 105.62 ? 97   DG  I "O4'" 1 
ATOM   1965  C  "C3'" . DG  A  1  97  ? 30.153  14.233 -31.831 1.00 105.56 ? 97   DG  I "C3'" 1 
ATOM   1966  O  "O3'" . DG  A  1  97  ? 31.031  13.111 -31.905 1.00 105.35 ? 97   DG  I "O3'" 1 
ATOM   1967  C  "C2'" . DG  A  1  97  ? 30.921  15.512 -31.547 1.00 104.84 ? 97   DG  I "C2'" 1 
ATOM   1968  C  "C1'" . DG  A  1  97  ? 31.357  15.939 -32.937 1.00 104.32 ? 97   DG  I "C1'" 1 
ATOM   1969  N  N9    . DG  A  1  97  ? 31.580  17.374 -33.100 1.00 102.92 ? 97   DG  I N9    1 
ATOM   1970  C  C8    . DG  A  1  97  ? 30.732  18.395 -32.742 1.00 102.25 ? 97   DG  I C8    1 
ATOM   1971  N  N7    . DG  A  1  97  ? 31.202  19.579 -33.031 1.00 101.07 ? 97   DG  I N7    1 
ATOM   1972  C  C5    . DG  A  1  97  ? 32.439  19.326 -33.612 1.00 101.20 ? 97   DG  I C5    1 
ATOM   1973  C  C6    . DG  A  1  97  ? 33.416  20.222 -34.132 1.00 100.25 ? 97   DG  I C6    1 
ATOM   1974  O  O6    . DG  A  1  97  ? 33.379  21.457 -34.190 1.00 99.15  ? 97   DG  I O6    1 
ATOM   1975  N  N1    . DG  A  1  97  ? 34.524  19.541 -34.621 1.00 99.88  ? 97   DG  I N1    1 
ATOM   1976  C  C2    . DG  A  1  97  ? 34.679  18.177 -34.616 1.00 100.54 ? 97   DG  I C2    1 
ATOM   1977  N  N2    . DG  A  1  97  ? 35.826  17.712 -35.135 1.00 99.72  ? 97   DG  I N2    1 
ATOM   1978  N  N3    . DG  A  1  97  ? 33.778  17.331 -34.139 1.00 100.94 ? 97   DG  I N3    1 
ATOM   1979  C  C4    . DG  A  1  97  ? 32.690  17.970 -33.656 1.00 101.84 ? 97   DG  I C4    1 
ATOM   1980  P  P     . DG  A  1  98  ? 31.659  12.508 -30.560 1.00 105.01 ? 98   DG  I P     1 
ATOM   1981  O  OP1   . DG  A  1  98  ? 32.021  11.089 -30.811 1.00 104.24 ? 98   DG  I OP1   1 
ATOM   1982  O  OP2   . DG  A  1  98  ? 30.746  12.849 -29.437 1.00 104.66 ? 98   DG  I OP2   1 
ATOM   1983  O  "O5'" . DG  A  1  98  ? 32.995  13.351 -30.376 1.00 104.31 ? 98   DG  I "O5'" 1 
ATOM   1984  C  "C5'" . DG  A  1  98  ? 34.060  13.232 -31.314 1.00 102.05 ? 98   DG  I "C5'" 1 
ATOM   1985  C  "C4'" . DG  A  1  98  ? 35.222  14.096 -30.888 1.00 100.57 ? 98   DG  I "C4'" 1 
ATOM   1986  O  "O4'" . DG  A  1  98  ? 34.967  15.486 -31.199 1.00 100.29 ? 98   DG  I "O4'" 1 
ATOM   1987  C  "C3'" . DG  A  1  98  ? 35.520  14.043 -29.389 1.00 99.79  ? 98   DG  I "C3'" 1 
ATOM   1988  O  "O3'" . DG  A  1  98  ? 36.929  14.058 -29.196 1.00 99.01  ? 98   DG  I "O3'" 1 
ATOM   1989  C  "C2'" . DG  A  1  98  ? 34.935  15.347 -28.876 1.00 99.85  ? 98   DG  I "C2'" 1 
ATOM   1990  C  "C1'" . DG  A  1  98  ? 35.228  16.263 -30.046 1.00 100.30 ? 98   DG  I "C1'" 1 
ATOM   1991  N  N9    . DG  A  1  98  ? 34.425  17.478 -30.124 1.00 100.95 ? 98   DG  I N9    1 
ATOM   1992  C  C8    . DG  A  1  98  ? 33.132  17.660 -29.700 1.00 101.38 ? 98   DG  I C8    1 
ATOM   1993  N  N7    . DG  A  1  98  ? 32.695  18.875 -29.898 1.00 101.90 ? 98   DG  I N7    1 
ATOM   1994  C  C5    . DG  A  1  98  ? 33.765  19.532 -30.491 1.00 101.50 ? 98   DG  I C5    1 
ATOM   1995  C  C6    . DG  A  1  98  ? 33.891  20.875 -30.935 1.00 101.61 ? 98   DG  I C6    1 
ATOM   1996  O  O6    . DG  A  1  98  ? 33.056  21.785 -30.888 1.00 101.87 ? 98   DG  I O6    1 
ATOM   1997  N  N1    . DG  A  1  98  ? 35.147  21.115 -31.482 1.00 101.37 ? 98   DG  I N1    1 
ATOM   1998  C  C2    . DG  A  1  98  ? 36.152  20.187 -31.588 1.00 101.02 ? 98   DG  I C2    1 
ATOM   1999  N  N2    . DG  A  1  98  ? 37.289  20.609 -32.152 1.00 101.29 ? 98   DG  I N2    1 
ATOM   2000  N  N3    . DG  A  1  98  ? 36.050  18.938 -31.174 1.00 100.89 ? 98   DG  I N3    1 
ATOM   2001  C  C4    . DG  A  1  98  ? 34.838  18.681 -30.641 1.00 101.32 ? 98   DG  I C4    1 
ATOM   2002  P  P     . DA  A  1  99  ? 37.724  12.673 -29.059 1.00 99.02  ? 99   DA  I P     1 
ATOM   2003  O  OP1   . DA  A  1  99  ? 37.053  11.669 -29.925 1.00 98.69  ? 99   DA  I OP1   1 
ATOM   2004  O  OP2   . DA  A  1  99  ? 37.904  12.393 -27.610 1.00 98.60  ? 99   DA  I OP2   1 
ATOM   2005  O  "O5'" . DA  A  1  99  ? 39.149  13.003 -29.688 1.00 97.44  ? 99   DA  I "O5'" 1 
ATOM   2006  C  "C5'" . DA  A  1  99  ? 39.328  13.069 -31.102 1.00 94.12  ? 99   DA  I "C5'" 1 
ATOM   2007  C  "C4'" . DA  A  1  99  ? 40.297  14.173 -31.454 1.00 91.44  ? 99   DA  I "C4'" 1 
ATOM   2008  O  "O4'" . DA  A  1  99  ? 39.670  15.463 -31.258 1.00 90.84  ? 99   DA  I "O4'" 1 
ATOM   2009  C  "C3'" . DA  A  1  99  ? 41.567  14.182 -30.606 1.00 89.67  ? 99   DA  I "C3'" 1 
ATOM   2010  O  "O3'" . DA  A  1  99  ? 42.695  14.514 -31.418 1.00 87.46  ? 99   DA  I "O3'" 1 
ATOM   2011  C  "C2'" . DA  A  1  99  ? 41.295  15.261 -29.572 1.00 89.93  ? 99   DA  I "C2'" 1 
ATOM   2012  C  "C1'" . DA  A  1  99  ? 40.414  16.240 -30.331 1.00 90.36  ? 99   DA  I "C1'" 1 
ATOM   2013  N  N9    . DA  A  1  99  ? 39.460  16.968 -29.492 1.00 90.39  ? 99   DA  I N9    1 
ATOM   2014  C  C8    . DA  A  1  99  ? 38.599  16.450 -28.555 1.00 90.29  ? 99   DA  I C8    1 
ATOM   2015  N  N7    . DA  A  1  99  ? 37.847  17.352 -27.970 1.00 89.89  ? 99   DA  I N7    1 
ATOM   2016  C  C5    . DA  A  1  99  ? 38.239  18.546 -28.559 1.00 90.30  ? 99   DA  I C5    1 
ATOM   2017  C  C6    . DA  A  1  99  ? 37.816  19.879 -28.378 1.00 90.58  ? 99   DA  I C6    1 
ATOM   2018  N  N6    . DA  A  1  99  ? 36.859  20.244 -27.522 1.00 90.44  ? 99   DA  I N6    1 
ATOM   2019  N  N1    . DA  A  1  99  ? 38.418  20.835 -29.119 1.00 90.15  ? 99   DA  I N1    1 
ATOM   2020  C  C2    . DA  A  1  99  ? 39.375  20.469 -29.981 1.00 89.74  ? 99   DA  I C2    1 
ATOM   2021  N  N3    . DA  A  1  99  ? 39.855  19.254 -30.244 1.00 89.52  ? 99   DA  I N3    1 
ATOM   2022  C  C4    . DA  A  1  99  ? 39.238  18.326 -29.493 1.00 90.08  ? 99   DA  I C4    1 
ATOM   2023  P  P     . DG  A  1  100 ? 44.180  14.316 -30.840 1.00 85.20  ? 100  DG  I P     1 
ATOM   2024  O  OP1   . DG  A  1  100 ? 45.107  14.127 -31.985 1.00 85.94  ? 100  DG  I OP1   1 
ATOM   2025  O  OP2   . DG  A  1  100 ? 44.121  13.290 -29.765 1.00 85.53  ? 100  DG  I OP2   1 
ATOM   2026  O  "O5'" . DG  A  1  100 ? 44.496  15.723 -30.170 1.00 83.16  ? 100  DG  I "O5'" 1 
ATOM   2027  C  "C5'" . DG  A  1  100 ? 44.430  16.912 -30.947 1.00 78.59  ? 100  DG  I "C5'" 1 
ATOM   2028  C  "C4'" . DG  A  1  100 ? 44.477  18.129 -30.056 1.00 76.00  ? 100  DG  I "C4'" 1 
ATOM   2029  O  "O4'" . DG  A  1  100 ? 43.233  18.306 -29.334 1.00 74.39  ? 100  DG  I "O4'" 1 
ATOM   2030  C  "C3'" . DG  A  1  100 ? 45.582  18.124 -28.997 1.00 74.19  ? 100  DG  I "C3'" 1 
ATOM   2031  O  "O3'" . DG  A  1  100 ? 46.092  19.445 -28.879 1.00 71.34  ? 100  DG  I "O3'" 1 
ATOM   2032  C  "C2'" . DG  A  1  100 ? 44.823  17.823 -27.720 1.00 74.15  ? 100  DG  I "C2'" 1 
ATOM   2033  C  "C1'" . DG  A  1  100 ? 43.558  18.604 -27.992 1.00 75.08  ? 100  DG  I "C1'" 1 
ATOM   2034  N  N9    . DG  A  1  100 ? 42.415  18.289 -27.144 1.00 77.38  ? 100  DG  I N9    1 
ATOM   2035  C  C8    . DG  A  1  100 ? 42.109  17.083 -26.559 1.00 77.37  ? 100  DG  I C8    1 
ATOM   2036  N  N7    . DG  A  1  100 ? 41.043  17.138 -25.807 1.00 78.25  ? 100  DG  I N7    1 
ATOM   2037  C  C5    . DG  A  1  100 ? 40.615  18.455 -25.910 1.00 78.08  ? 100  DG  I C5    1 
ATOM   2038  C  C6    . DG  A  1  100 ? 39.509  19.116 -25.308 1.00 78.63  ? 100  DG  I C6    1 
ATOM   2039  O  O6    . DG  A  1  100 ? 38.668  18.658 -24.523 1.00 79.97  ? 100  DG  I O6    1 
ATOM   2040  N  N1    . DG  A  1  100 ? 39.437  20.450 -25.699 1.00 78.12  ? 100  DG  I N1    1 
ATOM   2041  C  C2    . DG  A  1  100 ? 40.316  21.071 -26.552 1.00 77.51  ? 100  DG  I C2    1 
ATOM   2042  N  N2    . DG  A  1  100 ? 40.074  22.362 -26.814 1.00 76.49  ? 100  DG  I N2    1 
ATOM   2043  N  N3    . DG  A  1  100 ? 41.356  20.470 -27.108 1.00 77.23  ? 100  DG  I N3    1 
ATOM   2044  C  C4    . DG  A  1  100 ? 41.442  19.173 -26.746 1.00 77.47  ? 100  DG  I C4    1 
ATOM   2045  P  P     . DC  A  1  101 ? 47.641  19.733 -29.148 1.00 67.36  ? 101  DC  I P     1 
ATOM   2046  O  OP1   . DC  A  1  101 ? 47.957  19.280 -30.520 1.00 69.68  ? 101  DC  I OP1   1 
ATOM   2047  O  OP2   . DC  A  1  101 ? 48.439  19.225 -28.008 1.00 68.28  ? 101  DC  I OP2   1 
ATOM   2048  O  "O5'" . DC  A  1  101 ? 47.692  21.321 -29.111 1.00 72.49  ? 101  DC  I "O5'" 1 
ATOM   2049  C  "C5'" . DC  A  1  101 ? 46.898  22.089 -30.010 1.00 76.36  ? 101  DC  I "C5'" 1 
ATOM   2050  C  "C4'" . DC  A  1  101 ? 46.217  23.220 -29.276 1.00 79.80  ? 101  DC  I "C4'" 1 
ATOM   2051  O  "O4'" . DC  A  1  101 ? 45.173  22.706 -28.412 1.00 80.68  ? 101  DC  I "O4'" 1 
ATOM   2052  C  "C3'" . DC  A  1  101 ? 47.133  24.056 -28.382 1.00 81.66  ? 101  DC  I "C3'" 1 
ATOM   2053  O  "O3'" . DC  A  1  101 ? 46.798  25.438 -28.512 1.00 85.04  ? 101  DC  I "O3'" 1 
ATOM   2054  C  "C2'" . DC  A  1  101 ? 46.812  23.561 -26.982 1.00 81.39  ? 101  DC  I "C2'" 1 
ATOM   2055  C  "C1'" . DC  A  1  101 ? 45.339  23.222 -27.100 1.00 80.58  ? 101  DC  I "C1'" 1 
ATOM   2056  N  N1    . DC  A  1  101 ? 44.851  22.208 -26.152 1.00 80.58  ? 101  DC  I N1    1 
ATOM   2057  C  C2    . DC  A  1  101 ? 43.704  22.490 -25.399 1.00 80.30  ? 101  DC  I C2    1 
ATOM   2058  O  O2    . DC  A  1  101 ? 43.148  23.590 -25.538 1.00 79.46  ? 101  DC  I O2    1 
ATOM   2059  N  N3    . DC  A  1  101 ? 43.233  21.559 -24.539 1.00 80.22  ? 101  DC  I N3    1 
ATOM   2060  C  C4    . DC  A  1  101 ? 43.860  20.387 -24.415 1.00 80.20  ? 101  DC  I C4    1 
ATOM   2061  N  N4    . DC  A  1  101 ? 43.351  19.497 -23.564 1.00 80.94  ? 101  DC  I N4    1 
ATOM   2062  C  C5    . DC  A  1  101 ? 45.036  20.078 -25.161 1.00 79.89  ? 101  DC  I C5    1 
ATOM   2063  C  C6    . DC  A  1  101 ? 45.493  21.009 -26.009 1.00 80.70  ? 101  DC  I C6    1 
ATOM   2064  P  P     . DA  A  1  102 ? 47.689  26.542 -27.765 1.00 87.97  ? 102  DA  I P     1 
ATOM   2065  O  OP1   . DA  A  1  102 ? 47.648  27.790 -28.572 1.00 86.59  ? 102  DA  I OP1   1 
ATOM   2066  O  OP2   . DA  A  1  102 ? 48.996  25.914 -27.439 1.00 87.24  ? 102  DA  I OP2   1 
ATOM   2067  O  "O5'" . DA  A  1  102 ? 46.906  26.789 -26.401 1.00 89.28  ? 102  DA  I "O5'" 1 
ATOM   2068  C  "C5'" . DA  A  1  102 ? 45.576  27.303 -26.413 1.00 90.59  ? 102  DA  I "C5'" 1 
ATOM   2069  C  "C4'" . DA  A  1  102 ? 45.048  27.431 -25.003 1.00 91.10  ? 102  DA  I "C4'" 1 
ATOM   2070  O  "O4'" . DA  A  1  102 ? 44.768  26.125 -24.443 1.00 90.35  ? 102  DA  I "O4'" 1 
ATOM   2071  C  "C3'" . DA  A  1  102 ? 45.997  28.116 -24.019 1.00 92.10  ? 102  DA  I "C3'" 1 
ATOM   2072  O  "O3'" . DA  A  1  102 ? 45.232  28.928 -23.131 1.00 94.85  ? 102  DA  I "O3'" 1 
ATOM   2073  C  "C2'" . DA  A  1  102 ? 46.578  26.953 -23.237 1.00 91.17  ? 102  DA  I "C2'" 1 
ATOM   2074  C  "C1'" . DA  A  1  102 ? 45.372  26.043 -23.165 1.00 89.83  ? 102  DA  I "C1'" 1 
ATOM   2075  N  N9    . DA  A  1  102 ? 45.641  24.636 -22.876 1.00 88.94  ? 102  DA  I N9    1 
ATOM   2076  C  C8    . DA  A  1  102 ? 46.729  23.871 -23.214 1.00 88.77  ? 102  DA  I C8    1 
ATOM   2077  N  N7    . DA  A  1  102 ? 46.651  22.630 -22.797 1.00 87.75  ? 102  DA  I N7    1 
ATOM   2078  C  C5    . DA  A  1  102 ? 45.429  22.576 -22.139 1.00 87.97  ? 102  DA  I C5    1 
ATOM   2079  C  C6    . DA  A  1  102 ? 44.754  21.537 -21.473 1.00 87.48  ? 102  DA  I C6    1 
ATOM   2080  N  N6    . DA  A  1  102 ? 45.232  20.297 -21.354 1.00 87.64  ? 102  DA  I N6    1 
ATOM   2081  N  N1    . DA  A  1  102 ? 43.553  21.820 -20.925 1.00 86.60  ? 102  DA  I N1    1 
ATOM   2082  C  C2    . DA  A  1  102 ? 43.071  23.062 -21.042 1.00 86.31  ? 102  DA  I C2    1 
ATOM   2083  N  N3    . DA  A  1  102 ? 43.608  24.119 -21.643 1.00 86.98  ? 102  DA  I N3    1 
ATOM   2084  C  C4    . DA  A  1  102 ? 44.800  23.806 -22.178 1.00 88.16  ? 102  DA  I C4    1 
ATOM   2085  P  P     . DG  A  1  103 ? 45.858  30.286 -22.554 1.00 96.33  ? 103  DG  I P     1 
ATOM   2086  O  OP1   . DG  A  1  103 ? 45.598  31.337 -23.570 1.00 96.01  ? 103  DG  I OP1   1 
ATOM   2087  O  OP2   . DG  A  1  103 ? 47.247  30.024 -22.096 1.00 95.74  ? 103  DG  I OP2   1 
ATOM   2088  O  "O5'" . DG  A  1  103 ? 44.966  30.588 -21.271 1.00 98.57  ? 103  DG  I "O5'" 1 
ATOM   2089  C  "C5'" . DG  A  1  103 ? 43.550  30.719 -21.376 1.00 101.26 ? 103  DG  I "C5'" 1 
ATOM   2090  C  "C4'" . DG  A  1  103 ? 42.894  30.312 -20.078 1.00 103.12 ? 103  DG  I "C4'" 1 
ATOM   2091  O  "O4'" . DG  A  1  103 ? 42.965  28.873 -19.922 1.00 102.77 ? 103  DG  I "O4'" 1 
ATOM   2092  C  "C3'" . DG  A  1  103 ? 43.560  30.905 -18.838 1.00 104.73 ? 103  DG  I "C3'" 1 
ATOM   2093  O  "O3'" . DG  A  1  103 ? 42.576  31.279 -17.873 1.00 108.26 ? 103  DG  I "O3'" 1 
ATOM   2094  C  "C2'" . DG  A  1  103 ? 44.421  29.768 -18.319 1.00 103.99 ? 103  DG  I "C2'" 1 
ATOM   2095  C  "C1'" . DG  A  1  103 ? 43.619  28.542 -18.707 1.00 103.28 ? 103  DG  I "C1'" 1 
ATOM   2096  N  N9    . DG  A  1  103 ? 44.435  27.357 -18.950 1.00 103.47 ? 103  DG  I N9    1 
ATOM   2097  C  C8    . DG  A  1  103 ? 45.477  27.242 -19.837 1.00 104.11 ? 103  DG  I C8    1 
ATOM   2098  N  N7    . DG  A  1  103 ? 46.022  26.056 -19.836 1.00 104.53 ? 103  DG  I N7    1 
ATOM   2099  C  C5    . DG  A  1  103 ? 45.296  25.344 -18.892 1.00 104.50 ? 103  DG  I C5    1 
ATOM   2100  C  C6    . DG  A  1  103 ? 45.425  23.997 -18.455 1.00 104.54 ? 103  DG  I C6    1 
ATOM   2101  O  O6    . DG  A  1  103 ? 46.231  23.139 -18.829 1.00 104.86 ? 103  DG  I O6    1 
ATOM   2102  N  N1    . DG  A  1  103 ? 44.484  23.684 -17.480 1.00 104.67 ? 103  DG  I N1    1 
ATOM   2103  C  C2    . DG  A  1  103 ? 43.541  24.551 -16.986 1.00 104.69 ? 103  DG  I C2    1 
ATOM   2104  N  N2    . DG  A  1  103 ? 42.725  24.057 -16.043 1.00 104.65 ? 103  DG  I N2    1 
ATOM   2105  N  N3    . DG  A  1  103 ? 43.408  25.807 -17.386 1.00 104.35 ? 103  DG  I N3    1 
ATOM   2106  C  C4    . DG  A  1  103 ? 44.313  26.134 -18.333 1.00 104.14 ? 103  DG  I C4    1 
ATOM   2107  P  P     . DT  A  1  104 ? 43.041  31.843 -16.444 1.00 110.80 ? 104  DT  I P     1 
ATOM   2108  O  OP1   . DT  A  1  104 ? 41.962  32.717 -15.915 1.00 110.90 ? 104  DT  I OP1   1 
ATOM   2109  O  OP2   . DT  A  1  104 ? 44.418  32.383 -16.597 1.00 110.90 ? 104  DT  I OP2   1 
ATOM   2110  O  "O5'" . DT  A  1  104 ? 43.111  30.536 -15.538 1.00 111.58 ? 104  DT  I "O5'" 1 
ATOM   2111  C  "C5'" . DT  A  1  104 ? 41.917  29.848 -15.175 1.00 113.64 ? 104  DT  I "C5'" 1 
ATOM   2112  C  "C4'" . DT  A  1  104 ? 42.138  29.050 -13.914 1.00 114.98 ? 104  DT  I "C4'" 1 
ATOM   2113  O  "O4'" . DT  A  1  104 ? 42.820  27.809 -14.212 1.00 114.68 ? 104  DT  I "O4'" 1 
ATOM   2114  C  "C3'" . DT  A  1  104 ? 42.983  29.763 -12.859 1.00 116.03 ? 104  DT  I "C3'" 1 
ATOM   2115  O  "O3'" . DT  A  1  104 ? 42.434  29.522 -11.564 1.00 118.29 ? 104  DT  I "O3'" 1 
ATOM   2116  C  "C2'" . DT  A  1  104 ? 44.345  29.104 -12.999 1.00 115.37 ? 104  DT  I "C2'" 1 
ATOM   2117  C  "C1'" . DT  A  1  104 ? 43.976  27.687 -13.400 1.00 114.51 ? 104  DT  I "C1'" 1 
ATOM   2118  N  N1    . DT  A  1  104 ? 45.002  26.972 -14.183 1.00 113.96 ? 104  DT  I N1    1 
ATOM   2119  C  C2    . DT  A  1  104 ? 45.230  25.644 -13.895 1.00 113.71 ? 104  DT  I C2    1 
ATOM   2120  O  O2    . DT  A  1  104 ? 44.635  25.040 -13.020 1.00 113.69 ? 104  DT  I O2    1 
ATOM   2121  N  N3    . DT  A  1  104 ? 46.186  25.045 -14.675 1.00 113.82 ? 104  DT  I N3    1 
ATOM   2122  C  C4    . DT  A  1  104 ? 46.922  25.625 -15.688 1.00 113.61 ? 104  DT  I C4    1 
ATOM   2123  O  O4    . DT  A  1  104 ? 47.744  24.954 -16.306 1.00 113.49 ? 104  DT  I O4    1 
ATOM   2124  C  C5    . DT  A  1  104 ? 46.638  27.024 -15.932 1.00 113.67 ? 104  DT  I C5    1 
ATOM   2125  C  C7    . DT  A  1  104 ? 47.392  27.742 -17.006 1.00 113.37 ? 104  DT  I C7    1 
ATOM   2126  C  C6    . DT  A  1  104 ? 45.704  27.618 -15.177 1.00 113.84 ? 104  DT  I C6    1 
ATOM   2127  P  P     . DT  A  1  105 ? 43.025  30.296 -10.289 1.00 120.04 ? 105  DT  I P     1 
ATOM   2128  O  OP1   . DT  A  1  105 ? 41.888  30.989 -9.630  1.00 119.92 ? 105  DT  I OP1   1 
ATOM   2129  O  OP2   . DT  A  1  105 ? 44.219  31.076 -10.709 1.00 120.12 ? 105  DT  I OP2   1 
ATOM   2130  O  "O5'" . DT  A  1  105 ? 43.501  29.104 -9.349  1.00 120.31 ? 105  DT  I "O5'" 1 
ATOM   2131  C  "C5'" . DT  A  1  105 ? 42.688  27.947 -9.199  1.00 121.70 ? 105  DT  I "C5'" 1 
ATOM   2132  C  "C4'" . DT  A  1  105 ? 43.520  26.775 -8.737  1.00 123.08 ? 105  DT  I "C4'" 1 
ATOM   2133  O  "O4'" . DT  A  1  105 ? 44.377  26.300 -9.805  1.00 123.08 ? 105  DT  I "O4'" 1 
ATOM   2134  C  "C3'" . DT  A  1  105 ? 44.440  27.072 -7.552  1.00 124.03 ? 105  DT  I "C3'" 1 
ATOM   2135  O  "O3'" . DT  A  1  105 ? 44.414  25.969 -6.647  1.00 125.57 ? 105  DT  I "O3'" 1 
ATOM   2136  C  "C2'" . DT  A  1  105 ? 45.812  27.173 -8.193  1.00 123.82 ? 105  DT  I "C2'" 1 
ATOM   2137  C  "C1'" . DT  A  1  105 ? 45.695  26.148 -9.303  1.00 123.58 ? 105  DT  I "C1'" 1 
ATOM   2138  N  N1    . DT  A  1  105 ? 46.647  26.313 -10.420 1.00 123.50 ? 105  DT  I N1    1 
ATOM   2139  C  C2    . DT  A  1  105 ? 47.312  25.191 -10.868 1.00 123.37 ? 105  DT  I C2    1 
ATOM   2140  O  O2    . DT  A  1  105 ? 47.136  24.080 -10.398 1.00 123.33 ? 105  DT  I O2    1 
ATOM   2141  N  N3    . DT  A  1  105 ? 48.195  25.420 -11.894 1.00 123.17 ? 105  DT  I N3    1 
ATOM   2142  C  C4    . DT  A  1  105 ? 48.472  26.629 -12.503 1.00 123.28 ? 105  DT  I C4    1 
ATOM   2143  O  O4    . DT  A  1  105 ? 49.296  26.681 -13.410 1.00 123.35 ? 105  DT  I O4    1 
ATOM   2144  C  C5    . DT  A  1  105 ? 47.733  27.761 -11.990 1.00 123.34 ? 105  DT  I C5    1 
ATOM   2145  C  C7    . DT  A  1  105 ? 47.963  29.111 -12.594 1.00 123.36 ? 105  DT  I C7    1 
ATOM   2146  C  C6    . DT  A  1  105 ? 46.869  27.549 -10.989 1.00 123.58 ? 105  DT  I C6    1 
ATOM   2147  P  P     . DT  A  1  106 ? 44.993  26.142 -5.161  1.00 126.28 ? 106  DT  I P     1 
ATOM   2148  O  OP1   . DT  A  1  106 ? 43.837  26.153 -4.229  1.00 126.19 ? 106  DT  I OP1   1 
ATOM   2149  O  OP2   . DT  A  1  106 ? 45.954  27.275 -5.153  1.00 126.13 ? 106  DT  I OP2   1 
ATOM   2150  O  "O5'" . DT  A  1  106 ? 45.796  24.789 -4.930  1.00 126.52 ? 106  DT  I "O5'" 1 
ATOM   2151  C  "C5'" . DT  A  1  106 ? 45.160  23.529 -5.122  1.00 127.23 ? 106  DT  I "C5'" 1 
ATOM   2152  C  "C4'" . DT  A  1  106 ? 46.188  22.424 -5.126  1.00 127.81 ? 106  DT  I "C4'" 1 
ATOM   2153  O  "O4'" . DT  A  1  106 ? 46.923  22.425 -6.375  1.00 128.27 ? 106  DT  I "O4'" 1 
ATOM   2154  C  "C3'" . DT  A  1  106 ? 47.232  22.554 -4.017  1.00 127.72 ? 106  DT  I "C3'" 1 
ATOM   2155  O  "O3'" . DT  A  1  106 ? 47.520  21.273 -3.453  1.00 127.21 ? 106  DT  I "O3'" 1 
ATOM   2156  C  "C2'" . DT  A  1  106 ? 48.448  23.105 -4.739  1.00 128.08 ? 106  DT  I "C2'" 1 
ATOM   2157  C  "C1'" . DT  A  1  106 ? 48.316  22.459 -6.106  1.00 128.36 ? 106  DT  I "C1'" 1 
ATOM   2158  N  N1    . DT  A  1  106 ? 48.984  23.183 -7.207  1.00 128.44 ? 106  DT  I N1    1 
ATOM   2159  C  C2    . DT  A  1  106 ? 49.576  22.436 -8.203  1.00 128.55 ? 106  DT  I C2    1 
ATOM   2160  O  O2    . DT  A  1  106 ? 49.564  21.216 -8.220  1.00 128.45 ? 106  DT  I O2    1 
ATOM   2161  N  N3    . DT  A  1  106 ? 50.187  23.176 -9.185  1.00 128.58 ? 106  DT  I N3    1 
ATOM   2162  C  C4    . DT  A  1  106 ? 50.264  24.553 -9.269  1.00 128.52 ? 106  DT  I C4    1 
ATOM   2163  O  O4    . DT  A  1  106 ? 50.849  25.076 -10.213 1.00 128.79 ? 106  DT  I O4    1 
ATOM   2164  C  C5    . DT  A  1  106 ? 49.620  25.273 -8.193  1.00 128.35 ? 106  DT  I C5    1 
ATOM   2165  C  C7    . DT  A  1  106 ? 49.653  26.768 -8.199  1.00 128.00 ? 106  DT  I C7    1 
ATOM   2166  C  C6    . DT  A  1  106 ? 49.019  24.561 -7.230  1.00 128.29 ? 106  DT  I C6    1 
ATOM   2167  P  P     . DC  A  1  107 ? 48.673  21.139 -2.347  1.00 126.74 ? 107  DC  I P     1 
ATOM   2168  O  OP1   . DC  A  1  107 ? 48.471  19.851 -1.634  1.00 126.56 ? 107  DC  I OP1   1 
ATOM   2169  O  OP2   . DC  A  1  107 ? 48.726  22.408 -1.575  1.00 126.42 ? 107  DC  I OP2   1 
ATOM   2170  O  "O5'" . DC  A  1  107 ? 50.001  21.026 -3.216  1.00 125.87 ? 107  DC  I "O5'" 1 
ATOM   2171  C  "C5'" . DC  A  1  107 ? 50.182  19.944 -4.126  1.00 123.81 ? 107  DC  I "C5'" 1 
ATOM   2172  C  "C4'" . DC  A  1  107 ? 51.633  19.839 -4.525  1.00 122.52 ? 107  DC  I "C4'" 1 
ATOM   2173  O  "O4'" . DC  A  1  107 ? 51.974  20.876 -5.476  1.00 121.89 ? 107  DC  I "O4'" 1 
ATOM   2174  C  "C3'" . DC  A  1  107 ? 52.609  19.997 -3.359  1.00 121.91 ? 107  DC  I "C3'" 1 
ATOM   2175  O  "O3'" . DC  A  1  107 ? 53.704  19.102 -3.530  1.00 121.78 ? 107  DC  I "O3'" 1 
ATOM   2176  C  "C2'" . DC  A  1  107 ? 53.096  21.426 -3.505  1.00 121.48 ? 107  DC  I "C2'" 1 
ATOM   2177  C  "C1'" . DC  A  1  107 ? 53.115  21.580 -5.014  1.00 120.84 ? 107  DC  I "C1'" 1 
ATOM   2178  N  N1    . DC  A  1  107 ? 53.039  22.960 -5.521  1.00 119.60 ? 107  DC  I N1    1 
ATOM   2179  C  C2    . DC  A  1  107 ? 53.477  23.215 -6.822  1.00 119.04 ? 107  DC  I C2    1 
ATOM   2180  O  O2    . DC  A  1  107 ? 53.908  22.272 -7.504  1.00 118.46 ? 107  DC  I O2    1 
ATOM   2181  N  N3    . DC  A  1  107 ? 53.420  24.477 -7.305  1.00 118.36 ? 107  DC  I N3    1 
ATOM   2182  C  C4    . DC  A  1  107 ? 52.947  25.462 -6.540  1.00 118.21 ? 107  DC  I C4    1 
ATOM   2183  N  N4    . DC  A  1  107 ? 52.908  26.691 -7.058  1.00 117.80 ? 107  DC  I N4    1 
ATOM   2184  C  C5    . DC  A  1  107 ? 52.494  25.230 -5.209  1.00 118.51 ? 107  DC  I C5    1 
ATOM   2185  C  C6    . DC  A  1  107 ? 52.556  23.976 -4.744  1.00 118.95 ? 107  DC  I C6    1 
ATOM   2186  P  P     . DC  A  1  108 ? 54.249  18.270 -2.274  1.00 121.62 ? 108  DC  I P     1 
ATOM   2187  O  OP1   . DC  A  1  108 ? 53.314  17.138 -2.039  1.00 121.84 ? 108  DC  I OP1   1 
ATOM   2188  O  OP2   . DC  A  1  108 ? 54.522  19.240 -1.184  1.00 121.50 ? 108  DC  I OP2   1 
ATOM   2189  O  "O5'" . DC  A  1  108 ? 55.634  17.684 -2.796  1.00 120.70 ? 108  DC  I "O5'" 1 
ATOM   2190  C  "C5'" . DC  A  1  108 ? 55.687  16.920 -3.996  1.00 119.01 ? 108  DC  I "C5'" 1 
ATOM   2191  C  "C4'" . DC  A  1  108 ? 56.883  17.327 -4.825  1.00 117.69 ? 108  DC  I "C4'" 1 
ATOM   2192  O  "O4'" . DC  A  1  108 ? 56.723  18.687 -5.301  1.00 117.20 ? 108  DC  I "O4'" 1 
ATOM   2193  C  "C3'" . DC  A  1  108 ? 58.221  17.293 -4.084  1.00 116.77 ? 108  DC  I "C3'" 1 
ATOM   2194  O  "O3'" . DC  A  1  108 ? 59.235  16.848 -4.984  1.00 116.11 ? 108  DC  I "O3'" 1 
ATOM   2195  C  "C2'" . DC  A  1  108 ? 58.463  18.753 -3.747  1.00 116.68 ? 108  DC  I "C2'" 1 
ATOM   2196  C  "C1'" . DC  A  1  108 ? 57.887  19.429 -4.976  1.00 116.73 ? 108  DC  I "C1'" 1 
ATOM   2197  N  N1    . DC  A  1  108 ? 57.506  20.840 -4.817  1.00 116.05 ? 108  DC  I N1    1 
ATOM   2198  C  C2    . DC  A  1  108 ? 57.676  21.697 -5.903  1.00 115.93 ? 108  DC  I C2    1 
ATOM   2199  O  O2    . DC  A  1  108 ? 58.132  21.237 -6.962  1.00 116.10 ? 108  DC  I O2    1 
ATOM   2200  N  N3    . DC  A  1  108 ? 57.342  23.001 -5.778  1.00 115.59 ? 108  DC  I N3    1 
ATOM   2201  C  C4    . DC  A  1  108 ? 56.852  23.454 -4.624  1.00 115.23 ? 108  DC  I C4    1 
ATOM   2202  N  N4    . DC  A  1  108 ? 56.535  24.748 -4.546  1.00 114.59 ? 108  DC  I N4    1 
ATOM   2203  C  C5    . DC  A  1  108 ? 56.664  22.601 -3.499  1.00 115.66 ? 108  DC  I C5    1 
ATOM   2204  C  C6    . DC  A  1  108 ? 57.001  21.312 -3.638  1.00 115.94 ? 108  DC  I C6    1 
ATOM   2205  P  P     . DA  A  1  109 ? 60.036  15.491 -4.679  1.00 115.80 ? 109  DA  I P     1 
ATOM   2206  O  OP1   . DA  A  1  109 ? 59.050  14.380 -4.676  1.00 115.68 ? 109  DA  I OP1   1 
ATOM   2207  O  OP2   . DA  A  1  109 ? 60.901  15.712 -3.490  1.00 116.07 ? 109  DA  I OP2   1 
ATOM   2208  O  "O5'" . DA  A  1  109 ? 60.968  15.322 -5.960  1.00 114.99 ? 109  DA  I "O5'" 1 
ATOM   2209  C  "C5'" . DA  A  1  109 ? 60.399  15.168 -7.261  1.00 113.13 ? 109  DA  I "C5'" 1 
ATOM   2210  C  "C4'" . DA  A  1  109 ? 61.124  16.040 -8.260  1.00 111.86 ? 109  DA  I "C4'" 1 
ATOM   2211  O  "O4'" . DA  A  1  109 ? 60.865  17.434 -7.968  1.00 110.92 ? 109  DA  I "O4'" 1 
ATOM   2212  C  "C3'" . DA  A  1  109 ? 62.643  15.884 -8.258  1.00 111.38 ? 109  DA  I "C3'" 1 
ATOM   2213  O  "O3'" . DA  A  1  109 ? 63.146  15.971 -9.595  1.00 110.86 ? 109  DA  I "O3'" 1 
ATOM   2214  C  "C2'" . DA  A  1  109 ? 63.119  17.049 -7.407  1.00 110.73 ? 109  DA  I "C2'" 1 
ATOM   2215  C  "C1'" . DA  A  1  109 ? 62.075  18.121 -7.673  1.00 110.49 ? 109  DA  I "C1'" 1 
ATOM   2216  N  N9    . DA  A  1  109 ? 61.817  18.987 -6.522  1.00 110.26 ? 109  DA  I N9    1 
ATOM   2217  C  C8    . DA  A  1  109 ? 61.743  18.614 -5.203  1.00 110.43 ? 109  DA  I C8    1 
ATOM   2218  N  N7    . DA  A  1  109 ? 61.474  19.605 -4.387  1.00 110.30 ? 109  DA  I N7    1 
ATOM   2219  C  C5    . DA  A  1  109 ? 61.369  20.706 -5.224  1.00 110.05 ? 109  DA  I C5    1 
ATOM   2220  C  C6    . DA  A  1  109 ? 61.092  22.063 -4.972  1.00 109.86 ? 109  DA  I C6    1 
ATOM   2221  N  N6    . DA  A  1  109 ? 60.853  22.557 -3.755  1.00 109.61 ? 109  DA  I N6    1 
ATOM   2222  N  N1    . DA  A  1  109 ? 61.066  22.905 -6.028  1.00 109.27 ? 109  DA  I N1    1 
ATOM   2223  C  C2    . DA  A  1  109 ? 61.301  22.407 -7.248  1.00 109.72 ? 109  DA  I C2    1 
ATOM   2224  N  N3    . DA  A  1  109 ? 61.567  21.153 -7.613  1.00 110.04 ? 109  DA  I N3    1 
ATOM   2225  C  C4    . DA  A  1  109 ? 61.587  20.342 -6.542  1.00 110.19 ? 109  DA  I C4    1 
ATOM   2226  P  P     . DA  A  1  110 ? 64.731  16.018 -9.850  1.00 109.78 ? 110  DA  I P     1 
ATOM   2227  O  OP1   . DA  A  1  110 ? 64.996  15.409 -11.180 1.00 109.73 ? 110  DA  I OP1   1 
ATOM   2228  O  OP2   . DA  A  1  110 ? 65.425  15.488 -8.647  1.00 110.20 ? 110  DA  I OP2   1 
ATOM   2229  O  "O5'" . DA  A  1  110 ? 65.026  17.577 -9.953  1.00 109.13 ? 110  DA  I "O5'" 1 
ATOM   2230  C  "C5'" . DA  A  1  110 ? 64.269  18.395 -10.841 1.00 107.74 ? 110  DA  I "C5'" 1 
ATOM   2231  C  "C4'" . DA  A  1  110 ? 64.792  19.811 -10.815 1.00 106.65 ? 110  DA  I "C4'" 1 
ATOM   2232  O  "O4'" . DA  A  1  110 ? 64.383  20.482 -9.599  1.00 106.40 ? 110  DA  I "O4'" 1 
ATOM   2233  C  "C3'" . DA  A  1  110 ? 66.316  19.912 -10.864 1.00 106.18 ? 110  DA  I "C3'" 1 
ATOM   2234  O  "O3'" . DA  A  1  110 ? 66.683  21.030 -11.669 1.00 104.98 ? 110  DA  I "O3'" 1 
ATOM   2235  C  "C2'" . DA  A  1  110 ? 66.690  20.174 -9.416  1.00 106.20 ? 110  DA  I "C2'" 1 
ATOM   2236  C  "C1'" . DA  A  1  110 ? 65.524  21.027 -8.958  1.00 106.50 ? 110  DA  I "C1'" 1 
ATOM   2237  N  N9    . DA  A  1  110 ? 65.283  21.023 -7.516  1.00 106.70 ? 110  DA  I N9    1 
ATOM   2238  C  C8    . DA  A  1  110 ? 65.412  19.981 -6.634  1.00 107.06 ? 110  DA  I C8    1 
ATOM   2239  N  N7    . DA  A  1  110 ? 65.127  20.300 -5.395  1.00 107.76 ? 110  DA  I N7    1 
ATOM   2240  C  C5    . DA  A  1  110 ? 64.785  21.644 -5.466  1.00 107.53 ? 110  DA  I C5    1 
ATOM   2241  C  C6    . DA  A  1  110 ? 64.380  22.576 -4.488  1.00 107.43 ? 110  DA  I C6    1 
ATOM   2242  N  N6    . DA  A  1  110 ? 64.246  22.282 -3.193  1.00 107.32 ? 110  DA  I N6    1 
ATOM   2243  N  N1    . DA  A  1  110 ? 64.114  23.836 -4.894  1.00 106.84 ? 110  DA  I N1    1 
ATOM   2244  C  C2    . DA  A  1  110 ? 64.247  24.131 -6.191  1.00 106.88 ? 110  DA  I C2    1 
ATOM   2245  N  N3    . DA  A  1  110 ? 64.619  23.347 -7.201  1.00 106.87 ? 110  DA  I N3    1 
ATOM   2246  C  C4    . DA  A  1  110 ? 64.876  22.102 -6.766  1.00 107.01 ? 110  DA  I C4    1 
ATOM   2247  P  P     . DA  A  1  111 ? 68.176  21.149 -12.247 1.00 103.18 ? 111  DA  I P     1 
ATOM   2248  O  OP1   . DA  A  1  111 ? 68.213  20.534 -13.598 1.00 102.67 ? 111  DA  I OP1   1 
ATOM   2249  O  OP2   . DA  A  1  111 ? 69.127  20.686 -11.203 1.00 103.11 ? 111  DA  I OP2   1 
ATOM   2250  O  "O5'" . DA  A  1  111 ? 68.344  22.721 -12.405 1.00 101.49 ? 111  DA  I "O5'" 1 
ATOM   2251  C  "C5'" . DA  A  1  111 ? 67.203  23.555 -12.595 1.00 99.29  ? 111  DA  I "C5'" 1 
ATOM   2252  C  "C4'" . DA  A  1  111 ? 67.384  24.848 -11.838 1.00 98.74  ? 111  DA  I "C4'" 1 
ATOM   2253  O  "O4'" . DA  A  1  111 ? 66.937  24.722 -10.464 1.00 97.67  ? 111  DA  I "O4'" 1 
ATOM   2254  C  "C3'" . DA  A  1  111 ? 68.846  25.285 -11.776 1.00 98.26  ? 111  DA  I "C3'" 1 
ATOM   2255  O  "O3'" . DA  A  1  111 ? 68.973  26.677 -12.029 1.00 98.42  ? 111  DA  I "O3'" 1 
ATOM   2256  C  "C2'" . DA  A  1  111 ? 69.256  24.971 -10.349 1.00 98.10  ? 111  DA  I "C2'" 1 
ATOM   2257  C  "C1'" . DA  A  1  111 ? 67.960  25.170 -9.588  1.00 97.46  ? 111  DA  I "C1'" 1 
ATOM   2258  N  N9    . DA  A  1  111 ? 67.878  24.391 -8.352  1.00 96.94  ? 111  DA  I N9    1 
ATOM   2259  C  C8    . DA  A  1  111 ? 68.124  23.051 -8.186  1.00 96.76  ? 111  DA  I C8    1 
ATOM   2260  N  N7    . DA  A  1  111 ? 67.990  22.638 -6.949  1.00 96.62  ? 111  DA  I N7    1 
ATOM   2261  C  C5    . DA  A  1  111 ? 67.627  23.781 -6.253  1.00 96.15  ? 111  DA  I C5    1 
ATOM   2262  C  C6    . DA  A  1  111 ? 67.337  24.009 -4.898  1.00 95.41  ? 111  DA  I C6    1 
ATOM   2263  N  N6    . DA  A  1  111 ? 67.377  23.059 -3.965  1.00 95.21  ? 111  DA  I N6    1 
ATOM   2264  N  N1    . DA  A  1  111 ? 67.001  25.263 -4.529  1.00 95.04  ? 111  DA  I N1    1 
ATOM   2265  C  C2    . DA  A  1  111 ? 66.965  26.217 -5.466  1.00 95.58  ? 111  DA  I C2    1 
ATOM   2266  N  N3    . DA  A  1  111 ? 67.218  26.128 -6.771  1.00 96.13  ? 111  DA  I N3    1 
ATOM   2267  C  C4    . DA  A  1  111 ? 67.547  24.868 -7.105  1.00 96.36  ? 111  DA  I C4    1 
ATOM   2268  P  P     . DT  A  1  112 ? 70.434  27.312 -12.193 1.00 98.30  ? 112  DT  I P     1 
ATOM   2269  O  OP1   . DT  A  1  112 ? 70.480  28.120 -13.437 1.00 98.22  ? 112  DT  I OP1   1 
ATOM   2270  O  OP2   . DT  A  1  112 ? 71.416  26.217 -11.991 1.00 97.88  ? 112  DT  I OP2   1 
ATOM   2271  O  "O5'" . DT  A  1  112 ? 70.530  28.294 -10.950 1.00 98.99  ? 112  DT  I "O5'" 1 
ATOM   2272  C  "C5'" . DT  A  1  112 ? 69.591  29.350 -10.784 1.00 100.45 ? 112  DT  I "C5'" 1 
ATOM   2273  C  "C4'" . DT  A  1  112 ? 69.978  30.184 -9.589  1.00 101.51 ? 112  DT  I "C4'" 1 
ATOM   2274  O  "O4'" . DT  A  1  112 ? 69.651  29.469 -8.372  1.00 101.72 ? 112  DT  I "O4'" 1 
ATOM   2275  C  "C3'" . DT  A  1  112 ? 71.482  30.440 -9.542  1.00 102.23 ? 112  DT  I "C3'" 1 
ATOM   2276  O  "O3'" . DT  A  1  112 ? 71.763  31.760 -9.100  1.00 102.79 ? 112  DT  I "O3'" 1 
ATOM   2277  C  "C2'" . DT  A  1  112 ? 71.990  29.420 -8.540  1.00 102.43 ? 112  DT  I "C2'" 1 
ATOM   2278  C  "C1'" . DT  A  1  112 ? 70.818  29.284 -7.585  1.00 102.34 ? 112  DT  I "C1'" 1 
ATOM   2279  N  N1    . DT  A  1  112 ? 70.722  27.964 -6.927  1.00 102.58 ? 112  DT  I N1    1 
ATOM   2280  C  C2    . DT  A  1  112 ? 70.068  27.887 -5.717  1.00 102.66 ? 112  DT  I C2    1 
ATOM   2281  O  O2    . DT  A  1  112 ? 69.552  28.852 -5.173  1.00 102.23 ? 112  DT  I O2    1 
ATOM   2282  N  N3    . DT  A  1  112 ? 70.038  26.629 -5.163  1.00 102.42 ? 112  DT  I N3    1 
ATOM   2283  C  C4    . DT  A  1  112 ? 70.581  25.470 -5.689  1.00 102.14 ? 112  DT  I C4    1 
ATOM   2284  O  O4    . DT  A  1  112 ? 70.479  24.412 -5.073  1.00 101.76 ? 112  DT  I O4    1 
ATOM   2285  C  C5    . DT  A  1  112 ? 71.245  25.624 -6.963  1.00 101.97 ? 112  DT  I C5    1 
ATOM   2286  C  C7    . DT  A  1  112 ? 71.859  24.425 -7.612  1.00 101.82 ? 112  DT  I C7    1 
ATOM   2287  C  C6    . DT  A  1  112 ? 71.280  26.845 -7.511  1.00 102.10 ? 112  DT  I C6    1 
ATOM   2288  P  P     . DA  A  1  113 ? 73.210  32.385 -9.372  1.00 104.14 ? 113  DA  I P     1 
ATOM   2289  O  OP1   . DA  A  1  113 ? 73.096  33.415 -10.433 1.00 104.26 ? 113  DA  I OP1   1 
ATOM   2290  O  OP2   . DA  A  1  113 ? 74.158  31.256 -9.543  1.00 103.25 ? 113  DA  I OP2   1 
ATOM   2291  O  "O5'" . DA  A  1  113 ? 73.553  33.111 -8.003  1.00 106.21 ? 113  DA  I "O5'" 1 
ATOM   2292  C  "C5'" . DA  A  1  113 ? 72.558  33.848 -7.301  1.00 108.48 ? 113  DA  I "C5'" 1 
ATOM   2293  C  "C4'" . DA  A  1  113 ? 72.959  33.985 -5.854  1.00 110.26 ? 113  DA  I "C4'" 1 
ATOM   2294  O  "O4'" . DA  A  1  113 ? 72.801  32.710 -5.189  1.00 110.08 ? 113  DA  I "O4'" 1 
ATOM   2295  C  "C3'" . DA  A  1  113 ? 74.425  34.368 -5.691  1.00 111.49 ? 113  DA  I "C3'" 1 
ATOM   2296  O  "O3'" . DA  A  1  113 ? 74.589  35.295 -4.618  1.00 114.43 ? 113  DA  I "O3'" 1 
ATOM   2297  C  "C2'" . DA  A  1  113 ? 75.112  33.041 -5.413  1.00 111.02 ? 113  DA  I "C2'" 1 
ATOM   2298  C  "C1'" . DA  A  1  113 ? 74.044  32.254 -4.676  1.00 110.65 ? 113  DA  I "C1'" 1 
ATOM   2299  N  N9    . DA  A  1  113 ? 74.084  30.801 -4.864  1.00 111.09 ? 113  DA  I N9    1 
ATOM   2300  C  C8    . DA  A  1  113 ? 74.229  30.125 -6.049  1.00 111.42 ? 113  DA  I C8    1 
ATOM   2301  N  N7    . DA  A  1  113 ? 74.192  28.820 -5.923  1.00 111.70 ? 113  DA  I N7    1 
ATOM   2302  C  C5    . DA  A  1  113 ? 74.020  28.619 -4.562  1.00 111.38 ? 113  DA  I C5    1 
ATOM   2303  C  C6    . DA  A  1  113 ? 73.901  27.449 -3.787  1.00 111.52 ? 113  DA  I C6    1 
ATOM   2304  N  N6    . DA  A  1  113 ? 73.933  26.213 -4.297  1.00 110.85 ? 113  DA  I N6    1 
ATOM   2305  N  N1    . DA  A  1  113 ? 73.743  27.593 -2.454  1.00 111.90 ? 113  DA  I N1    1 
ATOM   2306  C  C2    . DA  A  1  113 ? 73.705  28.833 -1.945  1.00 111.94 ? 113  DA  I C2    1 
ATOM   2307  N  N3    . DA  A  1  113 ? 73.804  30.006 -2.569  1.00 111.75 ? 113  DA  I N3    1 
ATOM   2308  C  C4    . DA  A  1  113 ? 73.961  29.830 -3.893  1.00 111.48 ? 113  DA  I C4    1 
ATOM   2309  P  P     . DC  A  1  114 ? 75.919  36.188 -4.550  1.00 116.08 ? 114  DC  I P     1 
ATOM   2310  O  OP1   . DC  A  1  114 ? 75.959  36.864 -3.227  1.00 116.11 ? 114  DC  I OP1   1 
ATOM   2311  O  OP2   . DC  A  1  114 ? 75.988  36.999 -5.792  1.00 115.83 ? 114  DC  I OP2   1 
ATOM   2312  O  "O5'" . DC  A  1  114 ? 77.072  35.093 -4.613  1.00 117.87 ? 114  DC  I "O5'" 1 
ATOM   2313  C  "C5'" . DC  A  1  114 ? 78.107  35.057 -3.636  1.00 120.66 ? 114  DC  I "C5'" 1 
ATOM   2314  C  "C4'" . DC  A  1  114 ? 77.558  34.601 -2.303  1.00 121.78 ? 114  DC  I "C4'" 1 
ATOM   2315  O  "O4'" . DC  A  1  114 ? 76.862  33.336 -2.434  1.00 121.84 ? 114  DC  I "O4'" 1 
ATOM   2316  C  "C3'" . DC  A  1  114 ? 78.635  34.383 -1.243  1.00 122.70 ? 114  DC  I "C3'" 1 
ATOM   2317  O  "O3'" . DC  A  1  114 ? 78.190  34.878 0.020   1.00 124.00 ? 114  DC  I "O3'" 1 
ATOM   2318  C  "C2'" . DC  A  1  114 ? 78.812  32.875 -1.216  1.00 122.36 ? 114  DC  I "C2'" 1 
ATOM   2319  C  "C1'" . DC  A  1  114 ? 77.418  32.376 -1.545  1.00 121.93 ? 114  DC  I "C1'" 1 
ATOM   2320  N  N1    . DC  A  1  114 ? 77.379  31.063 -2.211  1.00 122.05 ? 114  DC  I N1    1 
ATOM   2321  C  C2    . DC  A  1  114 ? 77.142  29.917 -1.442  1.00 122.11 ? 114  DC  I C2    1 
ATOM   2322  O  O2    . DC  A  1  114 ? 77.002  30.031 -0.220  1.00 122.32 ? 114  DC  I O2    1 
ATOM   2323  N  N3    . DC  A  1  114 ? 77.079  28.712 -2.052  1.00 122.24 ? 114  DC  I N3    1 
ATOM   2324  C  C4    . DC  A  1  114 ? 77.255  28.623 -3.371  1.00 122.38 ? 114  DC  I C4    1 
ATOM   2325  N  N4    . DC  A  1  114 ? 77.180  27.414 -3.931  1.00 122.27 ? 114  DC  I N4    1 
ATOM   2326  C  C5    . DC  A  1  114 ? 77.513  29.770 -4.176  1.00 122.38 ? 114  DC  I C5    1 
ATOM   2327  C  C6    . DC  A  1  114 ? 77.565  30.959 -3.561  1.00 122.34 ? 114  DC  I C6    1 
ATOM   2328  P  P     . DA  A  1  115 ? 79.265  35.437 1.070   1.00 124.58 ? 115  DA  I P     1 
ATOM   2329  O  OP1   . DA  A  1  115 ? 78.537  36.060 2.207   1.00 124.46 ? 115  DA  I OP1   1 
ATOM   2330  O  OP2   . DA  A  1  115 ? 80.274  36.227 0.319   1.00 124.11 ? 115  DA  I OP2   1 
ATOM   2331  O  "O5'" . DA  A  1  115 ? 79.966  34.115 1.604   1.00 125.05 ? 115  DA  I "O5'" 1 
ATOM   2332  C  "C5'" . DA  A  1  115 ? 79.342  33.342 2.614   1.00 126.26 ? 115  DA  I "C5'" 1 
ATOM   2333  C  "C4'" . DA  A  1  115 ? 80.178  32.129 2.938   1.00 127.24 ? 115  DA  I "C4'" 1 
ATOM   2334  O  "O4'" . DA  A  1  115 ? 80.042  31.130 1.899   1.00 127.61 ? 115  DA  I "O4'" 1 
ATOM   2335  C  "C3'" . DA  A  1  115 ? 81.674  32.390 3.095   1.00 127.53 ? 115  DA  I "C3'" 1 
ATOM   2336  O  "O3'" . DA  A  1  115 ? 82.145  31.724 4.268   1.00 127.89 ? 115  DA  I "O3'" 1 
ATOM   2337  C  "C2'" . DA  A  1  115 ? 82.277  31.782 1.839   1.00 127.46 ? 115  DA  I "C2'" 1 
ATOM   2338  C  "C1'" . DA  A  1  115 ? 81.321  30.641 1.540   1.00 127.49 ? 115  DA  I "C1'" 1 
ATOM   2339  N  N9    . DA  A  1  115 ? 81.264  30.218 0.139   1.00 127.23 ? 115  DA  I N9    1 
ATOM   2340  C  C8    . DA  A  1  115 ? 81.547  30.964 -0.978  1.00 126.99 ? 115  DA  I C8    1 
ATOM   2341  N  N7    . DA  A  1  115 ? 81.404  30.306 -2.103  1.00 126.89 ? 115  DA  I N7    1 
ATOM   2342  C  C5    . DA  A  1  115 ? 81.000  29.040 -1.703  1.00 126.65 ? 115  DA  I C5    1 
ATOM   2343  C  C6    . DA  A  1  115 ? 80.685  27.874 -2.425  1.00 126.35 ? 115  DA  I C6    1 
ATOM   2344  N  N6    . DA  A  1  115 ? 80.728  27.792 -3.756  1.00 126.23 ? 115  DA  I N6    1 
ATOM   2345  N  N1    . DA  A  1  115 ? 80.319  26.780 -1.724  1.00 126.08 ? 115  DA  I N1    1 
ATOM   2346  C  C2    . DA  A  1  115 ? 80.274  26.862 -0.390  1.00 126.43 ? 115  DA  I C2    1 
ATOM   2347  N  N3    . DA  A  1  115 ? 80.546  27.898 0.403   1.00 126.83 ? 115  DA  I N3    1 
ATOM   2348  C  C4    . DA  A  1  115 ? 80.908  28.970 -0.324  1.00 126.92 ? 115  DA  I C4    1 
ATOM   2349  P  P     . DC  A  1  116 ? 83.705  31.760 4.629   1.00 127.99 ? 116  DC  I P     1 
ATOM   2350  O  OP1   . DC  A  1  116 ? 83.842  31.857 6.104   1.00 128.13 ? 116  DC  I OP1   1 
ATOM   2351  O  OP2   . DC  A  1  116 ? 84.350  32.776 3.762   1.00 128.19 ? 116  DC  I OP2   1 
ATOM   2352  O  "O5'" . DC  A  1  116 ? 84.196  30.320 4.176   1.00 128.58 ? 116  DC  I "O5'" 1 
ATOM   2353  C  "C5'" . DC  A  1  116 ? 83.507  29.160 4.625   1.00 129.64 ? 116  DC  I "C5'" 1 
ATOM   2354  C  "C4'" . DC  A  1  116 ? 84.170  27.920 4.081   1.00 130.57 ? 116  DC  I "C4'" 1 
ATOM   2355  O  "O4'" . DC  A  1  116 ? 83.835  27.746 2.683   1.00 131.20 ? 116  DC  I "O4'" 1 
ATOM   2356  C  "C3'" . DC  A  1  116 ? 85.696  27.944 4.160   1.00 130.64 ? 116  DC  I "C3'" 1 
ATOM   2357  O  "O3'" . DC  A  1  116 ? 86.183  26.676 4.593   1.00 130.16 ? 116  DC  I "O3'" 1 
ATOM   2358  C  "C2'" . DC  A  1  116 ? 86.122  28.219 2.729   1.00 131.12 ? 116  DC  I "C2'" 1 
ATOM   2359  C  "C1'" . DC  A  1  116 ? 85.020  27.545 1.932   1.00 131.68 ? 116  DC  I "C1'" 1 
ATOM   2360  N  N1    . DC  A  1  116 ? 84.807  28.098 0.583   1.00 132.34 ? 116  DC  I N1    1 
ATOM   2361  C  C2    . DC  A  1  116 ? 84.394  27.236 -0.443  1.00 132.58 ? 116  DC  I C2    1 
ATOM   2362  O  O2    . DC  A  1  116 ? 84.197  26.040 -0.181  1.00 132.64 ? 116  DC  I O2    1 
ATOM   2363  N  N3    . DC  A  1  116 ? 84.219  27.729 -1.690  1.00 132.79 ? 116  DC  I N3    1 
ATOM   2364  C  C4    . DC  A  1  116 ? 84.436  29.024 -1.932  1.00 133.02 ? 116  DC  I C4    1 
ATOM   2365  N  N4    . DC  A  1  116 ? 84.259  29.464 -3.179  1.00 133.06 ? 116  DC  I N4    1 
ATOM   2366  C  C5    . DC  A  1  116 ? 84.845  29.925 -0.905  1.00 133.00 ? 116  DC  I C5    1 
ATOM   2367  C  C6    . DC  A  1  116 ? 85.016  29.424 0.326   1.00 132.76 ? 116  DC  I C6    1 
ATOM   2368  P  P     . DT  A  1  117 ? 87.763  26.426 4.681   1.00 129.83 ? 117  DT  I P     1 
ATOM   2369  O  OP1   . DT  A  1  117 ? 88.020  25.465 5.783   1.00 130.29 ? 117  DT  I OP1   1 
ATOM   2370  O  OP2   . DT  A  1  117 ? 88.433  27.751 4.686   1.00 129.63 ? 117  DT  I OP2   1 
ATOM   2371  O  "O5'" . DT  A  1  117 ? 88.086  25.704 3.303   1.00 129.55 ? 117  DT  I "O5'" 1 
ATOM   2372  C  "C5'" . DT  A  1  117 ? 87.397  24.512 2.950   1.00 129.42 ? 117  DT  I "C5'" 1 
ATOM   2373  C  "C4'" . DT  A  1  117 ? 87.991  23.910 1.700   1.00 129.40 ? 117  DT  I "C4'" 1 
ATOM   2374  O  "O4'" . DT  A  1  117 ? 87.544  24.620 0.519   1.00 129.29 ? 117  DT  I "O4'" 1 
ATOM   2375  C  "C3'" . DT  A  1  117 ? 89.518  23.899 1.647   1.00 129.40 ? 117  DT  I "C3'" 1 
ATOM   2376  O  "O3'" . DT  A  1  117 ? 89.944  22.646 1.127   1.00 129.72 ? 117  DT  I "O3'" 1 
ATOM   2377  C  "C2'" . DT  A  1  117 ? 89.839  25.007 0.659   1.00 129.30 ? 117  DT  I "C2'" 1 
ATOM   2378  C  "C1'" . DT  A  1  117 ? 88.664  24.914 -0.297  1.00 128.99 ? 117  DT  I "C1'" 1 
ATOM   2379  N  N1    . DT  A  1  117 ? 88.368  26.143 -1.061  1.00 128.32 ? 117  DT  I N1    1 
ATOM   2380  C  C2    . DT  A  1  117 ? 87.942  26.006 -2.364  1.00 127.87 ? 117  DT  I C2    1 
ATOM   2381  O  O2    . DT  A  1  117 ? 87.784  24.922 -2.904  1.00 127.27 ? 117  DT  I O2    1 
ATOM   2382  N  N3    . DT  A  1  117 ? 87.703  27.191 -3.015  1.00 127.53 ? 117  DT  I N3    1 
ATOM   2383  C  C4    . DT  A  1  117 ? 87.841  28.467 -2.503  1.00 127.59 ? 117  DT  I C4    1 
ATOM   2384  O  O4    . DT  A  1  117 ? 87.590  29.438 -3.210  1.00 126.91 ? 117  DT  I O4    1 
ATOM   2385  C  C5    . DT  A  1  117 ? 88.284  28.536 -1.129  1.00 127.80 ? 117  DT  I C5    1 
ATOM   2386  C  C7    . DT  A  1  117 ? 88.457  29.876 -0.487  1.00 127.91 ? 117  DT  I C7    1 
ATOM   2387  C  C6    . DT  A  1  117 ? 88.521  27.386 -0.486  1.00 128.06 ? 117  DT  I C6    1 
ATOM   2388  P  P     . DT  A  1  118 ? 91.492  22.242 1.175   1.00 130.42 ? 118  DT  I P     1 
ATOM   2389  O  OP1   . DT  A  1  118 ? 91.665  21.267 2.280   1.00 130.39 ? 118  DT  I OP1   1 
ATOM   2390  O  OP2   . DT  A  1  118 ? 92.330  23.470 1.134   1.00 130.38 ? 118  DT  I OP2   1 
ATOM   2391  O  "O5'" . DT  A  1  118 ? 91.664  21.459 -0.195  1.00 130.59 ? 118  DT  I "O5'" 1 
ATOM   2392  C  "C5'" . DT  A  1  118 ? 90.579  20.697 -0.709  1.00 130.67 ? 118  DT  I "C5'" 1 
ATOM   2393  C  "C4'" . DT  A  1  118 ? 90.601  20.699 -2.216  1.00 130.56 ? 118  DT  I "C4'" 1 
ATOM   2394  O  "O4'" . DT  A  1  118 ? 90.250  21.992 -2.757  1.00 130.30 ? 118  DT  I "O4'" 1 
ATOM   2395  C  "C3'" . DT  A  1  118 ? 91.952  20.353 -2.818  1.00 130.78 ? 118  DT  I "C3'" 1 
ATOM   2396  O  "O3'" . DT  A  1  118 ? 91.717  19.594 -3.990  1.00 131.71 ? 118  DT  I "O3'" 1 
ATOM   2397  C  "C2'" . DT  A  1  118 ? 92.507  21.703 -3.222  1.00 130.45 ? 118  DT  I "C2'" 1 
ATOM   2398  C  "C1'" . DT  A  1  118 ? 91.236  22.361 -3.702  1.00 130.28 ? 118  DT  I "C1'" 1 
ATOM   2399  N  N1    . DT  A  1  118 ? 91.269  23.827 -3.779  1.00 130.30 ? 118  DT  I N1    1 
ATOM   2400  C  C2    . DT  A  1  118 ? 91.043  24.413 -5.003  1.00 130.34 ? 118  DT  I C2    1 
ATOM   2401  O  O2    . DT  A  1  118 ? 90.853  23.771 -6.024  1.00 130.62 ? 118  DT  I O2    1 
ATOM   2402  N  N3    . DT  A  1  118 ? 91.050  25.782 -4.987  1.00 129.95 ? 118  DT  I N3    1 
ATOM   2403  C  C4    . DT  A  1  118 ? 91.260  26.601 -3.897  1.00 130.00 ? 118  DT  I C4    1 
ATOM   2404  O  O4    . DT  A  1  118 ? 91.219  27.822 -4.032  1.00 129.32 ? 118  DT  I O4    1 
ATOM   2405  C  C5    . DT  A  1  118 ? 91.513  25.916 -2.651  1.00 130.27 ? 118  DT  I C5    1 
ATOM   2406  C  C7    . DT  A  1  118 ? 91.771  26.723 -1.419  1.00 130.49 ? 118  DT  I C7    1 
ATOM   2407  C  C6    . DT  A  1  118 ? 91.505  24.581 -2.655  1.00 130.36 ? 118  DT  I C6    1 
ATOM   2408  P  P     . DT  A  1  119 ? 92.870  18.627 -4.532  1.00 132.47 ? 119  DT  I P     1 
ATOM   2409  O  OP1   . DT  A  1  119 ? 92.291  17.261 -4.667  1.00 132.48 ? 119  DT  I OP1   1 
ATOM   2410  O  OP2   . DT  A  1  119 ? 94.047  18.834 -3.641  1.00 132.31 ? 119  DT  I OP2   1 
ATOM   2411  O  "O5'" . DT  A  1  119 ? 93.213  19.217 -5.970  1.00 132.77 ? 119  DT  I "O5'" 1 
ATOM   2412  C  "C5'" . DT  A  1  119 ? 92.424  18.884 -7.101  1.00 132.72 ? 119  DT  I "C5'" 1 
ATOM   2413  C  "C4'" . DT  A  1  119 ? 93.150  19.293 -8.359  1.00 132.13 ? 119  DT  I "C4'" 1 
ATOM   2414  O  "O4'" . DT  A  1  119 ? 93.154  20.742 -8.430  1.00 132.81 ? 119  DT  I "O4'" 1 
ATOM   2415  C  "C3'" . DT  A  1  119 ? 94.622  18.862 -8.369  1.00 131.32 ? 119  DT  I "C3'" 1 
ATOM   2416  O  "O3'" . DT  A  1  119 ? 95.004  18.312 -9.656  1.00 128.14 ? 119  DT  I "O3'" 1 
ATOM   2417  C  "C2'" . DT  A  1  119 ? 95.372  20.112 -7.931  1.00 132.28 ? 119  DT  I "C2'" 1 
ATOM   2418  C  "C1'" . DT  A  1  119 ? 94.486  21.245 -8.428  1.00 133.24 ? 119  DT  I "C1'" 1 
ATOM   2419  N  N1    . DT  A  1  119 ? 94.521  22.454 -7.578  1.00 134.15 ? 119  DT  I N1    1 
ATOM   2420  C  C2    . DT  A  1  119 ? 94.121  23.648 -8.133  1.00 134.78 ? 119  DT  I C2    1 
ATOM   2421  O  O2    . DT  A  1  119 ? 93.715  23.749 -9.278  1.00 135.44 ? 119  DT  I O2    1 
ATOM   2422  N  N3    . DT  A  1  119 ? 94.216  24.732 -7.293  1.00 135.05 ? 119  DT  I N3    1 
ATOM   2423  C  C4    . DT  A  1  119 ? 94.654  24.739 -5.983  1.00 135.17 ? 119  DT  I C4    1 
ATOM   2424  O  O4    . DT  A  1  119 ? 94.687  25.794 -5.355  1.00 134.95 ? 119  DT  I O4    1 
ATOM   2425  C  C5    . DT  A  1  119 ? 95.046  23.449 -5.459  1.00 135.32 ? 119  DT  I C5    1 
ATOM   2426  C  C7    . DT  A  1  119 ? 95.524  23.355 -4.045  1.00 135.75 ? 119  DT  I C7    1 
ATOM   2427  C  C6    . DT  A  1  119 ? 94.959  22.386 -6.271  1.00 134.94 ? 119  DT  I C6    1 
ATOM   2428  P  P     . DT  A  1  120 ? 96.001  19.111 -10.640 1.00 125.44 ? 120  DT  I P     1 
ATOM   2429  O  OP1   . DT  A  1  120 ? 96.574  18.092 -11.550 1.00 125.39 ? 120  DT  I OP1   1 
ATOM   2430  O  OP2   . DT  A  1  120 ? 96.911  20.027 -9.904  1.00 124.95 ? 120  DT  I OP2   1 
ATOM   2431  O  "O5'" . DT  A  1  120 ? 94.986  19.989 -11.495 1.00 122.39 ? 120  DT  I "O5'" 1 
ATOM   2432  C  "C5'" . DT  A  1  120 ? 93.601  19.631 -11.554 1.00 116.90 ? 120  DT  I "C5'" 1 
ATOM   2433  C  "C4'" . DT  A  1  120 ? 92.845  20.582 -12.451 1.00 112.81 ? 120  DT  I "C4'" 1 
ATOM   2434  O  "O4'" . DT  A  1  120 ? 92.929  21.917 -11.902 1.00 112.33 ? 120  DT  I "O4'" 1 
ATOM   2435  C  "C3'" . DT  A  1  120 ? 93.389  20.675 -13.873 1.00 110.03 ? 120  DT  I "C3'" 1 
ATOM   2436  O  "O3'" . DT  A  1  120 ? 92.313  20.841 -14.797 1.00 104.79 ? 120  DT  I "O3'" 1 
ATOM   2437  C  "C2'" . DT  A  1  120 ? 94.271  21.907 -13.832 1.00 110.83 ? 120  DT  I "C2'" 1 
ATOM   2438  C  "C1'" . DT  A  1  120 ? 93.564  22.792 -12.821 1.00 112.05 ? 120  DT  I "C1'" 1 
ATOM   2439  N  N1    . DT  A  1  120 ? 94.472  23.664 -12.053 1.00 112.52 ? 120  DT  I N1    1 
ATOM   2440  C  C2    . DT  A  1  120 ? 94.154  24.998 -11.938 1.00 112.95 ? 120  DT  I C2    1 
ATOM   2441  O  O2    . DT  A  1  120 ? 93.164  25.494 -12.451 1.00 113.48 ? 120  DT  I O2    1 
ATOM   2442  N  N3    . DT  A  1  120 ? 95.042  25.736 -11.196 1.00 113.25 ? 120  DT  I N3    1 
ATOM   2443  C  C4    . DT  A  1  120 ? 96.192  25.283 -10.574 1.00 113.80 ? 120  DT  I C4    1 
ATOM   2444  O  O4    . DT  A  1  120 ? 96.892  26.065 -9.931  1.00 113.72 ? 120  DT  I O4    1 
ATOM   2445  C  C5    . DT  A  1  120 ? 96.468  23.874 -10.744 1.00 113.60 ? 120  DT  I C5    1 
ATOM   2446  C  C7    . DT  A  1  120 ? 97.694  23.293 -10.115 1.00 113.78 ? 120  DT  I C7    1 
ATOM   2447  C  C6    . DT  A  1  120 ? 95.605  23.146 -11.465 1.00 112.94 ? 120  DT  I C6    1 
ATOM   2448  P  P     . DG  A  1  121 ? 92.615  20.865 -16.371 1.00 100.35 ? 121  DG  I P     1 
ATOM   2449  O  OP1   . DG  A  1  121 ? 91.386  20.424 -17.083 1.00 100.75 ? 121  DG  I OP1   1 
ATOM   2450  O  OP2   . DG  A  1  121 ? 93.896  20.152 -16.601 1.00 100.22 ? 121  DG  I OP2   1 
ATOM   2451  O  "O5'" . DG  A  1  121 ? 92.846  22.408 -16.679 1.00 97.47  ? 121  DG  I "O5'" 1 
ATOM   2452  C  "C5'" . DG  A  1  121 ? 91.793  23.346 -16.494 1.00 92.72  ? 121  DG  I "C5'" 1 
ATOM   2453  C  "C4'" . DG  A  1  121 ? 92.247  24.723 -16.909 1.00 89.88  ? 121  DG  I "C4'" 1 
ATOM   2454  O  "O4'" . DG  A  1  121 ? 93.259  25.196 -15.989 1.00 89.88  ? 121  DG  I "O4'" 1 
ATOM   2455  C  "C3'" . DG  A  1  121 ? 92.877  24.785 -18.298 1.00 87.76  ? 121  DG  I "C3'" 1 
ATOM   2456  O  "O3'" . DG  A  1  121 ? 92.505  26.010 -18.932 1.00 84.02  ? 121  DG  I "O3'" 1 
ATOM   2457  C  "C2'" . DG  A  1  121 ? 94.367  24.742 -18.010 1.00 88.63  ? 121  DG  I "C2'" 1 
ATOM   2458  C  "C1'" . DG  A  1  121 ? 94.468  25.474 -16.683 1.00 90.24  ? 121  DG  I "C1'" 1 
ATOM   2459  N  N9    . DG  A  1  121 ? 95.574  25.035 -15.836 1.00 91.53  ? 121  DG  I N9    1 
ATOM   2460  C  C8    . DG  A  1  121 ? 96.092  23.766 -15.744 1.00 91.35  ? 121  DG  I C8    1 
ATOM   2461  N  N7    . DG  A  1  121 ? 97.067  23.672 -14.880 1.00 91.95  ? 121  DG  I N7    1 
ATOM   2462  C  C5    . DG  A  1  121 ? 97.207  24.958 -14.376 1.00 92.32  ? 121  DG  I C5    1 
ATOM   2463  C  C6    . DG  A  1  121 ? 98.104  25.474 -13.399 1.00 92.53  ? 121  DG  I C6    1 
ATOM   2464  O  O6    . DG  A  1  121 ? 98.979  24.875 -12.760 1.00 92.23  ? 121  DG  I O6    1 
ATOM   2465  N  N1    . DG  A  1  121 ? 97.906  26.836 -13.192 1.00 92.32  ? 121  DG  I N1    1 
ATOM   2466  C  C2    . DG  A  1  121 ? 96.967  27.605 -13.837 1.00 92.31  ? 121  DG  I C2    1 
ATOM   2467  N  N2    . DG  A  1  121 ? 96.939  28.905 -13.505 1.00 91.15  ? 121  DG  I N2    1 
ATOM   2468  N  N3    . DG  A  1  121 ? 96.121  27.136 -14.742 1.00 92.23  ? 121  DG  I N3    1 
ATOM   2469  C  C4    . DG  A  1  121 ? 96.297  25.814 -14.961 1.00 92.11  ? 121  DG  I C4    1 
ATOM   2470  P  P     . DG  A  1  122 ? 93.028  26.334 -20.413 1.00 81.01  ? 122  DG  I P     1 
ATOM   2471  O  OP1   . DG  A  1  122 ? 91.875  26.824 -21.207 1.00 81.23  ? 122  DG  I OP1   1 
ATOM   2472  O  OP2   . DG  A  1  122 ? 93.816  25.175 -20.899 1.00 81.02  ? 122  DG  I OP2   1 
ATOM   2473  O  "O5'" . DG  A  1  122 ? 94.024  27.551 -20.180 1.00 83.43  ? 122  DG  I "O5'" 1 
ATOM   2474  C  "C5'" . DG  A  1  122 ? 93.595  28.695 -19.449 1.00 86.42  ? 122  DG  I "C5'" 1 
ATOM   2475  C  "C4'" . DG  A  1  122 ? 94.756  29.624 -19.183 1.00 88.21  ? 122  DG  I "C4'" 1 
ATOM   2476  O  "O4'" . DG  A  1  122 ? 95.621  29.089 -18.151 1.00 88.60  ? 122  DG  I "O4'" 1 
ATOM   2477  C  "C3'" . DG  A  1  122 ? 95.654  29.915 -20.386 1.00 89.03  ? 122  DG  I "C3'" 1 
ATOM   2478  O  "O3'" . DG  A  1  122 ? 95.943  31.311 -20.427 1.00 91.02  ? 122  DG  I "O3'" 1 
ATOM   2479  C  "C2'" . DG  A  1  122 ? 96.913  29.119 -20.091 1.00 88.81  ? 122  DG  I "C2'" 1 
ATOM   2480  C  "C1'" . DG  A  1  122 ? 96.969  29.180 -18.578 1.00 89.39  ? 122  DG  I "C1'" 1 
ATOM   2481  N  N9    . DG  A  1  122 ? 97.727  28.108 -17.937 1.00 90.02  ? 122  DG  I N9    1 
ATOM   2482  C  C8    . DG  A  1  122 ? 97.703  26.769 -18.243 1.00 90.25  ? 122  DG  I C8    1 
ATOM   2483  N  N7    . DG  A  1  122 ? 98.507  26.058 -17.497 1.00 90.43  ? 122  DG  I N7    1 
ATOM   2484  C  C5    . DG  A  1  122 ? 99.096  26.984 -16.646 1.00 90.45  ? 122  DG  I C5    1 
ATOM   2485  C  C6    . DG  A  1  122 ? 100.060 26.807 -15.618 1.00 90.95  ? 122  DG  I C6    1 
ATOM   2486  O  O6    . DG  A  1  122 ? 100.610 25.760 -15.246 1.00 90.38  ? 122  DG  I O6    1 
ATOM   2487  N  N1    . DG  A  1  122 ? 100.375 28.015 -15.000 1.00 91.00  ? 122  DG  I N1    1 
ATOM   2488  C  C2    . DG  A  1  122 ? 99.838  29.236 -15.330 1.00 90.72  ? 122  DG  I C2    1 
ATOM   2489  N  N2    . DG  A  1  122 ? 100.266 30.287 -14.614 1.00 90.16  ? 122  DG  I N2    1 
ATOM   2490  N  N3    . DG  A  1  122 ? 98.945  29.414 -16.289 1.00 90.68  ? 122  DG  I N3    1 
ATOM   2491  C  C4    . DG  A  1  122 ? 98.621  28.253 -16.901 1.00 90.48  ? 122  DG  I C4    1 
ATOM   2492  P  P     . DT  A  1  123 ? 96.948  31.886 -21.535 1.00 92.95  ? 123  DT  I P     1 
ATOM   2493  O  OP1   . DT  A  1  123 ? 96.381  33.150 -22.066 1.00 93.12  ? 123  DT  I OP1   1 
ATOM   2494  O  OP2   . DT  A  1  123 ? 97.289  30.784 -22.467 1.00 93.25  ? 123  DT  I OP2   1 
ATOM   2495  O  "O5'" . DT  A  1  123 ? 98.243  32.247 -20.685 1.00 96.47  ? 123  DT  I "O5'" 1 
ATOM   2496  C  "C5'" . DT  A  1  123 ? 98.132  33.061 -19.520 1.00 100.26 ? 123  DT  I "C5'" 1 
ATOM   2497  C  "C4'" . DT  A  1  123 ? 99.499  33.356 -18.949 1.00 103.19 ? 123  DT  I "C4'" 1 
ATOM   2498  O  "O4'" . DT  A  1  123 ? 100.030 32.190 -18.273 1.00 103.19 ? 123  DT  I "O4'" 1 
ATOM   2499  C  "C3'" . DT  A  1  123 ? 100.547 33.767 -19.983 1.00 105.04 ? 123  DT  I "C3'" 1 
ATOM   2500  O  "O3'" . DT  A  1  123 ? 101.313 34.861 -19.477 1.00 109.18 ? 123  DT  I "O3'" 1 
ATOM   2501  C  "C2'" . DT  A  1  123 ? 101.405 32.522 -20.134 1.00 103.83 ? 123  DT  I "C2'" 1 
ATOM   2502  C  "C1'" . DT  A  1  123 ? 101.340 31.923 -18.741 1.00 102.90 ? 123  DT  I "C1'" 1 
ATOM   2503  N  N1    . DT  A  1  123 ? 101.561 30.465 -18.662 1.00 102.23 ? 123  DT  I N1    1 
ATOM   2504  C  C2    . DT  A  1  123 ? 102.428 30.001 -17.697 1.00 102.15 ? 123  DT  I C2    1 
ATOM   2505  O  O2    . DT  A  1  123 ? 103.021 30.737 -16.925 1.00 101.94 ? 123  DT  I O2    1 
ATOM   2506  N  N3    . DT  A  1  123 ? 102.576 28.636 -17.668 1.00 101.36 ? 123  DT  I N3    1 
ATOM   2507  C  C4    . DT  A  1  123 ? 101.965 27.712 -18.492 1.00 101.50 ? 123  DT  I C4    1 
ATOM   2508  O  O4    . DT  A  1  123 ? 102.195 26.514 -18.346 1.00 101.21 ? 123  DT  I O4    1 
ATOM   2509  C  C5    . DT  A  1  123 ? 101.076 28.269 -19.487 1.00 101.33 ? 123  DT  I C5    1 
ATOM   2510  C  C7    . DT  A  1  123 ? 100.376 27.344 -20.430 1.00 101.52 ? 123  DT  I C7    1 
ATOM   2511  C  C6    . DT  A  1  123 ? 100.919 29.600 -19.521 1.00 101.55 ? 123  DT  I C6    1 
ATOM   2512  P  P     . DA  A  1  124 ? 102.475 35.500 -20.377 1.00 111.80 ? 124  DA  I P     1 
ATOM   2513  O  OP1   . DA  A  1  124 ? 102.594 36.938 -20.030 1.00 111.27 ? 124  DA  I OP1   1 
ATOM   2514  O  OP2   . DA  A  1  124 ? 102.232 35.100 -21.785 1.00 111.33 ? 124  DA  I OP2   1 
ATOM   2515  O  "O5'" . DA  A  1  124 ? 103.775 34.742 -19.866 1.00 115.30 ? 124  DA  I "O5'" 1 
ATOM   2516  C  "C5'" . DA  A  1  124 ? 104.217 34.892 -18.521 1.00 120.77 ? 124  DA  I "C5'" 1 
ATOM   2517  C  "C4'" . DA  A  1  124 ? 105.614 34.342 -18.375 1.00 124.71 ? 124  DA  I "C4'" 1 
ATOM   2518  O  "O4'" . DA  A  1  124 ? 105.585 32.901 -18.229 1.00 125.16 ? 124  DA  I "O4'" 1 
ATOM   2519  C  "C3'" . DA  A  1  124 ? 106.503 34.631 -19.584 1.00 127.28 ? 124  DA  I "C3'" 1 
ATOM   2520  O  "O3'" . DA  A  1  124 ? 107.819 34.965 -19.151 1.00 130.84 ? 124  DA  I "O3'" 1 
ATOM   2521  C  "C2'" . DA  A  1  124 ? 106.521 33.308 -20.328 1.00 126.70 ? 124  DA  I "C2'" 1 
ATOM   2522  C  "C1'" . DA  A  1  124 ? 106.457 32.318 -19.182 1.00 125.89 ? 124  DA  I "C1'" 1 
ATOM   2523  N  N9    . DA  A  1  124 ? 105.932 30.998 -19.529 1.00 125.60 ? 124  DA  I N9    1 
ATOM   2524  C  C8    . DA  A  1  124 ? 105.119 30.656 -20.580 1.00 125.68 ? 124  DA  I C8    1 
ATOM   2525  N  N7    . DA  A  1  124 ? 104.830 29.378 -20.630 1.00 125.59 ? 124  DA  I N7    1 
ATOM   2526  C  C5    . DA  A  1  124 ? 105.494 28.844 -19.535 1.00 125.61 ? 124  DA  I C5    1 
ATOM   2527  C  C6    . DA  A  1  124 ? 105.589 27.534 -19.032 1.00 125.67 ? 124  DA  I C6    1 
ATOM   2528  N  N6    . DA  A  1  124 ? 104.986 26.483 -19.590 1.00 126.18 ? 124  DA  I N6    1 
ATOM   2529  N  N1    . DA  A  1  124 ? 106.334 27.339 -17.923 1.00 125.57 ? 124  DA  I N1    1 
ATOM   2530  C  C2    . DA  A  1  124 ? 106.937 28.395 -17.364 1.00 125.41 ? 124  DA  I C2    1 
ATOM   2531  N  N3    . DA  A  1  124 ? 106.923 29.671 -17.741 1.00 125.37 ? 124  DA  I N3    1 
ATOM   2532  C  C4    . DA  A  1  124 ? 106.175 29.830 -18.847 1.00 125.56 ? 124  DA  I C4    1 
ATOM   2533  P  P     . DG  A  1  125 ? 108.724 35.940 -20.046 1.00 133.57 ? 125  DG  I P     1 
ATOM   2534  O  OP1   . DG  A  1  125 ? 108.490 37.330 -19.573 1.00 132.88 ? 125  DG  I OP1   1 
ATOM   2535  O  OP2   . DG  A  1  125 ? 108.507 35.603 -21.477 1.00 133.22 ? 125  DG  I OP2   1 
ATOM   2536  O  "O5'" . DG  A  1  125 ? 110.201 35.509 -19.646 1.00 135.62 ? 125  DG  I "O5'" 1 
ATOM   2537  C  "C5'" . DG  A  1  125 ? 110.542 35.271 -18.282 1.00 139.04 ? 125  DG  I "C5'" 1 
ATOM   2538  C  "C4'" . DG  A  1  125 ? 111.473 34.086 -18.178 1.00 141.23 ? 125  DG  I "C4'" 1 
ATOM   2539  O  "O4'" . DG  A  1  125 ? 110.738 32.846 -18.339 1.00 141.47 ? 125  DG  I "O4'" 1 
ATOM   2540  C  "C3'" . DG  A  1  125 ? 112.573 34.071 -19.239 1.00 142.65 ? 125  DG  I "C3'" 1 
ATOM   2541  O  "O3'" . DG  A  1  125 ? 113.816 33.672 -18.659 1.00 144.35 ? 125  DG  I "O3'" 1 
ATOM   2542  C  "C2'" . DG  A  1  125 ? 112.091 33.029 -20.232 1.00 142.48 ? 125  DG  I "C2'" 1 
ATOM   2543  C  "C1'" . DG  A  1  125 ? 111.372 32.049 -19.328 1.00 142.31 ? 125  DG  I "C1'" 1 
ATOM   2544  N  N9    . DG  A  1  125 ? 110.352 31.249 -19.998 1.00 142.59 ? 125  DG  I N9    1 
ATOM   2545  C  C8    . DG  A  1  125 ? 109.451 31.676 -20.944 1.00 142.55 ? 125  DG  I C8    1 
ATOM   2546  N  N7    . DG  A  1  125 ? 108.671 30.722 -21.376 1.00 142.64 ? 125  DG  I N7    1 
ATOM   2547  C  C5    . DG  A  1  125 ? 109.078 29.598 -20.671 1.00 142.94 ? 125  DG  I C5    1 
ATOM   2548  C  C6    . DG  A  1  125 ? 108.600 28.259 -20.716 1.00 143.09 ? 125  DG  I C6    1 
ATOM   2549  O  O6    . DG  A  1  125 ? 107.692 27.786 -21.411 1.00 143.05 ? 125  DG  I O6    1 
ATOM   2550  N  N1    . DG  A  1  125 ? 109.295 27.438 -19.834 1.00 143.30 ? 125  DG  I N1    1 
ATOM   2551  C  C2    . DG  A  1  125 ? 110.319 27.846 -19.015 1.00 143.61 ? 125  DG  I C2    1 
ATOM   2552  N  N2    . DG  A  1  125 ? 110.863 26.900 -18.234 1.00 143.73 ? 125  DG  I N2    1 
ATOM   2553  N  N3    . DG  A  1  125 ? 110.776 29.089 -18.965 1.00 143.41 ? 125  DG  I N3    1 
ATOM   2554  C  C4    . DG  A  1  125 ? 110.113 29.906 -19.814 1.00 142.99 ? 125  DG  I C4    1 
ATOM   2555  P  P     . DA  A  1  126 ? 115.015 33.193 -19.611 1.00 145.56 ? 126  DA  I P     1 
ATOM   2556  O  OP1   . DA  A  1  126 ? 116.282 33.411 -18.865 1.00 145.83 ? 126  DA  I OP1   1 
ATOM   2557  O  OP2   . DA  A  1  126 ? 114.838 33.804 -20.953 1.00 145.11 ? 126  DA  I OP2   1 
ATOM   2558  O  "O5'" . DA  A  1  126 ? 114.776 31.624 -19.730 1.00 145.97 ? 126  DA  I "O5'" 1 
ATOM   2559  C  "C5'" . DA  A  1  126 ? 115.079 30.767 -18.635 1.00 146.88 ? 126  DA  I "C5'" 1 
ATOM   2560  C  "C4'" . DA  A  1  126 ? 115.716 29.494 -19.137 1.00 147.53 ? 126  DA  I "C4'" 1 
ATOM   2561  O  "O4'" . DA  A  1  126 ? 114.694 28.562 -19.567 1.00 147.81 ? 126  DA  I "O4'" 1 
ATOM   2562  C  "C3'" . DA  A  1  126 ? 116.647 29.698 -20.333 1.00 147.68 ? 126  DA  I "C3'" 1 
ATOM   2563  O  "O3'" . DA  A  1  126 ? 117.833 28.913 -20.174 1.00 147.45 ? 126  DA  I "O3'" 1 
ATOM   2564  C  "C2'" . DA  A  1  126 ? 115.809 29.234 -21.512 1.00 147.97 ? 126  DA  I "C2'" 1 
ATOM   2565  C  "C1'" . DA  A  1  126 ? 114.949 28.146 -20.897 1.00 148.17 ? 126  DA  I "C1'" 1 
ATOM   2566  N  N9    . DA  A  1  126 ? 113.660 27.946 -21.560 1.00 148.67 ? 126  DA  I N9    1 
ATOM   2567  C  C8    . DA  A  1  126 ? 112.934 28.855 -22.292 1.00 148.65 ? 126  DA  I C8    1 
ATOM   2568  N  N7    . DA  A  1  126 ? 111.813 28.373 -22.771 1.00 148.73 ? 126  DA  I N7    1 
ATOM   2569  C  C5    . DA  A  1  126 ? 111.797 27.058 -22.323 1.00 149.07 ? 126  DA  I C5    1 
ATOM   2570  C  C6    . DA  A  1  126 ? 110.871 26.009 -22.492 1.00 149.17 ? 126  DA  I C6    1 
ATOM   2571  N  N6    . DA  A  1  126 ? 109.739 26.123 -23.189 1.00 149.05 ? 126  DA  I N6    1 
ATOM   2572  N  N1    . DA  A  1  126 ? 111.155 24.822 -21.913 1.00 149.20 ? 126  DA  I N1    1 
ATOM   2573  C  C2    . DA  A  1  126 ? 112.293 24.706 -21.216 1.00 149.33 ? 126  DA  I C2    1 
ATOM   2574  N  N3    . DA  A  1  126 ? 113.240 25.614 -20.987 1.00 149.24 ? 126  DA  I N3    1 
ATOM   2575  C  C4    . DA  A  1  126 ? 112.928 26.783 -21.575 1.00 149.03 ? 126  DA  I C4    1 
ATOM   2576  P  P     . DA  A  1  127 ? 118.735 28.548 -21.454 1.00 147.06 ? 127  DA  I P     1 
ATOM   2577  O  OP1   . DA  A  1  127 ? 120.153 28.488 -21.017 1.00 147.26 ? 127  DA  I OP1   1 
ATOM   2578  O  OP2   . DA  A  1  127 ? 118.354 29.438 -22.580 1.00 146.92 ? 127  DA  I OP2   1 
ATOM   2579  O  "O5'" . DA  A  1  127 ? 118.261 27.067 -21.791 1.00 146.50 ? 127  DA  I "O5'" 1 
ATOM   2580  C  "C5'" . DA  A  1  127 ? 118.047 26.129 -20.738 1.00 145.18 ? 127  DA  I "C5'" 1 
ATOM   2581  C  "C4'" . DA  A  1  127 ? 117.854 24.742 -21.300 1.00 144.33 ? 127  DA  I "C4'" 1 
ATOM   2582  O  "O4'" . DA  A  1  127 ? 116.539 24.631 -21.897 1.00 144.35 ? 127  DA  I "O4'" 1 
ATOM   2583  C  "C3'" . DA  A  1  127 ? 118.858 24.362 -22.388 1.00 143.78 ? 127  DA  I "C3'" 1 
ATOM   2584  O  "O3'" . DA  A  1  127 ? 119.298 23.012 -22.202 1.00 142.26 ? 127  DA  I "O3'" 1 
ATOM   2585  C  "C2'" . DA  A  1  127 ? 118.066 24.530 -23.674 1.00 144.06 ? 127  DA  I "C2'" 1 
ATOM   2586  C  "C1'" . DA  A  1  127 ? 116.650 24.190 -23.242 1.00 144.46 ? 127  DA  I "C1'" 1 
ATOM   2587  N  N9    . DA  A  1  127 ? 115.605 24.855 -24.024 1.00 144.43 ? 127  DA  I N9    1 
ATOM   2588  C  C8    . DA  A  1  127 ? 115.627 26.124 -24.551 1.00 144.26 ? 127  DA  I C8    1 
ATOM   2589  N  N7    . DA  A  1  127 ? 114.543 26.440 -25.218 1.00 144.07 ? 127  DA  I N7    1 
ATOM   2590  C  C5    . DA  A  1  127 ? 113.750 25.303 -25.123 1.00 144.10 ? 127  DA  I C5    1 
ATOM   2591  C  C6    . DA  A  1  127 ? 112.471 24.998 -25.622 1.00 143.75 ? 127  DA  I C6    1 
ATOM   2592  N  N6    . DA  A  1  127 ? 111.737 25.845 -26.346 1.00 143.45 ? 127  DA  I N6    1 
ATOM   2593  N  N1    . DA  A  1  127 ? 111.965 23.776 -25.348 1.00 143.62 ? 127  DA  I N1    1 
ATOM   2594  C  C2    . DA  A  1  127 ? 112.702 22.926 -24.622 1.00 143.86 ? 127  DA  I C2    1 
ATOM   2595  N  N3    . DA  A  1  127 ? 113.916 23.096 -24.099 1.00 144.16 ? 127  DA  I N3    1 
ATOM   2596  C  C4    . DA  A  1  127 ? 114.391 24.320 -24.388 1.00 144.26 ? 127  DA  I C4    1 
ATOM   2597  P  P     . DT  A  1  128 ? 119.963 22.211 -23.425 1.00 140.61 ? 128  DT  I P     1 
ATOM   2598  O  OP1   . DT  A  1  128 ? 120.805 21.132 -22.848 1.00 140.41 ? 128  DT  I OP1   1 
ATOM   2599  O  OP2   . DT  A  1  128 ? 120.568 23.189 -24.368 1.00 140.07 ? 128  DT  I OP2   1 
ATOM   2600  O  "O5'" . DT  A  1  128 ? 118.703 21.532 -24.121 1.00 139.21 ? 128  DT  I "O5'" 1 
ATOM   2601  C  "C5'" . DT  A  1  128 ? 117.720 20.869 -23.328 1.00 136.27 ? 128  DT  I "C5'" 1 
ATOM   2602  C  "C4'" . DT  A  1  128 ? 116.818 20.026 -24.197 1.00 133.80 ? 128  DT  I "C4'" 1 
ATOM   2603  O  "O4'" . DT  A  1  128 ? 115.821 20.847 -24.854 1.00 133.50 ? 128  DT  I "O4'" 1 
ATOM   2604  C  "C3'" . DT  A  1  128 ? 117.537 19.255 -25.303 1.00 132.05 ? 128  DT  I "C3'" 1 
ATOM   2605  O  "O3'" . DT  A  1  128 ? 117.007 17.932 -25.381 1.00 129.45 ? 128  DT  I "O3'" 1 
ATOM   2606  C  "C2'" . DT  A  1  128 ? 117.208 20.046 -26.557 1.00 132.16 ? 128  DT  I "C2'" 1 
ATOM   2607  C  "C1'" . DT  A  1  128 ? 115.817 20.568 -26.245 1.00 132.78 ? 128  DT  I "C1'" 1 
ATOM   2608  N  N1    . DT  A  1  128 ? 115.432 21.803 -26.960 1.00 132.47 ? 128  DT  I N1    1 
ATOM   2609  C  C2    . DT  A  1  128 ? 114.144 21.897 -27.444 1.00 132.21 ? 128  DT  I C2    1 
ATOM   2610  O  O2    . DT  A  1  128 ? 113.313 21.009 -27.315 1.00 131.91 ? 128  DT  I O2    1 
ATOM   2611  N  N3    . DT  A  1  128 ? 113.860 23.076 -28.089 1.00 131.75 ? 128  DT  I N3    1 
ATOM   2612  C  C4    . DT  A  1  128 ? 114.715 24.143 -28.296 1.00 131.46 ? 128  DT  I C4    1 
ATOM   2613  O  O4    . DT  A  1  128 ? 114.317 25.141 -28.891 1.00 131.28 ? 128  DT  I O4    1 
ATOM   2614  C  C5    . DT  A  1  128 ? 116.050 23.975 -27.768 1.00 131.51 ? 128  DT  I C5    1 
ATOM   2615  C  C7    . DT  A  1  128 ? 117.045 25.076 -27.950 1.00 131.20 ? 128  DT  I C7    1 
ATOM   2616  C  C6    . DT  A  1  128 ? 116.337 22.830 -27.134 1.00 131.90 ? 128  DT  I C6    1 
ATOM   2617  P  P     . DC  A  1  129 ? 117.492 16.946 -26.550 1.00 127.41 ? 129  DC  I P     1 
ATOM   2618  O  OP1   . DC  A  1  129 ? 117.681 15.592 -25.968 1.00 127.23 ? 129  DC  I OP1   1 
ATOM   2619  O  OP2   . DC  A  1  129 ? 118.615 17.603 -27.269 1.00 127.09 ? 129  DC  I OP2   1 
ATOM   2620  O  "O5'" . DC  A  1  129 ? 116.229 16.899 -27.517 1.00 125.28 ? 129  DC  I "O5'" 1 
ATOM   2621  C  "C5'" . DC  A  1  129 ? 114.924 16.667 -26.990 1.00 121.04 ? 129  DC  I "C5'" 1 
ATOM   2622  C  "C4'" . DC  A  1  129 ? 113.897 16.694 -28.097 1.00 117.73 ? 129  DC  I "C4'" 1 
ATOM   2623  O  "O4'" . DC  A  1  129 ? 113.702 18.048 -28.572 1.00 117.08 ? 129  DC  I "O4'" 1 
ATOM   2624  C  "C3'" . DC  A  1  129 ? 114.274 15.863 -29.323 1.00 115.17 ? 129  DC  I "C3'" 1 
ATOM   2625  O  "O3'" . DC  A  1  129 ? 113.125 15.183 -29.822 1.00 111.00 ? 129  DC  I "O3'" 1 
ATOM   2626  C  "C2'" . DC  A  1  129 ? 114.753 16.901 -30.322 1.00 115.52 ? 129  DC  I "C2'" 1 
ATOM   2627  C  "C1'" . DC  A  1  129 ? 113.886 18.097 -29.978 1.00 116.55 ? 129  DC  I "C1'" 1 
ATOM   2628  N  N1    . DC  A  1  129 ? 114.473 19.403 -30.312 1.00 116.67 ? 129  DC  I N1    1 
ATOM   2629  C  C2    . DC  A  1  129 ? 113.712 20.307 -31.058 1.00 116.93 ? 129  DC  I C2    1 
ATOM   2630  O  O2    . DC  A  1  129 ? 112.574 19.974 -31.423 1.00 116.22 ? 129  DC  I O2    1 
ATOM   2631  N  N3    . DC  A  1  129 ? 114.234 21.518 -31.363 1.00 117.35 ? 129  DC  I N3    1 
ATOM   2632  C  C4    . DC  A  1  129 ? 115.464 21.837 -30.953 1.00 117.56 ? 129  DC  I C4    1 
ATOM   2633  N  N4    . DC  A  1  129 ? 115.935 23.046 -31.271 1.00 117.56 ? 129  DC  I N4    1 
ATOM   2634  C  C5    . DC  A  1  129 ? 116.265 20.931 -30.197 1.00 117.45 ? 129  DC  I C5    1 
ATOM   2635  C  C6    . DC  A  1  129 ? 115.734 19.736 -29.902 1.00 117.23 ? 129  DC  I C6    1 
ATOM   2636  P  P     . DT  A  1  130 ? 113.296 14.078 -30.971 1.00 108.47 ? 130  DT  I P     1 
ATOM   2637  O  OP1   . DT  A  1  130 ? 112.632 12.825 -30.531 1.00 108.08 ? 130  DT  I OP1   1 
ATOM   2638  O  OP2   . DT  A  1  130 ? 114.729 14.055 -31.366 1.00 108.13 ? 130  DT  I OP2   1 
ATOM   2639  O  "O5'" . DT  A  1  130 ? 112.467 14.683 -32.185 1.00 105.96 ? 130  DT  I "O5'" 1 
ATOM   2640  C  "C5'" . DT  A  1  130 ? 111.079 14.968 -32.047 1.00 99.79  ? 130  DT  I "C5'" 1 
ATOM   2641  C  "C4'" . DT  A  1  130 ? 110.543 15.556 -33.330 1.00 95.31  ? 130  DT  I "C4'" 1 
ATOM   2642  O  "O4'" . DT  A  1  130 ? 111.075 16.889 -33.517 1.00 94.79  ? 130  DT  I "O4'" 1 
ATOM   2643  C  "C3'" . DT  A  1  130 ? 110.925 14.766 -34.582 1.00 92.55  ? 130  DT  I "C3'" 1 
ATOM   2644  O  "O3'" . DT  A  1  130 ? 109.837 14.776 -35.501 1.00 87.70  ? 130  DT  I "O3'" 1 
ATOM   2645  C  "C2'" . DT  A  1  130 ? 112.076 15.568 -35.159 1.00 93.52  ? 130  DT  I "C2'" 1 
ATOM   2646  C  "C1'" . DT  A  1  130 ? 111.667 16.982 -34.800 1.00 94.57  ? 130  DT  I "C1'" 1 
ATOM   2647  N  N1    . DT  A  1  130 ? 112.770 17.955 -34.729 1.00 95.01  ? 130  DT  I N1    1 
ATOM   2648  C  C2    . DT  A  1  130 ? 112.633 19.129 -35.432 1.00 95.50  ? 130  DT  I C2    1 
ATOM   2649  O  O2    . DT  A  1  130 ? 111.637 19.403 -36.076 1.00 95.78  ? 130  DT  I O2    1 
ATOM   2650  N  N3    . DT  A  1  130 ? 113.707 19.976 -35.350 1.00 96.14  ? 130  DT  I N3    1 
ATOM   2651  C  C4    . DT  A  1  130 ? 114.875 19.775 -34.643 1.00 96.27  ? 130  DT  I C4    1 
ATOM   2652  O  O4    . DT  A  1  130 ? 115.761 20.624 -34.674 1.00 96.39  ? 130  DT  I O4    1 
ATOM   2653  C  C5    . DT  A  1  130 ? 114.943 18.530 -33.909 1.00 96.11  ? 130  DT  I C5    1 
ATOM   2654  C  C7    . DT  A  1  130 ? 116.162 18.233 -33.096 1.00 96.63  ? 130  DT  I C7    1 
ATOM   2655  C  C6    . DT  A  1  130 ? 113.902 17.692 -33.990 1.00 95.58  ? 130  DT  I C6    1 
ATOM   2656  P  P     . DG  A  1  131 ? 108.963 13.450 -35.716 1.00 84.17  ? 131  DG  I P     1 
ATOM   2657  O  OP1   . DG  A  1  131 ? 108.417 13.031 -34.400 1.00 82.80  ? 131  DG  I OP1   1 
ATOM   2658  O  OP2   . DG  A  1  131 ? 109.769 12.495 -36.516 1.00 84.58  ? 131  DG  I OP2   1 
ATOM   2659  O  "O5'" . DG  A  1  131 ? 107.761 13.956 -36.627 1.00 82.30  ? 131  DG  I "O5'" 1 
ATOM   2660  C  "C5'" . DG  A  1  131 ? 106.871 14.971 -36.168 1.00 75.61  ? 131  DG  I "C5'" 1 
ATOM   2661  C  "C4'" . DG  A  1  131 ? 106.656 16.006 -37.248 1.00 72.55  ? 131  DG  I "C4'" 1 
ATOM   2662  O  "O4'" . DG  A  1  131 ? 107.825 16.848 -37.379 1.00 70.14  ? 131  DG  I "O4'" 1 
ATOM   2663  C  "C3'" . DG  A  1  131 ? 106.387 15.434 -38.639 1.00 70.76  ? 131  DG  I "C3'" 1 
ATOM   2664  O  "O3'" . DG  A  1  131 ? 105.397 16.225 -39.296 1.00 68.24  ? 131  DG  I "O3'" 1 
ATOM   2665  C  "C2'" . DG  A  1  131 ? 107.733 15.543 -39.335 1.00 69.44  ? 131  DG  I "C2'" 1 
ATOM   2666  C  "C1'" . DG  A  1  131 ? 108.346 16.782 -38.702 1.00 70.53  ? 131  DG  I "C1'" 1 
ATOM   2667  N  N9    . DG  A  1  131 ? 109.802 16.743 -38.592 1.00 71.46  ? 131  DG  I N9    1 
ATOM   2668  C  C8    . DG  A  1  131 ? 110.584 15.643 -38.332 1.00 71.18  ? 131  DG  I C8    1 
ATOM   2669  N  N7    . DG  A  1  131 ? 111.854 15.929 -38.237 1.00 71.06  ? 131  DG  I N7    1 
ATOM   2670  C  C5    . DG  A  1  131 ? 111.918 17.297 -38.463 1.00 70.96  ? 131  DG  I C5    1 
ATOM   2671  C  C6    . DG  A  1  131 ? 113.031 18.175 -38.480 1.00 70.98  ? 131  DG  I C6    1 
ATOM   2672  O  O6    . DG  A  1  131 ? 114.221 17.914 -38.289 1.00 72.26  ? 131  DG  I O6    1 
ATOM   2673  N  N1    . DG  A  1  131 ? 112.647 19.482 -38.749 1.00 70.28  ? 131  DG  I N1    1 
ATOM   2674  C  C2    . DG  A  1  131 ? 111.360 19.896 -38.973 1.00 70.80  ? 131  DG  I C2    1 
ATOM   2675  N  N2    . DG  A  1  131 ? 111.192 21.206 -39.217 1.00 70.44  ? 131  DG  I N2    1 
ATOM   2676  N  N3    . DG  A  1  131 ? 110.313 19.088 -38.959 1.00 70.86  ? 131  DG  I N3    1 
ATOM   2677  C  C4    . DG  A  1  131 ? 110.662 17.812 -38.698 1.00 70.90  ? 131  DG  I C4    1 
ATOM   2678  P  P     . DC  A  1  132 ? 104.865 15.796 -40.745 1.00 68.67  ? 132  DC  I P     1 
ATOM   2679  O  OP1   . DC  A  1  132 ? 103.418 16.141 -40.817 1.00 68.19  ? 132  DC  I OP1   1 
ATOM   2680  O  OP2   . DC  A  1  132 ? 105.296 14.394 -40.996 1.00 69.24  ? 132  DC  I OP2   1 
ATOM   2681  O  "O5'" . DC  A  1  132 ? 105.676 16.758 -41.721 1.00 66.62  ? 132  DC  I "O5'" 1 
ATOM   2682  C  "C5'" . DC  A  1  132 ? 105.687 18.163 -41.489 1.00 67.93  ? 132  DC  I "C5'" 1 
ATOM   2683  C  "C4'" . DC  A  1  132 ? 106.697 18.846 -42.381 1.00 69.00  ? 132  DC  I "C4'" 1 
ATOM   2684  O  "O4'" . DC  A  1  132 ? 108.048 18.620 -41.914 1.00 68.69  ? 132  DC  I "O4'" 1 
ATOM   2685  C  "C3'" . DC  A  1  132 ? 106.681 18.428 -43.853 1.00 69.46  ? 132  DC  I "C3'" 1 
ATOM   2686  O  "O3'" . DC  A  1  132 ? 106.904 19.586 -44.654 1.00 71.26  ? 132  DC  I "O3'" 1 
ATOM   2687  C  "C2'" . DC  A  1  132 ? 107.901 17.531 -43.964 1.00 69.39  ? 132  DC  I "C2'" 1 
ATOM   2688  C  "C1'" . DC  A  1  132 ? 108.850 18.244 -43.020 1.00 69.03  ? 132  DC  I "C1'" 1 
ATOM   2689  N  N1    . DC  A  1  132 ? 109.993 17.467 -42.518 1.00 68.48  ? 132  DC  I N1    1 
ATOM   2690  C  C2    . DC  A  1  132 ? 111.185 18.144 -42.244 1.00 68.19  ? 132  DC  I C2    1 
ATOM   2691  O  O2    . DC  A  1  132 ? 111.238 19.364 -42.445 1.00 67.51  ? 132  DC  I O2    1 
ATOM   2692  N  N3    . DC  A  1  132 ? 112.247 17.454 -41.770 1.00 68.02  ? 132  DC  I N3    1 
ATOM   2693  C  C4    . DC  A  1  132 ? 112.151 16.137 -41.571 1.00 68.33  ? 132  DC  I C4    1 
ATOM   2694  N  N4    . DC  A  1  132 ? 113.225 15.498 -41.093 1.00 67.11  ? 132  DC  I N4    1 
ATOM   2695  C  C5    . DC  A  1  132 ? 110.950 15.417 -41.851 1.00 67.74  ? 132  DC  I C5    1 
ATOM   2696  C  C6    . DC  A  1  132 ? 109.905 16.116 -42.318 1.00 68.63  ? 132  DC  I C6    1 
ATOM   2697  P  P     . DA  A  1  133 ? 105.790 20.059 -45.707 1.00 73.58  ? 133  DA  I P     1 
ATOM   2698  O  OP1   . DA  A  1  133 ? 104.565 20.353 -44.921 1.00 73.20  ? 133  DA  I OP1   1 
ATOM   2699  O  OP2   . DA  A  1  133 ? 105.728 19.085 -46.830 1.00 72.87  ? 133  DA  I OP2   1 
ATOM   2700  O  "O5'" . DA  A  1  133 ? 106.385 21.426 -46.262 1.00 74.08  ? 133  DA  I "O5'" 1 
ATOM   2701  C  "C5'" . DA  A  1  133 ? 106.615 22.526 -45.385 1.00 77.20  ? 133  DA  I "C5'" 1 
ATOM   2702  C  "C4'" . DA  A  1  133 ? 107.918 23.209 -45.731 1.00 80.04  ? 133  DA  I "C4'" 1 
ATOM   2703  O  "O4'" . DA  A  1  133 ? 109.031 22.359 -45.367 1.00 79.54  ? 133  DA  I "O4'" 1 
ATOM   2704  C  "C3'" . DA  A  1  133 ? 108.094 23.525 -47.214 1.00 82.30  ? 133  DA  I "C3'" 1 
ATOM   2705  O  "O3'" . DA  A  1  133 ? 108.785 24.772 -47.370 1.00 86.53  ? 133  DA  I "O3'" 1 
ATOM   2706  C  "C2'" . DA  A  1  133 ? 108.929 22.360 -47.718 1.00 80.55  ? 133  DA  I "C2'" 1 
ATOM   2707  C  "C1'" . DA  A  1  133 ? 109.799 22.022 -46.516 1.00 78.84  ? 133  DA  I "C1'" 1 
ATOM   2708  N  N9    . DA  A  1  133 ? 110.144 20.606 -46.405 1.00 77.57  ? 133  DA  I N9    1 
ATOM   2709  C  C8    . DA  A  1  133 ? 109.360 19.526 -46.728 1.00 77.19  ? 133  DA  I C8    1 
ATOM   2710  N  N7    . DA  A  1  133 ? 109.919 18.370 -46.470 1.00 76.04  ? 133  DA  I N7    1 
ATOM   2711  C  C5    . DA  A  1  133 ? 111.160 18.709 -45.948 1.00 76.20  ? 133  DA  I C5    1 
ATOM   2712  C  C6    . DA  A  1  133 ? 112.227 17.931 -45.465 1.00 74.63  ? 133  DA  I C6    1 
ATOM   2713  N  N6    . DA  A  1  133 ? 112.204 16.598 -45.412 1.00 73.48  ? 133  DA  I N6    1 
ATOM   2714  N  N1    . DA  A  1  133 ? 113.328 18.579 -45.027 1.00 73.51  ? 133  DA  I N1    1 
ATOM   2715  C  C2    . DA  A  1  133 ? 113.342 19.918 -45.070 1.00 75.65  ? 133  DA  I C2    1 
ATOM   2716  N  N3    . DA  A  1  133 ? 112.399 20.760 -45.490 1.00 76.08  ? 133  DA  I N3    1 
ATOM   2717  C  C4    . DA  A  1  133 ? 111.320 20.084 -45.921 1.00 76.62  ? 133  DA  I C4    1 
ATOM   2718  P  P     . DG  A  1  134 ? 108.344 25.790 -48.535 1.00 89.90  ? 134  DG  I P     1 
ATOM   2719  O  OP1   . DG  A  1  134 ? 108.388 27.174 -47.995 1.00 90.71  ? 134  DG  I OP1   1 
ATOM   2720  O  OP2   . DG  A  1  134 ? 107.088 25.269 -49.131 1.00 90.21  ? 134  DG  I OP2   1 
ATOM   2721  O  "O5'" . DG  A  1  134 ? 109.487 25.636 -49.629 1.00 91.56  ? 134  DG  I "O5'" 1 
ATOM   2722  C  "C5'" . DG  A  1  134 ? 110.104 24.376 -49.825 1.00 93.72  ? 134  DG  I "C5'" 1 
ATOM   2723  C  "C4'" . DG  A  1  134 ? 111.604 24.505 -49.729 1.00 94.49  ? 134  DG  I "C4'" 1 
ATOM   2724  O  "O4'" . DG  A  1  134 ? 112.131 23.316 -49.105 1.00 93.82  ? 134  DG  I "O4'" 1 
ATOM   2725  C  "C3'" . DG  A  1  134 ? 112.300 24.618 -51.078 1.00 95.41  ? 134  DG  I "C3'" 1 
ATOM   2726  O  "O3'" . DG  A  1  134 ? 113.481 25.416 -50.955 1.00 97.84  ? 134  DG  I "O3'" 1 
ATOM   2727  C  "C2'" . DG  A  1  134 ? 112.618 23.172 -51.416 1.00 94.62  ? 134  DG  I "C2'" 1 
ATOM   2728  C  "C1'" . DG  A  1  134 ? 112.836 22.529 -50.049 1.00 93.37  ? 134  DG  I "C1'" 1 
ATOM   2729  N  N9    . DG  A  1  134 ? 112.326 21.166 -49.932 1.00 92.01  ? 134  DG  I N9    1 
ATOM   2730  C  C8    . DG  A  1  134 ? 111.115 20.691 -50.378 1.00 91.24  ? 134  DG  I C8    1 
ATOM   2731  N  N7    . DG  A  1  134 ? 110.931 19.427 -50.112 1.00 90.18  ? 134  DG  I N7    1 
ATOM   2732  C  C5    . DG  A  1  134 ? 112.092 19.043 -49.453 1.00 90.61  ? 134  DG  I C5    1 
ATOM   2733  C  C6    . DG  A  1  134 ? 112.474 17.786 -48.920 1.00 89.51  ? 134  DG  I C6    1 
ATOM   2734  O  O6    . DG  A  1  134 ? 111.842 16.724 -48.918 1.00 88.04  ? 134  DG  I O6    1 
ATOM   2735  N  N1    . DG  A  1  134 ? 113.738 17.840 -48.341 1.00 90.16  ? 134  DG  I N1    1 
ATOM   2736  C  C2    . DG  A  1  134 ? 114.533 18.958 -48.279 1.00 90.59  ? 134  DG  I C2    1 
ATOM   2737  N  N2    . DG  A  1  134 ? 115.721 18.809 -47.678 1.00 90.70  ? 134  DG  I N2    1 
ATOM   2738  N  N3    . DG  A  1  134 ? 114.187 20.136 -48.769 1.00 90.63  ? 134  DG  I N3    1 
ATOM   2739  C  C4    . DG  A  1  134 ? 112.964 20.106 -49.338 1.00 91.13  ? 134  DG  I C4    1 
ATOM   2740  P  P     . DG  A  1  135 ? 114.386 25.702 -52.249 1.00 99.58  ? 135  DG  I P     1 
ATOM   2741  O  OP1   . DG  A  1  135 ? 115.160 26.944 -51.987 1.00 99.36  ? 135  DG  I OP1   1 
ATOM   2742  O  OP2   . DG  A  1  135 ? 113.535 25.610 -53.463 1.00 99.50  ? 135  DG  I OP2   1 
ATOM   2743  O  "O5'" . DG  A  1  135 ? 115.400 24.476 -52.263 1.00 100.32 ? 135  DG  I "O5'" 1 
ATOM   2744  C  "C5'" . DG  A  1  135 ? 116.528 24.458 -51.395 1.00 101.17 ? 135  DG  I "C5'" 1 
ATOM   2745  C  "C4'" . DG  A  1  135 ? 117.486 23.371 -51.818 1.00 101.82 ? 135  DG  I "C4'" 1 
ATOM   2746  O  "O4'" . DG  A  1  135 ? 116.999 22.079 -51.375 1.00 101.13 ? 135  DG  I "O4'" 1 
ATOM   2747  C  "C3'" . DG  A  1  135 ? 117.660 23.270 -53.334 1.00 102.62 ? 135  DG  I "C3'" 1 
ATOM   2748  O  "O3'" . DG  A  1  135 ? 119.030 23.048 -53.673 1.00 105.20 ? 135  DG  I "O3'" 1 
ATOM   2749  C  "C2'" . DG  A  1  135 ? 116.818 22.063 -53.707 1.00 101.43 ? 135  DG  I "C2'" 1 
ATOM   2750  C  "C1'" . DG  A  1  135 ? 116.949 21.186 -52.476 1.00 100.20 ? 135  DG  I "C1'" 1 
ATOM   2751  N  N9    . DG  A  1  135 ? 115.820 20.284 -52.278 1.00 98.32  ? 135  DG  I N9    1 
ATOM   2752  C  C8    . DG  A  1  135 ? 114.488 20.584 -52.425 1.00 97.63  ? 135  DG  I C8    1 
ATOM   2753  N  N7    . DG  A  1  135 ? 113.706 19.560 -52.220 1.00 97.14  ? 135  DG  I N7    1 
ATOM   2754  C  C5    . DG  A  1  135 ? 114.573 18.522 -51.910 1.00 96.87  ? 135  DG  I C5    1 
ATOM   2755  C  C6    . DG  A  1  135 ? 114.305 17.163 -51.598 1.00 96.19  ? 135  DG  I C6    1 
ATOM   2756  O  O6    . DG  A  1  135 ? 113.213 16.586 -51.538 1.00 95.20  ? 135  DG  I O6    1 
ATOM   2757  N  N1    . DG  A  1  135 ? 115.476 16.458 -51.344 1.00 96.34  ? 135  DG  I N1    1 
ATOM   2758  C  C2    . DG  A  1  135 ? 116.742 16.986 -51.388 1.00 96.96  ? 135  DG  I C2    1 
ATOM   2759  N  N2    . DG  A  1  135 ? 117.743 16.141 -51.107 1.00 96.75  ? 135  DG  I N2    1 
ATOM   2760  N  N3    . DG  A  1  135 ? 117.006 18.250 -51.683 1.00 97.25  ? 135  DG  I N3    1 
ATOM   2761  C  C4    . DG  A  1  135 ? 115.882 18.955 -51.931 1.00 97.49  ? 135  DG  I C4    1 
ATOM   2762  P  P     . DT  A  1  136 ? 119.419 22.661 -55.181 1.00 107.11 ? 136  DT  I P     1 
ATOM   2763  O  OP1   . DT  A  1  136 ? 120.741 23.258 -55.498 1.00 106.98 ? 136  DT  I OP1   1 
ATOM   2764  O  OP2   . DT  A  1  136 ? 118.250 22.964 -56.048 1.00 107.02 ? 136  DT  I OP2   1 
ATOM   2765  O  "O5'" . DT  A  1  136 ? 119.586 21.081 -55.116 1.00 106.77 ? 136  DT  I "O5'" 1 
ATOM   2766  C  "C5'" . DT  A  1  136 ? 120.612 20.497 -54.323 1.00 106.97 ? 136  DT  I "C5'" 1 
ATOM   2767  C  "C4'" . DT  A  1  136 ? 120.948 19.125 -54.851 1.00 107.29 ? 136  DT  I "C4'" 1 
ATOM   2768  O  "O4'" . DT  A  1  136 ? 119.903 18.193 -54.477 1.00 106.60 ? 136  DT  I "O4'" 1 
ATOM   2769  C  "C3'" . DT  A  1  136 ? 121.043 19.078 -56.376 1.00 107.74 ? 136  DT  I "C3'" 1 
ATOM   2770  O  "O3'" . DT  A  1  136 ? 122.140 18.261 -56.794 1.00 108.85 ? 136  DT  I "O3'" 1 
ATOM   2771  C  "C2'" . DT  A  1  136 ? 119.710 18.485 -56.795 1.00 107.46 ? 136  DT  I "C2'" 1 
ATOM   2772  C  "C1'" . DT  A  1  136 ? 119.363 17.570 -55.633 1.00 106.47 ? 136  DT  I "C1'" 1 
ATOM   2773  N  N1    . DT  A  1  136 ? 117.909 17.405 -55.428 1.00 105.90 ? 136  DT  I N1    1 
ATOM   2774  C  C2    . DT  A  1  136 ? 117.419 16.150 -55.134 1.00 105.14 ? 136  DT  I C2    1 
ATOM   2775  O  O2    . DT  A  1  136 ? 118.128 15.166 -55.014 1.00 105.27 ? 136  DT  I O2    1 
ATOM   2776  N  N3    . DT  A  1  136 ? 116.056 16.090 -54.985 1.00 104.48 ? 136  DT  I N3    1 
ATOM   2777  C  C4    . DT  A  1  136 ? 115.157 17.133 -55.097 1.00 104.60 ? 136  DT  I C4    1 
ATOM   2778  O  O4    . DT  A  1  136 ? 113.958 16.923 -54.944 1.00 104.24 ? 136  DT  I O4    1 
ATOM   2779  C  C5    . DT  A  1  136 ? 115.741 18.421 -55.399 1.00 104.74 ? 136  DT  I C5    1 
ATOM   2780  C  C7    . DT  A  1  136 ? 114.847 19.612 -55.537 1.00 104.28 ? 136  DT  I C7    1 
ATOM   2781  C  C6    . DT  A  1  136 ? 117.068 18.491 -55.544 1.00 105.34 ? 136  DT  I C6    1 
ATOM   2782  P  P     . DG  A  1  137 ? 122.096 17.545 -58.231 1.00 109.32 ? 137  DG  I P     1 
ATOM   2783  O  OP1   . DG  A  1  137 ? 123.473 17.117 -58.589 1.00 109.82 ? 137  DG  I OP1   1 
ATOM   2784  O  OP2   . DG  A  1  137 ? 121.330 18.405 -59.171 1.00 108.99 ? 137  DG  I OP2   1 
ATOM   2785  O  "O5'" . DG  A  1  137 ? 121.243 16.239 -57.931 1.00 108.58 ? 137  DG  I "O5'" 1 
ATOM   2786  C  "C5'" . DG  A  1  137 ? 121.771 15.212 -57.097 1.00 106.98 ? 137  DG  I "C5'" 1 
ATOM   2787  C  "C4'" . DG  A  1  137 ? 121.606 13.878 -57.780 1.00 105.79 ? 137  DG  I "C4'" 1 
ATOM   2788  O  "O4'" . DG  A  1  137 ? 120.226 13.461 -57.672 1.00 105.06 ? 137  DG  I "O4'" 1 
ATOM   2789  C  "C3'" . DG  A  1  137 ? 121.913 13.956 -59.273 1.00 105.22 ? 137  DG  I "C3'" 1 
ATOM   2790  O  "O3'" . DG  A  1  137 ? 122.553 12.761 -59.721 1.00 104.86 ? 137  DG  I "O3'" 1 
ATOM   2791  C  "C2'" . DG  A  1  137 ? 120.549 14.162 -59.908 1.00 104.53 ? 137  DG  I "C2'" 1 
ATOM   2792  C  "C1'" . DG  A  1  137 ? 119.589 13.476 -58.943 1.00 103.74 ? 137  DG  I "C1'" 1 
ATOM   2793  N  N9    . DG  A  1  137 ? 118.320 14.180 -58.781 1.00 101.87 ? 137  DG  I N9    1 
ATOM   2794  C  C8    . DG  A  1  137 ? 118.082 15.517 -58.995 1.00 101.14 ? 137  DG  I C8    1 
ATOM   2795  N  N7    . DG  A  1  137 ? 116.850 15.866 -58.742 1.00 100.00 ? 137  DG  I N7    1 
ATOM   2796  C  C5    . DG  A  1  137 ? 116.236 14.688 -58.341 1.00 99.68  ? 137  DG  I C5    1 
ATOM   2797  C  C6    . DG  A  1  137 ? 114.904 14.443 -57.936 1.00 98.66  ? 137  DG  I C6    1 
ATOM   2798  O  O6    . DG  A  1  137 ? 113.972 15.245 -57.841 1.00 98.63  ? 137  DG  I O6    1 
ATOM   2799  N  N1    . DG  A  1  137 ? 114.702 13.105 -57.620 1.00 98.49  ? 137  DG  I N1    1 
ATOM   2800  C  C2    . DG  A  1  137 ? 115.662 12.124 -57.683 1.00 99.05  ? 137  DG  I C2    1 
ATOM   2801  N  N2    . DG  A  1  137 ? 115.273 10.888 -57.338 1.00 98.87  ? 137  DG  I N2    1 
ATOM   2802  N  N3    . DG  A  1  137 ? 116.911 12.340 -58.057 1.00 99.73  ? 137  DG  I N3    1 
ATOM   2803  C  C4    . DG  A  1  137 ? 117.127 13.636 -58.369 1.00 100.53 ? 137  DG  I C4    1 
ATOM   2804  P  P     . DG  A  1  138 ? 122.601 12.423 -61.290 1.00 104.16 ? 138  DG  I P     1 
ATOM   2805  O  OP1   . DG  A  1  138 ? 123.811 11.604 -61.549 1.00 104.20 ? 138  DG  I OP1   1 
ATOM   2806  O  OP2   . DG  A  1  138 ? 122.378 13.675 -62.061 1.00 103.19 ? 138  DG  I OP2   1 
ATOM   2807  O  "O5'" . DG  A  1  138 ? 121.330 11.491 -61.475 1.00 102.57 ? 138  DG  I "O5'" 1 
ATOM   2808  C  "C5'" . DG  A  1  138 ? 121.122 10.385 -60.606 1.00 98.96  ? 138  DG  I "C5'" 1 
ATOM   2809  C  "C4'" . DG  A  1  138 ? 119.921 9.597  -61.062 1.00 96.71  ? 138  DG  I "C4'" 1 
ATOM   2810  O  "O4'" . DG  A  1  138 ? 118.716 10.355 -60.790 1.00 94.50  ? 138  DG  I "O4'" 1 
ATOM   2811  C  "C3'" . DG  A  1  138 ? 119.923 9.322  -62.565 1.00 95.67  ? 138  DG  I "C3'" 1 
ATOM   2812  O  "O3'" . DG  A  1  138 ? 119.426 8.008  -62.814 1.00 96.15  ? 138  DG  I "O3'" 1 
ATOM   2813  C  "C2'" . DG  A  1  138 ? 118.986 10.382 -63.116 1.00 94.36  ? 138  DG  I "C2'" 1 
ATOM   2814  C  "C1'" . DG  A  1  138 ? 117.982 10.540 -61.989 1.00 92.85  ? 138  DG  I "C1'" 1 
ATOM   2815  N  N9    . DG  A  1  138 ? 117.341 11.850 -61.927 1.00 89.94  ? 138  DG  I N9    1 
ATOM   2816  C  C8    . DG  A  1  138 ? 117.898 13.067 -62.240 1.00 88.32  ? 138  DG  I C8    1 
ATOM   2817  N  N7    . DG  A  1  138 ? 117.068 14.063 -62.090 1.00 86.97  ? 138  DG  I N7    1 
ATOM   2818  C  C5    . DG  A  1  138 ? 115.893 13.468 -61.651 1.00 86.62  ? 138  DG  I C5    1 
ATOM   2819  C  C6    . DG  A  1  138 ? 114.637 14.041 -61.319 1.00 85.75  ? 138  DG  I C6    1 
ATOM   2820  O  O6    . DG  A  1  138 ? 114.300 15.229 -61.348 1.00 85.32  ? 138  DG  I O6    1 
ATOM   2821  N  N1    . DG  A  1  138 ? 113.725 13.072 -60.919 1.00 84.98  ? 138  DG  I N1    1 
ATOM   2822  C  C2    . DG  A  1  138 ? 113.982 11.727 -60.847 1.00 85.49  ? 138  DG  I C2    1 
ATOM   2823  N  N2    . DG  A  1  138 ? 112.970 10.953 -60.441 1.00 85.37  ? 138  DG  I N2    1 
ATOM   2824  N  N3    . DG  A  1  138 ? 115.144 11.180 -61.153 1.00 86.19  ? 138  DG  I N3    1 
ATOM   2825  C  C4    . DG  A  1  138 ? 116.047 12.102 -61.544 1.00 87.70  ? 138  DG  I C4    1 
ATOM   2826  P  P     . DA  A  1  139 ? 119.189 7.516  -64.323 1.00 95.99  ? 139  DA  I P     1 
ATOM   2827  O  OP1   . DA  A  1  139 ? 119.968 6.268  -64.534 1.00 96.90  ? 139  DA  I OP1   1 
ATOM   2828  O  OP2   . DA  A  1  139 ? 119.400 8.674  -65.230 1.00 96.69  ? 139  DA  I OP2   1 
ATOM   2829  O  "O5'" . DA  A  1  139 ? 117.643 7.150  -64.327 1.00 93.80  ? 139  DA  I "O5'" 1 
ATOM   2830  C  "C5'" . DA  A  1  139 ? 117.055 6.513  -63.198 1.00 90.25  ? 139  DA  I "C5'" 1 
ATOM   2831  C  "C4'" . DA  A  1  139 ? 115.550 6.600  -63.276 1.00 88.66  ? 139  DA  I "C4'" 1 
ATOM   2832  O  "O4'" . DA  A  1  139 ? 115.115 7.962  -63.041 1.00 87.28  ? 139  DA  I "O4'" 1 
ATOM   2833  C  "C3'" . DA  A  1  139 ? 114.976 6.197  -64.633 1.00 88.41  ? 139  DA  I "C3'" 1 
ATOM   2834  O  "O3'" . DA  A  1  139 ? 113.787 5.428  -64.444 1.00 89.72  ? 139  DA  I "O3'" 1 
ATOM   2835  C  "C2'" . DA  A  1  139 ? 114.663 7.527  -65.295 1.00 87.02  ? 139  DA  I "C2'" 1 
ATOM   2836  C  "C1'" . DA  A  1  139 ? 114.285 8.394  -64.110 1.00 85.41  ? 139  DA  I "C1'" 1 
ATOM   2837  N  N9    . DA  A  1  139 ? 114.505 9.829  -64.306 1.00 82.86  ? 139  DA  I N9    1 
ATOM   2838  C  C8    . DA  A  1  139 ? 115.667 10.465 -64.667 1.00 81.98  ? 139  DA  I C8    1 
ATOM   2839  N  N7    . DA  A  1  139 ? 115.550 11.769 -64.763 1.00 80.64  ? 139  DA  I N7    1 
ATOM   2840  C  C5    . DA  A  1  139 ? 114.221 12.008 -64.441 1.00 79.36  ? 139  DA  I C5    1 
ATOM   2841  C  C6    . DA  A  1  139 ? 113.467 13.193 -64.357 1.00 77.84  ? 139  DA  I C6    1 
ATOM   2842  N  N6    . DA  A  1  139 ? 113.963 14.405 -64.601 1.00 75.82  ? 139  DA  I N6    1 
ATOM   2843  N  N1    . DA  A  1  139 ? 112.167 13.086 -64.009 1.00 77.08  ? 139  DA  I N1    1 
ATOM   2844  C  C2    . DA  A  1  139 ? 111.668 11.868 -63.765 1.00 78.12  ? 139  DA  I C2    1 
ATOM   2845  N  N3    . DA  A  1  139 ? 112.274 10.683 -63.812 1.00 78.93  ? 139  DA  I N3    1 
ATOM   2846  C  C4    . DA  A  1  139 ? 113.565 10.823 -64.159 1.00 80.47  ? 139  DA  I C4    1 
ATOM   2847  P  P     . DT  A  1  140 ? 113.125 4.668  -65.693 1.00 90.59  ? 140  DT  I P     1 
ATOM   2848  O  OP1   . DT  A  1  140 ? 112.602 3.356  -65.227 1.00 90.92  ? 140  DT  I OP1   1 
ATOM   2849  O  OP2   . DT  A  1  140 ? 114.094 4.719  -66.820 1.00 90.27  ? 140  DT  I OP2   1 
ATOM   2850  O  "O5'" . DT  A  1  140 ? 111.886 5.592  -66.064 1.00 89.42  ? 140  DT  I "O5'" 1 
ATOM   2851  C  "C5'" . DT  A  1  140 ? 110.903 5.908  -65.083 1.00 86.05  ? 140  DT  I "C5'" 1 
ATOM   2852  C  "C4'" . DT  A  1  140 ? 109.936 6.932  -65.626 1.00 83.32  ? 140  DT  I "C4'" 1 
ATOM   2853  O  "O4'" . DT  A  1  140 ? 110.517 8.260  -65.623 1.00 81.68  ? 140  DT  I "O4'" 1 
ATOM   2854  C  "C3'" . DT  A  1  140 ? 109.479 6.676  -67.064 1.00 83.05  ? 140  DT  I "C3'" 1 
ATOM   2855  O  "O3'" . DT  A  1  140 ? 108.111 7.038  -67.165 1.00 84.73  ? 140  DT  I "O3'" 1 
ATOM   2856  C  "C2'" . DT  A  1  140 ? 110.278 7.690  -67.861 1.00 81.29  ? 140  DT  I "C2'" 1 
ATOM   2857  C  "C1'" . DT  A  1  140 ? 110.274 8.848  -66.888 1.00 79.56  ? 140  DT  I "C1'" 1 
ATOM   2858  N  N1    . DT  A  1  140 ? 111.274 9.903  -67.121 1.00 77.24  ? 140  DT  I N1    1 
ATOM   2859  C  C2    . DT  A  1  140 ? 110.861 11.208 -66.957 1.00 75.57  ? 140  DT  I C2    1 
ATOM   2860  O  O2    . DT  A  1  140 ? 109.734 11.511 -66.603 1.00 73.86  ? 140  DT  I O2    1 
ATOM   2861  N  N3    . DT  A  1  140 ? 111.820 12.150 -67.219 1.00 74.51  ? 140  DT  I N3    1 
ATOM   2862  C  C4    . DT  A  1  140 ? 113.120 11.927 -67.618 1.00 74.53  ? 140  DT  I C4    1 
ATOM   2863  O  O4    . DT  A  1  140 ? 113.862 12.881 -67.837 1.00 73.95  ? 140  DT  I O4    1 
ATOM   2864  C  C5    . DT  A  1  140 ? 113.496 10.533 -67.750 1.00 74.97  ? 140  DT  I C5    1 
ATOM   2865  C  C7    . DT  A  1  140 ? 114.895 10.193 -68.157 1.00 74.79  ? 140  DT  I C7    1 
ATOM   2866  C  C6    . DT  A  1  140 ? 112.565 9.603  -67.500 1.00 75.63  ? 140  DT  I C6    1 
ATOM   2867  P  P     . DA  A  1  141 ? 107.061 6.036  -67.837 1.00 86.05  ? 141  DA  I P     1 
ATOM   2868  O  OP1   . DA  A  1  141 ? 106.953 4.829  -66.977 1.00 85.45  ? 141  DA  I OP1   1 
ATOM   2869  O  OP2   . DA  A  1  141 ? 107.397 5.888  -69.278 1.00 85.71  ? 141  DA  I OP2   1 
ATOM   2870  O  "O5'" . DA  A  1  141 ? 105.708 6.862  -67.704 1.00 84.95  ? 141  DA  I "O5'" 1 
ATOM   2871  C  "C5'" . DA  A  1  141 ? 105.408 7.551  -66.490 1.00 82.32  ? 141  DA  I "C5'" 1 
ATOM   2872  C  "C4'" . DA  A  1  141 ? 104.957 8.965  -66.778 1.00 80.32  ? 141  DA  I "C4'" 1 
ATOM   2873  O  "O4'" . DA  A  1  141 ? 106.077 9.837  -67.075 1.00 78.64  ? 141  DA  I "O4'" 1 
ATOM   2874  C  "C3'" . DA  A  1  141 ? 103.985 9.101  -67.947 1.00 79.94  ? 141  DA  I "C3'" 1 
ATOM   2875  O  "O3'" . DA  A  1  141 ? 102.909 9.958  -67.575 1.00 80.79  ? 141  DA  I "O3'" 1 
ATOM   2876  C  "C2'" . DA  A  1  141 ? 104.827 9.727  -69.047 1.00 77.78  ? 141  DA  I "C2'" 1 
ATOM   2877  C  "C1'" . DA  A  1  141 ? 105.816 10.569 -68.265 1.00 75.50  ? 141  DA  I "C1'" 1 
ATOM   2878  N  N9    . DA  A  1  141 ? 107.096 10.795 -68.939 1.00 73.36  ? 141  DA  I N9    1 
ATOM   2879  C  C8    . DA  A  1  141 ? 108.019 9.855  -69.322 1.00 72.97  ? 141  DA  I C8    1 
ATOM   2880  N  N7    . DA  A  1  141 ? 109.097 10.362 -69.870 1.00 70.90  ? 141  DA  I N7    1 
ATOM   2881  C  C5    . DA  A  1  141 ? 108.867 11.730 -69.856 1.00 70.38  ? 141  DA  I C5    1 
ATOM   2882  C  C6    . DA  A  1  141 ? 109.640 12.825 -70.282 1.00 69.14  ? 141  DA  I C6    1 
ATOM   2883  N  N6    . DA  A  1  141 ? 110.859 12.713 -70.809 1.00 67.53  ? 141  DA  I N6    1 
ATOM   2884  N  N1    . DA  A  1  141 ? 109.113 14.057 -70.136 1.00 68.64  ? 141  DA  I N1    1 
ATOM   2885  C  C2    . DA  A  1  141 ? 107.899 14.173 -69.589 1.00 68.89  ? 141  DA  I C2    1 
ATOM   2886  N  N3    . DA  A  1  141 ? 107.083 13.226 -69.137 1.00 70.49  ? 141  DA  I N3    1 
ATOM   2887  C  C4    . DA  A  1  141 ? 107.631 12.011 -69.300 1.00 71.35  ? 141  DA  I C4    1 
ATOM   2888  P  P     . DT  A  1  142 ? 101.763 10.293 -68.639 1.00 81.46  ? 142  DT  I P     1 
ATOM   2889  O  OP1   . DT  A  1  142 ? 100.506 10.525 -67.884 1.00 82.04  ? 142  DT  I OP1   1 
ATOM   2890  O  OP2   . DT  A  1  142 ? 101.797 9.273  -69.719 1.00 81.62  ? 142  DT  I OP2   1 
ATOM   2891  O  "O5'" . DT  A  1  142 ? 102.244 11.688 -69.220 1.00 79.41  ? 142  DT  I "O5'" 1 
ATOM   2892  C  "C5'" . DT  A  1  142 ? 102.513 12.760 -68.331 1.00 76.56  ? 142  DT  I "C5'" 1 
ATOM   2893  C  "C4'" . DT  A  1  142 ? 102.599 14.057 -69.093 1.00 75.27  ? 142  DT  I "C4'" 1 
ATOM   2894  O  "O4'" . DT  A  1  142 ? 103.902 14.194 -69.703 1.00 74.02  ? 142  DT  I "O4'" 1 
ATOM   2895  C  "C3'" . DT  A  1  142 ? 101.574 14.205 -70.214 1.00 74.13  ? 142  DT  I "C3'" 1 
ATOM   2896  O  "O3'" . DT  A  1  142 ? 101.027 15.523 -70.164 1.00 72.55  ? 142  DT  I "O3'" 1 
ATOM   2897  C  "C2'" . DT  A  1  142 ? 102.390 13.969 -71.478 1.00 74.24  ? 142  DT  I "C2'" 1 
ATOM   2898  C  "C1'" . DT  A  1  142 ? 103.768 14.481 -71.083 1.00 73.70  ? 142  DT  I "C1'" 1 
ATOM   2899  N  N1    . DT  A  1  142 ? 104.919 13.862 -71.774 1.00 72.18  ? 142  DT  I N1    1 
ATOM   2900  C  C2    . DT  A  1  142 ? 105.927 14.694 -72.211 1.00 71.47  ? 142  DT  I C2    1 
ATOM   2901  O  O2    . DT  A  1  142 ? 105.893 15.908 -72.086 1.00 69.63  ? 142  DT  I O2    1 
ATOM   2902  N  N3    . DT  A  1  142 ? 106.983 14.050 -72.804 1.00 71.67  ? 142  DT  I N3    1 
ATOM   2903  C  C4    . DT  A  1  142 ? 107.128 12.691 -73.001 1.00 71.98  ? 142  DT  I C4    1 
ATOM   2904  O  O4    . DT  A  1  142 ? 108.145 12.257 -73.531 1.00 73.48  ? 142  DT  I O4    1 
ATOM   2905  C  C5    . DT  A  1  142 ? 106.027 11.880 -72.538 1.00 71.71  ? 142  DT  I C5    1 
ATOM   2906  C  C7    . DT  A  1  142 ? 106.092 10.399 -72.729 1.00 70.83  ? 142  DT  I C7    1 
ATOM   2907  C  C6    . DT  A  1  142 ? 104.990 12.497 -71.956 1.00 71.77  ? 142  DT  I C6    1 
ATOM   2908  P  P     . DT  A  1  143 ? 99.882  15.950 -71.198 1.00 72.23  ? 143  DT  I P     1 
ATOM   2909  O  OP1   . DT  A  1  143 ? 98.945  16.845 -70.477 1.00 73.57  ? 143  DT  I OP1   1 
ATOM   2910  O  OP2   . DT  A  1  143 ? 99.368  14.727 -71.859 1.00 73.00  ? 143  DT  I OP2   1 
ATOM   2911  O  "O5'" . DT  A  1  143 ? 100.690 16.822 -72.257 1.00 70.83  ? 143  DT  I "O5'" 1 
ATOM   2912  C  "C5'" . DT  A  1  143 ? 101.562 17.850 -71.799 1.00 68.68  ? 143  DT  I "C5'" 1 
ATOM   2913  C  "C4'" . DT  A  1  143 ? 102.334 18.451 -72.950 1.00 67.38  ? 143  DT  I "C4'" 1 
ATOM   2914  O  "O4'" . DT  A  1  143 ? 103.434 17.598 -73.350 1.00 66.48  ? 143  DT  I "O4'" 1 
ATOM   2915  C  "C3'" . DT  A  1  143 ? 101.515 18.723 -74.209 1.00 65.88  ? 143  DT  I "C3'" 1 
ATOM   2916  O  "O3'" . DT  A  1  143 ? 101.805 20.037 -74.675 1.00 66.47  ? 143  DT  I "O3'" 1 
ATOM   2917  C  "C2'" . DT  A  1  143 ? 102.003 17.668 -75.190 1.00 65.49  ? 143  DT  I "C2'" 1 
ATOM   2918  C  "C1'" . DT  A  1  143 ? 103.446 17.467 -74.760 1.00 64.23  ? 143  DT  I "C1'" 1 
ATOM   2919  N  N1    . DT  A  1  143 ? 104.035 16.150 -75.087 1.00 61.91  ? 143  DT  I N1    1 
ATOM   2920  C  C2    . DT  A  1  143 ? 105.342 16.113 -75.535 1.00 61.57  ? 143  DT  I C2    1 
ATOM   2921  O  O2    . DT  A  1  143 ? 106.022 17.115 -75.696 1.00 60.25  ? 143  DT  I O2    1 
ATOM   2922  N  N3    . DT  A  1  143 ? 105.825 14.852 -75.795 1.00 60.02  ? 143  DT  I N3    1 
ATOM   2923  C  C4    . DT  A  1  143 ? 105.143 13.657 -75.663 1.00 62.71  ? 143  DT  I C4    1 
ATOM   2924  O  O4    . DT  A  1  143 ? 105.705 12.597 -75.927 1.00 63.91  ? 143  DT  I O4    1 
ATOM   2925  C  C5    . DT  A  1  143 ? 103.778 13.773 -75.203 1.00 61.56  ? 143  DT  I C5    1 
ATOM   2926  C  C7    . DT  A  1  143 ? 102.963 12.530 -75.042 1.00 62.94  ? 143  DT  I C7    1 
ATOM   2927  C  C6    . DT  A  1  143 ? 103.300 14.996 -74.940 1.00 61.27  ? 143  DT  I C6    1 
ATOM   2928  P  P     . DG  A  1  144 ? 100.924 20.675 -75.854 1.00 67.26  ? 144  DG  I P     1 
ATOM   2929  O  OP1   . DG  A  1  144 ? 100.640 22.099 -75.527 1.00 64.60  ? 144  DG  I OP1   1 
ATOM   2930  O  OP2   . DG  A  1  144 ? 99.805  19.746 -76.147 1.00 64.44  ? 144  DG  I OP2   1 
ATOM   2931  O  "O5'" . DG  A  1  144 ? 101.920 20.642 -77.090 1.00 68.22  ? 144  DG  I "O5'" 1 
ATOM   2932  C  "C5'" . DG  A  1  144 ? 103.195 21.263 -77.001 1.00 71.09  ? 144  DG  I "C5'" 1 
ATOM   2933  C  "C4'" . DG  A  1  144 ? 104.024 20.916 -78.213 1.00 74.38  ? 144  DG  I "C4'" 1 
ATOM   2934  O  "O4'" . DG  A  1  144 ? 104.498 19.548 -78.129 1.00 73.73  ? 144  DG  I "O4'" 1 
ATOM   2935  C  "C3'" . DG  A  1  144 ? 103.260 21.022 -79.534 1.00 75.97  ? 144  DG  I "C3'" 1 
ATOM   2936  O  "O3'" . DG  A  1  144 ? 104.102 21.601 -80.529 1.00 81.02  ? 144  DG  I "O3'" 1 
ATOM   2937  C  "C2'" . DG  A  1  144 ? 102.965 19.574 -79.883 1.00 74.44  ? 144  DG  I "C2'" 1 
ATOM   2938  C  "C1'" . DG  A  1  144 ? 104.208 18.893 -79.350 1.00 73.29  ? 144  DG  I "C1'" 1 
ATOM   2939  N  N9    . DG  A  1  144 ? 104.104 17.459 -79.098 1.00 71.80  ? 144  DG  I N9    1 
ATOM   2940  C  C8    . DG  A  1  144 ? 103.008 16.753 -78.664 1.00 71.91  ? 144  DG  I C8    1 
ATOM   2941  N  N7    . DG  A  1  144 ? 103.229 15.468 -78.569 1.00 70.98  ? 144  DG  I N7    1 
ATOM   2942  C  C5    . DG  A  1  144 ? 104.554 15.319 -78.958 1.00 70.56  ? 144  DG  I C5    1 
ATOM   2943  C  C6    . DG  A  1  144 ? 105.363 14.150 -79.067 1.00 70.28  ? 144  DG  I C6    1 
ATOM   2944  O  O6    . DG  A  1  144 ? 105.060 12.972 -78.830 1.00 69.54  ? 144  DG  I O6    1 
ATOM   2945  N  N1    . DG  A  1  144 ? 106.647 14.458 -79.503 1.00 69.54  ? 144  DG  I N1    1 
ATOM   2946  C  C2    . DG  A  1  144 ? 107.100 15.721 -79.795 1.00 71.24  ? 144  DG  I C2    1 
ATOM   2947  N  N2    . DG  A  1  144 ? 108.371 15.815 -80.202 1.00 71.86  ? 144  DG  I N2    1 
ATOM   2948  N  N3    . DG  A  1  144 ? 106.362 16.813 -79.696 1.00 71.90  ? 144  DG  I N3    1 
ATOM   2949  C  C4    . DG  A  1  144 ? 105.109 16.540 -79.277 1.00 71.57  ? 144  DG  I C4    1 
ATOM   2950  P  P     . DA  A  1  145 ? 103.459 22.165 -81.890 1.00 85.12  ? 145  DA  I P     1 
ATOM   2951  O  OP1   . DA  A  1  145 ? 103.213 23.621 -81.723 1.00 84.57  ? 145  DA  I OP1   1 
ATOM   2952  O  OP2   . DA  A  1  145 ? 102.336 21.264 -82.271 1.00 83.09  ? 145  DA  I OP2   1 
ATOM   2953  O  "O5'" . DA  A  1  145 ? 104.635 21.975 -82.944 1.00 84.86  ? 145  DA  I "O5'" 1 
ATOM   2954  C  "C5'" . DA  A  1  145 ? 105.987 22.250 -82.581 1.00 86.74  ? 145  DA  I "C5'" 1 
ATOM   2955  C  "C4'" . DA  A  1  145 ? 106.922 21.348 -83.351 1.00 87.91  ? 145  DA  I "C4'" 1 
ATOM   2956  O  "O4'" . DA  A  1  145 ? 106.930 20.015 -82.776 1.00 86.42  ? 145  DA  I "O4'" 1 
ATOM   2957  C  "C3'" . DA  A  1  145 ? 106.521 21.184 -84.818 1.00 89.64  ? 145  DA  I "C3'" 1 
ATOM   2958  O  "O3'" . DA  A  1  145 ? 107.653 21.280 -85.682 1.00 93.76  ? 145  DA  I "O3'" 1 
ATOM   2959  C  "C2'" . DA  A  1  145 ? 105.925 19.789 -84.875 1.00 87.73  ? 145  DA  I "C2'" 1 
ATOM   2960  C  "C1'" . DA  A  1  145 ? 106.696 19.056 -83.794 1.00 85.63  ? 145  DA  I "C1'" 1 
ATOM   2961  N  N9    . DA  A  1  145 ? 105.952 17.937 -83.215 1.00 83.28  ? 145  DA  I N9    1 
ATOM   2962  C  C8    . DA  A  1  145 ? 104.727 17.966 -82.597 1.00 82.45  ? 145  DA  I C8    1 
ATOM   2963  N  N7    . DA  A  1  145 ? 104.291 16.783 -82.233 1.00 81.60  ? 145  DA  I N7    1 
ATOM   2964  C  C5    . DA  A  1  145 ? 105.302 15.919 -82.627 1.00 81.21  ? 145  DA  I C5    1 
ATOM   2965  C  C6    . DA  A  1  145 ? 105.442 14.519 -82.538 1.00 81.25  ? 145  DA  I C6    1 
ATOM   2966  N  N6    . DA  A  1  145 ? 104.517 13.712 -82.015 1.00 80.00  ? 145  DA  I N6    1 
ATOM   2967  N  N1    . DA  A  1  145 ? 106.580 13.971 -83.019 1.00 80.78  ? 145  DA  I N1    1 
ATOM   2968  C  C2    . DA  A  1  145 ? 107.500 14.779 -83.560 1.00 80.83  ? 145  DA  I C2    1 
ATOM   2969  N  N3    . DA  A  1  145 ? 107.478 16.102 -83.711 1.00 81.68  ? 145  DA  I N3    1 
ATOM   2970  C  C4    . DA  A  1  145 ? 106.338 16.618 -83.218 1.00 81.94  ? 145  DA  I C4    1 
ATOM   2971  P  P     . DT  A  1  146 ? 107.430 21.343 -87.275 1.00 96.16  ? 146  DT  I P     1 
ATOM   2972  O  OP1   . DT  A  1  146 ? 108.463 22.248 -87.842 1.00 95.53  ? 146  DT  I OP1   1 
ATOM   2973  O  OP2   . DT  A  1  146 ? 105.991 21.630 -87.522 1.00 95.35  ? 146  DT  I OP2   1 
ATOM   2974  O  "O5'" . DT  A  1  146 ? 107.734 19.848 -87.744 1.00 95.98  ? 146  DT  I "O5'" 1 
ATOM   2975  C  "C5'" . DT  A  1  146 ? 108.977 19.224 -87.415 1.00 96.30  ? 146  DT  I "C5'" 1 
ATOM   2976  C  "C4'" . DT  A  1  146 ? 109.012 17.798 -87.919 1.00 96.57  ? 146  DT  I "C4'" 1 
ATOM   2977  O  "O4'" . DT  A  1  146 ? 108.214 16.927 -87.077 1.00 95.27  ? 146  DT  I "O4'" 1 
ATOM   2978  C  "C3'" . DT  A  1  146 ? 108.500 17.595 -89.347 1.00 97.03  ? 146  DT  I "C3'" 1 
ATOM   2979  O  "O3'" . DT  A  1  146 ? 109.237 16.544 -89.982 1.00 98.54  ? 146  DT  I "O3'" 1 
ATOM   2980  C  "C2'" . DT  A  1  146 ? 107.107 17.036 -89.129 1.00 96.24  ? 146  DT  I "C2'" 1 
ATOM   2981  C  "C1'" . DT  A  1  146 ? 107.332 16.178 -87.897 1.00 94.62  ? 146  DT  I "C1'" 1 
ATOM   2982  N  N1    . DT  A  1  146 ? 106.120 15.861 -87.116 1.00 92.85  ? 146  DT  I N1    1 
ATOM   2983  C  C2    . DT  A  1  146 ? 105.979 14.574 -86.650 1.00 91.77  ? 146  DT  I C2    1 
ATOM   2984  O  O2    . DT  A  1  146 ? 106.816 13.705 -86.827 1.00 91.60  ? 146  DT  I O2    1 
ATOM   2985  N  N3    . DT  A  1  146 ? 104.816 14.338 -85.965 1.00 91.24  ? 146  DT  I N3    1 
ATOM   2986  C  C4    . DT  A  1  146 ? 103.804 15.240 -85.701 1.00 91.67  ? 146  DT  I C4    1 
ATOM   2987  O  O4    . DT  A  1  146 ? 102.806 14.878 -85.084 1.00 91.49  ? 146  DT  I O4    1 
ATOM   2988  C  C5    . DT  A  1  146 ? 104.025 16.576 -86.202 1.00 91.70  ? 146  DT  I C5    1 
ATOM   2989  C  C7    . DT  A  1  146 ? 102.988 17.624 -85.949 1.00 91.88  ? 146  DT  I C7    1 
ATOM   2990  C  C6    . DT  A  1  146 ? 105.157 16.818 -86.875 1.00 92.34  ? 146  DT  I C6    1 
ATOM   2991  O  "O5'" . DA  B  1  1   ? 102.639 4.925  -83.777 1.00 118.37 ? 147  DA  J "O5'" 1 
ATOM   2992  C  "C5'" . DA  B  1  1   ? 103.152 3.942  -84.684 1.00 118.00 ? 147  DA  J "C5'" 1 
ATOM   2993  C  "C4'" . DA  B  1  1   ? 104.465 4.359  -85.305 1.00 117.39 ? 147  DA  J "C4'" 1 
ATOM   2994  O  "O4'" . DA  B  1  1   ? 104.276 5.615  -86.003 1.00 116.48 ? 147  DA  J "O4'" 1 
ATOM   2995  C  "C3'" . DA  B  1  1   ? 105.580 4.601  -84.289 1.00 117.52 ? 147  DA  J "C3'" 1 
ATOM   2996  O  "O3'" . DA  B  1  1   ? 106.846 4.169  -84.793 1.00 118.06 ? 147  DA  J "O3'" 1 
ATOM   2997  C  "C2'" . DA  B  1  1   ? 105.570 6.105  -84.101 1.00 116.88 ? 147  DA  J "C2'" 1 
ATOM   2998  C  "C1'" . DA  B  1  1   ? 105.109 6.625  -85.452 1.00 115.29 ? 147  DA  J "C1'" 1 
ATOM   2999  N  N9    . DA  B  1  1   ? 104.313 7.845  -85.333 1.00 113.36 ? 147  DA  J N9    1 
ATOM   3000  C  C8    . DA  B  1  1   ? 103.049 7.968  -84.810 1.00 112.67 ? 147  DA  J C8    1 
ATOM   3001  N  N7    . DA  B  1  1   ? 102.600 9.198  -84.798 1.00 112.12 ? 147  DA  J N7    1 
ATOM   3002  C  C5    . DA  B  1  1   ? 103.633 9.935  -85.359 1.00 111.46 ? 147  DA  J C5    1 
ATOM   3003  C  C6    . DA  B  1  1   ? 103.781 11.308 -85.621 1.00 110.61 ? 147  DA  J C6    1 
ATOM   3004  N  N6    . DA  B  1  1   ? 102.852 12.221 -85.334 1.00 110.04 ? 147  DA  J N6    1 
ATOM   3005  N  N1    . DA  B  1  1   ? 104.933 11.717 -86.192 1.00 110.14 ? 147  DA  J N1    1 
ATOM   3006  C  C2    . DA  B  1  1   ? 105.868 10.802 -86.472 1.00 110.86 ? 147  DA  J C2    1 
ATOM   3007  N  N3    . DA  B  1  1   ? 105.849 9.487  -86.269 1.00 111.33 ? 147  DA  J N3    1 
ATOM   3008  C  C4    . DA  B  1  1   ? 104.690 9.113  -85.702 1.00 111.97 ? 147  DA  J C4    1 
ATOM   3009  P  P     . DT  B  1  2   ? 108.142 4.242  -83.844 1.00 118.53 ? 148  DT  J P     1 
ATOM   3010  O  OP1   . DT  B  1  2   ? 109.083 3.164  -84.243 1.00 119.00 ? 148  DT  J OP1   1 
ATOM   3011  O  OP2   . DT  B  1  2   ? 107.662 4.312  -82.440 1.00 118.38 ? 148  DT  J OP2   1 
ATOM   3012  O  "O5'" . DT  B  1  2   ? 108.801 5.644  -84.210 1.00 117.57 ? 148  DT  J "O5'" 1 
ATOM   3013  C  "C5'" . DT  B  1  2   ? 109.335 5.880  -85.511 1.00 117.13 ? 148  DT  J "C5'" 1 
ATOM   3014  C  "C4'" . DT  B  1  2   ? 110.149 7.152  -85.516 1.00 116.89 ? 148  DT  J "C4'" 1 
ATOM   3015  O  "O4'" . DT  B  1  2   ? 109.270 8.296  -85.389 1.00 116.88 ? 148  DT  J "O4'" 1 
ATOM   3016  C  "C3'" . DT  B  1  2   ? 111.148 7.254  -84.364 1.00 116.51 ? 148  DT  J "C3'" 1 
ATOM   3017  O  "O3'" . DT  B  1  2   ? 112.360 7.866  -84.812 1.00 116.18 ? 148  DT  J "O3'" 1 
ATOM   3018  C  "C2'" . DT  B  1  2   ? 110.434 8.139  -83.357 1.00 116.48 ? 148  DT  J "C2'" 1 
ATOM   3019  C  "C1'" . DT  B  1  2   ? 109.627 9.066  -84.250 1.00 116.00 ? 148  DT  J "C1'" 1 
ATOM   3020  N  N1    . DT  B  1  2   ? 108.381 9.576  -83.642 1.00 115.00 ? 148  DT  J N1    1 
ATOM   3021  C  C2    . DT  B  1  2   ? 108.099 10.916 -83.771 1.00 114.42 ? 148  DT  J C2    1 
ATOM   3022  O  O2    . DT  B  1  2   ? 108.835 11.699 -84.346 1.00 114.23 ? 148  DT  J O2    1 
ATOM   3023  N  N3    . DT  B  1  2   ? 106.917 11.310 -83.195 1.00 114.10 ? 148  DT  J N3    1 
ATOM   3024  C  C4    . DT  B  1  2   ? 106.015 10.516 -82.513 1.00 114.13 ? 148  DT  J C4    1 
ATOM   3025  O  O4    . DT  B  1  2   ? 104.990 11.011 -82.055 1.00 114.27 ? 148  DT  J O4    1 
ATOM   3026  C  C5    . DT  B  1  2   ? 106.381 9.125  -82.402 1.00 114.19 ? 148  DT  J C5    1 
ATOM   3027  C  C7    . DT  B  1  2   ? 105.472 8.194  -81.663 1.00 114.10 ? 148  DT  J C7    1 
ATOM   3028  C  C6    . DT  B  1  2   ? 107.528 8.728  -82.968 1.00 114.49 ? 148  DT  J C6    1 
ATOM   3029  P  P     . DC  B  1  3   ? 113.639 7.896  -83.840 1.00 116.25 ? 149  DC  J P     1 
ATOM   3030  O  OP1   . DC  B  1  3   ? 114.822 8.341  -84.621 1.00 115.76 ? 149  DC  J OP1   1 
ATOM   3031  O  OP2   . DC  B  1  3   ? 113.675 6.592  -83.125 1.00 115.81 ? 149  DC  J OP2   1 
ATOM   3032  O  "O5'" . DC  B  1  3   ? 113.274 9.038  -82.792 1.00 114.13 ? 149  DC  J "O5'" 1 
ATOM   3033  C  "C5'" . DC  B  1  3   ? 114.189 9.427  -81.769 1.00 110.69 ? 149  DC  J "C5'" 1 
ATOM   3034  C  "C4'" . DC  B  1  3   ? 114.637 10.852 -81.999 1.00 108.10 ? 149  DC  J "C4'" 1 
ATOM   3035  O  "O4'" . DC  B  1  3   ? 113.488 11.626 -82.419 1.00 106.26 ? 149  DC  J "O4'" 1 
ATOM   3036  C  "C3'" . DC  B  1  3   ? 115.198 11.553 -80.762 1.00 106.82 ? 149  DC  J "C3'" 1 
ATOM   3037  O  "O3'" . DC  B  1  3   ? 116.377 12.321 -81.058 1.00 105.63 ? 149  DC  J "O3'" 1 
ATOM   3038  C  "C2'" . DC  B  1  3   ? 114.031 12.364 -80.232 1.00 105.80 ? 149  DC  J "C2'" 1 
ATOM   3039  C  "C1'" . DC  B  1  3   ? 113.121 12.587 -81.436 1.00 104.27 ? 149  DC  J "C1'" 1 
ATOM   3040  N  N1    . DC  B  1  3   ? 111.703 12.361 -81.109 1.00 101.82 ? 149  DC  J N1    1 
ATOM   3041  C  C2    . DC  B  1  3   ? 110.813 13.442 -81.124 1.00 100.39 ? 149  DC  J C2    1 
ATOM   3042  O  O2    . DC  B  1  3   ? 111.232 14.564 -81.445 1.00 99.13  ? 149  DC  J O2    1 
ATOM   3043  N  N3    . DC  B  1  3   ? 109.518 13.233 -80.790 1.00 98.65  ? 149  DC  J N3    1 
ATOM   3044  C  C4    . DC  B  1  3   ? 109.103 12.008 -80.459 1.00 98.49  ? 149  DC  J C4    1 
ATOM   3045  N  N4    . DC  B  1  3   ? 107.822 11.847 -80.127 1.00 98.02  ? 149  DC  J N4    1 
ATOM   3046  C  C5    . DC  B  1  3   ? 109.984 10.891 -80.451 1.00 99.28  ? 149  DC  J C5    1 
ATOM   3047  C  C6    . DC  B  1  3   ? 111.261 11.110 -80.780 1.00 100.67 ? 149  DC  J C6    1 
ATOM   3048  P  P     . DA  B  1  4   ? 116.267 13.707 -81.869 1.00 104.96 ? 150  DA  J P     1 
ATOM   3049  O  OP1   . DA  B  1  4   ? 115.539 13.433 -83.138 1.00 105.45 ? 150  DA  J OP1   1 
ATOM   3050  O  OP2   . DA  B  1  4   ? 117.629 14.301 -81.919 1.00 105.05 ? 150  DA  J OP2   1 
ATOM   3051  O  "O5'" . DA  B  1  4   ? 115.367 14.673 -80.979 1.00 102.42 ? 150  DA  J "O5'" 1 
ATOM   3052  C  "C5'" . DA  B  1  4   ? 114.897 15.902 -81.530 1.00 97.98  ? 150  DA  J "C5'" 1 
ATOM   3053  C  "C4'" . DA  B  1  4   ? 114.406 16.831 -80.444 1.00 94.48  ? 150  DA  J "C4'" 1 
ATOM   3054  O  "O4'" . DA  B  1  4   ? 113.170 16.345 -79.871 1.00 92.25  ? 150  DA  J "O4'" 1 
ATOM   3055  C  "C3'" . DA  B  1  4   ? 115.349 17.074 -79.268 1.00 92.99  ? 150  DA  J "C3'" 1 
ATOM   3056  O  "O3'" . DA  B  1  4   ? 115.238 18.451 -78.908 1.00 92.58  ? 150  DA  J "O3'" 1 
ATOM   3057  C  "C2'" . DA  B  1  4   ? 114.771 16.191 -78.174 1.00 90.91  ? 150  DA  J "C2'" 1 
ATOM   3058  C  "C1'" . DA  B  1  4   ? 113.284 16.289 -78.459 1.00 89.27  ? 150  DA  J "C1'" 1 
ATOM   3059  N  N9    . DA  B  1  4   ? 112.464 15.169 -77.998 1.00 86.19  ? 150  DA  J N9    1 
ATOM   3060  C  C8    . DA  B  1  4   ? 112.811 13.852 -77.843 1.00 84.81  ? 150  DA  J C8    1 
ATOM   3061  N  N7    . DA  B  1  4   ? 111.819 13.084 -77.462 1.00 83.50  ? 150  DA  J N7    1 
ATOM   3062  C  C5    . DA  B  1  4   ? 110.749 13.959 -77.343 1.00 82.79  ? 150  DA  J C5    1 
ATOM   3063  C  C6    . DA  B  1  4   ? 109.406 13.769 -76.977 1.00 81.78  ? 150  DA  J C6    1 
ATOM   3064  N  N6    . DA  B  1  4   ? 108.882 12.581 -76.668 1.00 80.34  ? 150  DA  J N6    1 
ATOM   3065  N  N1    . DA  B  1  4   ? 108.605 14.855 -76.946 1.00 81.33  ? 150  DA  J N1    1 
ATOM   3066  C  C2    . DA  B  1  4   ? 109.124 16.044 -77.269 1.00 81.90  ? 150  DA  J C2    1 
ATOM   3067  N  N3    . DA  B  1  4   ? 110.363 16.348 -77.638 1.00 83.02  ? 150  DA  J N3    1 
ATOM   3068  C  C4    . DA  B  1  4   ? 111.135 15.248 -77.656 1.00 84.15  ? 150  DA  J C4    1 
ATOM   3069  P  P     . DA  B  1  5   ? 116.167 19.062 -77.753 1.00 93.25  ? 151  DA  J P     1 
ATOM   3070  O  OP1   . DA  B  1  5   ? 117.134 19.997 -78.380 1.00 93.39  ? 151  DA  J OP1   1 
ATOM   3071  O  OP2   . DA  B  1  5   ? 116.661 17.948 -76.902 1.00 93.95  ? 151  DA  J OP2   1 
ATOM   3072  O  "O5'" . DA  B  1  5   ? 115.141 19.930 -76.904 1.00 91.92  ? 151  DA  J "O5'" 1 
ATOM   3073  C  "C5'" . DA  B  1  5   ? 114.209 20.783 -77.565 1.00 88.49  ? 151  DA  J "C5'" 1 
ATOM   3074  C  "C4'" . DA  B  1  5   ? 113.056 21.122 -76.650 1.00 85.07  ? 151  DA  J "C4'" 1 
ATOM   3075  O  "O4'" . DA  B  1  5   ? 112.248 19.948 -76.388 1.00 82.89  ? 151  DA  J "O4'" 1 
ATOM   3076  C  "C3'" . DA  B  1  5   ? 113.464 21.669 -75.285 1.00 83.73  ? 151  DA  J "C3'" 1 
ATOM   3077  O  "O3'" . DA  B  1  5   ? 112.555 22.710 -74.920 1.00 83.71  ? 151  DA  J "O3'" 1 
ATOM   3078  C  "C2'" . DA  B  1  5   ? 113.327 20.460 -74.375 1.00 82.20  ? 151  DA  J "C2'" 1 
ATOM   3079  C  "C1'" . DA  B  1  5   ? 112.144 19.732 -74.990 1.00 80.76  ? 151  DA  J "C1'" 1 
ATOM   3080  N  N9    . DA  B  1  5   ? 112.119 18.287 -74.763 1.00 78.39  ? 151  DA  J N9    1 
ATOM   3081  C  C8    . DA  B  1  5   ? 113.136 17.388 -74.955 1.00 77.24  ? 151  DA  J C8    1 
ATOM   3082  N  N7    . DA  B  1  5   ? 112.806 16.149 -74.683 1.00 77.22  ? 151  DA  J N7    1 
ATOM   3083  C  C5    . DA  B  1  5   ? 111.480 16.236 -74.282 1.00 76.03  ? 151  DA  J C5    1 
ATOM   3084  C  C6    . DA  B  1  5   ? 110.549 15.264 -73.867 1.00 74.94  ? 151  DA  J C6    1 
ATOM   3085  N  N6    . DA  B  1  5   ? 110.819 13.960 -73.791 1.00 73.53  ? 151  DA  J N6    1 
ATOM   3086  N  N1    . DA  B  1  5   ? 109.311 15.686 -73.531 1.00 74.98  ? 151  DA  J N1    1 
ATOM   3087  C  C2    . DA  B  1  5   ? 109.035 16.994 -73.614 1.00 75.48  ? 151  DA  J C2    1 
ATOM   3088  N  N3    . DA  B  1  5   ? 109.821 18.000 -73.994 1.00 76.13  ? 151  DA  J N3    1 
ATOM   3089  C  C4    . DA  B  1  5   ? 111.045 17.549 -74.320 1.00 77.13  ? 151  DA  J C4    1 
ATOM   3090  P  P     . DT  B  1  6   ? 112.959 23.759 -73.778 1.00 82.98  ? 152  DT  J P     1 
ATOM   3091  O  OP1   . DT  B  1  6   ? 112.621 25.129 -74.238 1.00 83.23  ? 152  DT  J OP1   1 
ATOM   3092  O  OP2   . DT  B  1  6   ? 114.348 23.442 -73.362 1.00 84.20  ? 152  DT  J OP2   1 
ATOM   3093  O  "O5'" . DT  B  1  6   ? 111.982 23.370 -72.588 1.00 82.15  ? 152  DT  J "O5'" 1 
ATOM   3094  C  "C5'" . DT  B  1  6   ? 111.528 22.031 -72.461 1.00 79.26  ? 152  DT  J "C5'" 1 
ATOM   3095  C  "C4'" . DT  B  1  6   ? 110.274 21.976 -71.629 1.00 76.64  ? 152  DT  J "C4'" 1 
ATOM   3096  O  "O4'" . DT  B  1  6   ? 109.794 20.614 -71.653 1.00 76.50  ? 152  DT  J "O4'" 1 
ATOM   3097  C  "C3'" . DT  B  1  6   ? 110.496 22.326 -70.162 1.00 75.60  ? 152  DT  J "C3'" 1 
ATOM   3098  O  "O3'" . DT  B  1  6   ? 109.358 23.021 -69.652 1.00 73.94  ? 152  DT  J "O3'" 1 
ATOM   3099  C  "C2'" . DT  B  1  6   ? 110.707 20.976 -69.503 1.00 74.94  ? 152  DT  J "C2'" 1 
ATOM   3100  C  "C1'" . DT  B  1  6   ? 109.912 20.011 -70.374 1.00 75.47  ? 152  DT  J "C1'" 1 
ATOM   3101  N  N1    . DT  B  1  6   ? 110.580 18.707 -70.563 1.00 73.90  ? 152  DT  J N1    1 
ATOM   3102  C  C2    . DT  B  1  6   ? 109.846 17.556 -70.389 1.00 73.60  ? 152  DT  J C2    1 
ATOM   3103  O  O2    . DT  B  1  6   ? 108.662 17.556 -70.089 1.00 74.01  ? 152  DT  J O2    1 
ATOM   3104  N  N3    . DT  B  1  6   ? 110.555 16.392 -70.580 1.00 72.91  ? 152  DT  J N3    1 
ATOM   3105  C  C4    . DT  B  1  6   ? 111.891 16.272 -70.916 1.00 72.45  ? 152  DT  J C4    1 
ATOM   3106  O  O4    . DT  B  1  6   ? 112.391 15.159 -71.048 1.00 71.39  ? 152  DT  J O4    1 
ATOM   3107  C  C5    . DT  B  1  6   ? 112.596 17.521 -71.085 1.00 73.14  ? 152  DT  J C5    1 
ATOM   3108  C  C7    . DT  B  1  6   ? 114.047 17.492 -71.452 1.00 73.57  ? 152  DT  J C7    1 
ATOM   3109  C  C6    . DT  B  1  6   ? 111.915 18.659 -70.904 1.00 73.67  ? 152  DT  J C6    1 
ATOM   3110  P  P     . DA  B  1  7   ? 109.260 23.362 -68.087 1.00 72.16  ? 153  DA  J P     1 
ATOM   3111  O  OP1   . DA  B  1  7   ? 108.605 24.689 -67.969 1.00 74.01  ? 153  DA  J OP1   1 
ATOM   3112  O  OP2   . DA  B  1  7   ? 110.577 23.137 -67.442 1.00 72.98  ? 153  DA  J OP2   1 
ATOM   3113  O  "O5'" . DA  B  1  7   ? 108.255 22.247 -67.562 1.00 71.70  ? 153  DA  J "O5'" 1 
ATOM   3114  C  "C5'" . DA  B  1  7   ? 107.094 21.923 -68.320 1.00 71.17  ? 153  DA  J "C5'" 1 
ATOM   3115  C  "C4'" . DA  B  1  7   ? 106.405 20.714 -67.736 1.00 71.51  ? 153  DA  J "C4'" 1 
ATOM   3116  O  "O4'" . DA  B  1  7   ? 107.177 19.516 -67.996 1.00 70.64  ? 153  DA  J "O4'" 1 
ATOM   3117  C  "C3'" . DA  B  1  7   ? 106.201 20.773 -66.226 1.00 71.59  ? 153  DA  J "C3'" 1 
ATOM   3118  O  "O3'" . DA  B  1  7   ? 104.913 20.245 -65.911 1.00 73.28  ? 153  DA  J "O3'" 1 
ATOM   3119  C  "C2'" . DA  B  1  7   ? 107.321 19.902 -65.682 1.00 71.05  ? 153  DA  J "C2'" 1 
ATOM   3120  C  "C1'" . DA  B  1  7   ? 107.500 18.861 -66.778 1.00 69.89  ? 153  DA  J "C1'" 1 
ATOM   3121  N  N9    . DA  B  1  7   ? 108.861 18.332 -66.907 1.00 68.11  ? 153  DA  J N9    1 
ATOM   3122  C  C8    . DA  B  1  7   ? 110.022 19.043 -67.088 1.00 67.21  ? 153  DA  J C8    1 
ATOM   3123  N  N7    . DA  B  1  7   ? 111.089 18.291 -67.216 1.00 66.45  ? 153  DA  J N7    1 
ATOM   3124  C  C5    . DA  B  1  7   ? 110.600 16.997 -67.102 1.00 66.31  ? 153  DA  J C5    1 
ATOM   3125  C  C6    . DA  B  1  7   ? 111.229 15.737 -67.159 1.00 66.22  ? 153  DA  J C6    1 
ATOM   3126  N  N6    . DA  B  1  7   ? 112.538 15.570 -67.365 1.00 64.87  ? 153  DA  J N6    1 
ATOM   3127  N  N1    . DA  B  1  7   ? 110.456 14.641 -66.999 1.00 65.06  ? 153  DA  J N1    1 
ATOM   3128  C  C2    . DA  B  1  7   ? 109.143 14.810 -66.796 1.00 65.55  ? 153  DA  J C2    1 
ATOM   3129  N  N3    . DA  B  1  7   ? 108.435 15.938 -66.729 1.00 65.51  ? 153  DA  J N3    1 
ATOM   3130  C  C4    . DA  B  1  7   ? 109.231 17.007 -66.896 1.00 66.49  ? 153  DA  J C4    1 
ATOM   3131  P  P     . DT  B  1  8   ? 104.421 20.201 -64.387 1.00 74.47  ? 154  DT  J P     1 
ATOM   3132  O  OP1   . DT  B  1  8   ? 102.958 20.428 -64.385 1.00 76.34  ? 154  DT  J OP1   1 
ATOM   3133  O  OP2   . DT  B  1  8   ? 105.306 21.087 -63.590 1.00 75.38  ? 154  DT  J OP2   1 
ATOM   3134  O  "O5'" . DT  B  1  8   ? 104.684 18.691 -63.976 1.00 73.40  ? 154  DT  J "O5'" 1 
ATOM   3135  C  "C5'" . DT  B  1  8   ? 104.233 17.642 -64.822 1.00 74.49  ? 154  DT  J "C5'" 1 
ATOM   3136  C  "C4'" . DT  B  1  8   ? 104.564 16.303 -64.214 1.00 74.73  ? 154  DT  J "C4'" 1 
ATOM   3137  O  "O4'" . DT  B  1  8   ? 105.944 15.941 -64.465 1.00 73.42  ? 154  DT  J "O4'" 1 
ATOM   3138  C  "C3'" . DT  B  1  8   ? 104.369 16.246 -62.701 1.00 76.20  ? 154  DT  J "C3'" 1 
ATOM   3139  O  "O3'" . DT  B  1  8   ? 103.708 15.025 -62.373 1.00 79.93  ? 154  DT  J "O3'" 1 
ATOM   3140  C  "C2'" . DT  B  1  8   ? 105.789 16.278 -62.161 1.00 74.44  ? 154  DT  J "C2'" 1 
ATOM   3141  C  "C1'" . DT  B  1  8   ? 106.558 15.547 -63.250 1.00 72.72  ? 154  DT  J "C1'" 1 
ATOM   3142  N  N1    . DT  B  1  8   ? 108.006 15.853 -63.348 1.00 69.58  ? 154  DT  J N1    1 
ATOM   3143  C  C2    . DT  B  1  8   ? 108.889 14.791 -63.439 1.00 68.65  ? 154  DT  J C2    1 
ATOM   3144  O  O2    . DT  B  1  8   ? 108.539 13.621 -63.402 1.00 68.72  ? 154  DT  J O2    1 
ATOM   3145  N  N3    . DT  B  1  8   ? 110.206 15.151 -63.572 1.00 66.74  ? 154  DT  J N3    1 
ATOM   3146  C  C4    . DT  B  1  8   ? 110.722 16.432 -63.615 1.00 67.07  ? 154  DT  J C4    1 
ATOM   3147  O  O4    . DT  B  1  8   ? 111.930 16.601 -63.765 1.00 65.74  ? 154  DT  J O4    1 
ATOM   3148  C  C5    . DT  B  1  8   ? 109.748 17.494 -63.482 1.00 66.71  ? 154  DT  J C5    1 
ATOM   3149  C  C7    . DT  B  1  8   ? 110.224 18.913 -63.483 1.00 66.22  ? 154  DT  J C7    1 
ATOM   3150  C  C6    . DT  B  1  8   ? 108.456 17.157 -63.362 1.00 67.90  ? 154  DT  J C6    1 
ATOM   3151  P  P     . DC  B  1  9   ? 103.047 14.836 -60.924 1.00 83.31  ? 155  DC  J P     1 
ATOM   3152  O  OP1   . DC  B  1  9   ? 101.635 14.398 -61.104 1.00 83.37  ? 155  DC  J OP1   1 
ATOM   3153  O  OP2   . DC  B  1  9   ? 103.357 16.037 -60.103 1.00 82.71  ? 155  DC  J OP2   1 
ATOM   3154  O  "O5'" . DC  B  1  9   ? 103.891 13.630 -60.346 1.00 82.40  ? 155  DC  J "O5'" 1 
ATOM   3155  C  "C5'" . DC  B  1  9   ? 105.205 13.430 -60.829 1.00 82.99  ? 155  DC  J "C5'" 1 
ATOM   3156  C  "C4'" . DC  B  1  9   ? 105.655 12.019 -60.562 1.00 82.56  ? 155  DC  J "C4'" 1 
ATOM   3157  O  "O4'" . DC  B  1  9   ? 107.039 11.944 -60.966 1.00 81.33  ? 155  DC  J "O4'" 1 
ATOM   3158  C  "C3'" . DC  B  1  9   ? 105.637 11.695 -59.077 1.00 82.51  ? 155  DC  J "C3'" 1 
ATOM   3159  O  "O3'" . DC  B  1  9   ? 105.421 10.302 -58.865 1.00 83.47  ? 155  DC  J "O3'" 1 
ATOM   3160  C  "C2'" . DC  B  1  9   ? 107.003 12.145 -58.601 1.00 81.73  ? 155  DC  J "C2'" 1 
ATOM   3161  C  "C1'" . DC  B  1  9   ? 107.891 12.003 -59.833 1.00 80.13  ? 155  DC  J "C1'" 1 
ATOM   3162  N  N1    . DC  B  1  9   ? 108.789 13.152 -60.017 1.00 77.37  ? 155  DC  J N1    1 
ATOM   3163  C  C2    . DC  B  1  9   ? 110.119 12.915 -60.337 1.00 76.41  ? 155  DC  J C2    1 
ATOM   3164  O  O2    . DC  B  1  9   ? 110.496 11.743 -60.475 1.00 77.04  ? 155  DC  J O2    1 
ATOM   3165  N  N3    . DC  B  1  9   ? 110.960 13.963 -60.490 1.00 75.26  ? 155  DC  J N3    1 
ATOM   3166  C  C4    . DC  B  1  9   ? 110.507 15.209 -60.334 1.00 75.19  ? 155  DC  J C4    1 
ATOM   3167  N  N4    . DC  B  1  9   ? 111.370 16.216 -60.489 1.00 74.53  ? 155  DC  J N4    1 
ATOM   3168  C  C5    . DC  B  1  9   ? 109.148 15.479 -60.012 1.00 75.00  ? 155  DC  J C5    1 
ATOM   3169  C  C6    . DC  B  1  9   ? 108.331 14.431 -59.867 1.00 76.06  ? 155  DC  J C6    1 
ATOM   3170  P  P     . DC  B  1  10  ? 105.152 9.765  -57.378 1.00 84.18  ? 156  DC  J P     1 
ATOM   3171  O  OP1   . DC  B  1  10  ? 104.232 8.601  -57.453 1.00 82.96  ? 156  DC  J OP1   1 
ATOM   3172  O  OP2   . DC  B  1  10  ? 104.792 10.937 -56.536 1.00 83.58  ? 156  DC  J OP2   1 
ATOM   3173  O  "O5'" . DC  B  1  10  ? 106.591 9.273  -56.913 1.00 84.15  ? 156  DC  J "O5'" 1 
ATOM   3174  C  "C5'" . DC  B  1  10  ? 107.325 8.327  -57.685 1.00 82.67  ? 156  DC  J "C5'" 1 
ATOM   3175  C  "C4'" . DC  B  1  10  ? 108.694 8.122  -57.081 1.00 81.70  ? 156  DC  J "C4'" 1 
ATOM   3176  O  "O4'" . DC  B  1  10  ? 109.587 9.202  -57.444 1.00 80.48  ? 156  DC  J "O4'" 1 
ATOM   3177  C  "C3'" . DC  B  1  10  ? 108.688 8.074  -55.553 1.00 82.00  ? 156  DC  J "C3'" 1 
ATOM   3178  O  "O3'" . DC  B  1  10  ? 109.607 7.086  -55.104 1.00 84.08  ? 156  DC  J "O3'" 1 
ATOM   3179  C  "C2'" . DC  B  1  10  ? 109.190 9.450  -55.156 1.00 79.90  ? 156  DC  J "C2'" 1 
ATOM   3180  C  "C1'" . DC  B  1  10  ? 110.175 9.739  -56.270 1.00 78.47  ? 156  DC  J "C1'" 1 
ATOM   3181  N  N1    . DC  B  1  10  ? 110.460 11.161 -56.513 1.00 76.25  ? 156  DC  J N1    1 
ATOM   3182  C  C2    . DC  B  1  10  ? 111.744 11.516 -56.915 1.00 74.95  ? 156  DC  J C2    1 
ATOM   3183  O  O2    . DC  B  1  10  ? 112.595 10.624 -57.036 1.00 75.02  ? 156  DC  J O2    1 
ATOM   3184  N  N3    . DC  B  1  10  ? 112.028 12.817 -57.159 1.00 73.36  ? 156  DC  J N3    1 
ATOM   3185  C  C4    . DC  B  1  10  ? 111.081 13.744 -57.004 1.00 72.59  ? 156  DC  J C4    1 
ATOM   3186  N  N4    . DC  B  1  10  ? 111.401 15.013 -57.252 1.00 72.00  ? 156  DC  J N4    1 
ATOM   3187  C  C5    . DC  B  1  10  ? 109.762 13.410 -56.586 1.00 73.59  ? 156  DC  J C5    1 
ATOM   3188  C  C6    . DC  B  1  10  ? 109.497 12.117 -56.354 1.00 75.07  ? 156  DC  J C6    1 
ATOM   3189  P  P     . DA  B  1  11  ? 109.324 6.303  -53.733 1.00 85.21  ? 157  DA  J P     1 
ATOM   3190  O  OP1   . DA  B  1  11  ? 108.693 4.998  -54.072 1.00 84.85  ? 157  DA  J OP1   1 
ATOM   3191  O  OP2   . DA  B  1  11  ? 108.645 7.231  -52.786 1.00 83.28  ? 157  DA  J OP2   1 
ATOM   3192  O  "O5'" . DA  B  1  11  ? 110.787 6.025  -53.187 1.00 84.40  ? 157  DA  J "O5'" 1 
ATOM   3193  C  "C5'" . DA  B  1  11  ? 111.816 5.598  -54.068 1.00 82.20  ? 157  DA  J "C5'" 1 
ATOM   3194  C  "C4'" . DA  B  1  11  ? 113.139 6.154  -53.607 1.00 81.37  ? 157  DA  J "C4'" 1 
ATOM   3195  O  "O4'" . DA  B  1  11  ? 113.293 7.525  -54.053 1.00 80.48  ? 157  DA  J "O4'" 1 
ATOM   3196  C  "C3'" . DA  B  1  11  ? 113.284 6.172  -52.086 1.00 80.75  ? 157  DA  J "C3'" 1 
ATOM   3197  O  "O3'" . DA  B  1  11  ? 114.549 5.641  -51.701 1.00 81.26  ? 157  DA  J "O3'" 1 
ATOM   3198  C  "C2'" . DA  B  1  11  ? 113.160 7.644  -51.725 1.00 79.74  ? 157  DA  J "C2'" 1 
ATOM   3199  C  "C1'" . DA  B  1  11  ? 113.688 8.344  -52.966 1.00 79.02  ? 157  DA  J "C1'" 1 
ATOM   3200  N  N9    . DA  B  1  11  ? 113.140 9.685  -53.186 1.00 78.45  ? 157  DA  J N9    1 
ATOM   3201  C  C8    . DA  B  1  11  ? 111.840 10.098 -53.020 1.00 78.08  ? 157  DA  J C8    1 
ATOM   3202  N  N7    . DA  B  1  11  ? 111.651 11.370 -53.279 1.00 77.45  ? 157  DA  J N7    1 
ATOM   3203  C  C5    . DA  B  1  11  ? 112.909 11.828 -53.646 1.00 77.38  ? 157  DA  J C5    1 
ATOM   3204  C  C6    . DA  B  1  11  ? 113.380 13.100 -54.035 1.00 77.07  ? 157  DA  J C6    1 
ATOM   3205  N  N6    . DA  B  1  11  ? 112.606 14.184 -54.122 1.00 76.37  ? 157  DA  J N6    1 
ATOM   3206  N  N1    . DA  B  1  11  ? 114.693 13.219 -54.332 1.00 76.84  ? 157  DA  J N1    1 
ATOM   3207  C  C2    . DA  B  1  11  ? 115.471 12.134 -54.238 1.00 76.79  ? 157  DA  J C2    1 
ATOM   3208  N  N3    . DA  B  1  11  ? 115.147 10.889 -53.884 1.00 77.54  ? 157  DA  J N3    1 
ATOM   3209  C  C4    . DA  B  1  11  ? 113.836 10.801 -53.596 1.00 77.79  ? 157  DA  J C4    1 
ATOM   3210  P  P     . DC  B  1  12  ? 115.000 5.695  -50.162 1.00 81.51  ? 158  DC  J P     1 
ATOM   3211  O  OP1   . DC  B  1  12  ? 115.936 4.562  -49.937 1.00 82.95  ? 158  DC  J OP1   1 
ATOM   3212  O  OP2   . DC  B  1  12  ? 113.790 5.830  -49.311 1.00 80.09  ? 158  DC  J OP2   1 
ATOM   3213  O  "O5'" . DC  B  1  12  ? 115.825 7.053  -50.104 1.00 80.23  ? 158  DC  J "O5'" 1 
ATOM   3214  C  "C5'" . DC  B  1  12  ? 116.771 7.349  -51.128 1.00 80.58  ? 158  DC  J "C5'" 1 
ATOM   3215  C  "C4'" . DC  B  1  12  ? 117.548 8.592  -50.777 1.00 80.66  ? 158  DC  J "C4'" 1 
ATOM   3216  O  "O4'" . DC  B  1  12  ? 116.841 9.783  -51.203 1.00 80.19  ? 158  DC  J "O4'" 1 
ATOM   3217  C  "C3'" . DC  B  1  12  ? 117.805 8.750  -49.279 1.00 81.48  ? 158  DC  J "C3'" 1 
ATOM   3218  O  "O3'" . DC  B  1  12  ? 119.158 9.142  -49.058 1.00 84.08  ? 158  DC  J "O3'" 1 
ATOM   3219  C  "C2'" . DC  B  1  12  ? 116.850 9.860  -48.871 1.00 80.73  ? 158  DC  J "C2'" 1 
ATOM   3220  C  "C1'" . DC  B  1  12  ? 116.796 10.707 -50.130 1.00 79.33  ? 158  DC  J "C1'" 1 
ATOM   3221  N  N1    . DC  B  1  12  ? 115.584 11.535 -50.278 1.00 76.88  ? 158  DC  J N1    1 
ATOM   3222  C  C2    . DC  B  1  12  ? 115.718 12.853 -50.750 1.00 75.53  ? 158  DC  J C2    1 
ATOM   3223  O  O2    . DC  B  1  12  ? 116.843 13.272 -51.055 1.00 74.41  ? 158  DC  J O2    1 
ATOM   3224  N  N3    . DC  B  1  12  ? 114.619 13.631 -50.862 1.00 73.71  ? 158  DC  J N3    1 
ATOM   3225  C  C4    . DC  B  1  12  ? 113.421 13.143 -50.533 1.00 74.34  ? 158  DC  J C4    1 
ATOM   3226  N  N4    . DC  B  1  12  ? 112.366 13.950 -50.658 1.00 72.96  ? 158  DC  J N4    1 
ATOM   3227  C  C5    . DC  B  1  12  ? 113.252 11.804 -50.062 1.00 74.49  ? 158  DC  J C5    1 
ATOM   3228  C  C6    . DC  B  1  12  ? 114.350 11.042 -49.953 1.00 75.80  ? 158  DC  J C6    1 
ATOM   3229  P  P     . DC  B  1  13  ? 119.678 9.399  -47.562 1.00 85.91  ? 159  DC  J P     1 
ATOM   3230  O  OP1   . DC  B  1  13  ? 121.068 8.882  -47.469 1.00 86.68  ? 159  DC  J OP1   1 
ATOM   3231  O  OP2   . DC  B  1  13  ? 118.644 8.908  -46.616 1.00 84.84  ? 159  DC  J OP2   1 
ATOM   3232  O  "O5'" . DC  B  1  13  ? 119.735 10.986 -47.481 1.00 87.23  ? 159  DC  J "O5'" 1 
ATOM   3233  C  "C5'" . DC  B  1  13  ? 120.460 11.725 -48.461 1.00 89.54  ? 159  DC  J "C5'" 1 
ATOM   3234  C  "C4'" . DC  B  1  13  ? 120.511 13.183 -48.076 1.00 90.96  ? 159  DC  J "C4'" 1 
ATOM   3235  O  "O4'" . DC  B  1  13  ? 119.253 13.831 -48.390 1.00 91.10  ? 159  DC  J "O4'" 1 
ATOM   3236  C  "C3'" . DC  B  1  13  ? 120.747 13.397 -46.583 1.00 91.58  ? 159  DC  J "C3'" 1 
ATOM   3237  O  "O3'" . DC  B  1  13  ? 121.670 14.462 -46.375 1.00 93.27  ? 159  DC  J "O3'" 1 
ATOM   3238  C  "C2'" . DC  B  1  13  ? 119.370 13.756 -46.052 1.00 91.38  ? 159  DC  J "C2'" 1 
ATOM   3239  C  "C1'" . DC  B  1  13  ? 118.736 14.472 -47.234 1.00 90.21  ? 159  DC  J "C1'" 1 
ATOM   3240  N  N1    . DC  B  1  13  ? 117.266 14.387 -47.288 1.00 88.30  ? 159  DC  J N1    1 
ATOM   3241  C  C2    . DC  B  1  13  ? 116.531 15.544 -47.587 1.00 87.35  ? 159  DC  J C2    1 
ATOM   3242  O  O2    . DC  B  1  13  ? 117.139 16.602 -47.806 1.00 86.03  ? 159  DC  J O2    1 
ATOM   3243  N  N3    . DC  B  1  13  ? 115.180 15.476 -47.629 1.00 86.06  ? 159  DC  J N3    1 
ATOM   3244  C  C4    . DC  B  1  13  ? 114.562 14.317 -47.387 1.00 86.46  ? 159  DC  J C4    1 
ATOM   3245  N  N4    . DC  B  1  13  ? 113.227 14.295 -47.433 1.00 84.54  ? 159  DC  J N4    1 
ATOM   3246  C  C5    . DC  B  1  13  ? 115.286 13.125 -47.086 1.00 86.88  ? 159  DC  J C5    1 
ATOM   3247  C  C6    . DC  B  1  13  ? 116.622 13.205 -47.048 1.00 87.60  ? 159  DC  J C6    1 
ATOM   3248  P  P     . DT  B  1  14  ? 122.464 14.556 -44.984 1.00 95.19  ? 160  DT  J P     1 
ATOM   3249  O  OP1   . DT  B  1  14  ? 123.912 14.715 -45.283 1.00 95.23  ? 160  DT  J OP1   1 
ATOM   3250  O  OP2   . DT  B  1  14  ? 122.008 13.433 -44.119 1.00 94.20  ? 160  DT  J OP2   1 
ATOM   3251  O  "O5'" . DT  B  1  14  ? 121.925 15.913 -44.357 1.00 95.78  ? 160  DT  J "O5'" 1 
ATOM   3252  C  "C5'" . DT  B  1  14  ? 121.994 17.126 -45.095 1.00 98.40  ? 160  DT  J "C5'" 1 
ATOM   3253  C  "C4'" . DT  B  1  14  ? 121.100 18.165 -44.464 1.00 100.60 ? 160  DT  J "C4'" 1 
ATOM   3254  O  "O4'" . DT  B  1  14  ? 119.708 17.886 -44.754 1.00 100.34 ? 160  DT  J "O4'" 1 
ATOM   3255  C  "C3'" . DT  B  1  14  ? 121.212 18.236 -42.939 1.00 102.24 ? 160  DT  J "C3'" 1 
ATOM   3256  O  "O3'" . DT  B  1  14  ? 121.122 19.600 -42.529 1.00 105.13 ? 160  DT  J "O3'" 1 
ATOM   3257  C  "C2'" . DT  B  1  14  ? 119.971 17.497 -42.471 1.00 101.48 ? 160  DT  J "C2'" 1 
ATOM   3258  C  "C1'" . DT  B  1  14  ? 118.979 17.918 -43.538 1.00 100.47 ? 160  DT  J "C1'" 1 
ATOM   3259  N  N1    . DT  B  1  14  ? 117.775 17.077 -43.690 1.00 99.46  ? 160  DT  J N1    1 
ATOM   3260  C  C2    . DT  B  1  14  ? 116.665 17.663 -44.256 1.00 98.53  ? 160  DT  J C2    1 
ATOM   3261  O  O2    . DT  B  1  14  ? 116.651 18.818 -44.648 1.00 97.72  ? 160  DT  J O2    1 
ATOM   3262  N  N3    . DT  B  1  14  ? 115.569 16.844 -44.348 1.00 97.66  ? 160  DT  J N3    1 
ATOM   3263  C  C4    . DT  B  1  14  ? 115.473 15.529 -43.943 1.00 97.83  ? 160  DT  J C4    1 
ATOM   3264  O  O4    . DT  B  1  14  ? 114.415 14.922 -44.083 1.00 96.91  ? 160  DT  J O4    1 
ATOM   3265  C  C5    . DT  B  1  14  ? 116.678 14.972 -43.369 1.00 98.40  ? 160  DT  J C5    1 
ATOM   3266  C  C7    . DT  B  1  14  ? 116.669 13.548 -42.909 1.00 98.05  ? 160  DT  J C7    1 
ATOM   3267  C  C6    . DT  B  1  14  ? 117.755 15.763 -43.273 1.00 98.94  ? 160  DT  J C6    1 
ATOM   3268  P  P     . DG  B  1  15  ? 122.428 20.362 -41.991 1.00 106.93 ? 161  DG  J P     1 
ATOM   3269  O  OP1   . DG  B  1  15  ? 123.504 20.207 -43.007 1.00 106.68 ? 161  DG  J OP1   1 
ATOM   3270  O  OP2   . DG  B  1  15  ? 122.668 19.926 -40.589 1.00 106.75 ? 161  DG  J OP2   1 
ATOM   3271  O  "O5'" . DG  B  1  15  ? 121.969 21.886 -41.980 1.00 107.06 ? 161  DG  J "O5'" 1 
ATOM   3272  C  "C5'" . DG  B  1  15  ? 121.664 22.559 -43.200 1.00 107.09 ? 161  DG  J "C5'" 1 
ATOM   3273  C  "C4'" . DG  B  1  15  ? 120.350 23.298 -43.082 1.00 107.43 ? 161  DG  J "C4'" 1 
ATOM   3274  O  "O4'" . DG  B  1  15  ? 119.239 22.368 -43.060 1.00 106.71 ? 161  DG  J "O4'" 1 
ATOM   3275  C  "C3'" . DG  B  1  15  ? 120.208 24.156 -41.827 1.00 107.69 ? 161  DG  J "C3'" 1 
ATOM   3276  O  "O3'" . DG  B  1  15  ? 119.561 25.385 -42.163 1.00 108.84 ? 161  DG  J "O3'" 1 
ATOM   3277  C  "C2'" . DG  B  1  15  ? 119.335 23.310 -40.916 1.00 106.84 ? 161  DG  J "C2'" 1 
ATOM   3278  C  "C1'" . DG  B  1  15  ? 118.441 22.581 -41.905 1.00 106.07 ? 161  DG  J "C1'" 1 
ATOM   3279  N  N9    . DG  B  1  15  ? 117.963 21.278 -41.451 1.00 105.42 ? 161  DG  J N9    1 
ATOM   3280  C  C8    . DG  B  1  15  ? 118.713 20.272 -40.895 1.00 105.24 ? 161  DG  J C8    1 
ATOM   3281  N  N7    . DG  B  1  15  ? 118.017 19.202 -40.622 1.00 104.81 ? 161  DG  J N7    1 
ATOM   3282  C  C5    . DG  B  1  15  ? 116.726 19.522 -41.016 1.00 104.32 ? 161  DG  J C5    1 
ATOM   3283  C  C6    . DG  B  1  15  ? 115.535 18.752 -40.972 1.00 103.85 ? 161  DG  J C6    1 
ATOM   3284  O  O6    . DG  B  1  15  ? 115.382 17.589 -40.580 1.00 102.58 ? 161  DG  J O6    1 
ATOM   3285  N  N1    . DG  B  1  15  ? 114.447 19.468 -41.458 1.00 103.87 ? 161  DG  J N1    1 
ATOM   3286  C  C2    . DG  B  1  15  ? 114.496 20.756 -41.931 1.00 104.20 ? 161  DG  J C2    1 
ATOM   3287  N  N2    . DG  B  1  15  ? 113.333 21.276 -42.349 1.00 104.05 ? 161  DG  J N2    1 
ATOM   3288  N  N3    . DG  B  1  15  ? 115.602 21.481 -41.989 1.00 104.50 ? 161  DG  J N3    1 
ATOM   3289  C  C4    . DG  B  1  15  ? 116.672 20.806 -41.517 1.00 104.81 ? 161  DG  J C4    1 
ATOM   3290  P  P     . DC  B  1  16  ? 119.526 26.581 -41.094 1.00 110.36 ? 162  DC  J P     1 
ATOM   3291  O  OP1   . DC  B  1  16  ? 119.565 27.854 -41.860 1.00 109.85 ? 162  DC  J OP1   1 
ATOM   3292  O  OP2   . DC  B  1  16  ? 120.548 26.319 -40.047 1.00 110.42 ? 162  DC  J OP2   1 
ATOM   3293  O  "O5'" . DC  B  1  16  ? 118.088 26.441 -40.426 1.00 110.11 ? 162  DC  J "O5'" 1 
ATOM   3294  C  "C5'" . DC  B  1  16  ? 116.910 26.740 -41.170 1.00 109.17 ? 162  DC  J "C5'" 1 
ATOM   3295  C  "C4'" . DC  B  1  16  ? 115.687 26.576 -40.299 1.00 108.76 ? 162  DC  J "C4'" 1 
ATOM   3296  O  "O4'" . DC  B  1  16  ? 115.407 25.172 -40.083 1.00 108.48 ? 162  DC  J "O4'" 1 
ATOM   3297  C  "C3'" . DC  B  1  16  ? 115.807 27.210 -38.912 1.00 108.67 ? 162  DC  J "C3'" 1 
ATOM   3298  O  "O3'" . DC  B  1  16  ? 114.570 27.832 -38.566 1.00 108.84 ? 162  DC  J "O3'" 1 
ATOM   3299  C  "C2'" . DC  B  1  16  ? 116.059 26.017 -38.006 1.00 108.43 ? 162  DC  J "C2'" 1 
ATOM   3300  C  "C1'" . DC  B  1  16  ? 115.249 24.935 -38.695 1.00 108.32 ? 162  DC  J "C1'" 1 
ATOM   3301  N  N1    . DC  B  1  16  ? 115.666 23.552 -38.421 1.00 107.89 ? 162  DC  J N1    1 
ATOM   3302  C  C2    . DC  B  1  16  ? 114.691 22.552 -38.423 1.00 107.70 ? 162  DC  J C2    1 
ATOM   3303  O  O2    . DC  B  1  16  ? 113.518 22.865 -38.668 1.00 107.44 ? 162  DC  J O2    1 
ATOM   3304  N  N3    . DC  B  1  16  ? 115.050 21.275 -38.163 1.00 107.46 ? 162  DC  J N3    1 
ATOM   3305  C  C4    . DC  B  1  16  ? 116.327 20.980 -37.913 1.00 107.54 ? 162  DC  J C4    1 
ATOM   3306  N  N4    . DC  B  1  16  ? 116.636 19.707 -37.662 1.00 107.30 ? 162  DC  J N4    1 
ATOM   3307  C  C5    . DC  B  1  16  ? 117.344 21.979 -37.910 1.00 107.72 ? 162  DC  J C5    1 
ATOM   3308  C  C6    . DC  B  1  16  ? 116.972 23.240 -38.166 1.00 107.77 ? 162  DC  J C6    1 
ATOM   3309  P  P     . DA  B  1  17  ? 114.507 29.423 -38.354 1.00 108.74 ? 163  DA  J P     1 
ATOM   3310  O  OP1   . DA  B  1  17  ? 115.203 30.062 -39.500 1.00 108.44 ? 163  DA  J OP1   1 
ATOM   3311  O  OP2   . DA  B  1  17  ? 114.939 29.731 -36.964 1.00 108.86 ? 163  DA  J OP2   1 
ATOM   3312  O  "O5'" . DA  B  1  17  ? 112.955 29.750 -38.493 1.00 109.08 ? 163  DA  J "O5'" 1 
ATOM   3313  C  "C5'" . DA  B  1  17  ? 112.268 29.496 -39.718 1.00 108.04 ? 163  DA  J "C5'" 1 
ATOM   3314  C  "C4'" . DA  B  1  17  ? 111.053 28.634 -39.468 1.00 107.20 ? 163  DA  J "C4'" 1 
ATOM   3315  O  "O4'" . DA  B  1  17  ? 111.475 27.339 -38.974 1.00 106.63 ? 163  DA  J "O4'" 1 
ATOM   3316  C  "C3'" . DA  B  1  17  ? 110.080 29.186 -38.427 1.00 106.97 ? 163  DA  J "C3'" 1 
ATOM   3317  O  "O3'" . DA  B  1  17  ? 108.735 28.895 -38.822 1.00 107.52 ? 163  DA  J "O3'" 1 
ATOM   3318  C  "C2'" . DA  B  1  17  ? 110.454 28.435 -37.162 1.00 106.32 ? 163  DA  J "C2'" 1 
ATOM   3319  C  "C1'" . DA  B  1  17  ? 110.913 27.087 -37.694 1.00 105.75 ? 163  DA  J "C1'" 1 
ATOM   3320  N  N9    . DA  B  1  17  ? 111.942 26.445 -36.875 1.00 105.11 ? 163  DA  J N9    1 
ATOM   3321  C  C8    . DA  B  1  17  ? 113.009 27.042 -36.249 1.00 104.84 ? 163  DA  J C8    1 
ATOM   3322  N  N7    . DA  B  1  17  ? 113.767 26.206 -35.583 1.00 104.62 ? 163  DA  J N7    1 
ATOM   3323  C  C5    . DA  B  1  17  ? 113.160 24.974 -35.781 1.00 104.40 ? 163  DA  J C5    1 
ATOM   3324  C  C6    . DA  B  1  17  ? 113.475 23.679 -35.329 1.00 104.12 ? 163  DA  J C6    1 
ATOM   3325  N  N6    . DA  B  1  17  ? 114.529 23.398 -34.559 1.00 103.80 ? 163  DA  J N6    1 
ATOM   3326  N  N1    . DA  B  1  17  ? 112.660 22.669 -35.700 1.00 103.65 ? 163  DA  J N1    1 
ATOM   3327  C  C2    . DA  B  1  17  ? 111.604 22.951 -36.474 1.00 104.50 ? 163  DA  J C2    1 
ATOM   3328  N  N3    . DA  B  1  17  ? 111.204 24.124 -36.963 1.00 104.60 ? 163  DA  J N3    1 
ATOM   3329  C  C4    . DA  B  1  17  ? 112.034 25.107 -36.574 1.00 104.72 ? 163  DA  J C4    1 
ATOM   3330  P  P     . DG  B  1  18  ? 107.504 29.521 -37.998 1.00 106.98 ? 164  DG  J P     1 
ATOM   3331  O  OP1   . DG  B  1  18  ? 106.451 29.910 -38.969 1.00 106.51 ? 164  DG  J OP1   1 
ATOM   3332  O  OP2   . DG  B  1  18  ? 108.046 30.533 -37.055 1.00 106.65 ? 164  DG  J OP2   1 
ATOM   3333  O  "O5'" . DG  B  1  18  ? 106.963 28.284 -37.158 1.00 105.08 ? 164  DG  J "O5'" 1 
ATOM   3334  C  "C5'" . DG  B  1  18  ? 106.639 27.065 -37.813 1.00 103.71 ? 164  DG  J "C5'" 1 
ATOM   3335  C  "C4'" . DG  B  1  18  ? 106.611 25.928 -36.822 1.00 103.42 ? 164  DG  J "C4'" 1 
ATOM   3336  O  "O4'" . DG  B  1  18  ? 107.935 25.701 -36.280 1.00 103.44 ? 164  DG  J "O4'" 1 
ATOM   3337  C  "C3'" . DG  B  1  18  ? 105.695 26.136 -35.615 1.00 102.88 ? 164  DG  J "C3'" 1 
ATOM   3338  O  "O3'" . DG  B  1  18  ? 105.083 24.889 -35.294 1.00 102.27 ? 164  DG  J "O3'" 1 
ATOM   3339  C  "C2'" . DG  B  1  18  ? 106.665 26.498 -34.506 1.00 102.98 ? 164  DG  J "C2'" 1 
ATOM   3340  C  "C1'" . DG  B  1  18  ? 107.833 25.609 -34.871 1.00 103.66 ? 164  DG  J "C1'" 1 
ATOM   3341  N  N9    . DG  B  1  18  ? 109.122 25.961 -34.283 1.00 104.16 ? 164  DG  J N9    1 
ATOM   3342  C  C8    . DG  B  1  18  ? 109.684 27.210 -34.165 1.00 104.33 ? 164  DG  J C8    1 
ATOM   3343  N  N7    . DG  B  1  18  ? 110.848 27.194 -33.571 1.00 104.38 ? 164  DG  J N7    1 
ATOM   3344  C  C5    . DG  B  1  18  ? 111.067 25.853 -33.283 1.00 104.46 ? 164  DG  J C5    1 
ATOM   3345  C  C6    . DG  B  1  18  ? 112.162 25.215 -32.643 1.00 104.54 ? 164  DG  J C6    1 
ATOM   3346  O  O6    . DG  B  1  18  ? 113.192 25.725 -32.186 1.00 105.46 ? 164  DG  J O6    1 
ATOM   3347  N  N1    . DG  B  1  18  ? 111.975 23.838 -32.562 1.00 104.01 ? 164  DG  J N1    1 
ATOM   3348  C  C2    . DG  B  1  18  ? 110.878 23.160 -33.035 1.00 103.95 ? 164  DG  J C2    1 
ATOM   3349  N  N2    . DG  B  1  18  ? 110.879 21.832 -32.862 1.00 103.58 ? 164  DG  J N2    1 
ATOM   3350  N  N3    . DG  B  1  18  ? 109.854 23.742 -33.633 1.00 103.80 ? 164  DG  J N3    1 
ATOM   3351  C  C4    . DG  B  1  18  ? 110.014 25.080 -33.721 1.00 104.13 ? 164  DG  J C4    1 
ATOM   3352  P  P     . DA  B  1  19  ? 103.684 24.859 -34.517 1.00 101.05 ? 165  DA  J P     1 
ATOM   3353  O  OP1   . DA  B  1  19  ? 102.616 24.804 -35.543 1.00 100.79 ? 165  DA  J OP1   1 
ATOM   3354  O  OP2   . DA  B  1  19  ? 103.670 25.933 -33.496 1.00 101.92 ? 165  DA  J OP2   1 
ATOM   3355  O  "O5'" . DA  B  1  19  ? 103.725 23.455 -33.776 1.00 103.10 ? 165  DA  J "O5'" 1 
ATOM   3356  C  "C5'" . DA  B  1  19  ? 104.061 22.275 -34.498 1.00 106.20 ? 165  DA  J "C5'" 1 
ATOM   3357  C  "C4'" . DA  B  1  19  ? 104.762 21.289 -33.595 1.00 108.27 ? 165  DA  J "C4'" 1 
ATOM   3358  O  "O4'" . DA  B  1  19  ? 106.083 21.775 -33.247 1.00 108.28 ? 165  DA  J "O4'" 1 
ATOM   3359  C  "C3'" . DA  B  1  19  ? 104.045 21.021 -32.273 1.00 109.60 ? 165  DA  J "C3'" 1 
ATOM   3360  O  "O3'" . DA  B  1  19  ? 104.112 19.630 -31.965 1.00 112.34 ? 165  DA  J "O3'" 1 
ATOM   3361  C  "C2'" . DA  B  1  19  ? 104.843 21.832 -31.267 1.00 109.33 ? 165  DA  J "C2'" 1 
ATOM   3362  C  "C1'" . DA  B  1  19  ? 106.245 21.753 -31.837 1.00 108.57 ? 165  DA  J "C1'" 1 
ATOM   3363  N  N9    . DA  B  1  19  ? 107.118 22.867 -31.464 1.00 108.33 ? 165  DA  J N9    1 
ATOM   3364  C  C8    . DA  B  1  19  ? 106.926 24.203 -31.708 1.00 108.46 ? 165  DA  J C8    1 
ATOM   3365  N  N7    . DA  B  1  19  ? 107.890 24.968 -31.254 1.00 108.16 ? 165  DA  J N7    1 
ATOM   3366  C  C5    . DA  B  1  19  ? 108.777 24.075 -30.669 1.00 108.13 ? 165  DA  J C5    1 
ATOM   3367  C  C6    . DA  B  1  19  ? 110.010 24.257 -30.011 1.00 108.21 ? 165  DA  J C6    1 
ATOM   3368  N  N6    . DA  B  1  19  ? 110.583 25.449 -29.822 1.00 107.32 ? 165  DA  J N6    1 
ATOM   3369  N  N1    . DA  B  1  19  ? 110.644 23.156 -29.549 1.00 107.69 ? 165  DA  J N1    1 
ATOM   3370  C  C2    . DA  B  1  19  ? 110.071 21.962 -29.740 1.00 107.94 ? 165  DA  J C2    1 
ATOM   3371  N  N3    . DA  B  1  19  ? 108.919 21.663 -30.340 1.00 108.27 ? 165  DA  J N3    1 
ATOM   3372  C  C4    . DA  B  1  19  ? 108.314 22.777 -30.790 1.00 108.33 ? 165  DA  J C4    1 
ATOM   3373  P  P     . DT  B  1  20  ? 103.436 19.082 -30.620 1.00 115.23 ? 166  DT  J P     1 
ATOM   3374  O  OP1   . DT  B  1  20  ? 102.767 17.795 -30.938 1.00 115.19 ? 166  DT  J OP1   1 
ATOM   3375  O  OP2   . DT  B  1  20  ? 102.655 20.185 -30.003 1.00 115.46 ? 166  DT  J OP2   1 
ATOM   3376  O  "O5'" . DT  B  1  20  ? 104.690 18.766 -29.694 1.00 117.04 ? 166  DT  J "O5'" 1 
ATOM   3377  C  "C5'" . DT  B  1  20  ? 105.701 17.869 -30.139 1.00 120.39 ? 166  DT  J "C5'" 1 
ATOM   3378  C  "C4'" . DT  B  1  20  ? 106.656 17.557 -29.012 1.00 122.85 ? 166  DT  J "C4'" 1 
ATOM   3379  O  "O4'" . DT  B  1  20  ? 107.563 18.666 -28.797 1.00 122.99 ? 166  DT  J "O4'" 1 
ATOM   3380  C  "C3'" . DT  B  1  20  ? 105.978 17.290 -27.668 1.00 124.17 ? 166  DT  J "C3'" 1 
ATOM   3381  O  "O3'" . DT  B  1  20  ? 106.599 16.176 -27.021 1.00 126.61 ? 166  DT  J "O3'" 1 
ATOM   3382  C  "C2'" . DT  B  1  20  ? 106.217 18.573 -26.891 1.00 123.68 ? 166  DT  J "C2'" 1 
ATOM   3383  C  "C1'" . DT  B  1  20  ? 107.566 19.014 -27.423 1.00 123.54 ? 166  DT  J "C1'" 1 
ATOM   3384  N  N1    . DT  B  1  20  ? 107.836 20.460 -27.316 1.00 123.72 ? 166  DT  J N1    1 
ATOM   3385  C  C2    . DT  B  1  20  ? 109.059 20.852 -26.815 1.00 124.15 ? 166  DT  J C2    1 
ATOM   3386  O  O2    . DT  B  1  20  ? 109.923 20.061 -26.466 1.00 124.29 ? 166  DT  J O2    1 
ATOM   3387  N  N3    . DT  B  1  20  ? 109.236 22.212 -26.738 1.00 124.06 ? 166  DT  J N3    1 
ATOM   3388  C  C4    . DT  B  1  20  ? 108.334 23.194 -27.104 1.00 123.71 ? 166  DT  J C4    1 
ATOM   3389  O  O4    . DT  B  1  20  ? 108.635 24.377 -26.977 1.00 123.32 ? 166  DT  J O4    1 
ATOM   3390  C  C5    . DT  B  1  20  ? 107.074 22.711 -27.622 1.00 123.59 ? 166  DT  J C5    1 
ATOM   3391  C  C7    . DT  B  1  20  ? 106.035 23.701 -28.042 1.00 123.53 ? 166  DT  J C7    1 
ATOM   3392  C  C6    . DT  B  1  20  ? 106.891 21.386 -27.702 1.00 123.60 ? 166  DT  J C6    1 
ATOM   3393  P  P     . DT  B  1  21  ? 106.350 15.926 -25.456 1.00 128.29 ? 167  DT  J P     1 
ATOM   3394  O  OP1   . DT  B  1  21  ? 106.565 14.484 -25.170 1.00 128.42 ? 167  DT  J OP1   1 
ATOM   3395  O  OP2   . DT  B  1  21  ? 105.059 16.560 -25.088 1.00 128.15 ? 167  DT  J OP2   1 
ATOM   3396  O  "O5'" . DT  B  1  21  ? 107.524 16.755 -24.775 1.00 129.88 ? 167  DT  J "O5'" 1 
ATOM   3397  C  "C5'" . DT  B  1  21  ? 108.886 16.393 -24.993 1.00 132.37 ? 167  DT  J "C5'" 1 
ATOM   3398  C  "C4'" . DT  B  1  21  ? 109.719 16.780 -23.796 1.00 134.00 ? 167  DT  J "C4'" 1 
ATOM   3399  O  "O4'" . DT  B  1  21  ? 109.945 18.210 -23.803 1.00 133.90 ? 167  DT  J "O4'" 1 
ATOM   3400  C  "C3'" . DT  B  1  21  ? 109.043 16.461 -22.465 1.00 135.49 ? 167  DT  J "C3'" 1 
ATOM   3401  O  "O3'" . DT  B  1  21  ? 109.998 15.993 -21.512 1.00 138.05 ? 167  DT  J "O3'" 1 
ATOM   3402  C  "C2'" . DT  B  1  21  ? 108.451 17.793 -22.041 1.00 134.94 ? 167  DT  J "C2'" 1 
ATOM   3403  C  "C1'" . DT  B  1  21  ? 109.440 18.795 -22.613 1.00 133.94 ? 167  DT  J "C1'" 1 
ATOM   3404  N  N1    . DT  B  1  21  ? 108.846 20.098 -22.970 1.00 133.45 ? 167  DT  J N1    1 
ATOM   3405  C  C2    . DT  B  1  21  ? 109.673 21.197 -23.022 1.00 133.03 ? 167  DT  J C2    1 
ATOM   3406  O  O2    . DT  B  1  21  ? 110.868 21.144 -22.786 1.00 132.99 ? 167  DT  J O2    1 
ATOM   3407  N  N3    . DT  B  1  21  ? 109.045 22.369 -23.364 1.00 132.78 ? 167  DT  J N3    1 
ATOM   3408  C  C4    . DT  B  1  21  ? 107.705 22.546 -23.653 1.00 132.46 ? 167  DT  J C4    1 
ATOM   3409  O  O4    . DT  B  1  21  ? 107.286 23.662 -23.947 1.00 132.11 ? 167  DT  J O4    1 
ATOM   3410  C  C5    . DT  B  1  21  ? 106.896 21.351 -23.578 1.00 132.36 ? 167  DT  J C5    1 
ATOM   3411  C  C7    . DT  B  1  21  ? 105.433 21.444 -23.874 1.00 132.29 ? 167  DT  J C7    1 
ATOM   3412  C  C6    . DT  B  1  21  ? 107.498 20.204 -23.245 1.00 132.87 ? 167  DT  J C6    1 
ATOM   3413  P  P     . DC  B  1  22  ? 109.604 15.937 -19.958 1.00 139.99 ? 168  DC  J P     1 
ATOM   3414  O  OP1   . DC  B  1  22  ? 110.438 14.884 -19.327 1.00 139.95 ? 168  DC  J OP1   1 
ATOM   3415  O  OP2   . DC  B  1  22  ? 108.124 15.867 -19.844 1.00 139.90 ? 168  DC  J OP2   1 
ATOM   3416  O  "O5'" . DC  B  1  22  ? 110.087 17.354 -19.415 1.00 141.40 ? 168  DC  J "O5'" 1 
ATOM   3417  C  "C5'" . DC  B  1  22  ? 111.471 17.692 -19.428 1.00 144.14 ? 168  DC  J "C5'" 1 
ATOM   3418  C  "C4'" . DC  B  1  22  ? 111.771 18.714 -18.358 1.00 146.20 ? 168  DC  J "C4'" 1 
ATOM   3419  O  "O4'" . DC  B  1  22  ? 111.513 20.055 -18.841 1.00 146.44 ? 168  DC  J "O4'" 1 
ATOM   3420  C  "C3'" . DC  B  1  22  ? 110.953 18.550 -17.077 1.00 147.58 ? 168  DC  J "C3'" 1 
ATOM   3421  O  "O3'" . DC  B  1  22  ? 111.793 18.725 -15.933 1.00 149.54 ? 168  DC  J "O3'" 1 
ATOM   3422  C  "C2'" . DC  B  1  22  ? 109.925 19.665 -17.174 1.00 147.47 ? 168  DC  J "C2'" 1 
ATOM   3423  C  "C1'" . DC  B  1  22  ? 110.704 20.744 -17.903 1.00 146.94 ? 168  DC  J "C1'" 1 
ATOM   3424  N  N1    . DC  B  1  22  ? 109.890 21.729 -18.636 1.00 146.86 ? 168  DC  J N1    1 
ATOM   3425  C  C2    . DC  B  1  22  ? 110.417 23.007 -18.847 1.00 146.74 ? 168  DC  J C2    1 
ATOM   3426  O  O2    . DC  B  1  22  ? 111.550 23.267 -18.415 1.00 146.49 ? 168  DC  J O2    1 
ATOM   3427  N  N3    . DC  B  1  22  ? 109.680 23.926 -19.512 1.00 146.70 ? 168  DC  J N3    1 
ATOM   3428  C  C4    . DC  B  1  22  ? 108.465 23.608 -19.961 1.00 146.67 ? 168  DC  J C4    1 
ATOM   3429  N  N4    . DC  B  1  22  ? 107.774 24.548 -20.611 1.00 146.31 ? 168  DC  J N4    1 
ATOM   3430  C  C5    . DC  B  1  22  ? 107.903 22.312 -19.763 1.00 146.75 ? 168  DC  J C5    1 
ATOM   3431  C  C6    . DC  B  1  22  ? 108.644 21.411 -19.102 1.00 146.82 ? 168  DC  J C6    1 
ATOM   3432  P  P     . DT  B  1  23  ? 111.136 19.019 -14.497 1.00 150.78 ? 169  DT  J P     1 
ATOM   3433  O  OP1   . DT  B  1  23  ? 112.098 18.593 -13.450 1.00 150.77 ? 169  DT  J OP1   1 
ATOM   3434  O  OP2   . DT  B  1  23  ? 109.756 18.468 -14.494 1.00 150.62 ? 169  DT  J OP2   1 
ATOM   3435  O  "O5'" . DT  B  1  23  ? 111.038 20.607 -14.468 1.00 151.80 ? 169  DT  J "O5'" 1 
ATOM   3436  C  "C5'" . DT  B  1  23  ? 112.216 21.407 -14.542 1.00 153.45 ? 169  DT  J "C5'" 1 
ATOM   3437  C  "C4'" . DT  B  1  23  ? 111.968 22.752 -13.903 1.00 154.59 ? 169  DT  J "C4'" 1 
ATOM   3438  O  "O4'" . DT  B  1  23  ? 111.191 23.588 -14.796 1.00 155.12 ? 169  DT  J "O4'" 1 
ATOM   3439  C  "C3'" . DT  B  1  23  ? 111.177 22.668 -12.598 1.00 155.11 ? 169  DT  J "C3'" 1 
ATOM   3440  O  "O3'" . DT  B  1  23  ? 111.693 23.590 -11.637 1.00 155.28 ? 169  DT  J "O3'" 1 
ATOM   3441  C  "C2'" . DT  B  1  23  ? 109.768 23.054 -13.011 1.00 155.27 ? 169  DT  J "C2'" 1 
ATOM   3442  C  "C1'" . DT  B  1  23  ? 110.019 24.043 -14.137 1.00 155.24 ? 169  DT  J "C1'" 1 
ATOM   3443  N  N1    . DT  B  1  23  ? 108.937 24.133 -15.140 1.00 155.12 ? 169  DT  J N1    1 
ATOM   3444  C  C2    . DT  B  1  23  ? 108.923 25.227 -15.974 1.00 155.16 ? 169  DT  J C2    1 
ATOM   3445  O  O2    . DT  B  1  23  ? 109.762 26.112 -15.928 1.00 154.85 ? 169  DT  J O2    1 
ATOM   3446  N  N3    . DT  B  1  23  ? 107.884 25.248 -16.871 1.00 155.21 ? 169  DT  J N3    1 
ATOM   3447  C  C4    . DT  B  1  23  ? 106.883 24.306 -17.014 1.00 155.22 ? 169  DT  J C4    1 
ATOM   3448  O  O4    . DT  B  1  23  ? 106.012 24.462 -17.863 1.00 155.34 ? 169  DT  J O4    1 
ATOM   3449  C  C5    . DT  B  1  23  ? 106.963 23.182 -16.111 1.00 155.15 ? 169  DT  J C5    1 
ATOM   3450  C  C7    . DT  B  1  23  ? 105.924 22.108 -16.195 1.00 155.17 ? 169  DT  J C7    1 
ATOM   3451  C  C6    . DT  B  1  23  ? 107.972 23.151 -15.231 1.00 155.08 ? 169  DT  J C6    1 
ATOM   3452  P  P     . DA  B  1  24  ? 111.118 23.577 -10.138 1.00 155.32 ? 170  DA  J P     1 
ATOM   3453  O  OP1   . DA  B  1  24  ? 112.266 23.600 -9.196  1.00 155.50 ? 170  DA  J OP1   1 
ATOM   3454  O  OP2   . DA  B  1  24  ? 110.108 22.489 -10.041 1.00 155.36 ? 170  DA  J OP2   1 
ATOM   3455  O  "O5'" . DA  B  1  24  ? 110.358 24.968 -10.031 1.00 154.45 ? 170  DA  J "O5'" 1 
ATOM   3456  C  "C5'" . DA  B  1  24  ? 111.053 26.188 -10.261 1.00 152.88 ? 170  DA  J "C5'" 1 
ATOM   3457  C  "C4'" . DA  B  1  24  ? 110.094 27.351 -10.182 1.00 151.82 ? 170  DA  J "C4'" 1 
ATOM   3458  O  "O4'" . DA  B  1  24  ? 109.252 27.377 -11.362 1.00 151.74 ? 170  DA  J "O4'" 1 
ATOM   3459  C  "C3'" . DA  B  1  24  ? 109.149 27.293 -8.982  1.00 151.04 ? 170  DA  J "C3'" 1 
ATOM   3460  O  "O3'" . DA  B  1  24  ? 109.014 28.595 -8.404  1.00 149.53 ? 170  DA  J "O3'" 1 
ATOM   3461  C  "C2'" . DA  B  1  24  ? 107.843 26.804 -9.584  1.00 151.27 ? 170  DA  J "C2'" 1 
ATOM   3462  C  "C1'" . DA  B  1  24  ? 107.885 27.402 -10.978 1.00 151.48 ? 170  DA  J "C1'" 1 
ATOM   3463  N  N9    . DA  B  1  24  ? 107.114 26.660 -11.978 1.00 151.12 ? 170  DA  J N9    1 
ATOM   3464  C  C8    . DA  B  1  24  ? 106.967 25.299 -12.094 1.00 150.88 ? 170  DA  J C8    1 
ATOM   3465  N  N7    . DA  B  1  24  ? 106.196 24.933 -13.090 1.00 150.70 ? 170  DA  J N7    1 
ATOM   3466  C  C5    . DA  B  1  24  ? 105.810 26.132 -13.673 1.00 150.66 ? 170  DA  J C5    1 
ATOM   3467  C  C6    . DA  B  1  24  ? 104.987 26.428 -14.776 1.00 150.57 ? 170  DA  J C6    1 
ATOM   3468  N  N6    . DA  B  1  24  ? 104.377 25.500 -15.517 1.00 150.39 ? 170  DA  J N6    1 
ATOM   3469  N  N1    . DA  B  1  24  ? 104.809 27.729 -15.094 1.00 150.41 ? 170  DA  J N1    1 
ATOM   3470  C  C2    . DA  B  1  24  ? 105.418 28.660 -14.349 1.00 150.37 ? 170  DA  J C2    1 
ATOM   3471  N  N3    . DA  B  1  24  ? 106.213 28.507 -13.292 1.00 150.53 ? 170  DA  J N3    1 
ATOM   3472  C  C4    . DA  B  1  24  ? 106.371 27.204 -13.001 1.00 150.80 ? 170  DA  J C4    1 
ATOM   3473  P  P     . DC  B  1  25  ? 107.678 28.979 -7.599  1.00 148.02 ? 171  DC  J P     1 
ATOM   3474  O  OP1   . DC  B  1  25  ? 107.996 30.108 -6.689  1.00 148.26 ? 171  DC  J OP1   1 
ATOM   3475  O  OP2   . DC  B  1  25  ? 107.083 27.734 -7.046  1.00 147.95 ? 171  DC  J OP2   1 
ATOM   3476  O  "O5'" . DC  B  1  25  ? 106.726 29.528 -8.747  1.00 146.26 ? 171  DC  J "O5'" 1 
ATOM   3477  C  "C5'" . DC  B  1  25  ? 107.112 30.662 -9.518  1.00 143.36 ? 171  DC  J "C5'" 1 
ATOM   3478  C  "C4'" . DC  B  1  25  ? 105.909 31.532 -9.782  1.00 141.35 ? 171  DC  J "C4'" 1 
ATOM   3479  O  "O4'" . DC  B  1  25  ? 105.103 30.939 -10.826 1.00 140.98 ? 171  DC  J "O4'" 1 
ATOM   3480  C  "C3'" . DC  B  1  25  ? 105.001 31.665 -8.562  1.00 140.21 ? 171  DC  J "C3'" 1 
ATOM   3481  O  "O3'" . DC  B  1  25  ? 104.486 32.990 -8.464  1.00 138.69 ? 171  DC  J "O3'" 1 
ATOM   3482  C  "C2'" . DC  B  1  25  ? 103.901 30.651 -8.823  1.00 140.07 ? 171  DC  J "C2'" 1 
ATOM   3483  C  "C1'" . DC  B  1  25  ? 103.804 30.629 -10.341 1.00 140.04 ? 171  DC  J "C1'" 1 
ATOM   3484  N  N1    . DC  B  1  25  ? 103.417 29.326 -10.913 1.00 139.08 ? 171  DC  J N1    1 
ATOM   3485  C  C2    . DC  B  1  25  ? 102.677 29.305 -12.099 1.00 138.41 ? 171  DC  J C2    1 
ATOM   3486  O  O2    . DC  B  1  25  ? 102.365 30.382 -12.630 1.00 138.02 ? 171  DC  J O2    1 
ATOM   3487  N  N3    . DC  B  1  25  ? 102.323 28.115 -12.637 1.00 137.73 ? 171  DC  J N3    1 
ATOM   3488  C  C4    . DC  B  1  25  ? 102.680 26.978 -12.035 1.00 137.58 ? 171  DC  J C4    1 
ATOM   3489  N  N4    . DC  B  1  25  ? 102.312 25.827 -12.602 1.00 136.97 ? 171  DC  J N4    1 
ATOM   3490  C  C5    . DC  B  1  25  ? 103.432 26.970 -10.825 1.00 137.97 ? 171  DC  J C5    1 
ATOM   3491  C  C6    . DC  B  1  25  ? 103.775 28.155 -10.303 1.00 138.68 ? 171  DC  J C6    1 
ATOM   3492  P  P     . DC  B  1  26  ? 103.675 33.427 -7.153  1.00 137.63 ? 172  DC  J P     1 
ATOM   3493  O  OP1   . DC  B  1  26  ? 103.961 34.865 -6.909  1.00 137.35 ? 172  DC  J OP1   1 
ATOM   3494  O  OP2   . DC  B  1  26  ? 103.938 32.432 -6.080  1.00 137.31 ? 172  DC  J OP2   1 
ATOM   3495  O  "O5'" . DC  B  1  26  ? 102.156 33.282 -7.606  1.00 136.70 ? 172  DC  J "O5'" 1 
ATOM   3496  C  "C5'" . DC  B  1  26  ? 101.651 34.050 -8.695  1.00 134.81 ? 172  DC  J "C5'" 1 
ATOM   3497  C  "C4'" . DC  B  1  26  ? 100.206 33.699 -8.956  1.00 133.21 ? 172  DC  J "C4'" 1 
ATOM   3498  O  "O4'" . DC  B  1  26  ? 100.110 32.422 -9.631  1.00 133.22 ? 172  DC  J "O4'" 1 
ATOM   3499  C  "C3'" . DC  B  1  26  ? 99.352  33.583 -7.694  1.00 132.33 ? 172  DC  J "C3'" 1 
ATOM   3500  O  "O3'" . DC  B  1  26  ? 98.074  34.171 -7.928  1.00 130.76 ? 172  DC  J "O3'" 1 
ATOM   3501  C  "C2'" . DC  B  1  26  ? 99.210  32.083 -7.504  1.00 132.53 ? 172  DC  J "C2'" 1 
ATOM   3502  C  "C1'" . DC  B  1  26  ? 99.191  31.594 -8.940  1.00 132.85 ? 172  DC  J "C1'" 1 
ATOM   3503  N  N1    . DC  B  1  26  ? 99.594  30.192 -9.146  1.00 132.78 ? 172  DC  J N1    1 
ATOM   3504  C  C2    . DC  B  1  26  ? 99.109  29.518 -10.271 1.00 133.13 ? 172  DC  J C2    1 
ATOM   3505  O  O2    . DC  B  1  26  ? 98.371  30.125 -11.062 1.00 133.50 ? 172  DC  J O2    1 
ATOM   3506  N  N3    . DC  B  1  26  ? 99.457  28.226 -10.471 1.00 133.04 ? 172  DC  J N3    1 
ATOM   3507  C  C4    . DC  B  1  26  ? 100.257 27.610 -9.601  1.00 132.72 ? 172  DC  J C4    1 
ATOM   3508  N  N4    . DC  B  1  26  ? 100.570 26.333 -9.836  1.00 132.51 ? 172  DC  J N4    1 
ATOM   3509  C  C5    . DC  B  1  26  ? 100.773 28.275 -8.450  1.00 132.73 ? 172  DC  J C5    1 
ATOM   3510  C  C6    . DC  B  1  26  ? 100.420 29.554 -8.263  1.00 132.66 ? 172  DC  J C6    1 
ATOM   3511  P  P     . DA  B  1  27  ? 97.677  35.532 -7.177  1.00 129.58 ? 173  DA  J P     1 
ATOM   3512  O  OP1   . DA  B  1  27  ? 98.816  36.477 -7.300  1.00 129.45 ? 173  DA  J OP1   1 
ATOM   3513  O  OP2   . DA  B  1  27  ? 97.156  35.175 -5.831  1.00 129.48 ? 173  DA  J OP2   1 
ATOM   3514  O  "O5'" . DA  B  1  27  ? 96.475  36.096 -8.051  1.00 128.14 ? 173  DA  J "O5'" 1 
ATOM   3515  C  "C5'" . DA  B  1  27  ? 96.684  36.474 -9.408  1.00 125.45 ? 173  DA  J "C5'" 1 
ATOM   3516  C  "C4'" . DA  B  1  27  ? 95.711  35.747 -10.306 1.00 123.52 ? 173  DA  J "C4'" 1 
ATOM   3517  O  "O4'" . DA  B  1  27  ? 96.005  34.329 -10.315 1.00 122.45 ? 173  DA  J "O4'" 1 
ATOM   3518  C  "C3'" . DA  B  1  27  ? 94.248  35.867 -9.884  1.00 122.47 ? 173  DA  J "C3'" 1 
ATOM   3519  O  "O3'" . DA  B  1  27  ? 93.433  35.930 -11.052 1.00 121.28 ? 173  DA  J "O3'" 1 
ATOM   3520  C  "C2'" . DA  B  1  27  ? 93.995  34.566 -9.146  1.00 121.90 ? 173  DA  J "C2'" 1 
ATOM   3521  C  "C1'" . DA  B  1  27  ? 94.850  33.597 -9.937  1.00 121.78 ? 173  DA  J "C1'" 1 
ATOM   3522  N  N9    . DA  B  1  27  ? 95.289  32.417 -9.193  1.00 121.58 ? 173  DA  J N9    1 
ATOM   3523  C  C8    . DA  B  1  27  ? 95.781  32.356 -7.914  1.00 121.55 ? 173  DA  J C8    1 
ATOM   3524  N  N7    . DA  B  1  27  ? 96.105  31.145 -7.529  1.00 121.53 ? 173  DA  J N7    1 
ATOM   3525  C  C5    . DA  B  1  27  ? 95.802  30.353 -8.628  1.00 121.39 ? 173  DA  J C5    1 
ATOM   3526  C  C6    . DA  B  1  27  ? 95.916  28.968 -8.861  1.00 121.18 ? 173  DA  J C6    1 
ATOM   3527  N  N6    . DA  B  1  27  ? 96.391  28.100 -7.965  1.00 120.57 ? 173  DA  J N6    1 
ATOM   3528  N  N1    . DA  B  1  27  ? 95.522  28.501 -10.064 1.00 121.19 ? 173  DA  J N1    1 
ATOM   3529  C  C2    . DA  B  1  27  ? 95.051  29.371 -10.967 1.00 121.63 ? 173  DA  J C2    1 
ATOM   3530  N  N3    . DA  B  1  27  ? 94.896  30.690 -10.868 1.00 121.88 ? 173  DA  J N3    1 
ATOM   3531  C  C4    . DA  B  1  27  ? 95.295  31.124 -9.659  1.00 121.69 ? 173  DA  J C4    1 
ATOM   3532  P  P     . DA  B  1  28  ? 91.936  36.497 -10.953 1.00 120.52 ? 174  DA  J P     1 
ATOM   3533  O  OP1   . DA  B  1  28  ? 91.928  37.898 -11.449 1.00 120.11 ? 174  DA  J OP1   1 
ATOM   3534  O  OP2   . DA  B  1  28  ? 91.417  36.192 -9.595  1.00 120.39 ? 174  DA  J OP2   1 
ATOM   3535  O  "O5'" . DA  B  1  28  ? 91.151  35.592 -11.997 1.00 118.63 ? 174  DA  J "O5'" 1 
ATOM   3536  C  "C5'" . DA  B  1  28  ? 91.804  35.119 -13.171 1.00 116.17 ? 174  DA  J "C5'" 1 
ATOM   3537  C  "C4'" . DA  B  1  28  ? 91.345  33.717 -13.489 1.00 114.37 ? 174  DA  J "C4'" 1 
ATOM   3538  O  "O4'" . DA  B  1  28  ? 91.893  32.779 -12.530 1.00 113.77 ? 174  DA  J "O4'" 1 
ATOM   3539  C  "C3'" . DA  B  1  28  ? 89.829  33.544 -13.435 1.00 113.25 ? 174  DA  J "C3'" 1 
ATOM   3540  O  "O3'" . DA  B  1  28  ? 89.403  32.688 -14.495 1.00 111.53 ? 174  DA  J "O3'" 1 
ATOM   3541  C  "C2'" . DA  B  1  28  ? 89.599  32.901 -12.078 1.00 112.93 ? 174  DA  J "C2'" 1 
ATOM   3542  C  "C1'" . DA  B  1  28  ? 90.843  32.048 -11.913 1.00 112.98 ? 174  DA  J "C1'" 1 
ATOM   3543  N  N9    . DA  B  1  28  ? 91.229  31.796 -10.524 1.00 112.61 ? 174  DA  J N9    1 
ATOM   3544  C  C8    . DA  B  1  28  ? 91.291  32.703 -9.495  1.00 112.55 ? 174  DA  J C8    1 
ATOM   3545  N  N7    . DA  B  1  28  ? 91.689  32.187 -8.357  1.00 112.20 ? 174  DA  J N7    1 
ATOM   3546  C  C5    . DA  B  1  28  ? 91.900  30.848 -8.654  1.00 111.43 ? 174  DA  J C5    1 
ATOM   3547  C  C6    . DA  B  1  28  ? 92.334  29.762 -7.871  1.00 110.93 ? 174  DA  J C6    1 
ATOM   3548  N  N6    . DA  B  1  28  ? 92.648  29.861 -6.578  1.00 110.59 ? 174  DA  J N6    1 
ATOM   3549  N  N1    . DA  B  1  28  ? 92.434  28.556 -8.470  1.00 110.45 ? 174  DA  J N1    1 
ATOM   3550  C  C2    . DA  B  1  28  ? 92.120  28.459 -9.766  1.00 110.89 ? 174  DA  J C2    1 
ATOM   3551  N  N3    . DA  B  1  28  ? 91.706  29.404 -10.608 1.00 111.64 ? 174  DA  J N3    1 
ATOM   3552  C  C4    . DA  B  1  28  ? 91.616  30.591 -9.983  1.00 111.88 ? 174  DA  J C4    1 
ATOM   3553  P  P     . DA  B  1  29  ? 87.877  32.734 -14.987 1.00 110.55 ? 175  DA  J P     1 
ATOM   3554  O  OP1   . DA  B  1  29  ? 87.853  32.779 -16.472 1.00 111.10 ? 175  DA  J OP1   1 
ATOM   3555  O  OP2   . DA  B  1  29  ? 87.183  33.790 -14.205 1.00 110.58 ? 175  DA  J OP2   1 
ATOM   3556  O  "O5'" . DA  B  1  29  ? 87.318  31.327 -14.513 1.00 107.98 ? 175  DA  J "O5'" 1 
ATOM   3557  C  "C5'" . DA  B  1  29  ? 87.876  30.704 -13.372 1.00 104.64 ? 175  DA  J "C5'" 1 
ATOM   3558  C  "C4'" . DA  B  1  29  ? 87.616  29.220 -13.401 1.00 102.82 ? 175  DA  J "C4'" 1 
ATOM   3559  O  "O4'" . DA  B  1  29  ? 88.241  28.653 -12.233 1.00 103.18 ? 175  DA  J "O4'" 1 
ATOM   3560  C  "C3'" . DA  B  1  29  ? 86.141  28.863 -13.288 1.00 101.39 ? 175  DA  J "C3'" 1 
ATOM   3561  O  "O3'" . DA  B  1  29  ? 85.920  27.587 -13.887 1.00 97.99  ? 175  DA  J "O3'" 1 
ATOM   3562  C  "C2'" . DA  B  1  29  ? 85.921  28.826 -11.788 1.00 102.45 ? 175  DA  J "C2'" 1 
ATOM   3563  C  "C1'" . DA  B  1  29  ? 87.267  28.357 -11.242 1.00 103.53 ? 175  DA  J "C1'" 1 
ATOM   3564  N  N9    . DA  B  1  29  ? 87.678  29.047 -10.021 1.00 104.16 ? 175  DA  J N9    1 
ATOM   3565  C  C8    . DA  B  1  29  ? 87.473  30.365 -9.689  1.00 104.07 ? 175  DA  J C8    1 
ATOM   3566  N  N7    . DA  B  1  29  ? 87.979  30.701 -8.529  1.00 104.27 ? 175  DA  J N7    1 
ATOM   3567  C  C5    . DA  B  1  29  ? 88.551  29.526 -8.063  1.00 104.45 ? 175  DA  J C5    1 
ATOM   3568  C  C6    . DA  B  1  29  ? 89.250  29.218 -6.887  1.00 105.08 ? 175  DA  J C6    1 
ATOM   3569  N  N6    . DA  B  1  29  ? 89.502  30.107 -5.923  1.00 106.35 ? 175  DA  J N6    1 
ATOM   3570  N  N1    . DA  B  1  29  ? 89.688  27.951 -6.730  1.00 104.87 ? 175  DA  J N1    1 
ATOM   3571  C  C2    . DA  B  1  29  ? 89.435  27.062 -7.697  1.00 104.28 ? 175  DA  J C2    1 
ATOM   3572  N  N3    . DA  B  1  29  ? 88.790  27.229 -8.846  1.00 103.96 ? 175  DA  J N3    1 
ATOM   3573  C  C4    . DA  B  1  29  ? 88.369  28.499 -8.970  1.00 104.13 ? 175  DA  J C4    1 
ATOM   3574  P  P     . DA  B  1  30  ? 84.450  27.181 -14.386 1.00 95.03  ? 176  DA  J P     1 
ATOM   3575  O  OP1   . DA  B  1  30  ? 84.504  27.005 -15.858 1.00 95.97  ? 176  DA  J OP1   1 
ATOM   3576  O  OP2   . DA  B  1  30  ? 83.470  28.126 -13.793 1.00 95.00  ? 176  DA  J OP2   1 
ATOM   3577  O  "O5'" . DA  B  1  30  ? 84.227  25.758 -13.717 1.00 94.35  ? 176  DA  J "O5'" 1 
ATOM   3578  C  "C5'" . DA  B  1  30  ? 85.263  24.780 -13.732 1.00 92.41  ? 176  DA  J "C5'" 1 
ATOM   3579  C  "C4'" . DA  B  1  30  ? 85.202  23.938 -12.479 1.00 91.56  ? 176  DA  J "C4'" 1 
ATOM   3580  O  "O4'" . DA  B  1  30  ? 85.666  24.704 -11.340 1.00 90.91  ? 176  DA  J "O4'" 1 
ATOM   3581  C  "C3'" . DA  B  1  30  ? 83.801  23.446 -12.115 1.00 90.72  ? 176  DA  J "C3'" 1 
ATOM   3582  O  "O3'" . DA  B  1  30  ? 83.864  22.101 -11.646 1.00 90.07  ? 176  DA  J "O3'" 1 
ATOM   3583  C  "C2'" . DA  B  1  30  ? 83.389  24.365 -10.980 1.00 90.97  ? 176  DA  J "C2'" 1 
ATOM   3584  C  "C1'" . DA  B  1  30  ? 84.716  24.606 -10.292 1.00 91.52  ? 176  DA  J "C1'" 1 
ATOM   3585  N  N9    . DA  B  1  30  ? 84.797  25.827 -9.491  1.00 92.88  ? 176  DA  J N9    1 
ATOM   3586  C  C8    . DA  B  1  30  ? 84.272  27.063 -9.772  1.00 93.59  ? 176  DA  J C8    1 
ATOM   3587  N  N7    . DA  B  1  30  ? 84.529  27.968 -8.857  1.00 93.69  ? 176  DA  J N7    1 
ATOM   3588  C  C5    . DA  B  1  30  ? 85.269  27.279 -7.906  1.00 93.84  ? 176  DA  J C5    1 
ATOM   3589  C  C6    . DA  B  1  30  ? 85.850  27.677 -6.684  1.00 93.95  ? 176  DA  J C6    1 
ATOM   3590  N  N6    . DA  B  1  30  ? 85.783  28.918 -6.197  1.00 93.61  ? 176  DA  J N6    1 
ATOM   3591  N  N1    . DA  B  1  30  ? 86.514  26.742 -5.973  1.00 93.55  ? 176  DA  J N1    1 
ATOM   3592  C  C2    . DA  B  1  30  ? 86.591  25.498 -6.463  1.00 93.88  ? 176  DA  J C2    1 
ATOM   3593  N  N3    . DA  B  1  30  ? 86.094  25.005 -7.596  1.00 93.91  ? 176  DA  J N3    1 
ATOM   3594  C  C4    . DA  B  1  30  ? 85.436  25.958 -8.280  1.00 93.66  ? 176  DA  J C4    1 
ATOM   3595  P  P     . DG  B  1  31  ? 82.530  21.210 -11.611 1.00 89.53  ? 177  DG  J P     1 
ATOM   3596  O  OP1   . DG  B  1  31  ? 82.677  20.110 -12.597 1.00 89.37  ? 177  DG  J OP1   1 
ATOM   3597  O  OP2   . DG  B  1  31  ? 81.367  22.127 -11.697 1.00 89.26  ? 177  DG  J OP2   1 
ATOM   3598  O  "O5'" . DG  B  1  31  ? 82.545  20.576 -10.151 1.00 92.55  ? 177  DG  J "O5'" 1 
ATOM   3599  C  "C5'" . DG  B  1  31  ? 83.596  19.698 -9.749  1.00 95.23  ? 177  DG  J "C5'" 1 
ATOM   3600  C  "C4'" . DG  B  1  31  ? 83.483  19.391 -8.274  1.00 97.08  ? 177  DG  J "C4'" 1 
ATOM   3601  O  "O4'" . DG  B  1  31  ? 83.835  20.554 -7.490  1.00 97.41  ? 177  DG  J "O4'" 1 
ATOM   3602  C  "C3'" . DG  B  1  31  ? 82.084  18.986 -7.823  1.00 98.08  ? 177  DG  J "C3'" 1 
ATOM   3603  O  "O3'" . DG  B  1  31  ? 82.194  17.967 -6.833  1.00 100.71 ? 177  DG  J "O3'" 1 
ATOM   3604  C  "C2'" . DG  B  1  31  ? 81.512  20.269 -7.244  1.00 97.32  ? 177  DG  J "C2'" 1 
ATOM   3605  C  "C1'" . DG  B  1  31  ? 82.740  20.966 -6.682  1.00 97.76  ? 177  DG  J "C1'" 1 
ATOM   3606  N  N9    . DG  B  1  31  ? 82.691  22.424 -6.731  1.00 98.51  ? 177  DG  J N9    1 
ATOM   3607  C  C8    . DG  B  1  31  ? 82.597  23.205 -7.857  1.00 98.51  ? 177  DG  J C8    1 
ATOM   3608  N  N7    . DG  B  1  31  ? 82.616  24.484 -7.599  1.00 98.56  ? 177  DG  J N7    1 
ATOM   3609  C  C5    . DG  B  1  31  ? 82.720  24.555 -6.217  1.00 99.44  ? 177  DG  J C5    1 
ATOM   3610  C  C6    . DG  B  1  31  ? 82.791  25.684 -5.356  1.00 99.64  ? 177  DG  J C6    1 
ATOM   3611  O  O6    . DG  B  1  31  ? 82.785  26.882 -5.656  1.00 99.68  ? 177  DG  J O6    1 
ATOM   3612  N  N1    . DG  B  1  31  ? 82.879  25.305 -4.020  1.00 99.60  ? 177  DG  J N1    1 
ATOM   3613  C  C2    . DG  B  1  31  ? 82.898  24.009 -3.568  1.00 99.89  ? 177  DG  J C2    1 
ATOM   3614  N  N2    . DG  B  1  31  ? 82.970  23.851 -2.237  1.00 100.55 ? 177  DG  J N2    1 
ATOM   3615  N  N3    . DG  B  1  31  ? 82.846  22.947 -4.359  1.00 99.84  ? 177  DG  J N3    1 
ATOM   3616  C  C4    . DG  B  1  31  ? 82.757  23.292 -5.663  1.00 99.37  ? 177  DG  J C4    1 
ATOM   3617  P  P     . DT  B  1  32  ? 80.933  17.031 -6.513  1.00 102.51 ? 178  DT  J P     1 
ATOM   3618  O  OP1   . DT  B  1  32  ? 81.457  15.655 -6.326  1.00 102.18 ? 178  DT  J OP1   1 
ATOM   3619  O  OP2   . DT  B  1  32  ? 79.871  17.281 -7.517  1.00 102.85 ? 178  DT  J OP2   1 
ATOM   3620  O  "O5'" . DT  B  1  32  ? 80.436  17.582 -5.106  1.00 104.11 ? 178  DT  J "O5'" 1 
ATOM   3621  C  "C5'" . DT  B  1  32  ? 81.295  17.533 -3.974  1.00 106.27 ? 178  DT  J "C5'" 1 
ATOM   3622  C  "C4'" . DT  B  1  32  ? 80.677  18.272 -2.812  1.00 108.23 ? 178  DT  J "C4'" 1 
ATOM   3623  O  "O4'" . DT  B  1  32  ? 80.839  19.703 -2.965  1.00 107.95 ? 178  DT  J "O4'" 1 
ATOM   3624  C  "C3'" . DT  B  1  32  ? 79.183  18.031 -2.604  1.00 109.58 ? 178  DT  J "C3'" 1 
ATOM   3625  O  "O3'" . DT  B  1  32  ? 78.926  17.886 -1.212  1.00 112.90 ? 178  DT  J "O3'" 1 
ATOM   3626  C  "C2'" . DT  B  1  32  ? 78.552  19.323 -3.089  1.00 109.15 ? 178  DT  J "C2'" 1 
ATOM   3627  C  "C1'" . DT  B  1  32  ? 79.607  20.335 -2.684  1.00 108.30 ? 178  DT  J "C1'" 1 
ATOM   3628  N  N1    . DT  B  1  32  ? 79.574  21.619 -3.407  1.00 108.60 ? 178  DT  J N1    1 
ATOM   3629  C  C2    . DT  B  1  32  ? 79.868  22.763 -2.698  1.00 108.35 ? 178  DT  J C2    1 
ATOM   3630  O  O2    . DT  B  1  32  ? 80.164  22.756 -1.515  1.00 108.56 ? 178  DT  J O2    1 
ATOM   3631  N  N3    . DT  B  1  32  ? 79.805  23.922 -3.430  1.00 108.27 ? 178  DT  J N3    1 
ATOM   3632  C  C4    . DT  B  1  32  ? 79.485  24.048 -4.769  1.00 108.16 ? 178  DT  J C4    1 
ATOM   3633  O  O4    . DT  B  1  32  ? 79.463  25.160 -5.289  1.00 107.81 ? 178  DT  J O4    1 
ATOM   3634  C  C5    . DT  B  1  32  ? 79.195  22.806 -5.453  1.00 108.18 ? 178  DT  J C5    1 
ATOM   3635  C  C7    . DT  B  1  32  ? 78.843  22.841 -6.906  1.00 107.94 ? 178  DT  J C7    1 
ATOM   3636  C  C6    . DT  B  1  32  ? 79.255  21.670 -4.747  1.00 108.47 ? 178  DT  J C6    1 
ATOM   3637  P  P     . DG  B  1  33  ? 77.737  16.932 -0.716  1.00 115.14 ? 179  DG  J P     1 
ATOM   3638  O  OP1   . DG  B  1  33  ? 78.259  15.545 -0.609  1.00 115.04 ? 179  DG  J OP1   1 
ATOM   3639  O  OP2   . DG  B  1  33  ? 76.543  17.206 -1.556  1.00 115.11 ? 179  DG  J OP2   1 
ATOM   3640  O  "O5'" . DG  B  1  33  ? 77.444  17.481 0.745   1.00 116.46 ? 179  DG  J "O5'" 1 
ATOM   3641  C  "C5'" . DG  B  1  33  ? 78.506  17.961 1.565   1.00 119.41 ? 179  DG  J "C5'" 1 
ATOM   3642  C  "C4'" . DG  B  1  33  ? 78.072  19.214 2.286   1.00 121.55 ? 179  DG  J "C4'" 1 
ATOM   3643  O  "O4'" . DG  B  1  33  ? 78.205  20.374 1.426   1.00 122.06 ? 179  DG  J "O4'" 1 
ATOM   3644  C  "C3'" . DG  B  1  33  ? 76.611  19.174 2.732   1.00 122.53 ? 179  DG  J "C3'" 1 
ATOM   3645  O  "O3'" . DG  B  1  33  ? 76.470  19.680 4.057   1.00 123.54 ? 179  DG  J "O3'" 1 
ATOM   3646  C  "C2'" . DG  B  1  33  ? 75.906  20.074 1.733   1.00 122.49 ? 179  DG  J "C2'" 1 
ATOM   3647  C  "C1'" . DG  B  1  33  ? 76.979  21.090 1.389   1.00 122.63 ? 179  DG  J "C1'" 1 
ATOM   3648  N  N9    . DG  B  1  33  ? 76.835  21.676 0.059   1.00 123.00 ? 179  DG  J N9    1 
ATOM   3649  C  C8    . DG  B  1  33  ? 76.603  21.004 -1.117  1.00 123.03 ? 179  DG  J C8    1 
ATOM   3650  N  N7    . DG  B  1  33  ? 76.504  21.795 -2.150  1.00 122.93 ? 179  DG  J N7    1 
ATOM   3651  C  C5    . DG  B  1  33  ? 76.686  23.069 -1.628  1.00 122.90 ? 179  DG  J C5    1 
ATOM   3652  C  C6    . DG  B  1  33  ? 76.685  24.335 -2.272  1.00 122.90 ? 179  DG  J C6    1 
ATOM   3653  O  O6    . DG  B  1  33  ? 76.515  24.591 -3.470  1.00 123.14 ? 179  DG  J O6    1 
ATOM   3654  N  N1    . DG  B  1  33  ? 76.910  25.368 -1.368  1.00 122.55 ? 179  DG  J N1    1 
ATOM   3655  C  C2    . DG  B  1  33  ? 77.110  25.209 -0.021  1.00 122.29 ? 179  DG  J C2    1 
ATOM   3656  N  N2    . DG  B  1  33  ? 77.313  26.333 0.680   1.00 121.69 ? 179  DG  J N2    1 
ATOM   3657  N  N3    . DG  B  1  33  ? 77.113  24.035 0.593   1.00 122.74 ? 179  DG  J N3    1 
ATOM   3658  C  C4    . DG  B  1  33  ? 76.896  23.015 -0.266  1.00 122.95 ? 179  DG  J C4    1 
ATOM   3659  P  P     . DT  B  1  34  ? 75.012  19.759 4.718   1.00 124.21 ? 180  DT  J P     1 
ATOM   3660  O  OP1   . DT  B  1  34  ? 75.162  19.532 6.176   1.00 124.48 ? 180  DT  J OP1   1 
ATOM   3661  O  OP2   . DT  B  1  34  ? 74.080  18.905 3.933   1.00 124.26 ? 180  DT  J OP2   1 
ATOM   3662  O  "O5'" . DT  B  1  34  ? 74.610  21.278 4.490   1.00 124.06 ? 180  DT  J "O5'" 1 
ATOM   3663  C  "C5'" . DT  B  1  34  ? 75.393  22.319 5.055   1.00 124.59 ? 180  DT  J "C5'" 1 
ATOM   3664  C  "C4'" . DT  B  1  34  ? 74.602  23.601 5.064   1.00 125.52 ? 180  DT  J "C4'" 1 
ATOM   3665  O  "O4'" . DT  B  1  34  ? 74.592  24.173 3.733   1.00 125.98 ? 180  DT  J "O4'" 1 
ATOM   3666  C  "C3'" . DT  B  1  34  ? 73.139  23.400 5.458   1.00 125.90 ? 180  DT  J "C3'" 1 
ATOM   3667  O  "O3'" . DT  B  1  34  ? 72.712  24.452 6.324   1.00 126.09 ? 180  DT  J "O3'" 1 
ATOM   3668  C  "C2'" . DT  B  1  34  ? 72.403  23.436 4.130   1.00 126.31 ? 180  DT  J "C2'" 1 
ATOM   3669  C  "C1'" . DT  B  1  34  ? 73.256  24.387 3.308   1.00 126.30 ? 180  DT  J "C1'" 1 
ATOM   3670  N  N1    . DT  B  1  34  ? 73.202  24.173 1.846   1.00 126.33 ? 180  DT  J N1    1 
ATOM   3671  C  C2    . DT  B  1  34  ? 73.049  25.281 1.043   1.00 126.26 ? 180  DT  J C2    1 
ATOM   3672  O  O2    . DT  B  1  34  ? 72.955  26.413 1.485   1.00 126.34 ? 180  DT  J O2    1 
ATOM   3673  N  N3    . DT  B  1  34  ? 73.006  25.013 -0.303  1.00 126.28 ? 180  DT  J N3    1 
ATOM   3674  C  C4    . DT  B  1  34  ? 73.096  23.777 -0.912  1.00 126.24 ? 180  DT  J C4    1 
ATOM   3675  O  O4    . DT  B  1  34  ? 73.040  23.694 -2.137  1.00 126.01 ? 180  DT  J O4    1 
ATOM   3676  C  C5    . DT  B  1  34  ? 73.253  22.657 -0.011  1.00 126.38 ? 180  DT  J C5    1 
ATOM   3677  C  C7    . DT  B  1  34  ? 73.351  21.277 -0.580  1.00 125.99 ? 180  DT  J C7    1 
ATOM   3678  C  C6    . DT  B  1  34  ? 73.300  22.908 1.306   1.00 126.35 ? 180  DT  J C6    1 
ATOM   3679  P  P     . DA  B  1  35  ? 71.167  24.559 6.742   1.00 126.07 ? 181  DA  J P     1 
ATOM   3680  O  OP1   . DA  B  1  35  ? 71.095  25.022 8.152   1.00 126.31 ? 181  DA  J OP1   1 
ATOM   3681  O  OP2   . DA  B  1  35  ? 70.491  23.297 6.345   1.00 126.12 ? 181  DA  J OP2   1 
ATOM   3682  O  "O5'" . DA  B  1  35  ? 70.639  25.729 5.806   1.00 125.60 ? 181  DA  J "O5'" 1 
ATOM   3683  C  "C5'" . DA  B  1  35  ? 71.354  26.956 5.729   1.00 124.58 ? 181  DA  J "C5'" 1 
ATOM   3684  C  "C4'" . DA  B  1  35  ? 70.583  27.957 4.906   1.00 123.90 ? 181  DA  J "C4'" 1 
ATOM   3685  O  "O4'" . DA  B  1  35  ? 70.671  27.615 3.502   1.00 123.64 ? 181  DA  J "O4'" 1 
ATOM   3686  C  "C3'" . DA  B  1  35  ? 69.095  28.029 5.240   1.00 123.51 ? 181  DA  J "C3'" 1 
ATOM   3687  O  "O3'" . DA  B  1  35  ? 68.672  29.394 5.252   1.00 122.59 ? 181  DA  J "O3'" 1 
ATOM   3688  C  "C2'" . DA  B  1  35  ? 68.439  27.236 4.121   1.00 123.40 ? 181  DA  J "C2'" 1 
ATOM   3689  C  "C1'" . DA  B  1  35  ? 69.372  27.478 2.946   1.00 123.34 ? 181  DA  J "C1'" 1 
ATOM   3690  N  N9    . DA  B  1  35  ? 69.419  26.388 1.970   1.00 122.61 ? 181  DA  J N9    1 
ATOM   3691  C  C8    . DA  B  1  35  ? 69.194  25.049 2.181   1.00 122.25 ? 181  DA  J C8    1 
ATOM   3692  N  N7    . DA  B  1  35  ? 69.327  24.314 1.103   1.00 121.58 ? 181  DA  J N7    1 
ATOM   3693  C  C5    . DA  B  1  35  ? 69.660  25.230 0.114   1.00 121.66 ? 181  DA  J C5    1 
ATOM   3694  C  C6    . DA  B  1  35  ? 69.939  25.083 -1.256  1.00 121.16 ? 181  DA  J C6    1 
ATOM   3695  N  N6    . DA  B  1  35  ? 69.930  23.911 -1.892  1.00 120.29 ? 181  DA  J N6    1 
ATOM   3696  N  N1    . DA  B  1  35  ? 70.234  26.197 -1.959  1.00 120.90 ? 181  DA  J N1    1 
ATOM   3697  C  C2    . DA  B  1  35  ? 70.247  27.374 -1.320  1.00 121.38 ? 181  DA  J C2    1 
ATOM   3698  N  N3    . DA  B  1  35  ? 70.005  27.640 -0.039  1.00 121.70 ? 181  DA  J N3    1 
ATOM   3699  C  C4    . DA  B  1  35  ? 69.715  26.512 0.632   1.00 122.11 ? 181  DA  J C4    1 
ATOM   3700  P  P     . DT  B  1  36  ? 67.108  29.744 5.214   1.00 122.06 ? 182  DT  J P     1 
ATOM   3701  O  OP1   . DT  B  1  36  ? 66.909  31.066 5.862   1.00 122.07 ? 182  DT  J OP1   1 
ATOM   3702  O  OP2   . DT  B  1  36  ? 66.348  28.562 5.702   1.00 121.91 ? 182  DT  J OP2   1 
ATOM   3703  O  "O5'" . DT  B  1  36  ? 66.834  29.914 3.659   1.00 121.51 ? 182  DT  J "O5'" 1 
ATOM   3704  C  "C5'" . DT  B  1  36  ? 67.570  30.873 2.908   1.00 120.22 ? 182  DT  J "C5'" 1 
ATOM   3705  C  "C4'" . DT  B  1  36  ? 66.835  31.207 1.635   1.00 118.75 ? 182  DT  J "C4'" 1 
ATOM   3706  O  "O4'" . DT  B  1  36  ? 67.068  30.176 0.645   1.00 118.47 ? 182  DT  J "O4'" 1 
ATOM   3707  C  "C3'" . DT  B  1  36  ? 65.321  31.300 1.818   1.00 117.82 ? 182  DT  J "C3'" 1 
ATOM   3708  O  "O3'" . DT  B  1  36  ? 64.811  32.440 1.124   1.00 116.30 ? 182  DT  J "O3'" 1 
ATOM   3709  C  "C2'" . DT  B  1  36  ? 64.809  29.990 1.244   1.00 117.68 ? 182  DT  J "C2'" 1 
ATOM   3710  C  "C1'" . DT  B  1  36  ? 65.833  29.668 0.169   1.00 117.99 ? 182  DT  J "C1'" 1 
ATOM   3711  N  N1    . DT  B  1  36  ? 66.011  28.227 -0.111  1.00 117.85 ? 182  DT  J N1    1 
ATOM   3712  C  C2    . DT  B  1  36  ? 66.601  27.867 -1.305  1.00 117.84 ? 182  DT  J C2    1 
ATOM   3713  O  O2    . DT  B  1  36  ? 66.993  28.678 -2.128  1.00 117.85 ? 182  DT  J O2    1 
ATOM   3714  N  N3    . DT  B  1  36  ? 66.717  26.513 -1.500  1.00 117.43 ? 182  DT  J N3    1 
ATOM   3715  C  C4    . DT  B  1  36  ? 66.316  25.506 -0.642  1.00 117.65 ? 182  DT  J C4    1 
ATOM   3716  O  O4    . DT  B  1  36  ? 66.484  24.330 -0.956  1.00 116.94 ? 182  DT  J O4    1 
ATOM   3717  C  C5    . DT  B  1  36  ? 65.711  25.956 0.593   1.00 117.63 ? 182  DT  J C5    1 
ATOM   3718  C  C7    . DT  B  1  36  ? 65.246  24.938 1.586   1.00 117.64 ? 182  DT  J C7    1 
ATOM   3719  C  C6    . DT  B  1  36  ? 65.593  27.275 0.795   1.00 117.54 ? 182  DT  J C6    1 
ATOM   3720  P  P     . DT  B  1  37  ? 63.278  32.470 0.661   1.00 115.81 ? 183  DT  J P     1 
ATOM   3721  O  OP1   . DT  B  1  37  ? 62.851  33.889 0.573   1.00 115.10 ? 183  DT  J OP1   1 
ATOM   3722  O  OP2   . DT  B  1  37  ? 62.504  31.518 1.500   1.00 115.31 ? 183  DT  J OP2   1 
ATOM   3723  O  "O5'" . DT  B  1  37  ? 63.370  31.882 -0.812  1.00 115.69 ? 183  DT  J "O5'" 1 
ATOM   3724  C  "C5'" . DT  B  1  37  ? 64.430  32.288 -1.673  1.00 114.35 ? 183  DT  J "C5'" 1 
ATOM   3725  C  "C4'" . DT  B  1  37  ? 64.109  31.920 -3.099  1.00 113.22 ? 183  DT  J "C4'" 1 
ATOM   3726  O  "O4'" . DT  B  1  37  ? 64.365  30.513 -3.322  1.00 113.27 ? 183  DT  J "O4'" 1 
ATOM   3727  C  "C3'" . DT  B  1  37  ? 62.649  32.158 -3.473  1.00 112.09 ? 183  DT  J "C3'" 1 
ATOM   3728  O  "O3'" . DT  B  1  37  ? 62.571  32.720 -4.780  1.00 110.10 ? 183  DT  J "O3'" 1 
ATOM   3729  C  "C2'" . DT  B  1  37  ? 62.038  30.768 -3.425  1.00 112.53 ? 183  DT  J "C2'" 1 
ATOM   3730  C  "C1'" . DT  B  1  37  ? 63.202  29.880 -3.826  1.00 113.31 ? 183  DT  J "C1'" 1 
ATOM   3731  N  N1    . DT  B  1  37  ? 63.164  28.514 -3.272  1.00 114.15 ? 183  DT  J N1    1 
ATOM   3732  C  C2    . DT  B  1  37  ? 63.635  27.487 -4.057  1.00 114.93 ? 183  DT  J C2    1 
ATOM   3733  O  O2    . DT  B  1  37  ? 64.067  27.657 -5.184  1.00 116.13 ? 183  DT  J O2    1 
ATOM   3734  N  N3    . DT  B  1  37  ? 63.584  26.248 -3.471  1.00 114.93 ? 183  DT  J N3    1 
ATOM   3735  C  C4    . DT  B  1  37  ? 63.117  25.940 -2.210  1.00 114.92 ? 183  DT  J C4    1 
ATOM   3736  O  O4    . DT  B  1  37  ? 63.140  24.778 -1.817  1.00 115.19 ? 183  DT  J O4    1 
ATOM   3737  C  C5    . DT  B  1  37  ? 62.629  27.064 -1.443  1.00 114.91 ? 183  DT  J C5    1 
ATOM   3738  C  C7    . DT  B  1  37  ? 62.095  26.825 -0.066  1.00 115.24 ? 183  DT  J C7    1 
ATOM   3739  C  C6    . DT  B  1  37  ? 62.676  28.278 -2.005  1.00 114.33 ? 183  DT  J C6    1 
ATOM   3740  P  P     . DT  B  1  38  ? 61.143  33.111 -5.392  1.00 108.54 ? 184  DT  J P     1 
ATOM   3741  O  OP1   . DT  B  1  38  ? 61.258  34.439 -6.046  1.00 107.97 ? 184  DT  J OP1   1 
ATOM   3742  O  OP2   . DT  B  1  38  ? 60.125  32.899 -4.333  1.00 108.35 ? 184  DT  J OP2   1 
ATOM   3743  O  "O5'" . DT  B  1  38  ? 60.934  32.003 -6.514  1.00 107.05 ? 184  DT  J "O5'" 1 
ATOM   3744  C  "C5'" . DT  B  1  38  ? 61.985  31.702 -7.427  1.00 103.35 ? 184  DT  J "C5'" 1 
ATOM   3745  C  "C4'" . DT  B  1  38  ? 61.589  30.550 -8.317  1.00 101.27 ? 184  DT  J "C4'" 1 
ATOM   3746  O  "O4'" . DT  B  1  38  ? 61.706  29.290 -7.616  1.00 100.85 ? 184  DT  J "O4'" 1 
ATOM   3747  C  "C3'" . DT  B  1  38  ? 60.154  30.621 -8.837  1.00 99.61  ? 184  DT  J "C3'" 1 
ATOM   3748  O  "O3'" . DT  B  1  38  ? 60.130  30.183 -10.193 1.00 97.07  ? 184  DT  J "O3'" 1 
ATOM   3749  C  "C2'" . DT  B  1  38  ? 59.424  29.615 -7.966  1.00 99.84  ? 184  DT  J "C2'" 1 
ATOM   3750  C  "C1'" . DT  B  1  38  ? 60.499  28.565 -7.764  1.00 101.05 ? 184  DT  J "C1'" 1 
ATOM   3751  N  N1    . DT  B  1  38  ? 60.334  27.709 -6.579  1.00 102.36 ? 184  DT  J N1    1 
ATOM   3752  C  C2    . DT  B  1  38  ? 60.581  26.362 -6.720  1.00 103.05 ? 184  DT  J C2    1 
ATOM   3753  O  O2    . DT  B  1  38  ? 60.928  25.854 -7.773  1.00 103.27 ? 184  DT  J O2    1 
ATOM   3754  N  N3    . DT  B  1  38  ? 60.406  25.625 -5.575  1.00 103.77 ? 184  DT  J N3    1 
ATOM   3755  C  C4    . DT  B  1  38  ? 60.019  26.090 -4.333  1.00 103.91 ? 184  DT  J C4    1 
ATOM   3756  O  O4    . DT  B  1  38  ? 59.900  25.304 -3.396  1.00 104.23 ? 184  DT  J O4    1 
ATOM   3757  C  C5    . DT  B  1  38  ? 59.780  27.516 -4.257  1.00 103.59 ? 184  DT  J C5    1 
ATOM   3758  C  C7    . DT  B  1  38  ? 59.362  28.114 -2.951  1.00 103.79 ? 184  DT  J C7    1 
ATOM   3759  C  C6    . DT  B  1  38  ? 59.947  28.243 -5.369  1.00 103.23 ? 184  DT  J C6    1 
ATOM   3760  P  P     . DG  B  1  39  ? 59.828  31.234 -11.366 1.00 94.25  ? 185  DG  J P     1 
ATOM   3761  O  OP1   . DG  B  1  39  ? 60.736  32.402 -11.209 1.00 93.78  ? 185  DG  J OP1   1 
ATOM   3762  O  OP2   . DG  B  1  39  ? 58.358  31.447 -11.408 1.00 94.96  ? 185  DG  J OP2   1 
ATOM   3763  O  "O5'" . DG  B  1  39  ? 60.257  30.437 -12.674 1.00 92.62  ? 185  DG  J "O5'" 1 
ATOM   3764  C  "C5'" . DG  B  1  39  ? 61.578  29.917 -12.807 1.00 88.21  ? 185  DG  J "C5'" 1 
ATOM   3765  C  "C4'" . DG  B  1  39  ? 61.524  28.453 -13.173 1.00 85.75  ? 185  DG  J "C4'" 1 
ATOM   3766  O  "O4'" . DG  B  1  39  ? 60.998  27.701 -12.057 1.00 85.18  ? 185  DG  J "O4'" 1 
ATOM   3767  C  "C3'" . DG  B  1  39  ? 60.616  28.131 -14.359 1.00 84.27  ? 185  DG  J "C3'" 1 
ATOM   3768  O  "O3'" . DG  B  1  39  ? 61.176  27.053 -15.112 1.00 80.94  ? 185  DG  J "O3'" 1 
ATOM   3769  C  "C2'" . DG  B  1  39  ? 59.319  27.703 -13.699 1.00 84.74  ? 185  DG  J "C2'" 1 
ATOM   3770  C  "C1'" . DG  B  1  39  ? 59.803  27.029 -12.427 1.00 85.32  ? 185  DG  J "C1'" 1 
ATOM   3771  N  N9    . DG  B  1  39  ? 58.876  27.146 -11.308 1.00 86.60  ? 185  DG  J N9    1 
ATOM   3772  C  C8    . DG  B  1  39  ? 58.129  28.249 -10.969 1.00 87.37  ? 185  DG  J C8    1 
ATOM   3773  N  N7    . DG  B  1  39  ? 57.417  28.074 -9.889  1.00 88.05  ? 185  DG  J N7    1 
ATOM   3774  C  C5    . DG  B  1  39  ? 57.705  26.774 -9.494  1.00 87.45  ? 185  DG  J C5    1 
ATOM   3775  C  C6    . DG  B  1  39  ? 57.235  26.029 -8.384  1.00 87.12  ? 185  DG  J C6    1 
ATOM   3776  O  O6    . DG  B  1  39  ? 56.455  26.385 -7.491  1.00 87.20  ? 185  DG  J O6    1 
ATOM   3777  N  N1    . DG  B  1  39  ? 57.769  24.744 -8.369  1.00 86.06  ? 185  DG  J N1    1 
ATOM   3778  C  C2    . DG  B  1  39  ? 58.647  24.243 -9.299  1.00 85.91  ? 185  DG  J C2    1 
ATOM   3779  N  N2    . DG  B  1  39  ? 59.037  22.976 -9.116  1.00 84.90  ? 185  DG  J N2    1 
ATOM   3780  N  N3    . DG  B  1  39  ? 59.104  24.932 -10.332 1.00 85.85  ? 185  DG  J N3    1 
ATOM   3781  C  C4    . DG  B  1  39  ? 58.593  26.182 -10.368 1.00 87.05  ? 185  DG  J C4    1 
ATOM   3782  P  P     . DG  B  1  40  ? 60.671  26.779 -16.609 1.00 77.50  ? 186  DG  J P     1 
ATOM   3783  O  OP1   . DG  B  1  40  ? 61.842  26.288 -17.377 1.00 77.63  ? 186  DG  J OP1   1 
ATOM   3784  O  OP2   . DG  B  1  40  ? 59.933  27.979 -17.073 1.00 75.81  ? 186  DG  J OP2   1 
ATOM   3785  O  "O5'" . DG  B  1  40  ? 59.642  25.579 -16.445 1.00 78.55  ? 186  DG  J "O5'" 1 
ATOM   3786  C  "C5'" . DG  B  1  40  ? 60.078  24.328 -15.923 1.00 82.14  ? 186  DG  J "C5'" 1 
ATOM   3787  C  "C4'" . DG  B  1  40  ? 58.894  23.471 -15.540 1.00 84.82  ? 186  DG  J "C4'" 1 
ATOM   3788  O  "O4'" . DG  B  1  40  ? 58.245  23.979 -14.348 1.00 85.18  ? 186  DG  J "O4'" 1 
ATOM   3789  C  "C3'" . DG  B  1  40  ? 57.799  23.362 -16.603 1.00 86.93  ? 186  DG  J "C3'" 1 
ATOM   3790  O  "O3'" . DG  B  1  40  ? 57.285  22.033 -16.593 1.00 90.50  ? 186  DG  J "O3'" 1 
ATOM   3791  C  "C2'" . DG  B  1  40  ? 56.723  24.296 -16.081 1.00 86.53  ? 186  DG  J "C2'" 1 
ATOM   3792  C  "C1'" . DG  B  1  40  ? 56.850  24.038 -14.594 1.00 86.48  ? 186  DG  J "C1'" 1 
ATOM   3793  N  N9    . DG  B  1  40  ? 56.260  25.034 -13.706 1.00 85.91  ? 186  DG  J N9    1 
ATOM   3794  C  C8    . DG  B  1  40  ? 56.009  26.359 -13.973 1.00 85.80  ? 186  DG  J C8    1 
ATOM   3795  N  N7    . DG  B  1  40  ? 55.449  26.985 -12.973 1.00 85.19  ? 186  DG  J N7    1 
ATOM   3796  C  C5    . DG  B  1  40  ? 55.328  26.016 -11.985 1.00 85.48  ? 186  DG  J C5    1 
ATOM   3797  C  C6    . DG  B  1  40  ? 54.792  26.100 -10.671 1.00 85.21  ? 186  DG  J C6    1 
ATOM   3798  O  O6    . DG  B  1  40  ? 54.302  27.083 -10.097 1.00 83.47  ? 186  DG  J O6    1 
ATOM   3799  N  N1    . DG  B  1  40  ? 54.869  24.877 -10.011 1.00 84.62  ? 186  DG  J N1    1 
ATOM   3800  C  C2    . DG  B  1  40  ? 55.394  23.722 -10.542 1.00 85.18  ? 186  DG  J C2    1 
ATOM   3801  N  N2    . DG  B  1  40  ? 55.382  22.640 -9.747  1.00 83.74  ? 186  DG  J N2    1 
ATOM   3802  N  N3    . DG  B  1  40  ? 55.894  23.633 -11.762 1.00 84.93  ? 186  DG  J N3    1 
ATOM   3803  C  C4    . DG  B  1  40  ? 55.829  24.809 -12.422 1.00 85.64  ? 186  DG  J C4    1 
ATOM   3804  P  P     . DA  B  1  41  ? 57.307  21.161 -17.936 1.00 93.08  ? 187  DA  J P     1 
ATOM   3805  O  OP1   . DA  B  1  41  ? 58.696  21.174 -18.461 1.00 93.64  ? 187  DA  J OP1   1 
ATOM   3806  O  OP2   . DA  B  1  41  ? 56.189  21.626 -18.796 1.00 93.50  ? 187  DA  J OP2   1 
ATOM   3807  O  "O5'" . DA  B  1  41  ? 56.969  19.692 -17.427 1.00 95.79  ? 187  DA  J "O5'" 1 
ATOM   3808  C  "C5'" . DA  B  1  41  ? 57.864  19.002 -16.561 1.00 100.49 ? 187  DA  J "C5'" 1 
ATOM   3809  C  "C4'" . DA  B  1  41  ? 57.096  18.318 -15.454 1.00 104.00 ? 187  DA  J "C4'" 1 
ATOM   3810  O  "O4'" . DA  B  1  41  ? 56.562  19.302 -14.534 1.00 104.51 ? 187  DA  J "O4'" 1 
ATOM   3811  C  "C3'" . DA  B  1  41  ? 55.903  17.489 -15.927 1.00 105.78 ? 187  DA  J "C3'" 1 
ATOM   3812  O  "O3'" . DA  B  1  41  ? 55.818  16.285 -15.164 1.00 109.74 ? 187  DA  J "O3'" 1 
ATOM   3813  C  "C2'" . DA  B  1  41  ? 54.713  18.389 -15.647 1.00 105.10 ? 187  DA  J "C2'" 1 
ATOM   3814  C  "C1'" . DA  B  1  41  ? 55.156  19.137 -14.404 1.00 104.60 ? 187  DA  J "C1'" 1 
ATOM   3815  N  N9    . DA  B  1  41  ? 54.563  20.466 -14.255 1.00 104.46 ? 187  DA  J N9    1 
ATOM   3816  C  C8    . DA  B  1  41  ? 54.615  21.515 -15.139 1.00 104.23 ? 187  DA  J C8    1 
ATOM   3817  N  N7    . DA  B  1  41  ? 54.006  22.596 -14.714 1.00 104.18 ? 187  DA  J N7    1 
ATOM   3818  C  C5    . DA  B  1  41  ? 53.515  22.233 -13.468 1.00 104.22 ? 187  DA  J C5    1 
ATOM   3819  C  C6    . DA  B  1  41  ? 52.776  22.937 -12.499 1.00 104.05 ? 187  DA  J C6    1 
ATOM   3820  N  N6    . DA  B  1  41  ? 52.396  24.209 -12.637 1.00 103.70 ? 187  DA  J N6    1 
ATOM   3821  N  N1    . DA  B  1  41  ? 52.440  22.282 -11.367 1.00 103.71 ? 187  DA  J N1    1 
ATOM   3822  C  C2    . DA  B  1  41  ? 52.827  21.007 -11.227 1.00 104.44 ? 187  DA  J C2    1 
ATOM   3823  N  N3    . DA  B  1  41  ? 53.526  20.240 -12.063 1.00 104.58 ? 187  DA  J N3    1 
ATOM   3824  C  C4    . DA  B  1  41  ? 53.844  20.921 -13.177 1.00 104.30 ? 187  DA  J C4    1 
ATOM   3825  P  P     . DA  B  1  42  ? 54.629  15.244 -15.450 1.00 112.62 ? 188  DA  J P     1 
ATOM   3826  O  OP1   . DA  B  1  42  ? 55.092  13.888 -15.056 1.00 112.28 ? 188  DA  J OP1   1 
ATOM   3827  O  OP2   . DA  B  1  42  ? 54.138  15.480 -16.832 1.00 112.61 ? 188  DA  J OP2   1 
ATOM   3828  O  "O5'" . DA  B  1  42  ? 53.495  15.702 -14.433 1.00 113.92 ? 188  DA  J "O5'" 1 
ATOM   3829  C  "C5'" . DA  B  1  42  ? 53.683  15.558 -13.028 1.00 116.61 ? 188  DA  J "C5'" 1 
ATOM   3830  C  "C4'" . DA  B  1  42  ? 52.352  15.617 -12.319 1.00 118.31 ? 188  DA  J "C4'" 1 
ATOM   3831  O  "O4'" . DA  B  1  42  ? 51.892  16.987 -12.235 1.00 118.51 ? 188  DA  J "O4'" 1 
ATOM   3832  C  "C3'" . DA  B  1  42  ? 51.247  14.837 -13.027 1.00 119.35 ? 188  DA  J "C3'" 1 
ATOM   3833  O  "O3'" . DA  B  1  42  ? 50.432  14.161 -12.071 1.00 121.32 ? 188  DA  J "O3'" 1 
ATOM   3834  C  "C2'" . DA  B  1  42  ? 50.460  15.914 -13.754 1.00 118.78 ? 188  DA  J "C2'" 1 
ATOM   3835  C  "C1'" . DA  B  1  42  ? 50.611  17.114 -12.834 1.00 118.26 ? 188  DA  J "C1'" 1 
ATOM   3836  N  N9    . DA  B  1  42  ? 50.568  18.408 -13.515 1.00 117.72 ? 188  DA  J N9    1 
ATOM   3837  C  C8    . DA  B  1  42  ? 51.060  18.723 -14.758 1.00 117.49 ? 188  DA  J C8    1 
ATOM   3838  N  N7    . DA  B  1  42  ? 50.877  19.976 -15.097 1.00 117.42 ? 188  DA  J N7    1 
ATOM   3839  C  C5    . DA  B  1  42  ? 50.219  20.525 -14.004 1.00 117.15 ? 188  DA  J C5    1 
ATOM   3840  C  C6    . DA  B  1  42  ? 49.742  21.822 -13.739 1.00 116.87 ? 188  DA  J C6    1 
ATOM   3841  N  N6    . DA  B  1  42  ? 49.855  22.842 -14.590 1.00 116.50 ? 188  DA  J N6    1 
ATOM   3842  N  N1    . DA  B  1  42  ? 49.134  22.037 -12.552 1.00 116.85 ? 188  DA  J N1    1 
ATOM   3843  C  C2    . DA  B  1  42  ? 49.017  21.012 -11.699 1.00 116.87 ? 188  DA  J C2    1 
ATOM   3844  N  N3    . DA  B  1  42  ? 49.421  19.751 -11.834 1.00 117.03 ? 188  DA  J N3    1 
ATOM   3845  C  C4    . DA  B  1  42  ? 50.022  19.570 -13.023 1.00 117.31 ? 188  DA  J C4    1 
ATOM   3846  P  P     . DA  B  1  43  ? 49.297  13.145 -12.574 1.00 122.70 ? 189  DA  J P     1 
ATOM   3847  O  OP1   . DA  B  1  43  ? 49.277  11.973 -11.659 1.00 122.33 ? 189  DA  J OP1   1 
ATOM   3848  O  OP2   . DA  B  1  43  ? 49.494  12.936 -14.033 1.00 122.72 ? 189  DA  J OP2   1 
ATOM   3849  O  "O5'" . DA  B  1  43  ? 47.958  13.977 -12.363 1.00 122.55 ? 189  DA  J "O5'" 1 
ATOM   3850  C  "C5'" . DA  B  1  43  ? 47.633  14.498 -11.079 1.00 122.70 ? 189  DA  J "C5'" 1 
ATOM   3851  C  "C4'" . DA  B  1  43  ? 46.382  15.339 -11.158 1.00 122.98 ? 189  DA  J "C4'" 1 
ATOM   3852  O  "O4'" . DA  B  1  43  ? 46.675  16.637 -11.731 1.00 122.92 ? 189  DA  J "O4'" 1 
ATOM   3853  C  "C3'" . DA  B  1  43  ? 45.270  14.733 -12.014 1.00 123.13 ? 189  DA  J "C3'" 1 
ATOM   3854  O  "O3'" . DA  B  1  43  ? 44.012  14.918 -11.366 1.00 123.29 ? 189  DA  J "O3'" 1 
ATOM   3855  C  "C2'" . DA  B  1  43  ? 45.327  15.551 -13.293 1.00 122.85 ? 189  DA  J "C2'" 1 
ATOM   3856  C  "C1'" . DA  B  1  43  ? 45.747  16.909 -12.767 1.00 122.40 ? 189  DA  J "C1'" 1 
ATOM   3857  N  N9    . DA  B  1  43  ? 46.397  17.778 -13.747 1.00 121.92 ? 189  DA  J N9    1 
ATOM   3858  C  C8    . DA  B  1  43  ? 47.306  17.437 -14.717 1.00 121.62 ? 189  DA  J C8    1 
ATOM   3859  N  N7    . DA  B  1  43  ? 47.699  18.450 -15.452 1.00 121.42 ? 189  DA  J N7    1 
ATOM   3860  C  C5    . DA  B  1  43  ? 47.004  19.531 -14.930 1.00 121.55 ? 189  DA  J C5    1 
ATOM   3861  C  C6    . DA  B  1  43  ? 46.978  20.896 -15.272 1.00 121.58 ? 189  DA  J C6    1 
ATOM   3862  N  N6    . DA  B  1  43  ? 47.698  21.426 -16.263 1.00 121.76 ? 189  DA  J N6    1 
ATOM   3863  N  N1    . DA  B  1  43  ? 46.176  21.709 -14.550 1.00 121.59 ? 189  DA  J N1    1 
ATOM   3864  C  C2    . DA  B  1  43  ? 45.453  21.178 -13.556 1.00 121.57 ? 189  DA  J C2    1 
ATOM   3865  N  N3    . DA  B  1  43  ? 45.391  19.914 -13.141 1.00 121.44 ? 189  DA  J N3    1 
ATOM   3866  C  C4    . DA  B  1  43  ? 46.200  19.132 -13.878 1.00 121.68 ? 189  DA  J C4    1 
ATOM   3867  P  P     . DC  B  1  44  ? 42.682  14.304 -12.018 1.00 123.32 ? 190  DC  J P     1 
ATOM   3868  O  OP1   . DC  B  1  44  ? 41.994  13.523 -10.959 1.00 123.13 ? 190  DC  J OP1   1 
ATOM   3869  O  OP2   . DC  B  1  44  ? 43.039  13.647 -13.303 1.00 123.22 ? 190  DC  J OP2   1 
ATOM   3870  O  "O5'" . DC  B  1  44  ? 41.805  15.597 -12.326 1.00 123.15 ? 190  DC  J "O5'" 1 
ATOM   3871  C  "C5'" . DC  B  1  44  ? 41.531  16.546 -11.296 1.00 122.15 ? 190  DC  J "C5'" 1 
ATOM   3872  C  "C4'" . DC  B  1  44  ? 40.820  17.751 -11.865 1.00 121.47 ? 190  DC  J "C4'" 1 
ATOM   3873  O  "O4'" . DC  B  1  44  ? 41.739  18.565 -12.637 1.00 121.58 ? 190  DC  J "O4'" 1 
ATOM   3874  C  "C3'" . DC  B  1  44  ? 39.652  17.425 -12.798 1.00 121.05 ? 190  DC  J "C3'" 1 
ATOM   3875  O  "O3'" . DC  B  1  44  ? 38.560  18.314 -12.544 1.00 119.98 ? 190  DC  J "O3'" 1 
ATOM   3876  C  "C2'" . DC  B  1  44  ? 40.228  17.679 -14.180 1.00 121.15 ? 190  DC  J "C2'" 1 
ATOM   3877  C  "C1'" . DC  B  1  44  ? 41.168  18.837 -13.907 1.00 121.22 ? 190  DC  J "C1'" 1 
ATOM   3878  N  N1    . DC  B  1  44  ? 42.259  19.002 -14.883 1.00 120.82 ? 190  DC  J N1    1 
ATOM   3879  C  C2    . DC  B  1  44  ? 42.651  20.300 -15.236 1.00 120.56 ? 190  DC  J C2    1 
ATOM   3880  O  O2    . DC  B  1  44  ? 42.089  21.265 -14.697 1.00 120.27 ? 190  DC  J O2    1 
ATOM   3881  N  N3    . DC  B  1  44  ? 43.632  20.469 -16.151 1.00 120.50 ? 190  DC  J N3    1 
ATOM   3882  C  C4    . DC  B  1  44  ? 44.218  19.405 -16.705 1.00 120.37 ? 190  DC  J C4    1 
ATOM   3883  N  N4    . DC  B  1  44  ? 45.176  19.622 -17.610 1.00 120.22 ? 190  DC  J N4    1 
ATOM   3884  C  C5    . DC  B  1  44  ? 43.848  18.073 -16.355 1.00 120.29 ? 190  DC  J C5    1 
ATOM   3885  C  C6    . DC  B  1  44  ? 42.874  17.919 -15.448 1.00 120.42 ? 190  DC  J C6    1 
ATOM   3886  P  P     . DT  B  1  45  ? 37.259  18.270 -13.486 1.00 118.68 ? 191  DT  J P     1 
ATOM   3887  O  OP1   . DT  B  1  45  ? 36.139  18.921 -12.759 1.00 118.40 ? 191  DT  J OP1   1 
ATOM   3888  O  OP2   . DT  B  1  45  ? 37.106  16.876 -13.978 1.00 118.75 ? 191  DT  J OP2   1 
ATOM   3889  O  "O5'" . DT  B  1  45  ? 37.659  19.196 -14.719 1.00 117.74 ? 191  DT  J "O5'" 1 
ATOM   3890  C  "C5'" . DT  B  1  45  ? 37.870  20.594 -14.534 1.00 115.70 ? 191  DT  J "C5'" 1 
ATOM   3891  C  "C4'" . DT  B  1  45  ? 37.852  21.313 -15.863 1.00 114.01 ? 191  DT  J "C4'" 1 
ATOM   3892  O  "O4'" . DT  B  1  45  ? 39.101  21.130 -16.573 1.00 113.30 ? 191  DT  J "O4'" 1 
ATOM   3893  C  "C3'" . DT  B  1  45  ? 36.746  20.871 -16.825 1.00 113.18 ? 191  DT  J "C3'" 1 
ATOM   3894  O  "O3'" . DT  B  1  45  ? 36.226  22.017 -17.500 1.00 112.06 ? 191  DT  J "O3'" 1 
ATOM   3895  C  "C2'" . DT  B  1  45  ? 37.490  20.008 -17.828 1.00 112.88 ? 191  DT  J "C2'" 1 
ATOM   3896  C  "C1'" . DT  B  1  45  ? 38.810  20.751 -17.907 1.00 112.63 ? 191  DT  J "C1'" 1 
ATOM   3897  N  N1    . DT  B  1  45  ? 39.961  19.998 -18.441 1.00 111.44 ? 191  DT  J N1    1 
ATOM   3898  C  C2    . DT  B  1  45  ? 41.037  20.728 -18.887 1.00 110.72 ? 191  DT  J C2    1 
ATOM   3899  O  O2    . DT  B  1  45  ? 41.081  21.947 -18.836 1.00 110.35 ? 191  DT  J O2    1 
ATOM   3900  N  N3    . DT  B  1  45  ? 42.065  19.978 -19.397 1.00 110.36 ? 191  DT  J N3    1 
ATOM   3901  C  C4    . DT  B  1  45  ? 42.124  18.603 -19.499 1.00 110.54 ? 191  DT  J C4    1 
ATOM   3902  O  O4    . DT  B  1  45  ? 43.115  18.069 -19.986 1.00 110.75 ? 191  DT  J O4    1 
ATOM   3903  C  C5    . DT  B  1  45  ? 40.965  17.898 -19.001 1.00 110.70 ? 191  DT  J C5    1 
ATOM   3904  C  C7    . DT  B  1  45  ? 40.943  16.404 -19.065 1.00 110.70 ? 191  DT  J C7    1 
ATOM   3905  C  C6    . DT  B  1  45  ? 39.955  18.622 -18.502 1.00 111.02 ? 191  DT  J C6    1 
ATOM   3906  P  P     . DG  B  1  46  ? 34.644  22.285 -17.522 1.00 110.80 ? 192  DG  J P     1 
ATOM   3907  O  OP1   . DG  B  1  46  ? 34.163  22.309 -16.116 1.00 110.66 ? 192  DG  J OP1   1 
ATOM   3908  O  OP2   . DG  B  1  46  ? 34.032  21.343 -18.496 1.00 110.07 ? 192  DG  J OP2   1 
ATOM   3909  O  "O5'" . DG  B  1  46  ? 34.538  23.762 -18.106 1.00 109.26 ? 192  DG  J "O5'" 1 
ATOM   3910  C  "C5'" . DG  B  1  46  ? 35.123  24.855 -17.404 1.00 106.24 ? 192  DG  J "C5'" 1 
ATOM   3911  C  "C4'" . DG  B  1  46  ? 35.891  25.744 -18.354 1.00 104.24 ? 192  DG  J "C4'" 1 
ATOM   3912  O  "O4'" . DG  B  1  46  ? 37.053  25.045 -18.861 1.00 103.70 ? 192  DG  J "O4'" 1 
ATOM   3913  C  "C3'" . DG  B  1  46  ? 35.101  26.194 -19.580 1.00 103.30 ? 192  DG  J "C3'" 1 
ATOM   3914  O  "O3'" . DG  B  1  46  ? 35.427  27.550 -19.888 1.00 102.36 ? 192  DG  J "O3'" 1 
ATOM   3915  C  "C2'" . DG  B  1  46  ? 35.587  25.261 -20.674 1.00 103.08 ? 192  DG  J "C2'" 1 
ATOM   3916  C  "C1'" . DG  B  1  46  ? 37.035  25.039 -20.281 1.00 102.68 ? 192  DG  J "C1'" 1 
ATOM   3917  N  N9    . DG  B  1  46  ? 37.596  23.769 -20.730 1.00 101.73 ? 192  DG  J N9    1 
ATOM   3918  C  C8    . DG  B  1  46  ? 37.240  22.512 -20.306 1.00 101.70 ? 192  DG  J C8    1 
ATOM   3919  N  N7    . DG  B  1  46  ? 37.929  21.563 -20.880 1.00 101.42 ? 192  DG  J N7    1 
ATOM   3920  C  C5    . DG  B  1  46  ? 38.791  22.234 -21.737 1.00 101.46 ? 192  DG  J C5    1 
ATOM   3921  C  C6    . DG  B  1  46  ? 39.782  21.733 -22.626 1.00 101.23 ? 192  DG  J C6    1 
ATOM   3922  O  O6    . DG  B  1  46  ? 40.112  20.558 -22.833 1.00 100.64 ? 192  DG  J O6    1 
ATOM   3923  N  N1    . DG  B  1  46  ? 40.420  22.762 -23.311 1.00 100.86 ? 192  DG  J N1    1 
ATOM   3924  C  C2    . DG  B  1  46  ? 40.146  24.098 -23.164 1.00 100.87 ? 192  DG  J C2    1 
ATOM   3925  N  N2    . DG  B  1  46  ? 40.868  24.935 -23.923 1.00 100.42 ? 192  DG  J N2    1 
ATOM   3926  N  N3    . DG  B  1  46  ? 39.231  24.579 -22.335 1.00 101.30 ? 192  DG  J N3    1 
ATOM   3927  C  C4    . DG  B  1  46  ? 38.596  23.597 -21.659 1.00 101.42 ? 192  DG  J C4    1 
ATOM   3928  P  P     . DC  B  1  47  ? 34.537  28.357 -20.951 1.00 102.49 ? 193  DC  J P     1 
ATOM   3929  O  OP1   . DC  B  1  47  ? 34.840  29.804 -20.800 1.00 101.69 ? 193  DC  J OP1   1 
ATOM   3930  O  OP2   . DC  B  1  47  ? 33.132  27.882 -20.823 1.00 102.77 ? 193  DC  J OP2   1 
ATOM   3931  O  "O5'" . DC  B  1  47  ? 35.106  27.871 -22.358 1.00 101.28 ? 193  DC  J "O5'" 1 
ATOM   3932  C  "C5'" . DC  B  1  47  ? 36.349  28.369 -22.849 1.00 98.21  ? 193  DC  J "C5'" 1 
ATOM   3933  C  "C4'" . DC  B  1  47  ? 36.608  27.857 -24.247 1.00 95.77  ? 193  DC  J "C4'" 1 
ATOM   3934  O  "O4'" . DC  B  1  47  ? 37.034  26.474 -24.221 1.00 94.91  ? 193  DC  J "O4'" 1 
ATOM   3935  C  "C3'" . DC  B  1  47  ? 35.415  27.915 -25.203 1.00 94.86  ? 193  DC  J "C3'" 1 
ATOM   3936  O  "O3'" . DC  B  1  47  ? 35.895  28.231 -26.511 1.00 94.04  ? 193  DC  J "O3'" 1 
ATOM   3937  C  "C2'" . DC  B  1  47  ? 34.933  26.475 -25.222 1.00 94.56  ? 193  DC  J "C2'" 1 
ATOM   3938  C  "C1'" . DC  B  1  47  ? 36.263  25.750 -25.162 1.00 94.71  ? 193  DC  J "C1'" 1 
ATOM   3939  N  N1    . DC  B  1  47  ? 36.239  24.338 -24.752 1.00 94.16  ? 193  DC  J N1    1 
ATOM   3940  C  C2    . DC  B  1  47  ? 37.187  23.472 -25.308 1.00 94.24  ? 193  DC  J C2    1 
ATOM   3941  O  O2    . DC  B  1  47  ? 38.010  23.928 -26.117 1.00 93.63  ? 193  DC  J O2    1 
ATOM   3942  N  N3    . DC  B  1  47  ? 37.185  22.169 -24.950 1.00 93.86  ? 193  DC  J N3    1 
ATOM   3943  C  C4    . DC  B  1  47  ? 36.287  21.722 -24.072 1.00 93.51  ? 193  DC  J C4    1 
ATOM   3944  N  N4    . DC  B  1  47  ? 36.324  20.429 -23.747 1.00 92.91  ? 193  DC  J N4    1 
ATOM   3945  C  C5    . DC  B  1  47  ? 35.310  22.583 -23.487 1.00 93.64  ? 193  DC  J C5    1 
ATOM   3946  C  C6    . DC  B  1  47  ? 35.322  23.871 -23.854 1.00 93.67  ? 193  DC  J C6    1 
ATOM   3947  P  P     . DT  B  1  48  ? 35.683  29.703 -27.115 1.00 93.23  ? 194  DT  J P     1 
ATOM   3948  O  OP1   . DT  B  1  48  ? 35.951  30.683 -26.029 1.00 92.53  ? 194  DT  J OP1   1 
ATOM   3949  O  OP2   . DT  B  1  48  ? 34.384  29.735 -27.836 1.00 93.22  ? 194  DT  J OP2   1 
ATOM   3950  O  "O5'" . DT  B  1  48  ? 36.857  29.823 -28.187 1.00 91.72  ? 194  DT  J "O5'" 1 
ATOM   3951  C  "C5'" . DT  B  1  48  ? 38.216  29.938 -27.763 1.00 87.28  ? 194  DT  J "C5'" 1 
ATOM   3952  C  "C4'" . DT  B  1  48  ? 39.119  29.082 -28.623 1.00 84.05  ? 194  DT  J "C4'" 1 
ATOM   3953  O  "O4'" . DT  B  1  48  ? 38.899  27.676 -28.357 1.00 83.25  ? 194  DT  J "O4'" 1 
ATOM   3954  C  "C3'" . DT  B  1  48  ? 38.971  29.259 -30.134 1.00 81.67  ? 194  DT  J "C3'" 1 
ATOM   3955  O  "O3'" . DT  B  1  48  ? 40.273  29.260 -30.722 1.00 79.22  ? 194  DT  J "O3'" 1 
ATOM   3956  C  "C2'" . DT  B  1  48  ? 38.195  28.024 -30.560 1.00 82.11  ? 194  DT  J "C2'" 1 
ATOM   3957  C  "C1'" . DT  B  1  48  ? 38.697  26.981 -29.578 1.00 83.11  ? 194  DT  J "C1'" 1 
ATOM   3958  N  N1    . DT  B  1  48  ? 37.767  25.863 -29.314 1.00 83.76  ? 194  DT  J N1    1 
ATOM   3959  C  C2    . DT  B  1  48  ? 38.235  24.573 -29.460 1.00 84.56  ? 194  DT  J C2    1 
ATOM   3960  O  O2    . DT  B  1  48  ? 39.373  24.309 -29.812 1.00 84.34  ? 194  DT  J O2    1 
ATOM   3961  N  N3    . DT  B  1  48  ? 37.314  23.594 -29.175 1.00 85.28  ? 194  DT  J N3    1 
ATOM   3962  C  C4    . DT  B  1  48  ? 36.003  23.770 -28.769 1.00 85.72  ? 194  DT  J C4    1 
ATOM   3963  O  O4    . DT  B  1  48  ? 35.295  22.790 -28.536 1.00 85.43  ? 194  DT  J O4    1 
ATOM   3964  C  C5    . DT  B  1  48  ? 35.577  25.145 -28.649 1.00 85.54  ? 194  DT  J C5    1 
ATOM   3965  C  C7    . DT  B  1  48  ? 34.171  25.432 -28.226 1.00 86.16  ? 194  DT  J C7    1 
ATOM   3966  C  C6    . DT  B  1  48  ? 36.468  26.110 -28.925 1.00 84.94  ? 194  DT  J C6    1 
ATOM   3967  P  P     . DC  B  1  49  ? 40.471  29.760 -32.236 1.00 76.78  ? 195  DC  J P     1 
ATOM   3968  O  OP1   . DC  B  1  49  ? 41.827  30.357 -32.345 1.00 76.66  ? 195  DC  J OP1   1 
ATOM   3969  O  OP2   . DC  B  1  49  ? 39.283  30.558 -32.635 1.00 76.52  ? 195  DC  J OP2   1 
ATOM   3970  O  "O5'" . DC  B  1  49  ? 40.452  28.402 -33.063 1.00 73.14  ? 195  DC  J "O5'" 1 
ATOM   3971  C  "C5'" . DC  B  1  49  ? 41.422  27.391 -32.821 1.00 68.60  ? 195  DC  J "C5'" 1 
ATOM   3972  C  "C4'" . DC  B  1  49  ? 41.077  26.154 -33.613 1.00 67.25  ? 195  DC  J "C4'" 1 
ATOM   3973  O  "O4'" . DC  B  1  49  ? 39.971  25.460 -32.988 1.00 67.68  ? 195  DC  J "O4'" 1 
ATOM   3974  C  "C3'" . DC  B  1  49  ? 40.640  26.446 -35.053 1.00 64.79  ? 195  DC  J "C3'" 1 
ATOM   3975  O  "O3'" . DC  B  1  49  ? 41.094  25.397 -35.910 1.00 60.46  ? 195  DC  J "O3'" 1 
ATOM   3976  C  "C2'" . DC  B  1  49  ? 39.126  26.372 -34.963 1.00 66.78  ? 195  DC  J "C2'" 1 
ATOM   3977  C  "C1'" . DC  B  1  49  ? 38.966  25.241 -33.963 1.00 68.87  ? 195  DC  J "C1'" 1 
ATOM   3978  N  N1    . DC  B  1  49  ? 37.667  25.140 -33.278 1.00 69.78  ? 195  DC  J N1    1 
ATOM   3979  C  C2    . DC  B  1  49  ? 37.297  23.905 -32.732 1.00 70.51  ? 195  DC  J C2    1 
ATOM   3980  O  O2    . DC  B  1  49  ? 38.076  22.946 -32.839 1.00 68.64  ? 195  DC  J O2    1 
ATOM   3981  N  N3    . DC  B  1  49  ? 36.105  23.789 -32.104 1.00 70.98  ? 195  DC  J N3    1 
ATOM   3982  C  C4    . DC  B  1  49  ? 35.296  24.847 -32.011 1.00 72.36  ? 195  DC  J C4    1 
ATOM   3983  N  N4    . DC  B  1  49  ? 34.128  24.688 -31.384 1.00 73.72  ? 195  DC  J N4    1 
ATOM   3984  C  C5    . DC  B  1  49  ? 35.648  26.117 -32.558 1.00 72.22  ? 195  DC  J C5    1 
ATOM   3985  C  C6    . DC  B  1  49  ? 36.833  26.218 -33.175 1.00 71.35  ? 195  DC  J C6    1 
ATOM   3986  P  P     . DC  B  1  50  ? 42.566  25.465 -36.549 1.00 57.76  ? 196  DC  J P     1 
ATOM   3987  O  OP1   . DC  B  1  50  ? 43.504  25.857 -35.465 1.00 54.10  ? 196  DC  J OP1   1 
ATOM   3988  O  OP2   . DC  B  1  50  ? 42.508  26.270 -37.797 1.00 56.67  ? 196  DC  J OP2   1 
ATOM   3989  O  "O5'" . DC  B  1  50  ? 42.863  23.947 -36.915 1.00 54.63  ? 196  DC  J "O5'" 1 
ATOM   3990  C  "C5'" . DC  B  1  50  ? 43.268  23.025 -35.904 1.00 55.15  ? 196  DC  J "C5'" 1 
ATOM   3991  C  "C4'" . DC  B  1  50  ? 42.628  21.677 -36.139 1.00 55.82  ? 196  DC  J "C4'" 1 
ATOM   3992  O  "O4'" . DC  B  1  50  ? 41.274  21.635 -35.618 1.00 57.11  ? 196  DC  J "O4'" 1 
ATOM   3993  C  "C3'" . DC  B  1  50  ? 42.538  21.290 -37.613 1.00 54.82  ? 196  DC  J "C3'" 1 
ATOM   3994  O  "O3'" . DC  B  1  50  ? 42.999  19.954 -37.793 1.00 52.33  ? 196  DC  J "O3'" 1 
ATOM   3995  C  "C2'" . DC  B  1  50  ? 41.057  21.432 -37.940 1.00 55.15  ? 196  DC  J "C2'" 1 
ATOM   3996  C  "C1'" . DC  B  1  50  ? 40.388  21.129 -36.608 1.00 56.80  ? 196  DC  J "C1'" 1 
ATOM   3997  N  N1    . DC  B  1  50  ? 39.064  21.757 -36.398 1.00 58.15  ? 196  DC  J N1    1 
ATOM   3998  C  C2    . DC  B  1  50  ? 38.012  20.972 -35.883 1.00 58.53  ? 196  DC  J C2    1 
ATOM   3999  O  O2    . DC  B  1  50  ? 38.214  19.773 -35.650 1.00 58.52  ? 196  DC  J O2    1 
ATOM   4000  N  N3    . DC  B  1  50  ? 36.806  21.544 -35.661 1.00 57.35  ? 196  DC  J N3    1 
ATOM   4001  C  C4    . DC  B  1  50  ? 36.618  22.836 -35.941 1.00 59.10  ? 196  DC  J C4    1 
ATOM   4002  N  N4    . DC  B  1  50  ? 35.414  23.360 -35.699 1.00 58.95  ? 196  DC  J N4    1 
ATOM   4003  C  C5    . DC  B  1  50  ? 37.660  23.652 -36.482 1.00 58.01  ? 196  DC  J C5    1 
ATOM   4004  C  C6    . DC  B  1  50  ? 38.854  23.078 -36.690 1.00 57.20  ? 196  DC  J C6    1 
ATOM   4005  P  P     . DA  B  1  51  ? 43.181  19.377 -39.271 1.00 50.85  ? 197  DA  J P     1 
ATOM   4006  O  OP1   . DA  B  1  51  ? 44.514  18.737 -39.364 1.00 51.67  ? 197  DA  J OP1   1 
ATOM   4007  O  OP2   . DA  B  1  51  ? 42.810  20.464 -40.212 1.00 51.95  ? 197  DA  J OP2   1 
ATOM   4008  O  "O5'" . DA  B  1  51  ? 42.080  18.233 -39.358 1.00 56.86  ? 197  DA  J "O5'" 1 
ATOM   4009  C  "C5'" . DA  B  1  51  ? 42.047  17.197 -38.377 1.00 62.09  ? 197  DA  J "C5'" 1 
ATOM   4010  C  "C4'" . DA  B  1  51  ? 40.810  16.347 -38.546 1.00 66.17  ? 197  DA  J "C4'" 1 
ATOM   4011  O  "O4'" . DA  B  1  51  ? 39.631  17.117 -38.214 1.00 66.95  ? 197  DA  J "O4'" 1 
ATOM   4012  C  "C3'" . DA  B  1  51  ? 40.582  15.806 -39.955 1.00 68.91  ? 197  DA  J "C3'" 1 
ATOM   4013  O  "O3'" . DA  B  1  51  ? 40.091  14.467 -39.853 1.00 73.82  ? 197  DA  J "O3'" 1 
ATOM   4014  C  "C2'" . DA  B  1  51  ? 39.542  16.755 -40.531 1.00 67.80  ? 197  DA  J "C2'" 1 
ATOM   4015  C  "C1'" . DA  B  1  51  ? 38.725  17.128 -39.307 1.00 67.23  ? 197  DA  J "C1'" 1 
ATOM   4016  N  N9    . DA  B  1  51  ? 38.104  18.451 -39.344 1.00 68.50  ? 197  DA  J N9    1 
ATOM   4017  C  C8    . DA  B  1  51  ? 38.647  19.626 -39.798 1.00 69.57  ? 197  DA  J C8    1 
ATOM   4018  N  N7    . DA  B  1  51  ? 37.862  20.665 -39.649 1.00 69.93  ? 197  DA  J N7    1 
ATOM   4019  C  C5    . DA  B  1  51  ? 36.718  20.138 -39.068 1.00 69.45  ? 197  DA  J C5    1 
ATOM   4020  C  C6    . DA  B  1  51  ? 35.508  20.727 -38.654 1.00 69.53  ? 197  DA  J C6    1 
ATOM   4021  N  N6    . DA  B  1  51  ? 35.245  22.033 -38.752 1.00 68.51  ? 197  DA  J N6    1 
ATOM   4022  N  N1    . DA  B  1  51  ? 34.566  19.919 -38.124 1.00 68.63  ? 197  DA  J N1    1 
ATOM   4023  C  C2    . DA  B  1  51  ? 34.830  18.612 -38.017 1.00 68.90  ? 197  DA  J C2    1 
ATOM   4024  N  N3    . DA  B  1  51  ? 35.928  17.942 -38.364 1.00 70.10  ? 197  DA  J N3    1 
ATOM   4025  C  C4    . DA  B  1  51  ? 36.846  18.773 -38.889 1.00 69.79  ? 197  DA  J C4    1 
ATOM   4026  P  P     . DT  B  1  52  ? 39.862  13.589 -41.179 1.00 77.37  ? 198  DT  J P     1 
ATOM   4027  O  OP1   . DT  B  1  52  ? 40.465  12.255 -40.933 1.00 78.16  ? 198  DT  J OP1   1 
ATOM   4028  O  OP2   . DT  B  1  52  ? 40.275  14.373 -42.370 1.00 78.00  ? 198  DT  J OP2   1 
ATOM   4029  O  "O5'" . DT  B  1  52  ? 38.282  13.431 -41.202 1.00 79.83  ? 198  DT  J "O5'" 1 
ATOM   4030  C  "C5'" . DT  B  1  52  ? 37.464  14.469 -40.676 1.00 84.60  ? 198  DT  J "C5'" 1 
ATOM   4031  C  "C4'" . DT  B  1  52  ? 36.033  14.281 -41.106 1.00 87.87  ? 198  DT  J "C4'" 1 
ATOM   4032  O  "O4'" . DT  B  1  52  ? 35.329  15.514 -40.819 1.00 86.94  ? 198  DT  J "O4'" 1 
ATOM   4033  C  "C3'" . DT  B  1  52  ? 35.875  14.044 -42.608 1.00 90.83  ? 198  DT  J "C3'" 1 
ATOM   4034  O  "O3'" . DT  B  1  52  ? 34.769  13.173 -42.844 1.00 97.05  ? 198  DT  J "O3'" 1 
ATOM   4035  C  "C2'" . DT  B  1  52  ? 35.575  15.425 -43.152 1.00 89.87  ? 198  DT  J "C2'" 1 
ATOM   4036  C  "C1'" . DT  B  1  52  ? 34.801  16.064 -42.013 1.00 87.65  ? 198  DT  J "C1'" 1 
ATOM   4037  N  N1    . DT  B  1  52  ? 34.949  17.527 -41.945 1.00 87.36  ? 198  DT  J N1    1 
ATOM   4038  C  C2    . DT  B  1  52  ? 33.968  18.243 -41.306 1.00 87.24  ? 198  DT  J C2    1 
ATOM   4039  O  O2    . DT  B  1  52  ? 33.016  17.719 -40.755 1.00 87.19  ? 198  DT  J O2    1 
ATOM   4040  N  N3    . DT  B  1  52  ? 34.146  19.604 -41.334 1.00 86.95  ? 198  DT  J N3    1 
ATOM   4041  C  C4    . DT  B  1  52  ? 35.189  20.300 -41.918 1.00 86.64  ? 198  DT  J C4    1 
ATOM   4042  O  O4    . DT  B  1  52  ? 35.202  21.528 -41.882 1.00 86.05  ? 198  DT  J O4    1 
ATOM   4043  C  C5    . DT  B  1  52  ? 36.199  19.480 -42.543 1.00 86.83  ? 198  DT  J C5    1 
ATOM   4044  C  C7    . DT  B  1  52  ? 37.380  20.142 -43.179 1.00 86.24  ? 198  DT  J C7    1 
ATOM   4045  C  C6    . DT  B  1  52  ? 36.031  18.154 -42.525 1.00 87.07  ? 198  DT  J C6    1 
ATOM   4046  P  P     . DC  B  1  53  ? 34.782  12.184 -44.112 1.00 100.52 ? 199  DC  J P     1 
ATOM   4047  O  OP1   . DC  B  1  53  ? 35.351  10.877 -43.692 1.00 99.94  ? 199  DC  J OP1   1 
ATOM   4048  O  OP2   . DC  B  1  53  ? 35.370  12.907 -45.271 1.00 101.42 ? 199  DC  J OP2   1 
ATOM   4049  O  "O5'" . DC  B  1  53  ? 33.235  11.977 -44.395 1.00 101.35 ? 199  DC  J "O5'" 1 
ATOM   4050  C  "C5'" . DC  B  1  53  ? 32.344  11.709 -43.321 1.00 104.35 ? 199  DC  J "C5'" 1 
ATOM   4051  C  "C4'" . DC  B  1  53  ? 31.043  12.442 -43.536 1.00 106.11 ? 199  DC  J "C4'" 1 
ATOM   4052  O  "O4'" . DC  B  1  53  ? 31.194  13.849 -43.211 1.00 105.60 ? 199  DC  J "O4'" 1 
ATOM   4053  C  "C3'" . DC  B  1  53  ? 30.541  12.386 -44.981 1.00 107.23 ? 199  DC  J "C3'" 1 
ATOM   4054  O  "O3'" . DC  B  1  53  ? 29.127  12.158 -45.008 1.00 108.88 ? 199  DC  J "O3'" 1 
ATOM   4055  C  "C2'" . DC  B  1  53  ? 30.874  13.766 -45.519 1.00 106.88 ? 199  DC  J "C2'" 1 
ATOM   4056  C  "C1'" . DC  B  1  53  ? 30.678  14.622 -44.282 1.00 106.03 ? 199  DC  J "C1'" 1 
ATOM   4057  N  N1    . DC  B  1  53  ? 31.372  15.921 -44.306 1.00 105.45 ? 199  DC  J N1    1 
ATOM   4058  C  C2    . DC  B  1  53  ? 30.708  17.043 -43.796 1.00 104.94 ? 199  DC  J C2    1 
ATOM   4059  O  O2    . DC  B  1  53  ? 29.578  16.900 -43.310 1.00 105.22 ? 199  DC  J O2    1 
ATOM   4060  N  N3    . DC  B  1  53  ? 31.314  18.250 -43.846 1.00 104.56 ? 199  DC  J N3    1 
ATOM   4061  C  C4    . DC  B  1  53  ? 32.535  18.362 -44.372 1.00 104.30 ? 199  DC  J C4    1 
ATOM   4062  N  N4    . DC  B  1  53  ? 33.088  19.575 -44.411 1.00 103.41 ? 199  DC  J N4    1 
ATOM   4063  C  C5    . DC  B  1  53  ? 33.241  17.234 -44.885 1.00 104.32 ? 199  DC  J C5    1 
ATOM   4064  C  C6    . DC  B  1  53  ? 32.629  16.043 -44.830 1.00 105.15 ? 199  DC  J C6    1 
ATOM   4065  P  P     . DA  B  1  54  ? 28.267  12.635 -46.280 1.00 109.63 ? 200  DA  J P     1 
ATOM   4066  O  OP1   . DA  B  1  54  ? 26.927  11.999 -46.205 1.00 110.17 ? 200  DA  J OP1   1 
ATOM   4067  O  OP2   . DA  B  1  54  ? 29.100  12.455 -47.497 1.00 109.02 ? 200  DA  J OP2   1 
ATOM   4068  O  "O5'" . DA  B  1  54  ? 28.082  14.195 -46.028 1.00 109.21 ? 200  DA  J "O5'" 1 
ATOM   4069  C  "C5'" . DA  B  1  54  ? 27.013  14.677 -45.222 1.00 108.67 ? 200  DA  J "C5'" 1 
ATOM   4070  C  "C4'" . DA  B  1  54  ? 26.232  15.711 -45.992 1.00 108.63 ? 200  DA  J "C4'" 1 
ATOM   4071  O  "O4'" . DA  B  1  54  ? 26.952  16.967 -45.989 1.00 107.91 ? 200  DA  J "O4'" 1 
ATOM   4072  C  "C3'" . DA  B  1  54  ? 26.059  15.319 -47.457 1.00 108.95 ? 200  DA  J "C3'" 1 
ATOM   4073  O  "O3'" . DA  B  1  54  ? 24.752  15.653 -47.923 1.00 110.63 ? 200  DA  J "O3'" 1 
ATOM   4074  C  "C2'" . DA  B  1  54  ? 27.127  16.126 -48.173 1.00 107.89 ? 200  DA  J "C2'" 1 
ATOM   4075  C  "C1'" . DA  B  1  54  ? 27.228  17.378 -47.319 1.00 107.11 ? 200  DA  J "C1'" 1 
ATOM   4076  N  N9    . DA  B  1  54  ? 28.548  18.010 -47.328 1.00 105.98 ? 200  DA  J N9    1 
ATOM   4077  C  C8    . DA  B  1  54  ? 29.775  17.399 -47.414 1.00 105.59 ? 200  DA  J C8    1 
ATOM   4078  N  N7    . DA  B  1  54  ? 30.784  18.236 -47.404 1.00 104.99 ? 200  DA  J N7    1 
ATOM   4079  C  C5    . DA  B  1  54  ? 30.183  19.482 -47.304 1.00 104.96 ? 200  DA  J C5    1 
ATOM   4080  C  C6    . DA  B  1  54  ? 30.709  20.786 -47.246 1.00 104.88 ? 200  DA  J C6    1 
ATOM   4081  N  N6    . DA  B  1  54  ? 32.014  21.062 -47.284 1.00 104.26 ? 200  DA  J N6    1 
ATOM   4082  N  N1    . DA  B  1  54  ? 29.836  21.812 -47.146 1.00 104.91 ? 200  DA  J N1    1 
ATOM   4083  C  C2    . DA  B  1  54  ? 28.527  21.536 -47.110 1.00 105.06 ? 200  DA  J C2    1 
ATOM   4084  N  N3    . DA  B  1  54  ? 27.912  20.356 -47.156 1.00 105.13 ? 200  DA  J N3    1 
ATOM   4085  C  C4    . DA  B  1  54  ? 28.806  19.358 -47.254 1.00 105.19 ? 200  DA  J C4    1 
ATOM   4086  P  P     . DA  B  1  55  ? 24.341  15.314 -49.437 1.00 111.36 ? 201  DA  J P     1 
ATOM   4087  O  OP1   . DA  B  1  55  ? 22.895  14.974 -49.469 1.00 111.50 ? 201  DA  J OP1   1 
ATOM   4088  O  OP2   . DA  B  1  55  ? 25.335  14.350 -49.977 1.00 111.14 ? 201  DA  J OP2   1 
ATOM   4089  O  "O5'" . DA  B  1  55  ? 24.546  16.706 -50.177 1.00 110.95 ? 201  DA  J "O5'" 1 
ATOM   4090  C  "C5'" . DA  B  1  55  ? 23.779  17.843 -49.798 1.00 110.67 ? 201  DA  J "C5'" 1 
ATOM   4091  C  "C4'" . DA  B  1  55  ? 23.920  18.922 -50.842 1.00 110.54 ? 201  DA  J "C4'" 1 
ATOM   4092  O  "O4'" . DA  B  1  55  ? 25.190  19.602 -50.691 1.00 110.30 ? 201  DA  J "O4'" 1 
ATOM   4093  C  "C3'" . DA  B  1  55  ? 23.901  18.362 -52.262 1.00 110.81 ? 201  DA  J "C3'" 1 
ATOM   4094  O  "O3'" . DA  B  1  55  ? 23.214  19.264 -53.120 1.00 111.57 ? 201  DA  J "O3'" 1 
ATOM   4095  C  "C2'" . DA  B  1  55  ? 25.372  18.299 -52.629 1.00 110.68 ? 201  DA  J "C2'" 1 
ATOM   4096  C  "C1'" . DA  B  1  55  ? 25.932  19.507 -51.897 1.00 110.21 ? 201  DA  J "C1'" 1 
ATOM   4097  N  N9    . DA  B  1  55  ? 27.352  19.402 -51.552 1.00 109.28 ? 201  DA  J N9    1 
ATOM   4098  C  C8    . DA  B  1  55  ? 28.123  18.267 -51.489 1.00 108.65 ? 201  DA  J C8    1 
ATOM   4099  N  N7    . DA  B  1  55  ? 29.372  18.493 -51.163 1.00 108.23 ? 201  DA  J N7    1 
ATOM   4100  C  C5    . DA  B  1  55  ? 29.428  19.870 -50.997 1.00 107.93 ? 201  DA  J C5    1 
ATOM   4101  C  C6    . DA  B  1  55  ? 30.477  20.737 -50.647 1.00 106.97 ? 201  DA  J C6    1 
ATOM   4102  N  N6    . DA  B  1  55  ? 31.719  20.328 -50.389 1.00 105.87 ? 201  DA  J N6    1 
ATOM   4103  N  N1    . DA  B  1  55  ? 30.201  22.056 -50.568 1.00 106.54 ? 201  DA  J N1    1 
ATOM   4104  C  C2    . DA  B  1  55  ? 28.953  22.466 -50.823 1.00 106.72 ? 201  DA  J C2    1 
ATOM   4105  N  N3    . DA  B  1  55  ? 27.883  21.749 -51.160 1.00 107.44 ? 201  DA  J N3    1 
ATOM   4106  C  C4    . DA  B  1  55  ? 28.191  20.443 -51.231 1.00 108.27 ? 201  DA  J C4    1 
ATOM   4107  P  P     . DA  B  1  56  ? 22.820  18.810 -54.609 1.00 111.52 ? 202  DA  J P     1 
ATOM   4108  O  OP1   . DA  B  1  56  ? 21.479  18.171 -54.565 1.00 111.46 ? 202  DA  J OP1   1 
ATOM   4109  O  OP2   . DA  B  1  56  ? 23.966  18.068 -55.200 1.00 110.97 ? 202  DA  J OP2   1 
ATOM   4110  O  "O5'" . DA  B  1  56  ? 22.695  20.210 -55.355 1.00 109.76 ? 202  DA  J "O5'" 1 
ATOM   4111  C  "C5'" . DA  B  1  56  ? 22.384  21.392 -54.616 1.00 105.96 ? 202  DA  J "C5'" 1 
ATOM   4112  C  "C4'" . DA  B  1  56  ? 23.280  22.529 -55.046 1.00 103.35 ? 202  DA  J "C4'" 1 
ATOM   4113  O  "O4'" . DA  B  1  56  ? 24.610  22.391 -54.484 1.00 102.62 ? 202  DA  J "O4'" 1 
ATOM   4114  C  "C3'" . DA  B  1  56  ? 23.465  22.622 -56.559 1.00 102.33 ? 202  DA  J "C3'" 1 
ATOM   4115  O  "O3'" . DA  B  1  56  ? 23.386  23.981 -56.976 1.00 101.14 ? 202  DA  J "O3'" 1 
ATOM   4116  C  "C2'" . DA  B  1  56  ? 24.864  22.076 -56.785 1.00 101.98 ? 202  DA  J "C2'" 1 
ATOM   4117  C  "C1'" . DA  B  1  56  ? 25.577  22.511 -55.519 1.00 101.60 ? 202  DA  J "C1'" 1 
ATOM   4118  N  N9    . DA  B  1  56  ? 26.744  21.701 -55.157 1.00 100.31 ? 202  DA  J N9    1 
ATOM   4119  C  C8    . DA  B  1  56  ? 26.820  20.336 -55.030 1.00 99.64  ? 202  DA  J C8    1 
ATOM   4120  N  N7    . DA  B  1  56  ? 28.009  19.900 -54.685 1.00 98.74  ? 202  DA  J N7    1 
ATOM   4121  C  C5    . DA  B  1  56  ? 28.769  21.056 -54.580 1.00 98.22  ? 202  DA  J C5    1 
ATOM   4122  C  C6    . DA  B  1  56  ? 30.117  21.274 -54.241 1.00 97.17  ? 202  DA  J C6    1 
ATOM   4123  N  N6    . DA  B  1  56  ? 30.968  20.295 -53.929 1.00 94.97  ? 202  DA  J N6    1 
ATOM   4124  N  N1    . DA  B  1  56  ? 30.564  22.548 -54.229 1.00 96.97  ? 202  DA  J N1    1 
ATOM   4125  C  C2    . DA  B  1  56  ? 29.707  23.530 -54.536 1.00 97.43  ? 202  DA  J C2    1 
ATOM   4126  N  N3    . DA  B  1  56  ? 28.419  23.453 -54.867 1.00 98.16  ? 202  DA  J N3    1 
ATOM   4127  C  C4    . DA  B  1  56  ? 28.005  22.173 -54.871 1.00 99.11  ? 202  DA  J C4    1 
ATOM   4128  P  P     . DA  B  1  57  ? 23.306  24.319 -58.537 1.00 99.95  ? 203  DA  J P     1 
ATOM   4129  O  OP1   . DA  B  1  57  ? 22.459  25.527 -58.702 1.00 100.22 ? 203  DA  J OP1   1 
ATOM   4130  O  OP2   . DA  B  1  57  ? 22.948  23.062 -59.244 1.00 99.68  ? 203  DA  J OP2   1 
ATOM   4131  O  "O5'" . DA  B  1  57  ? 24.808  24.688 -58.913 1.00 99.40  ? 203  DA  J "O5'" 1 
ATOM   4132  C  "C5'" . DA  B  1  57  ? 25.427  25.855 -58.375 1.00 96.98  ? 203  DA  J "C5'" 1 
ATOM   4133  C  "C4'" . DA  B  1  57  ? 26.764  26.085 -59.037 1.00 95.24  ? 203  DA  J "C4'" 1 
ATOM   4134  O  "O4'" . DA  B  1  57  ? 27.744  25.139 -58.545 1.00 94.63  ? 203  DA  J "O4'" 1 
ATOM   4135  C  "C3'" . DA  B  1  57  ? 26.751  25.929 -60.558 1.00 93.83  ? 203  DA  J "C3'" 1 
ATOM   4136  O  "O3'" . DA  B  1  57  ? 27.620  26.900 -61.134 1.00 93.17  ? 203  DA  J "O3'" 1 
ATOM   4137  C  "C2'" . DA  B  1  57  ? 27.345  24.549 -60.766 1.00 93.22  ? 203  DA  J "C2'" 1 
ATOM   4138  C  "C1'" . DA  B  1  57  ? 28.371  24.510 -59.650 1.00 93.37  ? 203  DA  J "C1'" 1 
ATOM   4139  N  N9    . DA  B  1  57  ? 28.805  23.179 -59.230 1.00 91.92  ? 203  DA  J N9    1 
ATOM   4140  C  C8    . DA  B  1  57  ? 28.210  21.965 -59.461 1.00 91.97  ? 203  DA  J C8    1 
ATOM   4141  N  N7    . DA  B  1  57  ? 28.863  20.950 -58.950 1.00 91.28  ? 203  DA  J N7    1 
ATOM   4142  C  C5    . DA  B  1  57  ? 29.963  21.537 -58.340 1.00 90.79  ? 203  DA  J C5    1 
ATOM   4143  C  C6    . DA  B  1  57  ? 31.045  21.002 -57.625 1.00 90.12  ? 203  DA  J C6    1 
ATOM   4144  N  N6    . DA  B  1  57  ? 31.208  19.700 -57.389 1.00 89.64  ? 203  DA  J N6    1 
ATOM   4145  N  N1    . DA  B  1  57  ? 31.971  21.863 -57.154 1.00 89.93  ? 203  DA  J N1    1 
ATOM   4146  C  C2    . DA  B  1  57  ? 31.810  23.169 -57.392 1.00 90.12  ? 203  DA  J C2    1 
ATOM   4147  N  N3    . DA  B  1  57  ? 30.840  23.792 -58.051 1.00 89.75  ? 203  DA  J N3    1 
ATOM   4148  C  C4    . DA  B  1  57  ? 29.938  22.909 -58.505 1.00 90.78  ? 203  DA  J C4    1 
ATOM   4149  P  P     . DG  B  1  58  ? 27.021  28.038 -62.093 1.00 92.88  ? 204  DG  J P     1 
ATOM   4150  O  OP1   . DG  B  1  58  ? 26.116  28.897 -61.287 1.00 91.88  ? 204  DG  J OP1   1 
ATOM   4151  O  OP2   . DG  B  1  58  ? 26.510  27.366 -63.315 1.00 91.70  ? 204  DG  J OP2   1 
ATOM   4152  O  "O5'" . DG  B  1  58  ? 28.302  28.896 -62.492 1.00 90.44  ? 204  DG  J "O5'" 1 
ATOM   4153  C  "C5'" . DG  B  1  58  ? 29.145  29.462 -61.490 1.00 86.36  ? 204  DG  J "C5'" 1 
ATOM   4154  C  "C4'" . DG  B  1  58  ? 30.580  29.048 -61.720 1.00 83.63  ? 204  DG  J "C4'" 1 
ATOM   4155  O  "O4'" . DG  B  1  58  ? 30.769  27.649 -61.394 1.00 81.87  ? 204  DG  J "O4'" 1 
ATOM   4156  C  "C3'" . DG  B  1  58  ? 31.069  29.212 -63.161 1.00 81.76  ? 204  DG  J "C3'" 1 
ATOM   4157  O  "O3'" . DG  B  1  58  ? 32.449  29.556 -63.138 1.00 79.50  ? 204  DG  J "O3'" 1 
ATOM   4158  C  "C2'" . DG  B  1  58  ? 30.960  27.804 -63.713 1.00 81.48  ? 204  DG  J "C2'" 1 
ATOM   4159  C  "C1'" . DG  B  1  58  ? 31.388  27.006 -62.496 1.00 81.82  ? 204  DG  J "C1'" 1 
ATOM   4160  N  N9    . DG  B  1  58  ? 30.996  25.602 -62.487 1.00 81.45  ? 204  DG  J N9    1 
ATOM   4161  C  C8    . DG  B  1  58  ? 29.881  25.042 -63.060 1.00 81.98  ? 204  DG  J C8    1 
ATOM   4162  N  N7    . DG  B  1  58  ? 29.814  23.750 -62.890 1.00 82.69  ? 204  DG  J N7    1 
ATOM   4163  C  C5    . DG  B  1  58  ? 30.952  23.439 -62.157 1.00 82.03  ? 204  DG  J C5    1 
ATOM   4164  C  C6    . DG  B  1  58  ? 31.425  22.189 -61.672 1.00 81.83  ? 204  DG  J C6    1 
ATOM   4165  O  O6    . DG  B  1  58  ? 30.912  21.070 -61.792 1.00 81.85  ? 204  DG  J O6    1 
ATOM   4166  N  N1    . DG  B  1  58  ? 32.624  22.328 -60.982 1.00 81.64  ? 204  DG  J N1    1 
ATOM   4167  C  C2    . DG  B  1  58  ? 33.283  23.513 -60.777 1.00 81.86  ? 204  DG  J C2    1 
ATOM   4168  N  N2    . DG  B  1  58  ? 34.426  23.440 -60.081 1.00 81.12  ? 204  DG  J N2    1 
ATOM   4169  N  N3    . DG  B  1  58  ? 32.852  24.685 -61.222 1.00 81.75  ? 204  DG  J N3    1 
ATOM   4170  C  C4    . DG  B  1  58  ? 31.690  24.572 -61.899 1.00 81.74  ? 204  DG  J C4    1 
ATOM   4171  P  P     . DG  B  1  59  ? 32.899  31.078 -63.348 1.00 77.84  ? 205  DG  J P     1 
ATOM   4172  O  OP1   . DG  B  1  59  ? 32.046  31.952 -62.505 1.00 77.09  ? 205  DG  J OP1   1 
ATOM   4173  O  OP2   . DG  B  1  59  ? 32.980  31.309 -64.812 1.00 77.78  ? 205  DG  J OP2   1 
ATOM   4174  O  "O5'" . DG  B  1  59  ? 34.367  31.098 -62.737 1.00 76.12  ? 205  DG  J "O5'" 1 
ATOM   4175  C  "C5'" . DG  B  1  59  ? 34.567  30.906 -61.338 1.00 71.74  ? 205  DG  J "C5'" 1 
ATOM   4176  C  "C4'" . DG  B  1  59  ? 35.729  29.973 -61.092 1.00 68.40  ? 205  DG  J "C4'" 1 
ATOM   4177  O  "O4'" . DG  B  1  59  ? 35.370  28.602 -61.384 1.00 67.81  ? 205  DG  J "O4'" 1 
ATOM   4178  C  "C3'" . DG  B  1  59  ? 36.980  30.271 -61.913 1.00 65.63  ? 205  DG  J "C3'" 1 
ATOM   4179  O  "O3'" . DG  B  1  59  ? 38.116  30.088 -61.074 1.00 62.44  ? 205  DG  J "O3'" 1 
ATOM   4180  C  "C2'" . DG  B  1  59  ? 36.925  29.241 -63.031 1.00 65.75  ? 205  DG  J "C2'" 1 
ATOM   4181  C  "C1'" . DG  B  1  59  ? 36.235  28.053 -62.372 1.00 67.59  ? 205  DG  J "C1'" 1 
ATOM   4182  N  N9    . DG  B  1  59  ? 35.409  27.255 -63.276 1.00 68.59  ? 205  DG  J N9    1 
ATOM   4183  C  C8    . DG  B  1  59  ? 34.518  27.734 -64.203 1.00 69.48  ? 205  DG  J C8    1 
ATOM   4184  N  N7    . DG  B  1  59  ? 33.877  26.791 -64.837 1.00 70.44  ? 205  DG  J N7    1 
ATOM   4185  C  C5    . DG  B  1  59  ? 34.378  25.612 -64.301 1.00 70.48  ? 205  DG  J C5    1 
ATOM   4186  C  C6    . DG  B  1  59  ? 34.043  24.252 -64.582 1.00 70.15  ? 205  DG  J C6    1 
ATOM   4187  O  O6    . DG  B  1  59  ? 33.196  23.810 -65.366 1.00 70.57  ? 205  DG  J O6    1 
ATOM   4188  N  N1    . DG  B  1  59  ? 34.805  23.371 -63.825 1.00 69.85  ? 205  DG  J N1    1 
ATOM   4189  C  C2    . DG  B  1  59  ? 35.757  23.740 -62.906 1.00 69.90  ? 205  DG  J C2    1 
ATOM   4190  N  N2    . DG  B  1  59  ? 36.393  22.734 -62.287 1.00 67.85  ? 205  DG  J N2    1 
ATOM   4191  N  N3    . DG  B  1  59  ? 36.065  25.002 -62.619 1.00 69.87  ? 205  DG  J N3    1 
ATOM   4192  C  C4    . DG  B  1  59  ? 35.342  25.879 -63.350 1.00 69.45  ? 205  DG  J C4    1 
ATOM   4193  P  P     . DC  B  1  60  ? 39.587  30.354 -61.648 1.00 60.26  ? 206  DC  J P     1 
ATOM   4194  O  OP1   . DC  B  1  60  ? 40.444  30.694 -60.482 1.00 58.99  ? 206  DC  J OP1   1 
ATOM   4195  O  OP2   . DC  B  1  60  ? 39.503  31.286 -62.799 1.00 59.43  ? 206  DC  J OP2   1 
ATOM   4196  O  "O5'" . DC  B  1  60  ? 40.025  28.929 -62.202 1.00 56.40  ? 206  DC  J "O5'" 1 
ATOM   4197  C  "C5'" . DC  B  1  60  ? 40.042  27.808 -61.332 1.00 51.34  ? 206  DC  J "C5'" 1 
ATOM   4198  C  "C4'" . DC  B  1  60  ? 40.392  26.555 -62.095 1.00 49.39  ? 206  DC  J "C4'" 1 
ATOM   4199  O  "O4'" . DC  B  1  60  ? 39.283  26.133 -62.927 1.00 50.85  ? 206  DC  J "O4'" 1 
ATOM   4200  C  "C3'" . DC  B  1  60  ? 41.614  26.644 -63.013 1.00 47.40  ? 206  DC  J "C3'" 1 
ATOM   4201  O  "O3'" . DC  B  1  60  ? 42.320  25.424 -62.854 1.00 46.46  ? 206  DC  J "O3'" 1 
ATOM   4202  C  "C2'" . DC  B  1  60  ? 41.000  26.676 -64.405 1.00 47.71  ? 206  DC  J "C2'" 1 
ATOM   4203  C  "C1'" . DC  B  1  60  ? 39.779  25.790 -64.209 1.00 48.85  ? 206  DC  J "C1'" 1 
ATOM   4204  N  N1    . DC  B  1  60  ? 38.687  25.957 -65.182 1.00 50.39  ? 206  DC  J N1    1 
ATOM   4205  C  C2    . DC  B  1  60  ? 37.951  24.826 -65.564 1.00 50.92  ? 206  DC  J C2    1 
ATOM   4206  O  O2    . DC  B  1  60  ? 38.231  23.735 -65.064 1.00 49.16  ? 206  DC  J O2    1 
ATOM   4207  N  N3    . DC  B  1  60  ? 36.953  24.954 -66.468 1.00 51.47  ? 206  DC  J N3    1 
ATOM   4208  C  C4    . DC  B  1  60  ? 36.675  26.154 -66.986 1.00 53.27  ? 206  DC  J C4    1 
ATOM   4209  N  N4    . DC  B  1  60  ? 35.684  26.233 -67.881 1.00 52.14  ? 206  DC  J N4    1 
ATOM   4210  C  C5    . DC  B  1  60  ? 37.403  27.327 -66.609 1.00 51.34  ? 206  DC  J C5    1 
ATOM   4211  C  C6    . DC  B  1  60  ? 38.392  27.183 -65.713 1.00 50.90  ? 206  DC  J C6    1 
ATOM   4212  P  P     . DA  B  1  61  ? 43.909  25.354 -63.050 1.00 40.69  ? 207  DA  J P     1 
ATOM   4213  O  OP1   . DA  B  1  61  ? 44.510  25.529 -61.705 1.00 40.79  ? 207  DA  J OP1   1 
ATOM   4214  O  OP2   . DA  B  1  61  ? 44.365  26.204 -64.183 1.00 40.70  ? 207  DA  J OP2   1 
ATOM   4215  O  "O5'" . DA  B  1  61  ? 44.054  23.814 -63.413 1.00 42.69  ? 207  DA  J "O5'" 1 
ATOM   4216  C  "C5'" . DA  B  1  61  ? 43.486  22.845 -62.523 1.00 41.72  ? 207  DA  J "C5'" 1 
ATOM   4217  C  "C4'" . DA  B  1  61  ? 43.191  21.555 -63.248 1.00 43.43  ? 207  DA  J "C4'" 1 
ATOM   4218  O  "O4'" . DA  B  1  61  ? 42.060  21.704 -64.142 1.00 41.93  ? 207  DA  J "O4'" 1 
ATOM   4219  C  "C3'" . DA  B  1  61  ? 44.348  21.038 -64.091 1.00 42.78  ? 207  DA  J "C3'" 1 
ATOM   4220  O  "O3'" . DA  B  1  61  ? 44.499  19.648 -63.835 1.00 41.42  ? 207  DA  J "O3'" 1 
ATOM   4221  C  "C2'" . DA  B  1  61  ? 43.934  21.350 -65.522 1.00 41.83  ? 207  DA  J "C2'" 1 
ATOM   4222  C  "C1'" . DA  B  1  61  ? 42.411  21.343 -65.468 1.00 43.50  ? 207  DA  J "C1'" 1 
ATOM   4223  N  N9    . DA  B  1  61  ? 41.752  22.300 -66.362 1.00 46.51  ? 207  DA  J N9    1 
ATOM   4224  C  C8    . DA  B  1  61  ? 41.992  23.647 -66.462 1.00 48.04  ? 207  DA  J C8    1 
ATOM   4225  N  N7    . DA  B  1  61  ? 41.207  24.267 -67.310 1.00 49.47  ? 207  DA  J N7    1 
ATOM   4226  C  C5    . DA  B  1  61  ? 40.401  23.259 -67.816 1.00 51.13  ? 207  DA  J C5    1 
ATOM   4227  C  C6    . DA  B  1  61  ? 39.351  23.264 -68.757 1.00 50.40  ? 207  DA  J C6    1 
ATOM   4228  N  N6    . DA  B  1  61  ? 38.897  24.367 -69.367 1.00 47.31  ? 207  DA  J N6    1 
ATOM   4229  N  N1    . DA  B  1  61  ? 38.768  22.081 -69.047 1.00 51.63  ? 207  DA  J N1    1 
ATOM   4230  C  C2    . DA  B  1  61  ? 39.205  20.977 -68.420 1.00 51.65  ? 207  DA  J C2    1 
ATOM   4231  N  N3    . DA  B  1  61  ? 40.168  20.848 -67.511 1.00 48.97  ? 207  DA  J N3    1 
ATOM   4232  C  C4    . DA  B  1  61  ? 40.736  22.037 -67.250 1.00 49.27  ? 207  DA  J C4    1 
ATOM   4233  P  P     . DT  B  1  62  ? 45.646  18.827 -64.571 1.00 43.15  ? 208  DT  J P     1 
ATOM   4234  O  OP1   . DT  B  1  62  ? 45.963  17.701 -63.651 1.00 45.77  ? 208  DT  J OP1   1 
ATOM   4235  O  OP2   . DT  B  1  62  ? 46.732  19.737 -65.031 1.00 45.48  ? 208  DT  J OP2   1 
ATOM   4236  O  "O5'" . DT  B  1  62  ? 44.893  18.270 -65.852 1.00 46.26  ? 208  DT  J "O5'" 1 
ATOM   4237  C  "C5'" . DT  B  1  62  ? 43.663  17.575 -65.688 1.00 46.65  ? 208  DT  J "C5'" 1 
ATOM   4238  C  "C4'" . DT  B  1  62  ? 43.153  17.078 -67.016 1.00 49.98  ? 208  DT  J "C4'" 1 
ATOM   4239  O  "O4'" . DT  B  1  62  ? 42.500  18.133 -67.762 1.00 47.83  ? 208  DT  J "O4'" 1 
ATOM   4240  C  "C3'" . DT  B  1  62  ? 44.213  16.480 -67.938 1.00 50.12  ? 208  DT  J "C3'" 1 
ATOM   4241  O  "O3'" . DT  B  1  62  ? 43.723  15.229 -68.412 1.00 54.11  ? 208  DT  J "O3'" 1 
ATOM   4242  C  "C2'" . DT  B  1  62  ? 44.338  17.505 -69.058 1.00 49.66  ? 208  DT  J "C2'" 1 
ATOM   4243  C  "C1'" . DT  B  1  62  ? 42.944  18.110 -69.104 1.00 49.33  ? 208  DT  J "C1'" 1 
ATOM   4244  N  N1    . DT  B  1  62  ? 42.816  19.487 -69.625 1.00 52.24  ? 208  DT  J N1    1 
ATOM   4245  C  C2    . DT  B  1  62  ? 41.782  19.737 -70.503 1.00 54.21  ? 208  DT  J C2    1 
ATOM   4246  O  O2    . DT  B  1  62  ? 41.029  18.865 -70.909 1.00 55.00  ? 208  DT  J O2    1 
ATOM   4247  N  N3    . DT  B  1  62  ? 41.658  21.050 -70.887 1.00 54.98  ? 208  DT  J N3    1 
ATOM   4248  C  C4    . DT  B  1  62  ? 42.452  22.115 -70.496 1.00 54.91  ? 208  DT  J C4    1 
ATOM   4249  O  O4    . DT  B  1  62  ? 42.187  23.253 -70.890 1.00 51.95  ? 208  DT  J O4    1 
ATOM   4250  C  C5    . DT  B  1  62  ? 43.551  21.772 -69.612 1.00 53.43  ? 208  DT  J C5    1 
ATOM   4251  C  C7    . DT  B  1  62  ? 44.497  22.849 -69.177 1.00 51.59  ? 208  DT  J C7    1 
ATOM   4252  C  C6    . DT  B  1  62  ? 43.673  20.492 -69.225 1.00 52.63  ? 208  DT  J C6    1 
ATOM   4253  P  P     . DG  B  1  63  ? 44.743  14.124 -68.972 1.00 55.51  ? 209  DG  J P     1 
ATOM   4254  O  OP1   . DG  B  1  63  ? 44.240  12.805 -68.496 1.00 58.13  ? 209  DG  J OP1   1 
ATOM   4255  O  OP2   . DG  B  1  63  ? 46.147  14.521 -68.696 1.00 55.37  ? 209  DG  J OP2   1 
ATOM   4256  O  "O5'" . DG  B  1  63  ? 44.499  14.208 -70.540 1.00 56.84  ? 209  DG  J "O5'" 1 
ATOM   4257  C  "C5'" . DG  B  1  63  ? 43.177  14.113 -71.052 1.00 57.78  ? 209  DG  J "C5'" 1 
ATOM   4258  C  "C4'" . DG  B  1  63  ? 43.136  14.558 -72.493 1.00 60.02  ? 209  DG  J "C4'" 1 
ATOM   4259  O  "O4'" . DG  B  1  63  ? 42.978  15.993 -72.609 1.00 59.19  ? 209  DG  J "O4'" 1 
ATOM   4260  C  "C3'" . DG  B  1  63  ? 44.368  14.188 -73.316 1.00 60.68  ? 209  DG  J "C3'" 1 
ATOM   4261  O  "O3'" . DG  B  1  63  ? 43.940  13.577 -74.525 1.00 62.46  ? 209  DG  J "O3'" 1 
ATOM   4262  C  "C2'" . DG  B  1  63  ? 45.041  15.527 -73.582 1.00 59.59  ? 209  DG  J "C2'" 1 
ATOM   4263  C  "C1'" . DG  B  1  63  ? 43.864  16.483 -73.601 1.00 58.43  ? 209  DG  J "C1'" 1 
ATOM   4264  N  N9    . DG  B  1  63  ? 44.173  17.873 -73.275 1.00 58.37  ? 209  DG  J N9    1 
ATOM   4265  C  C8    . DG  B  1  63  ? 45.112  18.328 -72.379 1.00 57.18  ? 209  DG  J C8    1 
ATOM   4266  N  N7    . DG  B  1  63  ? 45.136  19.631 -72.277 1.00 56.52  ? 209  DG  J N7    1 
ATOM   4267  C  C5    . DG  B  1  63  ? 44.160  20.066 -73.165 1.00 56.92  ? 209  DG  J C5    1 
ATOM   4268  C  C6    . DG  B  1  63  ? 43.727  21.384 -73.487 1.00 56.84  ? 209  DG  J C6    1 
ATOM   4269  O  O6    . DG  B  1  63  ? 44.125  22.460 -73.031 1.00 52.43  ? 209  DG  J O6    1 
ATOM   4270  N  N1    . DG  B  1  63  ? 42.718  21.372 -74.443 1.00 58.03  ? 209  DG  J N1    1 
ATOM   4271  C  C2    . DG  B  1  63  ? 42.185  20.243 -75.014 1.00 58.73  ? 209  DG  J C2    1 
ATOM   4272  N  N2    . DG  B  1  63  ? 41.214  20.446 -75.916 1.00 57.67  ? 209  DG  J N2    1 
ATOM   4273  N  N3    . DG  B  1  63  ? 42.575  19.009 -74.723 1.00 57.92  ? 209  DG  J N3    1 
ATOM   4274  C  C4    . DG  B  1  63  ? 43.560  18.995 -73.797 1.00 57.84  ? 209  DG  J C4    1 
ATOM   4275  P  P     . DT  B  1  64  ? 45.016  13.159 -75.628 1.00 65.35  ? 210  DT  J P     1 
ATOM   4276  O  OP1   . DT  B  1  64  ? 44.707  11.774 -76.067 1.00 66.28  ? 210  DT  J OP1   1 
ATOM   4277  O  OP2   . DT  B  1  64  ? 46.370  13.481 -75.112 1.00 65.67  ? 210  DT  J OP2   1 
ATOM   4278  O  "O5'" . DT  B  1  64  ? 44.658  14.157 -76.812 1.00 67.47  ? 210  DT  J "O5'" 1 
ATOM   4279  C  "C5'" . DT  B  1  64  ? 43.292  14.397 -77.146 1.00 68.52  ? 210  DT  J "C5'" 1 
ATOM   4280  C  "C4'" . DT  B  1  64  ? 43.192  15.383 -78.284 1.00 70.31  ? 210  DT  J "C4'" 1 
ATOM   4281  O  "O4'" . DT  B  1  64  ? 43.262  16.747 -77.798 1.00 70.99  ? 210  DT  J "O4'" 1 
ATOM   4282  C  "C3'" . DT  B  1  64  ? 44.292  15.236 -79.334 1.00 70.86  ? 210  DT  J "C3'" 1 
ATOM   4283  O  "O3'" . DT  B  1  64  ? 43.734  15.302 -80.642 1.00 73.32  ? 210  DT  J "O3'" 1 
ATOM   4284  C  "C2'" . DT  B  1  64  ? 45.189  16.433 -79.083 1.00 70.33  ? 210  DT  J "C2'" 1 
ATOM   4285  C  "C1'" . DT  B  1  64  ? 44.217  17.474 -78.550 1.00 69.78  ? 210  DT  J "C1'" 1 
ATOM   4286  N  N1    . DT  B  1  64  ? 44.838  18.476 -77.657 1.00 69.08  ? 210  DT  J N1    1 
ATOM   4287  C  C2    . DT  B  1  64  ? 44.441  19.793 -77.770 1.00 67.87  ? 210  DT  J C2    1 
ATOM   4288  O  O2    . DT  B  1  64  ? 43.573  20.166 -78.540 1.00 68.26  ? 210  DT  J O2    1 
ATOM   4289  N  N3    . DT  B  1  64  ? 45.101  20.663 -76.938 1.00 66.23  ? 210  DT  J N3    1 
ATOM   4290  C  C4    . DT  B  1  64  ? 46.088  20.356 -76.023 1.00 66.18  ? 210  DT  J C4    1 
ATOM   4291  O  O4    . DT  B  1  64  ? 46.599  21.247 -75.353 1.00 63.63  ? 210  DT  J O4    1 
ATOM   4292  C  C5    . DT  B  1  64  ? 46.440  18.955 -75.943 1.00 66.80  ? 210  DT  J C5    1 
ATOM   4293  C  C7    . DT  B  1  64  ? 47.495  18.526 -74.973 1.00 67.17  ? 210  DT  J C7    1 
ATOM   4294  C  C6    . DT  B  1  64  ? 45.802  18.098 -76.749 1.00 66.78  ? 210  DT  J C6    1 
ATOM   4295  P  P     . DT  B  1  65  ? 44.664  15.010 -81.918 1.00 76.12  ? 211  DT  J P     1 
ATOM   4296  O  OP1   . DT  B  1  65  ? 44.042  13.914 -82.709 1.00 74.93  ? 211  DT  J OP1   1 
ATOM   4297  O  OP2   . DT  B  1  65  ? 46.078  14.882 -81.468 1.00 74.92  ? 211  DT  J OP2   1 
ATOM   4298  O  "O5'" . DT  B  1  65  ? 44.539  16.363 -82.744 1.00 72.99  ? 211  DT  J "O5'" 1 
ATOM   4299  C  "C5'" . DT  B  1  65  ? 43.286  17.032 -82.834 1.00 69.45  ? 211  DT  J "C5'" 1 
ATOM   4300  C  "C4'" . DT  B  1  65  ? 43.476  18.404 -83.429 1.00 67.14  ? 211  DT  J "C4'" 1 
ATOM   4301  O  "O4'" . DT  B  1  65  ? 43.998  19.325 -82.440 1.00 65.22  ? 211  DT  J "O4'" 1 
ATOM   4302  C  "C3'" . DT  B  1  65  ? 44.463  18.417 -84.590 1.00 66.17  ? 211  DT  J "C3'" 1 
ATOM   4303  O  "O3'" . DT  B  1  65  ? 43.950  19.240 -85.633 1.00 67.13  ? 211  DT  J "O3'" 1 
ATOM   4304  C  "C2'" . DT  B  1  65  ? 45.730  18.999 -83.983 1.00 63.53  ? 211  DT  J "C2'" 1 
ATOM   4305  C  "C1'" . DT  B  1  65  ? 45.188  19.936 -82.919 1.00 62.20  ? 211  DT  J "C1'" 1 
ATOM   4306  N  N1    . DT  B  1  65  ? 46.080  20.161 -81.754 1.00 59.92  ? 211  DT  J N1    1 
ATOM   4307  C  C2    . DT  B  1  65  ? 46.262  21.459 -81.311 1.00 57.76  ? 211  DT  J C2    1 
ATOM   4308  O  O2    . DT  B  1  65  ? 45.753  22.428 -81.848 1.00 56.18  ? 211  DT  J O2    1 
ATOM   4309  N  N3    . DT  B  1  65  ? 47.073  21.580 -80.210 1.00 55.17  ? 211  DT  J N3    1 
ATOM   4310  C  C4    . DT  B  1  65  ? 47.717  20.566 -79.532 1.00 55.62  ? 211  DT  J C4    1 
ATOM   4311  O  O4    . DT  B  1  65  ? 48.409  20.830 -78.559 1.00 54.58  ? 211  DT  J O4    1 
ATOM   4312  C  C5    . DT  B  1  65  ? 47.500  19.234 -80.058 1.00 56.65  ? 211  DT  J C5    1 
ATOM   4313  C  C7    . DT  B  1  65  ? 48.174  18.074 -79.394 1.00 52.44  ? 211  DT  J C7    1 
ATOM   4314  C  C6    . DT  B  1  65  ? 46.702  19.101 -81.127 1.00 57.31  ? 211  DT  J C6    1 
ATOM   4315  P  P     . DC  B  1  66  ? 44.627  19.192 -87.082 1.00 67.09  ? 212  DC  J P     1 
ATOM   4316  O  OP1   . DC  B  1  66  ? 43.550  19.369 -88.087 1.00 68.42  ? 212  DC  J OP1   1 
ATOM   4317  O  OP2   . DC  B  1  66  ? 45.517  18.004 -87.148 1.00 64.16  ? 212  DC  J OP2   1 
ATOM   4318  O  "O5'" . DC  B  1  66  ? 45.535  20.497 -87.084 1.00 66.23  ? 212  DC  J "O5'" 1 
ATOM   4319  C  "C5'" . DC  B  1  66  ? 44.976  21.753 -86.724 1.00 65.02  ? 212  DC  J "C5'" 1 
ATOM   4320  C  "C4'" . DC  B  1  66  ? 46.062  22.796 -86.624 1.00 64.80  ? 212  DC  J "C4'" 1 
ATOM   4321  O  "O4'" . DC  B  1  66  ? 46.719  22.764 -85.333 1.00 64.02  ? 212  DC  J "O4'" 1 
ATOM   4322  C  "C3'" . DC  B  1  66  ? 47.162  22.663 -87.676 1.00 63.73  ? 212  DC  J "C3'" 1 
ATOM   4323  O  "O3'" . DC  B  1  66  ? 47.383  23.938 -88.274 1.00 64.89  ? 212  DC  J "O3'" 1 
ATOM   4324  C  "C2'" . DC  B  1  66  ? 48.376  22.212 -86.873 1.00 62.81  ? 212  DC  J "C2'" 1 
ATOM   4325  C  "C1'" . DC  B  1  66  ? 48.120  22.856 -85.522 1.00 61.61  ? 212  DC  J "C1'" 1 
ATOM   4326  N  N1    . DC  B  1  66  ? 48.777  22.236 -84.354 1.00 59.41  ? 212  DC  J N1    1 
ATOM   4327  C  C2    . DC  B  1  66  ? 49.246  23.072 -83.322 1.00 58.00  ? 212  DC  J C2    1 
ATOM   4328  O  O2    . DC  B  1  66  ? 49.109  24.296 -83.435 1.00 54.45  ? 212  DC  J O2    1 
ATOM   4329  N  N3    . DC  B  1  66  ? 49.828  22.522 -82.231 1.00 54.57  ? 212  DC  J N3    1 
ATOM   4330  C  C4    . DC  B  1  66  ? 49.948  21.196 -82.139 1.00 57.28  ? 212  DC  J C4    1 
ATOM   4331  N  N4    . DC  B  1  66  ? 50.513  20.699 -81.037 1.00 52.14  ? 212  DC  J N4    1 
ATOM   4332  C  C5    . DC  B  1  66  ? 49.490  20.319 -83.175 1.00 57.31  ? 212  DC  J C5    1 
ATOM   4333  C  C6    . DC  B  1  66  ? 48.919  20.879 -84.256 1.00 58.54  ? 212  DC  J C6    1 
ATOM   4334  P  P     . DA  B  1  67  ? 48.155  24.040 -89.676 1.00 63.55  ? 213  DA  J P     1 
ATOM   4335  O  OP1   . DA  B  1  67  ? 47.263  24.750 -90.630 1.00 63.33  ? 213  DA  J OP1   1 
ATOM   4336  O  OP2   . DA  B  1  67  ? 48.690  22.697 -90.016 1.00 60.89  ? 213  DA  J OP2   1 
ATOM   4337  O  "O5'" . DA  B  1  67  ? 49.382  24.996 -89.336 1.00 62.93  ? 213  DA  J "O5'" 1 
ATOM   4338  C  "C5'" . DA  B  1  67  ? 49.165  26.222 -88.643 1.00 62.25  ? 213  DA  J "C5'" 1 
ATOM   4339  C  "C4'" . DA  B  1  67  ? 50.437  26.670 -87.966 1.00 62.41  ? 213  DA  J "C4'" 1 
ATOM   4340  O  "O4'" . DA  B  1  67  ? 50.758  25.803 -86.852 1.00 60.32  ? 213  DA  J "O4'" 1 
ATOM   4341  C  "C3'" . DA  B  1  67  ? 51.667  26.659 -88.874 1.00 62.07  ? 213  DA  J "C3'" 1 
ATOM   4342  O  "O3'" . DA  B  1  67  ? 52.493  27.761 -88.525 1.00 63.14  ? 213  DA  J "O3'" 1 
ATOM   4343  C  "C2'" . DA  B  1  67  ? 52.378  25.382 -88.476 1.00 61.38  ? 213  DA  J "C2'" 1 
ATOM   4344  C  "C1'" . DA  B  1  67  ? 52.104  25.378 -86.988 1.00 61.23  ? 213  DA  J "C1'" 1 
ATOM   4345  N  N9    . DA  B  1  67  ? 52.251  24.090 -86.316 1.00 60.45  ? 213  DA  J N9    1 
ATOM   4346  C  C8    . DA  B  1  67  ? 52.109  22.823 -86.824 1.00 60.71  ? 213  DA  J C8    1 
ATOM   4347  N  N7    . DA  B  1  67  ? 52.332  21.875 -85.946 1.00 61.62  ? 213  DA  J N7    1 
ATOM   4348  C  C5    . DA  B  1  67  ? 52.637  22.566 -84.783 1.00 61.09  ? 213  DA  J C5    1 
ATOM   4349  C  C6    . DA  B  1  67  ? 52.973  22.139 -83.492 1.00 61.73  ? 213  DA  J C6    1 
ATOM   4350  N  N6    . DA  B  1  67  ? 53.061  20.857 -83.137 1.00 61.94  ? 213  DA  J N6    1 
ATOM   4351  N  N1    . DA  B  1  67  ? 53.219  23.086 -82.561 1.00 61.64  ? 213  DA  J N1    1 
ATOM   4352  C  C2    . DA  B  1  67  ? 53.131  24.374 -82.917 1.00 61.39  ? 213  DA  J C2    1 
ATOM   4353  N  N3    . DA  B  1  67  ? 52.825  24.900 -84.096 1.00 59.54  ? 213  DA  J N3    1 
ATOM   4354  C  C4    . DA  B  1  67  ? 52.587  23.930 -84.996 1.00 60.92  ? 213  DA  J C4    1 
ATOM   4355  P  P     . DG  B  1  68  ? 52.375  29.130 -89.347 1.00 62.03  ? 214  DG  J P     1 
ATOM   4356  O  OP1   . DG  B  1  68  ? 50.930  29.453 -89.504 1.00 60.14  ? 214  DG  J OP1   1 
ATOM   4357  O  OP2   . DG  B  1  68  ? 53.244  28.991 -90.544 1.00 61.38  ? 214  DG  J OP2   1 
ATOM   4358  O  "O5'" . DG  B  1  68  ? 53.007  30.206 -88.360 1.00 62.43  ? 214  DG  J "O5'" 1 
ATOM   4359  C  "C5'" . DG  B  1  68  ? 52.271  30.670 -87.231 1.00 62.14  ? 214  DG  J "C5'" 1 
ATOM   4360  C  "C4'" . DG  B  1  68  ? 53.204  30.937 -86.073 1.00 62.24  ? 214  DG  J "C4'" 1 
ATOM   4361  O  "O4'" . DG  B  1  68  ? 53.695  29.691 -85.522 1.00 61.03  ? 214  DG  J "O4'" 1 
ATOM   4362  C  "C3'" . DG  B  1  68  ? 54.439  31.755 -86.436 1.00 61.76  ? 214  DG  J "C3'" 1 
ATOM   4363  O  "O3'" . DG  B  1  68  ? 54.720  32.647 -85.357 1.00 63.52  ? 214  DG  J "O3'" 1 
ATOM   4364  C  "C2'" . DG  B  1  68  ? 55.520  30.701 -86.619 1.00 60.80  ? 214  DG  J "C2'" 1 
ATOM   4365  C  "C1'" . DG  B  1  68  ? 55.112  29.617 -85.628 1.00 60.09  ? 214  DG  J "C1'" 1 
ATOM   4366  N  N9    . DG  B  1  68  ? 55.441  28.250 -86.022 1.00 59.85  ? 214  DG  J N9    1 
ATOM   4367  C  C8    . DG  B  1  68  ? 55.385  27.715 -87.286 1.00 59.31  ? 214  DG  J C8    1 
ATOM   4368  N  N7    . DG  B  1  68  ? 55.662  26.437 -87.316 1.00 59.24  ? 214  DG  J N7    1 
ATOM   4369  C  C5    . DG  B  1  68  ? 55.936  26.110 -85.995 1.00 58.62  ? 214  DG  J C5    1 
ATOM   4370  C  C6    . DG  B  1  68  ? 56.277  24.864 -85.407 1.00 58.46  ? 214  DG  J C6    1 
ATOM   4371  O  O6    . DG  B  1  68  ? 56.386  23.760 -85.949 1.00 55.83  ? 214  DG  J O6    1 
ATOM   4372  N  N1    . DG  B  1  68  ? 56.484  24.984 -84.038 1.00 57.71  ? 214  DG  J N1    1 
ATOM   4373  C  C2    . DG  B  1  68  ? 56.364  26.147 -83.322 1.00 58.40  ? 214  DG  J C2    1 
ATOM   4374  N  N2    . DG  B  1  68  ? 56.609  26.054 -82.014 1.00 57.75  ? 214  DG  J N2    1 
ATOM   4375  N  N3    . DG  B  1  68  ? 56.028  27.312 -83.852 1.00 58.84  ? 214  DG  J N3    1 
ATOM   4376  C  C4    . DG  B  1  68  ? 55.830  27.221 -85.184 1.00 59.30  ? 214  DG  J C4    1 
ATOM   4377  P  P     . DC  B  1  69  ? 55.862  33.760 -85.517 1.00 62.11  ? 215  DC  J P     1 
ATOM   4378  O  OP1   . DC  B  1  69  ? 55.493  34.897 -84.645 1.00 60.57  ? 215  DC  J OP1   1 
ATOM   4379  O  OP2   . DC  B  1  69  ? 56.076  33.983 -86.971 1.00 64.34  ? 215  DC  J OP2   1 
ATOM   4380  O  "O5'" . DC  B  1  69  ? 57.153  33.039 -84.927 1.00 63.09  ? 215  DC  J "O5'" 1 
ATOM   4381  C  "C5'" . DC  B  1  69  ? 57.138  32.492 -83.611 1.00 59.38  ? 215  DC  J "C5'" 1 
ATOM   4382  C  "C4'" . DC  B  1  69  ? 58.383  31.672 -83.368 1.00 58.70  ? 215  DC  J "C4'" 1 
ATOM   4383  O  "O4'" . DC  B  1  69  ? 58.315  30.410 -84.076 1.00 58.55  ? 215  DC  J "O4'" 1 
ATOM   4384  C  "C3'" . DC  B  1  69  ? 59.697  32.332 -83.795 1.00 59.60  ? 215  DC  J "C3'" 1 
ATOM   4385  O  "O3'" . DC  B  1  69  ? 60.691  32.089 -82.794 1.00 58.74  ? 215  DC  J "O3'" 1 
ATOM   4386  C  "C2'" . DC  B  1  69  ? 60.065  31.580 -85.065 1.00 58.90  ? 215  DC  J "C2'" 1 
ATOM   4387  C  "C1'" . DC  B  1  69  ? 59.548  30.192 -84.736 1.00 59.74  ? 215  DC  J "C1'" 1 
ATOM   4388  N  N1    . DC  B  1  69  ? 59.317  29.281 -85.870 1.00 61.01  ? 215  DC  J N1    1 
ATOM   4389  C  C2    . DC  B  1  69  ? 59.457  27.902 -85.660 1.00 61.56  ? 215  DC  J C2    1 
ATOM   4390  O  O2    . DC  B  1  69  ? 59.745  27.492 -84.528 1.00 60.69  ? 215  DC  J O2    1 
ATOM   4391  N  N3    . DC  B  1  69  ? 59.271  27.052 -86.692 1.00 62.39  ? 215  DC  J N3    1 
ATOM   4392  C  C4    . DC  B  1  69  ? 58.952  27.526 -87.897 1.00 63.10  ? 215  DC  J C4    1 
ATOM   4393  N  N4    . DC  B  1  69  ? 58.782  26.645 -88.885 1.00 62.98  ? 215  DC  J N4    1 
ATOM   4394  C  C5    . DC  B  1  69  ? 58.793  28.923 -88.141 1.00 61.62  ? 215  DC  J C5    1 
ATOM   4395  C  C6    . DC  B  1  69  ? 58.982  29.758 -87.108 1.00 62.13  ? 215  DC  J C6    1 
ATOM   4396  P  P     . DG  B  1  70  ? 61.052  33.240 -81.727 1.00 58.92  ? 216  DG  J P     1 
ATOM   4397  O  OP1   . DG  B  1  70  ? 59.789  33.802 -81.191 1.00 57.92  ? 216  DG  J OP1   1 
ATOM   4398  O  OP2   . DG  B  1  70  ? 62.065  34.140 -82.334 1.00 58.25  ? 216  DG  J OP2   1 
ATOM   4399  O  "O5'" . DG  B  1  70  ? 61.754  32.434 -80.550 1.00 55.89  ? 216  DG  J "O5'" 1 
ATOM   4400  C  "C5'" . DG  B  1  70  ? 61.009  31.520 -79.757 1.00 52.56  ? 216  DG  J "C5'" 1 
ATOM   4401  C  "C4'" . DG  B  1  70  ? 61.793  30.245 -79.563 1.00 52.19  ? 216  DG  J "C4'" 1 
ATOM   4402  O  "O4'" . DG  B  1  70  ? 61.743  29.410 -80.746 1.00 51.79  ? 216  DG  J "O4'" 1 
ATOM   4403  C  "C3'" . DG  B  1  70  ? 63.275  30.446 -79.243 1.00 49.49  ? 216  DG  J "C3'" 1 
ATOM   4404  O  "O3'" . DG  B  1  70  ? 63.629  29.514 -78.230 1.00 48.69  ? 216  DG  J "O3'" 1 
ATOM   4405  C  "C2'" . DG  B  1  70  ? 63.967  30.112 -80.555 1.00 49.22  ? 216  DG  J "C2'" 1 
ATOM   4406  C  "C1'" . DG  B  1  70  ? 63.057  29.043 -81.141 1.00 51.04  ? 216  DG  J "C1'" 1 
ATOM   4407  N  N9    . DG  B  1  70  ? 63.067  28.949 -82.600 1.00 51.40  ? 216  DG  J N9    1 
ATOM   4408  C  C8    . DG  B  1  70  ? 63.049  29.993 -83.493 1.00 51.93  ? 216  DG  J C8    1 
ATOM   4409  N  N7    . DG  B  1  70  ? 63.009  29.603 -84.739 1.00 51.43  ? 216  DG  J N7    1 
ATOM   4410  C  C5    . DG  B  1  70  ? 63.014  28.217 -84.668 1.00 52.69  ? 216  DG  J C5    1 
ATOM   4411  C  C6    . DG  B  1  70  ? 62.969  27.245 -85.702 1.00 54.32  ? 216  DG  J C6    1 
ATOM   4412  O  O6    . DG  B  1  70  ? 62.904  27.424 -86.924 1.00 56.41  ? 216  DG  J O6    1 
ATOM   4413  N  N1    . DG  B  1  70  ? 63.001  25.952 -85.191 1.00 53.13  ? 216  DG  J N1    1 
ATOM   4414  C  C2    . DG  B  1  70  ? 63.064  25.634 -83.856 1.00 53.32  ? 216  DG  J C2    1 
ATOM   4415  N  N2    . DG  B  1  70  ? 63.095  24.321 -83.560 1.00 49.85  ? 216  DG  J N2    1 
ATOM   4416  N  N3    . DG  B  1  70  ? 63.095  26.531 -82.881 1.00 51.46  ? 216  DG  J N3    1 
ATOM   4417  C  C4    . DG  B  1  70  ? 63.067  27.794 -83.356 1.00 52.13  ? 216  DG  J C4    1 
ATOM   4418  P  P     . DG  B  1  71  ? 65.028  29.646 -77.459 1.00 44.79  ? 217  DG  J P     1 
ATOM   4419  O  OP1   . DG  B  1  71  ? 64.690  29.698 -76.013 1.00 45.43  ? 217  DG  J OP1   1 
ATOM   4420  O  OP2   . DG  B  1  71  ? 65.858  30.708 -78.051 1.00 46.98  ? 217  DG  J OP2   1 
ATOM   4421  O  "O5'" . DG  B  1  71  ? 65.675  28.230 -77.764 1.00 45.23  ? 217  DG  J "O5'" 1 
ATOM   4422  C  "C5'" . DG  B  1  71  ? 64.910  27.059 -77.522 1.00 49.60  ? 217  DG  J "C5'" 1 
ATOM   4423  C  "C4'" . DG  B  1  71  ? 65.557  25.856 -78.163 1.00 54.68  ? 217  DG  J "C4'" 1 
ATOM   4424  O  "O4'" . DG  B  1  71  ? 65.476  25.933 -79.604 1.00 55.39  ? 217  DG  J "O4'" 1 
ATOM   4425  C  "C3'" . DG  B  1  71  ? 67.030  25.661 -77.828 1.00 56.42  ? 217  DG  J "C3'" 1 
ATOM   4426  O  "O3'" . DG  B  1  71  ? 67.246  24.266 -77.640 1.00 60.45  ? 217  DG  J "O3'" 1 
ATOM   4427  C  "C2'" . DG  B  1  71  ? 67.747  26.199 -79.056 1.00 55.10  ? 217  DG  J "C2'" 1 
ATOM   4428  C  "C1'" . DG  B  1  71  ? 66.772  25.868 -80.177 1.00 55.51  ? 217  DG  J "C1'" 1 
ATOM   4429  N  N9    . DG  B  1  71  ? 66.778  26.772 -81.323 1.00 54.72  ? 217  DG  J N9    1 
ATOM   4430  C  C8    . DG  B  1  71  ? 66.852  28.142 -81.305 1.00 52.94  ? 217  DG  J C8    1 
ATOM   4431  N  N7    . DG  B  1  71  ? 66.753  28.675 -82.493 1.00 54.57  ? 217  DG  J N7    1 
ATOM   4432  C  C5    . DG  B  1  71  ? 66.618  27.589 -83.350 1.00 53.63  ? 217  DG  J C5    1 
ATOM   4433  C  C6    . DG  B  1  71  ? 66.445  27.544 -84.763 1.00 53.80  ? 217  DG  J C6    1 
ATOM   4434  O  O6    . DG  B  1  71  ? 66.353  28.487 -85.556 1.00 52.07  ? 217  DG  J O6    1 
ATOM   4435  N  N1    . DG  B  1  71  ? 66.367  26.233 -85.228 1.00 52.01  ? 217  DG  J N1    1 
ATOM   4436  C  C2    . DG  B  1  71  ? 66.434  25.113 -84.439 1.00 53.95  ? 217  DG  J C2    1 
ATOM   4437  N  N2    . DG  B  1  71  ? 66.339  23.936 -85.072 1.00 52.28  ? 217  DG  J N2    1 
ATOM   4438  N  N3    . DG  B  1  71  ? 66.579  25.142 -83.121 1.00 53.74  ? 217  DG  J N3    1 
ATOM   4439  C  C4    . DG  B  1  71  ? 66.661  26.407 -82.649 1.00 54.13  ? 217  DG  J C4    1 
ATOM   4440  P  P     . DA  B  1  72  ? 68.626  23.748 -77.019 1.00 63.98  ? 218  DA  J P     1 
ATOM   4441  O  OP1   . DA  B  1  72  ? 68.326  22.562 -76.180 1.00 62.70  ? 218  DA  J OP1   1 
ATOM   4442  O  OP2   . DA  B  1  72  ? 69.323  24.922 -76.434 1.00 64.55  ? 218  DA  J OP2   1 
ATOM   4443  O  "O5'" . DA  B  1  72  ? 69.441  23.273 -78.297 1.00 64.77  ? 218  DA  J "O5'" 1 
ATOM   4444  C  "C5'" . DA  B  1  72  ? 68.882  22.321 -79.198 1.00 64.98  ? 218  DA  J "C5'" 1 
ATOM   4445  C  "C4'" . DA  B  1  72  ? 69.711  22.248 -80.458 1.00 66.86  ? 218  DA  J "C4'" 1 
ATOM   4446  O  "O4'" . DA  B  1  72  ? 69.425  23.355 -81.346 1.00 65.81  ? 218  DA  J "O4'" 1 
ATOM   4447  C  "C3'" . DA  B  1  72  ? 71.224  22.277 -80.225 1.00 68.51  ? 218  DA  J "C3'" 1 
ATOM   4448  O  "O3'" . DA  B  1  72  ? 71.839  21.399 -81.158 1.00 72.46  ? 218  DA  J "O3'" 1 
ATOM   4449  C  "C2'" . DA  B  1  72  ? 71.597  23.697 -80.605 1.00 67.10  ? 218  DA  J "C2'" 1 
ATOM   4450  C  "C1'" . DA  B  1  72  ? 70.659  23.899 -81.772 1.00 65.74  ? 218  DA  J "C1'" 1 
ATOM   4451  N  N9    . DA  B  1  72  ? 70.442  25.275 -82.209 1.00 63.50  ? 218  DA  J N9    1 
ATOM   4452  C  C8    . DA  B  1  72  ? 70.510  26.443 -81.491 1.00 64.63  ? 218  DA  J C8    1 
ATOM   4453  N  N7    . DA  B  1  72  ? 70.289  27.519 -82.209 1.00 63.74  ? 218  DA  J N7    1 
ATOM   4454  C  C5    . DA  B  1  72  ? 70.051  27.022 -83.484 1.00 63.89  ? 218  DA  J C5    1 
ATOM   4455  C  C6    . DA  B  1  72  ? 69.757  27.652 -84.706 1.00 63.36  ? 218  DA  J C6    1 
ATOM   4456  N  N6    . DA  B  1  72  ? 69.639  28.975 -84.848 1.00 63.22  ? 218  DA  J N6    1 
ATOM   4457  N  N1    . DA  B  1  72  ? 69.584  26.867 -85.791 1.00 63.86  ? 218  DA  J N1    1 
ATOM   4458  C  C2    . DA  B  1  72  ? 69.697  25.539 -85.647 1.00 64.57  ? 218  DA  J C2    1 
ATOM   4459  N  N3    . DA  B  1  72  ? 69.968  24.830 -84.553 1.00 64.50  ? 218  DA  J N3    1 
ATOM   4460  C  C4    . DA  B  1  72  ? 70.137  25.643 -83.495 1.00 64.28  ? 218  DA  J C4    1 
ATOM   4461  P  P     . DA  B  1  73  ? 73.004  20.409 -80.682 1.00 74.35  ? 219  DA  J P     1 
ATOM   4462  O  OP1   . DA  B  1  73  ? 72.391  19.294 -79.911 1.00 72.09  ? 219  DA  J OP1   1 
ATOM   4463  O  OP2   . DA  B  1  73  ? 74.093  21.226 -80.077 1.00 72.84  ? 219  DA  J OP2   1 
ATOM   4464  O  "O5'" . DA  B  1  73  ? 73.534  19.826 -82.059 1.00 73.50  ? 219  DA  J "O5'" 1 
ATOM   4465  C  "C5'" . DA  B  1  73  ? 72.616  19.416 -83.064 1.00 73.41  ? 219  DA  J "C5'" 1 
ATOM   4466  C  "C4'" . DA  B  1  73  ? 73.117  19.839 -84.424 1.00 73.87  ? 219  DA  J "C4'" 1 
ATOM   4467  O  "O4'" . DA  B  1  73  ? 72.720  21.200 -84.730 1.00 71.55  ? 219  DA  J "O4'" 1 
ATOM   4468  C  "C3'" . DA  B  1  73  ? 74.638  19.789 -84.568 1.00 74.70  ? 219  DA  J "C3'" 1 
ATOM   4469  O  "O3'" . DA  B  1  73  ? 74.996  19.122 -85.779 1.00 78.77  ? 219  DA  J "O3'" 1 
ATOM   4470  C  "C2'" . DA  B  1  73  ? 75.046  21.254 -84.606 1.00 71.90  ? 219  DA  J "C2'" 1 
ATOM   4471  C  "C1'" . DA  B  1  73  ? 73.833  21.918 -85.231 1.00 69.65  ? 219  DA  J "C1'" 1 
ATOM   4472  N  N9    . DA  B  1  73  ? 73.658  23.328 -84.877 1.00 67.91  ? 219  DA  J N9    1 
ATOM   4473  C  C8    . DA  B  1  73  ? 73.712  23.886 -83.625 1.00 67.16  ? 219  DA  J C8    1 
ATOM   4474  N  N7    . DA  B  1  73  ? 73.526  25.184 -83.614 1.00 65.36  ? 219  DA  J N7    1 
ATOM   4475  C  C5    . DA  B  1  73  ? 73.332  25.504 -84.949 1.00 64.44  ? 219  DA  J C5    1 
ATOM   4476  C  C6    . DA  B  1  73  ? 73.083  26.726 -85.602 1.00 63.69  ? 219  DA  J C6    1 
ATOM   4477  N  N6    . DA  B  1  73  ? 72.981  27.896 -84.970 1.00 61.39  ? 219  DA  J N6    1 
ATOM   4478  N  N1    . DA  B  1  73  ? 72.940  26.703 -86.944 1.00 62.31  ? 219  DA  J N1    1 
ATOM   4479  C  C2    . DA  B  1  73  ? 73.037  25.529 -87.576 1.00 63.45  ? 219  DA  J C2    1 
ATOM   4480  N  N3    . DA  B  1  73  ? 73.267  24.315 -87.075 1.00 65.68  ? 219  DA  J N3    1 
ATOM   4481  C  C4    . DA  B  1  73  ? 73.408  24.371 -85.739 1.00 66.08  ? 219  DA  J C4    1 
ATOM   4482  P  P     . DT  B  1  74  ? 76.543  18.957 -86.164 1.00 80.20  ? 220  DT  J P     1 
ATOM   4483  O  OP1   . DT  B  1  74  ? 76.689  17.684 -86.908 1.00 82.17  ? 220  DT  J OP1   1 
ATOM   4484  O  OP2   . DT  B  1  74  ? 77.362  19.195 -84.946 1.00 81.31  ? 220  DT  J OP2   1 
ATOM   4485  O  "O5'" . DT  B  1  74  ? 76.777  20.168 -87.162 1.00 80.28  ? 220  DT  J "O5'" 1 
ATOM   4486  C  "C5'" . DT  B  1  74  ? 75.900  20.363 -88.262 1.00 80.88  ? 220  DT  J "C5'" 1 
ATOM   4487  C  "C4'" . DT  B  1  74  ? 76.451  21.428 -89.175 1.00 82.19  ? 220  DT  J "C4'" 1 
ATOM   4488  O  "O4'" . DT  B  1  74  ? 76.034  22.744 -88.740 1.00 81.72  ? 220  DT  J "O4'" 1 
ATOM   4489  C  "C3'" . DT  B  1  74  ? 77.979  21.452 -89.233 1.00 83.53  ? 220  DT  J "C3'" 1 
ATOM   4490  O  "O3'" . DT  B  1  74  ? 78.412  21.580 -90.587 1.00 86.73  ? 220  DT  J "O3'" 1 
ATOM   4491  C  "C2'" . DT  B  1  74  ? 78.346  22.689 -88.430 1.00 82.18  ? 220  DT  J "C2'" 1 
ATOM   4492  C  "C1'" . DT  B  1  74  ? 77.161  23.600 -88.694 1.00 81.25  ? 220  DT  J "C1'" 1 
ATOM   4493  N  N1    . DT  B  1  74  ? 76.912  24.634 -87.667 1.00 78.90  ? 220  DT  J N1    1 
ATOM   4494  C  C2    . DT  B  1  74  ? 76.581  25.899 -88.098 1.00 78.16  ? 220  DT  J C2    1 
ATOM   4495  O  O2    . DT  B  1  74  ? 76.478  26.195 -89.274 1.00 78.13  ? 220  DT  J O2    1 
ATOM   4496  N  N3    . DT  B  1  74  ? 76.375  26.811 -87.095 1.00 78.01  ? 220  DT  J N3    1 
ATOM   4497  C  C4    . DT  B  1  74  ? 76.466  26.591 -85.735 1.00 78.32  ? 220  DT  J C4    1 
ATOM   4498  O  O4    . DT  B  1  74  ? 76.256  27.513 -84.952 1.00 77.74  ? 220  DT  J O4    1 
ATOM   4499  C  C5    . DT  B  1  74  ? 76.816  25.240 -85.352 1.00 78.66  ? 220  DT  J C5    1 
ATOM   4500  C  C7    . DT  B  1  74  ? 76.945  24.908 -83.899 1.00 78.45  ? 220  DT  J C7    1 
ATOM   4501  C  C6    . DT  B  1  74  ? 77.013  24.340 -86.325 1.00 78.79  ? 220  DT  J C6    1 
ATOM   4502  P  P     . DT  B  1  75  ? 79.968  21.405 -90.951 1.00 88.37  ? 221  DT  J P     1 
ATOM   4503  O  OP1   . DT  B  1  75  ? 80.071  20.367 -92.008 1.00 87.84  ? 221  DT  J OP1   1 
ATOM   4504  O  OP2   . DT  B  1  75  ? 80.737  21.246 -89.685 1.00 87.94  ? 221  DT  J OP2   1 
ATOM   4505  O  "O5'" . DT  B  1  75  ? 80.315  22.816 -91.594 1.00 87.83  ? 221  DT  J "O5'" 1 
ATOM   4506  C  "C5'" . DT  B  1  75  ? 79.386  23.436 -92.477 1.00 88.61  ? 221  DT  J "C5'" 1 
ATOM   4507  C  "C4'" . DT  B  1  75  ? 79.705  24.902 -92.632 1.00 89.67  ? 221  DT  J "C4'" 1 
ATOM   4508  O  "O4'" . DT  B  1  75  ? 79.279  25.654 -91.468 1.00 88.67  ? 221  DT  J "O4'" 1 
ATOM   4509  C  "C3'" . DT  B  1  75  ? 81.192  25.198 -92.816 1.00 91.25  ? 221  DT  J "C3'" 1 
ATOM   4510  O  "O3'" . DT  B  1  75  ? 81.368  26.144 -93.870 1.00 93.75  ? 221  DT  J "O3'" 1 
ATOM   4511  C  "C2'" . DT  B  1  75  ? 81.607  25.788 -91.478 1.00 89.45  ? 221  DT  J "C2'" 1 
ATOM   4512  C  "C1'" . DT  B  1  75  ? 80.338  26.494 -91.040 1.00 87.41  ? 221  DT  J "C1'" 1 
ATOM   4513  N  N1    . DT  B  1  75  ? 80.202  26.702 -89.583 1.00 84.77  ? 221  DT  J N1    1 
ATOM   4514  C  C2    . DT  B  1  75  ? 79.860  27.961 -89.142 1.00 82.96  ? 221  DT  J C2    1 
ATOM   4515  O  O2    . DT  B  1  75  ? 79.668  28.901 -89.895 1.00 81.86  ? 221  DT  J O2    1 
ATOM   4516  N  N3    . DT  B  1  75  ? 79.748  28.080 -87.778 1.00 82.03  ? 221  DT  J N3    1 
ATOM   4517  C  C4    . DT  B  1  75  ? 79.935  27.088 -86.836 1.00 81.87  ? 221  DT  J C4    1 
ATOM   4518  O  O4    . DT  B  1  75  ? 79.791  27.341 -85.645 1.00 81.75  ? 221  DT  J O4    1 
ATOM   4519  C  C5    . DT  B  1  75  ? 80.295  25.793 -87.368 1.00 82.36  ? 221  DT  J C5    1 
ATOM   4520  C  C7    . DT  B  1  75  ? 80.522  24.658 -86.420 1.00 81.72  ? 221  DT  J C7    1 
ATOM   4521  C  C6    . DT  B  1  75  ? 80.410  25.667 -88.697 1.00 83.40  ? 221  DT  J C6    1 
ATOM   4522  P  P     . DC  B  1  76  ? 82.849  26.541 -94.336 1.00 95.27  ? 222  DC  J P     1 
ATOM   4523  O  OP1   . DC  B  1  76  ? 82.799  26.939 -95.769 1.00 96.32  ? 222  DC  J OP1   1 
ATOM   4524  O  OP2   . DC  B  1  76  ? 83.761  25.448 -93.903 1.00 94.56  ? 222  DC  J OP2   1 
ATOM   4525  O  "O5'" . DC  B  1  76  ? 83.156  27.836 -93.467 1.00 95.67  ? 222  DC  J "O5'" 1 
ATOM   4526  C  "C5'" . DC  B  1  76  ? 82.304  28.974 -93.548 1.00 96.78  ? 222  DC  J "C5'" 1 
ATOM   4527  C  "C4'" . DC  B  1  76  ? 82.881  30.103 -92.731 1.00 96.81  ? 222  DC  J "C4'" 1 
ATOM   4528  O  "O4'" . DC  B  1  76  ? 82.545  29.949 -91.330 1.00 96.44  ? 222  DC  J "O4'" 1 
ATOM   4529  C  "C3'" . DC  B  1  76  ? 84.406  30.156 -92.803 1.00 97.36  ? 222  DC  J "C3'" 1 
ATOM   4530  O  "O3'" . DC  B  1  76  ? 84.846  31.505 -92.912 1.00 98.57  ? 222  DC  J "O3'" 1 
ATOM   4531  C  "C2'" . DC  B  1  76  ? 84.842  29.567 -91.474 1.00 96.42  ? 222  DC  J "C2'" 1 
ATOM   4532  C  "C1'" . DC  B  1  76  ? 83.729  30.036 -90.556 1.00 94.94  ? 222  DC  J "C1'" 1 
ATOM   4533  N  N1    . DC  B  1  76  ? 83.542  29.241 -89.332 1.00 92.39  ? 222  DC  J N1    1 
ATOM   4534  C  C2    . DC  B  1  76  ? 83.144  29.898 -88.166 1.00 91.01  ? 222  DC  J C2    1 
ATOM   4535  O  O2    . DC  B  1  76  ? 82.936  31.117 -88.209 1.00 90.37  ? 222  DC  J O2    1 
ATOM   4536  N  N3    . DC  B  1  76  ? 82.993  29.190 -87.025 1.00 89.59  ? 222  DC  J N3    1 
ATOM   4537  C  C4    . DC  B  1  76  ? 83.220  27.875 -87.023 1.00 90.04  ? 222  DC  J C4    1 
ATOM   4538  N  N4    . DC  B  1  76  ? 83.069  27.216 -85.872 1.00 89.35  ? 222  DC  J N4    1 
ATOM   4539  C  C5    . DC  B  1  76  ? 83.615  27.177 -88.202 1.00 90.49  ? 222  DC  J C5    1 
ATOM   4540  C  C6    . DC  B  1  76  ? 83.762  27.892 -89.324 1.00 91.37  ? 222  DC  J C6    1 
ATOM   4541  P  P     . DC  B  1  77  ? 85.968  31.884 -93.993 1.00 99.20  ? 223  DC  J P     1 
ATOM   4542  O  OP1   . DC  B  1  77  ? 85.338  31.906 -95.340 1.00 99.14  ? 223  DC  J OP1   1 
ATOM   4543  O  OP2   . DC  B  1  77  ? 87.140  31.002 -93.738 1.00 98.45  ? 223  DC  J OP2   1 
ATOM   4544  O  "O5'" . DC  B  1  77  ? 86.364  33.372 -93.599 1.00 96.89  ? 223  DC  J "O5'" 1 
ATOM   4545  C  "C5'" . DC  B  1  77  ? 85.371  34.299 -93.171 1.00 94.26  ? 223  DC  J "C5'" 1 
ATOM   4546  C  "C4'" . DC  B  1  77  ? 85.806  34.952 -91.881 1.00 92.21  ? 223  DC  J "C4'" 1 
ATOM   4547  O  "O4'" . DC  B  1  77  ? 85.512  34.113 -90.735 1.00 90.01  ? 223  DC  J "O4'" 1 
ATOM   4548  C  "C3'" . DC  B  1  77  ? 87.307  35.230 -91.829 1.00 91.96  ? 223  DC  J "C3'" 1 
ATOM   4549  O  "O3'" . DC  B  1  77  ? 87.527  36.485 -91.203 1.00 93.60  ? 223  DC  J "O3'" 1 
ATOM   4550  C  "C2'" . DC  B  1  77  ? 87.833  34.127 -90.929 1.00 90.25  ? 223  DC  J "C2'" 1 
ATOM   4551  C  "C1'" . DC  B  1  77  ? 86.686  33.992 -89.949 1.00 87.70  ? 223  DC  J "C1'" 1 
ATOM   4552  N  N1    . DC  B  1  77  ? 86.624  32.724 -89.205 1.00 84.19  ? 223  DC  J N1    1 
ATOM   4553  C  C2    . DC  B  1  77  ? 86.179  32.754 -87.882 1.00 81.98  ? 223  DC  J C2    1 
ATOM   4554  O  O2    . DC  B  1  77  ? 85.835  33.842 -87.394 1.00 79.35  ? 223  DC  J O2    1 
ATOM   4555  N  N3    . DC  B  1  77  ? 86.133  31.605 -87.172 1.00 79.91  ? 223  DC  J N3    1 
ATOM   4556  C  C4    . DC  B  1  77  ? 86.507  30.457 -87.739 1.00 80.24  ? 223  DC  J C4    1 
ATOM   4557  N  N4    . DC  B  1  77  ? 86.448  29.346 -87.001 1.00 78.76  ? 223  DC  J N4    1 
ATOM   4558  C  C5    . DC  B  1  77  ? 86.959  30.396 -89.089 1.00 80.94  ? 223  DC  J C5    1 
ATOM   4559  C  C6    . DC  B  1  77  ? 86.999  31.543 -89.779 1.00 82.27  ? 223  DC  J C6    1 
ATOM   4560  P  P     . DG  B  1  78  ? 88.392  37.601 -91.953 1.00 95.18  ? 224  DG  J P     1 
ATOM   4561  O  OP1   . DG  B  1  78  ? 87.756  37.864 -93.269 1.00 95.02  ? 224  DG  J OP1   1 
ATOM   4562  O  OP2   . DG  B  1  78  ? 89.816  37.180 -91.892 1.00 94.82  ? 224  DG  J OP2   1 
ATOM   4563  O  "O5'" . DG  B  1  78  ? 88.198  38.874 -91.022 1.00 94.72  ? 224  DG  J "O5'" 1 
ATOM   4564  C  "C5'" . DG  B  1  78  ? 86.901  39.229 -90.552 1.00 93.52  ? 224  DG  J "C5'" 1 
ATOM   4565  C  "C4'" . DG  B  1  78  ? 86.916  39.399 -89.051 1.00 92.43  ? 224  DG  J "C4'" 1 
ATOM   4566  O  "O4'" . DG  B  1  78  ? 86.993  38.116 -88.383 1.00 91.15  ? 224  DG  J "O4'" 1 
ATOM   4567  C  "C3'" . DG  B  1  78  ? 88.087  40.223 -88.527 1.00 91.97  ? 224  DG  J "C3'" 1 
ATOM   4568  O  "O3'" . DG  B  1  78  ? 87.622  41.106 -87.510 1.00 92.45  ? 224  DG  J "O3'" 1 
ATOM   4569  C  "C2'" . DG  B  1  78  ? 89.041  39.180 -87.969 1.00 90.63  ? 224  DG  J "C2'" 1 
ATOM   4570  C  "C1'" . DG  B  1  78  ? 88.100  38.089 -87.492 1.00 89.58  ? 224  DG  J "C1'" 1 
ATOM   4571  N  N9    . DG  B  1  78  ? 88.659  36.739 -87.523 1.00 87.96  ? 224  DG  J N9    1 
ATOM   4572  C  C8    . DG  B  1  78  ? 89.351  36.152 -88.555 1.00 87.42  ? 224  DG  J C8    1 
ATOM   4573  N  N7    . DG  B  1  78  ? 89.694  34.916 -88.306 1.00 86.62  ? 224  DG  J N7    1 
ATOM   4574  C  C5    . DG  B  1  78  ? 89.205  34.674 -87.029 1.00 86.66  ? 224  DG  J C5    1 
ATOM   4575  C  C6    . DG  B  1  78  ? 89.263  33.502 -86.228 1.00 86.23  ? 224  DG  J C6    1 
ATOM   4576  O  O6    . DG  B  1  78  ? 89.757  32.405 -86.504 1.00 85.59  ? 224  DG  J O6    1 
ATOM   4577  N  N1    . DG  B  1  78  ? 88.656  33.695 -84.992 1.00 85.83  ? 224  DG  J N1    1 
ATOM   4578  C  C2    . DG  B  1  78  ? 88.060  34.858 -84.580 1.00 86.16  ? 224  DG  J C2    1 
ATOM   4579  N  N2    . DG  B  1  78  ? 87.535  34.843 -83.345 1.00 85.85  ? 224  DG  J N2    1 
ATOM   4580  N  N3    . DG  B  1  78  ? 87.986  35.955 -85.320 1.00 86.64  ? 224  DG  J N3    1 
ATOM   4581  C  C4    . DG  B  1  78  ? 88.576  35.792 -86.525 1.00 87.24  ? 224  DG  J C4    1 
ATOM   4582  P  P     . DC  B  1  79  ? 88.651  42.104 -86.799 1.00 94.11  ? 225  DC  J P     1 
ATOM   4583  O  OP1   . DC  B  1  79  ? 87.932  43.359 -86.456 1.00 92.88  ? 225  DC  J OP1   1 
ATOM   4584  O  OP2   . DC  B  1  79  ? 89.881  42.163 -87.629 1.00 93.94  ? 225  DC  J OP2   1 
ATOM   4585  O  "O5'" . DC  B  1  79  ? 89.009  41.328 -85.459 1.00 94.25  ? 225  DC  J "O5'" 1 
ATOM   4586  C  "C5'" . DC  B  1  79  ? 87.976  40.793 -84.636 1.00 93.92  ? 225  DC  J "C5'" 1 
ATOM   4587  C  "C4'" . DC  B  1  79  ? 88.578  40.112 -83.432 1.00 93.62  ? 225  DC  J "C4'" 1 
ATOM   4588  O  "O4'" . DC  B  1  79  ? 89.166  38.846 -83.816 1.00 93.96  ? 225  DC  J "O4'" 1 
ATOM   4589  C  "C3'" . DC  B  1  79  ? 89.698  40.919 -82.775 1.00 93.08  ? 225  DC  J "C3'" 1 
ATOM   4590  O  "O3'" . DC  B  1  79  ? 89.640  40.738 -81.364 1.00 91.69  ? 225  DC  J "O3'" 1 
ATOM   4591  C  "C2'" . DC  B  1  79  ? 90.955  40.266 -83.323 1.00 93.77  ? 225  DC  J "C2'" 1 
ATOM   4592  C  "C1'" . DC  B  1  79  ? 90.524  38.813 -83.412 1.00 94.14  ? 225  DC  J "C1'" 1 
ATOM   4593  N  N1    . DC  B  1  79  ? 91.264  37.985 -84.377 1.00 94.55  ? 225  DC  J N1    1 
ATOM   4594  C  C2    . DC  B  1  79  ? 91.541  36.655 -84.039 1.00 94.54  ? 225  DC  J C2    1 
ATOM   4595  O  O2    . DC  B  1  79  ? 91.160  36.225 -82.939 1.00 93.86  ? 225  DC  J O2    1 
ATOM   4596  N  N3    . DC  B  1  79  ? 92.213  35.874 -84.917 1.00 94.25  ? 225  DC  J N3    1 
ATOM   4597  C  C4    . DC  B  1  79  ? 92.603  36.376 -86.091 1.00 94.66  ? 225  DC  J C4    1 
ATOM   4598  N  N4    . DC  B  1  79  ? 93.259  35.568 -86.929 1.00 94.85  ? 225  DC  J N4    1 
ATOM   4599  C  C5    . DC  B  1  79  ? 92.338  37.729 -86.459 1.00 94.76  ? 225  DC  J C5    1 
ATOM   4600  C  C6    . DC  B  1  79  ? 91.672  38.491 -85.580 1.00 94.75  ? 225  DC  J C6    1 
ATOM   4601  P  P     . DT  B  1  80  ? 89.169  41.948 -80.418 1.00 90.18  ? 226  DT  J P     1 
ATOM   4602  O  OP1   . DT  B  1  80  ? 87.769  42.316 -80.754 1.00 89.81  ? 226  DT  J OP1   1 
ATOM   4603  O  OP2   . DT  B  1  80  ? 90.233  42.982 -80.445 1.00 88.58  ? 226  DT  J OP2   1 
ATOM   4604  O  "O5'" . DT  B  1  80  ? 89.155  41.271 -78.983 1.00 86.13  ? 226  DT  J "O5'" 1 
ATOM   4605  C  "C5'" . DT  B  1  80  ? 88.501  40.020 -78.782 1.00 81.47  ? 226  DT  J "C5'" 1 
ATOM   4606  C  "C4'" . DT  B  1  80  ? 89.443  39.047 -78.114 1.00 77.17  ? 226  DT  J "C4'" 1 
ATOM   4607  O  "O4'" . DT  B  1  80  ? 90.262  38.337 -79.077 1.00 76.38  ? 226  DT  J "O4'" 1 
ATOM   4608  C  "C3'" . DT  B  1  80  ? 90.416  39.715 -77.141 1.00 75.06  ? 226  DT  J "C3'" 1 
ATOM   4609  O  "O3'" . DT  B  1  80  ? 90.608  38.864 -76.025 1.00 71.59  ? 226  DT  J "O3'" 1 
ATOM   4610  C  "C2'" . DT  B  1  80  ? 91.715  39.737 -77.926 1.00 75.70  ? 226  DT  J "C2'" 1 
ATOM   4611  C  "C1'" . DT  B  1  80  ? 91.611  38.408 -78.645 1.00 75.53  ? 226  DT  J "C1'" 1 
ATOM   4612  N  N1    . DT  B  1  80  ? 92.493  38.224 -79.814 1.00 74.92  ? 226  DT  J N1    1 
ATOM   4613  C  C2    . DT  B  1  80  ? 92.878  36.937 -80.125 1.00 74.55  ? 226  DT  J C2    1 
ATOM   4614  O  O2    . DT  B  1  80  ? 92.523  35.961 -79.485 1.00 72.80  ? 226  DT  J O2    1 
ATOM   4615  N  N3    . DT  B  1  80  ? 93.700  36.833 -81.219 1.00 74.88  ? 226  DT  J N3    1 
ATOM   4616  C  C4    . DT  B  1  80  ? 94.161  37.860 -82.016 1.00 75.15  ? 226  DT  J C4    1 
ATOM   4617  O  O4    . DT  B  1  80  ? 94.889  37.611 -82.971 1.00 75.91  ? 226  DT  J O4    1 
ATOM   4618  C  C5    . DT  B  1  80  ? 93.721  39.183 -81.633 1.00 75.90  ? 226  DT  J C5    1 
ATOM   4619  C  C7    . DT  B  1  80  ? 94.174  40.359 -82.438 1.00 76.47  ? 226  DT  J C7    1 
ATOM   4620  C  C6    . DT  B  1  80  ? 92.919  39.297 -80.565 1.00 75.32  ? 226  DT  J C6    1 
ATOM   4621  P  P     . DG  B  1  81  ? 89.610  38.942 -74.778 1.00 67.34  ? 227  DG  J P     1 
ATOM   4622  O  OP1   . DG  B  1  81  ? 88.196  38.981 -75.222 1.00 69.99  ? 227  DG  J OP1   1 
ATOM   4623  O  OP2   . DG  B  1  81  ? 90.125  39.989 -73.867 1.00 65.14  ? 227  DG  J OP2   1 
ATOM   4624  O  "O5'" . DG  B  1  81  ? 89.860  37.540 -74.101 1.00 65.66  ? 227  DG  J "O5'" 1 
ATOM   4625  C  "C5'" . DG  B  1  81  ? 91.033  37.348 -73.361 1.00 63.89  ? 227  DG  J "C5'" 1 
ATOM   4626  C  "C4'" . DG  B  1  81  ? 91.780  36.138 -73.857 1.00 60.92  ? 227  DG  J "C4'" 1 
ATOM   4627  O  "O4'" . DG  B  1  81  ? 92.309  36.328 -75.195 1.00 61.37  ? 227  DG  J "O4'" 1 
ATOM   4628  C  "C3'" . DG  B  1  81  ? 92.986  35.912 -72.965 1.00 58.35  ? 227  DG  J "C3'" 1 
ATOM   4629  O  "O3'" . DG  B  1  81  ? 93.148  34.534 -72.738 1.00 54.26  ? 227  DG  J "O3'" 1 
ATOM   4630  C  "C2'" . DG  B  1  81  ? 94.146  36.472 -73.758 1.00 59.07  ? 227  DG  J "C2'" 1 
ATOM   4631  C  "C1'" . DG  B  1  81  ? 93.725  36.156 -75.175 1.00 60.24  ? 227  DG  J "C1'" 1 
ATOM   4632  N  N9    . DG  B  1  81  ? 94.316  37.057 -76.159 1.00 59.99  ? 227  DG  J N9    1 
ATOM   4633  C  C8    . DG  B  1  81  ? 94.185  38.424 -76.212 1.00 60.24  ? 227  DG  J C8    1 
ATOM   4634  N  N7    . DG  B  1  81  ? 94.822  38.961 -77.217 1.00 59.61  ? 227  DG  J N7    1 
ATOM   4635  C  C5    . DG  B  1  81  ? 95.412  37.885 -77.865 1.00 59.46  ? 227  DG  J C5    1 
ATOM   4636  C  C6    . DG  B  1  81  ? 96.220  37.849 -79.026 1.00 59.16  ? 227  DG  J C6    1 
ATOM   4637  O  O6    . DG  B  1  81  ? 96.576  38.790 -79.740 1.00 61.64  ? 227  DG  J O6    1 
ATOM   4638  N  N1    . DG  B  1  81  ? 96.616  36.551 -79.336 1.00 58.25  ? 227  DG  J N1    1 
ATOM   4639  C  C2    . DG  B  1  81  ? 96.270  35.427 -78.620 1.00 59.02  ? 227  DG  J C2    1 
ATOM   4640  N  N2    . DG  B  1  81  ? 96.755  34.253 -79.075 1.00 55.46  ? 227  DG  J N2    1 
ATOM   4641  N  N3    . DG  B  1  81  ? 95.507  35.449 -77.537 1.00 58.16  ? 227  DG  J N3    1 
ATOM   4642  C  C4    . DG  B  1  81  ? 95.117  36.702 -77.220 1.00 58.98  ? 227  DG  J C4    1 
ATOM   4643  P  P     . DA  B  1  82  ? 93.954  34.069 -71.458 1.00 50.69  ? 228  DA  J P     1 
ATOM   4644  O  OP1   . DA  B  1  82  ? 93.024  33.332 -70.563 1.00 52.24  ? 228  DA  J OP1   1 
ATOM   4645  O  OP2   . DA  B  1  82  ? 94.639  35.278 -70.962 1.00 49.51  ? 228  DA  J OP2   1 
ATOM   4646  O  "O5'" . DA  B  1  82  ? 95.025  33.076 -72.079 1.00 50.86  ? 228  DA  J "O5'" 1 
ATOM   4647  C  "C5'" . DA  B  1  82  ? 94.618  32.015 -72.938 1.00 50.74  ? 228  DA  J "C5'" 1 
ATOM   4648  C  "C4'" . DA  B  1  82  ? 95.834  31.289 -73.461 1.00 51.40  ? 228  DA  J "C4'" 1 
ATOM   4649  O  "O4'" . DA  B  1  82  ? 96.477  32.076 -74.488 1.00 52.97  ? 228  DA  J "O4'" 1 
ATOM   4650  C  "C3'" . DA  B  1  82  ? 96.891  31.048 -72.393 1.00 51.65  ? 228  DA  J "C3'" 1 
ATOM   4651  O  "O3'" . DA  B  1  82  ? 97.527  29.806 -72.642 1.00 52.33  ? 228  DA  J "O3'" 1 
ATOM   4652  C  "C2'" . DA  B  1  82  ? 97.849  32.211 -72.577 1.00 51.68  ? 228  DA  J "C2'" 1 
ATOM   4653  C  "C1'" . DA  B  1  82  ? 97.773  32.480 -74.073 1.00 53.48  ? 228  DA  J "C1'" 1 
ATOM   4654  N  N9    . DA  B  1  82  ? 97.923  33.885 -74.449 1.00 54.69  ? 228  DA  J N9    1 
ATOM   4655  C  C8    . DA  B  1  82  ? 97.440  34.988 -73.788 1.00 56.24  ? 228  DA  J C8    1 
ATOM   4656  N  N7    . DA  B  1  82  ? 97.687  36.122 -74.399 1.00 56.76  ? 228  DA  J N7    1 
ATOM   4657  C  C5    . DA  B  1  82  ? 98.390  35.742 -75.534 1.00 56.73  ? 228  DA  J C5    1 
ATOM   4658  C  C6    . DA  B  1  82  ? 98.931  36.479 -76.597 1.00 55.76  ? 228  DA  J C6    1 
ATOM   4659  N  N6    . DA  B  1  82  ? 98.827  37.804 -76.705 1.00 53.13  ? 228  DA  J N6    1 
ATOM   4660  N  N1    . DA  B  1  82  ? 99.586  35.800 -77.562 1.00 56.47  ? 228  DA  J N1    1 
ATOM   4661  C  C2    . DA  B  1  82  ? 99.674  34.465 -77.463 1.00 58.14  ? 228  DA  J C2    1 
ATOM   4662  N  N3    . DA  B  1  82  ? 99.197  33.657 -76.517 1.00 58.89  ? 228  DA  J N3    1 
ATOM   4663  C  C4    . DA  B  1  82  ? 98.557  34.367 -75.569 1.00 56.86  ? 228  DA  J C4    1 
ATOM   4664  P  P     . DA  B  1  83  ? 98.622  29.258 -71.616 1.00 51.04  ? 229  DA  J P     1 
ATOM   4665  O  OP1   . DA  B  1  83  ? 98.395  27.803 -71.480 1.00 50.12  ? 229  DA  J OP1   1 
ATOM   4666  O  OP2   . DA  B  1  83  ? 98.607  30.126 -70.417 1.00 52.50  ? 229  DA  J OP2   1 
ATOM   4667  O  "O5'" . DA  B  1  83  ? 99.991  29.511 -72.386 1.00 54.78  ? 229  DA  J "O5'" 1 
ATOM   4668  C  "C5'" . DA  B  1  83  ? 100.175 29.016 -73.712 1.00 55.55  ? 229  DA  J "C5'" 1 
ATOM   4669  C  "C4'" . DA  B  1  83  ? 101.501 29.479 -74.267 1.00 57.00  ? 229  DA  J "C4'" 1 
ATOM   4670  O  "O4'" . DA  B  1  83  ? 101.428 30.872 -74.650 1.00 54.05  ? 229  DA  J "O4'" 1 
ATOM   4671  C  "C3'" . DA  B  1  83  ? 102.673 29.358 -73.292 1.00 57.87  ? 229  DA  J "C3'" 1 
ATOM   4672  O  "O3'" . DA  B  1  83  ? 103.793 28.780 -73.963 1.00 63.68  ? 229  DA  J "O3'" 1 
ATOM   4673  C  "C2'" . DA  B  1  83  ? 102.946 30.793 -72.871 1.00 55.64  ? 229  DA  J "C2'" 1 
ATOM   4674  C  "C1'" . DA  B  1  83  ? 102.517 31.581 -74.093 1.00 55.60  ? 229  DA  J "C1'" 1 
ATOM   4675  N  N9    . DA  B  1  83  ? 102.071 32.949 -73.835 1.00 57.16  ? 229  DA  J N9    1 
ATOM   4676  C  C8    . DA  B  1  83  ? 101.389 33.448 -72.750 1.00 57.24  ? 229  DA  J C8    1 
ATOM   4677  N  N7    . DA  B  1  83  ? 101.137 34.735 -72.831 1.00 56.46  ? 229  DA  J N7    1 
ATOM   4678  C  C5    . DA  B  1  83  ? 101.685 35.106 -74.052 1.00 56.95  ? 229  DA  J C5    1 
ATOM   4679  C  C6    . DA  B  1  83  ? 101.746 36.338 -74.732 1.00 57.26  ? 229  DA  J C6    1 
ATOM   4680  N  N6    . DA  B  1  83  ? 101.211 37.473 -74.272 1.00 56.65  ? 229  DA  J N6    1 
ATOM   4681  N  N1    . DA  B  1  83  ? 102.379 36.365 -75.926 1.00 58.97  ? 229  DA  J N1    1 
ATOM   4682  C  C2    . DA  B  1  83  ? 102.899 35.228 -76.402 1.00 58.63  ? 229  DA  J C2    1 
ATOM   4683  N  N3    . DA  B  1  83  ? 102.895 34.010 -75.865 1.00 58.69  ? 229  DA  J N3    1 
ATOM   4684  C  C4    . DA  B  1  83  ? 102.267 34.017 -74.677 1.00 58.00  ? 229  DA  J C4    1 
ATOM   4685  P  P     . DC  B  1  84  ? 105.131 28.441 -73.143 1.00 65.20  ? 230  DC  J P     1 
ATOM   4686  O  OP1   . DC  B  1  84  ? 105.754 27.254 -73.778 1.00 65.65  ? 230  DC  J OP1   1 
ATOM   4687  O  OP2   . DC  B  1  84  ? 104.831 28.414 -71.692 1.00 67.29  ? 230  DC  J OP2   1 
ATOM   4688  O  "O5'" . DC  B  1  84  ? 106.028 29.718 -73.434 1.00 68.76  ? 230  DC  J "O5'" 1 
ATOM   4689  C  "C5'" . DC  B  1  84  ? 106.331 30.087 -74.774 1.00 73.57  ? 230  DC  J "C5'" 1 
ATOM   4690  C  "C4'" . DC  B  1  84  ? 107.256 31.279 -74.784 1.00 78.57  ? 230  DC  J "C4'" 1 
ATOM   4691  O  "O4'" . DC  B  1  84  ? 106.506 32.515 -74.694 1.00 76.79  ? 230  DC  J "O4'" 1 
ATOM   4692  C  "C3'" . DC  B  1  84  ? 108.252 31.290 -73.623 1.00 82.64  ? 230  DC  J "C3'" 1 
ATOM   4693  O  "O3'" . DC  B  1  84  ? 109.548 31.662 -74.084 1.00 92.41  ? 230  DC  J "O3'" 1 
ATOM   4694  C  "C2'" . DC  B  1  84  ? 107.714 32.377 -72.712 1.00 79.96  ? 230  DC  J "C2'" 1 
ATOM   4695  C  "C1'" . DC  B  1  84  ? 107.115 33.338 -73.720 1.00 75.96  ? 230  DC  J "C1'" 1 
ATOM   4696  N  N1    . DC  B  1  84  ? 106.108 34.271 -73.190 1.00 72.81  ? 230  DC  J N1    1 
ATOM   4697  C  C2    . DC  B  1  84  ? 105.824 35.432 -73.915 1.00 71.64  ? 230  DC  J C2    1 
ATOM   4698  O  O2    . DC  B  1  84  ? 106.363 35.596 -75.014 1.00 72.51  ? 230  DC  J O2    1 
ATOM   4699  N  N3    . DC  B  1  84  ? 104.967 36.342 -73.403 1.00 70.51  ? 230  DC  J N3    1 
ATOM   4700  C  C4    . DC  B  1  84  ? 104.389 36.120 -72.223 1.00 69.02  ? 230  DC  J C4    1 
ATOM   4701  N  N4    . DC  B  1  84  ? 103.580 37.061 -71.740 1.00 66.55  ? 230  DC  J N4    1 
ATOM   4702  C  C5    . DC  B  1  84  ? 104.623 34.924 -71.482 1.00 70.09  ? 230  DC  J C5    1 
ATOM   4703  C  C6    . DC  B  1  84  ? 105.480 34.034 -71.999 1.00 71.36  ? 230  DC  J C6    1 
ATOM   4704  P  P     . DA  B  1  85  ? 110.848 31.178 -73.275 1.00 99.40  ? 231  DA  J P     1 
ATOM   4705  O  OP1   . DA  B  1  85  ? 111.340 29.945 -73.936 1.00 99.02  ? 231  DA  J OP1   1 
ATOM   4706  O  OP2   . DA  B  1  85  ? 110.553 31.164 -71.820 1.00 99.09  ? 231  DA  J OP2   1 
ATOM   4707  O  "O5'" . DA  B  1  85  ? 111.887 32.343 -73.564 1.00 106.32 ? 231  DA  J "O5'" 1 
ATOM   4708  C  "C5'" . DA  B  1  85  ? 111.923 32.965 -74.843 1.00 118.25 ? 231  DA  J "C5'" 1 
ATOM   4709  C  "C4'" . DA  B  1  85  ? 112.192 34.442 -74.693 1.00 126.82 ? 231  DA  J "C4'" 1 
ATOM   4710  O  "O4'" . DA  B  1  85  ? 111.039 35.101 -74.112 1.00 128.69 ? 231  DA  J "O4'" 1 
ATOM   4711  C  "C3'" . DA  B  1  85  ? 113.374 34.763 -73.779 1.00 131.94 ? 231  DA  J "C3'" 1 
ATOM   4712  O  "O3'" . DA  B  1  85  ? 114.147 35.827 -74.338 1.00 138.86 ? 231  DA  J "O3'" 1 
ATOM   4713  C  "C2'" . DA  B  1  85  ? 112.713 35.185 -72.478 1.00 131.79 ? 231  DA  J "C2'" 1 
ATOM   4714  C  "C1'" . DA  B  1  85  ? 111.430 35.834 -72.961 1.00 131.06 ? 231  DA  J "C1'" 1 
ATOM   4715  N  N9    . DA  B  1  85  ? 110.333 35.782 -71.995 1.00 132.40 ? 231  DA  J N9    1 
ATOM   4716  C  C8    . DA  B  1  85  ? 109.830 34.679 -71.351 1.00 132.91 ? 231  DA  J C8    1 
ATOM   4717  N  N7    . DA  B  1  85  ? 108.844 34.948 -70.530 1.00 132.98 ? 231  DA  J N7    1 
ATOM   4718  C  C5    . DA  B  1  85  ? 108.684 36.323 -70.641 1.00 133.17 ? 231  DA  J C5    1 
ATOM   4719  C  C6    . DA  B  1  85  ? 107.798 37.225 -70.024 1.00 133.32 ? 231  DA  J C6    1 
ATOM   4720  N  N6    . DA  B  1  85  ? 106.866 36.861 -69.140 1.00 133.26 ? 231  DA  J N6    1 
ATOM   4721  N  N1    . DA  B  1  85  ? 107.903 38.531 -70.352 1.00 133.52 ? 231  DA  J N1    1 
ATOM   4722  C  C2    . DA  B  1  85  ? 108.836 38.895 -71.241 1.00 133.86 ? 231  DA  J C2    1 
ATOM   4723  N  N3    . DA  B  1  85  ? 109.724 38.142 -71.889 1.00 133.72 ? 231  DA  J N3    1 
ATOM   4724  C  C4    . DA  B  1  85  ? 109.595 36.850 -71.540 1.00 133.15 ? 231  DA  J C4    1 
ATOM   4725  P  P     . DT  B  1  86  ? 115.320 36.499 -73.474 1.00 143.70 ? 232  DT  J P     1 
ATOM   4726  O  OP1   . DT  B  1  86  ? 116.429 36.820 -74.409 1.00 143.70 ? 232  DT  J OP1   1 
ATOM   4727  O  OP2   . DT  B  1  86  ? 115.586 35.656 -72.277 1.00 143.46 ? 232  DT  J OP2   1 
ATOM   4728  O  "O5'" . DT  B  1  86  ? 114.665 37.865 -72.990 1.00 146.74 ? 232  DT  J "O5'" 1 
ATOM   4729  C  "C5'" . DT  B  1  86  ? 114.159 38.802 -73.938 1.00 151.85 ? 232  DT  J "C5'" 1 
ATOM   4730  C  "C4'" . DT  B  1  86  ? 114.155 40.184 -73.336 1.00 155.35 ? 232  DT  J "C4'" 1 
ATOM   4731  O  "O4'" . DT  B  1  86  ? 113.095 40.274 -72.352 1.00 156.51 ? 232  DT  J "O4'" 1 
ATOM   4732  C  "C3'" . DT  B  1  86  ? 115.452 40.504 -72.595 1.00 157.11 ? 232  DT  J "C3'" 1 
ATOM   4733  O  "O3'" . DT  B  1  86  ? 115.821 41.871 -72.780 1.00 158.93 ? 232  DT  J "O3'" 1 
ATOM   4734  C  "C2'" . DT  B  1  86  ? 115.107 40.224 -71.143 1.00 157.58 ? 232  DT  J "C2'" 1 
ATOM   4735  C  "C1'" . DT  B  1  86  ? 113.635 40.595 -71.078 1.00 157.88 ? 232  DT  J "C1'" 1 
ATOM   4736  N  N1    . DT  B  1  86  ? 112.860 39.861 -70.057 1.00 158.88 ? 232  DT  J N1    1 
ATOM   4737  C  C2    . DT  B  1  86  ? 111.552 40.236 -69.848 1.00 159.39 ? 232  DT  J C2    1 
ATOM   4738  O  O2    . DT  B  1  86  ? 111.008 41.133 -70.473 1.00 159.56 ? 232  DT  J O2    1 
ATOM   4739  N  N3    . DT  B  1  86  ? 110.900 39.516 -68.876 1.00 159.59 ? 232  DT  J N3    1 
ATOM   4740  C  C4    . DT  B  1  86  ? 111.413 38.484 -68.113 1.00 159.51 ? 232  DT  J C4    1 
ATOM   4741  O  O4    . DT  B  1  86  ? 110.705 37.931 -67.275 1.00 159.43 ? 232  DT  J O4    1 
ATOM   4742  C  C5    . DT  B  1  86  ? 112.790 38.141 -68.387 1.00 159.39 ? 232  DT  J C5    1 
ATOM   4743  C  C7    . DT  B  1  86  ? 113.431 37.034 -67.612 1.00 159.27 ? 232  DT  J C7    1 
ATOM   4744  C  C6    . DT  B  1  86  ? 113.435 38.837 -69.332 1.00 159.21 ? 232  DT  J C6    1 
ATOM   4745  P  P     . DG  B  1  87  ? 117.041 42.481 -71.935 1.00 160.17 ? 233  DG  J P     1 
ATOM   4746  O  OP1   . DG  B  1  87  ? 117.654 43.586 -72.716 1.00 160.39 ? 233  DG  J OP1   1 
ATOM   4747  O  OP2   . DG  B  1  87  ? 117.884 41.342 -71.488 1.00 160.29 ? 233  DG  J OP2   1 
ATOM   4748  O  "O5'" . DG  B  1  87  ? 116.325 43.103 -70.655 1.00 160.43 ? 233  DG  J "O5'" 1 
ATOM   4749  C  "C5'" . DG  B  1  87  ? 115.374 44.154 -70.799 1.00 160.40 ? 233  DG  J "C5'" 1 
ATOM   4750  C  "C4'" . DG  B  1  87  ? 115.257 44.934 -69.512 1.00 160.14 ? 233  DG  J "C4'" 1 
ATOM   4751  O  "O4'" . DG  B  1  87  ? 114.491 44.178 -68.541 1.00 160.98 ? 233  DG  J "O4'" 1 
ATOM   4752  C  "C3'" . DG  B  1  87  ? 116.594 45.260 -68.841 1.00 159.36 ? 233  DG  J "C3'" 1 
ATOM   4753  O  "O3'" . DG  B  1  87  ? 116.578 46.619 -68.374 1.00 156.71 ? 233  DG  J "O3'" 1 
ATOM   4754  C  "C2'" . DG  B  1  87  ? 116.677 44.241 -67.719 1.00 160.43 ? 233  DG  J "C2'" 1 
ATOM   4755  C  "C1'" . DG  B  1  87  ? 115.221 44.096 -67.327 1.00 161.87 ? 233  DG  J "C1'" 1 
ATOM   4756  N  N9    . DG  B  1  87  ? 114.870 42.844 -66.661 1.00 163.14 ? 233  DG  J N9    1 
ATOM   4757  C  C8    . DG  B  1  87  ? 115.551 41.651 -66.706 1.00 163.39 ? 233  DG  J C8    1 
ATOM   4758  N  N7    . DG  B  1  87  ? 114.989 40.714 -65.991 1.00 163.65 ? 233  DG  J N7    1 
ATOM   4759  C  C5    . DG  B  1  87  ? 113.870 41.325 -65.442 1.00 163.90 ? 233  DG  J C5    1 
ATOM   4760  C  C6    . DG  B  1  87  ? 112.872 40.809 -64.578 1.00 164.06 ? 233  DG  J C6    1 
ATOM   4761  O  O6    . DG  B  1  87  ? 112.774 39.670 -64.110 1.00 164.13 ? 233  DG  J O6    1 
ATOM   4762  N  N1    . DG  B  1  87  ? 111.917 41.771 -64.267 1.00 164.25 ? 233  DG  J N1    1 
ATOM   4763  C  C2    . DG  B  1  87  ? 111.919 43.064 -64.727 1.00 164.37 ? 233  DG  J C2    1 
ATOM   4764  N  N2    . DG  B  1  87  ? 110.908 43.842 -64.313 1.00 164.54 ? 233  DG  J N2    1 
ATOM   4765  N  N3    . DG  B  1  87  ? 112.844 43.558 -65.532 1.00 164.32 ? 233  DG  J N3    1 
ATOM   4766  C  C4    . DG  B  1  87  ? 113.782 42.639 -65.847 1.00 163.89 ? 233  DG  J C4    1 
ATOM   4767  P  P     . DC  B  1  88  ? 117.060 46.975 -66.878 1.00 154.52 ? 234  DC  J P     1 
ATOM   4768  O  OP1   . DC  B  1  88  ? 117.360 48.428 -66.841 1.00 154.87 ? 234  DC  J OP1   1 
ATOM   4769  O  OP2   . DC  B  1  88  ? 118.094 46.004 -66.436 1.00 154.48 ? 234  DC  J OP2   1 
ATOM   4770  O  "O5'" . DC  B  1  88  ? 115.743 46.738 -66.015 1.00 152.34 ? 234  DC  J "O5'" 1 
ATOM   4771  C  "C5'" . DC  B  1  88  ? 114.463 47.085 -66.542 1.00 147.15 ? 234  DC  J "C5'" 1 
ATOM   4772  C  "C4'" . DC  B  1  88  ? 113.493 47.367 -65.421 1.00 142.88 ? 234  DC  J "C4'" 1 
ATOM   4773  O  "O4'" . DC  B  1  88  ? 113.225 46.155 -64.678 1.00 142.81 ? 234  DC  J "O4'" 1 
ATOM   4774  C  "C3'" . DC  B  1  88  ? 113.987 48.386 -64.395 1.00 139.73 ? 234  DC  J "C3'" 1 
ATOM   4775  O  "O3'" . DC  B  1  88  ? 112.869 49.140 -63.945 1.00 134.53 ? 234  DC  J "O3'" 1 
ATOM   4776  C  "C2'" . DC  B  1  88  ? 114.490 47.514 -63.261 1.00 140.62 ? 234  DC  J "C2'" 1 
ATOM   4777  C  "C1'" . DC  B  1  88  ? 113.479 46.386 -63.302 1.00 142.28 ? 234  DC  J "C1'" 1 
ATOM   4778  N  N1    . DC  B  1  88  ? 113.912 45.118 -62.697 1.00 142.76 ? 234  DC  J N1    1 
ATOM   4779  C  C2    . DC  B  1  88  ? 113.055 44.490 -61.795 1.00 143.20 ? 234  DC  J C2    1 
ATOM   4780  O  O2    . DC  B  1  88  ? 111.958 45.012 -61.551 1.00 143.86 ? 234  DC  J O2    1 
ATOM   4781  N  N3    . DC  B  1  88  ? 113.438 43.331 -61.214 1.00 143.21 ? 234  DC  J N3    1 
ATOM   4782  C  C4    . DC  B  1  88  ? 114.622 42.797 -61.513 1.00 143.02 ? 234  DC  J C4    1 
ATOM   4783  N  N4    . DC  B  1  88  ? 114.958 41.654 -60.914 1.00 143.07 ? 234  DC  J N4    1 
ATOM   4784  C  C5    . DC  B  1  88  ? 115.513 43.412 -62.438 1.00 143.04 ? 234  DC  J C5    1 
ATOM   4785  C  C6    . DC  B  1  88  ? 115.123 44.562 -63.001 1.00 142.89 ? 234  DC  J C6    1 
ATOM   4786  P  P     . DC  B  1  89  ? 113.090 50.573 -63.270 1.00 130.70 ? 235  DC  J P     1 
ATOM   4787  O  OP1   . DC  B  1  89  ? 112.968 51.604 -64.332 1.00 130.89 ? 235  DC  J OP1   1 
ATOM   4788  O  OP2   . DC  B  1  89  ? 114.320 50.506 -62.441 1.00 130.84 ? 235  DC  J OP2   1 
ATOM   4789  O  "O5'" . DC  B  1  89  ? 111.837 50.692 -62.301 1.00 127.62 ? 235  DC  J "O5'" 1 
ATOM   4790  C  "C5'" . DC  B  1  89  ? 110.617 50.034 -62.628 1.00 121.18 ? 235  DC  J "C5'" 1 
ATOM   4791  C  "C4'" . DC  B  1  89  ? 110.091 49.276 -61.432 1.00 116.49 ? 235  DC  J "C4'" 1 
ATOM   4792  O  "O4'" . DC  B  1  89  ? 110.922 48.126 -61.131 1.00 115.40 ? 235  DC  J "O4'" 1 
ATOM   4793  C  "C3'" . DC  B  1  89  ? 110.014 50.087 -60.138 1.00 113.53 ? 235  DC  J "C3'" 1 
ATOM   4794  O  "O3'" . DC  B  1  89  ? 108.812 49.749 -59.456 1.00 108.41 ? 235  DC  J "O3'" 1 
ATOM   4795  C  "C2'" . DC  B  1  89  ? 111.191 49.571 -59.331 1.00 113.96 ? 235  DC  J "C2'" 1 
ATOM   4796  C  "C1'" . DC  B  1  89  ? 111.187 48.115 -59.738 1.00 115.05 ? 235  DC  J "C1'" 1 
ATOM   4797  N  N1    . DC  B  1  89  ? 112.444 47.388 -59.502 1.00 115.87 ? 235  DC  J N1    1 
ATOM   4798  C  C2    . DC  B  1  89  ? 112.371 46.072 -59.041 1.00 116.39 ? 235  DC  J C2    1 
ATOM   4799  O  O2    . DC  B  1  89  ? 111.256 45.560 -58.869 1.00 116.75 ? 235  DC  J O2    1 
ATOM   4800  N  N3    . DC  B  1  89  ? 113.512 45.389 -58.799 1.00 116.75 ? 235  DC  J N3    1 
ATOM   4801  C  C4    . DC  B  1  89  ? 114.694 45.972 -59.006 1.00 116.98 ? 235  DC  J C4    1 
ATOM   4802  N  N4    . DC  B  1  89  ? 115.794 45.260 -58.753 1.00 116.83 ? 235  DC  J N4    1 
ATOM   4803  C  C5    . DC  B  1  89  ? 114.799 47.313 -59.483 1.00 116.85 ? 235  DC  J C5    1 
ATOM   4804  C  C6    . DC  B  1  89  ? 113.658 47.978 -59.716 1.00 116.49 ? 235  DC  J C6    1 
ATOM   4805  P  P     . DT  B  1  90  ? 108.294 50.669 -58.251 1.00 104.50 ? 236  DT  J P     1 
ATOM   4806  O  OP1   . DT  B  1  90  ? 107.537 51.810 -58.829 1.00 104.36 ? 236  DT  J OP1   1 
ATOM   4807  O  OP2   . DT  B  1  90  ? 109.440 50.926 -57.342 1.00 105.15 ? 236  DT  J OP2   1 
ATOM   4808  O  "O5'" . DT  B  1  90  ? 107.279 49.709 -57.498 1.00 101.30 ? 236  DT  J "O5'" 1 
ATOM   4809  C  "C5'" . DT  B  1  90  ? 106.579 48.704 -58.218 1.00 94.94  ? 236  DT  J "C5'" 1 
ATOM   4810  C  "C4'" . DT  B  1  90  ? 106.476 47.447 -57.389 1.00 90.67  ? 236  DT  J "C4'" 1 
ATOM   4811  O  "O4'" . DT  B  1  90  ? 107.770 46.801 -57.297 1.00 90.35  ? 236  DT  J "O4'" 1 
ATOM   4812  C  "C3'" . DT  B  1  90  ? 106.011 47.683 -55.953 1.00 87.97  ? 236  DT  J "C3'" 1 
ATOM   4813  O  "O3'" . DT  B  1  90  ? 105.064 46.681 -55.586 1.00 82.51  ? 236  DT  J "O3'" 1 
ATOM   4814  C  "C2'" . DT  B  1  90  ? 107.285 47.549 -55.136 1.00 88.46  ? 236  DT  J "C2'" 1 
ATOM   4815  C  "C1'" . DT  B  1  90  ? 108.078 46.535 -55.937 1.00 90.19  ? 236  DT  J "C1'" 1 
ATOM   4816  N  N1    . DT  B  1  90  ? 109.543 46.632 -55.772 1.00 91.57  ? 236  DT  J N1    1 
ATOM   4817  C  C2    . DT  B  1  90  ? 110.251 45.473 -55.519 1.00 92.02  ? 236  DT  J C2    1 
ATOM   4818  O  O2    . DT  B  1  90  ? 109.726 44.377 -55.424 1.00 93.39  ? 236  DT  J O2    1 
ATOM   4819  N  N3    . DT  B  1  90  ? 111.606 45.647 -55.381 1.00 92.42  ? 236  DT  J N3    1 
ATOM   4820  C  C4    . DT  B  1  90  ? 112.308 46.832 -55.470 1.00 92.84  ? 236  DT  J C4    1 
ATOM   4821  O  O4    . DT  B  1  90  ? 113.529 46.832 -55.330 1.00 91.86  ? 236  DT  J O4    1 
ATOM   4822  C  C5    . DT  B  1  90  ? 111.504 48.007 -55.734 1.00 92.76  ? 236  DT  J C5    1 
ATOM   4823  C  C7    . DT  B  1  90  ? 112.178 49.337 -55.844 1.00 93.31  ? 236  DT  J C7    1 
ATOM   4824  C  C6    . DT  B  1  90  ? 110.180 47.850 -55.869 1.00 91.76  ? 236  DT  J C6    1 
ATOM   4825  P  P     . DT  B  1  91  ? 104.351 46.747 -54.153 1.00 76.18  ? 237  DT  J P     1 
ATOM   4826  O  OP1   . DT  B  1  91  ? 102.889 46.696 -54.391 1.00 78.12  ? 237  DT  J OP1   1 
ATOM   4827  O  OP2   . DT  B  1  91  ? 104.927 47.875 -53.384 1.00 77.72  ? 237  DT  J OP2   1 
ATOM   4828  O  "O5'" . DT  B  1  91  ? 104.819 45.385 -53.482 1.00 73.76  ? 237  DT  J "O5'" 1 
ATOM   4829  C  "C5'" . DT  B  1  91  ? 104.881 44.202 -54.269 1.00 70.99  ? 237  DT  J "C5'" 1 
ATOM   4830  C  "C4'" . DT  B  1  91  ? 105.689 43.135 -53.571 1.00 69.07  ? 237  DT  J "C4'" 1 
ATOM   4831  O  "O4'" . DT  B  1  91  ? 107.096 43.479 -53.572 1.00 68.85  ? 237  DT  J "O4'" 1 
ATOM   4832  C  "C3'" . DT  B  1  91  ? 105.310 42.866 -52.117 1.00 67.41  ? 237  DT  J "C3'" 1 
ATOM   4833  O  "O3'" . DT  B  1  91  ? 105.270 41.454 -51.908 1.00 63.96  ? 237  DT  J "O3'" 1 
ATOM   4834  C  "C2'" . DT  B  1  91  ? 106.440 43.509 -51.329 1.00 68.58  ? 237  DT  J "C2'" 1 
ATOM   4835  C  "C1'" . DT  B  1  91  ? 107.626 43.349 -52.265 1.00 69.49  ? 237  DT  J "C1'" 1 
ATOM   4836  N  N1    . DT  B  1  91  ? 108.694 44.360 -52.111 1.00 71.47  ? 237  DT  J N1    1 
ATOM   4837  C  C2    . DT  B  1  91  ? 109.994 43.923 -51.947 1.00 71.30  ? 237  DT  J C2    1 
ATOM   4838  O  O2    . DT  B  1  91  ? 110.309 42.743 -51.913 1.00 70.80  ? 237  DT  J O2    1 
ATOM   4839  N  N3    . DT  B  1  91  ? 110.921 44.925 -51.827 1.00 72.27  ? 237  DT  J N3    1 
ATOM   4840  C  C4    . DT  B  1  91  ? 110.690 46.285 -51.854 1.00 72.67  ? 237  DT  J C4    1 
ATOM   4841  O  O4    . DT  B  1  91  ? 111.629 47.065 -51.744 1.00 73.40  ? 237  DT  J O4    1 
ATOM   4842  C  C5    . DT  B  1  91  ? 109.308 46.674 -52.020 1.00 73.12  ? 237  DT  J C5    1 
ATOM   4843  C  C7    . DT  B  1  91  ? 108.965 48.130 -52.052 1.00 73.36  ? 237  DT  J C7    1 
ATOM   4844  C  C6    . DT  B  1  91  ? 108.391 45.704 -52.138 1.00 72.00  ? 237  DT  J C6    1 
ATOM   4845  P  P     . DT  B  1  92  ? 104.947 40.877 -50.453 1.00 62.14  ? 238  DT  J P     1 
ATOM   4846  O  OP1   . DT  B  1  92  ? 104.155 39.632 -50.622 1.00 62.94  ? 238  DT  J OP1   1 
ATOM   4847  O  OP2   . DT  B  1  92  ? 104.416 41.983 -49.618 1.00 61.63  ? 238  DT  J OP2   1 
ATOM   4848  O  "O5'" . DT  B  1  92  ? 106.379 40.433 -49.924 1.00 66.90  ? 238  DT  J "O5'" 1 
ATOM   4849  C  "C5'" . DT  B  1  92  ? 107.174 39.540 -50.702 1.00 69.77  ? 238  DT  J "C5'" 1 
ATOM   4850  C  "C4'" . DT  B  1  92  ? 108.479 39.244 -50.004 1.00 71.95  ? 238  DT  J "C4'" 1 
ATOM   4851  O  "O4'" . DT  B  1  92  ? 109.327 40.415 -50.018 1.00 72.17  ? 238  DT  J "O4'" 1 
ATOM   4852  C  "C3'" . DT  B  1  92  ? 108.353 38.825 -48.541 1.00 73.67  ? 238  DT  J "C3'" 1 
ATOM   4853  O  "O3'" . DT  B  1  92  ? 109.241 37.736 -48.291 1.00 77.25  ? 238  DT  J "O3'" 1 
ATOM   4854  C  "C2'" . DT  B  1  92  ? 108.766 40.069 -47.773 1.00 72.75  ? 238  DT  J "C2'" 1 
ATOM   4855  C  "C1'" . DT  B  1  92  ? 109.779 40.705 -48.706 1.00 72.24  ? 238  DT  J "C1'" 1 
ATOM   4856  N  N1    . DT  B  1  92  ? 109.924 42.173 -48.599 1.00 72.55  ? 238  DT  J N1    1 
ATOM   4857  C  C2    . DT  B  1  92  ? 111.204 42.691 -48.536 1.00 72.50  ? 238  DT  J C2    1 
ATOM   4858  O  O2    . DT  B  1  92  ? 112.208 41.994 -48.504 1.00 72.41  ? 238  DT  J O2    1 
ATOM   4859  N  N3    . DT  B  1  92  ? 111.264 44.061 -48.504 1.00 70.52  ? 238  DT  J N3    1 
ATOM   4860  C  C4    . DT  B  1  92  ? 110.201 44.943 -48.512 1.00 71.42  ? 238  DT  J C4    1 
ATOM   4861  O  O4    . DT  B  1  92  ? 110.408 46.152 -48.508 1.00 71.85  ? 238  DT  J O4    1 
ATOM   4862  C  C5    . DT  B  1  92  ? 108.895 44.336 -48.535 1.00 70.87  ? 238  DT  J C5    1 
ATOM   4863  C  C7    . DT  B  1  92  ? 107.691 45.221 -48.501 1.00 69.80  ? 238  DT  J C7    1 
ATOM   4864  C  C6    . DT  B  1  92  ? 108.820 42.998 -48.582 1.00 71.31  ? 238  DT  J C6    1 
ATOM   4865  P  P     . DT  B  1  93  ? 109.246 37.023 -46.854 1.00 80.01  ? 239  DT  J P     1 
ATOM   4866  O  OP1   . DT  B  1  93  ? 109.551 35.585 -47.054 1.00 80.65  ? 239  DT  J OP1   1 
ATOM   4867  O  OP2   . DT  B  1  93  ? 108.012 37.416 -46.132 1.00 80.88  ? 239  DT  J OP2   1 
ATOM   4868  O  "O5'" . DT  B  1  93  ? 110.491 37.704 -46.135 1.00 83.22  ? 239  DT  J "O5'" 1 
ATOM   4869  C  "C5'" . DT  B  1  93  ? 111.798 37.587 -46.698 1.00 86.32  ? 239  DT  J "C5'" 1 
ATOM   4870  C  "C4'" . DT  B  1  93  ? 112.821 38.210 -45.780 1.00 88.59  ? 239  DT  J "C4'" 1 
ATOM   4871  O  "O4'" . DT  B  1  93  ? 112.833 39.649 -45.938 1.00 87.28  ? 239  DT  J "O4'" 1 
ATOM   4872  C  "C3'" . DT  B  1  93  ? 112.569 37.942 -44.296 1.00 90.54  ? 239  DT  J "C3'" 1 
ATOM   4873  O  "O3'" . DT  B  1  93  ? 113.798 37.657 -43.626 1.00 94.79  ? 239  DT  J "O3'" 1 
ATOM   4874  C  "C2'" . DT  B  1  93  ? 111.989 39.253 -43.798 1.00 89.41  ? 239  DT  J "C2'" 1 
ATOM   4875  C  "C1'" . DT  B  1  93  ? 112.709 40.263 -44.670 1.00 87.40  ? 239  DT  J "C1'" 1 
ATOM   4876  N  N1    . DT  B  1  93  ? 112.009 41.544 -44.857 1.00 86.57  ? 239  DT  J N1    1 
ATOM   4877  C  C2    . DT  B  1  93  ? 112.779 42.671 -45.006 1.00 86.52  ? 239  DT  J C2    1 
ATOM   4878  O  O2    . DT  B  1  93  ? 113.998 42.651 -44.983 1.00 87.25  ? 239  DT  J O2    1 
ATOM   4879  N  N3    . DT  B  1  93  ? 112.069 43.831 -45.186 1.00 85.41  ? 239  DT  J N3    1 
ATOM   4880  C  C4    . DT  B  1  93  ? 110.697 43.970 -45.229 1.00 84.96  ? 239  DT  J C4    1 
ATOM   4881  O  O4    . DT  B  1  93  ? 110.201 45.078 -45.402 1.00 84.06  ? 239  DT  J O4    1 
ATOM   4882  C  C5    . DT  B  1  93  ? 109.948 42.746 -45.059 1.00 85.18  ? 239  DT  J C5    1 
ATOM   4883  C  C7    . DT  B  1  93  ? 108.454 42.801 -45.088 1.00 84.38  ? 239  DT  J C7    1 
ATOM   4884  C  C6    . DT  B  1  93  ? 110.633 41.608 -44.884 1.00 86.02  ? 239  DT  J C6    1 
ATOM   4885  P  P     . DG  B  1  94  ? 113.776 36.881 -42.218 1.00 98.59  ? 240  DG  J P     1 
ATOM   4886  O  OP1   . DG  B  1  94  ? 114.447 35.569 -42.412 1.00 97.59  ? 240  DG  J OP1   1 
ATOM   4887  O  OP2   . DG  B  1  94  ? 112.396 36.926 -41.663 1.00 97.77  ? 240  DG  J OP2   1 
ATOM   4888  O  "O5'" . DG  B  1  94  ? 114.706 37.790 -41.306 1.00 99.76  ? 240  DG  J "O5'" 1 
ATOM   4889  C  "C5'" . DG  B  1  94  ? 115.920 38.318 -41.824 1.00 103.57 ? 240  DG  J "C5'" 1 
ATOM   4890  C  "C4'" . DG  B  1  94  ? 116.239 39.634 -41.159 1.00 106.35 ? 240  DG  J "C4'" 1 
ATOM   4891  O  "O4'" . DG  B  1  94  ? 115.358 40.676 -41.649 1.00 106.76 ? 240  DG  J "O4'" 1 
ATOM   4892  C  "C3'" . DG  B  1  94  ? 116.075 39.620 -39.638 1.00 108.19 ? 240  DG  J "C3'" 1 
ATOM   4893  O  "O3'" . DG  B  1  94  ? 117.143 40.349 -39.032 1.00 110.27 ? 240  DG  J "O3'" 1 
ATOM   4894  C  "C2'" . DG  B  1  94  ? 114.760 40.347 -39.421 1.00 107.96 ? 240  DG  J "C2'" 1 
ATOM   4895  C  "C1'" . DG  B  1  94  ? 114.797 41.363 -40.543 1.00 107.57 ? 240  DG  J "C1'" 1 
ATOM   4896  N  N9    . DG  B  1  94  ? 113.498 41.899 -40.939 1.00 107.98 ? 240  DG  J N9    1 
ATOM   4897  C  C8    . DG  B  1  94  ? 112.320 41.209 -41.106 1.00 107.76 ? 240  DG  J C8    1 
ATOM   4898  N  N7    . DG  B  1  94  ? 111.320 41.977 -41.446 1.00 107.36 ? 240  DG  J N7    1 
ATOM   4899  C  C5    . DG  B  1  94  ? 111.872 43.250 -41.512 1.00 107.51 ? 240  DG  J C5    1 
ATOM   4900  C  C6    . DG  B  1  94  ? 111.273 44.498 -41.828 1.00 107.59 ? 240  DG  J C6    1 
ATOM   4901  O  O6    . DG  B  1  94  ? 110.096 44.737 -42.120 1.00 107.59 ? 240  DG  J O6    1 
ATOM   4902  N  N1    . DG  B  1  94  ? 112.199 45.536 -41.779 1.00 107.82 ? 240  DG  J N1    1 
ATOM   4903  C  C2    . DG  B  1  94  ? 113.528 45.395 -41.465 1.00 107.74 ? 240  DG  J C2    1 
ATOM   4904  N  N2    . DG  B  1  94  ? 114.262 46.517 -41.475 1.00 107.79 ? 240  DG  J N2    1 
ATOM   4905  N  N3    . DG  B  1  94  ? 114.096 44.240 -41.166 1.00 107.61 ? 240  DG  J N3    1 
ATOM   4906  C  C4    . DG  B  1  94  ? 113.216 43.217 -41.208 1.00 107.71 ? 240  DG  J C4    1 
ATOM   4907  P  P     . DA  B  1  95  ? 117.257 40.413 -37.433 1.00 111.76 ? 241  DA  J P     1 
ATOM   4908  O  OP1   . DA  B  1  95  ? 118.562 39.816 -37.051 1.00 111.69 ? 241  DA  J OP1   1 
ATOM   4909  O  OP2   . DA  B  1  95  ? 116.006 39.877 -36.840 1.00 112.15 ? 241  DA  J OP2   1 
ATOM   4910  O  "O5'" . DA  B  1  95  ? 117.321 41.975 -37.145 1.00 111.90 ? 241  DA  J "O5'" 1 
ATOM   4911  C  "C5'" . DA  B  1  95  ? 118.269 42.795 -37.821 1.00 112.65 ? 241  DA  J "C5'" 1 
ATOM   4912  C  "C4'" . DA  B  1  95  ? 118.075 44.240 -37.431 1.00 113.41 ? 241  DA  J "C4'" 1 
ATOM   4913  O  "O4'" . DA  B  1  95  ? 116.853 44.744 -38.022 1.00 113.40 ? 241  DA  J "O4'" 1 
ATOM   4914  C  "C3'" . DA  B  1  95  ? 117.943 44.465 -35.925 1.00 113.65 ? 241  DA  J "C3'" 1 
ATOM   4915  O  "O3'" . DA  B  1  95  ? 118.623 45.664 -35.548 1.00 113.84 ? 241  DA  J "O3'" 1 
ATOM   4916  C  "C2'" . DA  B  1  95  ? 116.444 44.600 -35.718 1.00 113.27 ? 241  DA  J "C2'" 1 
ATOM   4917  C  "C1'" . DA  B  1  95  ? 115.999 45.259 -37.012 1.00 113.13 ? 241  DA  J "C1'" 1 
ATOM   4918  N  N9    . DA  B  1  95  ? 114.621 44.963 -37.399 1.00 113.05 ? 241  DA  J N9    1 
ATOM   4919  C  C8    . DA  B  1  95  ? 114.030 43.731 -37.534 1.00 113.07 ? 241  DA  J C8    1 
ATOM   4920  N  N7    . DA  B  1  95  ? 112.775 43.785 -37.908 1.00 112.82 ? 241  DA  J N7    1 
ATOM   4921  C  C5    . DA  B  1  95  ? 112.520 45.145 -38.025 1.00 112.42 ? 241  DA  J C5    1 
ATOM   4922  C  C6    . DA  B  1  95  ? 111.369 45.864 -38.389 1.00 112.18 ? 241  DA  J C6    1 
ATOM   4923  N  N6    . DA  B  1  95  ? 110.210 45.289 -38.718 1.00 111.49 ? 241  DA  J N6    1 
ATOM   4924  N  N1    . DA  B  1  95  ? 111.450 47.212 -38.406 1.00 112.26 ? 241  DA  J N1    1 
ATOM   4925  C  C2    . DA  B  1  95  ? 112.613 47.788 -38.076 1.00 112.35 ? 241  DA  J C2    1 
ATOM   4926  N  N3    . DA  B  1  95  ? 113.762 47.221 -37.717 1.00 112.38 ? 241  DA  J N3    1 
ATOM   4927  C  C4    . DA  B  1  95  ? 113.648 45.882 -37.711 1.00 112.59 ? 241  DA  J C4    1 
ATOM   4928  P  P     . DT  B  1  96  ? 118.464 46.230 -34.056 1.00 113.98 ? 242  DT  J P     1 
ATOM   4929  O  OP1   . DT  B  1  96  ? 119.655 47.065 -33.768 1.00 114.19 ? 242  DT  J OP1   1 
ATOM   4930  O  OP2   . DT  B  1  96  ? 118.123 45.095 -33.159 1.00 113.72 ? 242  DT  J OP2   1 
ATOM   4931  O  "O5'" . DT  B  1  96  ? 117.200 47.193 -34.158 1.00 113.54 ? 242  DT  J "O5'" 1 
ATOM   4932  C  "C5'" . DT  B  1  96  ? 117.264 48.393 -34.923 1.00 112.25 ? 242  DT  J "C5'" 1 
ATOM   4933  C  "C4'" . DT  B  1  96  ? 116.203 49.362 -34.458 1.00 111.89 ? 242  DT  J "C4'" 1 
ATOM   4934  O  "O4'" . DT  B  1  96  ? 114.902 48.970 -34.960 1.00 111.41 ? 242  DT  J "O4'" 1 
ATOM   4935  C  "C3'" . DT  B  1  96  ? 116.066 49.448 -32.937 1.00 111.79 ? 242  DT  J "C3'" 1 
ATOM   4936  O  "O3'" . DT  B  1  96  ? 115.857 50.801 -32.537 1.00 111.77 ? 242  DT  J "O3'" 1 
ATOM   4937  C  "C2'" . DT  B  1  96  ? 114.819 48.633 -32.649 1.00 111.47 ? 242  DT  J "C2'" 1 
ATOM   4938  C  "C1'" . DT  B  1  96  ? 113.980 48.906 -33.884 1.00 110.86 ? 242  DT  J "C1'" 1 
ATOM   4939  N  N1    . DT  B  1  96  ? 112.981 47.867 -34.196 1.00 109.72 ? 242  DT  J N1    1 
ATOM   4940  C  C2    . DT  B  1  96  ? 111.779 48.272 -34.729 1.00 108.95 ? 242  DT  J C2    1 
ATOM   4941  O  O2    . DT  B  1  96  ? 111.515 49.439 -34.965 1.00 107.87 ? 242  DT  J O2    1 
ATOM   4942  N  N3    . DT  B  1  96  ? 110.894 47.253 -34.979 1.00 108.68 ? 242  DT  J N3    1 
ATOM   4943  C  C4    . DT  B  1  96  ? 111.087 45.903 -34.754 1.00 108.97 ? 242  DT  J C4    1 
ATOM   4944  O  O4    . DT  B  1  96  ? 110.196 45.105 -35.023 1.00 109.18 ? 242  DT  J O4    1 
ATOM   4945  C  C5    . DT  B  1  96  ? 112.372 45.549 -34.200 1.00 109.37 ? 242  DT  J C5    1 
ATOM   4946  C  C7    . DT  B  1  96  ? 112.673 44.109 -33.927 1.00 108.94 ? 242  DT  J C7    1 
ATOM   4947  C  C6    . DT  B  1  96  ? 113.244 46.536 -33.953 1.00 109.80 ? 242  DT  J C6    1 
ATOM   4948  P  P     . DG  B  1  97  ? 116.445 51.313 -31.135 1.00 110.92 ? 243  DG  J P     1 
ATOM   4949  O  OP1   . DG  B  1  97  ? 117.925 51.199 -31.205 1.00 111.18 ? 243  DG  J OP1   1 
ATOM   4950  O  OP2   . DG  B  1  97  ? 115.706 50.634 -30.039 1.00 110.66 ? 243  DG  J OP2   1 
ATOM   4951  O  "O5'" . DG  B  1  97  ? 116.062 52.857 -31.121 1.00 110.42 ? 243  DG  J "O5'" 1 
ATOM   4952  C  "C5'" . DG  B  1  97  ? 115.110 53.364 -30.193 1.00 110.00 ? 243  DG  J "C5'" 1 
ATOM   4953  C  "C4'" . DG  B  1  97  ? 113.909 53.910 -30.928 1.00 109.33 ? 243  DG  J "C4'" 1 
ATOM   4954  O  "O4'" . DG  B  1  97  ? 113.258 52.836 -31.651 1.00 109.46 ? 243  DG  J "O4'" 1 
ATOM   4955  C  "C3'" . DG  B  1  97  ? 112.842 54.505 -30.014 1.00 109.08 ? 243  DG  J "C3'" 1 
ATOM   4956  O  "O3'" . DG  B  1  97  ? 112.254 55.647 -30.638 1.00 108.33 ? 243  DG  J "O3'" 1 
ATOM   4957  C  "C2'" . DG  B  1  97  ? 111.833 53.381 -29.866 1.00 109.16 ? 243  DG  J "C2'" 1 
ATOM   4958  C  "C1'" . DG  B  1  97  ? 111.913 52.689 -31.214 1.00 108.81 ? 243  DG  J "C1'" 1 
ATOM   4959  N  N9    . DG  B  1  97  ? 111.608 51.261 -31.172 1.00 108.50 ? 243  DG  J N9    1 
ATOM   4960  C  C8    . DG  B  1  97  ? 112.377 50.263 -30.622 1.00 108.13 ? 243  DG  J C8    1 
ATOM   4961  N  N7    . DG  B  1  97  ? 111.846 49.077 -30.749 1.00 107.48 ? 243  DG  J N7    1 
ATOM   4962  C  C5    . DG  B  1  97  ? 110.653 49.304 -31.423 1.00 107.48 ? 243  DG  J C5    1 
ATOM   4963  C  C6    . DG  B  1  97  ? 109.649 48.395 -31.850 1.00 106.94 ? 243  DG  J C6    1 
ATOM   4964  O  O6    . DG  B  1  97  ? 109.615 47.166 -31.713 1.00 106.66 ? 243  DG  J O6    1 
ATOM   4965  N  N1    . DG  B  1  97  ? 108.606 49.052 -32.497 1.00 106.57 ? 243  DG  J N1    1 
ATOM   4966  C  C2    . DG  B  1  97  ? 108.535 50.407 -32.709 1.00 106.60 ? 243  DG  J C2    1 
ATOM   4967  N  N2    . DG  B  1  97  ? 107.447 50.851 -33.354 1.00 105.39 ? 243  DG  J N2    1 
ATOM   4968  N  N3    . DG  B  1  97  ? 109.464 51.265 -32.318 1.00 107.67 ? 243  DG  J N3    1 
ATOM   4969  C  C4    . DG  B  1  97  ? 110.488 50.649 -31.686 1.00 108.13 ? 243  DG  J C4    1 
ATOM   4970  P  P     . DG  B  1  98  ? 111.493 56.735 -29.737 1.00 108.38 ? 244  DG  J P     1 
ATOM   4971  O  OP1   . DG  B  1  98  ? 111.419 58.010 -30.497 1.00 108.08 ? 244  DG  J OP1   1 
ATOM   4972  O  OP2   . DG  B  1  98  ? 112.121 56.717 -28.390 1.00 108.39 ? 244  DG  J OP2   1 
ATOM   4973  O  "O5'" . DG  B  1  98  ? 110.022 56.144 -29.596 1.00 106.77 ? 244  DG  J "O5'" 1 
ATOM   4974  C  "C5'" . DG  B  1  98  ? 109.085 56.266 -30.661 1.00 104.04 ? 244  DG  J "C5'" 1 
ATOM   4975  C  "C4'" . DG  B  1  98  ? 107.766 55.646 -30.266 1.00 102.13 ? 244  DG  J "C4'" 1 
ATOM   4976  O  "O4'" . DG  B  1  98  ? 107.891 54.204 -30.223 1.00 101.74 ? 244  DG  J "O4'" 1 
ATOM   4977  C  "C3'" . DG  B  1  98  ? 107.255 56.068 -28.887 1.00 100.74 ? 244  DG  J "C3'" 1 
ATOM   4978  O  "O3'" . DG  B  1  98  ? 105.834 56.189 -28.929 1.00 99.01  ? 244  DG  J "O3'" 1 
ATOM   4979  C  "C2'" . DG  B  1  98  ? 107.632 54.891 -28.006 1.00 100.78 ? 244  DG  J "C2'" 1 
ATOM   4980  C  "C1'" . DG  B  1  98  ? 107.427 53.737 -28.968 1.00 101.00 ? 244  DG  J "C1'" 1 
ATOM   4981  N  N9    . DG  B  1  98  ? 108.136 52.502 -28.651 1.00 100.14 ? 244  DG  J N9    1 
ATOM   4982  C  C8    . DG  B  1  98  ? 109.308 52.360 -27.946 1.00 99.99  ? 244  DG  J C8    1 
ATOM   4983  N  N7    . DG  B  1  98  ? 109.686 51.116 -27.830 1.00 99.78  ? 244  DG  J N7    1 
ATOM   4984  C  C5    . DG  B  1  98  ? 108.705 50.395 -28.498 1.00 99.30  ? 244  DG  J C5    1 
ATOM   4985  C  C6    . DG  B  1  98  ? 108.572 49.001 -28.708 1.00 98.80  ? 244  DG  J C6    1 
ATOM   4986  O  O6    . DG  B  1  98  ? 109.318 48.089 -28.330 1.00 98.11  ? 244  DG  J O6    1 
ATOM   4987  N  N1    . DG  B  1  98  ? 107.429 48.703 -29.443 1.00 99.06  ? 244  DG  J N1    1 
ATOM   4988  C  C2    . DG  B  1  98  ? 106.529 49.626 -29.913 1.00 98.99  ? 244  DG  J C2    1 
ATOM   4989  N  N2    . DG  B  1  98  ? 105.491 49.143 -30.608 1.00 99.37  ? 244  DG  J N2    1 
ATOM   4990  N  N3    . DG  B  1  98  ? 106.639 50.926 -29.719 1.00 98.81  ? 244  DG  J N3    1 
ATOM   4991  C  C4    . DG  B  1  98  ? 107.743 51.238 -29.011 1.00 99.56  ? 244  DG  J C4    1 
ATOM   4992  P  P     . DA  B  1  99  ? 105.166 57.637 -29.092 1.00 97.73  ? 245  DA  J P     1 
ATOM   4993  O  OP1   . DA  B  1  99  ? 105.991 58.414 -30.056 1.00 97.90  ? 245  DA  J OP1   1 
ATOM   4994  O  OP2   . DA  B  1  99  ? 104.917 58.173 -27.730 1.00 98.07  ? 245  DA  J OP2   1 
ATOM   4995  O  "O5'" . DA  B  1  99  ? 103.760 57.329 -29.769 1.00 96.58  ? 245  DA  J "O5'" 1 
ATOM   4996  C  "C5'" . DA  B  1  99  ? 103.683 56.923 -31.133 1.00 94.08  ? 245  DA  J "C5'" 1 
ATOM   4997  C  "C4'" . DA  B  1  99  ? 102.712 55.774 -31.282 1.00 92.69  ? 245  DA  J "C4'" 1 
ATOM   4998  O  "O4'" . DA  B  1  99  ? 103.259 54.569 -30.697 1.00 91.60  ? 245  DA  J "O4'" 1 
ATOM   4999  C  "C3'" . DA  B  1  99  ? 101.360 55.990 -30.607 1.00 91.64  ? 245  DA  J "C3'" 1 
ATOM   5000  O  "O3'" . DA  B  1  99  ? 100.343 55.388 -31.403 1.00 90.33  ? 245  DA  J "O3'" 1 
ATOM   5001  C  "C2'" . DA  B  1  99  ? 101.506 55.247 -29.291 1.00 91.31  ? 245  DA  J "C2'" 1 
ATOM   5002  C  "C1'" . DA  B  1  99  ? 102.391 54.079 -29.684 1.00 91.05  ? 245  DA  J "C1'" 1 
ATOM   5003  N  N9    . DA  B  1  99  ? 103.229 53.556 -28.608 1.00 90.68  ? 245  DA  J N9    1 
ATOM   5004  C  C8    . DA  B  1  99  ? 104.014 54.259 -27.729 1.00 90.28  ? 245  DA  J C8    1 
ATOM   5005  N  N7    . DA  B  1  99  ? 104.698 53.500 -26.908 1.00 90.46  ? 245  DA  J N7    1 
ATOM   5006  C  C5    . DA  B  1  99  ? 104.329 52.209 -27.262 1.00 90.18  ? 245  DA  J C5    1 
ATOM   5007  C  C6    . DA  B  1  99  ? 104.709 50.948 -26.773 1.00 89.88  ? 245  DA  J C6    1 
ATOM   5008  N  N6    . DA  B  1  99  ? 105.594 50.770 -25.790 1.00 90.22  ? 245  DA  J N6    1 
ATOM   5009  N  N1    . DA  B  1  99  ? 104.145 49.860 -27.339 1.00 89.96  ? 245  DA  J N1    1 
ATOM   5010  C  C2    . DA  B  1  99  ? 103.264 50.038 -28.332 1.00 90.11  ? 245  DA  J C2    1 
ATOM   5011  N  N3    . DA  B  1  99  ? 102.833 51.169 -28.883 1.00 89.99  ? 245  DA  J N3    1 
ATOM   5012  C  C4    . DA  B  1  99  ? 103.412 52.230 -28.297 1.00 90.46  ? 245  DA  J C4    1 
ATOM   5013  P  P     . DG  B  1  100 ? 98.819  55.841 -31.217 1.00 90.01  ? 246  DG  J P     1 
ATOM   5014  O  OP1   . DG  B  1  100 ? 98.362  56.534 -32.449 1.00 90.98  ? 246  DG  J OP1   1 
ATOM   5015  O  OP2   . DG  B  1  100 ? 98.718  56.528 -29.904 1.00 90.31  ? 246  DG  J OP2   1 
ATOM   5016  O  "O5'" . DG  B  1  100 ? 98.048  54.458 -31.115 1.00 88.20  ? 246  DG  J "O5'" 1 
ATOM   5017  C  "C5'" . DG  B  1  100 ? 97.163  54.206 -30.040 1.00 85.82  ? 246  DG  J "C5'" 1 
ATOM   5018  C  "C4'" . DG  B  1  100 ? 97.374  52.809 -29.510 1.00 83.89  ? 246  DG  J "C4'" 1 
ATOM   5019  O  "O4'" . DG  B  1  100 ? 98.695  52.684 -28.917 1.00 84.11  ? 246  DG  J "O4'" 1 
ATOM   5020  C  "C3'" . DG  B  1  100 ? 96.384  52.451 -28.405 1.00 82.30  ? 246  DG  J "C3'" 1 
ATOM   5021  O  "O3'" . DG  B  1  100 ? 96.005  51.086 -28.523 1.00 78.89  ? 246  DG  J "O3'" 1 
ATOM   5022  C  "C2'" . DG  B  1  100 ? 97.192  52.645 -27.141 1.00 83.14  ? 246  DG  J "C2'" 1 
ATOM   5023  C  "C1'" . DG  B  1  100 ? 98.556  52.183 -27.595 1.00 84.14  ? 246  DG  J "C1'" 1 
ATOM   5024  N  N9    . DG  B  1  100 ? 99.647  52.697 -26.774 1.00 85.34  ? 246  DG  J N9    1 
ATOM   5025  C  C8    . DG  B  1  100 ? 99.963  54.011 -26.527 1.00 85.19  ? 246  DG  J C8    1 
ATOM   5026  N  N7    . DG  B  1  100 ? 100.976 54.149 -25.716 1.00 85.23  ? 246  DG  J N7    1 
ATOM   5027  C  C5    . DG  B  1  100 ? 101.356 52.848 -25.415 1.00 84.99  ? 246  DG  J C5    1 
ATOM   5028  C  C6    . DG  B  1  100 ? 102.396 52.361 -24.579 1.00 85.00  ? 246  DG  J C6    1 
ATOM   5029  O  O6    . DG  B  1  100 ? 103.212 53.000 -23.910 1.00 86.22  ? 246  DG  J O6    1 
ATOM   5030  N  N1    . DG  B  1  100 ? 102.432 50.971 -24.567 1.00 84.31  ? 246  DG  J N1    1 
ATOM   5031  C  C2    . DG  B  1  100 ? 101.580 50.153 -25.266 1.00 84.54  ? 246  DG  J C2    1 
ATOM   5032  N  N2    . DG  B  1  100 ? 101.784 48.834 -25.136 1.00 82.67  ? 246  DG  J N2    1 
ATOM   5033  N  N3    . DG  B  1  100 ? 100.602 50.593 -26.040 1.00 84.57  ? 246  DG  J N3    1 
ATOM   5034  C  C4    . DG  B  1  100 ? 100.550 51.941 -26.068 1.00 85.19  ? 246  DG  J C4    1 
ATOM   5035  P  P     . DC  B  1  101 ? 94.502  50.720 -28.924 1.00 75.49  ? 247  DC  J P     1 
ATOM   5036  O  OP1   . DC  B  1  101 ? 94.343  51.120 -30.342 1.00 76.31  ? 247  DC  J OP1   1 
ATOM   5037  O  OP2   . DC  B  1  101 ? 93.576  51.257 -27.902 1.00 75.40  ? 247  DC  J OP2   1 
ATOM   5038  O  "O5'" . DC  B  1  101 ? 94.484  49.136 -28.835 1.00 75.68  ? 247  DC  J "O5'" 1 
ATOM   5039  C  "C5'" . DC  B  1  101 ? 95.492  48.368 -29.473 1.00 76.52  ? 247  DC  J "C5'" 1 
ATOM   5040  C  "C4'" . DC  B  1  101 ? 96.018  47.322 -28.521 1.00 77.79  ? 247  DC  J "C4'" 1 
ATOM   5041  O  "O4'" . DC  B  1  101 ? 96.926  47.914 -27.560 1.00 77.87  ? 247  DC  J "O4'" 1 
ATOM   5042  C  "C3'" . DC  B  1  101 ? 94.926  46.632 -27.707 1.00 78.07  ? 247  DC  J "C3'" 1 
ATOM   5043  O  "O3'" . DC  B  1  101 ? 95.184  45.229 -27.655 1.00 78.24  ? 247  DC  J "O3'" 1 
ATOM   5044  C  "C2'" . DC  B  1  101 ? 95.028  47.286 -26.337 1.00 77.36  ? 247  DC  J "C2'" 1 
ATOM   5045  C  "C1'" . DC  B  1  101 ? 96.510  47.606 -26.236 1.00 77.96  ? 247  DC  J "C1'" 1 
ATOM   5046  N  N1    . DC  B  1  101 ? 96.857  48.757 -25.380 1.00 78.02  ? 247  DC  J N1    1 
ATOM   5047  C  C2    . DC  B  1  101 ? 97.998  48.676 -24.559 1.00 78.03  ? 247  DC  J C2    1 
ATOM   5048  O  O2    . DC  B  1  101 ? 98.646  47.616 -24.526 1.00 77.40  ? 247  DC  J O2    1 
ATOM   5049  N  N3    . DC  B  1  101 ? 98.360  49.753 -23.823 1.00 77.58  ? 247  DC  J N3    1 
ATOM   5050  C  C4    . DC  B  1  101 ? 97.630  50.870 -23.872 1.00 77.47  ? 247  DC  J C4    1 
ATOM   5051  N  N4    . DC  B  1  101 ? 98.042  51.917 -23.158 1.00 77.24  ? 247  DC  J N4    1 
ATOM   5052  C  C5    . DC  B  1  101 ? 96.446  50.964 -24.662 1.00 77.42  ? 247  DC  J C5    1 
ATOM   5053  C  C6    . DC  B  1  101 ? 96.101  49.896 -25.395 1.00 77.71  ? 247  DC  J C6    1 
ATOM   5054  P  P     . DA  B  1  102 ? 94.316  44.299 -26.684 1.00 78.56  ? 248  DA  J P     1 
ATOM   5055  O  OP1   . DA  B  1  102 ? 94.408  42.893 -27.155 1.00 77.57  ? 248  DA  J OP1   1 
ATOM   5056  O  OP2   . DA  B  1  102 ? 92.987  44.934 -26.500 1.00 77.74  ? 248  DA  J OP2   1 
ATOM   5057  O  "O5'" . DA  B  1  102 ? 95.104  44.410 -25.313 1.00 80.92  ? 248  DA  J "O5'" 1 
ATOM   5058  C  "C5'" . DA  B  1  102 ? 94.502  44.021 -24.100 1.00 84.33  ? 248  DA  J "C5'" 1 
ATOM   5059  C  "C4'" . DA  B  1  102 ? 95.495  44.166 -22.975 1.00 86.03  ? 248  DA  J "C4'" 1 
ATOM   5060  O  "O4'" . DA  B  1  102 ? 95.994  45.525 -22.935 1.00 85.37  ? 248  DA  J "O4'" 1 
ATOM   5061  C  "C3'" . DA  B  1  102 ? 94.876  43.901 -21.610 1.00 87.51  ? 248  DA  J "C3'" 1 
ATOM   5062  O  "O3'" . DA  B  1  102 ? 95.827  43.256 -20.779 1.00 90.89  ? 248  DA  J "O3'" 1 
ATOM   5063  C  "C2'" . DA  B  1  102 ? 94.575  45.289 -21.091 1.00 86.85  ? 248  DA  J "C2'" 1 
ATOM   5064  C  "C1'" . DA  B  1  102 ? 95.728  46.088 -21.661 1.00 86.01  ? 248  DA  J "C1'" 1 
ATOM   5065  N  N9    . DA  B  1  102 ? 95.407  47.500 -21.842 1.00 85.39  ? 248  DA  J N9    1 
ATOM   5066  C  C8    . DA  B  1  102 ? 94.379  48.049 -22.566 1.00 84.99  ? 248  DA  J C8    1 
ATOM   5067  N  N7    . DA  B  1  102 ? 94.321  49.355 -22.492 1.00 85.31  ? 248  DA  J N7    1 
ATOM   5068  C  C5    . DA  B  1  102 ? 95.389  49.690 -21.672 1.00 85.70  ? 248  DA  J C5    1 
ATOM   5069  C  C6    . DA  B  1  102 ? 95.869  50.922 -21.200 1.00 85.32  ? 248  DA  J C6    1 
ATOM   5070  N  N6    . DA  B  1  102 ? 95.305  52.097 -21.492 1.00 85.30  ? 248  DA  J N6    1 
ATOM   5071  N  N1    . DA  B  1  102 ? 96.962  50.906 -20.406 1.00 85.05  ? 248  DA  J N1    1 
ATOM   5072  C  C2    . DA  B  1  102 ? 97.525  49.727 -20.113 1.00 84.34  ? 248  DA  J C2    1 
ATOM   5073  N  N3    . DA  B  1  102 ? 97.164  48.505 -20.491 1.00 84.75  ? 248  DA  J N3    1 
ATOM   5074  C  C4    . DA  B  1  102 ? 96.076  48.557 -21.277 1.00 85.42  ? 248  DA  J C4    1 
ATOM   5075  P  P     . DG  B  1  103 ? 95.437  41.881 -20.069 1.00 93.12  ? 249  DG  J P     1 
ATOM   5076  O  OP1   . DG  B  1  103 ? 96.066  40.789 -20.856 1.00 93.09  ? 249  DG  J OP1   1 
ATOM   5077  O  OP2   . DG  B  1  103 ? 93.968  41.880 -19.849 1.00 92.54  ? 249  DG  J OP2   1 
ATOM   5078  O  "O5'" . DG  B  1  103 ? 96.159  41.984 -18.657 1.00 94.72  ? 249  DG  J "O5'" 1 
ATOM   5079  C  "C5'" . DG  B  1  103 ? 97.573  42.123 -18.564 1.00 96.79  ? 249  DG  J "C5'" 1 
ATOM   5080  C  "C4'" . DG  B  1  103 ? 97.927  42.866 -17.300 1.00 98.10  ? 249  DG  J "C4'" 1 
ATOM   5081  O  "O4'" . DG  B  1  103 ? 97.743  44.290 -17.488 1.00 97.94  ? 249  DG  J "O4'" 1 
ATOM   5082  C  "C3'" . DG  B  1  103 ? 97.040  42.477 -16.119 1.00 99.19  ? 249  DG  J "C3'" 1 
ATOM   5083  O  "O3'" . DG  B  1  103 ? 97.806  42.407 -14.919 1.00 101.32 ? 249  DG  J "O3'" 1 
ATOM   5084  C  "C2'" . DG  B  1  103 ? 96.028  43.606 -16.050 1.00 98.53  ? 249  DG  J "C2'" 1 
ATOM   5085  C  "C1'" . DG  B  1  103 ? 96.845  44.797 -16.512 1.00 98.46  ? 249  DG  J "C1'" 1 
ATOM   5086  N  N9    . DG  B  1  103 ? 96.062  45.860 -17.134 1.00 98.78  ? 249  DG  J N9    1 
ATOM   5087  C  C8    . DG  B  1  103 ? 95.054  45.712 -18.054 1.00 99.08  ? 249  DG  J C8    1 
ATOM   5088  N  N7    . DG  B  1  103 ? 94.546  46.849 -18.446 1.00 98.82  ? 249  DG  J N7    1 
ATOM   5089  C  C5    . DG  B  1  103 ? 95.260  47.806 -17.740 1.00 99.13  ? 249  DG  J C5    1 
ATOM   5090  C  C6    . DG  B  1  103 ? 95.157  49.219 -17.750 1.00 99.13  ? 249  DG  J C6    1 
ATOM   5091  O  O6    . DG  B  1  103 ? 94.395  49.931 -18.410 1.00 99.56  ? 249  DG  J O6    1 
ATOM   5092  N  N1    . DG  B  1  103 ? 96.070  49.804 -16.878 1.00 99.21  ? 249  DG  J N1    1 
ATOM   5093  C  C2    . DG  B  1  103 ? 96.967  49.118 -16.098 1.00 99.33  ? 249  DG  J C2    1 
ATOM   5094  N  N2    . DG  B  1  103 ? 97.766  49.863 -15.320 1.00 99.70  ? 249  DG  J N2    1 
ATOM   5095  N  N3    . DG  B  1  103 ? 97.074  47.800 -16.081 1.00 98.99  ? 249  DG  J N3    1 
ATOM   5096  C  C4    . DG  B  1  103 ? 96.196  47.212 -16.921 1.00 99.09  ? 249  DG  J C4    1 
ATOM   5097  P  P     . DT  B  1  104 ? 97.051  42.295 -13.510 1.00 102.80 ? 250  DT  J P     1 
ATOM   5098  O  OP1   . DT  B  1  104 ? 97.987  41.648 -12.556 1.00 103.72 ? 250  DT  J OP1   1 
ATOM   5099  O  OP2   . DT  B  1  104 ? 95.706  41.706 -13.735 1.00 103.31 ? 250  DT  J OP2   1 
ATOM   5100  O  "O5'" . DT  B  1  104 ? 96.869  43.813 -13.081 1.00 103.97 ? 250  DT  J "O5'" 1 
ATOM   5101  C  "C5'" . DT  B  1  104 ? 98.004  44.606 -12.757 1.00 106.05 ? 250  DT  J "C5'" 1 
ATOM   5102  C  "C4'" . DT  B  1  104 ? 97.618  45.664 -11.755 1.00 107.63 ? 250  DT  J "C4'" 1 
ATOM   5103  O  "O4'" . DT  B  1  104 ? 97.013  46.793 -12.429 1.00 107.23 ? 250  DT  J "O4'" 1 
ATOM   5104  C  "C3'" . DT  B  1  104 ? 96.599  45.177 -10.728 1.00 109.32 ? 250  DT  J "C3'" 1 
ATOM   5105  O  "O3'" . DT  B  1  104 ? 96.943  45.656 -9.430  1.00 112.67 ? 250  DT  J "O3'" 1 
ATOM   5106  C  "C2'" . DT  B  1  104 ? 95.291  45.782 -11.208 1.00 108.24 ? 250  DT  J "C2'" 1 
ATOM   5107  C  "C1'" . DT  B  1  104 ? 95.746  47.076 -11.858 1.00 106.94 ? 250  DT  J "C1'" 1 
ATOM   5108  N  N1    . DT  B  1  104 ? 94.870  47.578 -12.934 1.00 105.88 ? 250  DT  J N1    1 
ATOM   5109  C  C2    . DT  B  1  104 ? 94.723  48.942 -13.061 1.00 105.42 ? 250  DT  J C2    1 
ATOM   5110  O  O2    . DT  B  1  104 ? 95.271  49.743 -12.323 1.00 104.87 ? 250  DT  J O2    1 
ATOM   5111  N  N3    . DT  B  1  104 ? 93.905  49.336 -14.089 1.00 104.84 ? 250  DT  J N3    1 
ATOM   5112  C  C4    . DT  B  1  104 ? 93.233  48.525 -14.980 1.00 104.76 ? 250  DT  J C4    1 
ATOM   5113  O  O4    . DT  B  1  104 ? 92.537  49.026 -15.857 1.00 104.60 ? 250  DT  J O4    1 
ATOM   5114  C  C5    . DT  B  1  104 ? 93.425  47.105 -14.784 1.00 104.89 ? 250  DT  J C5    1 
ATOM   5115  C  C7    . DT  B  1  104 ? 92.730  46.146 -15.697 1.00 104.98 ? 250  DT  J C7    1 
ATOM   5116  C  C6    . DT  B  1  104 ? 94.224  46.708 -13.785 1.00 105.45 ? 250  DT  J C6    1 
ATOM   5117  P  P     . DT  B  1  105 ? 96.005  45.303 -8.178  1.00 115.26 ? 251  DT  J P     1 
ATOM   5118  O  OP1   . DT  B  1  105 ? 96.875  44.822 -7.073  1.00 115.54 ? 251  DT  J OP1   1 
ATOM   5119  O  OP2   . DT  B  1  105 ? 94.892  44.444 -8.661  1.00 114.93 ? 251  DT  J OP2   1 
ATOM   5120  O  "O5'" . DT  B  1  105 ? 95.412  46.727 -7.782  1.00 115.54 ? 251  DT  J "O5'" 1 
ATOM   5121  C  "C5'" . DT  B  1  105 ? 96.265  47.867 -7.724  1.00 116.22 ? 251  DT  J "C5'" 1 
ATOM   5122  C  "C4'" . DT  B  1  105 ? 95.450  49.126 -7.549  1.00 117.02 ? 251  DT  J "C4'" 1 
ATOM   5123  O  "O4'" . DT  B  1  105 ? 94.794  49.485 -8.790  1.00 117.12 ? 251  DT  J "O4'" 1 
ATOM   5124  C  "C3'" . DT  B  1  105 ? 94.346  49.023 -6.496  1.00 117.92 ? 251  DT  J "C3'" 1 
ATOM   5125  O  "O3'" . DT  B  1  105 ? 94.301  50.230 -5.732  1.00 119.16 ? 251  DT  J "O3'" 1 
ATOM   5126  C  "C2'" . DT  B  1  105 ? 93.084  48.872 -7.326  1.00 117.37 ? 251  DT  J "C2'" 1 
ATOM   5127  C  "C1'" . DT  B  1  105 ? 93.416  49.713 -8.543  1.00 117.06 ? 251  DT  J "C1'" 1 
ATOM   5128  N  N1    . DT  B  1  105 ? 92.662  49.373 -9.766  1.00 116.77 ? 251  DT  J N1    1 
ATOM   5129  C  C2    . DT  B  1  105 ? 92.265  50.407 -10.587 1.00 116.76 ? 251  DT  J C2    1 
ATOM   5130  O  O2    . DT  B  1  105 ? 92.520  51.579 -10.358 1.00 116.73 ? 251  DT  J O2    1 
ATOM   5131  N  N3    . DT  B  1  105 ? 91.554  50.017 -11.695 1.00 116.41 ? 251  DT  J N3    1 
ATOM   5132  C  C4    . DT  B  1  105 ? 91.211  48.729 -12.055 1.00 116.15 ? 251  DT  J C4    1 
ATOM   5133  O  O4    . DT  B  1  105 ? 90.564  48.535 -13.080 1.00 115.75 ? 251  DT  J O4    1 
ATOM   5134  C  C5    . DT  B  1  105 ? 91.665  47.694 -11.153 1.00 116.23 ? 251  DT  J C5    1 
ATOM   5135  C  C7    . DT  B  1  105 ? 91.343  46.267 -11.465 1.00 116.11 ? 251  DT  J C7    1 
ATOM   5136  C  C6    . DT  B  1  105 ? 92.360  48.063 -10.069 1.00 116.39 ? 251  DT  J C6    1 
ATOM   5137  P  P     . DT  B  1  106 ? 93.214  50.395 -4.562  1.00 119.77 ? 252  DT  J P     1 
ATOM   5138  O  OP1   . DT  B  1  106 ? 93.930  50.797 -3.323  1.00 119.81 ? 252  DT  J OP1   1 
ATOM   5139  O  OP2   . DT  B  1  106 ? 92.353  49.182 -4.553  1.00 119.26 ? 252  DT  J OP2   1 
ATOM   5140  O  "O5'" . DT  B  1  106 ? 92.340  51.629 -5.059  1.00 119.30 ? 252  DT  J "O5'" 1 
ATOM   5141  C  "C5'" . DT  B  1  106 ? 92.969  52.780 -5.620  1.00 118.54 ? 252  DT  J "C5'" 1 
ATOM   5142  C  "C4'" . DT  B  1  106 ? 91.932  53.726 -6.177  1.00 118.43 ? 252  DT  J "C4'" 1 
ATOM   5143  O  "O4'" . DT  B  1  106 ? 91.356  53.188 -7.394  1.00 117.83 ? 252  DT  J "O4'" 1 
ATOM   5144  C  "C3'" . DT  B  1  106 ? 90.762  53.998 -5.233  1.00 118.37 ? 252  DT  J "C3'" 1 
ATOM   5145  O  "O3'" . DT  B  1  106 ? 90.407  55.380 -5.280  1.00 118.61 ? 252  DT  J "O3'" 1 
ATOM   5146  C  "C2'" . DT  B  1  106 ? 89.645  53.138 -5.799  1.00 118.11 ? 252  DT  J "C2'" 1 
ATOM   5147  C  "C1'" . DT  B  1  106 ? 89.941  53.170 -7.288  1.00 117.68 ? 252  DT  J "C1'" 1 
ATOM   5148  N  N1    . DT  B  1  106 ? 89.437  52.006 -8.046  1.00 117.24 ? 252  DT  J N1    1 
ATOM   5149  C  C2    . DT  B  1  106 ? 88.691  52.247 -9.178  1.00 117.01 ? 252  DT  J C2    1 
ATOM   5150  O  O2    . DT  B  1  106 ? 88.430  53.370 -9.576  1.00 117.10 ? 252  DT  J O2    1 
ATOM   5151  N  N3    . DT  B  1  106 ? 88.258  51.118 -9.829  1.00 116.75 ? 252  DT  J N3    1 
ATOM   5152  C  C4    . DT  B  1  106 ? 88.490  49.805 -9.469  1.00 116.54 ? 252  DT  J C4    1 
ATOM   5153  O  O4    . DT  B  1  106 ? 88.036  48.892 -10.153 1.00 116.14 ? 252  DT  J O4    1 
ATOM   5154  C  C5    . DT  B  1  106 ? 89.278  49.625 -8.273  1.00 116.64 ? 252  DT  J C5    1 
ATOM   5155  C  C7    . DT  B  1  106 ? 89.579  48.236 -7.806  1.00 116.60 ? 252  DT  J C7    1 
ATOM   5156  C  C6    . DT  B  1  106 ? 89.707  50.720 -7.629  1.00 117.01 ? 252  DT  J C6    1 
ATOM   5157  P  P     . DC  B  1  107 ? 89.437  55.987 -4.156  1.00 118.74 ? 253  DC  J P     1 
ATOM   5158  O  OP1   . DC  B  1  107 ? 89.749  57.434 -4.036  1.00 118.59 ? 253  DC  J OP1   1 
ATOM   5159  O  OP2   . DC  B  1  107 ? 89.510  55.115 -2.953  1.00 118.72 ? 253  DC  J OP2   1 
ATOM   5160  O  "O5'" . DC  B  1  107 ? 87.984  55.842 -4.792  1.00 118.41 ? 253  DC  J "O5'" 1 
ATOM   5161  C  "C5'" . DC  B  1  107 ? 87.536  56.742 -5.804  1.00 117.16 ? 253  DC  J "C5'" 1 
ATOM   5162  C  "C4'" . DC  B  1  107 ? 86.081  56.488 -6.124  1.00 116.43 ? 253  DC  J "C4'" 1 
ATOM   5163  O  "O4'" . DC  B  1  107 ? 85.938  55.242 -6.848  1.00 115.89 ? 253  DC  J "O4'" 1 
ATOM   5164  C  "C3'" . DC  B  1  107 ? 85.163  56.375 -4.904  1.00 115.96 ? 253  DC  J "C3'" 1 
ATOM   5165  O  "O3'" . DC  B  1  107 ? 83.892  56.950 -5.216  1.00 115.50 ? 253  DC  J "O3'" 1 
ATOM   5166  C  "C2'" . DC  B  1  107 ? 84.999  54.875 -4.739  1.00 115.32 ? 253  DC  J "C2'" 1 
ATOM   5167  C  "C1'" . DC  B  1  107 ? 84.984  54.426 -6.189  1.00 114.97 ? 253  DC  J "C1'" 1 
ATOM   5168  N  N1    . DC  B  1  107 ? 85.339  53.022 -6.436  1.00 113.75 ? 253  DC  J N1    1 
ATOM   5169  C  C2    . DC  B  1  107 ? 84.685  52.347 -7.465  1.00 113.00 ? 253  DC  J C2    1 
ATOM   5170  O  O2    . DC  B  1  107 ? 83.831  52.954 -8.126  1.00 112.56 ? 253  DC  J O2    1 
ATOM   5171  N  N3    . DC  B  1  107 ? 84.998  51.056 -7.715  1.00 112.51 ? 253  DC  J N3    1 
ATOM   5172  C  C4    . DC  B  1  107 ? 85.923  50.440 -6.978  1.00 112.90 ? 253  DC  J C4    1 
ATOM   5173  N  N4    . DC  B  1  107 ? 86.201  49.165 -7.261  1.00 112.55 ? 253  DC  J N4    1 
ATOM   5174  C  C5    . DC  B  1  107 ? 86.606  51.105 -5.917  1.00 113.00 ? 253  DC  J C5    1 
ATOM   5175  C  C6    . DC  B  1  107 ? 86.285  52.384 -5.683  1.00 113.36 ? 253  DC  J C6    1 
ATOM   5176  P  P     . DC  B  1  108 ? 83.480  58.371 -4.593  1.00 115.14 ? 254  DC  J P     1 
ATOM   5177  O  OP1   . DC  B  1  108 ? 84.613  59.307 -4.818  1.00 114.50 ? 254  DC  J OP1   1 
ATOM   5178  O  OP2   . DC  B  1  108 ? 82.963  58.157 -3.217  1.00 114.72 ? 254  DC  J OP2   1 
ATOM   5179  O  "O5'" . DC  B  1  108 ? 82.273  58.838 -5.519  1.00 114.44 ? 254  DC  J "O5'" 1 
ATOM   5180  C  "C5'" . DC  B  1  108 ? 82.506  59.242 -6.867  1.00 112.78 ? 254  DC  J "C5'" 1 
ATOM   5181  C  "C4'" . DC  B  1  108 ? 81.464  58.643 -7.784  1.00 111.77 ? 254  DC  J "C4'" 1 
ATOM   5182  O  "O4'" . DC  B  1  108 ? 81.678  57.219 -7.938  1.00 111.44 ? 254  DC  J "O4'" 1 
ATOM   5183  C  "C3'" . DC  B  1  108 ? 80.017  58.803 -7.314  1.00 111.28 ? 254  DC  J "C3'" 1 
ATOM   5184  O  "O3'" . DC  B  1  108 ? 79.184  59.019 -8.452  1.00 110.78 ? 254  DC  J "O3'" 1 
ATOM   5185  C  "C2'" . DC  B  1  108 ? 79.697  57.439 -6.732  1.00 111.12 ? 254  DC  J "C2'" 1 
ATOM   5186  C  "C1'" . DC  B  1  108 ? 80.457  56.544 -7.689  1.00 111.24 ? 254  DC  J "C1'" 1 
ATOM   5187  N  N1    . DC  B  1  108 ? 80.766  55.194 -7.198  1.00 110.97 ? 254  DC  J N1    1 
ATOM   5188  C  C2    . DC  B  1  108 ? 80.467  54.106 -8.017  1.00 111.18 ? 254  DC  J C2    1 
ATOM   5189  O  O2    . DC  B  1  108 ? 79.960  54.318 -9.130  1.00 111.44 ? 254  DC  J O2    1 
ATOM   5190  N  N3    . DC  B  1  108 ? 80.737  52.855 -7.583  1.00 110.95 ? 254  DC  J N3    1 
ATOM   5191  C  C4    . DC  B  1  108 ? 81.288  52.672 -6.383  1.00 110.86 ? 254  DC  J C4    1 
ATOM   5192  N  N4    . DC  B  1  108 ? 81.539  51.420 -5.995  1.00 110.53 ? 254  DC  J N4    1 
ATOM   5193  C  C5    . DC  B  1  108 ? 81.607  53.765 -5.527  1.00 111.04 ? 254  DC  J C5    1 
ATOM   5194  C  C6    . DC  B  1  108 ? 81.331  54.999 -5.970  1.00 111.03 ? 254  DC  J C6    1 
ATOM   5195  P  P     . DA  B  1  109 ? 78.160  60.253 -8.472  1.00 110.10 ? 255  DA  J P     1 
ATOM   5196  O  OP1   . DA  B  1  109 ? 78.972  61.496 -8.442  1.00 110.46 ? 255  DA  J OP1   1 
ATOM   5197  O  OP2   . DA  B  1  109 ? 77.119  60.027 -7.437  1.00 109.92 ? 255  DA  J OP2   1 
ATOM   5198  O  "O5'" . DA  B  1  109 ? 77.482  60.132 -9.906  1.00 109.32 ? 255  DA  J "O5'" 1 
ATOM   5199  C  "C5'" . DA  B  1  109 ? 78.279  59.912 -11.069 1.00 107.68 ? 255  DA  J "C5'" 1 
ATOM   5200  C  "C4'" . DA  B  1  109 ? 77.750  58.735 -11.855 1.00 105.96 ? 255  DA  J "C4'" 1 
ATOM   5201  O  "O4'" . DA  B  1  109 ? 77.905  57.520 -11.081 1.00 105.44 ? 255  DA  J "O4'" 1 
ATOM   5202  C  "C3'" . DA  B  1  109 ? 76.269  58.821 -12.211 1.00 105.11 ? 255  DA  J "C3'" 1 
ATOM   5203  O  "O3'" . DA  B  1  109 ? 76.060  58.286 -13.519 1.00 104.11 ? 255  DA  J "O3'" 1 
ATOM   5204  C  "C2'" . DA  B  1  109 ? 75.599  57.963 -11.153 1.00 105.08 ? 255  DA  J "C2'" 1 
ATOM   5205  C  "C1'" . DA  B  1  109 ? 76.645  56.900 -10.868 1.00 105.06 ? 255  DA  J "C1'" 1 
ATOM   5206  N  N9    . DA  B  1  109 ? 76.627  56.401 -9.494  1.00 105.16 ? 255  DA  J N9    1 
ATOM   5207  C  C8    . DA  B  1  109 ? 76.378  57.112 -8.348  1.00 105.42 ? 255  DA  J C8    1 
ATOM   5208  N  N7    . DA  B  1  109 ? 76.457  56.396 -7.252  1.00 105.97 ? 255  DA  J N7    1 
ATOM   5209  C  C5    . DA  B  1  109 ? 76.778  55.126 -7.707  1.00 105.90 ? 255  DA  J C5    1 
ATOM   5210  C  C6    . DA  B  1  109 ? 77.009  53.911 -7.038  1.00 105.98 ? 255  DA  J C6    1 
ATOM   5211  N  N6    . DA  B  1  109 ? 76.960  53.774 -5.712  1.00 106.06 ? 255  DA  J N6    1 
ATOM   5212  N  N1    . DA  B  1  109 ? 77.298  52.826 -7.787  1.00 105.99 ? 255  DA  J N1    1 
ATOM   5213  C  C2    . DA  B  1  109 ? 77.353  52.964 -9.117  1.00 106.08 ? 255  DA  J C2    1 
ATOM   5214  N  N3    . DA  B  1  109 ? 77.162  54.052 -9.861  1.00 105.94 ? 255  DA  J N3    1 
ATOM   5215  C  C4    . DA  B  1  109 ? 76.875  55.111 -9.087  1.00 105.77 ? 255  DA  J C4    1 
ATOM   5216  P  P     . DA  B  1  110 ? 74.576  58.225 -14.127 1.00 103.64 ? 256  DA  J P     1 
ATOM   5217  O  OP1   . DA  B  1  110 ? 74.678  58.413 -15.597 1.00 103.57 ? 256  DA  J OP1   1 
ATOM   5218  O  OP2   . DA  B  1  110 ? 73.714  59.135 -13.327 1.00 103.82 ? 256  DA  J OP2   1 
ATOM   5219  O  "O5'" . DA  B  1  110 ? 74.123  56.727 -13.832 1.00 102.01 ? 256  DA  J "O5'" 1 
ATOM   5220  C  "C5'" . DA  B  1  110 ? 74.901  55.632 -14.307 1.00 99.54  ? 256  DA  J "C5'" 1 
ATOM   5221  C  "C4'" . DA  B  1  110 ? 74.303  54.323 -13.849 1.00 97.96  ? 256  DA  J "C4'" 1 
ATOM   5222  O  "O4'" . DA  B  1  110 ? 74.559  54.101 -12.440 1.00 97.73  ? 256  DA  J "O4'" 1 
ATOM   5223  C  "C3'" . DA  B  1  110 ? 72.788  54.199 -14.029 1.00 96.66  ? 256  DA  J "C3'" 1 
ATOM   5224  O  "O3'" . DA  B  1  110 ? 72.479  52.865 -14.422 1.00 94.85  ? 256  DA  J "O3'" 1 
ATOM   5225  C  "C2'" . DA  B  1  110 ? 72.260  54.416 -12.623 1.00 96.98  ? 256  DA  J "C2'" 1 
ATOM   5226  C  "C1'" . DA  B  1  110 ? 73.342  53.730 -11.815 1.00 97.68  ? 256  DA  J "C1'" 1 
ATOM   5227  N  N9    . DA  B  1  110 ? 73.410  54.099 -10.402 1.00 97.89  ? 256  DA  J N9    1 
ATOM   5228  C  C8    . DA  B  1  110 ? 73.209  55.327 -9.823  1.00 98.10  ? 256  DA  J C8    1 
ATOM   5229  N  N7    . DA  B  1  110 ? 73.328  55.321 -8.517  1.00 98.10  ? 256  DA  J N7    1 
ATOM   5230  C  C5    . DA  B  1  110 ? 73.631  54.001 -8.217  1.00 98.12  ? 256  DA  J C5    1 
ATOM   5231  C  C6    . DA  B  1  110 ? 73.883  53.341 -7.002  1.00 98.24  ? 256  DA  J C6    1 
ATOM   5232  N  N6    . DA  B  1  110 ? 73.864  53.945 -5.812  1.00 98.29  ? 256  DA  J N6    1 
ATOM   5233  N  N1    . DA  B  1  110 ? 74.161  52.020 -7.052  1.00 98.23  ? 256  DA  J N1    1 
ATOM   5234  C  C2    . DA  B  1  110 ? 74.181  51.415 -8.246  1.00 97.79  ? 256  DA  J C2    1 
ATOM   5235  N  N3    . DA  B  1  110 ? 73.959  51.926 -9.453  1.00 97.56  ? 256  DA  J N3    1 
ATOM   5236  C  C4    . DA  B  1  110 ? 73.688  53.239 -9.368  1.00 97.78  ? 256  DA  J C4    1 
ATOM   5237  P  P     . DA  B  1  111 ? 71.212  52.577 -15.359 1.00 93.38  ? 257  DA  J P     1 
ATOM   5238  O  OP1   . DA  B  1  111 ? 71.573  52.941 -16.751 1.00 92.97  ? 257  DA  J OP1   1 
ATOM   5239  O  OP2   . DA  B  1  111 ? 70.015  53.181 -14.725 1.00 92.21  ? 257  DA  J OP2   1 
ATOM   5240  O  "O5'" . DA  B  1  111 ? 71.073  50.998 -15.281 1.00 93.72  ? 257  DA  J "O5'" 1 
ATOM   5241  C  "C5'" . DA  B  1  111 ? 72.232  50.171 -15.336 1.00 95.45  ? 257  DA  J "C5'" 1 
ATOM   5242  C  "C4'" . DA  B  1  111 ? 72.108  49.042 -14.342 1.00 96.45  ? 257  DA  J "C4'" 1 
ATOM   5243  O  "O4'" . DA  B  1  111 ? 72.338  49.525 -12.995 1.00 96.76  ? 257  DA  J "O4'" 1 
ATOM   5244  C  "C3'" . DA  B  1  111 ? 70.721  48.405 -14.334 1.00 96.66  ? 257  DA  J "C3'" 1 
ATOM   5245  O  "O3'" . DA  B  1  111 ? 70.819  46.990 -14.211 1.00 98.21  ? 257  DA  J "O3'" 1 
ATOM   5246  C  "C2'" . DA  B  1  111 ? 70.069  48.994 -13.098 1.00 96.96  ? 257  DA  J "C2'" 1 
ATOM   5247  C  "C1'" . DA  B  1  111 ? 71.251  49.150 -12.164 1.00 97.20  ? 257  DA  J "C1'" 1 
ATOM   5248  N  N9    . DA  B  1  111 ? 71.075  50.186 -11.146 1.00 98.14  ? 257  DA  J N9    1 
ATOM   5249  C  C8    . DA  B  1  111 ? 70.761  51.508 -11.337 1.00 98.75  ? 257  DA  J C8    1 
ATOM   5250  N  N7    . DA  B  1  111 ? 70.652  52.193 -10.224 1.00 98.70  ? 257  DA  J N7    1 
ATOM   5251  C  C5    . DA  B  1  111 ? 70.916  51.260 -9.232  1.00 98.58  ? 257  DA  J C5    1 
ATOM   5252  C  C6    . DA  B  1  111 ? 70.954  51.356 -7.831  1.00 98.12  ? 257  DA  J C6    1 
ATOM   5253  N  N6    . DA  B  1  111 ? 70.718  52.486 -7.163  1.00 98.16  ? 257  DA  J N6    1 
ATOM   5254  N  N1    . DA  B  1  111 ? 71.248  50.239 -7.131  1.00 97.55  ? 257  DA  J N1    1 
ATOM   5255  C  C2    . DA  B  1  111 ? 71.486  49.107 -7.805  1.00 97.99  ? 257  DA  J C2    1 
ATOM   5256  N  N3    . DA  B  1  111 ? 71.478  48.890 -9.118  1.00 98.14  ? 257  DA  J N3    1 
ATOM   5257  C  C4    . DA  B  1  111 ? 71.182  50.020 -9.784  1.00 98.34  ? 257  DA  J C4    1 
ATOM   5258  P  P     . DT  B  1  112 ? 69.505  46.097 -14.409 1.00 99.74  ? 258  DT  J P     1 
ATOM   5259  O  OP1   . DT  B  1  112 ? 69.728  44.779 -13.763 1.00 99.58  ? 258  DT  J OP1   1 
ATOM   5260  O  OP2   . DT  B  1  112 ? 69.121  46.155 -15.841 1.00 99.74  ? 258  DT  J OP2   1 
ATOM   5261  O  "O5'" . DT  B  1  112 ? 68.416  46.900 -13.576 1.00 101.02 ? 258  DT  J "O5'" 1 
ATOM   5262  C  "C5'" . DT  B  1  112 ? 67.311  46.236 -12.993 1.00 104.16 ? 258  DT  J "C5'" 1 
ATOM   5263  C  "C4'" . DT  B  1  112 ? 67.763  45.451 -11.786 1.00 105.50 ? 258  DT  J "C4'" 1 
ATOM   5264  O  "O4'" . DT  B  1  112 ? 68.497  46.312 -10.884 1.00 105.53 ? 258  DT  J "O4'" 1 
ATOM   5265  C  "C3'" . DT  B  1  112 ? 66.604  44.876 -10.986 1.00 106.68 ? 258  DT  J "C3'" 1 
ATOM   5266  O  "O3'" . DT  B  1  112 ? 66.911  43.556 -10.561 1.00 108.87 ? 258  DT  J "O3'" 1 
ATOM   5267  C  "C2'" . DT  B  1  112 ? 66.446  45.837 -9.824  1.00 106.53 ? 258  DT  J "C2'" 1 
ATOM   5268  C  "C1'" . DT  B  1  112 ? 67.840  46.410 -9.630  1.00 105.80 ? 258  DT  J "C1'" 1 
ATOM   5269  N  N1    . DT  B  1  112 ? 67.816  47.835 -9.253  1.00 105.34 ? 258  DT  J N1    1 
ATOM   5270  C  C2    . DT  B  1  112 ? 68.280  48.200 -8.011  1.00 104.76 ? 258  DT  J C2    1 
ATOM   5271  O  O2    . DT  B  1  112 ? 68.716  47.399 -7.200  1.00 104.34 ? 258  DT  J O2    1 
ATOM   5272  N  N3    . DT  B  1  112 ? 68.214  49.546 -7.751  1.00 104.09 ? 258  DT  J N3    1 
ATOM   5273  C  C4    . DT  B  1  112 ? 67.741  50.537 -8.591  1.00 104.20 ? 258  DT  J C4    1 
ATOM   5274  O  O4    . DT  B  1  112 ? 67.745  51.707 -8.222  1.00 103.94 ? 258  DT  J O4    1 
ATOM   5275  C  C5    . DT  B  1  112 ? 67.271  50.082 -9.876  1.00 104.42 ? 258  DT  J C5    1 
ATOM   5276  C  C7    . DT  B  1  112 ? 66.739  51.084 -10.851 1.00 104.36 ? 258  DT  J C7    1 
ATOM   5277  C  C6    . DT  B  1  112 ? 67.332  48.772 -10.139 1.00 104.56 ? 258  DT  J C6    1 
ATOM   5278  P  P     . DA  B  1  113 ? 65.891  42.373 -10.908 1.00 111.01 ? 259  DA  J P     1 
ATOM   5279  O  OP1   . DA  B  1  113 ? 66.664  41.181 -11.346 1.00 110.70 ? 259  DA  J OP1   1 
ATOM   5280  O  OP2   . DA  B  1  113 ? 64.860  42.954 -11.805 1.00 110.23 ? 259  DA  J OP2   1 
ATOM   5281  O  "O5'" . DA  B  1  113 ? 65.202  42.052 -9.512  1.00 111.88 ? 259  DA  J "O5'" 1 
ATOM   5282  C  "C5'" . DA  B  1  113 ? 65.957  41.511 -8.435  1.00 112.53 ? 259  DA  J "C5'" 1 
ATOM   5283  C  "C4'" . DA  B  1  113 ? 65.176  41.632 -7.150  1.00 113.39 ? 259  DA  J "C4'" 1 
ATOM   5284  O  "O4'" . DA  B  1  113 ? 65.102  43.026 -6.767  1.00 113.16 ? 259  DA  J "O4'" 1 
ATOM   5285  C  "C3'" . DA  B  1  113 ? 63.734  41.144 -7.262  1.00 113.86 ? 259  DA  J "C3'" 1 
ATOM   5286  O  "O3'" . DA  B  1  113 ? 63.357  40.457 -6.069  1.00 115.34 ? 259  DA  J "O3'" 1 
ATOM   5287  C  "C2'" . DA  B  1  113 ? 62.936  42.422 -7.453  1.00 113.49 ? 259  DA  J "C2'" 1 
ATOM   5288  C  "C1'" . DA  B  1  113 ? 63.752  43.458 -6.697  1.00 112.98 ? 259  DA  J "C1'" 1 
ATOM   5289  N  N9    . DA  B  1  113 ? 63.694  44.800 -7.276  1.00 112.59 ? 259  DA  J N9    1 
ATOM   5290  C  C8    . DA  B  1  113 ? 63.522  45.132 -8.598  1.00 112.75 ? 259  DA  J C8    1 
ATOM   5291  N  N7    . DA  B  1  113 ? 63.542  46.423 -8.826  1.00 112.62 ? 259  DA  J N7    1 
ATOM   5292  C  C5    . DA  B  1  113 ? 63.736  46.982 -7.570  1.00 112.47 ? 259  DA  J C5    1 
ATOM   5293  C  C6    . DA  B  1  113 ? 63.850  48.316 -7.133  1.00 112.25 ? 259  DA  J C6    1 
ATOM   5294  N  N6    . DA  B  1  113 ? 63.793  49.370 -7.950  1.00 112.24 ? 259  DA  J N6    1 
ATOM   5295  N  N1    . DA  B  1  113 ? 64.027  48.531 -5.812  1.00 111.68 ? 259  DA  J N1    1 
ATOM   5296  C  C2    . DA  B  1  113 ? 64.087  47.473 -4.995  1.00 111.69 ? 259  DA  J C2    1 
ATOM   5297  N  N3    . DA  B  1  113 ? 63.998  46.175 -5.284  1.00 112.13 ? 259  DA  J N3    1 
ATOM   5298  C  C4    . DA  B  1  113 ? 63.821  45.994 -6.604  1.00 112.46 ? 259  DA  J C4    1 
ATOM   5299  P  P     . DC  B  1  114 ? 61.838  39.990 -5.870  1.00 116.51 ? 260  DC  J P     1 
ATOM   5300  O  OP1   . DC  B  1  114 ? 61.866  38.739 -5.070  1.00 116.87 ? 260  DC  J OP1   1 
ATOM   5301  O  OP2   . DC  B  1  114 ? 61.156  40.006 -7.189  1.00 116.42 ? 260  DC  J OP2   1 
ATOM   5302  O  "O5'" . DC  B  1  114 ? 61.230  41.150 -4.966  1.00 117.18 ? 260  DC  J "O5'" 1 
ATOM   5303  C  "C5'" . DC  B  1  114 ? 61.821  41.459 -3.707  1.00 118.40 ? 260  DC  J "C5'" 1 
ATOM   5304  C  "C4'" . DC  B  1  114 ? 61.010  42.510 -2.988  1.00 119.28 ? 260  DC  J "C4'" 1 
ATOM   5305  O  "O4'" . DC  B  1  114 ? 61.293  43.829 -3.516  1.00 119.07 ? 260  DC  J "O4'" 1 
ATOM   5306  C  "C3'" . DC  B  1  114 ? 59.495  42.322 -3.085  1.00 119.69 ? 260  DC  J "C3'" 1 
ATOM   5307  O  "O3'" . DC  B  1  114 ? 58.893  42.547 -1.810  1.00 120.36 ? 260  DC  J "O3'" 1 
ATOM   5308  C  "C2'" . DC  B  1  114 ? 59.067  43.401 -4.064  1.00 119.51 ? 260  DC  J "C2'" 1 
ATOM   5309  C  "C1'" . DC  B  1  114 ? 60.072  44.500 -3.771  1.00 119.57 ? 260  DC  J "C1'" 1 
ATOM   5310  N  N1    . DC  B  1  114 ? 60.292  45.462 -4.864  1.00 119.76 ? 260  DC  J N1    1 
ATOM   5311  C  C2    . DC  B  1  114 ? 60.515  46.806 -4.541  1.00 119.70 ? 260  DC  J C2    1 
ATOM   5312  O  O2    . DC  B  1  114 ? 60.543  47.140 -3.350  1.00 119.70 ? 260  DC  J O2    1 
ATOM   5313  N  N3    . DC  B  1  114 ? 60.693  47.705 -5.533  1.00 119.89 ? 260  DC  J N3    1 
ATOM   5314  C  C4    . DC  B  1  114 ? 60.657  47.307 -6.807  1.00 120.17 ? 260  DC  J C4    1 
ATOM   5315  N  N4    . DC  B  1  114 ? 60.829  48.233 -7.755  1.00 119.78 ? 260  DC  J N4    1 
ATOM   5316  C  C5    . DC  B  1  114 ? 60.444  45.944 -7.165  1.00 120.11 ? 260  DC  J C5    1 
ATOM   5317  C  C6    . DC  B  1  114 ? 60.270  45.062 -6.171  1.00 120.06 ? 260  DC  J C6    1 
ATOM   5318  P  P     . DA  B  1  115 ? 57.345  42.187 -1.587  1.00 120.83 ? 261  DA  J P     1 
ATOM   5319  O  OP1   . DA  B  1  115 ? 57.236  41.284 -0.415  1.00 121.06 ? 261  DA  J OP1   1 
ATOM   5320  O  OP2   . DA  B  1  115 ? 56.776  41.763 -2.893  1.00 120.87 ? 261  DA  J OP2   1 
ATOM   5321  O  "O5'" . DA  B  1  115 ? 56.708  43.590 -1.196  1.00 121.21 ? 261  DA  J "O5'" 1 
ATOM   5322  C  "C5'" . DA  B  1  115 ? 57.268  44.368 -0.144  1.00 121.75 ? 261  DA  J "C5'" 1 
ATOM   5323  C  "C4'" . DA  B  1  115 ? 56.683  45.759 -0.162  1.00 122.16 ? 261  DA  J "C4'" 1 
ATOM   5324  O  "O4'" . DA  B  1  115 ? 57.160  46.471 -1.330  1.00 122.09 ? 261  DA  J "O4'" 1 
ATOM   5325  C  "C3'" . DA  B  1  115 ? 55.159  45.795 -0.242  1.00 122.54 ? 261  DA  J "C3'" 1 
ATOM   5326  O  "O3'" . DA  B  1  115 ? 54.659  46.867 0.567   1.00 123.08 ? 261  DA  J "O3'" 1 
ATOM   5327  C  "C2'" . DA  B  1  115 ? 54.904  46.056 -1.716  1.00 122.35 ? 261  DA  J "C2'" 1 
ATOM   5328  C  "C1'" . DA  B  1  115 ? 56.057  46.974 -2.062  1.00 121.94 ? 261  DA  J "C1'" 1 
ATOM   5329  N  N9    . DA  B  1  115 ? 56.428  47.004 -3.476  1.00 121.48 ? 261  DA  J N9    1 
ATOM   5330  C  C8    . DA  B  1  115 ? 56.521  45.947 -4.344  1.00 121.32 ? 261  DA  J C8    1 
ATOM   5331  N  N7    . DA  B  1  115 ? 56.879  46.290 -5.557  1.00 121.40 ? 261  DA  J N7    1 
ATOM   5332  C  C5    . DA  B  1  115 ? 57.031  47.667 -5.484  1.00 121.38 ? 261  DA  J C5    1 
ATOM   5333  C  C6    . DA  B  1  115 ? 57.401  48.633 -6.441  1.00 121.51 ? 261  DA  J C6    1 
ATOM   5334  N  N6    . DA  B  1  115 ? 57.696  48.343 -7.711  1.00 121.21 ? 261  DA  J N6    1 
ATOM   5335  N  N1    . DA  B  1  115 ? 57.460  49.923 -6.044  1.00 121.30 ? 261  DA  J N1    1 
ATOM   5336  C  C2    . DA  B  1  115 ? 57.165  50.212 -4.771  1.00 121.28 ? 261  DA  J C2    1 
ATOM   5337  N  N3    . DA  B  1  115 ? 56.805  49.395 -3.780  1.00 121.38 ? 261  DA  J N3    1 
ATOM   5338  C  C4    . DA  B  1  115 ? 56.756  48.121 -4.208  1.00 121.37 ? 261  DA  J C4    1 
ATOM   5339  P  P     . DC  B  1  116 ? 53.217  46.734 1.264   1.00 123.78 ? 262  DC  J P     1 
ATOM   5340  O  OP1   . DC  B  1  116 ? 53.254  47.448 2.566   1.00 124.06 ? 262  DC  J OP1   1 
ATOM   5341  O  OP2   . DC  B  1  116 ? 52.831  45.300 1.221   1.00 123.46 ? 262  DC  J OP2   1 
ATOM   5342  O  "O5'" . DC  B  1  116 ? 52.256  47.537 0.284   1.00 123.96 ? 262  DC  J "O5'" 1 
ATOM   5343  C  "C5'" . DC  B  1  116 ? 52.674  47.824 -1.043  1.00 124.59 ? 262  DC  J "C5'" 1 
ATOM   5344  C  "C4'" . DC  B  1  116 ? 52.503  49.292 -1.341  1.00 124.80 ? 262  DC  J "C4'" 1 
ATOM   5345  O  "O4'" . DC  B  1  116 ? 53.269  49.625 -2.521  1.00 125.26 ? 262  DC  J "O4'" 1 
ATOM   5346  C  "C3'" . DC  B  1  116 ? 51.062  49.683 -1.645  1.00 124.73 ? 262  DC  J "C3'" 1 
ATOM   5347  O  "O3'" . DC  B  1  116 ? 50.793  50.993 -1.146  1.00 123.75 ? 262  DC  J "O3'" 1 
ATOM   5348  C  "C2'" . DC  B  1  116 ? 50.998  49.623 -3.160  1.00 125.27 ? 262  DC  J "C2'" 1 
ATOM   5349  C  "C1'" . DC  B  1  116 ? 52.411  49.994 -3.591  1.00 125.64 ? 262  DC  J "C1'" 1 
ATOM   5350  N  N1    . DC  B  1  116 ? 52.880  49.282 -4.791  1.00 126.15 ? 262  DC  J N1    1 
ATOM   5351  C  C2    . DC  B  1  116 ? 53.153  50.011 -5.952  1.00 126.56 ? 262  DC  J C2    1 
ATOM   5352  O  O2    . DC  B  1  116 ? 52.974  51.239 -5.945  1.00 126.44 ? 262  DC  J O2    1 
ATOM   5353  N  N3    . DC  B  1  116 ? 53.604  49.360 -7.050  1.00 126.96 ? 262  DC  J N3    1 
ATOM   5354  C  C4    . DC  B  1  116 ? 53.780  48.036 -7.016  1.00 127.02 ? 262  DC  J C4    1 
ATOM   5355  N  N4    . DC  B  1  116 ? 54.233  47.434 -8.119  1.00 126.83 ? 262  DC  J N4    1 
ATOM   5356  C  C5    . DC  B  1  116 ? 53.500  47.268 -5.849  1.00 126.87 ? 262  DC  J C5    1 
ATOM   5357  C  C6    . DC  B  1  116 ? 53.056  47.925 -4.770  1.00 126.53 ? 262  DC  J C6    1 
ATOM   5358  P  P     . DT  B  1  117 ? 49.287  51.546 -1.150  1.00 123.36 ? 263  DT  J P     1 
ATOM   5359  O  OP1   . DT  B  1  117 ? 49.244  52.702 -0.216  1.00 122.95 ? 263  DT  J OP1   1 
ATOM   5360  O  OP2   . DT  B  1  117 ? 48.359  50.402 -0.954  1.00 122.98 ? 263  DT  J OP2   1 
ATOM   5361  O  "O5'" . DT  B  1  117 ? 49.106  52.102 -2.629  1.00 122.36 ? 263  DT  J "O5'" 1 
ATOM   5362  C  "C5'" . DT  B  1  117 ? 49.881  53.209 -3.072  1.00 120.84 ? 263  DT  J "C5'" 1 
ATOM   5363  C  "C4'" . DT  B  1  117 ? 49.565  53.541 -4.511  1.00 119.42 ? 263  DT  J "C4'" 1 
ATOM   5364  O  "O4'" . DT  B  1  117 ? 50.222  52.622 -5.420  1.00 118.69 ? 263  DT  J "O4'" 1 
ATOM   5365  C  "C3'" . DT  B  1  117 ? 48.081  53.524 -4.876  1.00 118.69 ? 263  DT  J "C3'" 1 
ATOM   5366  O  "O3'" . DT  B  1  117 ? 47.785  54.674 -5.666  1.00 118.24 ? 263  DT  J "O3'" 1 
ATOM   5367  C  "C2'" . DT  B  1  117 ? 47.935  52.257 -5.702  1.00 118.29 ? 263  DT  J "C2'" 1 
ATOM   5368  C  "C1'" . DT  B  1  117 ? 49.286  52.181 -6.388  1.00 118.15 ? 263  DT  J "C1'" 1 
ATOM   5369  N  N1    . DT  B  1  117 ? 49.692  50.835 -6.845  1.00 117.50 ? 263  DT  J N1    1 
ATOM   5370  C  C2    . DT  B  1  117 ? 50.311  50.730 -8.073  1.00 117.15 ? 263  DT  J C2    1 
ATOM   5371  O  O2    . DT  B  1  117 ? 50.544  51.692 -8.790  1.00 116.76 ? 263  DT  J O2    1 
ATOM   5372  N  N3    . DT  B  1  117 ? 50.650  49.449 -8.434  1.00 116.60 ? 263  DT  J N3    1 
ATOM   5373  C  C4    . DT  B  1  117 ? 50.438  48.292 -7.709  1.00 116.39 ? 263  DT  J C4    1 
ATOM   5374  O  O4    . DT  B  1  117 ? 50.794  47.209 -8.166  1.00 115.84 ? 263  DT  J O4    1 
ATOM   5375  C  C5    . DT  B  1  117 ? 49.792  48.476 -6.430  1.00 116.45 ? 263  DT  J C5    1 
ATOM   5376  C  C7    . DT  B  1  117 ? 49.529  47.279 -5.571  1.00 116.11 ? 263  DT  J C7    1 
ATOM   5377  C  C6    . DT  B  1  117 ? 49.454  49.721 -6.067  1.00 116.97 ? 263  DT  J C6    1 
ATOM   5378  P  P     . DT  B  1  118 ? 46.291  54.917 -6.196  1.00 117.62 ? 264  DT  J P     1 
ATOM   5379  O  OP1   . DT  B  1  118 ? 45.931  56.326 -5.899  1.00 117.49 ? 264  DT  J OP1   1 
ATOM   5380  O  OP2   . DT  B  1  118 ? 45.417  53.819 -5.713  1.00 117.77 ? 264  DT  J OP2   1 
ATOM   5381  O  "O5'" . DT  B  1  118 ? 46.454  54.777 -7.770  1.00 118.30 ? 264  DT  J "O5'" 1 
ATOM   5382  C  "C5'" . DT  B  1  118 ? 47.459  55.513 -8.461  1.00 118.33 ? 264  DT  J "C5'" 1 
ATOM   5383  C  "C4'" . DT  B  1  118 ? 47.436  55.160 -9.928  1.00 118.40 ? 264  DT  J "C4'" 1 
ATOM   5384  O  "O4'" . DT  B  1  118 ? 47.985  53.835 -10.126 1.00 118.41 ? 264  DT  J "O4'" 1 
ATOM   5385  C  "C3'" . DT  B  1  118 ? 46.025  55.124 -10.512 1.00 118.79 ? 264  DT  J "C3'" 1 
ATOM   5386  O  "O3'" . DT  B  1  118 ? 46.054  55.597 -11.852 1.00 119.55 ? 264  DT  J "O3'" 1 
ATOM   5387  C  "C2'" . DT  B  1  118 ? 45.685  53.647 -10.500 1.00 118.68 ? 264  DT  J "C2'" 1 
ATOM   5388  C  "C1'" . DT  B  1  118 ? 47.034  53.019 -10.789 1.00 118.45 ? 264  DT  J "C1'" 1 
ATOM   5389  N  N1    . DT  B  1  118 ? 47.188  51.644 -10.290 1.00 118.60 ? 264  DT  J N1    1 
ATOM   5390  C  C2    . DT  B  1  118 ? 47.880  50.750 -11.071 1.00 118.67 ? 264  DT  J C2    1 
ATOM   5391  O  O2    . DT  B  1  118 ? 48.373  51.047 -12.146 1.00 118.65 ? 264  DT  J O2    1 
ATOM   5392  N  N3    . DT  B  1  118 ? 47.974  49.487 -10.546 1.00 118.62 ? 264  DT  J N3    1 
ATOM   5393  C  C4    . DT  B  1  118 ? 47.459  49.041 -9.345  1.00 118.63 ? 264  DT  J C4    1 
ATOM   5394  O  O4    . DT  B  1  118 ? 47.620  47.873 -9.007  1.00 118.75 ? 264  DT  J O4    1 
ATOM   5395  C  C5    . DT  B  1  118 ? 46.751  50.032 -8.573  1.00 118.79 ? 264  DT  J C5    1 
ATOM   5396  C  C7    . DT  B  1  118 ? 46.163  49.641 -7.255  1.00 118.83 ? 264  DT  J C7    1 
ATOM   5397  C  C6    . DT  B  1  118 ? 46.651  51.269 -9.077  1.00 118.75 ? 264  DT  J C6    1 
ATOM   5398  P  P     . DT  B  1  119 ? 44.986  56.693 -12.334 1.00 119.88 ? 265  DT  J P     1 
ATOM   5399  O  OP1   . DT  B  1  119 ? 45.233  57.936 -11.562 1.00 119.90 ? 265  DT  J OP1   1 
ATOM   5400  O  OP2   . DT  B  1  119 ? 43.632  56.082 -12.336 1.00 120.13 ? 265  DT  J OP2   1 
ATOM   5401  O  "O5'" . DT  B  1  119 ? 45.434  56.954 -13.833 1.00 119.97 ? 265  DT  J "O5'" 1 
ATOM   5402  C  "C5'" . DT  B  1  119 ? 46.817  57.052 -14.149 1.00 119.87 ? 265  DT  J "C5'" 1 
ATOM   5403  C  "C4'" . DT  B  1  119 ? 47.182  56.055 -15.222 1.00 119.20 ? 265  DT  J "C4'" 1 
ATOM   5404  O  "O4'" . DT  B  1  119 ? 47.158  54.698 -14.709 1.00 119.16 ? 265  DT  J "O4'" 1 
ATOM   5405  C  "C3'" . DT  B  1  119 ? 46.247  56.072 -16.429 1.00 118.62 ? 265  DT  J "C3'" 1 
ATOM   5406  O  "O3'" . DT  B  1  119 ? 47.024  56.018 -17.620 1.00 117.00 ? 265  DT  J "O3'" 1 
ATOM   5407  C  "C2'" . DT  B  1  119 ? 45.415  54.811 -16.260 1.00 118.67 ? 265  DT  J "C2'" 1 
ATOM   5408  C  "C1'" . DT  B  1  119 ? 46.396  53.875 -15.579 1.00 119.54 ? 265  DT  J "C1'" 1 
ATOM   5409  N  N1    . DT  B  1  119 ? 45.784  52.792 -14.776 1.00 120.20 ? 265  DT  J N1    1 
ATOM   5410  C  C2    . DT  B  1  119 ? 46.250  51.507 -14.959 1.00 120.79 ? 265  DT  J C2    1 
ATOM   5411  O  O2    . DT  B  1  119 ? 47.123  51.221 -15.755 1.00 121.26 ? 265  DT  J O2    1 
ATOM   5412  N  N3    . DT  B  1  119 ? 45.647  50.559 -14.173 1.00 121.02 ? 265  DT  J N3    1 
ATOM   5413  C  C4    . DT  B  1  119 ? 44.644  50.756 -13.250 1.00 121.10 ? 265  DT  J C4    1 
ATOM   5414  O  O4    . DT  B  1  119 ? 44.205  49.802 -12.612 1.00 120.93 ? 265  DT  J O4    1 
ATOM   5415  C  C5    . DT  B  1  119 ? 44.191  52.123 -13.116 1.00 121.09 ? 265  DT  J C5    1 
ATOM   5416  C  C7    . DT  B  1  119 ? 43.093  52.431 -12.149 1.00 121.54 ? 265  DT  J C7    1 
ATOM   5417  C  C6    . DT  B  1  119 ? 44.779  53.061 -13.874 1.00 120.74 ? 265  DT  J C6    1 
ATOM   5418  P  P     . DT  B  1  120 ? 46.311  56.211 -19.039 1.00 115.92 ? 266  DT  J P     1 
ATOM   5419  O  OP1   . DT  B  1  120 ? 47.178  57.107 -19.851 1.00 115.61 ? 266  DT  J OP1   1 
ATOM   5420  O  OP2   . DT  B  1  120 ? 44.885  56.569 -18.813 1.00 115.78 ? 266  DT  J OP2   1 
ATOM   5421  O  "O5'" . DT  B  1  120 ? 46.369  54.746 -19.651 1.00 113.49 ? 266  DT  J "O5'" 1 
ATOM   5422  C  "C5'" . DT  B  1  120 ? 47.574  53.991 -19.592 1.00 109.38 ? 266  DT  J "C5'" 1 
ATOM   5423  C  "C4'" . DT  B  1  120 ? 47.350  52.616 -20.173 1.00 106.08 ? 266  DT  J "C4'" 1 
ATOM   5424  O  "O4'" . DT  B  1  120 ? 46.693  51.750 -19.216 1.00 105.65 ? 266  DT  J "O4'" 1 
ATOM   5425  C  "C3'" . DT  B  1  120 ? 46.467  52.625 -21.420 1.00 104.21 ? 266  DT  J "C3'" 1 
ATOM   5426  O  "O3'" . DT  B  1  120 ? 46.969  51.682 -22.356 1.00 100.56 ? 266  DT  J "O3'" 1 
ATOM   5427  C  "C2'" . DT  B  1  120 ? 45.125  52.147 -20.897 1.00 104.40 ? 266  DT  J "C2'" 1 
ATOM   5428  C  "C1'" . DT  B  1  120 ? 45.555  51.165 -19.823 1.00 105.15 ? 266  DT  J "C1'" 1 
ATOM   5429  N  N1    . DT  B  1  120 ? 44.550  50.917 -18.775 1.00 105.11 ? 266  DT  J N1    1 
ATOM   5430  C  C2    . DT  B  1  120 ? 44.412  49.632 -18.303 1.00 105.25 ? 266  DT  J C2    1 
ATOM   5431  O  O2    . DT  B  1  120 ? 45.104  48.704 -18.685 1.00 104.21 ? 266  DT  J O2    1 
ATOM   5432  N  N3    . DT  B  1  120 ? 43.430  49.473 -17.358 1.00 106.13 ? 266  DT  J N3    1 
ATOM   5433  C  C4    . DT  B  1  120 ? 42.598  50.450 -16.845 1.00 106.49 ? 266  DT  J C4    1 
ATOM   5434  O  O4    . DT  B  1  120 ? 41.749  50.152 -16.009 1.00 106.87 ? 266  DT  J O4    1 
ATOM   5435  C  C5    . DT  B  1  120 ? 42.814  51.781 -17.370 1.00 106.35 ? 266  DT  J C5    1 
ATOM   5436  C  C7    . DT  B  1  120 ? 41.975  52.910 -16.860 1.00 106.37 ? 266  DT  J C7    1 
ATOM   5437  C  C6    . DT  B  1  120 ? 43.766  51.943 -18.296 1.00 105.92 ? 266  DT  J C6    1 
ATOM   5438  P  P     . DG  B  1  121 ? 47.496  52.180 -23.785 1.00 96.59  ? 267  DG  J P     1 
ATOM   5439  O  OP1   . DG  B  1  121 ? 48.674  53.062 -23.584 1.00 95.93  ? 267  DG  J OP1   1 
ATOM   5440  O  OP2   . DG  B  1  121 ? 46.329  52.674 -24.556 1.00 96.02  ? 267  DG  J OP2   1 
ATOM   5441  O  "O5'" . DG  B  1  121 ? 48.003  50.823 -24.434 1.00 94.68  ? 267  DG  J "O5'" 1 
ATOM   5442  C  "C5'" . DG  B  1  121 ? 48.868  49.962 -23.702 1.00 90.29  ? 267  DG  J "C5'" 1 
ATOM   5443  C  "C4'" . DG  B  1  121 ? 48.300  48.564 -23.661 1.00 87.76  ? 267  DG  J "C4'" 1 
ATOM   5444  O  "O4'" . DG  B  1  121 ? 47.150  48.502 -22.784 1.00 87.92  ? 267  DG  J "O4'" 1 
ATOM   5445  C  "C3'" . DG  B  1  121 ? 47.835  48.027 -25.012 1.00 85.58  ? 267  DG  J "C3'" 1 
ATOM   5446  O  "O3'" . DG  B  1  121 ? 48.202  46.654 -25.107 1.00 81.47  ? 267  DG  J "O3'" 1 
ATOM   5447  C  "C2'" . DG  B  1  121 ? 46.325  48.185 -24.953 1.00 86.37  ? 267  DG  J "C2'" 1 
ATOM   5448  C  "C1'" . DG  B  1  121 ? 46.035  47.962 -23.480 1.00 88.29  ? 267  DG  J "C1'" 1 
ATOM   5449  N  N9    . DG  B  1  121 ? 44.835  48.629 -22.982 1.00 90.21  ? 267  DG  J N9    1 
ATOM   5450  C  C8    . DG  B  1  121 ? 44.335  49.846 -23.381 1.00 91.19  ? 267  DG  J C8    1 
ATOM   5451  N  N7    . DG  B  1  121 ? 43.256  50.196 -22.734 1.00 91.88  ? 267  DG  J N7    1 
ATOM   5452  C  C5    . DG  B  1  121 ? 43.026  49.145 -21.855 1.00 91.45  ? 267  DG  J C5    1 
ATOM   5453  C  C6    . DG  B  1  121 ? 42.001  48.962 -20.885 1.00 91.86  ? 267  DG  J C6    1 
ATOM   5454  O  O6    . DG  B  1  121 ? 41.067  49.721 -20.594 1.00 92.52  ? 267  DG  J O6    1 
ATOM   5455  N  N1    . DG  B  1  121 ? 42.141  47.750 -20.218 1.00 91.09  ? 267  DG  J N1    1 
ATOM   5456  C  C2    . DG  B  1  121 ? 43.135  46.832 -20.450 1.00 91.22  ? 267  DG  J C2    1 
ATOM   5457  N  N2    . DG  B  1  121 ? 43.091  45.715 -19.713 1.00 91.41  ? 267  DG  J N2    1 
ATOM   5458  N  N3    . DG  B  1  121 ? 44.100  46.995 -21.341 1.00 90.82  ? 267  DG  J N3    1 
ATOM   5459  C  C4    . DG  B  1  121 ? 43.985  48.165 -22.002 1.00 90.67  ? 267  DG  J C4    1 
ATOM   5460  P  P     . DG  B  1  122 ? 48.018  45.871 -26.492 1.00 77.69  ? 268  DG  J P     1 
ATOM   5461  O  OP1   . DG  B  1  122 ? 49.339  45.347 -26.907 1.00 78.29  ? 268  DG  J OP1   1 
ATOM   5462  O  OP2   . DG  B  1  122 ? 47.238  46.732 -27.415 1.00 77.03  ? 268  DG  J OP2   1 
ATOM   5463  O  "O5'" . DG  B  1  122 ? 47.121  44.637 -26.063 1.00 80.30  ? 268  DG  J "O5'" 1 
ATOM   5464  C  "C5'" . DG  B  1  122 ? 46.206  44.777 -24.990 1.00 83.35  ? 268  DG  J "C5'" 1 
ATOM   5465  C  "C4'" . DG  B  1  122 ? 45.567  43.451 -24.668 1.00 84.86  ? 268  DG  J "C4'" 1 
ATOM   5466  O  "O4'" . DG  B  1  122 ? 44.509  43.725 -23.727 1.00 85.78  ? 268  DG  J "O4'" 1 
ATOM   5467  C  "C3'" . DG  B  1  122 ? 44.890  42.796 -25.865 1.00 85.95  ? 268  DG  J "C3'" 1 
ATOM   5468  O  "O3'" . DG  B  1  122 ? 44.901  41.375 -25.724 1.00 87.53  ? 268  DG  J "O3'" 1 
ATOM   5469  C  "C2'" . DG  B  1  122 ? 43.484  43.361 -25.828 1.00 86.17  ? 268  DG  J "C2'" 1 
ATOM   5470  C  "C1'" . DG  B  1  122 ? 43.238  43.606 -24.348 1.00 86.35  ? 268  DG  J "C1'" 1 
ATOM   5471  N  N9    . DG  B  1  122 ? 42.514  44.845 -24.091 1.00 86.81  ? 268  DG  J N9    1 
ATOM   5472  C  C8    . DG  B  1  122 ? 42.687  46.051 -24.727 1.00 86.53  ? 268  DG  J C8    1 
ATOM   5473  N  N7    . DG  B  1  122 ? 41.882  46.980 -24.290 1.00 87.02  ? 268  DG  J N7    1 
ATOM   5474  C  C5    . DG  B  1  122 ? 41.134  46.350 -23.305 1.00 87.75  ? 268  DG  J C5    1 
ATOM   5475  C  C6    . DG  B  1  122 ? 40.096  46.850 -22.481 1.00 87.76  ? 268  DG  J C6    1 
ATOM   5476  O  O6    . DG  B  1  122 ? 39.606  47.988 -22.462 1.00 87.88  ? 268  DG  J O6    1 
ATOM   5477  N  N1    . DG  B  1  122 ? 39.617  45.872 -21.614 1.00 88.15  ? 268  DG  J N1    1 
ATOM   5478  C  C2    . DG  B  1  122 ? 40.074  44.578 -21.551 1.00 88.45  ? 268  DG  J C2    1 
ATOM   5479  N  N2    . DG  B  1  122 ? 39.484  43.784 -20.643 1.00 89.18  ? 268  DG  J N2    1 
ATOM   5480  N  N3    . DG  B  1  122 ? 41.036  44.097 -22.319 1.00 88.03  ? 268  DG  J N3    1 
ATOM   5481  C  C4    . DG  B  1  122 ? 41.517  45.032 -23.166 1.00 87.53  ? 268  DG  J C4    1 
ATOM   5482  P  P     . DT  B  1  123 ? 44.037  40.473 -26.730 1.00 89.81  ? 269  DT  J P     1 
ATOM   5483  O  OP1   . DT  B  1  123 ? 44.526  39.075 -26.643 1.00 89.26  ? 269  DT  J OP1   1 
ATOM   5484  O  OP2   . DT  B  1  123 ? 44.006  41.160 -28.045 1.00 90.03  ? 269  DT  J OP2   1 
ATOM   5485  O  "O5'" . DT  B  1  123 ? 42.570  40.540 -26.114 1.00 93.67  ? 269  DT  J "O5'" 1 
ATOM   5486  C  "C5'" . DT  B  1  123 ? 42.320  40.109 -24.777 1.00 98.61  ? 269  DT  J "C5'" 1 
ATOM   5487  C  "C4'" . DT  B  1  123 ? 40.837  40.123 -24.487 1.00 102.01 ? 269  DT  J "C4'" 1 
ATOM   5488  O  "O4'" . DT  B  1  123 ? 40.367  41.477 -24.277 1.00 101.77 ? 269  DT  J "O4'" 1 
ATOM   5489  C  "C3'" . DT  B  1  123 ? 39.971  39.537 -25.603 1.00 105.11 ? 269  DT  J "C3'" 1 
ATOM   5490  O  "O3'" . DT  B  1  123 ? 38.928  38.736 -25.046 1.00 111.21 ? 269  DT  J "O3'" 1 
ATOM   5491  C  "C2'" . DT  B  1  123 ? 39.379  40.767 -26.269 1.00 103.72 ? 269  DT  J "C2'" 1 
ATOM   5492  C  "C1'" . DT  B  1  123 ? 39.232  41.712 -25.093 1.00 102.21 ? 269  DT  J "C1'" 1 
ATOM   5493  N  N1    . DT  B  1  123 ? 39.198  43.149 -25.434 1.00 101.85 ? 269  DT  J N1    1 
ATOM   5494  C  C2    . DT  B  1  123 ? 38.305  43.945 -24.756 1.00 101.82 ? 269  DT  J C2    1 
ATOM   5495  O  O2    . DT  B  1  123 ? 37.556  43.517 -23.894 1.00 102.99 ? 269  DT  J O2    1 
ATOM   5496  N  N3    . DT  B  1  123 ? 38.320  45.268 -25.123 1.00 100.75 ? 269  DT  J N3    1 
ATOM   5497  C  C4    . DT  B  1  123 ? 39.126  45.860 -26.074 1.00 100.78 ? 269  DT  J C4    1 
ATOM   5498  O  O4    . DT  B  1  123 ? 39.030  47.066 -26.293 1.00 99.68  ? 269  DT  J O4    1 
ATOM   5499  C  C5    . DT  B  1  123 ? 40.043  44.967 -26.745 1.00 101.16 ? 269  DT  J C5    1 
ATOM   5500  C  C7    . DT  B  1  123 ? 40.958  45.521 -27.791 1.00 102.04 ? 269  DT  J C7    1 
ATOM   5501  C  C6    . DT  B  1  123 ? 40.032  43.673 -26.398 1.00 101.74 ? 269  DT  J C6    1 
ATOM   5502  P  P     . DA  B  1  124 ? 38.588  37.306 -25.699 1.00 115.85 ? 270  DA  J P     1 
ATOM   5503  O  OP1   . DA  B  1  124 ? 39.257  36.244 -24.903 1.00 115.39 ? 270  DA  J OP1   1 
ATOM   5504  O  OP2   . DA  B  1  124 ? 38.842  37.399 -27.159 1.00 116.14 ? 270  DA  J OP2   1 
ATOM   5505  O  "O5'" . DA  B  1  124 ? 37.018  37.172 -25.487 1.00 119.75 ? 270  DA  J "O5'" 1 
ATOM   5506  C  "C5'" . DA  B  1  124 ? 36.462  37.074 -24.179 1.00 126.35 ? 270  DA  J "C5'" 1 
ATOM   5507  C  "C4'" . DA  B  1  124 ? 35.051  37.614 -24.177 1.00 130.86 ? 270  DA  J "C4'" 1 
ATOM   5508  O  "O4'" . DA  B  1  124 ? 35.071  39.064 -24.189 1.00 131.90 ? 270  DA  J "O4'" 1 
ATOM   5509  C  "C3'" . DA  B  1  124 ? 34.232  37.191 -25.397 1.00 133.62 ? 270  DA  J "C3'" 1 
ATOM   5510  O  "O3'" . DA  B  1  124 ? 32.890  36.884 -25.017 1.00 137.12 ? 270  DA  J "O3'" 1 
ATOM   5511  C  "C2'" . DA  B  1  124 ? 34.266  38.421 -26.288 1.00 133.48 ? 270  DA  J "C2'" 1 
ATOM   5512  C  "C1'" . DA  B  1  124 ? 34.281  39.542 -25.268 1.00 133.11 ? 270  DA  J "C1'" 1 
ATOM   5513  N  N9    . DA  B  1  124 ? 34.870  40.795 -25.745 1.00 133.62 ? 270  DA  J N9    1 
ATOM   5514  C  C8    . DA  B  1  124 ? 35.975  40.967 -26.541 1.00 133.81 ? 270  DA  J C8    1 
ATOM   5515  N  N7    . DA  B  1  124 ? 36.250  42.223 -26.799 1.00 134.03 ? 270  DA  J N7    1 
ATOM   5516  C  C5    . DA  B  1  124 ? 35.260  42.926 -26.126 1.00 133.96 ? 270  DA  J C5    1 
ATOM   5517  C  C6    . DA  B  1  124 ? 34.994  44.303 -26.000 1.00 133.88 ? 270  DA  J C6    1 
ATOM   5518  N  N6    . DA  B  1  124 ? 35.732  45.257 -26.572 1.00 133.72 ? 270  DA  J N6    1 
ATOM   5519  N  N1    . DA  B  1  124 ? 33.928  44.670 -25.256 1.00 133.89 ? 270  DA  J N1    1 
ATOM   5520  C  C2    . DA  B  1  124 ? 33.187  43.714 -24.683 1.00 134.08 ? 270  DA  J C2    1 
ATOM   5521  N  N3    . DA  B  1  124 ? 33.335  42.392 -24.728 1.00 134.21 ? 270  DA  J N3    1 
ATOM   5522  C  C4    . DA  B  1  124 ? 34.403  42.059 -25.474 1.00 133.99 ? 270  DA  J C4    1 
ATOM   5523  P  P     . DG  B  1  125 ? 31.758  36.748 -26.148 1.00 140.01 ? 271  DG  J P     1 
ATOM   5524  O  OP1   . DG  B  1  125 ? 30.691  35.868 -25.609 1.00 140.35 ? 271  DG  J OP1   1 
ATOM   5525  O  OP2   . DG  B  1  125 ? 32.407  36.409 -27.442 1.00 139.88 ? 271  DG  J OP2   1 
ATOM   5526  O  "O5'" . DG  B  1  125 ? 31.174  38.223 -26.252 1.00 142.04 ? 271  DG  J "O5'" 1 
ATOM   5527  C  "C5'" . DG  B  1  125 ? 30.483  38.806 -25.152 1.00 145.77 ? 271  DG  J "C5'" 1 
ATOM   5528  C  "C4'" . DG  B  1  125 ? 29.556  39.890 -25.643 1.00 148.43 ? 271  DG  J "C4'" 1 
ATOM   5529  O  "O4'" . DG  B  1  125 ? 30.322  41.062 -26.008 1.00 148.88 ? 271  DG  J "O4'" 1 
ATOM   5530  C  "C3'" . DG  B  1  125 ? 28.765  39.496 -26.888 1.00 150.07 ? 271  DG  J "C3'" 1 
ATOM   5531  O  "O3'" . DG  B  1  125 ? 27.445  40.035 -26.821 1.00 152.79 ? 271  DG  J "O3'" 1 
ATOM   5532  C  "C2'" . DG  B  1  125 ? 29.549  40.136 -28.019 1.00 149.84 ? 271  DG  J "C2'" 1 
ATOM   5533  C  "C1'" . DG  B  1  125 ? 30.075  41.400 -27.364 1.00 149.52 ? 271  DG  J "C1'" 1 
ATOM   5534  N  N9    . DG  B  1  125 ? 31.319  41.910 -27.928 1.00 149.69 ? 271  DG  J N9    1 
ATOM   5535  C  C8    . DG  B  1  125 ? 32.388  41.179 -28.391 1.00 149.82 ? 271  DG  J C8    1 
ATOM   5536  N  N7    . DG  B  1  125 ? 33.368  41.925 -28.825 1.00 149.83 ? 271  DG  J N7    1 
ATOM   5537  C  C5    . DG  B  1  125 ? 32.918  43.225 -28.641 1.00 149.74 ? 271  DG  J C5    1 
ATOM   5538  C  C6    . DG  B  1  125 ? 33.546  44.464 -28.925 1.00 149.67 ? 271  DG  J C6    1 
ATOM   5539  O  O6    . DG  B  1  125 ? 34.665  44.669 -29.411 1.00 149.60 ? 271  DG  J O6    1 
ATOM   5540  N  N1    . DG  B  1  125 ? 32.731  45.538 -28.582 1.00 149.66 ? 271  DG  J N1    1 
ATOM   5541  C  C2    . DG  B  1  125 ? 31.474  45.436 -28.037 1.00 149.48 ? 271  DG  J C2    1 
ATOM   5542  N  N2    . DG  B  1  125 ? 30.844  46.590 -27.777 1.00 149.32 ? 271  DG  J N2    1 
ATOM   5543  N  N3    . DG  B  1  125 ? 30.879  44.288 -27.767 1.00 149.52 ? 271  DG  J N3    1 
ATOM   5544  C  C4    . DG  B  1  125 ? 31.653  43.231 -28.092 1.00 149.74 ? 271  DG  J C4    1 
ATOM   5545  P  P     . DA  B  1  126 ? 26.319  39.504 -27.833 1.00 154.69 ? 272  DA  J P     1 
ATOM   5546  O  OP1   . DA  B  1  126 ? 25.095  39.198 -27.050 1.00 154.76 ? 272  DA  J OP1   1 
ATOM   5547  O  OP2   . DA  B  1  126 ? 26.934  38.447 -28.677 1.00 154.35 ? 272  DA  J OP2   1 
ATOM   5548  O  "O5'" . DA  B  1  126 ? 26.025  40.768 -28.755 1.00 155.70 ? 272  DA  J "O5'" 1 
ATOM   5549  C  "C5'" . DA  B  1  126 ? 25.305  41.891 -28.251 1.00 157.70 ? 272  DA  J "C5'" 1 
ATOM   5550  C  "C4'" . DA  B  1  126 ? 25.122  42.916 -29.345 1.00 159.24 ? 272  DA  J "C4'" 1 
ATOM   5551  O  "O4'" . DA  B  1  126 ? 26.387  43.568 -29.614 1.00 159.82 ? 272  DA  J "O4'" 1 
ATOM   5552  C  "C3'" . DA  B  1  126 ? 24.663  42.304 -30.672 1.00 159.95 ? 272  DA  J "C3'" 1 
ATOM   5553  O  "O3'" . DA  B  1  126 ? 23.788  43.179 -31.407 1.00 160.31 ? 272  DA  J "O3'" 1 
ATOM   5554  C  "C2'" . DA  B  1  126 ? 25.965  42.178 -31.442 1.00 160.33 ? 272  DA  J "C2'" 1 
ATOM   5555  C  "C1'" . DA  B  1  126 ? 26.687  43.435 -30.989 1.00 160.54 ? 272  DA  J "C1'" 1 
ATOM   5556  N  N9    . DA  B  1  126 ? 28.142  43.445 -31.145 1.00 160.96 ? 272  DA  J N9    1 
ATOM   5557  C  C8    . DA  B  1  126 ? 28.987  42.393 -31.400 1.00 161.19 ? 272  DA  J C8    1 
ATOM   5558  N  N7    . DA  B  1  126 ? 30.245  42.745 -31.525 1.00 161.37 ? 272  DA  J N7    1 
ATOM   5559  C  C5    . DA  B  1  126 ? 30.227  44.120 -31.331 1.00 161.34 ? 272  DA  J C5    1 
ATOM   5560  C  C6    . DA  B  1  126 ? 31.244  45.092 -31.348 1.00 161.44 ? 272  DA  J C6    1 
ATOM   5561  N  N6    . DA  B  1  126 ? 32.527  44.819 -31.590 1.00 161.63 ? 272  DA  J N6    1 
ATOM   5562  N  N1    . DA  B  1  126 ? 30.890  46.374 -31.109 1.00 161.25 ? 272  DA  J N1    1 
ATOM   5563  C  C2    . DA  B  1  126 ? 29.602  46.651 -30.879 1.00 161.11 ? 272  DA  J C2    1 
ATOM   5564  N  N3    . DA  B  1  126 ? 28.556  45.828 -30.846 1.00 161.19 ? 272  DA  J N3    1 
ATOM   5565  C  C4    . DA  B  1  126 ? 28.941  44.562 -31.083 1.00 161.20 ? 272  DA  J C4    1 
ATOM   5566  P  P     . DA  B  1  127 ? 23.209  44.517 -30.723 1.00 160.34 ? 273  DA  J P     1 
ATOM   5567  O  OP1   . DA  B  1  127 ? 22.755  44.196 -29.344 1.00 160.23 ? 273  DA  J OP1   1 
ATOM   5568  O  OP2   . DA  B  1  127 ? 22.256  45.133 -31.682 1.00 160.35 ? 273  DA  J OP2   1 
ATOM   5569  O  "O5'" . DA  B  1  127 ? 24.498  45.451 -30.643 1.00 160.00 ? 273  DA  J "O5'" 1 
ATOM   5570  C  "C5'" . DA  B  1  127 ? 24.397  46.839 -30.338 1.00 159.01 ? 273  DA  J "C5'" 1 
ATOM   5571  C  "C4'" . DA  B  1  127 ? 24.713  47.667 -31.563 1.00 158.33 ? 273  DA  J "C4'" 1 
ATOM   5572  O  "O4'" . DA  B  1  127 ? 26.024  47.312 -32.078 1.00 158.48 ? 273  DA  J "O4'" 1 
ATOM   5573  C  "C3'" . DA  B  1  127 ? 23.744  47.480 -32.734 1.00 157.63 ? 273  DA  J "C3'" 1 
ATOM   5574  O  "O3'" . DA  B  1  127 ? 23.552  48.736 -33.390 1.00 155.98 ? 273  DA  J "O3'" 1 
ATOM   5575  C  "C2'" . DA  B  1  127 ? 24.494  46.538 -33.657 1.00 158.15 ? 273  DA  J "C2'" 1 
ATOM   5576  C  "C1'" . DA  B  1  127 ? 25.916  47.019 -33.465 1.00 158.54 ? 273  DA  J "C1'" 1 
ATOM   5577  N  N9    . DA  B  1  127 ? 26.945  46.041 -33.823 1.00 158.59 ? 273  DA  J N9    1 
ATOM   5578  C  C8    . DA  B  1  127 ? 26.810  44.680 -33.957 1.00 158.43 ? 273  DA  J C8    1 
ATOM   5579  N  N7    . DA  B  1  127 ? 27.914  44.071 -34.316 1.00 158.36 ? 273  DA  J N7    1 
ATOM   5580  C  C5    . DA  B  1  127 ? 28.841  45.098 -34.424 1.00 158.49 ? 273  DA  J C5    1 
ATOM   5581  C  C6    . DA  B  1  127 ? 30.203  45.110 -34.773 1.00 158.46 ? 273  DA  J C6    1 
ATOM   5582  N  N6    . DA  B  1  127 ? 30.895  44.015 -35.091 1.00 158.38 ? 273  DA  J N6    1 
ATOM   5583  N  N1    . DA  B  1  127 ? 30.837  46.303 -34.783 1.00 158.44 ? 273  DA  J N1    1 
ATOM   5584  C  C2    . DA  B  1  127 ? 30.142  47.401 -34.464 1.00 158.32 ? 273  DA  J C2    1 
ATOM   5585  N  N3    . DA  B  1  127 ? 28.862  47.518 -34.120 1.00 158.40 ? 273  DA  J N3    1 
ATOM   5586  C  C4    . DA  B  1  127 ? 28.259  46.316 -34.119 1.00 158.53 ? 273  DA  J C4    1 
ATOM   5587  P  P     . DT  B  1  128 ? 22.539  48.849 -34.632 1.00 154.56 ? 274  DT  J P     1 
ATOM   5588  O  OP1   . DT  B  1  128 ? 21.234  49.336 -34.118 1.00 154.83 ? 274  DT  J OP1   1 
ATOM   5589  O  OP2   . DT  B  1  128 ? 22.594  47.581 -35.406 1.00 154.58 ? 274  DT  J OP2   1 
ATOM   5590  O  "O5'" . DT  B  1  128 ? 23.189  50.002 -35.518 1.00 153.15 ? 274  DT  J "O5'" 1 
ATOM   5591  C  "C5'" . DT  B  1  128 ? 23.644  51.208 -34.907 1.00 150.49 ? 274  DT  J "C5'" 1 
ATOM   5592  C  "C4'" . DT  B  1  128 ? 24.756  51.835 -35.718 1.00 148.31 ? 274  DT  J "C4'" 1 
ATOM   5593  O  "O4'" . DT  B  1  128 ? 25.919  50.969 -35.730 1.00 148.49 ? 274  DT  J "O4'" 1 
ATOM   5594  C  "C3'" . DT  B  1  128 ? 24.434  52.134 -37.184 1.00 146.31 ? 274  DT  J "C3'" 1 
ATOM   5595  O  "O3'" . DT  B  1  128 ? 24.969  53.416 -37.537 1.00 142.35 ? 274  DT  J "O3'" 1 
ATOM   5596  C  "C2'" . DT  B  1  128 ? 25.157  51.032 -37.936 1.00 147.05 ? 274  DT  J "C2'" 1 
ATOM   5597  C  "C1'" . DT  B  1  128 ? 26.378  50.815 -37.065 1.00 148.19 ? 274  DT  J "C1'" 1 
ATOM   5598  N  N1    . DT  B  1  128 ? 27.002  49.482 -37.192 1.00 148.69 ? 274  DT  J N1    1 
ATOM   5599  C  C2    . DT  B  1  128 ? 28.379  49.409 -37.186 1.00 149.07 ? 274  DT  J C2    1 
ATOM   5600  O  O2    . DT  B  1  128 ? 29.101  50.388 -37.068 1.00 149.29 ? 274  DT  J O2    1 
ATOM   5601  N  N3    . DT  B  1  128 ? 28.885  48.140 -37.324 1.00 148.97 ? 274  DT  J N3    1 
ATOM   5602  C  C4    . DT  B  1  128 ? 28.169  46.966 -37.462 1.00 148.60 ? 274  DT  J C4    1 
ATOM   5603  O  O4    . DT  B  1  128 ? 28.763  45.897 -37.580 1.00 148.42 ? 274  DT  J O4    1 
ATOM   5604  C  C5    . DT  B  1  128 ? 26.732  47.116 -37.455 1.00 148.51 ? 274  DT  J C5    1 
ATOM   5605  C  C7    . DT  B  1  128 ? 25.875  45.898 -37.598 1.00 148.38 ? 274  DT  J C7    1 
ATOM   5606  C  C6    . DT  B  1  128 ? 26.227  48.349 -37.320 1.00 148.55 ? 274  DT  J C6    1 
ATOM   5607  P  P     . DC  B  1  129 ? 25.085  53.839 -39.083 1.00 139.24 ? 275  DC  J P     1 
ATOM   5608  O  OP1   . DC  B  1  129 ? 24.919  55.314 -39.154 1.00 139.30 ? 275  DC  J OP1   1 
ATOM   5609  O  OP2   . DC  B  1  129 ? 24.197  52.962 -39.889 1.00 139.20 ? 275  DC  J OP2   1 
ATOM   5610  O  "O5'" . DC  B  1  129 ? 26.596  53.492 -39.446 1.00 136.73 ? 275  DC  J "O5'" 1 
ATOM   5611  C  "C5'" . DC  B  1  129 ? 27.658  53.875 -38.571 1.00 131.17 ? 275  DC  J "C5'" 1 
ATOM   5612  C  "C4'" . DC  B  1  129 ? 28.999  53.644 -39.229 1.00 126.77 ? 275  DC  J "C4'" 1 
ATOM   5613  O  "O4'" . DC  B  1  129 ? 29.267  52.225 -39.340 1.00 126.06 ? 275  DC  J "O4'" 1 
ATOM   5614  C  "C3'" . DC  B  1  129 ? 29.135  54.215 -40.641 1.00 123.49 ? 275  DC  J "C3'" 1 
ATOM   5615  O  "O3'" . DC  B  1  129 ? 30.436  54.785 -40.808 1.00 118.40 ? 275  DC  J "O3'" 1 
ATOM   5616  C  "C2'" . DC  B  1  129 ? 28.973  52.997 -41.531 1.00 123.85 ? 275  DC  J "C2'" 1 
ATOM   5617  C  "C1'" . DC  B  1  129 ? 29.595  51.903 -40.682 1.00 125.25 ? 275  DC  J "C1'" 1 
ATOM   5618  N  N1    . DC  B  1  129 ? 29.093  50.548 -40.960 1.00 125.37 ? 275  DC  J N1    1 
ATOM   5619  C  C2    . DC  B  1  129 ? 30.015  49.529 -41.223 1.00 125.62 ? 275  DC  J C2    1 
ATOM   5620  O  O2    . DC  B  1  129 ? 31.226  49.794 -41.205 1.00 126.03 ? 275  DC  J O2    1 
ATOM   5621  N  N3    . DC  B  1  129 ? 29.564  48.282 -41.487 1.00 125.66 ? 275  DC  J N3    1 
ATOM   5622  C  C4    . DC  B  1  129 ? 28.254  48.035 -41.494 1.00 125.65 ? 275  DC  J C4    1 
ATOM   5623  N  N4    . DC  B  1  129 ? 27.855  46.790 -41.764 1.00 125.76 ? 275  DC  J N4    1 
ATOM   5624  C  C5    . DC  B  1  129 ? 27.293  49.053 -41.226 1.00 125.72 ? 275  DC  J C5    1 
ATOM   5625  C  C6    . DC  B  1  129 ? 27.752  50.284 -40.967 1.00 125.46 ? 275  DC  J C6    1 
ATOM   5626  P  P     . DT  B  1  130 ? 30.725  55.762 -42.051 1.00 114.59 ? 276  DT  J P     1 
ATOM   5627  O  OP1   . DT  B  1  130 ? 31.638  56.830 -41.564 1.00 114.08 ? 276  DT  J OP1   1 
ATOM   5628  O  OP2   . DT  B  1  130 ? 29.435  56.130 -42.687 1.00 114.48 ? 276  DT  J OP2   1 
ATOM   5629  O  "O5'" . DT  B  1  130 ? 31.536  54.843 -43.068 1.00 110.68 ? 276  DT  J "O5'" 1 
ATOM   5630  C  "C5'" . DT  B  1  130 ? 32.854  54.404 -42.752 1.00 102.68 ? 276  DT  J "C5'" 1 
ATOM   5631  C  "C4'" . DT  B  1  130 ? 33.405  53.538 -43.860 1.00 96.50  ? 276  DT  J "C4'" 1 
ATOM   5632  O  "O4'" . DT  B  1  130 ? 32.767  52.238 -43.862 1.00 95.63  ? 276  DT  J "O4'" 1 
ATOM   5633  C  "C3'" . DT  B  1  130 ? 33.233  54.097 -45.273 1.00 92.24  ? 276  DT  J "C3'" 1 
ATOM   5634  O  "O3'" . DT  B  1  130 ? 34.406  53.797 -46.029 1.00 85.99  ? 276  DT  J "O3'" 1 
ATOM   5635  C  "C2'" . DT  B  1  130 ? 32.080  53.277 -45.823 1.00 93.26  ? 276  DT  J "C2'" 1 
ATOM   5636  C  "C1'" . DT  B  1  130 ? 32.371  51.934 -45.186 1.00 95.28  ? 276  DT  J "C1'" 1 
ATOM   5637  N  N1    . DT  B  1  130 ? 31.252  50.977 -45.126 1.00 96.28  ? 276  DT  J N1    1 
ATOM   5638  C  C2    . DT  B  1  130 ? 31.527  49.659 -45.417 1.00 96.66  ? 276  DT  J C2    1 
ATOM   5639  O  O2    . DT  B  1  130 ? 32.637  49.263 -45.727 1.00 96.60  ? 276  DT  J O2    1 
ATOM   5640  N  N3    . DT  B  1  130 ? 30.449  48.816 -45.337 1.00 97.46  ? 276  DT  J N3    1 
ATOM   5641  C  C4    . DT  B  1  130 ? 29.152  49.151 -45.007 1.00 97.77  ? 276  DT  J C4    1 
ATOM   5642  O  O4    . DT  B  1  130 ? 28.286  48.280 -44.977 1.00 97.73  ? 276  DT  J O4    1 
ATOM   5643  C  C5    . DT  B  1  130 ? 28.932  50.554 -44.718 1.00 97.63  ? 276  DT  J C5    1 
ATOM   5644  C  C7    . DT  B  1  130 ? 27.556  51.014 -44.355 1.00 97.77  ? 276  DT  J C7    1 
ATOM   5645  C  C6    . DT  B  1  130 ? 29.981  51.384 -44.789 1.00 97.10  ? 276  DT  J C6    1 
ATOM   5646  P  P     . DG  B  1  131 ? 35.319  54.987 -46.596 1.00 80.95  ? 277  DG  J P     1 
ATOM   5647  O  OP1   . DG  B  1  131 ? 35.827  55.767 -45.441 1.00 81.21  ? 277  DG  J OP1   1 
ATOM   5648  O  OP2   . DG  B  1  131 ? 34.580  55.681 -47.680 1.00 81.89  ? 277  DG  J OP2   1 
ATOM   5649  O  "O5'" . DG  B  1  131 ? 36.551  54.222 -47.257 1.00 78.55  ? 277  DG  J "O5'" 1 
ATOM   5650  C  "C5'" . DG  B  1  131 ? 37.427  53.422 -46.467 1.00 71.95  ? 277  DG  J "C5'" 1 
ATOM   5651  C  "C4'" . DG  B  1  131 ? 37.730  52.124 -47.179 1.00 69.24  ? 277  DG  J "C4'" 1 
ATOM   5652  O  "O4'" . DG  B  1  131 ? 36.549  51.288 -47.210 1.00 68.68  ? 277  DG  J "O4'" 1 
ATOM   5653  C  "C3'" . DG  B  1  131 ? 38.177  52.279 -48.632 1.00 66.68  ? 277  DG  J "C3'" 1 
ATOM   5654  O  "O3'" . DG  B  1  131 ? 39.199  51.326 -48.923 1.00 62.33  ? 277  DG  J "O3'" 1 
ATOM   5655  C  "C2'" . DG  B  1  131 ? 36.917  51.980 -49.427 1.00 67.77  ? 277  DG  J "C2'" 1 
ATOM   5656  C  "C1'" . DG  B  1  131 ? 36.204  50.964 -48.552 1.00 70.53  ? 277  DG  J "C1'" 1 
ATOM   5657  N  N9    . DG  B  1  131 ? 34.748  51.001 -48.652 1.00 73.64  ? 277  DG  J N9    1 
ATOM   5658  C  C8    . DG  B  1  131 ? 33.953  52.121 -48.702 1.00 74.48  ? 277  DG  J C8    1 
ATOM   5659  N  N7    . DG  B  1  131 ? 32.679  51.843 -48.754 1.00 75.72  ? 277  DG  J N7    1 
ATOM   5660  C  C5    . DG  B  1  131 ? 32.628  50.456 -48.746 1.00 76.39  ? 277  DG  J C5    1 
ATOM   5661  C  C6    . DG  B  1  131 ? 31.513  49.579 -48.776 1.00 77.81  ? 277  DG  J C6    1 
ATOM   5662  O  O6    . DG  B  1  131 ? 30.308  49.864 -48.806 1.00 79.15  ? 277  DG  J O6    1 
ATOM   5663  N  N1    . DG  B  1  131 ? 31.912  48.244 -48.761 1.00 77.41  ? 277  DG  J N1    1 
ATOM   5664  C  C2    . DG  B  1  131 ? 33.213  47.809 -48.720 1.00 76.65  ? 277  DG  J C2    1 
ATOM   5665  N  N2    . DG  B  1  131 ? 33.392  46.479 -48.725 1.00 75.90  ? 277  DG  J N2    1 
ATOM   5666  N  N3    . DG  B  1  131 ? 34.261  48.618 -48.679 1.00 75.88  ? 277  DG  J N3    1 
ATOM   5667  C  C4    . DG  B  1  131 ? 33.897  49.919 -48.695 1.00 75.14  ? 277  DG  J C4    1 
ATOM   5668  P  P     . DC  B  1  132 ? 39.957  51.380 -50.333 1.00 59.05  ? 278  DC  J P     1 
ATOM   5669  O  OP1   . DC  B  1  132 ? 41.379  51.014 -50.102 1.00 59.77  ? 278  DC  J OP1   1 
ATOM   5670  O  OP2   . DC  B  1  132 ? 39.638  52.667 -50.998 1.00 59.85  ? 278  DC  J OP2   1 
ATOM   5671  O  "O5'" . DC  B  1  132 ? 39.250  50.211 -51.153 1.00 60.90  ? 278  DC  J "O5'" 1 
ATOM   5672  C  "C5'" . DC  B  1  132 ? 39.158  48.894 -50.606 1.00 62.45  ? 278  DC  J "C5'" 1 
ATOM   5673  C  "C4'" . DC  B  1  132 ? 38.292  48.016 -51.481 1.00 65.21  ? 278  DC  J "C4'" 1 
ATOM   5674  O  "O4'" . DC  B  1  132 ? 36.883  48.292 -51.294 1.00 65.41  ? 278  DC  J "O4'" 1 
ATOM   5675  C  "C3'" . DC  B  1  132 ? 38.547  48.146 -52.983 1.00 66.32  ? 278  DC  J "C3'" 1 
ATOM   5676  O  "O3'" . DC  B  1  132 ? 38.384  46.862 -53.576 1.00 67.70  ? 278  DC  J "O3'" 1 
ATOM   5677  C  "C2'" . DC  B  1  132 ? 37.403  49.030 -53.446 1.00 66.07  ? 278  DC  J "C2'" 1 
ATOM   5678  C  "C1'" . DC  B  1  132 ? 36.288  48.503 -52.565 1.00 67.30  ? 278  DC  J "C1'" 1 
ATOM   5679  N  N1    . DC  B  1  132 ? 35.132  49.392 -52.389 1.00 69.21  ? 278  DC  J N1    1 
ATOM   5680  C  C2    . DC  B  1  132 ? 33.877  48.816 -52.157 1.00 69.86  ? 278  DC  J C2    1 
ATOM   5681  O  O2    . DC  B  1  132 ? 33.786  47.578 -52.096 1.00 69.11  ? 278  DC  J O2    1 
ATOM   5682  N  N3    . DC  B  1  132 ? 32.802  49.618 -52.002 1.00 70.73  ? 278  DC  J N3    1 
ATOM   5683  C  C4    . DC  B  1  132 ? 32.943  50.944 -52.065 1.00 71.81  ? 278  DC  J C4    1 
ATOM   5684  N  N4    . DC  B  1  132 ? 31.854  51.698 -51.900 1.00 72.95  ? 278  DC  J N4    1 
ATOM   5685  C  C5    . DC  B  1  132 ? 34.208  51.558 -52.299 1.00 71.56  ? 278  DC  J C5    1 
ATOM   5686  C  C6    . DC  B  1  132 ? 35.267  50.751 -52.454 1.00 70.86  ? 278  DC  J C6    1 
ATOM   5687  P  P     . DA  B  1  133 ? 39.669  46.031 -54.034 1.00 66.25  ? 279  DA  J P     1 
ATOM   5688  O  OP1   . DA  B  1  133 ? 40.588  46.000 -52.870 1.00 68.07  ? 279  DA  J OP1   1 
ATOM   5689  O  OP2   . DA  B  1  133 ? 40.147  46.555 -55.339 1.00 66.73  ? 279  DA  J OP2   1 
ATOM   5690  O  "O5'" . DA  B  1  133 ? 39.084  44.568 -54.250 1.00 68.91  ? 279  DA  J "O5'" 1 
ATOM   5691  C  "C5'" . DA  B  1  133 ? 38.653  43.786 -53.140 1.00 71.16  ? 279  DA  J "C5'" 1 
ATOM   5692  C  "C4'" . DA  B  1  133 ? 37.433  42.981 -53.516 1.00 74.61  ? 279  DA  J "C4'" 1 
ATOM   5693  O  "O4'" . DA  B  1  133 ? 36.275  43.841 -53.596 1.00 73.46  ? 279  DA  J "O4'" 1 
ATOM   5694  C  "C3'" . DA  B  1  133 ? 37.535  42.286 -54.870 1.00 76.60  ? 279  DA  J "C3'" 1 
ATOM   5695  O  "O3'" . DA  B  1  133 ? 36.898  41.014 -54.805 1.00 82.51  ? 279  DA  J "O3'" 1 
ATOM   5696  C  "C2'" . DA  B  1  133 ? 36.801  43.226 -55.811 1.00 74.58  ? 279  DA  J "C2'" 1 
ATOM   5697  C  "C1'" . DA  B  1  133 ? 35.748  43.863 -54.917 1.00 73.40  ? 279  DA  J "C1'" 1 
ATOM   5698  N  N9    . DA  B  1  133 ? 35.456  45.261 -55.236 1.00 72.69  ? 279  DA  J N9    1 
ATOM   5699  C  C8    . DA  B  1  133 ? 36.351  46.230 -55.612 1.00 71.65  ? 279  DA  J C8    1 
ATOM   5700  N  N7    . DA  B  1  133 ? 35.816  47.415 -55.768 1.00 71.03  ? 279  DA  J N7    1 
ATOM   5701  C  C5    . DA  B  1  133 ? 34.473  47.212 -55.491 1.00 71.68  ? 279  DA  J C5    1 
ATOM   5702  C  C6    . DA  B  1  133 ? 33.373  48.082 -55.472 1.00 71.94  ? 279  DA  J C6    1 
ATOM   5703  N  N6    . DA  B  1  133 ? 33.459  49.388 -55.734 1.00 71.34  ? 279  DA  J N6    1 
ATOM   5704  N  N1    . DA  B  1  133 ? 32.166  47.561 -55.166 1.00 71.98  ? 279  DA  J N1    1 
ATOM   5705  C  C2    . DA  B  1  133 ? 32.084  46.254 -54.895 1.00 71.64  ? 279  DA  J C2    1 
ATOM   5706  N  N3    . DA  B  1  133 ? 33.046  45.336 -54.872 1.00 72.31  ? 279  DA  J N3    1 
ATOM   5707  C  C4    . DA  B  1  133 ? 34.232  45.886 -55.181 1.00 72.01  ? 279  DA  J C4    1 
ATOM   5708  P  P     . DG  B  1  134 ? 37.032  39.999 -56.037 1.00 87.24  ? 280  DG  J P     1 
ATOM   5709  O  OP1   . DG  B  1  134 ? 36.843  38.633 -55.482 1.00 87.83  ? 280  DG  J OP1   1 
ATOM   5710  O  OP2   . DG  B  1  134 ? 38.270  40.322 -56.794 1.00 86.11  ? 280  DG  J OP2   1 
ATOM   5711  O  "O5'" . DG  B  1  134 ? 35.776  40.364 -56.944 1.00 89.29  ? 280  DG  J "O5'" 1 
ATOM   5712  C  "C5'" . DG  B  1  134 ? 34.458  40.307 -56.406 1.00 94.89  ? 280  DG  J "C5'" 1 
ATOM   5713  C  "C4'" . DG  B  1  134 ? 33.456  40.814 -57.417 1.00 99.39  ? 280  DG  J "C4'" 1 
ATOM   5714  O  "O4'" . DG  B  1  134 ? 33.463  42.263 -57.480 1.00 100.40 ? 280  DG  J "O4'" 1 
ATOM   5715  C  "C3'" . DG  B  1  134 ? 33.700  40.323 -58.845 1.00 102.07 ? 280  DG  J "C3'" 1 
ATOM   5716  O  "O3'" . DG  B  1  134 ? 32.449  40.017 -59.459 1.00 105.66 ? 280  DG  J "O3'" 1 
ATOM   5717  C  "C2'" . DG  B  1  134 ? 34.318  41.530 -59.526 1.00 101.62 ? 280  DG  J "C2'" 1 
ATOM   5718  C  "C1'" . DG  B  1  134 ? 33.590  42.668 -58.834 1.00 101.19 ? 280  DG  J "C1'" 1 
ATOM   5719  N  N9    . DG  B  1  134 ? 34.276  43.957 -58.868 1.00 101.03 ? 280  DG  J N9    1 
ATOM   5720  C  C8    . DG  B  1  134 ? 35.621  44.182 -59.032 1.00 101.13 ? 280  DG  J C8    1 
ATOM   5721  N  N7    . DG  B  1  134 ? 35.931  45.450 -59.042 1.00 100.65 ? 280  DG  J N7    1 
ATOM   5722  C  C5    . DG  B  1  134 ? 34.718  46.101 -58.871 1.00 100.77 ? 280  DG  J C5    1 
ATOM   5723  C  C6    . DG  B  1  134 ? 34.418  47.491 -58.802 1.00 101.01 ? 280  DG  J C6    1 
ATOM   5724  O  O6    . DG  B  1  134 ? 35.192  48.455 -58.883 1.00 101.27 ? 280  DG  J O6    1 
ATOM   5725  N  N1    . DG  B  1  134 ? 33.057  47.709 -58.618 1.00 100.64 ? 280  DG  J N1    1 
ATOM   5726  C  C2    . DG  B  1  134 ? 32.105  46.724 -58.513 1.00 100.96 ? 280  DG  J C2    1 
ATOM   5727  N  N2    . DG  B  1  134 ? 30.844  47.138 -58.336 1.00 100.76 ? 280  DG  J N2    1 
ATOM   5728  N  N3    . DG  B  1  134 ? 32.370  45.429 -58.578 1.00 100.72 ? 280  DG  J N3    1 
ATOM   5729  C  C4    . DG  B  1  134 ? 33.687  45.193 -58.756 1.00 100.66 ? 280  DG  J C4    1 
ATOM   5730  P  P     . DG  B  1  135 ? 32.395  39.018 -60.713 1.00 107.04 ? 281  DG  J P     1 
ATOM   5731  O  OP1   . DG  B  1  135 ? 32.120  37.659 -60.186 1.00 106.92 ? 281  DG  J OP1   1 
ATOM   5732  O  OP2   . DG  B  1  135 ? 33.583  39.247 -61.573 1.00 107.03 ? 281  DG  J OP2   1 
ATOM   5733  O  "O5'" . DG  B  1  135 ? 31.106  39.520 -61.494 1.00 109.29 ? 281  DG  J "O5'" 1 
ATOM   5734  C  "C5'" . DG  B  1  135 ? 29.877  39.722 -60.803 1.00 113.15 ? 281  DG  J "C5'" 1 
ATOM   5735  C  "C4'" . DG  B  1  135 ? 29.041  40.756 -61.521 1.00 115.80 ? 281  DG  J "C4'" 1 
ATOM   5736  O  "O4'" . DG  B  1  135 ? 29.473  42.099 -61.184 1.00 116.08 ? 281  DG  J "O4'" 1 
ATOM   5737  C  "C3'" . DG  B  1  135 ? 29.113  40.648 -63.043 1.00 117.60 ? 281  DG  J "C3'" 1 
ATOM   5738  O  "O3'" . DG  B  1  135 ? 27.810  40.763 -63.613 1.00 120.50 ? 281  DG  J "O3'" 1 
ATOM   5739  C  "C2'" . DG  B  1  135 ? 29.993  41.818 -63.447 1.00 116.88 ? 281  DG  J "C2'" 1 
ATOM   5740  C  "C1'" . DG  B  1  135 ? 29.693  42.848 -62.371 1.00 116.03 ? 281  DG  J "C1'" 1 
ATOM   5741  N  N9    . DG  B  1  135 ? 30.788  43.784 -62.122 1.00 115.24 ? 281  DG  J N9    1 
ATOM   5742  C  C8    . DG  B  1  135 ? 32.088  43.468 -61.811 1.00 115.23 ? 281  DG  J C8    1 
ATOM   5743  N  N7    . DG  B  1  135 ? 32.851  44.517 -61.666 1.00 114.68 ? 281  DG  J N7    1 
ATOM   5744  C  C5    . DG  B  1  135 ? 32.005  45.594 -61.890 1.00 114.23 ? 281  DG  J C5    1 
ATOM   5745  C  C6    . DG  B  1  135 ? 32.269  46.991 -61.874 1.00 113.57 ? 281  DG  J C6    1 
ATOM   5746  O  O6    . DG  B  1  135 ? 33.340  47.572 -61.661 1.00 112.11 ? 281  DG  J O6    1 
ATOM   5747  N  N1    . DG  B  1  135 ? 31.124  47.729 -62.149 1.00 113.77 ? 281  DG  J N1    1 
ATOM   5748  C  C2    . DG  B  1  135 ? 29.885  47.197 -62.411 1.00 114.52 ? 281  DG  J C2    1 
ATOM   5749  N  N2    . DG  B  1  135 ? 28.905  48.079 -62.652 1.00 115.00 ? 281  DG  J N2    1 
ATOM   5750  N  N3    . DG  B  1  135 ? 29.626  45.898 -62.435 1.00 114.74 ? 281  DG  J N3    1 
ATOM   5751  C  C4    . DG  B  1  135 ? 30.724  45.160 -62.166 1.00 114.79 ? 281  DG  J C4    1 
ATOM   5752  P  P     . DT  B  1  136 ? 27.653  40.879 -65.204 1.00 122.46 ? 282  DT  J P     1 
ATOM   5753  O  OP1   . DT  B  1  136 ? 26.299  40.392 -65.575 1.00 122.28 ? 282  DT  J OP1   1 
ATOM   5754  O  OP2   . DT  B  1  136 ? 28.855  40.262 -65.826 1.00 121.74 ? 282  DT  J OP2   1 
ATOM   5755  O  "O5'" . DT  B  1  136 ? 27.707  42.450 -65.445 1.00 123.13 ? 282  DT  J "O5'" 1 
ATOM   5756  C  "C5'" . DT  B  1  136 ? 26.725  43.301 -64.862 1.00 124.68 ? 282  DT  J "C5'" 1 
ATOM   5757  C  "C4'" . DT  B  1  136 ? 26.597  44.567 -65.673 1.00 126.22 ? 282  DT  J "C4'" 1 
ATOM   5758  O  "O4'" . DT  B  1  136 ? 27.616  45.520 -65.283 1.00 125.74 ? 282  DT  J "O4'" 1 
ATOM   5759  C  "C3'" . DT  B  1  136 ? 26.769  44.339 -67.175 1.00 127.70 ? 282  DT  J "C3'" 1 
ATOM   5760  O  "O3'" . DT  B  1  136 ? 25.801  45.087 -67.909 1.00 130.63 ? 282  DT  J "O3'" 1 
ATOM   5761  C  "C2'" . DT  B  1  136 ? 28.173  44.849 -67.454 1.00 126.65 ? 282  DT  J "C2'" 1 
ATOM   5762  C  "C1'" . DT  B  1  136 ? 28.319  45.962 -66.433 1.00 125.36 ? 282  DT  J "C1'" 1 
ATOM   5763  N  N1    . DT  B  1  136 ? 29.709  46.258 -66.034 1.00 123.88 ? 282  DT  J N1    1 
ATOM   5764  C  C2    . DT  B  1  136 ? 30.090  47.578 -65.952 1.00 122.89 ? 282  DT  J C2    1 
ATOM   5765  O  O2    . DT  B  1  136 ? 29.335  48.503 -66.194 1.00 122.43 ? 282  DT  J O2    1 
ATOM   5766  N  N3    . DT  B  1  136 ? 31.394  47.776 -65.577 1.00 122.42 ? 282  DT  J N3    1 
ATOM   5767  C  C4    . DT  B  1  136 ? 32.336  46.808 -65.286 1.00 122.53 ? 282  DT  J C4    1 
ATOM   5768  O  O4    . DT  B  1  136 ? 33.474  47.139 -64.964 1.00 121.91 ? 282  DT  J O4    1 
ATOM   5769  C  C5    . DT  B  1  136 ? 31.870  45.443 -65.393 1.00 122.82 ? 282  DT  J C5    1 
ATOM   5770  C  C7    . DT  B  1  136 ? 32.820  44.326 -65.100 1.00 122.52 ? 282  DT  J C7    1 
ATOM   5771  C  C6    . DT  B  1  136 ? 30.596  45.240 -65.754 1.00 123.37 ? 282  DT  J C6    1 
ATOM   5772  P  P     . DG  B  1  137 ? 25.673  44.877 -69.495 1.00 132.35 ? 283  DG  J P     1 
ATOM   5773  O  OP1   . DG  B  1  137 ? 24.231  44.961 -69.841 1.00 132.48 ? 283  DG  J OP1   1 
ATOM   5774  O  OP2   . DG  B  1  137 ? 26.451  43.671 -69.879 1.00 132.21 ? 283  DG  J OP2   1 
ATOM   5775  O  "O5'" . DG  B  1  137 ? 26.407  46.160 -70.085 1.00 133.48 ? 283  DG  J "O5'" 1 
ATOM   5776  C  "C5'" . DG  B  1  137 ? 26.030  47.468 -69.661 1.00 135.29 ? 283  DG  J "C5'" 1 
ATOM   5777  C  "C4'" . DG  B  1  137 ? 26.966  48.494 -70.251 1.00 136.88 ? 283  DG  J "C4'" 1 
ATOM   5778  O  "O4'" . DG  B  1  137 ? 28.264  48.412 -69.612 1.00 137.69 ? 283  DG  J "O4'" 1 
ATOM   5779  C  "C3'" . DG  B  1  137 ? 27.220  48.309 -71.748 1.00 137.73 ? 283  DG  J "C3'" 1 
ATOM   5780  O  "O3'" . DG  B  1  137 ? 27.334  49.586 -72.371 1.00 138.45 ? 283  DG  J "O3'" 1 
ATOM   5781  C  "C2'" . DG  B  1  137 ? 28.565  47.609 -71.783 1.00 137.95 ? 283  DG  J "C2'" 1 
ATOM   5782  C  "C1'" . DG  B  1  137 ? 29.263  48.263 -70.608 1.00 138.34 ? 283  DG  J "C1'" 1 
ATOM   5783  N  N9    . DG  B  1  137 ? 30.368  47.499 -70.039 1.00 138.80 ? 283  DG  J N9    1 
ATOM   5784  C  C8    . DG  B  1  137 ? 30.511  46.132 -70.006 1.00 138.84 ? 283  DG  J C8    1 
ATOM   5785  N  N7    . DG  B  1  137 ? 31.628  45.747 -69.451 1.00 138.85 ? 283  DG  J N7    1 
ATOM   5786  C  C5    . DG  B  1  137 ? 32.258  46.931 -69.090 1.00 138.99 ? 283  DG  J C5    1 
ATOM   5787  C  C6    . DG  B  1  137 ? 33.505  47.150 -68.452 1.00 139.04 ? 283  DG  J C6    1 
ATOM   5788  O  O6    . DG  B  1  137 ? 34.331  46.313 -68.067 1.00 139.36 ? 283  DG  J O6    1 
ATOM   5789  N  N1    . DG  B  1  137 ? 33.757  48.507 -68.273 1.00 138.86 ? 283  DG  J N1    1 
ATOM   5790  C  C2    . DG  B  1  137 ? 32.920  49.524 -68.659 1.00 138.55 ? 283  DG  J C2    1 
ATOM   5791  N  N2    . DG  B  1  137 ? 33.344  50.771 -68.399 1.00 138.30 ? 283  DG  J N2    1 
ATOM   5792  N  N3    . DG  B  1  137 ? 31.756  49.334 -69.257 1.00 138.52 ? 283  DG  J N3    1 
ATOM   5793  C  C4    . DG  B  1  137 ? 31.490  48.021 -69.439 1.00 138.86 ? 283  DG  J C4    1 
ATOM   5794  P  P     . DG  B  1  138 ? 26.607  49.857 -73.775 1.00 139.03 ? 284  DG  J P     1 
ATOM   5795  O  OP1   . DG  B  1  138 ? 25.142  49.941 -73.540 1.00 138.61 ? 284  DG  J OP1   1 
ATOM   5796  O  OP2   . DG  B  1  138 ? 27.138  48.876 -74.757 1.00 139.00 ? 284  DG  J OP2   1 
ATOM   5797  O  "O5'" . DG  B  1  138 ? 27.141  51.301 -74.172 1.00 138.49 ? 284  DG  J "O5'" 1 
ATOM   5798  C  "C5'" . DG  B  1  138 ? 27.254  52.326 -73.189 1.00 137.97 ? 284  DG  J "C5'" 1 
ATOM   5799  C  "C4'" . DG  B  1  138 ? 28.650  52.900 -73.192 1.00 137.79 ? 284  DG  J "C4'" 1 
ATOM   5800  O  "O4'" . DG  B  1  138 ? 29.585  51.986 -72.561 1.00 137.66 ? 284  DG  J "O4'" 1 
ATOM   5801  C  "C3'" . DG  B  1  138 ? 29.204  53.175 -74.591 1.00 137.90 ? 284  DG  J "C3'" 1 
ATOM   5802  O  "O3'" . DG  B  1  138 ? 29.904  54.419 -74.603 1.00 137.95 ? 284  DG  J "O3'" 1 
ATOM   5803  C  "C2'" . DG  B  1  138 ? 30.181  52.034 -74.814 1.00 137.79 ? 284  DG  J "C2'" 1 
ATOM   5804  C  "C1'" . DG  B  1  138 ? 30.710  51.812 -73.412 1.00 137.39 ? 284  DG  J "C1'" 1 
ATOM   5805  N  N9    . DG  B  1  138 ? 31.275  50.486 -73.169 1.00 136.60 ? 284  DG  J N9    1 
ATOM   5806  C  C8    . DG  B  1  138 ? 30.731  49.273 -73.516 1.00 136.31 ? 284  DG  J C8    1 
ATOM   5807  N  N7    . DG  B  1  138 ? 31.476  48.257 -73.171 1.00 135.81 ? 284  DG  J N7    1 
ATOM   5808  C  C5    . DG  B  1  138 ? 32.582  48.833 -72.559 1.00 135.70 ? 284  DG  J C5    1 
ATOM   5809  C  C6    . DG  B  1  138 ? 33.734  48.230 -71.979 1.00 135.25 ? 284  DG  J C6    1 
ATOM   5810  O  O6    . DG  B  1  138 ? 34.015  47.027 -71.885 1.00 134.42 ? 284  DG  J O6    1 
ATOM   5811  N  N1    . DG  B  1  138 ? 34.609  49.186 -71.472 1.00 134.99 ? 284  DG  J N1    1 
ATOM   5812  C  C2    . DG  B  1  138 ? 34.407  50.544 -71.514 1.00 135.12 ? 284  DG  J C2    1 
ATOM   5813  N  N2    . DG  B  1  138 ? 35.370  51.300 -70.969 1.00 134.99 ? 284  DG  J N2    1 
ATOM   5814  N  N3    . DG  B  1  138 ? 33.340  51.117 -72.050 1.00 135.41 ? 284  DG  J N3    1 
ATOM   5815  C  C4    . DG  B  1  138 ? 32.474  50.209 -72.549 1.00 135.91 ? 284  DG  J C4    1 
ATOM   5816  P  P     . DA  B  1  139 ? 30.436  55.016 -75.994 1.00 137.90 ? 285  DA  J P     1 
ATOM   5817  O  OP1   . DA  B  1  139 ? 29.812  56.347 -76.201 1.00 138.11 ? 285  DA  J OP1   1 
ATOM   5818  O  OP2   . DA  B  1  139 ? 30.284  53.962 -77.032 1.00 137.61 ? 285  DA  J OP2   1 
ATOM   5819  O  "O5'" . DA  B  1  139 ? 31.989  55.232 -75.728 1.00 136.77 ? 285  DA  J "O5'" 1 
ATOM   5820  C  "C5'" . DA  B  1  139 ? 32.433  56.126 -74.714 1.00 135.04 ? 285  DA  J "C5'" 1 
ATOM   5821  C  "C4'" . DA  B  1  139 ? 33.938  56.229 -74.745 1.00 133.81 ? 285  DA  J "C4'" 1 
ATOM   5822  O  "O4'" . DA  B  1  139 ? 34.513  54.985 -74.272 1.00 133.76 ? 285  DA  J "O4'" 1 
ATOM   5823  C  "C3'" . DA  B  1  139 ? 34.502  56.452 -76.148 1.00 132.43 ? 285  DA  J "C3'" 1 
ATOM   5824  O  "O3'" . DA  B  1  139 ? 35.605  57.360 -76.098 1.00 130.35 ? 285  DA  J "O3'" 1 
ATOM   5825  C  "C2'" . DA  B  1  139 ? 34.939  55.063 -76.576 1.00 132.74 ? 285  DA  J "C2'" 1 
ATOM   5826  C  "C1'" . DA  B  1  139 ? 35.365  54.431 -75.263 1.00 133.00 ? 285  DA  J "C1'" 1 
ATOM   5827  N  N9    . DA  B  1  139 ? 35.215  52.976 -75.228 1.00 132.61 ? 285  DA  J N9    1 
ATOM   5828  C  C8    . DA  B  1  139 ? 34.193  52.222 -75.752 1.00 132.24 ? 285  DA  J C8    1 
ATOM   5829  N  N7    . DA  B  1  139 ? 34.342  50.932 -75.573 1.00 131.93 ? 285  DA  J N7    1 
ATOM   5830  C  C5    . DA  B  1  139 ? 35.541  50.828 -74.881 1.00 131.86 ? 285  DA  J C5    1 
ATOM   5831  C  C6    . DA  B  1  139 ? 36.257  49.721 -74.390 1.00 131.58 ? 285  DA  J C6    1 
ATOM   5832  N  N6    . DA  B  1  139 ? 35.853  48.456 -74.529 1.00 131.04 ? 285  DA  J N6    1 
ATOM   5833  N  N1    . DA  B  1  139 ? 37.418  49.962 -73.743 1.00 131.52 ? 285  DA  J N1    1 
ATOM   5834  C  C2    . DA  B  1  139 ? 37.823  51.231 -73.605 1.00 131.75 ? 285  DA  J C2    1 
ATOM   5835  N  N3    . DA  B  1  139 ? 37.240  52.353 -74.022 1.00 131.82 ? 285  DA  J N3    1 
ATOM   5836  C  C4    . DA  B  1  139 ? 36.089  52.079 -74.660 1.00 132.14 ? 285  DA  J C4    1 
ATOM   5837  P  P     . DT  B  1  140 ? 36.702  57.351 -77.272 1.00 128.66 ? 286  DT  J P     1 
ATOM   5838  O  OP1   . DT  B  1  140 ? 37.288  58.714 -77.350 1.00 128.70 ? 286  DT  J OP1   1 
ATOM   5839  O  OP2   . DT  B  1  140 ? 36.106  56.739 -78.489 1.00 128.34 ? 286  DT  J OP2   1 
ATOM   5840  O  "O5'" . DT  B  1  140 ? 37.820  56.370 -76.703 1.00 126.60 ? 286  DT  J "O5'" 1 
ATOM   5841  C  "C5'" . DT  B  1  140 ? 38.355  56.568 -75.394 1.00 122.19 ? 286  DT  J "C5'" 1 
ATOM   5842  C  "C4'" . DT  B  1  140 ? 39.685  55.866 -75.258 1.00 119.07 ? 286  DT  J "C4'" 1 
ATOM   5843  O  "O4'" . DT  B  1  140 ? 39.481  54.434 -75.191 1.00 117.85 ? 286  DT  J "O4'" 1 
ATOM   5844  C  "C3'" . DT  B  1  140 ? 40.650  56.104 -76.420 1.00 117.17 ? 286  DT  J "C3'" 1 
ATOM   5845  O  "O3'" . DT  B  1  140 ? 41.986  56.251 -75.929 1.00 114.34 ? 286  DT  J "O3'" 1 
ATOM   5846  C  "C2'" . DT  B  1  140 ? 40.509  54.845 -77.259 1.00 116.42 ? 286  DT  J "C2'" 1 
ATOM   5847  C  "C1'" . DT  B  1  140 ? 40.232  53.786 -76.207 1.00 115.99 ? 286  DT  J "C1'" 1 
ATOM   5848  N  N1    . DT  B  1  140 ? 39.445  52.632 -76.683 1.00 114.18 ? 286  DT  J N1    1 
ATOM   5849  C  C2    . DT  B  1  140 ? 39.900  51.369 -76.376 1.00 113.22 ? 286  DT  J C2    1 
ATOM   5850  O  O2    . DT  B  1  140 ? 40.923  51.163 -75.743 1.00 112.93 ? 286  DT  J O2    1 
ATOM   5851  N  N3    . DT  B  1  140 ? 39.108  50.349 -76.840 1.00 112.18 ? 286  DT  J N3    1 
ATOM   5852  C  C4    . DT  B  1  140 ? 37.938  50.463 -77.564 1.00 111.92 ? 286  DT  J C4    1 
ATOM   5853  O  O4    . DT  B  1  140 ? 37.331  49.453 -77.908 1.00 110.55 ? 286  DT  J O4    1 
ATOM   5854  C  C5    . DT  B  1  140 ? 37.525  51.816 -77.858 1.00 112.33 ? 286  DT  J C5    1 
ATOM   5855  C  C7    . DT  B  1  140 ? 36.272  52.037 -78.645 1.00 112.52 ? 286  DT  J C7    1 
ATOM   5856  C  C6    . DT  B  1  140 ? 38.289  52.820 -77.408 1.00 113.00 ? 286  DT  J C6    1 
ATOM   5857  P  P     . DA  B  1  141 ? 43.223  56.158 -76.947 1.00 112.41 ? 287  DA  J P     1 
ATOM   5858  O  OP1   . DA  B  1  141 ? 44.424  56.751 -76.307 1.00 112.74 ? 287  DA  J OP1   1 
ATOM   5859  O  OP2   . DA  B  1  141 ? 42.774  56.658 -78.273 1.00 112.62 ? 287  DA  J OP2   1 
ATOM   5860  O  "O5'" . DA  B  1  141 ? 43.458  54.592 -77.076 1.00 109.33 ? 287  DA  J "O5'" 1 
ATOM   5861  C  "C5'" . DA  B  1  141 ? 44.671  54.083 -77.603 1.00 103.56 ? 287  DA  J "C5'" 1 
ATOM   5862  C  "C4'" . DA  B  1  141 ? 45.173  52.954 -76.736 1.00 99.09  ? 287  DA  J "C4'" 1 
ATOM   5863  O  "O4'" . DA  B  1  141 ? 44.114  51.989 -76.547 1.00 97.58  ? 287  DA  J "O4'" 1 
ATOM   5864  C  "C3'" . DA  B  1  141 ? 46.327  52.192 -77.370 1.00 96.74  ? 287  DA  J "C3'" 1 
ATOM   5865  O  "O3'" . DA  B  1  141 ? 47.257  51.771 -76.376 1.00 92.69  ? 287  DA  J "O3'" 1 
ATOM   5866  C  "C2'" . DA  B  1  141 ? 45.647  51.031 -78.073 1.00 96.44  ? 287  DA  J "C2'" 1 
ATOM   5867  C  "C1'" . DA  B  1  141 ? 44.380  50.791 -77.265 1.00 96.10  ? 287  DA  J "C1'" 1 
ATOM   5868  N  N9    . DA  B  1  141 ? 43.206  50.516 -78.096 1.00 94.97  ? 287  DA  J N9    1 
ATOM   5869  C  C8    . DA  B  1  141 ? 42.399  51.440 -78.712 1.00 94.33  ? 287  DA  J C8    1 
ATOM   5870  N  N7    . DA  B  1  141 ? 41.401  50.912 -79.378 1.00 93.78  ? 287  DA  J N7    1 
ATOM   5871  C  C5    . DA  B  1  141 ? 41.565  49.547 -79.195 1.00 94.33  ? 287  DA  J C5    1 
ATOM   5872  C  C6    . DA  B  1  141 ? 40.829  48.437 -79.648 1.00 94.46  ? 287  DA  J C6    1 
ATOM   5873  N  N6    . DA  B  1  141 ? 39.734  48.532 -80.406 1.00 94.14  ? 287  DA  J N6    1 
ATOM   5874  N  N1    . DA  B  1  141 ? 41.261  47.208 -79.290 1.00 94.20  ? 287  DA  J N1    1 
ATOM   5875  C  C2    . DA  B  1  141 ? 42.359  47.113 -78.531 1.00 94.31  ? 287  DA  J C2    1 
ATOM   5876  N  N3    . DA  B  1  141 ? 43.134  48.080 -78.041 1.00 94.34  ? 287  DA  J N3    1 
ATOM   5877  C  C4    . DA  B  1  141 ? 42.677  49.288 -78.413 1.00 94.73  ? 287  DA  J C4    1 
ATOM   5878  P  P     . DT  B  1  142 ? 48.696  51.228 -76.828 1.00 91.93  ? 288  DT  J P     1 
ATOM   5879  O  OP1   . DT  B  1  142 ? 49.594  51.210 -75.644 1.00 91.13  ? 288  DT  J OP1   1 
ATOM   5880  O  OP2   . DT  B  1  142 ? 49.104  51.980 -78.045 1.00 90.96  ? 288  DT  J OP2   1 
ATOM   5881  O  "O5'" . DT  B  1  142 ? 48.378  49.724 -77.247 1.00 87.99  ? 288  DT  J "O5'" 1 
ATOM   5882  C  "C5'" . DT  B  1  142 ? 47.783  48.826 -76.313 1.00 81.84  ? 288  DT  J "C5'" 1 
ATOM   5883  C  "C4'" . DT  B  1  142 ? 47.685  47.441 -76.907 1.00 77.36  ? 288  DT  J "C4'" 1 
ATOM   5884  O  "O4'" . DT  B  1  142 ? 46.478  47.294 -77.693 1.00 76.58  ? 288  DT  J "O4'" 1 
ATOM   5885  C  "C3'" . DT  B  1  142 ? 48.848  47.065 -77.825 1.00 75.01  ? 288  DT  J "C3'" 1 
ATOM   5886  O  "O3'" . DT  B  1  142 ? 49.252  45.719 -77.548 1.00 69.87  ? 288  DT  J "O3'" 1 
ATOM   5887  C  "C2'" . DT  B  1  142 ? 48.248  47.200 -79.217 1.00 75.09  ? 288  DT  J "C2'" 1 
ATOM   5888  C  "C1'" . DT  B  1  142 ? 46.805  46.787 -78.978 1.00 76.15  ? 288  DT  J "C1'" 1 
ATOM   5889  N  N1    . DT  B  1  142 ? 45.809  47.308 -79.941 1.00 77.68  ? 288  DT  J N1    1 
ATOM   5890  C  C2    . DT  B  1  142 ? 44.880  46.424 -80.456 1.00 78.14  ? 288  DT  J C2    1 
ATOM   5891  O  O2    . DT  B  1  142 ? 44.872  45.233 -80.197 1.00 77.72  ? 288  DT  J O2    1 
ATOM   5892  N  N3    . DT  B  1  142 ? 43.956  46.990 -81.298 1.00 79.52  ? 288  DT  J N3    1 
ATOM   5893  C  C4    . DT  B  1  142 ? 43.874  48.313 -81.680 1.00 80.07  ? 288  DT  J C4    1 
ATOM   5894  O  O4    . DT  B  1  142 ? 42.973  48.673 -82.435 1.00 80.42  ? 288  DT  J O4    1 
ATOM   5895  C  C5    . DT  B  1  142 ? 44.896  49.180 -81.127 1.00 79.25  ? 288  DT  J C5    1 
ATOM   5896  C  C7    . DT  B  1  142 ? 44.900  50.629 -81.499 1.00 79.36  ? 288  DT  J C7    1 
ATOM   5897  C  C6    . DT  B  1  142 ? 45.799  48.639 -80.297 1.00 78.16  ? 288  DT  J C6    1 
ATOM   5898  P  P     . DT  B  1  143 ? 50.664  45.174 -78.093 1.00 68.35  ? 289  DT  J P     1 
ATOM   5899  O  OP1   . DT  B  1  143 ? 51.364  44.485 -76.974 1.00 68.06  ? 289  DT  J OP1   1 
ATOM   5900  O  OP2   . DT  B  1  143 ? 51.351  46.258 -78.841 1.00 66.67  ? 289  DT  J OP2   1 
ATOM   5901  O  "O5'" . DT  B  1  143 ? 50.222  44.071 -79.143 1.00 65.93  ? 289  DT  J "O5'" 1 
ATOM   5902  C  "C5'" . DT  B  1  143 ? 49.006  44.230 -79.840 1.00 63.96  ? 289  DT  J "C5'" 1 
ATOM   5903  C  "C4'" . DT  B  1  143 ? 48.477  42.896 -80.296 1.00 60.34  ? 289  DT  J "C4'" 1 
ATOM   5904  O  "O4'" . DT  B  1  143 ? 47.238  43.162 -80.980 1.00 59.66  ? 289  DT  J "O4'" 1 
ATOM   5905  C  "C3'" . DT  B  1  143 ? 49.370  42.214 -81.322 1.00 57.30  ? 289  DT  J "C3'" 1 
ATOM   5906  O  "O3'" . DT  B  1  143 ? 49.169  40.800 -81.258 1.00 51.55  ? 289  DT  J "O3'" 1 
ATOM   5907  C  "C2'" . DT  B  1  143 ? 48.896  42.813 -82.633 1.00 57.62  ? 289  DT  J "C2'" 1 
ATOM   5908  C  "C1'" . DT  B  1  143 ? 47.417  43.092 -82.384 1.00 59.80  ? 289  DT  J "C1'" 1 
ATOM   5909  N  N1    . DT  B  1  143 ? 46.926  44.368 -82.944 1.00 61.17  ? 289  DT  J N1    1 
ATOM   5910  C  C2    . DT  B  1  143 ? 45.744  44.354 -83.650 1.00 61.22  ? 289  DT  J C2    1 
ATOM   5911  O  O2    . DT  B  1  143 ? 45.098  43.338 -83.848 1.00 60.70  ? 289  DT  J O2    1 
ATOM   5912  N  N3    . DT  B  1  143 ? 45.343  45.581 -84.117 1.00 61.31  ? 289  DT  J N3    1 
ATOM   5913  C  C4    . DT  B  1  143 ? 45.993  46.790 -83.957 1.00 62.13  ? 289  DT  J C4    1 
ATOM   5914  O  O4    . DT  B  1  143 ? 45.509  47.812 -84.436 1.00 64.59  ? 289  DT  J O4    1 
ATOM   5915  C  C5    . DT  B  1  143 ? 47.230  46.732 -83.212 1.00 62.33  ? 289  DT  J C5    1 
ATOM   5916  C  C7    . DT  B  1  143 ? 48.005  47.994 -82.992 1.00 60.33  ? 289  DT  J C7    1 
ATOM   5917  C  C6    . DT  B  1  143 ? 47.630  45.539 -82.750 1.00 60.93  ? 289  DT  J C6    1 
ATOM   5918  P  P     . DG  B  1  144 ? 50.143  39.819 -82.074 1.00 49.37  ? 290  DG  J P     1 
ATOM   5919  O  OP1   . DG  B  1  144 ? 50.125  38.482 -81.403 1.00 48.87  ? 290  DG  J OP1   1 
ATOM   5920  O  OP2   . DG  B  1  144 ? 51.432  40.513 -82.288 1.00 48.78  ? 290  DG  J OP2   1 
ATOM   5921  O  "O5'" . DG  B  1  144 ? 49.426  39.673 -83.484 1.00 53.44  ? 290  DG  J "O5'" 1 
ATOM   5922  C  "C5'" . DG  B  1  144 ? 48.135  39.079 -83.575 1.00 59.02  ? 290  DG  J "C5'" 1 
ATOM   5923  C  "C4'" . DG  B  1  144 ? 47.622  39.161 -84.991 1.00 63.47  ? 290  DG  J "C4'" 1 
ATOM   5924  O  "O4'" . DG  B  1  144 ? 47.278  40.529 -85.316 1.00 64.34  ? 290  DG  J "O4'" 1 
ATOM   5925  C  "C3'" . DG  B  1  144 ? 48.639  38.724 -86.045 1.00 66.35  ? 290  DG  J "C3'" 1 
ATOM   5926  O  "O3'" . DG  B  1  144 ? 47.947  38.074 -87.107 1.00 70.44  ? 290  DG  J "O3'" 1 
ATOM   5927  C  "C2'" . DG  B  1  144 ? 49.203  40.040 -86.545 1.00 65.89  ? 290  DG  J "C2'" 1 
ATOM   5928  C  "C1'" . DG  B  1  144 ? 47.961  40.900 -86.502 1.00 65.97  ? 290  DG  J "C1'" 1 
ATOM   5929  N  N9    . DG  B  1  144 ? 48.183  42.339 -86.468 1.00 67.15  ? 290  DG  J N9    1 
ATOM   5930  C  C8    . DG  B  1  144 ? 49.273  43.021 -85.981 1.00 68.63  ? 290  DG  J C8    1 
ATOM   5931  N  N7    . DG  B  1  144 ? 49.163  44.315 -86.108 1.00 68.26  ? 290  DG  J N7    1 
ATOM   5932  C  C5    . DG  B  1  144 ? 47.927  44.494 -86.712 1.00 68.32  ? 290  DG  J C5    1 
ATOM   5933  C  C6    . DG  B  1  144 ? 47.257  45.678 -87.106 1.00 69.02  ? 290  DG  J C6    1 
ATOM   5934  O  O6    . DG  B  1  144 ? 47.632  46.852 -86.992 1.00 70.30  ? 290  DG  J O6    1 
ATOM   5935  N  N1    . DG  B  1  144 ? 46.026  45.396 -87.688 1.00 68.66  ? 290  DG  J N1    1 
ATOM   5936  C  C2    . DG  B  1  144 ? 45.506  44.136 -87.872 1.00 68.82  ? 290  DG  J C2    1 
ATOM   5937  N  N2    . DG  B  1  144 ? 44.308  44.061 -88.461 1.00 67.77  ? 290  DG  J N2    1 
ATOM   5938  N  N3    . DG  B  1  144 ? 46.119  43.030 -87.508 1.00 68.19  ? 290  DG  J N3    1 
ATOM   5939  C  C4    . DG  B  1  144 ? 47.314  43.281 -86.939 1.00 68.07  ? 290  DG  J C4    1 
ATOM   5940  P  P     . DA  B  1  145 ? 48.764  37.202 -88.178 1.00 72.30  ? 291  DA  J P     1 
ATOM   5941  O  OP1   . DA  B  1  145 ? 48.762  35.794 -87.697 1.00 73.05  ? 291  DA  J OP1   1 
ATOM   5942  O  OP2   . DA  B  1  145 ? 50.055  37.879 -88.466 1.00 69.98  ? 291  DA  J OP2   1 
ATOM   5943  O  "O5'" . DA  B  1  145 ? 47.842  37.294 -89.471 1.00 72.81  ? 291  DA  J "O5'" 1 
ATOM   5944  C  "C5'" . DA  B  1  145 ? 46.430  37.125 -89.368 1.00 73.72  ? 291  DA  J "C5'" 1 
ATOM   5945  C  "C4'" . DA  B  1  145 ? 45.736  37.852 -90.496 1.00 75.40  ? 291  DA  J "C4'" 1 
ATOM   5946  O  "O4'" . DA  B  1  145 ? 45.759  39.283 -90.263 1.00 73.79  ? 291  DA  J "O4'" 1 
ATOM   5947  C  "C3'" . DA  B  1  145 ? 46.379  37.631 -91.866 1.00 76.15  ? 291  DA  J "C3'" 1 
ATOM   5948  O  "O3'" . DA  B  1  145 ? 45.372  37.470 -92.867 1.00 80.00  ? 291  DA  J "O3'" 1 
ATOM   5949  C  "C2'" . DA  B  1  145 ? 47.169  38.906 -92.097 1.00 74.93  ? 291  DA  J "C2'" 1 
ATOM   5950  C  "C1'" . DA  B  1  145 ? 46.333  39.950 -91.376 1.00 72.65  ? 291  DA  J "C1'" 1 
ATOM   5951  N  N9    . DA  B  1  145 ? 47.114  41.082 -90.876 1.00 70.78  ? 291  DA  J N9    1 
ATOM   5952  C  C8    . DA  B  1  145 ? 48.289  41.043 -90.168 1.00 69.69  ? 291  DA  J C8    1 
ATOM   5953  N  N7    . DA  B  1  145 ? 48.775  42.227 -89.884 1.00 69.18  ? 291  DA  J N7    1 
ATOM   5954  C  C5    . DA  B  1  145 ? 47.854  43.106 -90.433 1.00 69.64  ? 291  DA  J C5    1 
ATOM   5955  C  C6    . DA  B  1  145 ? 47.798  44.513 -90.484 1.00 69.57  ? 291  DA  J C6    1 
ATOM   5956  N  N6    . DA  B  1  145 ? 48.727  45.312 -89.953 1.00 69.19  ? 291  DA  J N6    1 
ATOM   5957  N  N1    . DA  B  1  145 ? 46.744  45.078 -91.111 1.00 68.94  ? 291  DA  J N1    1 
ATOM   5958  C  C2    . DA  B  1  145 ? 45.818  44.279 -91.650 1.00 69.68  ? 291  DA  J C2    1 
ATOM   5959  N  N3    . DA  B  1  145 ? 45.761  42.948 -91.673 1.00 70.49  ? 291  DA  J N3    1 
ATOM   5960  C  C4    . DA  B  1  145 ? 46.822  42.415 -91.041 1.00 70.41  ? 291  DA  J C4    1 
ATOM   5961  P  P     . DT  B  1  146 ? 45.795  37.091 -94.374 1.00 81.73  ? 292  DT  J P     1 
ATOM   5962  O  OP1   . DT  B  1  146 ? 44.704  36.247 -94.926 1.00 81.59  ? 292  DT  J OP1   1 
ATOM   5963  O  OP2   . DT  B  1  146 ? 47.191  36.574 -94.365 1.00 80.04  ? 292  DT  J OP2   1 
ATOM   5964  O  "O5'" . DT  B  1  146 ? 45.781  38.498 -95.123 1.00 79.44  ? 292  DT  J "O5'" 1 
ATOM   5965  C  "C5'" . DT  B  1  146 ? 44.583  39.269 -95.181 1.00 79.77  ? 292  DT  J "C5'" 1 
ATOM   5966  C  "C4'" . DT  B  1  146 ? 44.831  40.591 -95.871 1.00 80.71  ? 292  DT  J "C4'" 1 
ATOM   5967  O  "O4'" . DT  B  1  146 ? 45.556  41.505 -95.008 1.00 79.83  ? 292  DT  J "O4'" 1 
ATOM   5968  C  "C3'" . DT  B  1  146 ? 45.633  40.510 -97.173 1.00 81.02  ? 292  DT  J "C3'" 1 
ATOM   5969  O  "O3'" . DT  B  1  146 ? 45.157  41.506 -98.081 1.00 82.40  ? 292  DT  J "O3'" 1 
ATOM   5970  C  "C2'" . DT  B  1  146 ? 47.010  40.989 -96.753 1.00 80.62  ? 292  DT  J "C2'" 1 
ATOM   5971  C  "C1'" . DT  B  1  146 ? 46.636  42.056 -95.740 1.00 79.62  ? 292  DT  J "C1'" 1 
ATOM   5972  N  N1    . DT  B  1  146 ? 47.702  42.449 -94.797 1.00 78.63  ? 292  DT  J N1    1 
ATOM   5973  C  C2    . DT  B  1  146 ? 47.853  43.794 -94.532 1.00 78.86  ? 292  DT  J C2    1 
ATOM   5974  O  O2    . DT  B  1  146 ? 47.120  44.652 -94.995 1.00 78.46  ? 292  DT  J O2    1 
ATOM   5975  N  N3    . DT  B  1  146 ? 48.898  44.100 -93.698 1.00 78.91  ? 292  DT  J N3    1 
ATOM   5976  C  C4    . DT  B  1  146 ? 49.783  43.219 -93.110 1.00 78.85  ? 292  DT  J C4    1 
ATOM   5977  O  O4    . DT  B  1  146 ? 50.688  43.647 -92.399 1.00 79.64  ? 292  DT  J O4    1 
ATOM   5978  C  C5    . DT  B  1  146 ? 49.550  41.819 -93.406 1.00 78.31  ? 292  DT  J C5    1 
ATOM   5979  C  C7    . DT  B  1  146 ? 50.448  40.789 -92.797 1.00 77.56  ? 292  DT  J C7    1 
ATOM   5980  C  C6    . DT  B  1  146 ? 48.532  41.509 -94.221 1.00 77.96  ? 292  DT  J C6    1 
ATOM   5981  N  N     . PRO C  2  38  ? 112.983 24.981 -80.072 1.00 92.68  ? 438  PRO A N     1 
ATOM   5982  C  CA    . PRO C  2  38  ? 111.943 26.034 -80.154 1.00 92.35  ? 438  PRO A CA    1 
ATOM   5983  C  C     . PRO C  2  38  ? 110.656 25.546 -79.508 1.00 91.36  ? 438  PRO A C     1 
ATOM   5984  O  O     . PRO C  2  38  ? 109.638 25.367 -80.179 1.00 91.96  ? 438  PRO A O     1 
ATOM   5985  C  CB    . PRO C  2  38  ? 111.725 26.310 -81.634 1.00 92.81  ? 438  PRO A CB    1 
ATOM   5986  C  CG    . PRO C  2  38  ? 113.120 26.047 -82.197 1.00 93.28  ? 438  PRO A CG    1 
ATOM   5987  C  CD    . PRO C  2  38  ? 113.810 24.989 -81.295 1.00 93.17  ? 438  PRO A CD    1 
ATOM   5988  N  N     . HIS C  2  39  ? 110.688 25.362 -78.194 1.00 89.62  ? 439  HIS A N     1 
ATOM   5989  C  CA    . HIS C  2  39  ? 109.510 24.861 -77.517 1.00 87.08  ? 439  HIS A CA    1 
ATOM   5990  C  C     . HIS C  2  39  ? 108.379 25.834 -77.262 1.00 84.55  ? 439  HIS A C     1 
ATOM   5991  O  O     . HIS C  2  39  ? 108.593 26.982 -76.857 1.00 84.55  ? 439  HIS A O     1 
ATOM   5992  C  CB    . HIS C  2  39  ? 109.852 24.159 -76.215 1.00 88.58  ? 439  HIS A CB    1 
ATOM   5993  C  CG    . HIS C  2  39  ? 108.678 23.476 -75.613 1.00 89.73  ? 439  HIS A CG    1 
ATOM   5994  N  ND1   . HIS C  2  39  ? 107.754 24.143 -74.839 1.00 90.50  ? 439  HIS A ND1   1 
ATOM   5995  C  CD2   . HIS C  2  39  ? 108.204 22.220 -75.768 1.00 90.14  ? 439  HIS A CD2   1 
ATOM   5996  C  CE1   . HIS C  2  39  ? 106.760 23.328 -74.553 1.00 91.42  ? 439  HIS A CE1   1 
ATOM   5997  N  NE2   . HIS C  2  39  ? 107.007 22.153 -75.104 1.00 90.47  ? 439  HIS A NE2   1 
ATOM   5998  N  N     . ARG C  2  40  ? 107.160 25.338 -77.450 1.00 80.51  ? 440  ARG A N     1 
ATOM   5999  C  CA    . ARG C  2  40  ? 105.987 26.159 -77.226 1.00 76.20  ? 440  ARG A CA    1 
ATOM   6000  C  C     . ARG C  2  40  ? 104.730 25.356 -76.925 1.00 73.15  ? 440  ARG A C     1 
ATOM   6001  O  O     . ARG C  2  40  ? 104.255 24.573 -77.751 1.00 71.95  ? 440  ARG A O     1 
ATOM   6002  C  CB    . ARG C  2  40  ? 105.746 27.079 -78.415 1.00 75.45  ? 440  ARG A CB    1 
ATOM   6003  C  CG    . ARG C  2  40  ? 104.940 28.286 -78.032 1.00 74.68  ? 440  ARG A CG    1 
ATOM   6004  C  CD    . ARG C  2  40  ? 104.665 29.174 -79.211 1.00 72.39  ? 440  ARG A CD    1 
ATOM   6005  N  NE    . ARG C  2  40  ? 103.794 30.274 -78.822 1.00 71.01  ? 440  ARG A NE    1 
ATOM   6006  C  CZ    . ARG C  2  40  ? 104.206 31.335 -78.143 1.00 70.44  ? 440  ARG A CZ    1 
ATOM   6007  N  NH1   . ARG C  2  40  ? 105.476 31.436 -77.782 1.00 69.26  ? 440  ARG A NH1   1 
ATOM   6008  N  NH2   . ARG C  2  40  ? 103.352 32.298 -77.831 1.00 69.58  ? 440  ARG A NH2   1 
ATOM   6009  N  N     . TYR C  2  41  ? 104.220 25.544 -75.712 1.00 69.32  ? 441  TYR A N     1 
ATOM   6010  C  CA    . TYR C  2  41  ? 103.006 24.875 -75.270 1.00 65.48  ? 441  TYR A CA    1 
ATOM   6011  C  C     . TYR C  2  41  ? 101.810 25.562 -75.902 1.00 62.73  ? 441  TYR A C     1 
ATOM   6012  O  O     . TYR C  2  41  ? 101.785 26.785 -76.036 1.00 61.34  ? 441  TYR A O     1 
ATOM   6013  C  CB    . TYR C  2  41  ? 102.891 24.913 -73.743 1.00 63.43  ? 441  TYR A CB    1 
ATOM   6014  C  CG    . TYR C  2  41  ? 103.828 23.953 -73.055 1.00 61.81  ? 441  TYR A CG    1 
ATOM   6015  C  CD1   . TYR C  2  41  ? 104.860 24.414 -72.229 1.00 61.51  ? 441  TYR A CD1   1 
ATOM   6016  C  CD2   . TYR C  2  41  ? 103.715 22.578 -73.268 1.00 61.40  ? 441  TYR A CD2   1 
ATOM   6017  C  CE1   . TYR C  2  41  ? 105.765 23.523 -71.637 1.00 61.57  ? 441  TYR A CE1   1 
ATOM   6018  C  CE2   . TYR C  2  41  ? 104.610 21.681 -72.685 1.00 61.94  ? 441  TYR A CE2   1 
ATOM   6019  C  CZ    . TYR C  2  41  ? 105.634 22.157 -71.876 1.00 62.49  ? 441  TYR A CZ    1 
ATOM   6020  O  OH    . TYR C  2  41  ? 106.547 21.266 -71.355 1.00 63.26  ? 441  TYR A OH    1 
ATOM   6021  N  N     . ARG C  2  42  ? 100.841 24.768 -76.334 1.00 61.12  ? 442  ARG A N     1 
ATOM   6022  C  CA    . ARG C  2  42  ? 99.650  25.323 -76.952 1.00 61.40  ? 442  ARG A CA    1 
ATOM   6023  C  C     . ARG C  2  42  ? 98.755  26.035 -75.940 1.00 59.05  ? 442  ARG A C     1 
ATOM   6024  O  O     . ARG C  2  42  ? 98.774  25.724 -74.747 1.00 58.59  ? 442  ARG A O     1 
ATOM   6025  C  CB    . ARG C  2  42  ? 98.883  24.231 -77.689 1.00 63.90  ? 442  ARG A CB    1 
ATOM   6026  C  CG    . ARG C  2  42  ? 99.594  23.755 -78.945 1.00 69.30  ? 442  ARG A CG    1 
ATOM   6027  C  CD    . ARG C  2  42  ? 98.766  22.734 -79.681 1.00 74.30  ? 442  ARG A CD    1 
ATOM   6028  N  NE    . ARG C  2  42  ? 98.343  21.665 -78.785 1.00 79.58  ? 442  ARG A NE    1 
ATOM   6029  C  CZ    . ARG C  2  42  ? 97.096  21.216 -78.695 1.00 82.42  ? 442  ARG A CZ    1 
ATOM   6030  N  NH1   . ARG C  2  42  ? 96.141  21.747 -79.450 1.00 82.60  ? 442  ARG A NH1   1 
ATOM   6031  N  NH2   . ARG C  2  42  ? 96.804  20.234 -77.849 1.00 83.71  ? 442  ARG A NH2   1 
ATOM   6032  N  N     . PRO C  2  43  ? 97.981  27.030 -76.402 1.00 57.13  ? 443  PRO A N     1 
ATOM   6033  C  CA    . PRO C  2  43  ? 97.087  27.775 -75.512 1.00 55.27  ? 443  PRO A CA    1 
ATOM   6034  C  C     . PRO C  2  43  ? 96.207  26.826 -74.706 1.00 54.49  ? 443  PRO A C     1 
ATOM   6035  O  O     . PRO C  2  43  ? 95.534  25.959 -75.272 1.00 52.60  ? 443  PRO A O     1 
ATOM   6036  C  CB    . PRO C  2  43  ? 96.260  28.607 -76.491 1.00 55.57  ? 443  PRO A CB    1 
ATOM   6037  C  CG    . PRO C  2  43  ? 97.229  28.865 -77.607 1.00 56.58  ? 443  PRO A CG    1 
ATOM   6038  C  CD    . PRO C  2  43  ? 97.864  27.512 -77.790 1.00 56.15  ? 443  PRO A CD    1 
ATOM   6039  N  N     . GLY C  2  44  ? 96.255  26.961 -73.383 1.00 53.08  ? 444  GLY A N     1 
ATOM   6040  C  CA    . GLY C  2  44  ? 95.447  26.111 -72.525 1.00 52.74  ? 444  GLY A CA    1 
ATOM   6041  C  C     . GLY C  2  44  ? 96.231  25.093 -71.720 1.00 52.30  ? 444  GLY A C     1 
ATOM   6042  O  O     . GLY C  2  44  ? 95.853  24.768 -70.598 1.00 52.14  ? 444  GLY A O     1 
ATOM   6043  N  N     . THR C  2  45  ? 97.336  24.608 -72.280 1.00 51.62  ? 445  THR A N     1 
ATOM   6044  C  CA    . THR C  2  45  ? 98.168  23.611 -71.611 1.00 50.72  ? 445  THR A CA    1 
ATOM   6045  C  C     . THR C  2  45  ? 98.765  24.131 -70.303 1.00 49.42  ? 445  THR A C     1 
ATOM   6046  O  O     . THR C  2  45  ? 98.691  23.469 -69.269 1.00 50.32  ? 445  THR A O     1 
ATOM   6047  C  CB    . THR C  2  45  ? 99.312  23.133 -72.536 1.00 52.41  ? 445  THR A CB    1 
ATOM   6048  O  OG1   . THR C  2  45  ? 98.754  22.526 -73.709 1.00 50.70  ? 445  THR A OG1   1 
ATOM   6049  C  CG2   . THR C  2  45  ? 100.200 22.119 -71.817 1.00 51.69  ? 445  THR A CG2   1 
ATOM   6050  N  N     . VAL C  2  46  ? 99.379  25.304 -70.352 1.00 48.35  ? 446  VAL A N     1 
ATOM   6051  C  CA    . VAL C  2  46  ? 99.970  25.868 -69.150 1.00 48.31  ? 446  VAL A CA    1 
ATOM   6052  C  C     . VAL C  2  46  ? 98.862  26.305 -68.189 1.00 47.89  ? 446  VAL A C     1 
ATOM   6053  O  O     . VAL C  2  46  ? 98.994  26.149 -66.979 1.00 47.53  ? 446  VAL A O     1 
ATOM   6054  C  CB    . VAL C  2  46  ? 100.898 27.053 -69.473 1.00 49.15  ? 446  VAL A CB    1 
ATOM   6055  C  CG1   . VAL C  2  46  ? 101.616 27.518 -68.213 1.00 48.83  ? 446  VAL A CG1   1 
ATOM   6056  C  CG2   . VAL C  2  46  ? 101.900 26.654 -70.554 1.00 49.94  ? 446  VAL A CG2   1 
ATOM   6057  N  N     . ALA C  2  47  ? 97.768  26.835 -68.730 1.00 47.22  ? 447  ALA A N     1 
ATOM   6058  C  CA    . ALA C  2  47  ? 96.641  27.259 -67.898 1.00 48.02  ? 447  ALA A CA    1 
ATOM   6059  C  C     . ALA C  2  47  ? 96.175  26.064 -67.073 1.00 48.30  ? 447  ALA A C     1 
ATOM   6060  O  O     . ALA C  2  47  ? 96.023  26.162 -65.852 1.00 47.87  ? 447  ALA A O     1 
ATOM   6061  C  CB    . ALA C  2  47  ? 95.506  27.778 -68.762 1.00 46.18  ? 447  ALA A CB    1 
ATOM   6062  N  N     . LEU C  2  48  ? 96.000  24.927 -67.741 1.00 48.06  ? 448  LEU A N     1 
ATOM   6063  C  CA    . LEU C  2  48  ? 95.566  23.700 -67.079 1.00 50.71  ? 448  LEU A CA    1 
ATOM   6064  C  C     . LEU C  2  48  ? 96.580  23.300 -66.013 1.00 50.67  ? 448  LEU A C     1 
ATOM   6065  O  O     . LEU C  2  48  ? 96.219  22.867 -64.919 1.00 50.37  ? 448  LEU A O     1 
ATOM   6066  C  CB    . LEU C  2  48  ? 95.420  22.580 -68.110 1.00 51.50  ? 448  LEU A CB    1 
ATOM   6067  C  CG    . LEU C  2  48  ? 94.050  21.913 -68.288 1.00 53.52  ? 448  LEU A CG    1 
ATOM   6068  C  CD1   . LEU C  2  48  ? 92.926  22.923 -68.186 1.00 53.67  ? 448  LEU A CD1   1 
ATOM   6069  C  CD2   . LEU C  2  48  ? 94.013  21.213 -69.642 1.00 53.74  ? 448  LEU A CD2   1 
ATOM   6070  N  N     . ARG C  2  49  ? 97.855  23.452 -66.347 1.00 50.25  ? 449  ARG A N     1 
ATOM   6071  C  CA    . ARG C  2  49  ? 98.940  23.126 -65.438 1.00 50.58  ? 449  ARG A CA    1 
ATOM   6072  C  C     . ARG C  2  49  ? 98.850  24.016 -64.192 1.00 49.02  ? 449  ARG A C     1 
ATOM   6073  O  O     . ARG C  2  49  ? 99.032  23.548 -63.069 1.00 48.03  ? 449  ARG A O     1 
ATOM   6074  C  CB    . ARG C  2  49  ? 100.277 23.315 -66.170 1.00 53.69  ? 449  ARG A CB    1 
ATOM   6075  C  CG    . ARG C  2  49  ? 101.532 23.018 -65.363 1.00 57.49  ? 449  ARG A CG    1 
ATOM   6076  C  CD    . ARG C  2  49  ? 102.676 22.590 -66.288 1.00 61.25  ? 449  ARG A CD    1 
ATOM   6077  N  NE    . ARG C  2  49  ? 103.290 23.709 -66.992 1.00 62.34  ? 449  ARG A NE    1 
ATOM   6078  C  CZ    . ARG C  2  49  ? 103.568 23.713 -68.291 1.00 62.96  ? 449  ARG A CZ    1 
ATOM   6079  N  NH1   . ARG C  2  49  ? 103.286 22.648 -69.036 1.00 62.40  ? 449  ARG A NH1   1 
ATOM   6080  N  NH2   . ARG C  2  49  ? 104.116 24.787 -68.845 1.00 62.62  ? 449  ARG A NH2   1 
ATOM   6081  N  N     . GLU C  2  50  ? 98.540  25.292 -64.399 1.00 48.09  ? 450  GLU A N     1 
ATOM   6082  C  CA    . GLU C  2  50  ? 98.416  26.241 -63.295 1.00 48.62  ? 450  GLU A CA    1 
ATOM   6083  C  C     . GLU C  2  50  ? 97.225  25.894 -62.397 1.00 47.65  ? 450  GLU A C     1 
ATOM   6084  O  O     . GLU C  2  50  ? 97.313  25.997 -61.171 1.00 46.95  ? 450  GLU A O     1 
ATOM   6085  C  CB    . GLU C  2  50  ? 98.283  27.669 -63.825 1.00 49.79  ? 450  GLU A CB    1 
ATOM   6086  C  CG    . GLU C  2  50  ? 99.538  28.211 -64.494 1.00 55.61  ? 450  GLU A CG    1 
ATOM   6087  C  CD    . GLU C  2  50  ? 99.351  29.613 -65.079 1.00 59.86  ? 450  GLU A CD    1 
ATOM   6088  O  OE1   . GLU C  2  50  ? 98.442  30.351 -64.627 1.00 60.04  ? 450  GLU A OE1   1 
ATOM   6089  O  OE2   . GLU C  2  50  ? 100.117 29.974 -66.002 1.00 62.45  ? 450  GLU A OE2   1 
ATOM   6090  N  N     . ILE C  2  51  ? 96.112  25.481 -62.999 1.00 46.33  ? 451  ILE A N     1 
ATOM   6091  C  CA    . ILE C  2  51  ? 94.933  25.120 -62.212 1.00 44.94  ? 451  ILE A CA    1 
ATOM   6092  C  C     . ILE C  2  51  ? 95.292  23.997 -61.247 1.00 45.78  ? 451  ILE A C     1 
ATOM   6093  O  O     . ILE C  2  51  ? 94.983  24.070 -60.055 1.00 43.99  ? 451  ILE A O     1 
ATOM   6094  C  CB    . ILE C  2  51  ? 93.763  24.649 -63.102 1.00 45.07  ? 451  ILE A CB    1 
ATOM   6095  C  CG1   . ILE C  2  51  ? 93.231  25.816 -63.937 1.00 45.32  ? 451  ILE A CG1   1 
ATOM   6096  C  CG2   . ILE C  2  51  ? 92.653  24.038 -62.242 1.00 42.93  ? 451  ILE A CG2   1 
ATOM   6097  C  CD1   . ILE C  2  51  ? 92.180  25.417 -64.970 1.00 44.27  ? 451  ILE A CD1   1 
ATOM   6098  N  N     . ARG C  2  52  ? 95.955  22.961 -61.758 1.00 45.45  ? 452  ARG A N     1 
ATOM   6099  C  CA    . ARG C  2  52  ? 96.346  21.836 -60.917 1.00 46.72  ? 452  ARG A CA    1 
ATOM   6100  C  C     . ARG C  2  52  ? 97.315  22.248 -59.810 1.00 46.22  ? 452  ARG A C     1 
ATOM   6101  O  O     . ARG C  2  52  ? 97.235  21.755 -58.685 1.00 44.86  ? 452  ARG A O     1 
ATOM   6102  C  CB    . ARG C  2  52  ? 96.938  20.705 -61.764 1.00 49.75  ? 452  ARG A CB    1 
ATOM   6103  C  CG    . ARG C  2  52  ? 95.932  20.110 -62.743 1.00 54.00  ? 452  ARG A CG    1 
ATOM   6104  C  CD    . ARG C  2  52  ? 96.431  18.821 -63.388 1.00 58.03  ? 452  ARG A CD    1 
ATOM   6105  N  NE    . ARG C  2  52  ? 95.374  18.180 -64.173 1.00 61.34  ? 452  ARG A NE    1 
ATOM   6106  C  CZ    . ARG C  2  52  ? 95.258  18.274 -65.496 1.00 62.57  ? 452  ARG A CZ    1 
ATOM   6107  N  NH1   . ARG C  2  52  ? 96.142  18.977 -66.194 1.00 62.26  ? 452  ARG A NH1   1 
ATOM   6108  N  NH2   . ARG C  2  52  ? 94.233  17.699 -66.118 1.00 61.75  ? 452  ARG A NH2   1 
ATOM   6109  N  N     . ARG C  2  53  ? 98.220  23.167 -60.121 1.00 46.77  ? 453  ARG A N     1 
ATOM   6110  C  CA    . ARG C  2  53  ? 99.183  23.625 -59.133 1.00 48.37  ? 453  ARG A CA    1 
ATOM   6111  C  C     . ARG C  2  53  ? 98.519  24.401 -57.990 1.00 47.65  ? 453  ARG A C     1 
ATOM   6112  O  O     . ARG C  2  53  ? 98.679  24.062 -56.816 1.00 47.92  ? 453  ARG A O     1 
ATOM   6113  C  CB    . ARG C  2  53  ? 100.248 24.494 -59.802 1.00 50.77  ? 453  ARG A CB    1 
ATOM   6114  C  CG    . ARG C  2  53  ? 101.194 25.173 -58.833 1.00 54.97  ? 453  ARG A CG    1 
ATOM   6115  C  CD    . ARG C  2  53  ? 102.144 26.097 -59.564 1.00 60.82  ? 453  ARG A CD    1 
ATOM   6116  N  NE    . ARG C  2  53  ? 102.792 27.037 -58.653 1.00 66.88  ? 453  ARG A NE    1 
ATOM   6117  C  CZ    . ARG C  2  53  ? 103.535 28.067 -59.046 1.00 69.59  ? 453  ARG A CZ    1 
ATOM   6118  N  NH1   . ARG C  2  53  ? 103.728 28.294 -60.341 1.00 71.08  ? 453  ARG A NH1   1 
ATOM   6119  N  NH2   . ARG C  2  53  ? 104.080 28.877 -58.147 1.00 70.75  ? 453  ARG A NH2   1 
ATOM   6120  N  N     . TYR C  2  54  ? 97.778  25.446 -58.336 1.00 45.55  ? 454  TYR A N     1 
ATOM   6121  C  CA    . TYR C  2  54  ? 97.124  26.258 -57.321 1.00 45.15  ? 454  TYR A CA    1 
ATOM   6122  C  C     . TYR C  2  54  ? 96.001  25.562 -56.554 1.00 43.34  ? 454  TYR A C     1 
ATOM   6123  O  O     . TYR C  2  54  ? 95.684  25.964 -55.435 1.00 43.13  ? 454  TYR A O     1 
ATOM   6124  C  CB    . TYR C  2  54  ? 96.660  27.586 -57.919 1.00 43.48  ? 454  TYR A CB    1 
ATOM   6125  C  CG    . TYR C  2  54  ? 97.818  28.426 -58.389 1.00 44.74  ? 454  TYR A CG    1 
ATOM   6126  C  CD1   . TYR C  2  54  ? 97.997  28.713 -59.744 1.00 45.88  ? 454  TYR A CD1   1 
ATOM   6127  C  CD2   . TYR C  2  54  ? 98.772  28.896 -57.484 1.00 46.28  ? 454  TYR A CD2   1 
ATOM   6128  C  CE1   . TYR C  2  54  ? 99.093  29.443 -60.186 1.00 47.17  ? 454  TYR A CE1   1 
ATOM   6129  C  CE2   . TYR C  2  54  ? 99.874  29.624 -57.914 1.00 46.43  ? 454  TYR A CE2   1 
ATOM   6130  C  CZ    . TYR C  2  54  ? 100.024 29.892 -59.267 1.00 48.47  ? 454  TYR A CZ    1 
ATOM   6131  O  OH    . TYR C  2  54  ? 101.099 30.616 -59.705 1.00 52.41  ? 454  TYR A OH    1 
ATOM   6132  N  N     . GLN C  2  55  ? 95.402  24.524 -57.133 1.00 41.23  ? 455  GLN A N     1 
ATOM   6133  C  CA    . GLN C  2  55  ? 94.338  23.816 -56.421 1.00 40.94  ? 455  GLN A CA    1 
ATOM   6134  C  C     . GLN C  2  55  ? 94.948  22.845 -55.424 1.00 43.96  ? 455  GLN A C     1 
ATOM   6135  O  O     . GLN C  2  55  ? 94.257  22.300 -54.555 1.00 42.70  ? 455  GLN A O     1 
ATOM   6136  C  CB    . GLN C  2  55  ? 93.403  23.079 -57.379 1.00 38.90  ? 455  GLN A CB    1 
ATOM   6137  C  CG    . GLN C  2  55  ? 92.460  24.004 -58.147 1.00 38.99  ? 455  GLN A CG    1 
ATOM   6138  C  CD    . GLN C  2  55  ? 91.365  23.264 -58.882 1.00 39.29  ? 455  GLN A CD    1 
ATOM   6139  O  OE1   . GLN C  2  55  ? 91.517  22.092 -59.245 1.00 39.14  ? 455  GLN A OE1   1 
ATOM   6140  N  NE2   . GLN C  2  55  ? 90.241  23.944 -59.102 1.00 38.32  ? 455  GLN A NE2   1 
ATOM   6141  N  N     . LYS C  2  56  ? 96.256  22.641 -55.540 1.00 45.91  ? 456  LYS A N     1 
ATOM   6142  C  CA    . LYS C  2  56  ? 96.951  21.736 -54.636 1.00 49.73  ? 456  LYS A CA    1 
ATOM   6143  C  C     . LYS C  2  56  ? 97.541  22.479 -53.438 1.00 49.56  ? 456  LYS A C     1 
ATOM   6144  O  O     . LYS C  2  56  ? 97.709  21.901 -52.367 1.00 51.85  ? 456  LYS A O     1 
ATOM   6145  C  CB    . LYS C  2  56  ? 98.061  20.987 -55.375 1.00 52.98  ? 456  LYS A CB    1 
ATOM   6146  C  CG    . LYS C  2  56  ? 98.719  19.907 -54.531 1.00 59.43  ? 456  LYS A CG    1 
ATOM   6147  C  CD    . LYS C  2  56  ? 99.822  19.184 -55.296 1.00 64.84  ? 456  LYS A CD    1 
ATOM   6148  C  CE    . LYS C  2  56  ? 100.477 18.107 -54.425 1.00 67.53  ? 456  LYS A CE    1 
ATOM   6149  N  NZ    . LYS C  2  56  ? 101.517 17.328 -55.160 1.00 69.62  ? 456  LYS A NZ    1 
ATOM   6150  N  N     . SER C  2  57  ? 97.850  23.760 -53.624 1.00 48.07  ? 457  SER A N     1 
ATOM   6151  C  CA    . SER C  2  57  ? 98.436  24.574 -52.561 1.00 47.40  ? 457  SER A CA    1 
ATOM   6152  C  C     . SER C  2  57  ? 97.407  25.420 -51.805 1.00 47.31  ? 457  SER A C     1 
ATOM   6153  O  O     . SER C  2  57  ? 96.259  25.555 -52.238 1.00 46.40  ? 457  SER A O     1 
ATOM   6154  C  CB    . SER C  2  57  ? 99.520  25.482 -53.135 1.00 45.64  ? 457  SER A CB    1 
ATOM   6155  O  OG    . SER C  2  57  ? 98.982  26.346 -54.110 1.00 49.00  ? 457  SER A OG    1 
ATOM   6156  N  N     . THR C  2  58  ? 97.851  26.035 -50.710 1.00 46.81  ? 458  THR A N     1 
ATOM   6157  C  CA    . THR C  2  58  ? 96.980  26.853 -49.872 1.00 46.81  ? 458  THR A CA    1 
ATOM   6158  C  C     . THR C  2  58  ? 97.487  28.269 -49.612 1.00 47.70  ? 458  THR A C     1 
ATOM   6159  O  O     . THR C  2  58  ? 96.801  29.073 -48.973 1.00 46.96  ? 458  THR A O     1 
ATOM   6160  C  CB    . THR C  2  58  ? 96.783  26.187 -48.500 1.00 46.93  ? 458  THR A CB    1 
ATOM   6161  O  OG1   . THR C  2  58  ? 98.020  26.217 -47.776 1.00 44.75  ? 458  THR A OG1   1 
ATOM   6162  C  CG2   . THR C  2  58  ? 96.344  24.731 -48.671 1.00 45.91  ? 458  THR A CG2   1 
ATOM   6163  N  N     . GLU C  2  59  ? 98.689  28.579 -50.077 1.00 48.15  ? 459  GLU A N     1 
ATOM   6164  C  CA    . GLU C  2  59  ? 99.233  29.908 -49.836 1.00 50.86  ? 459  GLU A CA    1 
ATOM   6165  C  C     . GLU C  2  59  ? 98.397  31.020 -50.449 1.00 49.61  ? 459  GLU A C     1 
ATOM   6166  O  O     . GLU C  2  59  ? 97.662  30.797 -51.410 1.00 49.53  ? 459  GLU A O     1 
ATOM   6167  C  CB    . GLU C  2  59  ? 100.687 30.002 -50.306 1.00 53.77  ? 459  GLU A CB    1 
ATOM   6168  C  CG    . GLU C  2  59  ? 101.098 28.975 -51.346 1.00 62.88  ? 459  GLU A CG    1 
ATOM   6169  C  CD    . GLU C  2  59  ? 100.820 29.418 -52.763 1.00 65.55  ? 459  GLU A CD    1 
ATOM   6170  O  OE1   . GLU C  2  59  ? 101.082 30.598 -53.072 1.00 70.29  ? 459  GLU A OE1   1 
ATOM   6171  O  OE2   . GLU C  2  59  ? 100.358 28.585 -53.570 1.00 67.26  ? 459  GLU A OE2   1 
ATOM   6172  N  N     . LEU C  2  60  ? 98.485  32.206 -49.853 1.00 47.21  ? 460  LEU A N     1 
ATOM   6173  C  CA    . LEU C  2  60  ? 97.753  33.362 -50.343 1.00 46.81  ? 460  LEU A CA    1 
ATOM   6174  C  C     . LEU C  2  60  ? 98.296  33.680 -51.722 1.00 46.61  ? 460  LEU A C     1 
ATOM   6175  O  O     . LEU C  2  60  ? 99.481  33.486 -51.986 1.00 46.78  ? 460  LEU A O     1 
ATOM   6176  C  CB    . LEU C  2  60  ? 97.910  34.542 -49.383 1.00 48.49  ? 460  LEU A CB    1 
ATOM   6177  C  CG    . LEU C  2  60  ? 97.277  34.263 -48.014 1.00 50.71  ? 460  LEU A CG    1 
ATOM   6178  C  CD1   . LEU C  2  60  ? 97.510  35.427 -47.061 1.00 52.49  ? 460  LEU A CD1   1 
ATOM   6179  C  CD2   . LEU C  2  60  ? 95.786  33.981 -48.179 1.00 51.48  ? 460  LEU A CD2   1 
ATOM   6180  N  N     . LEU C  2  61  ? 97.430  34.164 -52.605 1.00 46.01  ? 461  LEU A N     1 
ATOM   6181  C  CA    . LEU C  2  61  ? 97.829  34.437 -53.976 1.00 43.08  ? 461  LEU A CA    1 
ATOM   6182  C  C     . LEU C  2  61  ? 98.027  35.904 -54.320 1.00 43.26  ? 461  LEU A C     1 
ATOM   6183  O  O     . LEU C  2  61  ? 98.576  36.224 -55.371 1.00 43.42  ? 461  LEU A O     1 
ATOM   6184  C  CB    . LEU C  2  61  ? 96.836  33.770 -54.931 1.00 43.05  ? 461  LEU A CB    1 
ATOM   6185  C  CG    . LEU C  2  61  ? 96.646  32.267 -54.656 1.00 42.81  ? 461  LEU A CG    1 
ATOM   6186  C  CD1   . LEU C  2  61  ? 95.524  31.704 -55.498 1.00 42.57  ? 461  LEU A CD1   1 
ATOM   6187  C  CD2   . LEU C  2  61  ? 97.935  31.506 -54.916 1.00 44.15  ? 461  LEU A CD2   1 
ATOM   6188  N  N     . ILE C  2  62  ? 97.530  36.794 -53.474 1.00 42.19  ? 462  ILE A N     1 
ATOM   6189  C  CA    . ILE C  2  62  ? 97.716  38.223 -53.696 1.00 42.90  ? 462  ILE A CA    1 
ATOM   6190  C  C     . ILE C  2  62  ? 98.915  38.615 -52.831 1.00 44.46  ? 462  ILE A C     1 
ATOM   6191  O  O     . ILE C  2  62  ? 99.059  38.110 -51.723 1.00 43.16  ? 462  ILE A O     1 
ATOM   6192  C  CB    . ILE C  2  62  ? 96.509  39.044 -53.210 1.00 41.04  ? 462  ILE A CB    1 
ATOM   6193  C  CG1   . ILE C  2  62  ? 95.229  38.573 -53.899 1.00 42.84  ? 462  ILE A CG1   1 
ATOM   6194  C  CG2   . ILE C  2  62  ? 96.752  40.531 -53.480 1.00 40.51  ? 462  ILE A CG2   1 
ATOM   6195  C  CD1   . ILE C  2  62  ? 93.987  39.328 -53.458 1.00 40.29  ? 462  ILE A CD1   1 
ATOM   6196  N  N     . ARG C  2  63  ? 99.770  39.504 -53.320 1.00 46.16  ? 463  ARG A N     1 
ATOM   6197  C  CA    . ARG C  2  63  ? 100.927 39.916 -52.530 1.00 49.25  ? 463  ARG A CA    1 
ATOM   6198  C  C     . ARG C  2  63  ? 100.502 40.742 -51.319 1.00 48.59  ? 463  ARG A C     1 
ATOM   6199  O  O     . ARG C  2  63  ? 99.643  41.616 -51.424 1.00 47.36  ? 463  ARG A O     1 
ATOM   6200  C  CB    . ARG C  2  63  ? 101.938 40.665 -53.395 1.00 52.92  ? 463  ARG A CB    1 
ATOM   6201  C  CG    . ARG C  2  63  ? 102.909 39.729 -54.093 1.00 60.24  ? 463  ARG A CG    1 
ATOM   6202  C  CD    . ARG C  2  63  ? 102.885 39.894 -55.596 1.00 65.12  ? 463  ARG A CD    1 
ATOM   6203  N  NE    . ARG C  2  63  ? 103.884 40.853 -56.060 1.00 71.47  ? 463  ARG A NE    1 
ATOM   6204  C  CZ    . ARG C  2  63  ? 105.180 40.815 -55.749 1.00 73.09  ? 463  ARG A CZ    1 
ATOM   6205  N  NH1   . ARG C  2  63  ? 105.661 39.860 -54.959 1.00 73.99  ? 463  ARG A NH1   1 
ATOM   6206  N  NH2   . ARG C  2  63  ? 106.003 41.725 -56.254 1.00 72.52  ? 463  ARG A NH2   1 
ATOM   6207  N  N     . LYS C  2  64  ? 101.119 40.464 -50.176 1.00 49.04  ? 464  LYS A N     1 
ATOM   6208  C  CA    . LYS C  2  64  ? 100.776 41.130 -48.923 1.00 51.23  ? 464  LYS A CA    1 
ATOM   6209  C  C     . LYS C  2  64  ? 100.753 42.654 -48.895 1.00 50.76  ? 464  LYS A C     1 
ATOM   6210  O  O     . LYS C  2  64  ? 99.732  43.259 -48.560 1.00 50.25  ? 464  LYS A O     1 
ATOM   6211  C  CB    . LYS C  2  64  ? 101.657 40.602 -47.792 1.00 54.92  ? 464  LYS A CB    1 
ATOM   6212  C  CG    . LYS C  2  64  ? 101.510 39.107 -47.583 1.00 61.65  ? 464  LYS A CG    1 
ATOM   6213  C  CD    . LYS C  2  64  ? 102.481 38.581 -46.546 1.00 65.79  ? 464  LYS A CD    1 
ATOM   6214  C  CE    . LYS C  2  64  ? 102.403 37.064 -46.458 1.00 68.20  ? 464  LYS A CE    1 
ATOM   6215  N  NZ    . LYS C  2  64  ? 101.435 36.616 -45.408 1.00 71.69  ? 464  LYS A NZ    1 
ATOM   6216  N  N     . LEU C  2  65  ? 101.874 43.279 -49.238 1.00 50.10  ? 465  LEU A N     1 
ATOM   6217  C  CA    . LEU C  2  65  ? 101.957 44.737 -49.209 1.00 48.23  ? 465  LEU A CA    1 
ATOM   6218  C  C     . LEU C  2  65  ? 100.858 45.454 -49.979 1.00 45.99  ? 465  LEU A C     1 
ATOM   6219  O  O     . LEU C  2  65  ? 100.209 46.349 -49.449 1.00 47.23  ? 465  LEU A O     1 
ATOM   6220  C  CB    . LEU C  2  65  ? 103.334 45.211 -49.688 1.00 49.30  ? 465  LEU A CB    1 
ATOM   6221  C  CG    . LEU C  2  65  ? 103.568 46.721 -49.586 1.00 51.37  ? 465  LEU A CG    1 
ATOM   6222  C  CD1   . LEU C  2  65  ? 103.408 47.186 -48.141 1.00 49.75  ? 465  LEU A CD1   1 
ATOM   6223  C  CD2   . LEU C  2  65  ? 104.959 47.069 -50.109 1.00 52.88  ? 465  LEU A CD2   1 
ATOM   6224  N  N     . PRO C  2  66  ? 100.643 45.087 -51.250 1.00 45.61  ? 466  PRO A N     1 
ATOM   6225  C  CA    . PRO C  2  66  ? 99.592  45.756 -52.025 1.00 44.77  ? 466  PRO A CA    1 
ATOM   6226  C  C     . PRO C  2  66  ? 98.232  45.582 -51.354 1.00 45.37  ? 466  PRO A C     1 
ATOM   6227  O  O     . PRO C  2  66  ? 97.429  46.520 -51.285 1.00 44.90  ? 466  PRO A O     1 
ATOM   6228  C  CB    . PRO C  2  66  ? 99.629  45.018 -53.361 1.00 44.29  ? 466  PRO A CB    1 
ATOM   6229  C  CG    . PRO C  2  66  ? 101.035 44.522 -53.447 1.00 45.84  ? 466  PRO A CG    1 
ATOM   6230  C  CD    . PRO C  2  66  ? 101.308 44.047 -52.053 1.00 43.82  ? 466  PRO A CD    1 
ATOM   6231  N  N     . PHE C  2  67  ? 97.985  44.381 -50.840 1.00 44.89  ? 467  PHE A N     1 
ATOM   6232  C  CA    . PHE C  2  67  ? 96.711  44.106 -50.188 1.00 45.70  ? 467  PHE A CA    1 
ATOM   6233  C  C     . PHE C  2  67  ? 96.552  44.986 -48.961 1.00 46.11  ? 467  PHE A C     1 
ATOM   6234  O  O     . PHE C  2  67  ? 95.496  45.583 -48.756 1.00 45.40  ? 467  PHE A O     1 
ATOM   6235  C  CB    . PHE C  2  67  ? 96.595  42.637 -49.784 1.00 43.66  ? 467  PHE A CB    1 
ATOM   6236  C  CG    . PHE C  2  67  ? 95.242  42.272 -49.240 1.00 43.24  ? 467  PHE A CG    1 
ATOM   6237  C  CD1   . PHE C  2  67  ? 94.195  41.952 -50.104 1.00 43.44  ? 467  PHE A CD1   1 
ATOM   6238  C  CD2   . PHE C  2  67  ? 95.003  42.275 -47.869 1.00 41.92  ? 467  PHE A CD2   1 
ATOM   6239  C  CE1   . PHE C  2  67  ? 92.926  41.641 -49.606 1.00 42.31  ? 467  PHE A CE1   1 
ATOM   6240  C  CE2   . PHE C  2  67  ? 93.735  41.965 -47.359 1.00 43.24  ? 467  PHE A CE2   1 
ATOM   6241  C  CZ    . PHE C  2  67  ? 92.698  41.649 -48.225 1.00 41.72  ? 467  PHE A CZ    1 
ATOM   6242  N  N     . GLN C  2  68  ? 97.614  45.087 -48.166 1.00 47.31  ? 468  GLN A N     1 
ATOM   6243  C  CA    . GLN C  2  68  ? 97.575  45.900 -46.957 1.00 48.81  ? 468  GLN A CA    1 
ATOM   6244  C  C     . GLN C  2  68  ? 97.309  47.373 -47.256 1.00 46.64  ? 468  GLN A C     1 
ATOM   6245  O  O     . GLN C  2  68  ? 96.576  48.030 -46.521 1.00 47.24  ? 468  GLN A O     1 
ATOM   6246  C  CB    . GLN C  2  68  ? 98.859  45.749 -46.144 1.00 51.91  ? 468  GLN A CB    1 
ATOM   6247  C  CG    . GLN C  2  68  ? 98.756  46.407 -44.772 1.00 59.29  ? 468  GLN A CG    1 
ATOM   6248  C  CD    . GLN C  2  68  ? 99.952  46.121 -43.893 1.00 63.20  ? 468  GLN A CD    1 
ATOM   6249  O  OE1   . GLN C  2  68  ? 100.833 46.969 -43.739 1.00 66.88  ? 468  GLN A OE1   1 
ATOM   6250  N  NE2   . GLN C  2  68  ? 99.999  44.919 -43.318 1.00 61.88  ? 468  GLN A NE2   1 
ATOM   6251  N  N     . ARG C  2  69  ? 97.911  47.899 -48.317 1.00 45.78  ? 469  ARG A N     1 
ATOM   6252  C  CA    . ARG C  2  69  ? 97.681  49.300 -48.685 1.00 46.40  ? 469  ARG A CA    1 
ATOM   6253  C  C     . ARG C  2  69  ? 96.212  49.493 -49.024 1.00 45.21  ? 469  ARG A C     1 
ATOM   6254  O  O     . ARG C  2  69  ? 95.588  50.477 -48.612 1.00 44.57  ? 469  ARG A O     1 
ATOM   6255  C  CB    . ARG C  2  69  ? 98.525  49.712 -49.899 1.00 48.25  ? 469  ARG A CB    1 
ATOM   6256  C  CG    . ARG C  2  69  ? 100.014 49.891 -49.612 1.00 53.01  ? 469  ARG A CG    1 
ATOM   6257  C  CD    . ARG C  2  69  ? 100.696 50.691 -50.716 1.00 53.60  ? 469  ARG A CD    1 
ATOM   6258  N  NE    . ARG C  2  69  ? 100.484 50.102 -52.034 1.00 55.80  ? 469  ARG A NE    1 
ATOM   6259  C  CZ    . ARG C  2  69  ? 101.368 49.324 -52.655 1.00 57.25  ? 469  ARG A CZ    1 
ATOM   6260  N  NH1   . ARG C  2  69  ? 102.531 49.045 -52.074 1.00 57.02  ? 469  ARG A NH1   1 
ATOM   6261  N  NH2   . ARG C  2  69  ? 101.090 48.824 -53.852 1.00 55.38  ? 469  ARG A NH2   1 
ATOM   6262  N  N     . LEU C  2  70  ? 95.669  48.541 -49.782 1.00 43.18  ? 470  LEU A N     1 
ATOM   6263  C  CA    . LEU C  2  70  ? 94.274  48.591 -50.190 1.00 41.54  ? 470  LEU A CA    1 
ATOM   6264  C  C     . LEU C  2  70  ? 93.370  48.638 -48.978 1.00 41.19  ? 470  LEU A C     1 
ATOM   6265  O  O     . LEU C  2  70  ? 92.483  49.483 -48.882 1.00 41.74  ? 470  LEU A O     1 
ATOM   6266  C  CB    . LEU C  2  70  ? 93.920  47.373 -51.043 1.00 43.12  ? 470  LEU A CB    1 
ATOM   6267  C  CG    . LEU C  2  70  ? 92.472  47.332 -51.545 1.00 42.62  ? 470  LEU A CG    1 
ATOM   6268  C  CD1   . LEU C  2  70  ? 92.164  48.591 -52.354 1.00 43.19  ? 470  LEU A CD1   1 
ATOM   6269  C  CD2   . LEU C  2  70  ? 92.273  46.099 -52.410 1.00 42.04  ? 470  LEU A CD2   1 
ATOM   6270  N  N     . VAL C  2  71  ? 93.608  47.724 -48.049 1.00 41.25  ? 471  VAL A N     1 
ATOM   6271  C  CA    . VAL C  2  71  ? 92.825  47.650 -46.834 1.00 42.15  ? 471  VAL A CA    1 
ATOM   6272  C  C     . VAL C  2  71  ? 92.882  48.965 -46.060 1.00 43.68  ? 471  VAL A C     1 
ATOM   6273  O  O     . VAL C  2  71  ? 91.846  49.520 -45.679 1.00 43.08  ? 471  VAL A O     1 
ATOM   6274  C  CB    . VAL C  2  71  ? 93.312  46.481 -45.945 1.00 41.69  ? 471  VAL A CB    1 
ATOM   6275  C  CG1   . VAL C  2  71  ? 92.787  46.634 -44.520 1.00 40.85  ? 471  VAL A CG1   1 
ATOM   6276  C  CG2   . VAL C  2  71  ? 92.848  45.149 -46.545 1.00 42.22  ? 471  VAL A CG2   1 
ATOM   6277  N  N     . ARG C  2  72  ? 94.094  49.463 -45.834 1.00 44.72  ? 472  ARG A N     1 
ATOM   6278  C  CA    . ARG C  2  72  ? 94.270  50.709 -45.091 1.00 45.78  ? 472  ARG A CA    1 
ATOM   6279  C  C     . ARG C  2  72  ? 93.558  51.875 -45.759 1.00 44.65  ? 472  ARG A C     1 
ATOM   6280  O  O     . ARG C  2  72  ? 92.887  52.664 -45.095 1.00 44.97  ? 472  ARG A O     1 
ATOM   6281  C  CB    . ARG C  2  72  ? 95.759  51.010 -44.899 1.00 46.60  ? 472  ARG A CB    1 
ATOM   6282  C  CG    . ARG C  2  72  ? 96.437  50.014 -43.975 1.00 47.30  ? 472  ARG A CG    1 
ATOM   6283  C  CD    . ARG C  2  72  ? 97.931  50.256 -43.853 1.00 49.94  ? 472  ARG A CD    1 
ATOM   6284  N  NE    . ARG C  2  72  ? 98.573  49.159 -43.134 1.00 49.84  ? 472  ARG A NE    1 
ATOM   6285  C  CZ    . ARG C  2  72  ? 98.628  49.062 -41.810 1.00 50.02  ? 472  ARG A CZ    1 
ATOM   6286  N  NH1   . ARG C  2  72  ? 98.090  50.004 -41.051 1.00 48.74  ? 472  ARG A NH1   1 
ATOM   6287  N  NH2   . ARG C  2  72  ? 99.194  48.005 -41.242 1.00 50.16  ? 472  ARG A NH2   1 
ATOM   6288  N  N     . GLU C  2  73  ? 93.666  51.958 -47.079 1.00 44.77  ? 473  GLU A N     1 
ATOM   6289  C  CA    . GLU C  2  73  ? 93.012  53.033 -47.811 1.00 46.98  ? 473  GLU A CA    1 
ATOM   6290  C  C     . GLU C  2  73  ? 91.500  52.986 -47.618 1.00 46.63  ? 473  GLU A C     1 
ATOM   6291  O  O     . GLU C  2  73  ? 90.858  54.015 -47.388 1.00 46.96  ? 473  GLU A O     1 
ATOM   6292  C  CB    . GLU C  2  73  ? 93.325  52.936 -49.298 1.00 50.09  ? 473  GLU A CB    1 
ATOM   6293  C  CG    . GLU C  2  73  ? 92.520  53.904 -50.142 1.00 56.84  ? 473  GLU A CG    1 
ATOM   6294  C  CD    . GLU C  2  73  ? 92.670  53.642 -51.629 1.00 61.74  ? 473  GLU A CD    1 
ATOM   6295  O  OE1   . GLU C  2  73  ? 93.650  54.138 -52.223 1.00 63.35  ? 473  GLU A OE1   1 
ATOM   6296  O  OE2   . GLU C  2  73  ? 91.807  52.934 -52.199 1.00 65.02  ? 473  GLU A OE2   1 
ATOM   6297  N  N     . ILE C  2  74  ? 90.922  51.795 -47.735 1.00 43.22  ? 474  ILE A N     1 
ATOM   6298  C  CA    . ILE C  2  74  ? 89.482  51.663 -47.577 1.00 39.97  ? 474  ILE A CA    1 
ATOM   6299  C  C     . ILE C  2  74  ? 89.056  52.031 -46.161 1.00 39.03  ? 474  ILE A C     1 
ATOM   6300  O  O     . ILE C  2  74  ? 88.072  52.742 -45.973 1.00 39.00  ? 474  ILE A O     1 
ATOM   6301  C  CB    . ILE C  2  74  ? 89.007  50.232 -47.932 1.00 38.45  ? 474  ILE A CB    1 
ATOM   6302  C  CG1   . ILE C  2  74  ? 89.188  49.986 -49.440 1.00 41.42  ? 474  ILE A CG1   1 
ATOM   6303  C  CG2   . ILE C  2  74  ? 87.558  50.046 -47.535 1.00 37.48  ? 474  ILE A CG2   1 
ATOM   6304  C  CD1   . ILE C  2  74  ? 88.972  48.543 -49.880 1.00 40.95  ? 474  ILE A CD1   1 
ATOM   6305  N  N     . ALA C  2  75  ? 89.802  51.565 -45.165 1.00 39.68  ? 475  ALA A N     1 
ATOM   6306  C  CA    . ALA C  2  75  ? 89.464  51.861 -43.777 1.00 42.44  ? 475  ALA A CA    1 
ATOM   6307  C  C     . ALA C  2  75  ? 89.529  53.370 -43.494 1.00 46.19  ? 475  ALA A C     1 
ATOM   6308  O  O     . ALA C  2  75  ? 88.711  53.910 -42.742 1.00 45.80  ? 475  ALA A O     1 
ATOM   6309  C  CB    . ALA C  2  75  ? 90.394  51.103 -42.842 1.00 40.59  ? 475  ALA A CB    1 
ATOM   6310  N  N     . GLN C  2  76  ? 90.491  54.043 -44.118 1.00 49.42  ? 476  GLN A N     1 
ATOM   6311  C  CA    . GLN C  2  76  ? 90.664  55.484 -43.941 1.00 54.45  ? 476  GLN A CA    1 
ATOM   6312  C  C     . GLN C  2  76  ? 89.362  56.245 -44.205 1.00 55.75  ? 476  GLN A C     1 
ATOM   6313  O  O     . GLN C  2  76  ? 89.111  57.280 -43.593 1.00 56.48  ? 476  GLN A O     1 
ATOM   6314  C  CB    . GLN C  2  76  ? 91.780  56.001 -44.862 1.00 57.16  ? 476  GLN A CB    1 
ATOM   6315  C  CG    . GLN C  2  76  ? 92.105  57.492 -44.718 1.00 61.40  ? 476  GLN A CG    1 
ATOM   6316  C  CD    . GLN C  2  76  ? 92.760  57.844 -43.387 1.00 64.33  ? 476  GLN A CD    1 
ATOM   6317  O  OE1   . GLN C  2  76  ? 93.208  56.968 -42.642 1.00 64.80  ? 476  GLN A OE1   1 
ATOM   6318  N  NE2   . GLN C  2  76  ? 92.819  59.139 -43.085 1.00 66.14  ? 476  GLN A NE2   1 
ATOM   6319  N  N     . ASP C  2  77  ? 88.528  55.726 -45.101 1.00 57.29  ? 477  ASP A N     1 
ATOM   6320  C  CA    . ASP C  2  77  ? 87.257  56.375 -45.418 1.00 57.61  ? 477  ASP A CA    1 
ATOM   6321  C  C     . ASP C  2  77  ? 86.274  56.289 -44.267 1.00 57.23  ? 477  ASP A C     1 
ATOM   6322  O  O     . ASP C  2  77  ? 85.381  57.121 -44.146 1.00 57.65  ? 477  ASP A O     1 
ATOM   6323  C  CB    . ASP C  2  77  ? 86.608  55.731 -46.641 1.00 61.90  ? 477  ASP A CB    1 
ATOM   6324  C  CG    . ASP C  2  77  ? 87.312  56.079 -47.918 1.00 66.33  ? 477  ASP A CG    1 
ATOM   6325  O  OD1   . ASP C  2  77  ? 87.455  55.181 -48.775 1.00 70.28  ? 477  ASP A OD1   1 
ATOM   6326  O  OD2   . ASP C  2  77  ? 87.718  57.253 -48.068 1.00 69.62  ? 477  ASP A OD2   1 
ATOM   6327  N  N     . PHE C  2  78  ? 86.419  55.267 -43.434 1.00 55.36  ? 478  PHE A N     1 
ATOM   6328  C  CA    . PHE C  2  78  ? 85.507  55.080 -42.316 1.00 54.91  ? 478  PHE A CA    1 
ATOM   6329  C  C     . PHE C  2  78  ? 86.003  55.723 -41.031 1.00 54.51  ? 478  PHE A C     1 
ATOM   6330  O  O     . PHE C  2  78  ? 85.218  56.224 -40.238 1.00 52.98  ? 478  PHE A O     1 
ATOM   6331  C  CB    . PHE C  2  78  ? 85.234  53.586 -42.109 1.00 53.63  ? 478  PHE A CB    1 
ATOM   6332  C  CG    . PHE C  2  78  ? 84.723  52.895 -43.341 1.00 53.01  ? 478  PHE A CG    1 
ATOM   6333  C  CD1   . PHE C  2  78  ? 85.322  51.726 -43.796 1.00 52.36  ? 478  PHE A CD1   1 
ATOM   6334  C  CD2   . PHE C  2  78  ? 83.654  53.420 -44.059 1.00 52.30  ? 478  PHE A CD2   1 
ATOM   6335  C  CE1   . PHE C  2  78  ? 84.863  51.089 -44.950 1.00 51.11  ? 478  PHE A CE1   1 
ATOM   6336  C  CE2   . PHE C  2  78  ? 83.188  52.787 -45.218 1.00 52.94  ? 478  PHE A CE2   1 
ATOM   6337  C  CZ    . PHE C  2  78  ? 83.799  51.618 -45.662 1.00 51.40  ? 478  PHE A CZ    1 
ATOM   6338  N  N     . LYS C  2  79  ? 87.310  55.688 -40.822 1.00 55.59  ? 479  LYS A N     1 
ATOM   6339  C  CA    . LYS C  2  79  ? 87.905  56.290 -39.641 1.00 56.11  ? 479  LYS A CA    1 
ATOM   6340  C  C     . LYS C  2  79  ? 89.374  56.550 -39.917 1.00 56.75  ? 479  LYS A C     1 
ATOM   6341  O  O     . LYS C  2  79  ? 90.087  55.674 -40.403 1.00 56.43  ? 479  LYS A O     1 
ATOM   6342  C  CB    . LYS C  2  79  ? 87.747  55.389 -38.417 1.00 57.12  ? 479  LYS A CB    1 
ATOM   6343  C  CG    . LYS C  2  79  ? 88.151  56.077 -37.129 1.00 60.56  ? 479  LYS A CG    1 
ATOM   6344  C  CD    . LYS C  2  79  ? 87.882  55.220 -35.908 1.00 64.55  ? 479  LYS A CD    1 
ATOM   6345  C  CE    . LYS C  2  79  ? 87.937  56.067 -34.645 1.00 68.34  ? 479  LYS A CE    1 
ATOM   6346  N  NZ    . LYS C  2  79  ? 88.246  55.263 -33.429 1.00 71.16  ? 479  LYS A NZ    1 
ATOM   6347  N  N     . THR C  2  80  ? 89.816  57.765 -39.613 1.00 57.45  ? 480  THR A N     1 
ATOM   6348  C  CA    . THR C  2  80  ? 91.197  58.168 -39.839 1.00 57.42  ? 480  THR A CA    1 
ATOM   6349  C  C     . THR C  2  80  ? 92.148  57.743 -38.728 1.00 57.10  ? 480  THR A C     1 
ATOM   6350  O  O     . THR C  2  80  ? 91.733  57.445 -37.614 1.00 57.62  ? 480  THR A O     1 
ATOM   6351  C  CB    . THR C  2  80  ? 91.299  59.695 -39.992 1.00 58.33  ? 480  THR A CB    1 
ATOM   6352  O  OG1   . THR C  2  80  ? 90.775  60.324 -38.817 1.00 58.92  ? 480  THR A OG1   1 
ATOM   6353  C  CG2   . THR C  2  80  ? 90.503  60.169 -41.199 1.00 57.83  ? 480  THR A CG2   1 
ATOM   6354  N  N     . ASP C  2  81  ? 93.432  57.703 -39.061 1.00 58.75  ? 481  ASP A N     1 
ATOM   6355  C  CA    . ASP C  2  81  ? 94.485  57.354 -38.114 1.00 59.96  ? 481  ASP A CA    1 
ATOM   6356  C  C     . ASP C  2  81  ? 94.311  55.999 -37.436 1.00 58.95  ? 481  ASP A C     1 
ATOM   6357  O  O     . ASP C  2  81  ? 94.574  55.854 -36.241 1.00 59.37  ? 481  ASP A O     1 
ATOM   6358  C  CB    . ASP C  2  81  ? 94.621  58.460 -37.058 1.00 62.36  ? 481  ASP A CB    1 
ATOM   6359  C  CG    . ASP C  2  81  ? 95.865  58.296 -36.189 1.00 66.46  ? 481  ASP A CG    1 
ATOM   6360  O  OD1   . ASP C  2  81  ? 96.932  57.902 -36.724 1.00 67.20  ? 481  ASP A OD1   1 
ATOM   6361  O  OD2   . ASP C  2  81  ? 95.769  58.565 -34.968 1.00 69.28  ? 481  ASP A OD2   1 
ATOM   6362  N  N     . LEU C  2  82  ? 93.883  55.000 -38.196 1.00 56.25  ? 482  LEU A N     1 
ATOM   6363  C  CA    . LEU C  2  82  ? 93.702  53.671 -37.636 1.00 54.02  ? 482  LEU A CA    1 
ATOM   6364  C  C     . LEU C  2  82  ? 94.953  52.823 -37.786 1.00 53.06  ? 482  LEU A C     1 
ATOM   6365  O  O     . LEU C  2  82  ? 95.750  53.028 -38.695 1.00 52.27  ? 482  LEU A O     1 
ATOM   6366  C  CB    . LEU C  2  82  ? 92.546  52.947 -38.332 1.00 53.90  ? 482  LEU A CB    1 
ATOM   6367  C  CG    . LEU C  2  82  ? 91.108  53.207 -37.892 1.00 53.86  ? 482  LEU A CG    1 
ATOM   6368  C  CD1   . LEU C  2  82  ? 90.160  52.525 -38.873 1.00 55.03  ? 482  LEU A CD1   1 
ATOM   6369  C  CD2   . LEU C  2  82  ? 90.888  52.680 -36.490 1.00 52.18  ? 482  LEU A CD2   1 
ATOM   6370  N  N     . ARG C  2  83  ? 95.119  51.875 -36.874 1.00 52.87  ? 483  ARG A N     1 
ATOM   6371  C  CA    . ARG C  2  83  ? 96.229  50.936 -36.928 1.00 53.30  ? 483  ARG A CA    1 
ATOM   6372  C  C     . ARG C  2  83  ? 95.576  49.555 -37.082 1.00 52.30  ? 483  ARG A C     1 
ATOM   6373  O  O     . ARG C  2  83  ? 94.399  49.384 -36.753 1.00 51.58  ? 483  ARG A O     1 
ATOM   6374  C  CB    . ARG C  2  83  ? 97.064  51.010 -35.648 1.00 55.91  ? 483  ARG A CB    1 
ATOM   6375  C  CG    . ARG C  2  83  ? 97.826  52.327 -35.499 1.00 59.29  ? 483  ARG A CG    1 
ATOM   6376  C  CD    . ARG C  2  83  ? 98.498  52.451 -34.142 1.00 62.12  ? 483  ARG A CD    1 
ATOM   6377  N  NE    . ARG C  2  83  ? 99.791  53.120 -34.254 1.00 67.52  ? 483  ARG A NE    1 
ATOM   6378  C  CZ    . ARG C  2  83  ? 100.958 52.536 -33.997 1.00 68.48  ? 483  ARG A CZ    1 
ATOM   6379  N  NH1   . ARG C  2  83  ? 101.001 51.271 -33.600 1.00 69.35  ? 483  ARG A NH1   1 
ATOM   6380  N  NH2   . ARG C  2  83  ? 102.087 53.202 -34.188 1.00 70.48  ? 483  ARG A NH2   1 
ATOM   6381  N  N     . PHE C  2  84  ? 96.321  48.588 -37.604 1.00 50.09  ? 484  PHE A N     1 
ATOM   6382  C  CA    . PHE C  2  84  ? 95.797  47.240 -37.807 1.00 49.25  ? 484  PHE A CA    1 
ATOM   6383  C  C     . PHE C  2  84  ? 96.726  46.195 -37.190 1.00 49.05  ? 484  PHE A C     1 
ATOM   6384  O  O     . PHE C  2  84  ? 97.941  46.307 -37.331 1.00 48.78  ? 484  PHE A O     1 
ATOM   6385  C  CB    . PHE C  2  84  ? 95.702  46.932 -39.317 1.00 47.76  ? 484  PHE A CB    1 
ATOM   6386  C  CG    . PHE C  2  84  ? 94.462  47.472 -39.994 1.00 48.13  ? 484  PHE A CG    1 
ATOM   6387  C  CD1   . PHE C  2  84  ? 94.433  48.773 -40.498 1.00 46.88  ? 484  PHE A CD1   1 
ATOM   6388  C  CD2   . PHE C  2  84  ? 93.335  46.659 -40.169 1.00 47.66  ? 484  PHE A CD2   1 
ATOM   6389  C  CE1   . PHE C  2  84  ? 93.301  49.258 -41.170 1.00 45.81  ? 484  PHE A CE1   1 
ATOM   6390  C  CE2   . PHE C  2  84  ? 92.199  47.136 -40.840 1.00 47.02  ? 484  PHE A CE2   1 
ATOM   6391  C  CZ    . PHE C  2  84  ? 92.183  48.434 -41.340 1.00 45.41  ? 484  PHE A CZ    1 
ATOM   6392  N  N     . GLN C  2  85  ? 96.177  45.208 -36.479 1.00 46.61  ? 485  GLN A N     1 
ATOM   6393  C  CA    . GLN C  2  85  ? 97.027  44.142 -35.958 1.00 46.86  ? 485  GLN A CA    1 
ATOM   6394  C  C     . GLN C  2  85  ? 97.380  43.389 -37.240 1.00 47.08  ? 485  GLN A C     1 
ATOM   6395  O  O     . GLN C  2  85  ? 96.588  43.373 -38.187 1.00 44.82  ? 485  GLN A O     1 
ATOM   6396  C  CB    . GLN C  2  85  ? 96.267  43.189 -35.026 1.00 47.05  ? 485  GLN A CB    1 
ATOM   6397  C  CG    . GLN C  2  85  ? 95.815  43.779 -33.710 1.00 48.67  ? 485  GLN A CG    1 
ATOM   6398  C  CD    . GLN C  2  85  ? 95.230  42.727 -32.784 1.00 51.67  ? 485  GLN A CD    1 
ATOM   6399  O  OE1   . GLN C  2  85  ? 94.544  41.796 -33.225 1.00 49.98  ? 485  GLN A OE1   1 
ATOM   6400  N  NE2   . GLN C  2  85  ? 95.516  42.857 -31.491 1.00 51.91  ? 485  GLN A NE2   1 
ATOM   6401  N  N     . SER C  2  86  ? 98.560  42.785 -37.297 1.00 47.30  ? 486  SER A N     1 
ATOM   6402  C  CA    . SER C  2  86  ? 98.932  42.061 -38.501 1.00 46.71  ? 486  SER A CA    1 
ATOM   6403  C  C     . SER C  2  86  ? 97.938  40.927 -38.740 1.00 44.90  ? 486  SER A C     1 
ATOM   6404  O  O     . SER C  2  86  ? 97.575  40.654 -39.879 1.00 45.10  ? 486  SER A O     1 
ATOM   6405  C  CB    . SER C  2  86  ? 100.359 41.510 -38.403 1.00 46.95  ? 486  SER A CB    1 
ATOM   6406  O  OG    . SER C  2  86  ? 100.447 40.536 -37.385 1.00 51.97  ? 486  SER A OG    1 
ATOM   6407  N  N     . SER C  2  87  ? 97.492  40.278 -37.668 1.00 43.80  ? 487  SER A N     1 
ATOM   6408  C  CA    . SER C  2  87  ? 96.535  39.183 -37.796 1.00 45.55  ? 487  SER A CA    1 
ATOM   6409  C  C     . SER C  2  87  ? 95.190  39.646 -38.373 1.00 43.88  ? 487  SER A C     1 
ATOM   6410  O  O     . SER C  2  87  ? 94.465  38.851 -38.972 1.00 41.74  ? 487  SER A O     1 
ATOM   6411  C  CB    . SER C  2  87  ? 96.324  38.469 -36.455 1.00 44.63  ? 487  SER A CB    1 
ATOM   6412  O  OG    . SER C  2  87  ? 95.955  39.380 -35.438 1.00 52.29  ? 487  SER A OG    1 
ATOM   6413  N  N     . ALA C  2  88  ? 94.866  40.926 -38.192 1.00 41.59  ? 488  ALA A N     1 
ATOM   6414  C  CA    . ALA C  2  88  ? 93.621  41.477 -38.717 1.00 40.80  ? 488  ALA A CA    1 
ATOM   6415  C  C     . ALA C  2  88  ? 93.702  41.543 -40.243 1.00 41.43  ? 488  ALA A C     1 
ATOM   6416  O  O     . ALA C  2  88  ? 92.758  41.170 -40.952 1.00 40.38  ? 488  ALA A O     1 
ATOM   6417  C  CB    . ALA C  2  88  ? 93.358  42.873 -38.142 1.00 38.97  ? 488  ALA A CB    1 
ATOM   6418  N  N     . VAL C  2  89  ? 94.832  42.023 -40.745 1.00 40.41  ? 489  VAL A N     1 
ATOM   6419  C  CA    . VAL C  2  89  ? 95.019  42.123 -42.180 1.00 40.97  ? 489  VAL A CA    1 
ATOM   6420  C  C     . VAL C  2  89  ? 95.029  40.735 -42.814 1.00 41.68  ? 489  VAL A C     1 
ATOM   6421  O  O     . VAL C  2  89  ? 94.437  40.530 -43.881 1.00 41.08  ? 489  VAL A O     1 
ATOM   6422  C  CB    . VAL C  2  89  ? 96.315  42.876 -42.542 1.00 41.51  ? 489  VAL A CB    1 
ATOM   6423  C  CG1   . VAL C  2  89  ? 96.523  42.840 -44.034 1.00 40.39  ? 489  VAL A CG1   1 
ATOM   6424  C  CG2   . VAL C  2  89  ? 96.234  44.329 -42.060 1.00 40.20  ? 489  VAL A CG2   1 
ATOM   6425  N  N     A MET C  2  90  ? 95.691  39.787 -42.159 0.50 40.66  ? 490  MET A N     1 
ATOM   6426  N  N     B MET C  2  90  ? 95.702  39.785 -42.168 0.50 41.03  ? 490  MET A N     1 
ATOM   6427  C  CA    A MET C  2  90  ? 95.764  38.429 -42.684 0.50 40.90  ? 490  MET A CA    1 
ATOM   6428  C  CA    B MET C  2  90  ? 95.759  38.418 -42.685 0.50 41.42  ? 490  MET A CA    1 
ATOM   6429  C  C     A MET C  2  90  ? 94.378  37.793 -42.740 0.50 40.16  ? 490  MET A C     1 
ATOM   6430  C  C     B MET C  2  90  ? 94.360  37.822 -42.760 0.50 40.79  ? 490  MET A C     1 
ATOM   6431  O  O     A MET C  2  90  ? 94.046  37.103 -43.700 0.50 39.90  ? 490  MET A O     1 
ATOM   6432  O  O     B MET C  2  90  ? 94.002  37.190 -43.751 0.50 41.06  ? 490  MET A O     1 
ATOM   6433  C  CB    A MET C  2  90  ? 96.715  37.573 -41.841 0.50 41.85  ? 490  MET A CB    1 
ATOM   6434  C  CB    B MET C  2  90  ? 96.629  37.520 -41.794 0.50 42.48  ? 490  MET A CB    1 
ATOM   6435  C  CG    A MET C  2  90  ? 97.435  36.497 -42.644 0.50 43.67  ? 490  MET A CG    1 
ATOM   6436  C  CG    B MET C  2  90  ? 98.123  37.787 -41.868 0.50 44.04  ? 490  MET A CG    1 
ATOM   6437  S  SD    A MET C  2  90  ? 98.859  37.085 -43.621 0.50 47.68  ? 490  MET A SD    1 
ATOM   6438  S  SD    B MET C  2  90  ? 99.068  36.423 -41.142 0.50 49.29  ? 490  MET A SD    1 
ATOM   6439  C  CE    A MET C  2  90  ? 98.255  38.569 -44.472 0.50 42.17  ? 490  MET A CE    1 
ATOM   6440  C  CE    B MET C  2  90  ? 98.691  36.635 -39.382 0.50 44.76  ? 490  MET A CE    1 
ATOM   6441  N  N     . ALA C  2  91  ? 93.576  38.019 -41.701 1.00 40.59  ? 491  ALA A N     1 
ATOM   6442  C  CA    . ALA C  2  91  ? 92.217  37.486 -41.650 1.00 39.15  ? 491  ALA A CA    1 
ATOM   6443  C  C     . ALA C  2  91  ? 91.427  38.082 -42.818 1.00 39.78  ? 491  ALA A C     1 
ATOM   6444  O  O     . ALA C  2  91  ? 90.691  37.389 -43.514 1.00 38.33  ? 491  ALA A O     1 
ATOM   6445  C  CB    . ALA C  2  91  ? 91.568  37.834 -40.334 1.00 38.41  ? 491  ALA A CB    1 
ATOM   6446  N  N     . LEU C  2  92  ? 91.638  39.368 -43.063 1.00 39.81  ? 492  LEU A N     1 
ATOM   6447  C  CA    . LEU C  2  92  ? 90.966  40.054 -44.157 1.00 39.75  ? 492  LEU A CA    1 
ATOM   6448  C  C     . LEU C  2  92  ? 91.404  39.442 -45.495 1.00 39.04  ? 492  LEU A C     1 
ATOM   6449  O  O     . LEU C  2  92  ? 90.590  39.278 -46.405 1.00 39.27  ? 492  LEU A O     1 
ATOM   6450  C  CB    . LEU C  2  92  ? 91.324  41.534 -44.117 1.00 36.90  ? 492  LEU A CB    1 
ATOM   6451  C  CG    . LEU C  2  92  ? 90.291  42.652 -43.921 1.00 42.88  ? 492  LEU A CG    1 
ATOM   6452  C  CD1   . LEU C  2  92  ? 88.989  42.189 -43.323 1.00 38.20  ? 492  LEU A CD1   1 
ATOM   6453  C  CD2   . LEU C  2  92  ? 90.936  43.749 -43.071 1.00 36.79  ? 492  LEU A CD2   1 
ATOM   6454  N  N     . GLN C  2  93  ? 92.678  39.072 -45.606 1.00 38.09  ? 493  GLN A N     1 
ATOM   6455  C  CA    . GLN C  2  93  ? 93.166  38.509 -46.855 1.00 39.34  ? 493  GLN A CA    1 
ATOM   6456  C  C     . GLN C  2  93  ? 92.710  37.068 -47.075 1.00 36.92  ? 493  GLN A C     1 
ATOM   6457  O  O     . GLN C  2  93  ? 92.440  36.674 -48.204 1.00 36.79  ? 493  GLN A O     1 
ATOM   6458  C  CB    . GLN C  2  93  ? 94.694  38.633 -46.980 1.00 40.21  ? 493  GLN A CB    1 
ATOM   6459  C  CG    . GLN C  2  93  ? 95.170  38.513 -48.418 1.00 42.17  ? 493  GLN A CG    1 
ATOM   6460  C  CD    . GLN C  2  93  ? 96.675  38.677 -48.577 1.00 46.67  ? 493  GLN A CD    1 
ATOM   6461  O  OE1   . GLN C  2  93  ? 97.352  39.246 -47.714 1.00 44.53  ? 493  GLN A OE1   1 
ATOM   6462  N  NE2   . GLN C  2  93  ? 97.206  38.183 -49.698 1.00 43.38  ? 493  GLN A NE2   1 
ATOM   6463  N  N     . GLU C  2  94  ? 92.645  36.280 -46.007 1.00 36.93  ? 494  GLU A N     1 
ATOM   6464  C  CA    . GLU C  2  94  ? 92.187  34.898 -46.118 1.00 37.48  ? 494  GLU A CA    1 
ATOM   6465  C  C     . GLU C  2  94  ? 90.720  34.898 -46.570 1.00 37.29  ? 494  GLU A C     1 
ATOM   6466  O  O     . GLU C  2  94  ? 90.342  34.157 -47.480 1.00 34.99  ? 494  GLU A O     1 
ATOM   6467  C  CB    . GLU C  2  94  ? 92.293  34.191 -44.767 1.00 40.43  ? 494  GLU A CB    1 
ATOM   6468  C  CG    . GLU C  2  94  ? 93.702  33.753 -44.379 1.00 45.94  ? 494  GLU A CG    1 
ATOM   6469  C  CD    . GLU C  2  94  ? 94.145  32.495 -45.097 1.00 48.69  ? 494  GLU A CD    1 
ATOM   6470  O  OE1   . GLU C  2  94  ? 95.369  32.305 -45.238 1.00 51.21  ? 494  GLU A OE1   1 
ATOM   6471  O  OE2   . GLU C  2  94  ? 93.278  31.687 -45.498 1.00 49.78  ? 494  GLU A OE2   1 
ATOM   6472  N  N     . ALA C  2  95  ? 89.903  35.743 -45.938 1.00 34.38  ? 495  ALA A N     1 
ATOM   6473  C  CA    . ALA C  2  95  ? 88.484  35.832 -46.282 1.00 34.00  ? 495  ALA A CA    1 
ATOM   6474  C  C     . ALA C  2  95  ? 88.270  36.369 -47.697 1.00 36.07  ? 495  ALA A C     1 
ATOM   6475  O  O     . ALA C  2  95  ? 87.436  35.844 -48.448 1.00 33.42  ? 495  ALA A O     1 
ATOM   6476  C  CB    . ALA C  2  95  ? 87.732  36.702 -45.263 1.00 34.26  ? 495  ALA A CB    1 
ATOM   6477  N  N     . SER C  2  96  ? 89.048  37.386 -48.076 1.00 34.34  ? 496  SER A N     1 
ATOM   6478  C  CA    . SER C  2  96  ? 88.923  37.978 -49.411 1.00 35.62  ? 496  SER A CA    1 
ATOM   6479  C  C     . SER C  2  96  ? 89.290  36.982 -50.504 1.00 34.88  ? 496  SER A C     1 
ATOM   6480  O  O     . SER C  2  96  ? 88.597  36.871 -51.500 1.00 34.50  ? 496  SER A O     1 
ATOM   6481  C  CB    . SER C  2  96  ? 89.797  39.233 -49.555 1.00 36.65  ? 496  SER A CB    1 
ATOM   6482  O  OG    . SER C  2  96  ? 89.367  40.272 -48.688 1.00 38.10  ? 496  SER A OG    1 
ATOM   6483  N  N     . GLU C  2  97  ? 90.374  36.240 -50.317 1.00 34.12  ? 497  GLU A N     1 
ATOM   6484  C  CA    . GLU C  2  97  ? 90.767  35.279 -51.338 1.00 34.68  ? 497  GLU A CA    1 
ATOM   6485  C  C     . GLU C  2  97  ? 89.813  34.086 -51.444 1.00 34.51  ? 497  GLU A C     1 
ATOM   6486  O  O     . GLU C  2  97  ? 89.531  33.612 -52.549 1.00 34.78  ? 497  GLU A O     1 
ATOM   6487  C  CB    . GLU C  2  97  ? 92.218  34.831 -51.143 1.00 35.76  ? 497  GLU A CB    1 
ATOM   6488  C  CG    . GLU C  2  97  ? 93.219  35.948 -51.432 1.00 42.26  ? 497  GLU A CG    1 
ATOM   6489  C  CD    . GLU C  2  97  ? 94.651  35.455 -51.576 1.00 46.38  ? 497  GLU A CD    1 
ATOM   6490  O  OE1   . GLU C  2  97  ? 94.856  34.310 -52.052 1.00 47.23  ? 497  GLU A OE1   1 
ATOM   6491  O  OE2   . GLU C  2  97  ? 95.573  36.227 -51.230 1.00 47.58  ? 497  GLU A OE2   1 
ATOM   6492  N  N     . ALA C  2  98  ? 89.327  33.604 -50.302 1.00 33.60  ? 498  ALA A N     1 
ATOM   6493  C  CA    . ALA C  2  98  ? 88.387  32.485 -50.276 1.00 33.84  ? 498  ALA A CA    1 
ATOM   6494  C  C     . ALA C  2  98  ? 87.105  32.909 -51.005 1.00 33.23  ? 498  ALA A C     1 
ATOM   6495  O  O     . ALA C  2  98  ? 86.517  32.135 -51.758 1.00 33.08  ? 498  ALA A O     1 
ATOM   6496  C  CB    . ALA C  2  98  ? 88.071  32.090 -48.815 1.00 32.68  ? 498  ALA A CB    1 
ATOM   6497  N  N     . TYR C  2  99  ? 86.696  34.160 -50.788 1.00 32.91  ? 499  TYR A N     1 
ATOM   6498  C  CA    . TYR C  2  99  ? 85.503  34.706 -51.423 1.00 32.49  ? 499  TYR A CA    1 
ATOM   6499  C  C     . TYR C  2  99  ? 85.729  34.804 -52.932 1.00 32.51  ? 499  TYR A C     1 
ATOM   6500  O  O     . TYR C  2  99  ? 84.920  34.304 -53.721 1.00 33.10  ? 499  TYR A O     1 
ATOM   6501  C  CB    . TYR C  2  99  ? 85.179  36.088 -50.840 1.00 34.12  ? 499  TYR A CB    1 
ATOM   6502  C  CG    . TYR C  2  99  ? 84.211  36.894 -51.687 1.00 33.96  ? 499  TYR A CG    1 
ATOM   6503  C  CD1   . TYR C  2  99  ? 82.837  36.668 -51.623 1.00 32.78  ? 499  TYR A CD1   1 
ATOM   6504  C  CD2   . TYR C  2  99  ? 84.676  37.871 -52.563 1.00 32.93  ? 499  TYR A CD2   1 
ATOM   6505  C  CE1   . TYR C  2  99  ? 81.951  37.395 -52.414 1.00 33.93  ? 499  TYR A CE1   1 
ATOM   6506  C  CE2   . TYR C  2  99  ? 83.802  38.603 -53.359 1.00 33.02  ? 499  TYR A CE2   1 
ATOM   6507  C  CZ    . TYR C  2  99  ? 82.443  38.362 -53.281 1.00 33.19  ? 499  TYR A CZ    1 
ATOM   6508  O  OH    . TYR C  2  99  ? 81.579  39.081 -54.072 1.00 36.13  ? 499  TYR A OH    1 
ATOM   6509  N  N     . LEU C  2  100 ? 86.862  35.375 -53.336 1.00 29.93  ? 500  LEU A N     1 
ATOM   6510  C  CA    . LEU C  2  100 ? 87.127  35.519 -54.760 1.00 30.41  ? 500  LEU A CA    1 
ATOM   6511  C  C     . LEU C  2  100 ? 87.296  34.179 -55.459 1.00 29.71  ? 500  LEU A C     1 
ATOM   6512  O  O     . LEU C  2  100 ? 86.875  34.026 -56.604 1.00 28.81  ? 500  LEU A O     1 
ATOM   6513  C  CB    . LEU C  2  100 ? 88.334  36.414 -55.033 1.00 30.17  ? 500  LEU A CB    1 
ATOM   6514  C  CG    . LEU C  2  100 ? 88.132  37.914 -54.780 1.00 35.75  ? 500  LEU A CG    1 
ATOM   6515  C  CD1   . LEU C  2  100 ? 89.427  38.670 -55.090 1.00 34.54  ? 500  LEU A CD1   1 
ATOM   6516  C  CD2   . LEU C  2  100 ? 86.991  38.449 -55.642 1.00 32.66  ? 500  LEU A CD2   1 
ATOM   6517  N  N     . VAL C  2  101 ? 87.901  33.210 -54.777 1.00 30.24  ? 501  VAL A N     1 
ATOM   6518  C  CA    . VAL C  2  101 ? 88.101  31.899 -55.385 1.00 31.63  ? 501  VAL A CA    1 
ATOM   6519  C  C     . VAL C  2  101 ? 86.749  31.235 -55.608 1.00 33.42  ? 501  VAL A C     1 
ATOM   6520  O  O     . VAL C  2  101 ? 86.485  30.723 -56.691 1.00 34.58  ? 501  VAL A O     1 
ATOM   6521  C  CB    . VAL C  2  101 ? 89.034  30.993 -54.539 1.00 32.58  ? 501  VAL A CB    1 
ATOM   6522  C  CG1   . VAL C  2  101 ? 88.959  29.535 -55.040 1.00 33.78  ? 501  VAL A CG1   1 
ATOM   6523  C  CG2   . VAL C  2  101 ? 90.477  31.493 -54.649 1.00 31.65  ? 501  VAL A CG2   1 
ATOM   6524  N  N     . ALA C  2  102 ? 85.875  31.283 -54.605 1.00 34.10  ? 502  ALA A N     1 
ATOM   6525  C  CA    . ALA C  2  102 ? 84.550  30.675 -54.729 1.00 34.41  ? 502  ALA A CA    1 
ATOM   6526  C  C     . ALA C  2  102 ? 83.719  31.393 -55.794 1.00 34.88  ? 502  ALA A C     1 
ATOM   6527  O  O     . ALA C  2  102 ? 82.962  30.752 -56.539 1.00 31.92  ? 502  ALA A O     1 
ATOM   6528  C  CB    . ALA C  2  102 ? 83.825  30.674 -53.399 1.00 32.73  ? 502  ALA A CB    1 
ATOM   6529  N  N     . LEU C  2  103 ? 83.863  32.713 -55.876 1.00 31.48  ? 503  LEU A N     1 
ATOM   6530  C  CA    . LEU C  2  103 ? 83.125  33.465 -56.893 1.00 31.37  ? 503  LEU A CA    1 
ATOM   6531  C  C     . LEU C  2  103 ? 83.593  33.053 -58.292 1.00 31.43  ? 503  LEU A C     1 
ATOM   6532  O  O     . LEU C  2  103 ? 82.793  32.993 -59.226 1.00 32.13  ? 503  LEU A O     1 
ATOM   6533  C  CB    . LEU C  2  103 ? 83.316  34.971 -56.723 1.00 30.08  ? 503  LEU A CB    1 
ATOM   6534  C  CG    . LEU C  2  103 ? 82.597  35.839 -57.763 1.00 31.06  ? 503  LEU A CG    1 
ATOM   6535  C  CD1   . LEU C  2  103 ? 81.079  35.624 -57.671 1.00 29.64  ? 503  LEU A CD1   1 
ATOM   6536  C  CD2   . LEU C  2  103 ? 82.939  37.314 -57.525 1.00 30.50  ? 503  LEU A CD2   1 
ATOM   6537  N  N     . PHE C  2  104 ? 84.891  32.801 -58.442 1.00 31.12  ? 504  PHE A N     1 
ATOM   6538  C  CA    . PHE C  2  104 ? 85.442  32.385 -59.729 1.00 31.42  ? 504  PHE A CA    1 
ATOM   6539  C  C     . PHE C  2  104 ? 84.891  31.021 -60.139 1.00 34.10  ? 504  PHE A C     1 
ATOM   6540  O  O     . PHE C  2  104 ? 84.681  30.772 -61.326 1.00 34.49  ? 504  PHE A O     1 
ATOM   6541  C  CB    . PHE C  2  104 ? 86.972  32.393 -59.707 1.00 32.51  ? 504  PHE A CB    1 
ATOM   6542  C  CG    . PHE C  2  104 ? 87.571  33.734 -60.052 1.00 33.23  ? 504  PHE A CG    1 
ATOM   6543  C  CD1   . PHE C  2  104 ? 88.564  34.297 -59.258 1.00 35.78  ? 504  PHE A CD1   1 
ATOM   6544  C  CD2   . PHE C  2  104 ? 87.113  34.451 -61.151 1.00 34.95  ? 504  PHE A CD2   1 
ATOM   6545  C  CE1   . PHE C  2  104 ? 89.095  35.570 -59.556 1.00 36.31  ? 504  PHE A CE1   1 
ATOM   6546  C  CE2   . PHE C  2  104 ? 87.633  35.718 -61.454 1.00 35.94  ? 504  PHE A CE2   1 
ATOM   6547  C  CZ    . PHE C  2  104 ? 88.624  36.274 -60.652 1.00 36.17  ? 504  PHE A CZ    1 
ATOM   6548  N  N     . GLU C  2  105 ? 84.642  30.146 -59.166 1.00 33.27  ? 505  GLU A N     1 
ATOM   6549  C  CA    . GLU C  2  105 ? 84.059  28.842 -59.465 1.00 36.25  ? 505  GLU A CA    1 
ATOM   6550  C  C     . GLU C  2  105 ? 82.658  29.090 -60.039 1.00 36.42  ? 505  GLU A C     1 
ATOM   6551  O  O     . GLU C  2  105 ? 82.315  28.566 -61.098 1.00 38.17  ? 505  GLU A O     1 
ATOM   6552  C  CB    . GLU C  2  105 ? 83.956  27.971 -58.203 1.00 38.66  ? 505  GLU A CB    1 
ATOM   6553  C  CG    . GLU C  2  105 ? 85.288  27.704 -57.499 1.00 43.10  ? 505  GLU A CG    1 
ATOM   6554  C  CD    . GLU C  2  105 ? 85.114  27.020 -56.136 1.00 47.88  ? 505  GLU A CD    1 
ATOM   6555  O  OE1   . GLU C  2  105 ? 83.955  26.874 -55.677 1.00 49.20  ? 505  GLU A OE1   1 
ATOM   6556  O  OE2   . GLU C  2  105 ? 86.137  26.641 -55.520 1.00 47.36  ? 505  GLU A OE2   1 
ATOM   6557  N  N     . ASP C  2  106 ? 81.848  29.901 -59.357 1.00 35.09  ? 506  ASP A N     1 
ATOM   6558  C  CA    . ASP C  2  106 ? 80.492  30.186 -59.858 1.00 34.36  ? 506  ASP A CA    1 
ATOM   6559  C  C     . ASP C  2  106 ? 80.536  30.861 -61.220 1.00 34.89  ? 506  ASP A C     1 
ATOM   6560  O  O     . ASP C  2  106 ? 79.726  30.577 -62.111 1.00 33.01  ? 506  ASP A O     1 
ATOM   6561  C  CB    . ASP C  2  106 ? 79.732  31.083 -58.883 1.00 36.09  ? 506  ASP A CB    1 
ATOM   6562  C  CG    . ASP C  2  106 ? 79.452  30.395 -57.561 1.00 39.99  ? 506  ASP A CG    1 
ATOM   6563  O  OD1   . ASP C  2  106 ? 79.794  29.197 -57.438 1.00 42.38  ? 506  ASP A OD1   1 
ATOM   6564  O  OD2   . ASP C  2  106 ? 78.900  31.050 -56.651 1.00 40.45  ? 506  ASP A OD2   1 
ATOM   6565  N  N     . THR C  2  107 ? 81.472  31.791 -61.361 1.00 32.02  ? 507  THR A N     1 
ATOM   6566  C  CA    . THR C  2  107 ? 81.635  32.513 -62.605 1.00 33.68  ? 507  THR A CA    1 
ATOM   6567  C  C     . THR C  2  107 ? 81.939  31.540 -63.767 1.00 33.50  ? 507  THR A C     1 
ATOM   6568  O  O     . THR C  2  107 ? 81.405  31.672 -64.876 1.00 34.10  ? 507  THR A O     1 
ATOM   6569  C  CB    . THR C  2  107 ? 82.770  33.554 -62.453 1.00 36.10  ? 507  THR A CB    1 
ATOM   6570  O  OG1   . THR C  2  107 ? 82.410  34.513 -61.431 1.00 31.65  ? 507  THR A OG1   1 
ATOM   6571  C  CG2   . THR C  2  107 ? 83.038  34.244 -63.782 1.00 30.32  ? 507  THR A CG2   1 
ATOM   6572  N  N     . ASN C  2  108 ? 82.748  30.533 -63.474 1.00 33.88  ? 508  ASN A N     1 
ATOM   6573  C  CA    . ASN C  2  108 ? 83.140  29.544 -64.465 1.00 33.31  ? 508  ASN A CA    1 
ATOM   6574  C  C     . ASN C  2  108 ? 81.929  28.708 -64.864 1.00 33.37  ? 508  ASN A C     1 
ATOM   6575  O  O     . ASN C  2  108 ? 81.781  28.346 -66.028 1.00 31.52  ? 508  ASN A O     1 
ATOM   6576  C  CB    . ASN C  2  108 ? 84.249  28.647 -63.907 1.00 33.73  ? 508  ASN A CB    1 
ATOM   6577  C  CG    . ASN C  2  108 ? 85.130  28.082 -64.996 1.00 37.87  ? 508  ASN A CG    1 
ATOM   6578  O  OD1   . ASN C  2  108 ? 85.314  28.709 -66.041 1.00 39.19  ? 508  ASN A OD1   1 
ATOM   6579  N  ND2   . ASN C  2  108 ? 85.690  26.904 -64.758 1.00 37.26  ? 508  ASN A ND2   1 
ATOM   6580  N  N     . LEU C  2  109 ? 81.078  28.379 -63.895 1.00 31.14  ? 509  LEU A N     1 
ATOM   6581  C  CA    . LEU C  2  109 ? 79.871  27.618 -64.203 1.00 32.45  ? 509  LEU A CA    1 
ATOM   6582  C  C     . LEU C  2  109 ? 78.953  28.428 -65.139 1.00 33.32  ? 509  LEU A C     1 
ATOM   6583  O  O     . LEU C  2  109 ? 78.330  27.866 -66.043 1.00 30.57  ? 509  LEU A O     1 
ATOM   6584  C  CB    . LEU C  2  109 ? 79.131  27.220 -62.927 1.00 31.22  ? 509  LEU A CB    1 
ATOM   6585  C  CG    . LEU C  2  109 ? 79.866  26.188 -62.053 1.00 34.86  ? 509  LEU A CG    1 
ATOM   6586  C  CD1   . LEU C  2  109 ? 79.060  25.896 -60.789 1.00 34.27  ? 509  LEU A CD1   1 
ATOM   6587  C  CD2   . LEU C  2  109 ? 80.108  24.886 -62.850 1.00 32.48  ? 509  LEU A CD2   1 
ATOM   6588  N  N     . CYS C  2  110 ? 78.897  29.748 -64.945 1.00 32.69  ? 510  CYS A N     1 
ATOM   6589  C  CA    . CYS C  2  110 ? 78.066  30.590 -65.802 1.00 33.30  ? 510  CYS A CA    1 
ATOM   6590  C  C     . CYS C  2  110 ? 78.621  30.656 -67.227 1.00 34.07  ? 510  CYS A C     1 
ATOM   6591  O  O     . CYS C  2  110 ? 77.863  30.598 -68.192 1.00 33.48  ? 510  CYS A O     1 
ATOM   6592  C  CB    . CYS C  2  110 ? 77.900  31.997 -65.209 1.00 33.94  ? 510  CYS A CB    1 
ATOM   6593  S  SG    . CYS C  2  110 ? 77.040  31.983 -63.613 1.00 34.20  ? 510  CYS A SG    1 
ATOM   6594  N  N     . ALA C  2  111 ? 79.938  30.776 -67.364 1.00 34.91  ? 511  ALA A N     1 
ATOM   6595  C  CA    . ALA C  2  111 ? 80.557  30.812 -68.694 1.00 35.24  ? 511  ALA A CA    1 
ATOM   6596  C  C     . ALA C  2  111 ? 80.253  29.494 -69.419 1.00 34.76  ? 511  ALA A C     1 
ATOM   6597  O  O     . ALA C  2  111 ? 79.851  29.488 -70.582 1.00 36.00  ? 511  ALA A O     1 
ATOM   6598  C  CB    . ALA C  2  111 ? 82.073  30.989 -68.574 1.00 34.49  ? 511  ALA A CB    1 
ATOM   6599  N  N     . ILE C  2  112 ? 80.438  28.380 -68.721 1.00 34.12  ? 512  ILE A N     1 
ATOM   6600  C  CA    . ILE C  2  112 ? 80.184  27.070 -69.312 1.00 35.63  ? 512  ILE A CA    1 
ATOM   6601  C  C     . ILE C  2  112 ? 78.705  26.888 -69.674 1.00 37.86  ? 512  ILE A C     1 
ATOM   6602  O  O     . ILE C  2  112 ? 78.367  26.236 -70.672 1.00 37.60  ? 512  ILE A O     1 
ATOM   6603  C  CB    . ILE C  2  112 ? 80.674  25.948 -68.371 1.00 36.28  ? 512  ILE A CB    1 
ATOM   6604  C  CG1   . ILE C  2  112 ? 82.195  26.052 -68.217 1.00 33.80  ? 512  ILE A CG1   1 
ATOM   6605  C  CG2   . ILE C  2  112 ? 80.268  24.569 -68.904 1.00 37.40  ? 512  ILE A CG2   1 
ATOM   6606  C  CD1   . ILE C  2  112 ? 82.798  25.089 -67.194 1.00 35.98  ? 512  ILE A CD1   1 
ATOM   6607  N  N     . HIS C  2  113 ? 77.825  27.503 -68.889 1.00 37.33  ? 513  HIS A N     1 
ATOM   6608  C  CA    . HIS C  2  113 ? 76.390  27.412 -69.142 1.00 35.81  ? 513  HIS A CA    1 
ATOM   6609  C  C     . HIS C  2  113 ? 76.084  28.005 -70.515 1.00 37.84  ? 513  HIS A C     1 
ATOM   6610  O  O     . HIS C  2  113 ? 75.188  27.535 -71.226 1.00 38.13  ? 513  HIS A O     1 
ATOM   6611  C  CB    . HIS C  2  113 ? 75.617  28.191 -68.074 1.00 32.23  ? 513  HIS A CB    1 
ATOM   6612  C  CG    . HIS C  2  113 ? 74.129  28.083 -68.201 1.00 33.05  ? 513  HIS A CG    1 
ATOM   6613  N  ND1   . HIS C  2  113 ? 73.448  26.907 -67.970 1.00 32.62  ? 513  HIS A ND1   1 
ATOM   6614  C  CD2   . HIS C  2  113 ? 73.186  29.016 -68.477 1.00 32.82  ? 513  HIS A CD2   1 
ATOM   6615  C  CE1   . HIS C  2  113 ? 72.151  27.121 -68.089 1.00 32.88  ? 513  HIS A CE1   1 
ATOM   6616  N  NE2   . HIS C  2  113 ? 71.964  28.393 -68.397 1.00 33.44  ? 513  HIS A NE2   1 
ATOM   6617  N  N     . ALA C  2  114 ? 76.803  29.072 -70.855 1.00 37.27  ? 514  ALA A N     1 
ATOM   6618  C  CA    . ALA C  2  114 ? 76.625  29.755 -72.125 1.00 38.21  ? 514  ALA A CA    1 
ATOM   6619  C  C     . ALA C  2  114 ? 77.489  29.123 -73.205 1.00 39.45  ? 514  ALA A C     1 
ATOM   6620  O  O     . ALA C  2  114 ? 77.701  29.714 -74.254 1.00 39.62  ? 514  ALA A O     1 
ATOM   6621  C  CB    . ALA C  2  114 ? 76.969  31.236 -71.974 1.00 38.01  ? 514  ALA A CB    1 
ATOM   6622  N  N     . LYS C  2  115 ? 77.999  27.927 -72.926 1.00 41.93  ? 515  LYS A N     1 
ATOM   6623  C  CA    . LYS C  2  115 ? 78.852  27.197 -73.862 1.00 45.61  ? 515  LYS A CA    1 
ATOM   6624  C  C     . LYS C  2  115 ? 80.175  27.890 -74.204 1.00 44.70  ? 515  LYS A C     1 
ATOM   6625  O  O     . LYS C  2  115 ? 80.651  27.828 -75.337 1.00 44.73  ? 515  LYS A O     1 
ATOM   6626  C  CB    . LYS C  2  115 ? 78.074  26.859 -75.133 1.00 49.33  ? 515  LYS A CB    1 
ATOM   6627  C  CG    . LYS C  2  115 ? 76.886  25.945 -74.865 1.00 54.95  ? 515  LYS A CG    1 
ATOM   6628  C  CD    . LYS C  2  115 ? 75.971  25.838 -76.072 1.00 59.52  ? 515  LYS A CD    1 
ATOM   6629  C  CE    . LYS C  2  115 ? 74.763  24.957 -75.769 1.00 63.22  ? 515  LYS A CE    1 
ATOM   6630  N  NZ    . LYS C  2  115 ? 75.135  23.508 -75.646 1.00 66.04  ? 515  LYS A NZ    1 
ATOM   6631  N  N     . ARG C  2  116 ? 80.752  28.578 -73.226 1.00 42.73  ? 516  ARG A N     1 
ATOM   6632  C  CA    . ARG C  2  116 ? 82.035  29.242 -73.434 1.00 42.11  ? 516  ARG A CA    1 
ATOM   6633  C  C     . ARG C  2  116 ? 82.999  28.611 -72.453 1.00 41.92  ? 516  ARG A C     1 
ATOM   6634  O  O     . ARG C  2  116 ? 82.588  27.864 -71.572 1.00 40.63  ? 516  ARG A O     1 
ATOM   6635  C  CB    . ARG C  2  116 ? 81.950  30.747 -73.158 1.00 40.88  ? 516  ARG A CB    1 
ATOM   6636  C  CG    . ARG C  2  116 ? 81.158  31.543 -74.182 1.00 41.23  ? 516  ARG A CG    1 
ATOM   6637  C  CD    . ARG C  2  116 ? 81.213  33.036 -73.883 1.00 39.12  ? 516  ARG A CD    1 
ATOM   6638  N  NE    . ARG C  2  116 ? 80.111  33.471 -73.028 1.00 39.42  ? 516  ARG A NE    1 
ATOM   6639  C  CZ    . ARG C  2  116 ? 80.224  33.723 -71.723 1.00 41.20  ? 516  ARG A CZ    1 
ATOM   6640  N  NH1   . ARG C  2  116 ? 81.397  33.577 -71.114 1.00 36.61  ? 516  ARG A NH1   1 
ATOM   6641  N  NH2   . ARG C  2  116 ? 79.175  34.165 -71.035 1.00 39.66  ? 516  ARG A NH2   1 
ATOM   6642  N  N     . VAL C  2  117 ? 84.286  28.862 -72.643 1.00 42.18  ? 517  VAL A N     1 
ATOM   6643  C  CA    . VAL C  2  117 ? 85.295  28.339 -71.731 1.00 42.19  ? 517  VAL A CA    1 
ATOM   6644  C  C     . VAL C  2  117 ? 86.047  29.544 -71.176 1.00 41.16  ? 517  VAL A C     1 
ATOM   6645  O  O     . VAL C  2  117 ? 86.948  29.408 -70.358 1.00 43.36  ? 517  VAL A O     1 
ATOM   6646  C  CB    . VAL C  2  117 ? 86.282  27.397 -72.453 1.00 43.85  ? 517  VAL A CB    1 
ATOM   6647  C  CG1   . VAL C  2  117 ? 85.542  26.171 -72.984 1.00 42.58  ? 517  VAL A CG1   1 
ATOM   6648  C  CG2   . VAL C  2  117 ? 86.984  28.138 -73.596 1.00 45.14  ? 517  VAL A CG2   1 
ATOM   6649  N  N     . THR C  2  118 ? 85.639  30.725 -71.622 1.00 39.20  ? 518  THR A N     1 
ATOM   6650  C  CA    . THR C  2  118 ? 86.253  31.986 -71.207 1.00 40.43  ? 518  THR A CA    1 
ATOM   6651  C  C     . THR C  2  118 ? 85.317  32.775 -70.295 1.00 39.60  ? 518  THR A C     1 
ATOM   6652  O  O     . THR C  2  118 ? 84.196  33.102 -70.693 1.00 38.80  ? 518  THR A O     1 
ATOM   6653  C  CB    . THR C  2  118 ? 86.538  32.889 -72.441 1.00 41.09  ? 518  THR A CB    1 
ATOM   6654  O  OG1   . THR C  2  118 ? 87.241  32.140 -73.441 1.00 44.55  ? 518  THR A OG1   1 
ATOM   6655  C  CG2   . THR C  2  118 ? 87.344  34.120 -72.044 1.00 39.91  ? 518  THR A CG2   1 
ATOM   6656  N  N     . ILE C  2  119 ? 85.779  33.124 -69.097 1.00 37.88  ? 519  ILE A N     1 
ATOM   6657  C  CA    . ILE C  2  119 ? 84.933  33.906 -68.197 1.00 36.79  ? 519  ILE A CA    1 
ATOM   6658  C  C     . ILE C  2  119 ? 84.924  35.385 -68.600 1.00 38.62  ? 519  ILE A C     1 
ATOM   6659  O  O     . ILE C  2  119 ? 85.959  35.950 -68.955 1.00 38.75  ? 519  ILE A O     1 
ATOM   6660  C  CB    . ILE C  2  119 ? 85.361  33.787 -66.714 1.00 36.35  ? 519  ILE A CB    1 
ATOM   6661  C  CG1   . ILE C  2  119 ? 86.792  34.266 -66.512 1.00 35.27  ? 519  ILE A CG1   1 
ATOM   6662  C  CG2   . ILE C  2  119 ? 85.189  32.360 -66.219 1.00 34.90  ? 519  ILE A CG2   1 
ATOM   6663  C  CD1   . ILE C  2  119 ? 87.200  34.297 -65.052 1.00 37.74  ? 519  ILE A CD1   1 
ATOM   6664  N  N     . MET C  2  120 ? 83.747  35.995 -68.543 1.00 37.86  ? 520  MET A N     1 
ATOM   6665  C  CA    . MET C  2  120 ? 83.570  37.398 -68.892 1.00 39.16  ? 520  MET A CA    1 
ATOM   6666  C  C     . MET C  2  120 ? 82.876  38.140 -67.750 1.00 39.99  ? 520  MET A C     1 
ATOM   6667  O  O     . MET C  2  120 ? 82.323  37.528 -66.841 1.00 38.17  ? 520  MET A O     1 
ATOM   6668  C  CB    . MET C  2  120 ? 82.730  37.512 -70.165 1.00 40.12  ? 520  MET A CB    1 
ATOM   6669  C  CG    . MET C  2  120 ? 83.393  36.874 -71.385 1.00 45.78  ? 520  MET A CG    1 
ATOM   6670  S  SD    . MET C  2  120 ? 82.301  36.732 -72.812 1.00 51.90  ? 520  MET A SD    1 
ATOM   6671  C  CE    . MET C  2  120 ? 83.394  35.865 -73.978 1.00 51.89  ? 520  MET A CE    1 
ATOM   6672  N  N     . PRO C  2  121 ? 82.887  39.476 -67.795 1.00 40.02  ? 521  PRO A N     1 
ATOM   6673  C  CA    . PRO C  2  121 ? 82.249  40.263 -66.743 1.00 40.67  ? 521  PRO A CA    1 
ATOM   6674  C  C     . PRO C  2  121 ? 80.795  39.876 -66.531 1.00 40.68  ? 521  PRO A C     1 
ATOM   6675  O  O     . PRO C  2  121 ? 80.319  39.828 -65.392 1.00 39.26  ? 521  PRO A O     1 
ATOM   6676  C  CB    . PRO C  2  121 ? 82.379  41.688 -67.270 1.00 40.88  ? 521  PRO A CB    1 
ATOM   6677  C  CG    . PRO C  2  121 ? 83.699  41.642 -67.970 1.00 39.71  ? 521  PRO A CG    1 
ATOM   6678  C  CD    . PRO C  2  121 ? 83.581  40.354 -68.755 1.00 41.23  ? 521  PRO A CD    1 
ATOM   6679  N  N     . LYS C  2  122 ? 80.093  39.579 -67.620 1.00 40.03  ? 522  LYS A N     1 
ATOM   6680  C  CA    . LYS C  2  122 ? 78.695  39.204 -67.500 1.00 40.11  ? 522  LYS A CA    1 
ATOM   6681  C  C     . LYS C  2  122 ? 78.511  37.912 -66.694 1.00 38.52  ? 522  LYS A C     1 
ATOM   6682  O  O     . LYS C  2  122 ? 77.448  37.688 -66.113 1.00 37.83  ? 522  LYS A O     1 
ATOM   6683  C  CB    . LYS C  2  122 ? 78.041  39.091 -68.881 1.00 43.89  ? 522  LYS A CB    1 
ATOM   6684  C  CG    . LYS C  2  122 ? 78.670  38.074 -69.811 1.00 47.88  ? 522  LYS A CG    1 
ATOM   6685  C  CD    . LYS C  2  122 ? 77.959  38.091 -71.156 1.00 52.28  ? 522  LYS A CD    1 
ATOM   6686  C  CE    . LYS C  2  122 ? 78.548  37.082 -72.116 1.00 56.65  ? 522  LYS A CE    1 
ATOM   6687  N  NZ    . LYS C  2  122 ? 77.696  36.951 -73.345 1.00 60.88  ? 522  LYS A NZ    1 
ATOM   6688  N  N     . ASP C  2  123 ? 79.537  37.062 -66.661 1.00 36.48  ? 523  ASP A N     1 
ATOM   6689  C  CA    . ASP C  2  123 ? 79.449  35.809 -65.895 1.00 33.94  ? 523  ASP A CA    1 
ATOM   6690  C  C     . ASP C  2  123 ? 79.538  36.146 -64.406 1.00 33.29  ? 523  ASP A C     1 
ATOM   6691  O  O     . ASP C  2  123 ? 78.773  35.629 -63.593 1.00 31.00  ? 523  ASP A O     1 
ATOM   6692  C  CB    . ASP C  2  123 ? 80.577  34.849 -66.278 1.00 34.12  ? 523  ASP A CB    1 
ATOM   6693  C  CG    . ASP C  2  123 ? 80.521  34.429 -67.742 1.00 35.12  ? 523  ASP A CG    1 
ATOM   6694  O  OD1   . ASP C  2  123 ? 79.425  34.063 -68.209 1.00 36.25  ? 523  ASP A OD1   1 
ATOM   6695  O  OD2   . ASP C  2  123 ? 81.569  34.468 -68.422 1.00 35.50  ? 523  ASP A OD2   1 
ATOM   6696  N  N     . ILE C  2  124 ? 80.479  37.015 -64.052 1.00 32.69  ? 524  ILE A N     1 
ATOM   6697  C  CA    . ILE C  2  124 ? 80.637  37.435 -62.658 1.00 32.28  ? 524  ILE A CA    1 
ATOM   6698  C  C     . ILE C  2  124 ? 79.356  38.136 -62.223 1.00 32.80  ? 524  ILE A C     1 
ATOM   6699  O  O     . ILE C  2  124 ? 78.856  37.907 -61.122 1.00 33.08  ? 524  ILE A O     1 
ATOM   6700  C  CB    . ILE C  2  124 ? 81.826  38.415 -62.477 1.00 31.36  ? 524  ILE A CB    1 
ATOM   6701  C  CG1   . ILE C  2  124 ? 83.147  37.674 -62.712 1.00 36.24  ? 524  ILE A CG1   1 
ATOM   6702  C  CG2   . ILE C  2  124 ? 81.785  39.064 -61.089 1.00 34.16  ? 524  ILE A CG2   1 
ATOM   6703  C  CD1   . ILE C  2  124 ? 84.389  38.496 -62.378 1.00 37.60  ? 524  ILE A CD1   1 
ATOM   6704  N  N     . GLN C  2  125 ? 78.815  38.965 -63.108 1.00 32.46  ? 525  GLN A N     1 
ATOM   6705  C  CA    . GLN C  2  125 ? 77.595  39.701 -62.812 1.00 34.97  ? 525  GLN A CA    1 
ATOM   6706  C  C     . GLN C  2  125 ? 76.419  38.775 -62.539 1.00 32.98  ? 525  GLN A C     1 
ATOM   6707  O  O     . GLN C  2  125 ? 75.706  38.949 -61.558 1.00 33.36  ? 525  GLN A O     1 
ATOM   6708  C  CB    . GLN C  2  125 ? 77.285  40.696 -63.936 1.00 36.95  ? 525  GLN A CB    1 
ATOM   6709  C  CG    . GLN C  2  125 ? 78.243  41.907 -63.926 1.00 42.13  ? 525  GLN A CG    1 
ATOM   6710  C  CD    . GLN C  2  125 ? 78.219  42.709 -65.225 1.00 47.05  ? 525  GLN A CD    1 
ATOM   6711  O  OE1   . GLN C  2  125 ? 77.545  42.342 -66.188 1.00 49.69  ? 525  GLN A OE1   1 
ATOM   6712  N  NE2   . GLN C  2  125 ? 78.983  43.798 -65.260 1.00 51.29  ? 525  GLN A NE2   1 
ATOM   6713  N  N     . LEU C  2  126 ? 76.230  37.774 -63.387 1.00 32.70  ? 526  LEU A N     1 
ATOM   6714  C  CA    . LEU C  2  126 ? 75.135  36.830 -63.190 1.00 31.34  ? 526  LEU A CA    1 
ATOM   6715  C  C     . LEU C  2  126 ? 75.286  36.115 -61.854 1.00 30.88  ? 526  LEU A C     1 
ATOM   6716  O  O     . LEU C  2  126 ? 74.322  35.968 -61.107 1.00 31.90  ? 526  LEU A O     1 
ATOM   6717  C  CB    . LEU C  2  126 ? 75.116  35.785 -64.314 1.00 31.25  ? 526  LEU A CB    1 
ATOM   6718  C  CG    . LEU C  2  126 ? 74.027  34.709 -64.208 1.00 32.28  ? 526  LEU A CG    1 
ATOM   6719  C  CD1   . LEU C  2  126 ? 72.636  35.366 -64.197 1.00 30.73  ? 526  LEU A CD1   1 
ATOM   6720  C  CD2   . LEU C  2  126 ? 74.153  33.727 -65.380 1.00 30.41  ? 526  LEU A CD2   1 
ATOM   6721  N  N     . ALA C  2  127 ? 76.495  35.642 -61.572 1.00 31.21  ? 527  ALA A N     1 
ATOM   6722  C  CA    . ALA C  2  127 ? 76.765  34.916 -60.336 1.00 31.33  ? 527  ALA A CA    1 
ATOM   6723  C  C     . ALA C  2  127 ? 76.406  35.748 -59.097 1.00 33.70  ? 527  ALA A C     1 
ATOM   6724  O  O     . ALA C  2  127 ? 75.699  35.277 -58.194 1.00 30.72  ? 527  ALA A O     1 
ATOM   6725  C  CB    . ALA C  2  127 ? 78.242  34.490 -60.300 1.00 29.86  ? 527  ALA A CB    1 
ATOM   6726  N  N     . ARG C  2  128 ? 76.868  36.998 -59.076 1.00 32.60  ? 528  ARG A N     1 
ATOM   6727  C  CA    . ARG C  2  128 ? 76.599  37.887 -57.958 1.00 33.87  ? 528  ARG A CA    1 
ATOM   6728  C  C     . ARG C  2  128 ? 75.104  38.191 -57.835 1.00 35.76  ? 528  ARG A C     1 
ATOM   6729  O  O     . ARG C  2  128 ? 74.563  38.254 -56.723 1.00 35.15  ? 528  ARG A O     1 
ATOM   6730  C  CB    . ARG C  2  128 ? 77.415  39.180 -58.091 1.00 32.87  ? 528  ARG A CB    1 
ATOM   6731  C  CG    . ARG C  2  128 ? 78.918  38.974 -57.954 1.00 34.68  ? 528  ARG A CG    1 
ATOM   6732  C  CD    . ARG C  2  128 ? 79.661  40.318 -57.850 1.00 37.03  ? 528  ARG A CD    1 
ATOM   6733  N  NE    . ARG C  2  128 ? 79.472  40.935 -56.538 1.00 38.31  ? 528  ARG A NE    1 
ATOM   6734  C  CZ    . ARG C  2  128 ? 79.107  42.200 -56.353 1.00 41.54  ? 528  ARG A CZ    1 
ATOM   6735  N  NH1   . ARG C  2  128 ? 78.900  42.993 -57.399 1.00 40.93  ? 528  ARG A NH1   1 
ATOM   6736  N  NH2   . ARG C  2  128 ? 78.904  42.659 -55.122 1.00 42.49  ? 528  ARG A NH2   1 
ATOM   6737  N  N     . ARG C  2  129 ? 74.434  38.371 -58.969 1.00 34.75  ? 529  ARG A N     1 
ATOM   6738  C  CA    . ARG C  2  129 ? 73.003  38.636 -58.946 1.00 36.68  ? 529  ARG A CA    1 
ATOM   6739  C  C     . ARG C  2  129 ? 72.243  37.449 -58.324 1.00 36.95  ? 529  ARG A C     1 
ATOM   6740  O  O     . ARG C  2  129 ? 71.400  37.634 -57.451 1.00 37.07  ? 529  ARG A O     1 
ATOM   6741  C  CB    . ARG C  2  129 ? 72.495  38.935 -60.364 1.00 40.74  ? 529  ARG A CB    1 
ATOM   6742  C  CG    . ARG C  2  129 ? 70.999  38.699 -60.587 1.00 45.68  ? 529  ARG A CG    1 
ATOM   6743  C  CD    . ARG C  2  129 ? 70.114  39.577 -59.696 1.00 49.53  ? 529  ARG A CD    1 
ATOM   6744  N  NE    . ARG C  2  129 ? 68.689  39.305 -59.904 1.00 52.60  ? 529  ARG A NE    1 
ATOM   6745  C  CZ    . ARG C  2  129 ? 68.011  38.315 -59.317 1.00 54.94  ? 529  ARG A CZ    1 
ATOM   6746  N  NH1   . ARG C  2  129 ? 68.615  37.486 -58.467 1.00 52.76  ? 529  ARG A NH1   1 
ATOM   6747  N  NH2   . ARG C  2  129 ? 66.724  38.136 -59.600 1.00 54.25  ? 529  ARG A NH2   1 
ATOM   6748  N  N     . ILE C  2  130 ? 72.578  36.227 -58.726 1.00 35.58  ? 530  ILE A N     1 
ATOM   6749  C  CA    . ILE C  2  130 ? 71.885  35.062 -58.182 1.00 37.31  ? 530  ILE A CA    1 
ATOM   6750  C  C     . ILE C  2  130 ? 72.223  34.808 -56.712 1.00 38.78  ? 530  ILE A C     1 
ATOM   6751  O  O     . ILE C  2  130 ? 71.380  34.336 -55.956 1.00 39.53  ? 530  ILE A O     1 
ATOM   6752  C  CB    . ILE C  2  130 ? 72.123  33.811 -59.054 1.00 36.35  ? 530  ILE A CB    1 
ATOM   6753  C  CG1   . ILE C  2  130 ? 71.506  34.057 -60.435 1.00 36.78  ? 530  ILE A CG1   1 
ATOM   6754  C  CG2   . ILE C  2  130 ? 71.503  32.567 -58.408 1.00 34.10  ? 530  ILE A CG2   1 
ATOM   6755  C  CD1   . ILE C  2  130 ? 71.789  32.952 -61.429 1.00 41.89  ? 530  ILE A CD1   1 
ATOM   6756  N  N     . ARG C  2  131 ? 73.442  35.150 -56.306 1.00 40.23  ? 531  ARG A N     1 
ATOM   6757  C  CA    . ARG C  2  131 ? 73.853  34.994 -54.912 1.00 42.03  ? 531  ARG A CA    1 
ATOM   6758  C  C     . ARG C  2  131 ? 73.133  36.023 -54.045 1.00 43.90  ? 531  ARG A C     1 
ATOM   6759  O  O     . ARG C  2  131 ? 73.066  35.875 -52.834 1.00 46.56  ? 531  ARG A O     1 
ATOM   6760  C  CB    . ARG C  2  131 ? 75.352  35.215 -54.762 1.00 40.68  ? 531  ARG A CB    1 
ATOM   6761  C  CG    . ARG C  2  131 ? 76.210  34.150 -55.381 1.00 38.95  ? 531  ARG A CG    1 
ATOM   6762  C  CD    . ARG C  2  131 ? 77.645  34.622 -55.389 1.00 39.76  ? 531  ARG A CD    1 
ATOM   6763  N  NE    . ARG C  2  131 ? 78.586  33.515 -55.325 1.00 41.09  ? 531  ARG A NE    1 
ATOM   6764  C  CZ    . ARG C  2  131 ? 79.736  33.560 -54.667 1.00 39.09  ? 531  ARG A CZ    1 
ATOM   6765  N  NH1   . ARG C  2  131 ? 80.083  34.668 -54.014 1.00 36.90  ? 531  ARG A NH1   1 
ATOM   6766  N  NH2   . ARG C  2  131 ? 80.536  32.502 -54.671 1.00 36.37  ? 531  ARG A NH2   1 
ATOM   6767  N  N     . GLY C  2  132 ? 72.632  37.078 -54.682 1.00 47.28  ? 532  GLY A N     1 
ATOM   6768  C  CA    . GLY C  2  132 ? 71.940  38.142 -53.980 1.00 51.40  ? 532  GLY A CA    1 
ATOM   6769  C  C     . GLY C  2  132 ? 72.894  39.230 -53.497 1.00 56.03  ? 532  GLY A C     1 
ATOM   6770  O  O     . GLY C  2  132 ? 72.581  39.942 -52.556 1.00 56.56  ? 532  GLY A O     1 
ATOM   6771  N  N     . GLU C  2  133 ? 74.034  39.392 -54.154 1.00 58.21  ? 533  GLU A N     1 
ATOM   6772  C  CA    . GLU C  2  133 ? 74.998  40.411 -53.789 1.00 62.95  ? 533  GLU A CA    1 
ATOM   6773  C  C     . GLU C  2  133 ? 74.762  41.630 -54.607 1.00 67.76  ? 533  GLU A C     1 
ATOM   6774  O  O     . GLU C  2  133 ? 75.224  42.712 -54.276 1.00 67.64  ? 533  GLU A O     1 
ATOM   6775  C  CB    . GLU C  2  133 ? 76.414  39.926 -54.090 1.00 60.08  ? 533  GLU A CB    1 
ATOM   6776  C  CG    . GLU C  2  133 ? 76.835  38.791 -53.234 1.00 56.11  ? 533  GLU A CG    1 
ATOM   6777  C  CD    . GLU C  2  133 ? 78.228  38.305 -53.530 1.00 55.16  ? 533  GLU A CD    1 
ATOM   6778  O  OE1   . GLU C  2  133 ? 79.025  39.055 -54.137 1.00 53.17  ? 533  GLU A OE1   1 
ATOM   6779  O  OE2   . GLU C  2  133 ? 78.525  37.157 -53.146 1.00 52.39  ? 533  GLU A OE2   1 
ATOM   6780  N  N     . ARG C  2  134 ? 74.136  41.416 -55.777 1.00 74.36  ? 534  ARG A N     1 
ATOM   6781  C  CA    . ARG C  2  134 ? 73.805  42.511 -56.666 1.00 81.25  ? 534  ARG A CA    1 
ATOM   6782  C  C     . ARG C  2  134 ? 72.345  42.642 -56.362 1.00 83.36  ? 534  ARG A C     1 
ATOM   6783  O  O     . ARG C  2  134 ? 71.892  43.705 -55.956 1.00 84.16  ? 534  ARG A O     1 
ATOM   6784  C  CB    . ARG C  2  134 ? 74.040  42.139 -58.142 1.00 84.01  ? 534  ARG A CB    1 
ATOM   6785  C  CG    . ARG C  2  134 ? 75.487  41.810 -58.412 1.00 88.66  ? 534  ARG A CG    1 
ATOM   6786  C  CD    . ARG C  2  134 ? 75.763  42.083 -59.869 1.00 92.39  ? 534  ARG A CD    1 
ATOM   6787  N  NE    . ARG C  2  134 ? 74.658  41.664 -60.731 1.00 96.40  ? 534  ARG A NE    1 
ATOM   6788  C  CZ    . ARG C  2  134 ? 74.347  42.247 -61.887 1.00 98.54  ? 534  ARG A CZ    1 
ATOM   6789  N  NH1   . ARG C  2  134 ? 75.055  43.282 -62.328 1.00 99.37  ? 534  ARG A NH1   1 
ATOM   6790  N  NH2   . ARG C  2  134 ? 73.322  41.798 -62.606 1.00 99.02  ? 534  ARG A NH2   1 
ATOM   6791  N  N     . ALA C  2  135 ? 71.641  41.513 -56.433 1.00 85.76  ? 535  ALA A N     1 
ATOM   6792  C  CA    . ALA C  2  135 ? 70.225  41.503 -56.109 1.00 88.42  ? 535  ALA A CA    1 
ATOM   6793  C  C     . ALA C  2  135 ? 70.082  42.065 -54.696 1.00 90.22  ? 535  ALA A C     1 
ATOM   6794  O  O     . ALA C  2  135 ? 71.043  41.888 -53.911 1.00 91.50  ? 535  ALA A O     1 
ATOM   6795  C  CB    . ALA C  2  135 ? 69.667  40.086 -56.188 1.00 86.69  ? 535  ALA A CB    1 
ATOM   6796  O  OXT   . ALA C  2  135 ? 69.048  42.715 -54.417 1.00 91.64  ? 535  ALA A OXT   1 
ATOM   6797  N  N     . LEU D  3  22  ? 104.022 55.702 -60.508 1.00 113.40 ? 22   LEU B N     1 
ATOM   6798  C  CA    . LEU D  3  22  ? 102.881 55.472 -59.584 1.00 113.50 ? 22   LEU B CA    1 
ATOM   6799  C  C     . LEU D  3  22  ? 102.096 54.207 -59.948 1.00 112.36 ? 22   LEU B C     1 
ATOM   6800  O  O     . LEU D  3  22  ? 102.529 53.431 -60.798 1.00 112.99 ? 22   LEU B O     1 
ATOM   6801  C  CB    . LEU D  3  22  ? 101.962 56.709 -59.539 1.00 115.21 ? 22   LEU B CB    1 
ATOM   6802  C  CG    . LEU D  3  22  ? 101.949 57.650 -60.752 1.00 116.54 ? 22   LEU B CG    1 
ATOM   6803  C  CD1   . LEU D  3  22  ? 101.282 56.974 -61.942 1.00 117.27 ? 22   LEU B CD1   1 
ATOM   6804  C  CD2   . LEU D  3  22  ? 101.219 58.944 -60.406 1.00 117.14 ? 22   LEU B CD2   1 
ATOM   6805  N  N     . ARG D  3  23  ? 100.973 53.991 -59.264 1.00 109.90 ? 23   ARG B N     1 
ATOM   6806  C  CA    . ARG D  3  23  ? 100.083 52.839 -59.463 1.00 106.63 ? 23   ARG B CA    1 
ATOM   6807  C  C     . ARG D  3  23  ? 99.326  52.849 -58.139 1.00 103.34 ? 23   ARG B C     1 
ATOM   6808  O  O     . ARG D  3  23  ? 99.890  52.516 -57.095 1.00 103.54 ? 23   ARG B O     1 
ATOM   6809  C  CB    . ARG D  3  23  ? 100.894 51.539 -59.603 1.00 108.09 ? 23   ARG B CB    1 
ATOM   6810  C  CG    . ARG D  3  23  ? 100.296 50.520 -60.579 1.00 109.30 ? 23   ARG B CG    1 
ATOM   6811  C  CD    . ARG D  3  23  ? 100.970 49.152 -60.454 1.00 110.45 ? 23   ARG B CD    1 
ATOM   6812  N  NE    . ARG D  3  23  ? 100.793 48.592 -59.117 1.00 111.80 ? 23   ARG B NE    1 
ATOM   6813  C  CZ    . ARG D  3  23  ? 101.624 47.729 -58.539 1.00 112.13 ? 23   ARG B CZ    1 
ATOM   6814  N  NH1   . ARG D  3  23  ? 102.706 47.308 -59.178 1.00 112.88 ? 23   ARG B NH1   1 
ATOM   6815  N  NH2   . ARG D  3  23  ? 101.390 47.309 -57.303 1.00 112.37 ? 23   ARG B NH2   1 
ATOM   6816  N  N     . ASP D  3  24  ? 98.067  53.269 -58.173 1.00 98.34  ? 24   ASP B N     1 
ATOM   6817  C  CA    . ASP D  3  24  ? 97.282  53.368 -56.949 1.00 93.30  ? 24   ASP B CA    1 
ATOM   6818  C  C     . ASP D  3  24  ? 96.538  52.148 -56.406 1.00 87.96  ? 24   ASP B C     1 
ATOM   6819  O  O     . ASP D  3  24  ? 95.629  51.613 -57.035 1.00 87.46  ? 24   ASP B O     1 
ATOM   6820  C  CB    . ASP D  3  24  ? 96.352  54.580 -57.002 1.00 95.03  ? 24   ASP B CB    1 
ATOM   6821  C  CG    . ASP D  3  24  ? 95.465  54.580 -58.224 1.00 96.10  ? 24   ASP B CG    1 
ATOM   6822  O  OD1   . ASP D  3  24  ? 95.716  55.389 -59.145 1.00 97.02  ? 24   ASP B OD1   1 
ATOM   6823  O  OD2   . ASP D  3  24  ? 94.506  53.776 -58.260 1.00 96.27  ? 24   ASP B OD2   1 
ATOM   6824  N  N     . ASN D  3  25  ? 96.939  51.770 -55.194 1.00 81.92  ? 25   ASN B N     1 
ATOM   6825  C  CA    . ASN D  3  25  ? 96.404  50.658 -54.414 1.00 75.06  ? 25   ASN B CA    1 
ATOM   6826  C  C     . ASN D  3  25  ? 95.575  49.571 -55.089 1.00 70.17  ? 25   ASN B C     1 
ATOM   6827  O  O     . ASN D  3  25  ? 96.052  48.448 -55.235 1.00 67.37  ? 25   ASN B O     1 
ATOM   6828  C  CB    . ASN D  3  25  ? 95.690  51.217 -53.184 1.00 74.75  ? 25   ASN B CB    1 
ATOM   6829  C  CG    . ASN D  3  25  ? 96.570  52.172 -52.398 1.00 74.22  ? 25   ASN B CG    1 
ATOM   6830  O  OD1   . ASN D  3  25  ? 97.779  51.966 -52.283 1.00 71.79  ? 25   ASN B OD1   1 
ATOM   6831  N  ND2   . ASN D  3  25  ? 95.972  53.239 -51.880 1.00 73.34  ? 25   ASN B ND2   1 
ATOM   6832  N  N     . ILE D  3  26  ? 94.342  49.883 -55.477 1.00 65.70  ? 26   ILE B N     1 
ATOM   6833  C  CA    . ILE D  3  26  ? 93.497  48.878 -56.121 1.00 62.39  ? 26   ILE B CA    1 
ATOM   6834  C  C     . ILE D  3  26  ? 94.202  48.209 -57.304 1.00 60.84  ? 26   ILE B C     1 
ATOM   6835  O  O     . ILE D  3  26  ? 93.980  47.026 -57.568 1.00 59.13  ? 26   ILE B O     1 
ATOM   6836  C  CB    . ILE D  3  26  ? 92.140  49.455 -56.577 1.00 61.88  ? 26   ILE B CB    1 
ATOM   6837  C  CG1   . ILE D  3  26  ? 91.209  48.324 -57.027 1.00 61.95  ? 26   ILE B CG1   1 
ATOM   6838  C  CG2   . ILE D  3  26  ? 92.344  50.429 -57.714 1.00 60.73  ? 26   ILE B CG2   1 
ATOM   6839  C  CD1   . ILE D  3  26  ? 90.907  47.297 -55.954 1.00 59.90  ? 26   ILE B CD1   1 
ATOM   6840  N  N     . GLN D  3  27  ? 95.061  48.956 -58.002 1.00 58.57  ? 27   GLN B N     1 
ATOM   6841  C  CA    . GLN D  3  27  ? 95.801  48.402 -59.136 1.00 56.54  ? 27   GLN B CA    1 
ATOM   6842  C  C     . GLN D  3  27  ? 96.930  47.513 -58.626 1.00 55.65  ? 27   GLN B C     1 
ATOM   6843  O  O     . GLN D  3  27  ? 97.516  46.728 -59.378 1.00 55.04  ? 27   GLN B O     1 
ATOM   6844  C  CB    . GLN D  3  27  ? 96.335  49.512 -60.046 1.00 56.95  ? 27   GLN B CB    1 
ATOM   6845  C  CG    . GLN D  3  27  ? 95.226  50.321 -60.732 1.00 56.60  ? 27   GLN B CG    1 
ATOM   6846  C  CD    . GLN D  3  27  ? 94.315  49.455 -61.600 1.00 55.88  ? 27   GLN B CD    1 
ATOM   6847  O  OE1   . GLN D  3  27  ? 94.784  48.584 -62.328 1.00 54.82  ? 27   GLN B OE1   1 
ATOM   6848  N  NE2   . GLN D  3  27  ? 93.009  49.693 -61.516 1.00 52.59  ? 27   GLN B NE2   1 
ATOM   6849  N  N     . GLY D  3  28  ? 97.223  47.638 -57.336 1.00 53.71  ? 28   GLY B N     1 
ATOM   6850  C  CA    . GLY D  3  28  ? 98.241  46.809 -56.727 1.00 52.55  ? 28   GLY B CA    1 
ATOM   6851  C  C     . GLY D  3  28  ? 97.793  45.368 -56.830 1.00 52.27  ? 28   GLY B C     1 
ATOM   6852  O  O     . GLY D  3  28  ? 98.616  44.452 -56.800 1.00 54.05  ? 28   GLY B O     1 
ATOM   6853  N  N     . ILE D  3  29  ? 96.479  45.158 -56.865 1.00 50.52  ? 29   ILE B N     1 
ATOM   6854  C  CA    . ILE D  3  29  ? 95.938  43.812 -57.009 1.00 49.33  ? 29   ILE B CA    1 
ATOM   6855  C  C     . ILE D  3  29  ? 96.147  43.567 -58.493 1.00 48.08  ? 29   ILE B C     1 
ATOM   6856  O  O     . ILE D  3  29  ? 95.325  43.943 -59.332 1.00 49.46  ? 29   ILE B O     1 
ATOM   6857  C  CB    . ILE D  3  29  ? 94.432  43.750 -56.661 1.00 49.82  ? 29   ILE B CB    1 
ATOM   6858  C  CG1   . ILE D  3  29  ? 94.180  44.354 -55.277 1.00 49.45  ? 29   ILE B CG1   1 
ATOM   6859  C  CG2   . ILE D  3  29  ? 93.947  42.313 -56.701 1.00 48.40  ? 29   ILE B CG2   1 
ATOM   6860  C  CD1   . ILE D  3  29  ? 94.931  43.669 -54.145 1.00 49.71  ? 29   ILE B CD1   1 
ATOM   6861  N  N     . THR D  3  30  ? 97.277  42.959 -58.807 1.00 48.16  ? 30   THR B N     1 
ATOM   6862  C  CA    . THR D  3  30  ? 97.666  42.720 -60.185 1.00 48.95  ? 30   THR B CA    1 
ATOM   6863  C  C     . THR D  3  30  ? 96.980  41.637 -60.997 1.00 50.30  ? 30   THR B C     1 
ATOM   6864  O  O     . THR D  3  30  ? 96.344  40.718 -60.462 1.00 49.56  ? 30   THR B O     1 
ATOM   6865  C  CB    . THR D  3  30  ? 99.164  42.447 -60.268 1.00 49.48  ? 30   THR B CB    1 
ATOM   6866  O  OG1   . THR D  3  30  ? 99.450  41.177 -59.671 1.00 49.34  ? 30   THR B OG1   1 
ATOM   6867  C  CG2   . THR D  3  30  ? 99.938  43.531 -59.518 1.00 48.87  ? 30   THR B CG2   1 
ATOM   6868  N  N     . LYS D  3  31  ? 97.199  41.724 -62.306 1.00 50.23  ? 31   LYS B N     1 
ATOM   6869  C  CA    . LYS D  3  31  ? 96.662  40.769 -63.250 1.00 50.88  ? 31   LYS B CA    1 
ATOM   6870  C  C     . LYS D  3  31  ? 97.143  39.364 -62.886 1.00 49.85  ? 31   LYS B C     1 
ATOM   6871  O  O     . LYS D  3  31  ? 96.336  38.442 -62.759 1.00 49.91  ? 31   LYS B O     1 
ATOM   6872  C  CB    . LYS D  3  31  ? 97.110  41.124 -64.668 1.00 53.23  ? 31   LYS B CB    1 
ATOM   6873  C  CG    . LYS D  3  31  ? 96.688  40.141 -65.732 1.00 57.84  ? 31   LYS B CG    1 
ATOM   6874  C  CD    . LYS D  3  31  ? 97.198  40.571 -67.110 1.00 61.18  ? 31   LYS B CD    1 
ATOM   6875  C  CE    . LYS D  3  31  ? 96.768  39.585 -68.188 1.00 63.10  ? 31   LYS B CE    1 
ATOM   6876  N  NZ    . LYS D  3  31  ? 97.234  40.000 -69.543 1.00 65.97  ? 31   LYS B NZ    1 
ATOM   6877  N  N     . PRO D  3  32  ? 98.460  39.185 -62.678 1.00 47.96  ? 32   PRO B N     1 
ATOM   6878  C  CA    . PRO D  3  32  ? 98.955  37.849 -62.323 1.00 46.67  ? 32   PRO B CA    1 
ATOM   6879  C  C     . PRO D  3  32  ? 98.302  37.305 -61.048 1.00 44.38  ? 32   PRO B C     1 
ATOM   6880  O  O     . PRO D  3  32  ? 98.071  36.109 -60.930 1.00 44.82  ? 32   PRO B O     1 
ATOM   6881  C  CB    . PRO D  3  32  ? 100.459 38.082 -62.124 1.00 47.30  ? 32   PRO B CB    1 
ATOM   6882  C  CG    . PRO D  3  32  ? 100.750 39.247 -63.044 1.00 48.12  ? 32   PRO B CG    1 
ATOM   6883  C  CD    . PRO D  3  32  ? 99.573  40.148 -62.785 1.00 48.38  ? 32   PRO B CD    1 
ATOM   6884  N  N     . ALA D  3  33  ? 98.020  38.183 -60.088 1.00 43.74  ? 33   ALA B N     1 
ATOM   6885  C  CA    . ALA D  3  33  ? 97.403  37.759 -58.833 1.00 42.63  ? 33   ALA B CA    1 
ATOM   6886  C  C     . ALA D  3  33  ? 95.972  37.291 -59.082 1.00 40.97  ? 33   ALA B C     1 
ATOM   6887  O  O     . ALA D  3  33  ? 95.556  36.232 -58.597 1.00 40.93  ? 33   ALA B O     1 
ATOM   6888  C  CB    . ALA D  3  33  ? 97.413  38.901 -57.832 1.00 43.66  ? 33   ALA B CB    1 
ATOM   6889  N  N     . ILE D  3  34  ? 95.225  38.095 -59.830 1.00 38.54  ? 34   ILE B N     1 
ATOM   6890  C  CA    . ILE D  3  34  ? 93.839  37.783 -60.151 1.00 40.69  ? 34   ILE B CA    1 
ATOM   6891  C  C     . ILE D  3  34  ? 93.758  36.487 -60.960 1.00 42.12  ? 34   ILE B C     1 
ATOM   6892  O  O     . ILE D  3  34  ? 92.844  35.683 -60.765 1.00 43.72  ? 34   ILE B O     1 
ATOM   6893  C  CB    . ILE D  3  34  ? 93.175  38.952 -60.902 1.00 39.04  ? 34   ILE B CB    1 
ATOM   6894  C  CG1   . ILE D  3  34  ? 93.105  40.168 -59.981 1.00 36.08  ? 34   ILE B CG1   1 
ATOM   6895  C  CG2   . ILE D  3  34  ? 91.783  38.572 -61.371 1.00 38.20  ? 34   ILE B CG2   1 
ATOM   6896  C  CD1   . ILE D  3  34  ? 92.758  41.464 -60.698 1.00 37.17  ? 34   ILE B CD1   1 
ATOM   6897  N  N     . ARG D  3  35  ? 94.741  36.266 -61.828 1.00 41.89  ? 35   ARG B N     1 
ATOM   6898  C  CA    . ARG D  3  35  ? 94.785  35.054 -62.633 1.00 43.63  ? 35   ARG B CA    1 
ATOM   6899  C  C     . ARG D  3  35  ? 95.028  33.847 -61.724 1.00 43.08  ? 35   ARG B C     1 
ATOM   6900  O  O     . ARG D  3  35  ? 94.416  32.790 -61.908 1.00 42.83  ? 35   ARG B O     1 
ATOM   6901  C  CB    . ARG D  3  35  ? 95.863  35.157 -63.719 1.00 45.11  ? 35   ARG B CB    1 
ATOM   6902  C  CG    . ARG D  3  35  ? 96.158  33.845 -64.441 1.00 51.93  ? 35   ARG B CG    1 
ATOM   6903  C  CD    . ARG D  3  35  ? 96.995  34.080 -65.693 1.00 55.88  ? 35   ARG B CD    1 
ATOM   6904  N  NE    . ARG D  3  35  ? 96.320  35.030 -66.570 1.00 60.51  ? 35   ARG B NE    1 
ATOM   6905  C  CZ    . ARG D  3  35  ? 96.044  34.816 -67.854 1.00 63.06  ? 35   ARG B CZ    1 
ATOM   6906  N  NH1   . ARG D  3  35  ? 96.401  33.679 -68.443 1.00 63.10  ? 35   ARG B NH1   1 
ATOM   6907  N  NH2   . ARG D  3  35  ? 95.329  35.709 -68.526 1.00 63.10  ? 35   ARG B NH2   1 
ATOM   6908  N  N     . ARG D  3  36  ? 95.902  33.998 -60.730 1.00 41.08  ? 36   ARG B N     1 
ATOM   6909  C  CA    . ARG D  3  36  ? 96.158  32.889 -59.810 1.00 40.68  ? 36   ARG B CA    1 
ATOM   6910  C  C     . ARG D  3  36  ? 94.871  32.516 -59.052 1.00 40.06  ? 36   ARG B C     1 
ATOM   6911  O  O     . ARG D  3  36  ? 94.575  31.337 -58.863 1.00 38.20  ? 36   ARG B O     1 
ATOM   6912  C  CB    . ARG D  3  36  ? 97.271  33.228 -58.814 1.00 42.10  ? 36   ARG B CB    1 
ATOM   6913  C  CG    . ARG D  3  36  ? 98.689  33.243 -59.408 1.00 44.87  ? 36   ARG B CG    1 
ATOM   6914  C  CD    . ARG D  3  36  ? 99.765  33.314 -58.302 1.00 42.21  ? 36   ARG B CD    1 
ATOM   6915  N  NE    . ARG D  3  36  ? 99.831  34.621 -57.641 1.00 42.85  ? 36   ARG B NE    1 
ATOM   6916  C  CZ    . ARG D  3  36  ? 100.528 35.662 -58.099 1.00 44.52  ? 36   ARG B CZ    1 
ATOM   6917  N  NH1   . ARG D  3  36  ? 101.221 35.555 -59.228 1.00 41.65  ? 36   ARG B NH1   1 
ATOM   6918  N  NH2   . ARG D  3  36  ? 100.543 36.809 -57.428 1.00 40.35  ? 36   ARG B NH2   1 
ATOM   6919  N  N     . LEU D  3  37  ? 94.133  33.528 -58.594 1.00 36.88  ? 37   LEU B N     1 
ATOM   6920  C  CA    . LEU D  3  37  ? 92.873  33.301 -57.884 1.00 37.43  ? 37   LEU B CA    1 
ATOM   6921  C  C     . LEU D  3  37  ? 91.905  32.529 -58.792 1.00 36.72  ? 37   LEU B C     1 
ATOM   6922  O  O     . LEU D  3  37  ? 91.282  31.549 -58.368 1.00 35.70  ? 37   LEU B O     1 
ATOM   6923  C  CB    . LEU D  3  37  ? 92.249  34.638 -57.468 1.00 34.40  ? 37   LEU B CB    1 
ATOM   6924  C  CG    . LEU D  3  37  ? 92.920  35.305 -56.263 1.00 35.57  ? 37   LEU B CG    1 
ATOM   6925  C  CD1   . LEU D  3  37  ? 92.493  36.755 -56.166 1.00 35.91  ? 37   LEU B CD1   1 
ATOM   6926  C  CD2   . LEU D  3  37  ? 92.582  34.540 -54.981 1.00 34.01  ? 37   LEU B CD2   1 
ATOM   6927  N  N     . ALA D  3  38  ? 91.799  32.969 -60.043 1.00 34.98  ? 38   ALA B N     1 
ATOM   6928  C  CA    . ALA D  3  38  ? 90.923  32.311 -60.998 1.00 36.65  ? 38   ALA B CA    1 
ATOM   6929  C  C     . ALA D  3  38  ? 91.356  30.864 -61.222 1.00 35.48  ? 38   ALA B C     1 
ATOM   6930  O  O     . ALA D  3  38  ? 90.517  29.970 -61.311 1.00 35.73  ? 38   ALA B O     1 
ATOM   6931  C  CB    . ALA D  3  38  ? 90.890  33.081 -62.321 1.00 35.32  ? 38   ALA B CB    1 
ATOM   6932  N  N     . ARG D  3  39  ? 92.664  30.633 -61.295 1.00 36.26  ? 39   ARG B N     1 
ATOM   6933  C  CA    . ARG D  3  39  ? 93.189  29.280 -61.491 1.00 36.25  ? 39   ARG B CA    1 
ATOM   6934  C  C     . ARG D  3  39  ? 92.755  28.374 -60.349 1.00 36.50  ? 39   ARG B C     1 
ATOM   6935  O  O     . ARG D  3  39  ? 92.320  27.248 -60.582 1.00 35.60  ? 39   ARG B O     1 
ATOM   6936  C  CB    . ARG D  3  39  ? 94.722  29.289 -61.595 1.00 38.70  ? 39   ARG B CB    1 
ATOM   6937  C  CG    . ARG D  3  39  ? 95.265  29.986 -62.839 1.00 38.16  ? 39   ARG B CG    1 
ATOM   6938  C  CD    . ARG D  3  39  ? 94.961  29.205 -64.119 1.00 42.00  ? 39   ARG B CD    1 
ATOM   6939  N  NE    . ARG D  3  39  ? 95.615  29.833 -65.266 1.00 43.28  ? 39   ARG B NE    1 
ATOM   6940  C  CZ    . ARG D  3  39  ? 94.979  30.484 -66.233 1.00 45.17  ? 39   ARG B CZ    1 
ATOM   6941  N  NH1   . ARG D  3  39  ? 93.655  30.586 -66.216 1.00 44.18  ? 39   ARG B NH1   1 
ATOM   6942  N  NH2   . ARG D  3  39  ? 95.674  31.105 -67.178 1.00 44.83  ? 39   ARG B NH2   1 
ATOM   6943  N  N     . ARG D  3  40  ? 92.893  28.851 -59.112 1.00 35.58  ? 40   ARG B N     1 
ATOM   6944  C  CA    . ARG D  3  40  ? 92.481  28.053 -57.961 1.00 35.18  ? 40   ARG B CA    1 
ATOM   6945  C  C     . ARG D  3  40  ? 90.974  27.802 -58.039 1.00 35.27  ? 40   ARG B C     1 
ATOM   6946  O  O     . ARG D  3  40  ? 90.474  26.777 -57.563 1.00 35.57  ? 40   ARG B O     1 
ATOM   6947  C  CB    . ARG D  3  40  ? 92.847  28.742 -56.643 1.00 35.15  ? 40   ARG B CB    1 
ATOM   6948  C  CG    . ARG D  3  40  ? 92.563  27.879 -55.407 1.00 37.41  ? 40   ARG B CG    1 
ATOM   6949  C  CD    . ARG D  3  40  ? 93.218  28.432 -54.141 1.00 40.03  ? 40   ARG B CD    1 
ATOM   6950  N  NE    . ARG D  3  40  ? 94.646  28.130 -54.098 1.00 43.73  ? 40   ARG B NE    1 
ATOM   6951  C  CZ    . ARG D  3  40  ? 95.525  28.712 -53.284 1.00 44.93  ? 40   ARG B CZ    1 
ATOM   6952  N  NH1   . ARG D  3  40  ? 95.138  29.640 -52.414 1.00 41.40  ? 40   ARG B NH1   1 
ATOM   6953  N  NH2   . ARG D  3  40  ? 96.809  28.393 -53.371 1.00 44.60  ? 40   ARG B NH2   1 
ATOM   6954  N  N     . GLY D  3  41  ? 90.261  28.736 -58.666 1.00 34.70  ? 41   GLY B N     1 
ATOM   6955  C  CA    . GLY D  3  41  ? 88.824  28.585 -58.833 1.00 34.90  ? 41   GLY B CA    1 
ATOM   6956  C  C     . GLY D  3  41  ? 88.464  27.686 -60.016 1.00 35.63  ? 41   GLY B C     1 
ATOM   6957  O  O     . GLY D  3  41  ? 87.285  27.559 -60.361 1.00 35.50  ? 41   GLY B O     1 
ATOM   6958  N  N     . GLY D  3  42  ? 89.480  27.112 -60.666 1.00 33.01  ? 42   GLY B N     1 
ATOM   6959  C  CA    . GLY D  3  42  ? 89.253  26.223 -61.800 1.00 34.65  ? 42   GLY B CA    1 
ATOM   6960  C  C     . GLY D  3  42  ? 89.088  26.857 -63.178 1.00 35.87  ? 42   GLY B C     1 
ATOM   6961  O  O     . GLY D  3  42  ? 88.713  26.169 -64.132 1.00 34.48  ? 42   GLY B O     1 
ATOM   6962  N  N     . VAL D  3  43  ? 89.387  28.148 -63.293 1.00 34.13  ? 43   VAL B N     1 
ATOM   6963  C  CA    . VAL D  3  43  ? 89.247  28.873 -64.553 1.00 34.90  ? 43   VAL B CA    1 
ATOM   6964  C  C     . VAL D  3  43  ? 90.412  28.677 -65.529 1.00 38.96  ? 43   VAL B C     1 
ATOM   6965  O  O     . VAL D  3  43  ? 91.573  28.910 -65.190 1.00 38.11  ? 43   VAL B O     1 
ATOM   6966  C  CB    . VAL D  3  43  ? 89.053  30.375 -64.287 1.00 35.54  ? 43   VAL B CB    1 
ATOM   6967  C  CG1   . VAL D  3  43  ? 88.932  31.137 -65.609 1.00 33.22  ? 43   VAL B CG1   1 
ATOM   6968  C  CG2   . VAL D  3  43  ? 87.828  30.585 -63.422 1.00 33.48  ? 43   VAL B CG2   1 
ATOM   6969  N  N     . LYS D  3  44  ? 90.079  28.313 -66.763 1.00 41.70  ? 44   LYS B N     1 
ATOM   6970  C  CA    . LYS D  3  44  ? 91.068  28.056 -67.805 1.00 43.47  ? 44   LYS B CA    1 
ATOM   6971  C  C     . LYS D  3  44  ? 91.379  29.216 -68.749 1.00 44.57  ? 44   LYS B C     1 
ATOM   6972  O  O     . LYS D  3  44  ? 92.514  29.351 -69.209 1.00 45.36  ? 44   LYS B O     1 
ATOM   6973  C  CB    . LYS D  3  44  ? 90.622  26.848 -68.624 1.00 44.87  ? 44   LYS B CB    1 
ATOM   6974  C  CG    . LYS D  3  44  ? 91.571  26.443 -69.740 1.00 47.96  ? 44   LYS B CG    1 
ATOM   6975  C  CD    . LYS D  3  44  ? 91.029  25.217 -70.471 1.00 49.09  ? 44   LYS B CD    1 
ATOM   6976  C  CE    . LYS D  3  44  ? 91.927  24.792 -71.631 1.00 50.24  ? 44   LYS B CE    1 
ATOM   6977  N  NZ    . LYS D  3  44  ? 91.248  23.783 -72.502 1.00 49.45  ? 44   LYS B NZ    1 
ATOM   6978  N  N     . ARG D  3  45  ? 90.386  30.053 -69.031 1.00 44.58  ? 45   ARG B N     1 
ATOM   6979  C  CA    . ARG D  3  45  ? 90.574  31.174 -69.947 1.00 44.33  ? 45   ARG B CA    1 
ATOM   6980  C  C     . ARG D  3  45  ? 89.879  32.417 -69.394 1.00 43.93  ? 45   ARG B C     1 
ATOM   6981  O  O     . ARG D  3  45  ? 88.722  32.349 -68.970 1.00 41.80  ? 45   ARG B O     1 
ATOM   6982  C  CB    . ARG D  3  45  ? 90.027  30.797 -71.324 1.00 45.19  ? 45   ARG B CB    1 
ATOM   6983  C  CG    . ARG D  3  45  ? 90.500  31.692 -72.446 1.00 47.74  ? 45   ARG B CG    1 
ATOM   6984  C  CD    . ARG D  3  45  ? 90.291  30.999 -73.794 1.00 50.74  ? 45   ARG B CD    1 
ATOM   6985  N  NE    . ARG D  3  45  ? 90.817  31.773 -74.915 1.00 54.36  ? 45   ARG B NE    1 
ATOM   6986  C  CZ    . ARG D  3  45  ? 90.179  32.784 -75.495 1.00 57.48  ? 45   ARG B CZ    1 
ATOM   6987  N  NH1   . ARG D  3  45  ? 88.978  33.159 -75.065 1.00 55.38  ? 45   ARG B NH1   1 
ATOM   6988  N  NH2   . ARG D  3  45  ? 90.747  33.425 -76.511 1.00 59.65  ? 45   ARG B NH2   1 
ATOM   6989  N  N     . ILE D  3  46  ? 90.574  33.552 -69.449 1.00 42.75  ? 46   ILE B N     1 
ATOM   6990  C  CA    . ILE D  3  46  ? 90.084  34.805 -68.879 1.00 41.60  ? 46   ILE B CA    1 
ATOM   6991  C  C     . ILE D  3  46  ? 90.035  35.987 -69.844 1.00 43.93  ? 46   ILE B C     1 
ATOM   6992  O  O     . ILE D  3  46  ? 91.031  36.317 -70.485 1.00 45.93  ? 46   ILE B O     1 
ATOM   6993  C  CB    . ILE D  3  46  ? 90.993  35.213 -67.716 1.00 41.24  ? 46   ILE B CB    1 
ATOM   6994  C  CG1   . ILE D  3  46  ? 91.163  34.041 -66.748 1.00 42.65  ? 46   ILE B CG1   1 
ATOM   6995  C  CG2   . ILE D  3  46  ? 90.434  36.433 -66.998 1.00 39.85  ? 46   ILE B CG2   1 
ATOM   6996  C  CD1   . ILE D  3  46  ? 92.258  34.286 -65.689 1.00 40.19  ? 46   ILE B CD1   1 
ATOM   6997  N  N     . SER D  3  47  ? 88.884  36.647 -69.908 1.00 43.03  ? 47   SER B N     1 
ATOM   6998  C  CA    . SER D  3  47  ? 88.705  37.804 -70.772 1.00 44.09  ? 47   SER B CA    1 
ATOM   6999  C  C     . SER D  3  47  ? 89.485  38.989 -70.196 1.00 44.71  ? 47   SER B C     1 
ATOM   7000  O  O     . SER D  3  47  ? 89.637  39.114 -68.975 1.00 42.37  ? 47   SER B O     1 
ATOM   7001  C  CB    . SER D  3  47  ? 87.222  38.153 -70.876 1.00 43.85  ? 47   SER B CB    1 
ATOM   7002  O  OG    . SER D  3  47  ? 87.055  39.549 -70.995 1.00 50.42  ? 47   SER B OG    1 
ATOM   7003  N  N     . GLY D  3  48  ? 89.961  39.868 -71.074 1.00 43.76  ? 48   GLY B N     1 
ATOM   7004  C  CA    . GLY D  3  48  ? 90.739  41.009 -70.628 1.00 42.69  ? 48   GLY B CA    1 
ATOM   7005  C  C     . GLY D  3  48  ? 90.014  41.923 -69.667 1.00 44.30  ? 48   GLY B C     1 
ATOM   7006  O  O     . GLY D  3  48  ? 90.639  42.534 -68.794 1.00 45.24  ? 48   GLY B O     1 
ATOM   7007  N  N     . LEU D  3  49  ? 88.691  41.988 -69.804 1.00 45.01  ? 49   LEU B N     1 
ATOM   7008  C  CA    . LEU D  3  49  ? 87.860  42.840 -68.960 1.00 44.66  ? 49   LEU B CA    1 
ATOM   7009  C  C     . LEU D  3  49  ? 87.637  42.311 -67.535 1.00 43.72  ? 49   LEU B C     1 
ATOM   7010  O  O     . LEU D  3  49  ? 87.140  43.040 -66.675 1.00 42.67  ? 49   LEU B O     1 
ATOM   7011  C  CB    . LEU D  3  49  ? 86.514  43.083 -69.645 1.00 46.21  ? 49   LEU B CB    1 
ATOM   7012  C  CG    . LEU D  3  49  ? 86.566  43.718 -71.045 1.00 50.06  ? 49   LEU B CG    1 
ATOM   7013  C  CD1   . LEU D  3  49  ? 85.190  43.657 -71.707 1.00 50.24  ? 49   LEU B CD1   1 
ATOM   7014  C  CD2   . LEU D  3  49  ? 87.045  45.160 -70.952 1.00 49.77  ? 49   LEU B CD2   1 
ATOM   7015  N  N     . ILE D  3  50  ? 87.997  41.051 -67.292 1.00 42.72  ? 50   ILE B N     1 
ATOM   7016  C  CA    . ILE D  3  50  ? 87.828  40.437 -65.972 1.00 41.74  ? 50   ILE B CA    1 
ATOM   7017  C  C     . ILE D  3  50  ? 88.593  41.150 -64.849 1.00 43.06  ? 50   ILE B C     1 
ATOM   7018  O  O     . ILE D  3  50  ? 88.054  41.384 -63.771 1.00 40.62  ? 50   ILE B O     1 
ATOM   7019  C  CB    . ILE D  3  50  ? 88.284  38.957 -65.982 1.00 42.28  ? 50   ILE B CB    1 
ATOM   7020  C  CG1   . ILE D  3  50  ? 87.310  38.100 -66.802 1.00 41.40  ? 50   ILE B CG1   1 
ATOM   7021  C  CG2   . ILE D  3  50  ? 88.426  38.428 -64.556 1.00 38.60  ? 50   ILE B CG2   1 
ATOM   7022  C  CD1   . ILE D  3  50  ? 85.898  38.049 -66.230 1.00 39.99  ? 50   ILE B CD1   1 
ATOM   7023  N  N     . TYR D  3  51  ? 89.841  41.511 -65.119 1.00 42.80  ? 51   TYR B N     1 
ATOM   7024  C  CA    . TYR D  3  51  ? 90.685  42.143 -64.112 1.00 44.02  ? 51   TYR B CA    1 
ATOM   7025  C  C     . TYR D  3  51  ? 90.089  43.368 -63.436 1.00 44.60  ? 51   TYR B C     1 
ATOM   7026  O  O     . TYR D  3  51  ? 90.066  43.444 -62.211 1.00 46.70  ? 51   TYR B O     1 
ATOM   7027  C  CB    . TYR D  3  51  ? 92.073  42.408 -64.700 1.00 43.88  ? 51   TYR B CB    1 
ATOM   7028  C  CG    . TYR D  3  51  ? 92.622  41.163 -65.374 1.00 44.22  ? 51   TYR B CG    1 
ATOM   7029  C  CD1   . TYR D  3  51  ? 93.002  40.050 -64.621 1.00 43.70  ? 51   TYR B CD1   1 
ATOM   7030  C  CD2   . TYR D  3  51  ? 92.657  41.057 -66.764 1.00 44.27  ? 51   TYR B CD2   1 
ATOM   7031  C  CE1   . TYR D  3  51  ? 93.394  38.860 -65.238 1.00 43.38  ? 51   TYR B CE1   1 
ATOM   7032  C  CE2   . TYR D  3  51  ? 93.043  39.873 -67.390 1.00 42.59  ? 51   TYR B CE2   1 
ATOM   7033  C  CZ    . TYR D  3  51  ? 93.409  38.777 -66.623 1.00 44.18  ? 51   TYR B CZ    1 
ATOM   7034  O  OH    . TYR D  3  51  ? 93.768  37.592 -67.235 1.00 43.77  ? 51   TYR B OH    1 
ATOM   7035  N  N     . GLU D  3  52  ? 89.564  44.304 -64.212 1.00 46.31  ? 52   GLU B N     1 
ATOM   7036  C  CA    . GLU D  3  52  ? 88.965  45.492 -63.618 1.00 47.03  ? 52   GLU B CA    1 
ATOM   7037  C  C     . GLU D  3  52  ? 87.673  45.120 -62.897 1.00 45.33  ? 52   GLU B C     1 
ATOM   7038  O  O     . GLU D  3  52  ? 87.378  45.657 -61.833 1.00 44.47  ? 52   GLU B O     1 
ATOM   7039  C  CB    . GLU D  3  52  ? 88.701  46.566 -64.679 1.00 50.08  ? 52   GLU B CB    1 
ATOM   7040  C  CG    . GLU D  3  52  ? 89.942  47.337 -65.088 1.00 56.23  ? 52   GLU B CG    1 
ATOM   7041  C  CD    . GLU D  3  52  ? 90.465  48.234 -63.967 1.00 61.07  ? 52   GLU B CD    1 
ATOM   7042  O  OE1   . GLU D  3  52  ? 89.904  49.340 -63.781 1.00 63.52  ? 52   GLU B OE1   1 
ATOM   7043  O  OE2   . GLU D  3  52  ? 91.430  47.835 -63.275 1.00 59.39  ? 52   GLU B OE2   1 
ATOM   7044  N  N     . GLU D  3  53  ? 86.914  44.191 -63.472 1.00 43.62  ? 53   GLU B N     1 
ATOM   7045  C  CA    . GLU D  3  53  ? 85.669  43.748 -62.855 1.00 42.70  ? 53   GLU B CA    1 
ATOM   7046  C  C     . GLU D  3  53  ? 85.978  43.153 -61.477 1.00 41.75  ? 53   GLU B C     1 
ATOM   7047  O  O     . GLU D  3  53  ? 85.317  43.482 -60.490 1.00 40.69  ? 53   GLU B O     1 
ATOM   7048  C  CB    . GLU D  3  53  ? 84.991  42.685 -63.728 1.00 44.78  ? 53   GLU B CB    1 
ATOM   7049  C  CG    . GLU D  3  53  ? 83.553  42.362 -63.337 1.00 49.47  ? 53   GLU B CG    1 
ATOM   7050  C  CD    . GLU D  3  53  ? 82.584  43.486 -63.691 1.00 54.27  ? 53   GLU B CD    1 
ATOM   7051  O  OE1   . GLU D  3  53  ? 82.996  44.432 -64.398 1.00 57.31  ? 53   GLU B OE1   1 
ATOM   7052  O  OE2   . GLU D  3  53  ? 81.410  43.422 -63.276 1.00 55.91  ? 53   GLU B OE2   1 
ATOM   7053  N  N     . THR D  3  54  ? 87.022  42.327 -61.415 1.00 38.76  ? 54   THR B N     1 
ATOM   7054  C  CA    . THR D  3  54  ? 87.419  41.674 -60.175 1.00 37.54  ? 54   THR B CA    1 
ATOM   7055  C  C     . THR D  3  54  ? 87.789  42.679 -59.087 1.00 40.03  ? 54   THR B C     1 
ATOM   7056  O  O     . THR D  3  54  ? 87.325  42.564 -57.950 1.00 37.99  ? 54   THR B O     1 
ATOM   7057  C  CB    . THR D  3  54  ? 88.591  40.706 -60.402 1.00 37.03  ? 54   THR B CB    1 
ATOM   7058  O  OG1   . THR D  3  54  ? 88.223  39.730 -61.385 1.00 39.94  ? 54   THR B OG1   1 
ATOM   7059  C  CG2   . THR D  3  54  ? 88.941  39.984 -59.114 1.00 38.57  ? 54   THR B CG2   1 
ATOM   7060  N  N     . ARG D  3  55  ? 88.603  43.674 -59.446 1.00 39.01  ? 55   ARG B N     1 
ATOM   7061  C  CA    . ARG D  3  55  ? 89.019  44.700 -58.493 1.00 39.83  ? 55   ARG B CA    1 
ATOM   7062  C  C     . ARG D  3  55  ? 87.798  45.392 -57.912 1.00 37.92  ? 55   ARG B C     1 
ATOM   7063  O  O     . ARG D  3  55  ? 87.716  45.601 -56.702 1.00 39.79  ? 55   ARG B O     1 
ATOM   7064  C  CB    . ARG D  3  55  ? 89.936  45.730 -59.170 1.00 41.03  ? 55   ARG B CB    1 
ATOM   7065  C  CG    . ARG D  3  55  ? 91.277  45.162 -59.569 1.00 42.49  ? 55   ARG B CG    1 
ATOM   7066  C  CD    . ARG D  3  55  ? 92.202  46.212 -60.184 1.00 46.00  ? 55   ARG B CD    1 
ATOM   7067  N  NE    . ARG D  3  55  ? 93.426  45.559 -60.631 1.00 46.53  ? 55   ARG B NE    1 
ATOM   7068  C  CZ    . ARG D  3  55  ? 93.742  45.366 -61.902 1.00 44.00  ? 55   ARG B CZ    1 
ATOM   7069  N  NH1   . ARG D  3  55  ? 92.935  45.800 -62.861 1.00 43.06  ? 55   ARG B NH1   1 
ATOM   7070  N  NH2   . ARG D  3  55  ? 94.814  44.653 -62.209 1.00 44.45  ? 55   ARG B NH2   1 
ATOM   7071  N  N     . GLY D  3  56  ? 86.855  45.752 -58.780 1.00 36.01  ? 56   GLY B N     1 
ATOM   7072  C  CA    . GLY D  3  56  ? 85.641  46.399 -58.317 1.00 36.83  ? 56   GLY B CA    1 
ATOM   7073  C  C     . GLY D  3  56  ? 84.906  45.514 -57.318 1.00 36.78  ? 56   GLY B C     1 
ATOM   7074  O  O     . GLY D  3  56  ? 84.448  45.975 -56.272 1.00 35.14  ? 56   GLY B O     1 
ATOM   7075  N  N     . VAL D  3  57  ? 84.825  44.223 -57.621 1.00 35.14  ? 57   VAL B N     1 
ATOM   7076  C  CA    . VAL D  3  57  ? 84.136  43.294 -56.730 1.00 35.42  ? 57   VAL B CA    1 
ATOM   7077  C  C     . VAL D  3  57  ? 84.843  43.183 -55.385 1.00 34.20  ? 57   VAL B C     1 
ATOM   7078  O  O     . VAL D  3  57  ? 84.196  43.240 -54.336 1.00 36.05  ? 57   VAL B O     1 
ATOM   7079  C  CB    . VAL D  3  57  ? 83.974  41.902 -57.384 1.00 35.24  ? 57   VAL B CB    1 
ATOM   7080  C  CG1   . VAL D  3  57  ? 83.563  40.875 -56.344 1.00 37.87  ? 57   VAL B CG1   1 
ATOM   7081  C  CG2   . VAL D  3  57  ? 82.941  41.982 -58.497 1.00 34.17  ? 57   VAL B CG2   1 
ATOM   7082  N  N     . LEU D  3  58  ? 86.167  43.045 -55.413 1.00 33.36  ? 58   LEU B N     1 
ATOM   7083  C  CA    . LEU D  3  58  ? 86.948  42.953 -54.183 1.00 35.71  ? 58   LEU B CA    1 
ATOM   7084  C  C     . LEU D  3  58  ? 86.786  44.227 -53.350 1.00 36.61  ? 58   LEU B C     1 
ATOM   7085  O  O     . LEU D  3  58  ? 86.701  44.179 -52.121 1.00 37.22  ? 58   LEU B O     1 
ATOM   7086  C  CB    . LEU D  3  58  ? 88.429  42.748 -54.507 1.00 35.95  ? 58   LEU B CB    1 
ATOM   7087  C  CG    . LEU D  3  58  ? 89.372  42.830 -53.304 1.00 38.94  ? 58   LEU B CG    1 
ATOM   7088  C  CD1   . LEU D  3  58  ? 89.106  41.675 -52.334 1.00 37.29  ? 58   LEU B CD1   1 
ATOM   7089  C  CD2   . LEU D  3  58  ? 90.824  42.809 -53.778 1.00 39.83  ? 58   LEU B CD2   1 
ATOM   7090  N  N     . LYS D  3  59  ? 86.751  45.370 -54.023 1.00 37.51  ? 59   LYS B N     1 
ATOM   7091  C  CA    . LYS D  3  59  ? 86.596  46.636 -53.319 1.00 39.44  ? 59   LYS B CA    1 
ATOM   7092  C  C     . LYS D  3  59  ? 85.283  46.636 -52.536 1.00 37.36  ? 59   LYS B C     1 
ATOM   7093  O  O     . LYS D  3  59  ? 85.250  47.012 -51.367 1.00 37.71  ? 59   LYS B O     1 
ATOM   7094  C  CB    . LYS D  3  59  ? 86.635  47.804 -54.309 1.00 41.53  ? 59   LYS B CB    1 
ATOM   7095  C  CG    . LYS D  3  59  ? 86.677  49.179 -53.656 1.00 47.14  ? 59   LYS B CG    1 
ATOM   7096  C  CD    . LYS D  3  59  ? 86.888  50.281 -54.702 1.00 48.32  ? 59   LYS B CD    1 
ATOM   7097  C  CE    . LYS D  3  59  ? 86.841  51.667 -54.063 1.00 52.92  ? 59   LYS B CE    1 
ATOM   7098  N  NZ    . LYS D  3  59  ? 85.472  52.257 -54.134 1.00 55.76  ? 59   LYS B NZ    1 
ATOM   7099  N  N     . VAL D  3  60  ? 84.200  46.220 -53.182 1.00 37.55  ? 60   VAL B N     1 
ATOM   7100  C  CA    . VAL D  3  60  ? 82.897  46.169 -52.521 1.00 36.39  ? 60   VAL B CA    1 
ATOM   7101  C  C     . VAL D  3  60  ? 82.962  45.218 -51.318 1.00 36.35  ? 60   VAL B C     1 
ATOM   7102  O  O     . VAL D  3  60  ? 82.487  45.545 -50.232 1.00 37.17  ? 60   VAL B O     1 
ATOM   7103  C  CB    . VAL D  3  60  ? 81.790  45.725 -53.501 1.00 36.52  ? 60   VAL B CB    1 
ATOM   7104  C  CG1   . VAL D  3  60  ? 80.523  45.359 -52.738 1.00 37.50  ? 60   VAL B CG1   1 
ATOM   7105  C  CG2   . VAL D  3  60  ? 81.505  46.845 -54.516 1.00 38.78  ? 60   VAL B CG2   1 
ATOM   7106  N  N     . PHE D  3  61  ? 83.580  44.057 -51.508 1.00 35.61  ? 61   PHE B N     1 
ATOM   7107  C  CA    . PHE D  3  61  ? 83.719  43.084 -50.425 1.00 35.70  ? 61   PHE B CA    1 
ATOM   7108  C  C     . PHE D  3  61  ? 84.451  43.705 -49.230 1.00 36.71  ? 61   PHE B C     1 
ATOM   7109  O  O     . PHE D  3  61  ? 83.976  43.641 -48.087 1.00 34.47  ? 61   PHE B O     1 
ATOM   7110  C  CB    . PHE D  3  61  ? 84.500  41.853 -50.904 1.00 35.65  ? 61   PHE B CB    1 
ATOM   7111  C  CG    . PHE D  3  61  ? 84.603  40.757 -49.870 1.00 34.10  ? 61   PHE B CG    1 
ATOM   7112  C  CD1   . PHE D  3  61  ? 83.571  39.838 -49.700 1.00 32.98  ? 61   PHE B CD1   1 
ATOM   7113  C  CD2   . PHE D  3  61  ? 85.732  40.644 -49.064 1.00 34.47  ? 61   PHE B CD2   1 
ATOM   7114  C  CE1   . PHE D  3  61  ? 83.666  38.812 -48.728 1.00 34.55  ? 61   PHE B CE1   1 
ATOM   7115  C  CE2   . PHE D  3  61  ? 85.835  39.624 -48.092 1.00 36.53  ? 61   PHE B CE2   1 
ATOM   7116  C  CZ    . PHE D  3  61  ? 84.798  38.711 -47.929 1.00 31.64  ? 61   PHE B CZ    1 
ATOM   7117  N  N     . LEU D  3  62  ? 85.628  44.270 -49.496 1.00 36.03  ? 62   LEU B N     1 
ATOM   7118  C  CA    . LEU D  3  62  ? 86.422  44.900 -48.440 1.00 36.33  ? 62   LEU B CA    1 
ATOM   7119  C  C     . LEU D  3  62  ? 85.654  46.030 -47.752 1.00 36.49  ? 62   LEU B C     1 
ATOM   7120  O  O     . LEU D  3  62  ? 85.641  46.113 -46.522 1.00 36.30  ? 62   LEU B O     1 
ATOM   7121  C  CB    . LEU D  3  62  ? 87.776  45.395 -48.990 1.00 35.73  ? 62   LEU B CB    1 
ATOM   7122  C  CG    . LEU D  3  62  ? 88.749  44.260 -49.366 1.00 36.57  ? 62   LEU B CG    1 
ATOM   7123  C  CD1   . LEU D  3  62  ? 89.987  44.802 -50.045 1.00 36.20  ? 62   LEU B CD1   1 
ATOM   7124  C  CD2   . LEU D  3  62  ? 89.123  43.448 -48.123 1.00 36.51  ? 62   LEU B CD2   1 
ATOM   7125  N  N     . GLU D  3  63  ? 85.010  46.894 -48.533 1.00 37.21  ? 63   GLU B N     1 
ATOM   7126  C  CA    . GLU D  3  63  ? 84.251  47.994 -47.953 1.00 38.85  ? 63   GLU B CA    1 
ATOM   7127  C  C     . GLU D  3  63  ? 83.222  47.479 -46.961 1.00 39.55  ? 63   GLU B C     1 
ATOM   7128  O  O     . GLU D  3  63  ? 83.157  47.949 -45.819 1.00 38.64  ? 63   GLU B O     1 
ATOM   7129  C  CB    . GLU D  3  63  ? 83.574  48.822 -49.046 1.00 40.78  ? 63   GLU B CB    1 
ATOM   7130  C  CG    . GLU D  3  63  ? 84.563  49.566 -49.936 1.00 47.31  ? 63   GLU B CG    1 
ATOM   7131  C  CD    . GLU D  3  63  ? 83.901  50.262 -51.122 1.00 50.82  ? 63   GLU B CD    1 
ATOM   7132  O  OE1   . GLU D  3  63  ? 82.841  49.789 -51.594 1.00 53.00  ? 63   GLU B OE1   1 
ATOM   7133  O  OE2   . GLU D  3  63  ? 84.447  51.285 -51.589 1.00 52.73  ? 63   GLU B OE2   1 
ATOM   7134  N  N     . ASN D  3  64  ? 82.458  46.467 -47.365 1.00 38.63  ? 64   ASN B N     1 
ATOM   7135  C  CA    . ASN D  3  64  ? 81.437  45.907 -46.485 1.00 37.15  ? 64   ASN B CA    1 
ATOM   7136  C  C     . ASN D  3  64  ? 82.008  45.318 -45.198 1.00 36.34  ? 64   ASN B C     1 
ATOM   7137  O  O     . ASN D  3  64  ? 81.562  45.664 -44.103 1.00 35.15  ? 64   ASN B O     1 
ATOM   7138  C  CB    . ASN D  3  64  ? 80.592  44.869 -47.230 1.00 39.75  ? 64   ASN B CB    1 
ATOM   7139  C  CG    . ASN D  3  64  ? 79.651  45.511 -48.242 1.00 41.60  ? 64   ASN B CG    1 
ATOM   7140  O  OD1   . ASN D  3  64  ? 79.174  46.619 -48.031 1.00 47.12  ? 64   ASN B OD1   1 
ATOM   7141  N  ND2   . ASN D  3  64  ? 79.379  44.814 -49.338 1.00 46.18  ? 64   ASN B ND2   1 
ATOM   7142  N  N     . VAL D  3  65  ? 83.036  44.482 -45.320 1.00 35.67  ? 65   VAL B N     1 
ATOM   7143  C  CA    . VAL D  3  65  ? 83.642  43.876 -44.138 1.00 35.44  ? 65   VAL B CA    1 
ATOM   7144  C  C     . VAL D  3  65  ? 84.346  44.913 -43.241 1.00 35.38  ? 65   VAL B C     1 
ATOM   7145  O  O     . VAL D  3  65  ? 84.104  44.969 -42.035 1.00 35.90  ? 65   VAL B O     1 
ATOM   7146  C  CB    . VAL D  3  65  ? 84.650  42.781 -44.536 1.00 37.48  ? 65   VAL B CB    1 
ATOM   7147  C  CG1   . VAL D  3  65  ? 85.216  42.106 -43.299 1.00 35.05  ? 65   VAL B CG1   1 
ATOM   7148  C  CG2   . VAL D  3  65  ? 83.961  41.742 -45.436 1.00 40.90  ? 65   VAL B CG2   1 
ATOM   7149  N  N     . ILE D  3  66  ? 85.210  45.732 -43.833 1.00 34.95  ? 66   ILE B N     1 
ATOM   7150  C  CA    . ILE D  3  66  ? 85.955  46.742 -43.067 1.00 35.78  ? 66   ILE B CA    1 
ATOM   7151  C  C     . ILE D  3  66  ? 85.049  47.725 -42.338 1.00 36.21  ? 66   ILE B C     1 
ATOM   7152  O  O     . ILE D  3  66  ? 85.275  48.028 -41.161 1.00 35.25  ? 66   ILE B O     1 
ATOM   7153  C  CB    . ILE D  3  66  ? 86.974  47.492 -43.956 1.00 35.62  ? 66   ILE B CB    1 
ATOM   7154  C  CG1   . ILE D  3  66  ? 88.057  46.511 -44.408 1.00 33.04  ? 66   ILE B CG1   1 
ATOM   7155  C  CG2   . ILE D  3  66  ? 87.620  48.650 -43.178 1.00 37.00  ? 66   ILE B CG2   1 
ATOM   7156  C  CD1   . ILE D  3  66  ? 88.966  47.054 -45.465 1.00 34.95  ? 66   ILE B CD1   1 
ATOM   7157  N  N     . ARG D  3  67  ? 84.006  48.189 -43.019 1.00 36.58  ? 67   ARG B N     1 
ATOM   7158  C  CA    . ARG D  3  67  ? 83.065  49.108 -42.397 1.00 37.63  ? 67   ARG B CA    1 
ATOM   7159  C  C     . ARG D  3  67  ? 82.586  48.499 -41.077 1.00 38.89  ? 67   ARG B C     1 
ATOM   7160  O  O     . ARG D  3  67  ? 82.584  49.164 -40.038 1.00 39.83  ? 67   ARG B O     1 
ATOM   7161  C  CB    . ARG D  3  67  ? 81.862  49.364 -43.311 1.00 38.87  ? 67   ARG B CB    1 
ATOM   7162  C  CG    . ARG D  3  67  ? 80.797  50.257 -42.674 1.00 44.38  ? 67   ARG B CG    1 
ATOM   7163  C  CD    . ARG D  3  67  ? 79.528  50.313 -43.520 1.00 50.58  ? 67   ARG B CD    1 
ATOM   7164  N  NE    . ARG D  3  67  ? 79.773  50.902 -44.837 1.00 56.81  ? 67   ARG B NE    1 
ATOM   7165  C  CZ    . ARG D  3  67  ? 79.572  50.275 -45.997 1.00 58.02  ? 67   ARG B CZ    1 
ATOM   7166  N  NH1   . ARG D  3  67  ? 79.109  49.025 -46.016 1.00 55.67  ? 67   ARG B NH1   1 
ATOM   7167  N  NH2   . ARG D  3  67  ? 79.864  50.889 -47.142 1.00 55.59  ? 67   ARG B NH2   1 
ATOM   7168  N  N     . ASP D  3  68  ? 82.170  47.237 -41.109 1.00 36.48  ? 68   ASP B N     1 
ATOM   7169  C  CA    . ASP D  3  68  ? 81.704  46.593 -39.880 1.00 35.70  ? 68   ASP B CA    1 
ATOM   7170  C  C     . ASP D  3  68  ? 82.844  46.392 -38.873 1.00 35.22  ? 68   ASP B C     1 
ATOM   7171  O  O     . ASP D  3  68  ? 82.653  46.581 -37.672 1.00 33.41  ? 68   ASP B O     1 
ATOM   7172  C  CB    . ASP D  3  68  ? 81.007  45.254 -40.179 1.00 37.69  ? 68   ASP B CB    1 
ATOM   7173  C  CG    . ASP D  3  68  ? 79.596  45.429 -40.748 1.00 40.01  ? 68   ASP B CG    1 
ATOM   7174  O  OD1   . ASP D  3  68  ? 79.207  46.580 -41.052 1.00 39.12  ? 68   ASP B OD1   1 
ATOM   7175  O  OD2   . ASP D  3  68  ? 78.866  44.410 -40.875 1.00 39.16  ? 68   ASP B OD2   1 
ATOM   7176  N  N     . ALA D  3  69  ? 84.025  46.001 -39.351 1.00 33.93  ? 69   ALA B N     1 
ATOM   7177  C  CA    . ALA D  3  69  ? 85.149  45.793 -38.439 1.00 35.74  ? 69   ALA B CA    1 
ATOM   7178  C  C     . ALA D  3  69  ? 85.464  47.111 -37.726 1.00 35.30  ? 69   ALA B C     1 
ATOM   7179  O  O     . ALA D  3  69  ? 85.660  47.130 -36.521 1.00 34.10  ? 69   ALA B O     1 
ATOM   7180  C  CB    . ALA D  3  69  ? 86.386  45.290 -39.183 1.00 32.61  ? 69   ALA B CB    1 
ATOM   7181  N  N     . VAL D  3  70  ? 85.485  48.205 -38.475 1.00 35.75  ? 70   VAL B N     1 
ATOM   7182  C  CA    . VAL D  3  70  ? 85.768  49.518 -37.896 1.00 36.42  ? 70   VAL B CA    1 
ATOM   7183  C  C     . VAL D  3  70  ? 84.711  49.901 -36.863 1.00 38.24  ? 70   VAL B C     1 
ATOM   7184  O  O     . VAL D  3  70  ? 85.034  50.472 -35.817 1.00 40.29  ? 70   VAL B O     1 
ATOM   7185  C  CB    . VAL D  3  70  ? 85.863  50.600 -38.992 1.00 36.71  ? 70   VAL B CB    1 
ATOM   7186  C  CG1   . VAL D  3  70  ? 85.938  52.016 -38.374 1.00 38.50  ? 70   VAL B CG1   1 
ATOM   7187  C  CG2   . VAL D  3  70  ? 87.092  50.334 -39.845 1.00 37.69  ? 70   VAL B CG2   1 
ATOM   7188  N  N     . THR D  3  71  ? 83.453  49.566 -37.138 1.00 37.11  ? 71   THR B N     1 
ATOM   7189  C  CA    . THR D  3  71  ? 82.378  49.875 -36.206 1.00 36.11  ? 71   THR B CA    1 
ATOM   7190  C  C     . THR D  3  71  ? 82.613  49.163 -34.869 1.00 38.38  ? 71   THR B C     1 
ATOM   7191  O  O     . THR D  3  71  ? 82.355  49.729 -33.796 1.00 35.50  ? 71   THR B O     1 
ATOM   7192  C  CB    . THR D  3  71  ? 81.010  49.515 -36.802 1.00 38.54  ? 71   THR B CB    1 
ATOM   7193  O  OG1   . THR D  3  71  ? 80.783  50.313 -37.974 1.00 36.23  ? 71   THR B OG1   1 
ATOM   7194  C  CG2   . THR D  3  71  ? 79.898  49.777 -35.798 1.00 36.98  ? 71   THR B CG2   1 
ATOM   7195  N  N     . TYR D  3  72  ? 83.129  47.934 -34.925 1.00 36.42  ? 72   TYR B N     1 
ATOM   7196  C  CA    . TYR D  3  72  ? 83.429  47.212 -33.694 1.00 37.82  ? 72   TYR B CA    1 
ATOM   7197  C  C     . TYR D  3  72  ? 84.635  47.885 -33.011 1.00 40.36  ? 72   TYR B C     1 
ATOM   7198  O  O     . TYR D  3  72  ? 84.682  47.999 -31.783 1.00 38.08  ? 72   TYR B O     1 
ATOM   7199  C  CB    . TYR D  3  72  ? 83.745  45.738 -33.969 1.00 35.91  ? 72   TYR B CB    1 
ATOM   7200  C  CG    . TYR D  3  72  ? 82.528  44.863 -34.226 1.00 35.75  ? 72   TYR B CG    1 
ATOM   7201  C  CD1   . TYR D  3  72  ? 82.373  44.186 -35.438 1.00 35.38  ? 72   TYR B CD1   1 
ATOM   7202  C  CD2   . TYR D  3  72  ? 81.546  44.693 -33.251 1.00 35.21  ? 72   TYR B CD2   1 
ATOM   7203  C  CE1   . TYR D  3  72  ? 81.269  43.357 -35.669 1.00 33.89  ? 72   TYR B CE1   1 
ATOM   7204  C  CE2   . TYR D  3  72  ? 80.434  43.873 -33.476 1.00 34.32  ? 72   TYR B CE2   1 
ATOM   7205  C  CZ    . TYR D  3  72  ? 80.303  43.211 -34.687 1.00 33.80  ? 72   TYR B CZ    1 
ATOM   7206  O  OH    . TYR D  3  72  ? 79.192  42.419 -34.921 1.00 35.46  ? 72   TYR B OH    1 
ATOM   7207  N  N     . THR D  3  73  ? 85.604  48.332 -33.812 1.00 40.68  ? 73   THR B N     1 
ATOM   7208  C  CA    . THR D  3  73  ? 86.792  48.997 -33.267 1.00 43.09  ? 73   THR B CA    1 
ATOM   7209  C  C     . THR D  3  73  ? 86.395  50.268 -32.496 1.00 45.38  ? 73   THR B C     1 
ATOM   7210  O  O     . THR D  3  73  ? 86.742  50.426 -31.327 1.00 44.88  ? 73   THR B O     1 
ATOM   7211  C  CB    . THR D  3  73  ? 87.790  49.383 -34.379 1.00 41.38  ? 73   THR B CB    1 
ATOM   7212  O  OG1   . THR D  3  73  ? 88.127  48.221 -35.149 1.00 39.44  ? 73   THR B OG1   1 
ATOM   7213  C  CG2   . THR D  3  73  ? 89.060  49.974 -33.768 1.00 40.28  ? 73   THR B CG2   1 
ATOM   7214  N  N     . GLU D  3  74  ? 85.658  51.159 -33.152 1.00 46.44  ? 74   GLU B N     1 
ATOM   7215  C  CA    . GLU D  3  74  ? 85.215  52.402 -32.521 1.00 49.37  ? 74   GLU B CA    1 
ATOM   7216  C  C     . GLU D  3  74  ? 84.392  52.119 -31.277 1.00 50.15  ? 74   GLU B C     1 
ATOM   7217  O  O     . GLU D  3  74  ? 84.522  52.811 -30.268 1.00 49.71  ? 74   GLU B O     1 
ATOM   7218  C  CB    . GLU D  3  74  ? 84.367  53.245 -33.483 1.00 52.42  ? 74   GLU B CB    1 
ATOM   7219  C  CG    . GLU D  3  74  ? 85.095  53.737 -34.721 1.00 60.18  ? 74   GLU B CG    1 
ATOM   7220  C  CD    . GLU D  3  74  ? 84.296  54.783 -35.491 1.00 65.35  ? 74   GLU B CD    1 
ATOM   7221  O  OE1   . GLU D  3  74  ? 84.453  55.990 -35.184 1.00 69.27  ? 74   GLU B OE1   1 
ATOM   7222  O  OE2   . GLU D  3  74  ? 83.513  54.403 -36.394 1.00 67.47  ? 74   GLU B OE2   1 
ATOM   7223  N  N     . HIS D  3  75  ? 83.527  51.112 -31.344 1.00 48.08  ? 75   HIS B N     1 
ATOM   7224  C  CA    . HIS D  3  75  ? 82.706  50.813 -30.189 1.00 47.35  ? 75   HIS B CA    1 
ATOM   7225  C  C     . HIS D  3  75  ? 83.562  50.459 -28.982 1.00 49.04  ? 75   HIS B C     1 
ATOM   7226  O  O     . HIS D  3  75  ? 83.192  50.754 -27.848 1.00 48.44  ? 75   HIS B O     1 
ATOM   7227  C  CB    . HIS D  3  75  ? 81.726  49.673 -30.458 1.00 43.44  ? 75   HIS B CB    1 
ATOM   7228  C  CG    . HIS D  3  75  ? 80.844  49.376 -29.289 1.00 41.15  ? 75   HIS B CG    1 
ATOM   7229  N  ND1   . HIS D  3  75  ? 79.696  50.093 -29.027 1.00 42.47  ? 75   HIS B ND1   1 
ATOM   7230  C  CD2   . HIS D  3  75  ? 80.976  48.494 -28.271 1.00 41.61  ? 75   HIS B CD2   1 
ATOM   7231  C  CE1   . HIS D  3  75  ? 79.161  49.669 -27.896 1.00 40.19  ? 75   HIS B CE1   1 
ATOM   7232  N  NE2   . HIS D  3  75  ? 79.918  48.699 -27.416 1.00 41.71  ? 75   HIS B NE2   1 
ATOM   7233  N  N     . ALA D  3  76  ? 84.698  49.816 -29.233 1.00 49.05  ? 76   ALA B N     1 
ATOM   7234  C  CA    . ALA D  3  76  ? 85.593  49.404 -28.159 1.00 51.80  ? 76   ALA B CA    1 
ATOM   7235  C  C     . ALA D  3  76  ? 86.542  50.532 -27.776 1.00 52.91  ? 76   ALA B C     1 
ATOM   7236  O  O     . ALA D  3  76  ? 87.430  50.350 -26.941 1.00 52.40  ? 76   ALA B O     1 
ATOM   7237  C  CB    . ALA D  3  76  ? 86.384  48.158 -28.578 1.00 49.98  ? 76   ALA B CB    1 
ATOM   7238  N  N     . LYS D  3  77  ? 86.375  51.679 -28.427 1.00 52.86  ? 77   LYS B N     1 
ATOM   7239  C  CA    . LYS D  3  77  ? 87.210  52.843 -28.160 1.00 55.80  ? 77   LYS B CA    1 
ATOM   7240  C  C     . LYS D  3  77  ? 88.697  52.578 -28.393 1.00 55.69  ? 77   LYS B C     1 
ATOM   7241  O  O     . LYS D  3  77  ? 89.543  52.964 -27.581 1.00 55.39  ? 77   LYS B O     1 
ATOM   7242  C  CB    . LYS D  3  77  ? 86.970  53.342 -26.729 1.00 57.26  ? 77   LYS B CB    1 
ATOM   7243  C  CG    . LYS D  3  77  ? 85.540  53.817 -26.483 1.00 61.53  ? 77   LYS B CG    1 
ATOM   7244  C  CD    . LYS D  3  77  ? 85.290  54.110 -25.011 1.00 66.25  ? 77   LYS B CD    1 
ATOM   7245  C  CE    . LYS D  3  77  ? 83.864  54.585 -24.779 1.00 69.16  ? 77   LYS B CE    1 
ATOM   7246  N  NZ    . LYS D  3  77  ? 83.305  54.072 -23.489 1.00 71.89  ? 77   LYS B NZ    1 
ATOM   7247  N  N     . ARG D  3  78  ? 89.008  51.896 -29.495 1.00 53.17  ? 78   ARG B N     1 
ATOM   7248  C  CA    . ARG D  3  78  ? 90.387  51.597 -29.849 1.00 51.73  ? 78   ARG B CA    1 
ATOM   7249  C  C     . ARG D  3  78  ? 90.747  52.321 -31.139 1.00 51.98  ? 78   ARG B C     1 
ATOM   7250  O  O     . ARG D  3  78  ? 89.882  52.877 -31.812 1.00 51.57  ? 78   ARG B O     1 
ATOM   7251  C  CB    . ARG D  3  78  ? 90.598  50.090 -30.048 1.00 53.47  ? 78   ARG B CB    1 
ATOM   7252  C  CG    . ARG D  3  78  ? 90.418  49.230 -28.799 1.00 54.60  ? 78   ARG B CG    1 
ATOM   7253  C  CD    . ARG D  3  78  ? 90.837  47.787 -29.070 1.00 53.89  ? 78   ARG B CD    1 
ATOM   7254  N  NE    . ARG D  3  78  ? 89.705  46.869 -29.179 1.00 53.40  ? 78   ARG B NE    1 
ATOM   7255  C  CZ    . ARG D  3  78  ? 89.181  46.449 -30.330 1.00 54.12  ? 78   ARG B CZ    1 
ATOM   7256  N  NH1   . ARG D  3  78  ? 89.684  46.862 -31.490 1.00 52.42  ? 78   ARG B NH1   1 
ATOM   7257  N  NH2   . ARG D  3  78  ? 88.151  45.615 -30.322 1.00 50.15  ? 78   ARG B NH2   1 
ATOM   7258  N  N     . LYS D  3  79  ? 92.036  52.354 -31.452 1.00 51.69  ? 79   LYS B N     1 
ATOM   7259  C  CA    . LYS D  3  79  ? 92.519  52.983 -32.673 1.00 52.92  ? 79   LYS B CA    1 
ATOM   7260  C  C     . LYS D  3  79  ? 93.111  51.880 -33.533 1.00 51.22  ? 79   LYS B C     1 
ATOM   7261  O  O     . LYS D  3  79  ? 93.592  52.133 -34.635 1.00 53.64  ? 79   LYS B O     1 
ATOM   7262  C  CB    . LYS D  3  79  ? 93.627  53.997 -32.367 1.00 57.42  ? 79   LYS B CB    1 
ATOM   7263  C  CG    . LYS D  3  79  ? 93.191  55.248 -31.625 1.00 63.68  ? 79   LYS B CG    1 
ATOM   7264  C  CD    . LYS D  3  79  ? 94.364  56.217 -31.504 1.00 68.30  ? 79   LYS B CD    1 
ATOM   7265  C  CE    . LYS D  3  79  ? 93.931  57.579 -30.967 1.00 72.00  ? 79   LYS B CE    1 
ATOM   7266  N  NZ    . LYS D  3  79  ? 94.782  58.692 -31.507 1.00 73.56  ? 79   LYS B NZ    1 
ATOM   7267  N  N     . THR D  3  80  ? 93.078  50.657 -33.013 1.00 47.51  ? 80   THR B N     1 
ATOM   7268  C  CA    . THR D  3  80  ? 93.644  49.505 -33.706 1.00 46.96  ? 80   THR B CA    1 
ATOM   7269  C  C     . THR D  3  80  ? 92.604  48.432 -34.046 1.00 44.52  ? 80   THR B C     1 
ATOM   7270  O  O     . THR D  3  80  ? 91.961  47.870 -33.156 1.00 42.58  ? 80   THR B O     1 
ATOM   7271  C  CB    . THR D  3  80  ? 94.734  48.833 -32.836 1.00 48.84  ? 80   THR B CB    1 
ATOM   7272  O  OG1   . THR D  3  80  ? 95.603  49.834 -32.291 1.00 53.57  ? 80   THR B OG1   1 
ATOM   7273  C  CG2   . THR D  3  80  ? 95.557  47.856 -33.666 1.00 47.88  ? 80   THR B CG2   1 
ATOM   7274  N  N     . VAL D  3  81  ? 92.448  48.141 -35.333 1.00 42.85  ? 81   VAL B N     1 
ATOM   7275  C  CA    . VAL D  3  81  ? 91.501  47.110 -35.755 1.00 41.61  ? 81   VAL B CA    1 
ATOM   7276  C  C     . VAL D  3  81  ? 92.121  45.757 -35.419 1.00 41.02  ? 81   VAL B C     1 
ATOM   7277  O  O     . VAL D  3  81  ? 93.215  45.449 -35.867 1.00 42.90  ? 81   VAL B O     1 
ATOM   7278  C  CB    . VAL D  3  81  ? 91.235  47.174 -37.267 1.00 41.71  ? 81   VAL B CB    1 
ATOM   7279  C  CG1   . VAL D  3  81  ? 90.310  46.019 -37.688 1.00 40.13  ? 81   VAL B CG1   1 
ATOM   7280  C  CG2   . VAL D  3  81  ? 90.629  48.532 -37.636 1.00 39.59  ? 81   VAL B CG2   1 
ATOM   7281  N  N     . THR D  3  82  ? 91.453  44.973 -34.585 1.00 41.26  ? 82   THR B N     1 
ATOM   7282  C  CA    . THR D  3  82  ? 91.987  43.665 -34.213 1.00 41.90  ? 82   THR B CA    1 
ATOM   7283  C  C     . THR D  3  82  ? 91.425  42.552 -35.091 1.00 42.52  ? 82   THR B C     1 
ATOM   7284  O  O     . THR D  3  82  ? 90.448  42.742 -35.809 1.00 41.88  ? 82   THR B O     1 
ATOM   7285  C  CB    . THR D  3  82  ? 91.658  43.317 -32.766 1.00 40.67  ? 82   THR B CB    1 
ATOM   7286  O  OG1   . THR D  3  82  ? 90.242  43.193 -32.635 1.00 43.99  ? 82   THR B OG1   1 
ATOM   7287  C  CG2   . THR D  3  82  ? 92.168  44.415 -31.805 1.00 41.54  ? 82   THR B CG2   1 
ATOM   7288  N  N     . ALA D  3  83  ? 92.059  41.387 -35.027 1.00 42.90  ? 83   ALA B N     1 
ATOM   7289  C  CA    . ALA D  3  83  ? 91.615  40.242 -35.802 1.00 42.45  ? 83   ALA B CA    1 
ATOM   7290  C  C     . ALA D  3  83  ? 90.170  39.919 -35.420 1.00 42.28  ? 83   ALA B C     1 
ATOM   7291  O  O     . ALA D  3  83  ? 89.351  39.630 -36.293 1.00 43.51  ? 83   ALA B O     1 
ATOM   7292  C  CB    . ALA D  3  83  ? 92.528  39.036 -35.542 1.00 42.55  ? 83   ALA B CB    1 
ATOM   7293  N  N     . MET D  3  84  ? 89.858  40.000 -34.125 1.00 40.56  ? 84   MET B N     1 
ATOM   7294  C  CA    . MET D  3  84  ? 88.506  39.720 -33.650 1.00 40.05  ? 84   MET B CA    1 
ATOM   7295  C  C     . MET D  3  84  ? 87.480  40.674 -34.266 1.00 40.10  ? 84   MET B C     1 
ATOM   7296  O  O     . MET D  3  84  ? 86.360  40.254 -34.609 1.00 38.36  ? 84   MET B O     1 
ATOM   7297  C  CB    . MET D  3  84  ? 88.431  39.767 -32.126 1.00 42.96  ? 84   MET B CB    1 
ATOM   7298  C  CG    . MET D  3  84  ? 89.047  38.550 -31.426 1.00 47.97  ? 84   MET B CG    1 
ATOM   7299  S  SD    . MET D  3  84  ? 88.552  36.958 -32.140 1.00 54.85  ? 84   MET B SD    1 
ATOM   7300  C  CE    . MET D  3  84  ? 86.956  36.704 -31.384 1.00 54.29  ? 84   MET B CE    1 
ATOM   7301  N  N     . ASP D  3  85  ? 87.853  41.947 -34.424 1.00 36.18  ? 85   ASP B N     1 
ATOM   7302  C  CA    . ASP D  3  85  ? 86.941  42.911 -35.043 1.00 35.76  ? 85   ASP B CA    1 
ATOM   7303  C  C     . ASP D  3  85  ? 86.588  42.355 -36.435 1.00 36.18  ? 85   ASP B C     1 
ATOM   7304  O  O     . ASP D  3  85  ? 85.429  42.368 -36.846 1.00 38.14  ? 85   ASP B O     1 
ATOM   7305  C  CB    . ASP D  3  85  ? 87.604  44.286 -35.226 1.00 36.18  ? 85   ASP B CB    1 
ATOM   7306  C  CG    . ASP D  3  85  ? 87.854  45.025 -33.899 1.00 38.57  ? 85   ASP B CG    1 
ATOM   7307  O  OD1   . ASP D  3  85  ? 87.167  44.744 -32.889 1.00 37.37  ? 85   ASP B OD1   1 
ATOM   7308  O  OD2   . ASP D  3  85  ? 88.732  45.915 -33.895 1.00 39.92  ? 85   ASP B OD2   1 
ATOM   7309  N  N     . VAL D  3  86  ? 87.599  41.878 -37.157 1.00 33.64  ? 86   VAL B N     1 
ATOM   7310  C  CA    . VAL D  3  86  ? 87.384  41.328 -38.493 1.00 34.46  ? 86   VAL B CA    1 
ATOM   7311  C  C     . VAL D  3  86  ? 86.547  40.037 -38.444 1.00 35.18  ? 86   VAL B C     1 
ATOM   7312  O  O     . VAL D  3  86  ? 85.575  39.898 -39.185 1.00 36.96  ? 86   VAL B O     1 
ATOM   7313  C  CB    . VAL D  3  86  ? 88.734  41.078 -39.213 1.00 33.77  ? 86   VAL B CB    1 
ATOM   7314  C  CG1   . VAL D  3  86  ? 88.515  40.408 -40.572 1.00 33.84  ? 86   VAL B CG1   1 
ATOM   7315  C  CG2   . VAL D  3  86  ? 89.472  42.412 -39.402 1.00 36.33  ? 86   VAL B CG2   1 
ATOM   7316  N  N     . VAL D  3  87  ? 86.911  39.116 -37.554 1.00 33.01  ? 87   VAL B N     1 
ATOM   7317  C  CA    . VAL D  3  87  ? 86.188  37.847 -37.402 1.00 33.97  ? 87   VAL B CA    1 
ATOM   7318  C  C     . VAL D  3  87  ? 84.705  38.100 -37.144 1.00 33.54  ? 87   VAL B C     1 
ATOM   7319  O  O     . VAL D  3  87  ? 83.849  37.486 -37.765 1.00 34.90  ? 87   VAL B O     1 
ATOM   7320  C  CB    . VAL D  3  87  ? 86.795  36.997 -36.258 1.00 34.46  ? 87   VAL B CB    1 
ATOM   7321  C  CG1   . VAL D  3  87  ? 85.927  35.777 -35.964 1.00 36.62  ? 87   VAL B CG1   1 
ATOM   7322  C  CG2   . VAL D  3  87  ? 88.202  36.556 -36.647 1.00 35.48  ? 87   VAL B CG2   1 
ATOM   7323  N  N     . TYR D  3  88  ? 84.407  39.034 -36.247 1.00 33.72  ? 88   TYR B N     1 
ATOM   7324  C  CA    . TYR D  3  88  ? 83.028  39.384 -35.933 1.00 33.17  ? 88   TYR B CA    1 
ATOM   7325  C  C     . TYR D  3  88  ? 82.332  40.000 -37.145 1.00 33.38  ? 88   TYR B C     1 
ATOM   7326  O  O     . TYR D  3  88  ? 81.154  39.729 -37.400 1.00 34.52  ? 88   TYR B O     1 
ATOM   7327  C  CB    . TYR D  3  88  ? 82.973  40.383 -34.775 1.00 35.77  ? 88   TYR B CB    1 
ATOM   7328  C  CG    . TYR D  3  88  ? 83.467  39.841 -33.457 1.00 39.44  ? 88   TYR B CG    1 
ATOM   7329  C  CD1   . TYR D  3  88  ? 84.173  40.659 -32.572 1.00 42.36  ? 88   TYR B CD1   1 
ATOM   7330  C  CD2   . TYR D  3  88  ? 83.217  38.521 -33.084 1.00 40.67  ? 88   TYR B CD2   1 
ATOM   7331  C  CE1   . TYR D  3  88  ? 84.617  40.181 -31.351 1.00 45.71  ? 88   TYR B CE1   1 
ATOM   7332  C  CE2   . TYR D  3  88  ? 83.658  38.025 -31.862 1.00 44.57  ? 88   TYR B CE2   1 
ATOM   7333  C  CZ    . TYR D  3  88  ? 84.355  38.864 -31.000 1.00 45.25  ? 88   TYR B CZ    1 
ATOM   7334  O  OH    . TYR D  3  88  ? 84.781  38.406 -29.777 1.00 51.93  ? 88   TYR B OH    1 
ATOM   7335  N  N     . ALA D  3  89  ? 83.047  40.853 -37.870 1.00 30.64  ? 89   ALA B N     1 
ATOM   7336  C  CA    . ALA D  3  89  ? 82.476  41.486 -39.049 1.00 33.90  ? 89   ALA B CA    1 
ATOM   7337  C  C     . ALA D  3  89  ? 82.129  40.420 -40.101 1.00 33.52  ? 89   ALA B C     1 
ATOM   7338  O  O     . ALA D  3  89  ? 81.037  40.415 -40.665 1.00 32.60  ? 89   ALA B O     1 
ATOM   7339  C  CB    . ALA D  3  89  ? 83.449  42.490 -39.621 1.00 31.80  ? 89   ALA B CB    1 
ATOM   7340  N  N     . LEU D  3  90  ? 83.066  39.513 -40.341 1.00 33.18  ? 90   LEU B N     1 
ATOM   7341  C  CA    . LEU D  3  90  ? 82.863  38.452 -41.311 1.00 33.05  ? 90   LEU B CA    1 
ATOM   7342  C  C     . LEU D  3  90  ? 81.682  37.574 -40.900 1.00 33.51  ? 90   LEU B C     1 
ATOM   7343  O  O     . LEU D  3  90  ? 80.828  37.244 -41.727 1.00 34.80  ? 90   LEU B O     1 
ATOM   7344  C  CB    . LEU D  3  90  ? 84.145  37.628 -41.455 1.00 31.90  ? 90   LEU B CB    1 
ATOM   7345  C  CG    . LEU D  3  90  ? 85.287  38.318 -42.222 1.00 33.60  ? 90   LEU B CG    1 
ATOM   7346  C  CD1   . LEU D  3  90  ? 86.601  37.591 -42.020 1.00 30.63  ? 90   LEU B CD1   1 
ATOM   7347  C  CD2   . LEU D  3  90  ? 84.948  38.429 -43.711 1.00 29.72  ? 90   LEU B CD2   1 
ATOM   7348  N  N     . LYS D  3  91  ? 81.576  37.275 -39.611 1.00 34.26  ? 91   LYS B N     1 
ATOM   7349  C  CA    . LYS D  3  91  ? 80.489  36.425 -39.140 1.00 35.38  ? 91   LYS B CA    1 
ATOM   7350  C  C     . LYS D  3  91  ? 79.105  37.029 -39.352 1.00 37.24  ? 91   LYS B C     1 
ATOM   7351  O  O     . LYS D  3  91  ? 78.196  36.338 -39.813 1.00 33.79  ? 91   LYS B O     1 
ATOM   7352  C  CB    . LYS D  3  91  ? 80.682  36.043 -37.669 1.00 39.58  ? 91   LYS B CB    1 
ATOM   7353  C  CG    . LYS D  3  91  ? 79.486  35.302 -37.069 1.00 44.19  ? 91   LYS B CG    1 
ATOM   7354  C  CD    . LYS D  3  91  ? 79.897  34.210 -36.087 1.00 52.16  ? 91   LYS B CD    1 
ATOM   7355  C  CE    . LYS D  3  91  ? 80.594  34.768 -34.862 1.00 56.59  ? 91   LYS B CE    1 
ATOM   7356  N  NZ    . LYS D  3  91  ? 80.692  33.734 -33.788 1.00 58.57  ? 91   LYS B NZ    1 
ATOM   7357  N  N     . ARG D  3  92  ? 78.935  38.319 -39.060 1.00 35.26  ? 92   ARG B N     1 
ATOM   7358  C  CA    . ARG D  3  92  ? 77.612  38.902 -39.238 1.00 36.97  ? 92   ARG B CA    1 
ATOM   7359  C  C     . ARG D  3  92  ? 77.297  39.051 -40.718 1.00 37.59  ? 92   ARG B C     1 
ATOM   7360  O  O     . ARG D  3  92  ? 76.156  39.278 -41.093 1.00 37.86  ? 92   ARG B O     1 
ATOM   7361  C  CB    . ARG D  3  92  ? 77.459  40.236 -38.489 1.00 37.07  ? 92   ARG B CB    1 
ATOM   7362  C  CG    . ARG D  3  92  ? 78.356  41.362 -38.979 1.00 36.73  ? 92   ARG B CG    1 
ATOM   7363  C  CD    . ARG D  3  92  ? 78.032  42.655 -38.208 1.00 36.67  ? 92   ARG B CD    1 
ATOM   7364  N  NE    . ARG D  3  92  ? 76.588  42.831 -38.123 1.00 34.59  ? 92   ARG B NE    1 
ATOM   7365  C  CZ    . ARG D  3  92  ? 75.832  43.273 -39.126 1.00 38.65  ? 92   ARG B CZ    1 
ATOM   7366  N  NH1   . ARG D  3  92  ? 76.382  43.611 -40.296 1.00 36.13  ? 92   ARG B NH1   1 
ATOM   7367  N  NH2   . ARG D  3  92  ? 74.511  43.308 -38.987 1.00 40.13  ? 92   ARG B NH2   1 
ATOM   7368  N  N     A GLN D  3  93  ? 78.328  38.953 -41.551 0.50 37.75  ? 93   GLN B N     1 
ATOM   7369  N  N     B GLN D  3  93  ? 78.315  38.946 -41.562 0.50 38.18  ? 93   GLN B N     1 
ATOM   7370  C  CA    A GLN D  3  93  ? 78.161  39.047 -43.001 0.50 38.35  ? 93   GLN B CA    1 
ATOM   7371  C  CA    B GLN D  3  93  ? 78.093  39.041 -43.002 0.50 38.99  ? 93   GLN B CA    1 
ATOM   7372  C  C     A GLN D  3  93  ? 77.896  37.654 -43.588 0.50 37.40  ? 93   GLN B C     1 
ATOM   7373  C  C     B GLN D  3  93  ? 77.859  37.652 -43.591 0.50 37.92  ? 93   GLN B C     1 
ATOM   7374  O  O     A GLN D  3  93  ? 77.845  37.489 -44.801 0.50 36.00  ? 93   GLN B O     1 
ATOM   7375  O  O     B GLN D  3  93  ? 77.820  37.485 -44.805 0.50 36.83  ? 93   GLN B O     1 
ATOM   7376  C  CB    A GLN D  3  93  ? 79.431  39.622 -43.644 0.50 39.97  ? 93   GLN B CB    1 
ATOM   7377  C  CB    B GLN D  3  93  ? 79.293  39.681 -43.690 0.50 41.32  ? 93   GLN B CB    1 
ATOM   7378  C  CG    A GLN D  3  93  ? 79.710  41.083 -43.312 0.50 42.74  ? 93   GLN B CG    1 
ATOM   7379  C  CG    B GLN D  3  93  ? 79.512  41.114 -43.286 0.50 45.33  ? 93   GLN B CG    1 
ATOM   7380  C  CD    A GLN D  3  93  ? 78.912  42.037 -44.173 0.50 41.62  ? 93   GLN B CD    1 
ATOM   7381  C  CD    B GLN D  3  93  ? 80.709  41.716 -43.959 0.50 45.07  ? 93   GLN B CD    1 
ATOM   7382  O  OE1   A GLN D  3  93  ? 78.912  41.928 -45.395 0.50 43.12  ? 93   GLN B OE1   1 
ATOM   7383  O  OE1   B GLN D  3  93  ? 81.312  41.107 -44.839 0.50 46.35  ? 93   GLN B OE1   1 
ATOM   7384  N  NE2   A GLN D  3  93  ? 78.236  42.981 -43.542 0.50 41.53  ? 93   GLN B NE2   1 
ATOM   7385  N  NE2   B GLN D  3  93  ? 81.067  42.920 -43.546 0.50 49.02  ? 93   GLN B NE2   1 
ATOM   7386  N  N     . GLY D  3  94  ? 77.751  36.655 -42.723 1.00 38.00  ? 94   GLY B N     1 
ATOM   7387  C  CA    . GLY D  3  94  ? 77.524  35.295 -43.189 1.00 37.66  ? 94   GLY B CA    1 
ATOM   7388  C  C     . GLY D  3  94  ? 78.761  34.680 -43.827 1.00 38.38  ? 94   GLY B C     1 
ATOM   7389  O  O     . GLY D  3  94  ? 78.653  33.793 -44.676 1.00 38.78  ? 94   GLY B O     1 
ATOM   7390  N  N     A ARG D  3  95  ? 79.942  35.122 -43.407 0.50 36.81  ? 95   ARG B N     1 
ATOM   7391  N  N     B ARG D  3  95  ? 79.940  35.125 -43.400 0.50 38.86  ? 95   ARG B N     1 
ATOM   7392  C  CA    A ARG D  3  95  ? 81.181  34.590 -43.966 0.50 34.92  ? 95   ARG B CA    1 
ATOM   7393  C  CA    B ARG D  3  95  ? 81.191  34.607 -43.947 0.50 38.49  ? 95   ARG B CA    1 
ATOM   7394  C  C     A ARG D  3  95  ? 82.151  34.168 -42.861 0.50 35.12  ? 95   ARG B C     1 
ATOM   7395  C  C     B ARG D  3  95  ? 82.153  34.179 -42.846 0.50 37.49  ? 95   ARG B C     1 
ATOM   7396  O  O     A ARG D  3  95  ? 83.329  34.531 -42.876 0.50 35.60  ? 95   ARG B O     1 
ATOM   7397  O  O     B ARG D  3  95  ? 83.333  34.540 -42.855 0.50 37.87  ? 95   ARG B O     1 
ATOM   7398  C  CB    A ARG D  3  95  ? 81.824  35.636 -44.878 0.50 33.82  ? 95   ARG B CB    1 
ATOM   7399  C  CB    B ARG D  3  95  ? 81.846  35.665 -44.827 0.50 41.19  ? 95   ARG B CB    1 
ATOM   7400  C  CG    A ARG D  3  95  ? 80.830  36.265 -45.866 0.50 33.74  ? 95   ARG B CG    1 
ATOM   7401  C  CG    B ARG D  3  95  ? 80.953  36.121 -45.965 0.50 45.89  ? 95   ARG B CG    1 
ATOM   7402  C  CD    A ARG D  3  95  ? 81.278  36.187 -47.327 0.50 29.63  ? 95   ARG B CD    1 
ATOM   7403  C  CD    B ARG D  3  95  ? 81.700  36.989 -46.954 0.50 48.65  ? 95   ARG B CD    1 
ATOM   7404  N  NE    A ARG D  3  95  ? 82.312  35.181 -47.547 0.50 31.14  ? 95   ARG B NE    1 
ATOM   7405  N  NE    B ARG D  3  95  ? 80.821  37.487 -48.011 0.50 52.41  ? 95   ARG B NE    1 
ATOM   7406  C  CZ    A ARG D  3  95  ? 82.280  34.255 -48.505 0.50 31.07  ? 95   ARG B CZ    1 
ATOM   7407  C  CZ    B ARG D  3  95  ? 80.138  36.711 -48.848 0.50 54.33  ? 95   ARG B CZ    1 
ATOM   7408  N  NH1   A ARG D  3  95  ? 81.251  34.184 -49.342 0.50 32.12  ? 95   ARG B NH1   1 
ATOM   7409  N  NH1   B ARG D  3  95  ? 80.229  35.392 -48.761 0.50 54.43  ? 95   ARG B NH1   1 
ATOM   7410  N  NH2   A ARG D  3  95  ? 83.307  33.429 -48.661 0.50 27.44  ? 95   ARG B NH2   1 
ATOM   7411  N  NH2   B ARG D  3  95  ? 79.343  37.256 -49.761 0.50 56.47  ? 95   ARG B NH2   1 
ATOM   7412  N  N     . THR D  3  96  ? 81.649  33.377 -41.916 1.00 36.02  ? 96   THR B N     1 
ATOM   7413  C  CA    . THR D  3  96  ? 82.449  32.901 -40.789 1.00 34.12  ? 96   THR B CA    1 
ATOM   7414  C  C     . THR D  3  96  ? 83.835  32.410 -41.210 1.00 35.91  ? 96   THR B C     1 
ATOM   7415  O  O     . THR D  3  96  ? 83.981  31.666 -42.190 1.00 32.60  ? 96   THR B O     1 
ATOM   7416  C  CB    . THR D  3  96  ? 81.708  31.780 -40.039 1.00 35.00  ? 96   THR B CB    1 
ATOM   7417  O  OG1   . THR D  3  96  ? 80.401  32.239 -39.690 1.00 37.96  ? 96   THR B OG1   1 
ATOM   7418  C  CG2   . THR D  3  96  ? 82.442  31.401 -38.749 1.00 36.21  ? 96   THR B CG2   1 
ATOM   7419  N  N     . LEU D  3  97  ? 84.851  32.862 -40.478 1.00 33.16  ? 97   LEU B N     1 
ATOM   7420  C  CA    . LEU D  3  97  ? 86.234  32.492 -40.749 1.00 35.38  ? 97   LEU B CA    1 
ATOM   7421  C  C     . LEU D  3  97  ? 86.850  31.774 -39.539 1.00 36.82  ? 97   LEU B C     1 
ATOM   7422  O  O     . LEU D  3  97  ? 86.739  32.247 -38.410 1.00 36.61  ? 97   LEU B O     1 
ATOM   7423  C  CB    . LEU D  3  97  ? 87.052  33.747 -41.066 1.00 34.84  ? 97   LEU B CB    1 
ATOM   7424  C  CG    . LEU D  3  97  ? 88.562  33.580 -41.288 1.00 36.80  ? 97   LEU B CG    1 
ATOM   7425  C  CD1   . LEU D  3  97  ? 88.824  32.736 -42.562 1.00 32.61  ? 97   LEU B CD1   1 
ATOM   7426  C  CD2   . LEU D  3  97  ? 89.230  34.961 -41.424 1.00 35.85  ? 97   LEU B CD2   1 
ATOM   7427  N  N     . TYR D  3  98  ? 87.458  30.615 -39.777 1.00 37.11  ? 98   TYR B N     1 
ATOM   7428  C  CA    . TYR D  3  98  ? 88.106  29.849 -38.711 1.00 38.85  ? 98   TYR B CA    1 
ATOM   7429  C  C     . TYR D  3  98  ? 89.608  30.069 -38.785 1.00 40.09  ? 98   TYR B C     1 
ATOM   7430  O  O     . TYR D  3  98  ? 90.163  30.233 -39.871 1.00 39.96  ? 98   TYR B O     1 
ATOM   7431  C  CB    . TYR D  3  98  ? 87.889  28.341 -38.884 1.00 37.39  ? 98   TYR B CB    1 
ATOM   7432  C  CG    . TYR D  3  98  ? 86.550  27.782 -38.470 1.00 35.59  ? 98   TYR B CG    1 
ATOM   7433  C  CD1   . TYR D  3  98  ? 85.562  28.597 -37.927 1.00 35.27  ? 98   TYR B CD1   1 
ATOM   7434  C  CD2   . TYR D  3  98  ? 86.263  26.429 -38.653 1.00 34.45  ? 98   TYR B CD2   1 
ATOM   7435  C  CE1   . TYR D  3  98  ? 84.310  28.081 -37.576 1.00 33.75  ? 98   TYR B CE1   1 
ATOM   7436  C  CE2   . TYR D  3  98  ? 85.018  25.902 -38.307 1.00 33.59  ? 98   TYR B CE2   1 
ATOM   7437  C  CZ    . TYR D  3  98  ? 84.049  26.739 -37.770 1.00 35.58  ? 98   TYR B CZ    1 
ATOM   7438  O  OH    . TYR D  3  98  ? 82.808  26.245 -37.438 1.00 35.70  ? 98   TYR B OH    1 
ATOM   7439  N  N     . GLY D  3  99  ? 90.268  30.008 -37.633 1.00 42.74  ? 99   GLY B N     1 
ATOM   7440  C  CA    . GLY D  3  99  ? 91.708  30.155 -37.605 1.00 45.40  ? 99   GLY B CA    1 
ATOM   7441  C  C     . GLY D  3  99  ? 92.248  31.461 -37.063 1.00 48.56  ? 99   GLY B C     1 
ATOM   7442  O  O     . GLY D  3  99  ? 93.461  31.640 -36.987 1.00 48.20  ? 99   GLY B O     1 
ATOM   7443  N  N     . PHE D  3  100 ? 91.369  32.352 -36.624 1.00 49.78  ? 100  PHE B N     1 
ATOM   7444  C  CA    . PHE D  3  100 ? 91.829  33.639 -36.121 1.00 52.58  ? 100  PHE B CA    1 
ATOM   7445  C  C     . PHE D  3  100 ? 91.185  34.090 -34.820 1.00 56.69  ? 100  PHE B C     1 
ATOM   7446  O  O     . PHE D  3  100 ? 91.149  35.281 -34.528 1.00 56.07  ? 100  PHE B O     1 
ATOM   7447  C  CB    . PHE D  3  100 ? 91.626  34.718 -37.188 1.00 49.90  ? 100  PHE B CB    1 
ATOM   7448  C  CG    . PHE D  3  100 ? 92.570  34.608 -38.344 1.00 49.74  ? 100  PHE B CG    1 
ATOM   7449  C  CD1   . PHE D  3  100 ? 92.257  33.837 -39.462 1.00 46.92  ? 100  PHE B CD1   1 
ATOM   7450  C  CD2   . PHE D  3  100 ? 93.794  35.262 -38.304 1.00 50.73  ? 100  PHE B CD2   1 
ATOM   7451  C  CE1   . PHE D  3  100 ? 93.155  33.716 -40.521 1.00 46.98  ? 100  PHE B CE1   1 
ATOM   7452  C  CE2   . PHE D  3  100 ? 94.703  35.152 -39.356 1.00 51.14  ? 100  PHE B CE2   1 
ATOM   7453  C  CZ    . PHE D  3  100 ? 94.384  34.375 -40.468 1.00 50.84  ? 100  PHE B CZ    1 
ATOM   7454  N  N     . GLY D  3  101 ? 90.665  33.153 -34.040 1.00 61.72  ? 101  GLY B N     1 
ATOM   7455  C  CA    . GLY D  3  101 ? 90.041  33.541 -32.790 1.00 69.01  ? 101  GLY B CA    1 
ATOM   7456  C  C     . GLY D  3  101 ? 88.629  33.025 -32.580 1.00 74.74  ? 101  GLY B C     1 
ATOM   7457  O  O     . GLY D  3  101 ? 88.181  32.926 -31.437 1.00 76.54  ? 101  GLY B O     1 
ATOM   7458  N  N     . GLY D  3  102 ? 87.908  32.724 -33.658 1.00 77.69  ? 102  GLY B N     1 
ATOM   7459  C  CA    . GLY D  3  102 ? 86.564  32.207 -33.483 1.00 81.99  ? 102  GLY B CA    1 
ATOM   7460  C  C     . GLY D  3  102 ? 85.677  32.226 -34.703 1.00 84.42  ? 102  GLY B C     1 
ATOM   7461  O  O     . GLY D  3  102 ? 85.604  31.211 -35.437 1.00 85.50  ? 102  GLY B O     1 
ATOM   7462  O  OXT   . GLY D  3  102 ? 85.016  33.263 -34.880 1.00 87.29  ? 102  GLY B OXT   1 
ATOM   7463  N  N     . ALA E  4  12  ? 50.185  62.320 -7.923  1.00 92.83  ? 812  ALA C N     1 
ATOM   7464  C  CA    . ALA E  4  12  ? 51.405  63.175 -7.987  1.00 92.71  ? 812  ALA C CA    1 
ATOM   7465  C  C     . ALA E  4  12  ? 52.188  63.007 -9.292  1.00 92.25  ? 812  ALA C C     1 
ATOM   7466  O  O     . ALA E  4  12  ? 53.361  62.636 -9.279  1.00 92.72  ? 812  ALA C O     1 
ATOM   7467  C  CB    . ALA E  4  12  ? 52.311  62.913 -6.779  1.00 92.50  ? 812  ALA C CB    1 
ATOM   7468  N  N     . LYS E  4  13  ? 51.494  63.214 -10.410 1.00 91.14  ? 813  LYS C N     1 
ATOM   7469  C  CA    . LYS E  4  13  ? 52.059  63.169 -11.764 1.00 89.91  ? 813  LYS C CA    1 
ATOM   7470  C  C     . LYS E  4  13  ? 53.021  62.081 -12.276 1.00 88.34  ? 813  LYS C C     1 
ATOM   7471  O  O     . LYS E  4  13  ? 54.193  62.360 -12.543 1.00 88.51  ? 813  LYS C O     1 
ATOM   7472  C  CB    . LYS E  4  13  ? 52.650  64.544 -12.104 1.00 91.05  ? 813  LYS C CB    1 
ATOM   7473  C  CG    . LYS E  4  13  ? 53.604  65.140 -11.049 1.00 91.83  ? 813  LYS C CG    1 
ATOM   7474  C  CD    . LYS E  4  13  ? 54.880  64.314 -10.861 1.00 93.22  ? 813  LYS C CD    1 
ATOM   7475  C  CE    . LYS E  4  13  ? 56.052  65.180 -10.413 1.00 93.93  ? 813  LYS C CE    1 
ATOM   7476  N  NZ    . LYS E  4  13  ? 56.763  64.627 -9.225  1.00 93.87  ? 813  LYS C NZ    1 
ATOM   7477  N  N     . ALA E  4  14  ? 52.527  60.867 -12.495 1.00 85.89  ? 814  ALA C N     1 
ATOM   7478  C  CA    . ALA E  4  14  ? 53.396  59.823 -13.036 1.00 83.58  ? 814  ALA C CA    1 
ATOM   7479  C  C     . ALA E  4  14  ? 53.244  59.848 -14.556 1.00 81.46  ? 814  ALA C C     1 
ATOM   7480  O  O     . ALA E  4  14  ? 52.185  59.501 -15.081 1.00 82.25  ? 814  ALA C O     1 
ATOM   7481  C  CB    . ALA E  4  14  ? 53.014  58.452 -12.485 1.00 82.89  ? 814  ALA C CB    1 
ATOM   7482  N  N     . LYS E  4  15  ? 54.267  60.331 -15.256 1.00 78.46  ? 815  LYS C N     1 
ATOM   7483  C  CA    . LYS E  4  15  ? 54.228  60.385 -16.715 1.00 75.05  ? 815  LYS C CA    1 
ATOM   7484  C  C     . LYS E  4  15  ? 54.912  59.157 -17.309 1.00 71.55  ? 815  LYS C C     1 
ATOM   7485  O  O     . LYS E  4  15  ? 55.932  58.692 -16.792 1.00 70.14  ? 815  LYS C O     1 
ATOM   7486  C  CB    . LYS E  4  15  ? 54.914  61.656 -17.230 1.00 77.21  ? 815  LYS C CB    1 
ATOM   7487  C  CG    . LYS E  4  15  ? 54.141  62.936 -16.977 1.00 79.59  ? 815  LYS C CG    1 
ATOM   7488  C  CD    . LYS E  4  15  ? 54.898  64.144 -17.510 1.00 82.41  ? 815  LYS C CD    1 
ATOM   7489  C  CE    . LYS E  4  15  ? 54.069  65.417 -17.399 1.00 83.67  ? 815  LYS C CE    1 
ATOM   7490  N  NZ    . LYS E  4  15  ? 54.674  66.554 -18.157 1.00 85.24  ? 815  LYS C NZ    1 
ATOM   7491  N  N     . THR E  4  16  ? 54.343  58.624 -18.386 1.00 67.16  ? 816  THR C N     1 
ATOM   7492  C  CA    . THR E  4  16  ? 54.926  57.460 -19.045 1.00 61.75  ? 816  THR C CA    1 
ATOM   7493  C  C     . THR E  4  16  ? 56.324  57.807 -19.551 1.00 58.17  ? 816  THR C C     1 
ATOM   7494  O  O     . THR E  4  16  ? 56.594  58.946 -19.948 1.00 55.68  ? 816  THR C O     1 
ATOM   7495  C  CB    . THR E  4  16  ? 54.076  56.998 -20.250 1.00 61.56  ? 816  THR C CB    1 
ATOM   7496  O  OG1   . THR E  4  16  ? 53.974  58.059 -21.209 1.00 61.13  ? 816  THR C OG1   1 
ATOM   7497  C  CG2   . THR E  4  16  ? 52.685  56.585 -19.798 1.00 62.71  ? 816  THR C CG2   1 
ATOM   7498  N  N     . ARG E  4  17  ? 57.222  56.832 -19.511 1.00 54.26  ? 817  ARG C N     1 
ATOM   7499  C  CA    . ARG E  4  17  ? 58.576  57.065 -19.994 1.00 51.58  ? 817  ARG C CA    1 
ATOM   7500  C  C     . ARG E  4  17  ? 58.539  57.470 -21.471 1.00 48.39  ? 817  ARG C C     1 
ATOM   7501  O  O     . ARG E  4  17  ? 59.422  58.170 -21.963 1.00 45.32  ? 817  ARG C O     1 
ATOM   7502  C  CB    . ARG E  4  17  ? 59.440  55.818 -19.800 1.00 53.38  ? 817  ARG C CB    1 
ATOM   7503  C  CG    . ARG E  4  17  ? 59.637  55.422 -18.348 1.00 53.75  ? 817  ARG C CG    1 
ATOM   7504  C  CD    . ARG E  4  17  ? 60.869  54.543 -18.201 1.00 54.11  ? 817  ARG C CD    1 
ATOM   7505  N  NE    . ARG E  4  17  ? 60.517  53.140 -18.020 1.00 55.21  ? 817  ARG C NE    1 
ATOM   7506  C  CZ    . ARG E  4  17  ? 61.345  52.125 -18.254 1.00 53.43  ? 817  ARG C CZ    1 
ATOM   7507  N  NH1   . ARG E  4  17  ? 62.578  52.356 -18.688 1.00 50.55  ? 817  ARG C NH1   1 
ATOM   7508  N  NH2   . ARG E  4  17  ? 60.948  50.884 -18.010 1.00 53.13  ? 817  ARG C NH2   1 
ATOM   7509  N  N     . SER E  4  18  ? 57.510  57.028 -22.178 1.00 46.90  ? 818  SER C N     1 
ATOM   7510  C  CA    . SER E  4  18  ? 57.382  57.385 -23.584 1.00 48.14  ? 818  SER C CA    1 
ATOM   7511  C  C     . SER E  4  18  ? 57.154  58.897 -23.729 1.00 47.44  ? 818  SER C C     1 
ATOM   7512  O  O     . SER E  4  18  ? 57.854  59.563 -24.490 1.00 45.95  ? 818  SER C O     1 
ATOM   7513  C  CB    . SER E  4  18  ? 56.241  56.598 -24.227 1.00 47.72  ? 818  SER C CB    1 
ATOM   7514  O  OG    . SER E  4  18  ? 56.513  55.206 -24.212 1.00 48.44  ? 818  SER C OG    1 
ATOM   7515  N  N     . SER E  4  19  ? 56.199  59.432 -22.974 1.00 48.51  ? 819  SER C N     1 
ATOM   7516  C  CA    . SER E  4  19  ? 55.920  60.854 -23.030 1.00 51.25  ? 819  SER C CA    1 
ATOM   7517  C  C     . SER E  4  19  ? 57.174  61.639 -22.677 1.00 50.74  ? 819  SER C C     1 
ATOM   7518  O  O     . SER E  4  19  ? 57.503  62.638 -23.324 1.00 50.33  ? 819  SER C O     1 
ATOM   7519  C  CB    . SER E  4  19  ? 54.758  61.254 -22.097 1.00 51.99  ? 819  SER C CB    1 
ATOM   7520  O  OG    . SER E  4  19  ? 55.037  60.973 -20.728 1.00 54.56  ? 819  SER C OG    1 
ATOM   7521  N  N     A ARG E  4  20  ? 57.891  61.195 -21.671 0.50 51.14  ? 820  ARG C N     1 
ATOM   7522  N  N     B ARG E  4  20  ? 57.844  61.129 -21.592 0.50 52.04  ? 820  ARG C N     1 
ATOM   7523  C  CA    A ARG E  4  20  ? 59.096  61.883 -21.217 0.50 51.47  ? 820  ARG C CA    1 
ATOM   7524  C  CA    B ARG E  4  20  ? 59.110  61.653 -21.064 0.50 53.43  ? 820  ARG C CA    1 
ATOM   7525  C  C     A ARG E  4  20  ? 60.107  61.896 -22.339 0.50 49.63  ? 820  ARG C C     1 
ATOM   7526  C  C     B ARG E  4  20  ? 60.268  61.515 -22.049 0.50 52.08  ? 820  ARG C C     1 
ATOM   7527  O  O     A ARG E  4  20  ? 60.932  62.799 -22.466 0.50 47.32  ? 820  ARG C O     1 
ATOM   7528  O  O     B ARG E  4  20  ? 61.387  61.886 -21.737 0.50 53.58  ? 820  ARG C O     1 
ATOM   7529  C  CB    A ARG E  4  20  ? 59.703  61.101 -20.032 0.50 55.80  ? 820  ARG C CB    1 
ATOM   7530  C  CB    B ARG E  4  20  ? 59.460  60.935 -19.752 0.50 57.12  ? 820  ARG C CB    1 
ATOM   7531  C  CG    A ARG E  4  20  ? 60.834  61.725 -19.459 0.50 61.44  ? 820  ARG C CG    1 
ATOM   7532  C  CG    B ARG E  4  20  ? 58.916  61.514 -18.406 0.50 62.62  ? 820  ARG C CG    1 
ATOM   7533  C  CD    A ARG E  4  20  ? 60.667  61.511 -17.992 0.50 66.50  ? 820  ARG C CD    1 
ATOM   7534  C  CD    B ARG E  4  20  ? 58.569  60.370 -17.440 0.50 67.42  ? 820  ARG C CD    1 
ATOM   7535  N  NE    A ARG E  4  20  ? 60.263  60.145 -17.658 0.50 71.62  ? 820  ARG C NE    1 
ATOM   7536  N  NE    B ARG E  4  20  ? 58.271  60.724 -16.045 0.50 72.24  ? 820  ARG C NE    1 
ATOM   7537  C  CZ    A ARG E  4  20  ? 59.328  59.837 -16.763 0.50 73.90  ? 820  ARG C CZ    1 
ATOM   7538  C  CZ    B ARG E  4  20  ? 58.566  61.870 -15.433 0.50 73.77  ? 820  ARG C CZ    1 
ATOM   7539  N  NH1   A ARG E  4  20  ? 58.683  60.796 -16.113 0.50 76.31  ? 820  ARG C NH1   1 
ATOM   7540  N  NH1   B ARG E  4  20  ? 59.180  62.854 -16.071 0.50 74.65  ? 820  ARG C NH1   1 
ATOM   7541  N  NH2   A ARG E  4  20  ? 59.056  58.566 -16.493 0.50 74.66  ? 820  ARG C NH2   1 
ATOM   7542  N  NH2   B ARG E  4  20  ? 58.274  62.015 -14.147 0.50 74.55  ? 820  ARG C NH2   1 
ATOM   7543  N  N     . ALA E  4  21  ? 60.029  60.860 -23.181 1.00 49.84  ? 821  ALA C N     1 
ATOM   7544  C  CA    . ALA E  4  21  ? 61.005  60.704 -24.247 1.00 47.89  ? 821  ALA C CA    1 
ATOM   7545  C  C     . ALA E  4  21  ? 60.467  61.325 -25.535 1.00 45.75  ? 821  ALA C C     1 
ATOM   7546  O  O     . ALA E  4  21  ? 61.217  61.514 -26.490 1.00 46.03  ? 821  ALA C O     1 
ATOM   7547  C  CB    . ALA E  4  21  ? 61.311  59.248 -24.472 1.00 48.01  ? 821  ALA C CB    1 
ATOM   7548  N  N     . GLY E  4  22  ? 59.198  61.737 -25.514 1.00 42.92  ? 822  GLY C N     1 
ATOM   7549  C  CA    . GLY E  4  22  ? 58.574  62.339 -26.684 1.00 42.00  ? 822  GLY C CA    1 
ATOM   7550  C  C     . GLY E  4  22  ? 58.278  61.282 -27.740 1.00 42.94  ? 822  GLY C C     1 
ATOM   7551  O  O     . GLY E  4  22  ? 58.289  61.572 -28.933 1.00 40.40  ? 822  GLY C O     1 
ATOM   7552  N  N     . LEU E  4  23  ? 57.973  60.060 -27.305 1.00 41.16  ? 823  LEU C N     1 
ATOM   7553  C  CA    . LEU E  4  23  ? 57.705  58.968 -28.240 1.00 42.52  ? 823  LEU C CA    1 
ATOM   7554  C  C     . LEU E  4  23  ? 56.286  58.407 -28.208 1.00 43.24  ? 823  LEU C C     1 
ATOM   7555  O  O     . LEU E  4  23  ? 55.556  58.555 -27.228 1.00 43.46  ? 823  LEU C O     1 
ATOM   7556  C  CB    . LEU E  4  23  ? 58.685  57.815 -27.984 1.00 40.74  ? 823  LEU C CB    1 
ATOM   7557  C  CG    . LEU E  4  23  ? 60.182  58.071 -28.159 1.00 38.96  ? 823  LEU C CG    1 
ATOM   7558  C  CD1   . LEU E  4  23  ? 60.979  56.875 -27.640 1.00 38.97  ? 823  LEU C CD1   1 
ATOM   7559  C  CD2   . LEU E  4  23  ? 60.486  58.347 -29.620 1.00 38.84  ? 823  LEU C CD2   1 
ATOM   7560  N  N     . GLN E  4  24  ? 55.912  57.752 -29.303 1.00 44.74  ? 824  GLN C N     1 
ATOM   7561  C  CA    . GLN E  4  24  ? 54.610  57.109 -29.434 1.00 45.52  ? 824  GLN C CA    1 
ATOM   7562  C  C     . GLN E  4  24  ? 54.782  55.643 -29.022 1.00 46.63  ? 824  GLN C C     1 
ATOM   7563  O  O     . GLN E  4  24  ? 53.888  55.055 -28.421 1.00 47.14  ? 824  GLN C O     1 
ATOM   7564  C  CB    . GLN E  4  24  ? 54.128  57.174 -30.887 1.00 46.95  ? 824  GLN C CB    1 
ATOM   7565  C  CG    . GLN E  4  24  ? 53.986  58.590 -31.447 1.00 49.30  ? 824  GLN C CG    1 
ATOM   7566  C  CD    . GLN E  4  24  ? 53.092  59.442 -30.579 1.00 48.92  ? 824  GLN C CD    1 
ATOM   7567  O  OE1   . GLN E  4  24  ? 51.919  59.127 -30.383 1.00 48.26  ? 824  GLN C OE1   1 
ATOM   7568  N  NE2   . GLN E  4  24  ? 53.653  60.506 -30.019 1.00 50.48  ? 824  GLN C NE2   1 
ATOM   7569  N  N     . PHE E  4  25  ? 55.917  55.047 -29.388 1.00 46.44  ? 825  PHE C N     1 
ATOM   7570  C  CA    . PHE E  4  25  ? 56.199  53.653 -29.038 1.00 46.05  ? 825  PHE C CA    1 
ATOM   7571  C  C     . PHE E  4  25  ? 56.409  53.490 -27.526 1.00 46.04  ? 825  PHE C C     1 
ATOM   7572  O  O     . PHE E  4  25  ? 57.046  54.327 -26.889 1.00 46.24  ? 825  PHE C O     1 
ATOM   7573  C  CB    . PHE E  4  25  ? 57.384  53.116 -29.852 1.00 41.71  ? 825  PHE C CB    1 
ATOM   7574  C  CG    . PHE E  4  25  ? 56.976  52.501 -31.161 1.00 42.90  ? 825  PHE C CG    1 
ATOM   7575  C  CD1   . PHE E  4  25  ? 56.058  53.139 -31.984 1.00 40.41  ? 825  PHE C CD1   1 
ATOM   7576  C  CD2   . PHE E  4  25  ? 57.462  51.249 -31.544 1.00 43.74  ? 825  PHE C CD2   1 
ATOM   7577  C  CE1   . PHE E  4  25  ? 55.617  52.545 -33.165 1.00 41.15  ? 825  PHE C CE1   1 
ATOM   7578  C  CE2   . PHE E  4  25  ? 57.028  50.641 -32.730 1.00 42.05  ? 825  PHE C CE2   1 
ATOM   7579  C  CZ    . PHE E  4  25  ? 56.104  51.289 -33.539 1.00 43.05  ? 825  PHE C CZ    1 
ATOM   7580  N  N     . PRO E  4  26  ? 55.942  52.362 -26.955 1.00 47.20  ? 826  PRO C N     1 
ATOM   7581  C  CA    . PRO E  4  26  ? 56.019  52.016 -25.525 1.00 45.85  ? 826  PRO C CA    1 
ATOM   7582  C  C     . PRO E  4  26  ? 57.390  51.689 -24.950 1.00 46.56  ? 826  PRO C C     1 
ATOM   7583  O  O     . PRO E  4  26  ? 57.829  50.535 -24.997 1.00 44.39  ? 826  PRO C O     1 
ATOM   7584  C  CB    . PRO E  4  26  ? 55.094  50.809 -25.432 1.00 46.32  ? 826  PRO C CB    1 
ATOM   7585  C  CG    . PRO E  4  26  ? 55.395  50.092 -26.718 1.00 46.54  ? 826  PRO C CG    1 
ATOM   7586  C  CD    . PRO E  4  26  ? 55.429  51.219 -27.738 1.00 45.65  ? 826  PRO C CD    1 
ATOM   7587  N  N     . VAL E  4  27  ? 58.010  52.679 -24.309 1.00 45.44  ? 827  VAL C N     1 
ATOM   7588  C  CA    . VAL E  4  27  ? 59.323  52.488 -23.711 1.00 43.74  ? 827  VAL C CA    1 
ATOM   7589  C  C     . VAL E  4  27  ? 59.281  51.413 -22.631 1.00 45.07  ? 827  VAL C C     1 
ATOM   7590  O  O     . VAL E  4  27  ? 60.155  50.545 -22.575 1.00 44.48  ? 827  VAL C O     1 
ATOM   7591  C  CB    . VAL E  4  27  ? 59.862  53.794 -23.106 1.00 44.71  ? 827  VAL C CB    1 
ATOM   7592  C  CG1   . VAL E  4  27  ? 61.152  53.528 -22.332 1.00 40.76  ? 827  VAL C CG1   1 
ATOM   7593  C  CG2   . VAL E  4  27  ? 60.095  54.824 -24.211 1.00 43.81  ? 827  VAL C CG2   1 
ATOM   7594  N  N     . GLY E  4  28  ? 58.253  51.456 -21.791 1.00 43.26  ? 828  GLY C N     1 
ATOM   7595  C  CA    . GLY E  4  28  ? 58.144  50.479 -20.719 1.00 44.93  ? 828  GLY C CA    1 
ATOM   7596  C  C     . GLY E  4  28  ? 58.077  49.043 -21.210 1.00 45.50  ? 828  GLY C C     1 
ATOM   7597  O  O     . GLY E  4  28  ? 58.676  48.144 -20.622 1.00 45.52  ? 828  GLY C O     1 
ATOM   7598  N  N     . ARG E  4  29  ? 57.316  48.830 -22.278 1.00 45.27  ? 829  ARG C N     1 
ATOM   7599  C  CA    . ARG E  4  29  ? 57.155  47.511 -22.866 1.00 45.29  ? 829  ARG C CA    1 
ATOM   7600  C  C     . ARG E  4  29  ? 58.485  47.047 -23.450 1.00 45.41  ? 829  ARG C C     1 
ATOM   7601  O  O     . ARG E  4  29  ? 58.900  45.902 -23.251 1.00 43.76  ? 829  ARG C O     1 
ATOM   7602  C  CB    . ARG E  4  29  ? 56.097  47.553 -23.963 1.00 47.99  ? 829  ARG C CB    1 
ATOM   7603  C  CG    . ARG E  4  29  ? 55.855  46.214 -24.622 1.00 50.19  ? 829  ARG C CG    1 
ATOM   7604  C  CD    . ARG E  4  29  ? 54.408  45.830 -24.498 1.00 53.01  ? 829  ARG C CD    1 
ATOM   7605  N  NE    . ARG E  4  29  ? 53.696  46.070 -25.738 1.00 55.66  ? 829  ARG C NE    1 
ATOM   7606  C  CZ    . ARG E  4  29  ? 52.394  46.310 -25.818 1.00 57.00  ? 829  ARG C CZ    1 
ATOM   7607  N  NH1   . ARG E  4  29  ? 51.646  46.349 -24.722 1.00 57.32  ? 829  ARG C NH1   1 
ATOM   7608  N  NH2   . ARG E  4  29  ? 51.841  46.506 -27.002 1.00 58.47  ? 829  ARG C NH2   1 
ATOM   7609  N  N     . VAL E  4  30  ? 59.144  47.951 -24.170 1.00 42.78  ? 830  VAL C N     1 
ATOM   7610  C  CA    . VAL E  4  30  ? 60.426  47.656 -24.783 1.00 43.29  ? 830  VAL C CA    1 
ATOM   7611  C  C     . VAL E  4  30  ? 61.480  47.296 -23.735 1.00 45.00  ? 830  VAL C C     1 
ATOM   7612  O  O     . VAL E  4  30  ? 62.298  46.404 -23.953 1.00 43.83  ? 830  VAL C O     1 
ATOM   7613  C  CB    . VAL E  4  30  ? 60.909  48.830 -25.660 1.00 40.72  ? 830  VAL C CB    1 
ATOM   7614  C  CG1   . VAL E  4  30  ? 62.377  48.631 -26.068 1.00 39.14  ? 830  VAL C CG1   1 
ATOM   7615  C  CG2   . VAL E  4  30  ? 60.031  48.930 -26.892 1.00 39.08  ? 830  VAL C CG2   1 
ATOM   7616  N  N     . HIS E  4  31  ? 61.466  47.998 -22.606 1.00 45.74  ? 831  HIS C N     1 
ATOM   7617  C  CA    . HIS E  4  31  ? 62.414  47.734 -21.527 1.00 47.91  ? 831  HIS C CA    1 
ATOM   7618  C  C     . HIS E  4  31  ? 62.181  46.314 -21.011 1.00 47.43  ? 831  HIS C C     1 
ATOM   7619  O  O     . HIS E  4  31  ? 63.115  45.537 -20.811 1.00 48.18  ? 831  HIS C O     1 
ATOM   7620  C  CB    . HIS E  4  31  ? 62.196  48.736 -20.390 1.00 51.81  ? 831  HIS C CB    1 
ATOM   7621  C  CG    . HIS E  4  31  ? 63.229  48.664 -19.309 1.00 56.40  ? 831  HIS C CG    1 
ATOM   7622  N  ND1   . HIS E  4  31  ? 63.916  47.508 -19.006 1.00 59.83  ? 831  HIS C ND1   1 
ATOM   7623  C  CD2   . HIS E  4  31  ? 63.695  49.611 -18.462 1.00 59.02  ? 831  HIS C CD2   1 
ATOM   7624  C  CE1   . HIS E  4  31  ? 64.762  47.746 -18.020 1.00 60.28  ? 831  HIS C CE1   1 
ATOM   7625  N  NE2   . HIS E  4  31  ? 64.648  49.015 -17.671 1.00 60.02  ? 831  HIS C NE2   1 
ATOM   7626  N  N     . ARG E  4  32  ? 60.915  45.976 -20.831 1.00 46.92  ? 832  ARG C N     1 
ATOM   7627  C  CA    . ARG E  4  32  ? 60.540  44.667 -20.344 1.00 48.74  ? 832  ARG C CA    1 
ATOM   7628  C  C     . ARG E  4  32  ? 60.917  43.569 -21.338 1.00 48.86  ? 832  ARG C C     1 
ATOM   7629  O  O     . ARG E  4  32  ? 61.448  42.532 -20.946 1.00 49.94  ? 832  ARG C O     1 
ATOM   7630  C  CB    . ARG E  4  32  ? 59.043  44.637 -20.064 1.00 50.04  ? 832  ARG C CB    1 
ATOM   7631  C  CG    . ARG E  4  32  ? 58.539  43.324 -19.527 1.00 53.75  ? 832  ARG C CG    1 
ATOM   7632  C  CD    . ARG E  4  32  ? 57.035  43.331 -19.529 1.00 57.76  ? 832  ARG C CD    1 
ATOM   7633  N  NE    . ARG E  4  32  ? 56.515  42.474 -20.585 1.00 61.42  ? 832  ARG C NE    1 
ATOM   7634  C  CZ    . ARG E  4  32  ? 55.563  42.824 -21.443 1.00 61.78  ? 832  ARG C CZ    1 
ATOM   7635  N  NH1   . ARG E  4  32  ? 55.013  44.026 -21.384 1.00 61.70  ? 832  ARG C NH1   1 
ATOM   7636  N  NH2   . ARG E  4  32  ? 55.148  41.954 -22.353 1.00 65.07  ? 832  ARG C NH2   1 
ATOM   7637  N  N     . LEU E  4  33  ? 60.627  43.786 -22.617 1.00 47.85  ? 833  LEU C N     1 
ATOM   7638  C  CA    . LEU E  4  33  ? 60.954  42.792 -23.634 1.00 46.92  ? 833  LEU C CA    1 
ATOM   7639  C  C     . LEU E  4  33  ? 62.455  42.560 -23.687 1.00 45.89  ? 833  LEU C C     1 
ATOM   7640  O  O     . LEU E  4  33  ? 62.899  41.429 -23.897 1.00 45.43  ? 833  LEU C O     1 
ATOM   7641  C  CB    . LEU E  4  33  ? 60.418  43.208 -25.005 1.00 46.83  ? 833  LEU C CB    1 
ATOM   7642  C  CG    . LEU E  4  33  ? 58.890  43.177 -25.130 1.00 47.56  ? 833  LEU C CG    1 
ATOM   7643  C  CD1   . LEU E  4  33  ? 58.459  43.747 -26.478 1.00 47.60  ? 833  LEU C CD1   1 
ATOM   7644  C  CD2   . LEU E  4  33  ? 58.371  41.752 -24.962 1.00 47.25  ? 833  LEU C CD2   1 
ATOM   7645  N  N     . LEU E  4  34  ? 63.239  43.619 -23.493 1.00 43.71  ? 834  LEU C N     1 
ATOM   7646  C  CA    . LEU E  4  34  ? 64.690  43.476 -23.499 1.00 45.84  ? 834  LEU C CA    1 
ATOM   7647  C  C     . LEU E  4  34  ? 65.124  42.562 -22.342 1.00 49.46  ? 834  LEU C C     1 
ATOM   7648  O  O     . LEU E  4  34  ? 66.046  41.757 -22.488 1.00 49.62  ? 834  LEU C O     1 
ATOM   7649  C  CB    . LEU E  4  34  ? 65.384  44.836 -23.388 1.00 42.72  ? 834  LEU C CB    1 
ATOM   7650  C  CG    . LEU E  4  34  ? 65.454  45.714 -24.645 1.00 44.27  ? 834  LEU C CG    1 
ATOM   7651  C  CD1   . LEU E  4  34  ? 66.030  47.089 -24.278 1.00 41.38  ? 834  LEU C CD1   1 
ATOM   7652  C  CD2   . LEU E  4  34  ? 66.301  45.043 -25.719 1.00 39.73  ? 834  LEU C CD2   1 
ATOM   7653  N  N     . ARG E  4  35  ? 64.452  42.676 -21.199 1.00 52.27  ? 835  ARG C N     1 
ATOM   7654  C  CA    . ARG E  4  35  ? 64.788  41.844 -20.042 1.00 56.40  ? 835  ARG C CA    1 
ATOM   7655  C  C     . ARG E  4  35  ? 64.419  40.375 -20.205 1.00 57.39  ? 835  ARG C C     1 
ATOM   7656  O  O     . ARG E  4  35  ? 65.221  39.492 -19.907 1.00 58.57  ? 835  ARG C O     1 
ATOM   7657  C  CB    . ARG E  4  35  ? 64.123  42.375 -18.776 1.00 60.59  ? 835  ARG C CB    1 
ATOM   7658  C  CG    . ARG E  4  35  ? 64.724  43.663 -18.257 1.00 65.62  ? 835  ARG C CG    1 
ATOM   7659  C  CD    . ARG E  4  35  ? 64.165  44.022 -16.892 1.00 71.19  ? 835  ARG C CD    1 
ATOM   7660  N  NE    . ARG E  4  35  ? 64.764  45.259 -16.407 1.00 76.83  ? 835  ARG C NE    1 
ATOM   7661  C  CZ    . ARG E  4  35  ? 66.060  45.409 -16.149 1.00 79.04  ? 835  ARG C CZ    1 
ATOM   7662  N  NH1   . ARG E  4  35  ? 66.899  44.391 -16.318 1.00 80.55  ? 835  ARG C NH1   1 
ATOM   7663  N  NH2   . ARG E  4  35  ? 66.526  46.593 -15.770 1.00 80.40  ? 835  ARG C NH2   1 
ATOM   7664  N  N     . LYS E  4  36  ? 63.194  40.118 -20.644 1.00 57.56  ? 836  LYS C N     1 
ATOM   7665  C  CA    . LYS E  4  36  ? 62.722  38.755 -20.821 1.00 59.90  ? 836  LYS C CA    1 
ATOM   7666  C  C     . LYS E  4  36  ? 63.421  38.044 -21.970 1.00 59.21  ? 836  LYS C C     1 
ATOM   7667  O  O     . LYS E  4  36  ? 63.444  36.818 -22.019 1.00 57.79  ? 836  LYS C O     1 
ATOM   7668  C  CB    . LYS E  4  36  ? 61.209  38.750 -21.051 1.00 63.41  ? 836  LYS C CB    1 
ATOM   7669  C  CG    . LYS E  4  36  ? 60.781  39.369 -22.370 1.00 68.51  ? 836  LYS C CG    1 
ATOM   7670  C  CD    . LYS E  4  36  ? 59.289  39.706 -22.381 1.00 71.81  ? 836  LYS C CD    1 
ATOM   7671  C  CE    . LYS E  4  36  ? 58.414  38.472 -22.258 1.00 72.93  ? 836  LYS C CE    1 
ATOM   7672  N  NZ    . LYS E  4  36  ? 57.036  38.837 -21.817 1.00 74.85  ? 836  LYS C NZ    1 
ATOM   7673  N  N     . GLY E  4  37  ? 63.966  38.816 -22.907 1.00 58.63  ? 837  GLY C N     1 
ATOM   7674  C  CA    . GLY E  4  37  ? 64.650  38.222 -24.041 1.00 56.97  ? 837  GLY C CA    1 
ATOM   7675  C  C     . GLY E  4  37  ? 66.028  37.710 -23.669 1.00 56.63  ? 837  GLY C C     1 
ATOM   7676  O  O     . GLY E  4  37  ? 66.694  37.055 -24.471 1.00 55.12  ? 837  GLY C O     1 
ATOM   7677  N  N     . ASN E  4  38  ? 66.456  38.009 -22.446 1.00 56.97  ? 838  ASN C N     1 
ATOM   7678  C  CA    . ASN E  4  38  ? 67.765  37.577 -21.969 1.00 58.57  ? 838  ASN C CA    1 
ATOM   7679  C  C     . ASN E  4  38  ? 68.866  37.976 -22.937 1.00 56.96  ? 838  ASN C C     1 
ATOM   7680  O  O     . ASN E  4  38  ? 69.624  37.133 -23.419 1.00 57.83  ? 838  ASN C O     1 
ATOM   7681  C  CB    . ASN E  4  38  ? 67.798  36.062 -21.773 1.00 63.69  ? 838  ASN C CB    1 
ATOM   7682  C  CG    . ASN E  4  38  ? 67.002  35.616 -20.573 1.00 66.83  ? 838  ASN C CG    1 
ATOM   7683  O  OD1   . ASN E  4  38  ? 66.006  34.905 -20.706 1.00 68.79  ? 838  ASN C OD1   1 
ATOM   7684  N  ND2   . ASN E  4  38  ? 67.432  36.041 -19.386 1.00 69.51  ? 838  ASN C ND2   1 
ATOM   7685  N  N     . TYR E  4  39  ? 68.935  39.261 -23.247 1.00 53.04  ? 839  TYR C N     1 
ATOM   7686  C  CA    . TYR E  4  39  ? 69.957  39.747 -24.151 1.00 50.99  ? 839  TYR C CA    1 
ATOM   7687  C  C     . TYR E  4  39  ? 71.245  40.044 -23.390 1.00 50.39  ? 839  TYR C C     1 
ATOM   7688  O  O     . TYR E  4  39  ? 72.345  39.889 -23.924 1.00 49.63  ? 839  TYR C O     1 
ATOM   7689  C  CB    . TYR E  4  39  ? 69.429  40.961 -24.913 1.00 48.38  ? 839  TYR C CB    1 
ATOM   7690  C  CG    . TYR E  4  39  ? 68.291  40.585 -25.844 1.00 46.66  ? 839  TYR C CG    1 
ATOM   7691  C  CD1   . TYR E  4  39  ? 66.959  40.798 -25.483 1.00 44.93  ? 839  TYR C CD1   1 
ATOM   7692  C  CD2   . TYR E  4  39  ? 68.549  39.992 -27.078 1.00 45.78  ? 839  TYR C CD2   1 
ATOM   7693  C  CE1   . TYR E  4  39  ? 65.910  40.426 -26.339 1.00 45.25  ? 839  TYR C CE1   1 
ATOM   7694  C  CE2   . TYR E  4  39  ? 67.514  39.619 -27.936 1.00 46.32  ? 839  TYR C CE2   1 
ATOM   7695  C  CZ    . TYR E  4  39  ? 66.200  39.839 -27.564 1.00 47.15  ? 839  TYR C CZ    1 
ATOM   7696  O  OH    . TYR E  4  39  ? 65.191  39.479 -28.433 1.00 48.41  ? 839  TYR C OH    1 
ATOM   7697  N  N     . ALA E  4  40  ? 71.099  40.408 -22.120 1.00 49.79  ? 840  ALA C N     1 
ATOM   7698  C  CA    . ALA E  4  40  ? 72.243  40.708 -21.260 1.00 51.39  ? 840  ALA C CA    1 
ATOM   7699  C  C     . ALA E  4  40  ? 71.812  40.624 -19.802 1.00 52.90  ? 840  ALA C C     1 
ATOM   7700  O  O     . ALA E  4  40  ? 70.623  40.523 -19.506 1.00 52.50  ? 840  ALA C O     1 
ATOM   7701  C  CB    . ALA E  4  40  ? 72.796  42.096 -21.565 1.00 50.73  ? 840  ALA C CB    1 
ATOM   7702  N  N     . GLU E  4  41  ? 72.773  40.640 -18.887 1.00 54.65  ? 841  GLU C N     1 
ATOM   7703  C  CA    . GLU E  4  41  ? 72.431  40.572 -17.475 1.00 57.48  ? 841  GLU C CA    1 
ATOM   7704  C  C     . GLU E  4  41  ? 71.712  41.844 -17.049 1.00 56.45  ? 841  GLU C C     1 
ATOM   7705  O  O     . GLU E  4  41  ? 70.738  41.805 -16.299 1.00 56.58  ? 841  GLU C O     1 
ATOM   7706  C  CB    . GLU E  4  41  ? 73.687  40.383 -16.619 1.00 60.89  ? 841  GLU C CB    1 
ATOM   7707  C  CG    . GLU E  4  41  ? 74.343  39.016 -16.761 1.00 68.21  ? 841  GLU C CG    1 
ATOM   7708  C  CD    . GLU E  4  41  ? 73.403  37.865 -16.412 1.00 71.38  ? 841  GLU C CD    1 
ATOM   7709  O  OE1   . GLU E  4  41  ? 72.427  38.093 -15.660 1.00 73.20  ? 841  GLU C OE1   1 
ATOM   7710  O  OE2   . GLU E  4  41  ? 73.641  36.731 -16.891 1.00 73.21  ? 841  GLU C OE2   1 
ATOM   7711  N  N     . ARG E  4  42  ? 72.157  42.969 -17.593 1.00 55.74  ? 842  ARG C N     1 
ATOM   7712  C  CA    . ARG E  4  42  ? 71.583  44.255 -17.235 1.00 54.89  ? 842  ARG C CA    1 
ATOM   7713  C  C     . ARG E  4  42  ? 71.225  45.121 -18.443 1.00 54.88  ? 842  ARG C C     1 
ATOM   7714  O  O     . ARG E  4  42  ? 71.815  44.983 -19.520 1.00 54.01  ? 842  ARG C O     1 
ATOM   7715  C  CB    . ARG E  4  42  ? 72.567  44.985 -16.315 1.00 55.59  ? 842  ARG C CB    1 
ATOM   7716  C  CG    . ARG E  4  42  ? 72.789  44.255 -14.992 1.00 58.58  ? 842  ARG C CG    1 
ATOM   7717  C  CD    . ARG E  4  42  ? 74.166  44.516 -14.388 1.00 61.28  ? 842  ARG C CD    1 
ATOM   7718  N  NE    . ARG E  4  42  ? 74.720  45.816 -14.752 1.00 63.03  ? 842  ARG C NE    1 
ATOM   7719  C  CZ    . ARG E  4  42  ? 74.973  46.786 -13.882 1.00 65.25  ? 842  ARG C CZ    1 
ATOM   7720  N  NH1   . ARG E  4  42  ? 74.719  46.607 -12.593 1.00 64.44  ? 842  ARG C NH1   1 
ATOM   7721  N  NH2   . ARG E  4  42  ? 75.490  47.934 -14.298 1.00 66.01  ? 842  ARG C NH2   1 
ATOM   7722  N  N     . VAL E  4  43  ? 70.262  46.022 -18.243 1.00 53.24  ? 843  VAL C N     1 
ATOM   7723  C  CA    . VAL E  4  43  ? 69.794  46.930 -19.288 1.00 50.68  ? 843  VAL C CA    1 
ATOM   7724  C  C     . VAL E  4  43  ? 69.781  48.358 -18.767 1.00 50.89  ? 843  VAL C C     1 
ATOM   7725  O  O     . VAL E  4  43  ? 69.075  48.661 -17.808 1.00 51.84  ? 843  VAL C O     1 
ATOM   7726  C  CB    . VAL E  4  43  ? 68.356  46.584 -19.730 1.00 49.51  ? 843  VAL C CB    1 
ATOM   7727  C  CG1   . VAL E  4  43  ? 67.845  47.613 -20.730 1.00 47.65  ? 843  VAL C CG1   1 
ATOM   7728  C  CG2   . VAL E  4  43  ? 68.310  45.191 -20.324 1.00 50.03  ? 843  VAL C CG2   1 
ATOM   7729  N  N     . GLY E  4  44  ? 70.583  49.221 -19.383 1.00 49.25  ? 844  GLY C N     1 
ATOM   7730  C  CA    . GLY E  4  44  ? 70.623  50.611 -18.977 1.00 49.59  ? 844  GLY C CA    1 
ATOM   7731  C  C     . GLY E  4  44  ? 69.295  51.291 -19.274 1.00 49.57  ? 844  GLY C C     1 
ATOM   7732  O  O     . GLY E  4  44  ? 68.551  50.863 -20.161 1.00 47.22  ? 844  GLY C O     1 
ATOM   7733  N  N     . ALA E  4  45  ? 69.003  52.358 -18.533 1.00 49.51  ? 845  ALA C N     1 
ATOM   7734  C  CA    . ALA E  4  45  ? 67.753  53.102 -18.690 1.00 47.93  ? 845  ALA C CA    1 
ATOM   7735  C  C     . ALA E  4  45  ? 67.567  53.725 -20.076 1.00 46.25  ? 845  ALA C C     1 
ATOM   7736  O  O     . ALA E  4  45  ? 66.448  53.820 -20.567 1.00 48.27  ? 845  ALA C O     1 
ATOM   7737  C  CB    . ALA E  4  45  ? 67.646  54.183 -17.603 1.00 49.83  ? 845  ALA C CB    1 
ATOM   7738  N  N     . GLY E  4  46  ? 68.656  54.169 -20.690 1.00 43.72  ? 846  GLY C N     1 
ATOM   7739  C  CA    . GLY E  4  46  ? 68.553  54.774 -22.008 1.00 44.19  ? 846  GLY C CA    1 
ATOM   7740  C  C     . GLY E  4  46  ? 68.393  53.773 -23.151 1.00 44.47  ? 846  GLY C C     1 
ATOM   7741  O  O     . GLY E  4  46  ? 67.972  54.135 -24.254 1.00 42.20  ? 846  GLY C O     1 
ATOM   7742  N  N     . ALA E  4  47  ? 68.707  52.506 -22.886 1.00 41.81  ? 847  ALA C N     1 
ATOM   7743  C  CA    . ALA E  4  47  ? 68.612  51.464 -23.910 1.00 39.83  ? 847  ALA C CA    1 
ATOM   7744  C  C     . ALA E  4  47  ? 67.216  51.331 -24.514 1.00 39.07  ? 847  ALA C C     1 
ATOM   7745  O  O     . ALA E  4  47  ? 67.050  51.445 -25.726 1.00 38.81  ? 847  ALA C O     1 
ATOM   7746  C  CB    . ALA E  4  47  ? 69.079  50.116 -23.348 1.00 39.85  ? 847  ALA C CB    1 
ATOM   7747  N  N     . PRO E  4  48  ? 66.194  51.094 -23.677 1.00 37.43  ? 848  PRO C N     1 
ATOM   7748  C  CA    . PRO E  4  48  ? 64.833  50.951 -24.194 1.00 36.93  ? 848  PRO C CA    1 
ATOM   7749  C  C     . PRO E  4  48  ? 64.278  52.233 -24.820 1.00 38.59  ? 848  PRO C C     1 
ATOM   7750  O  O     . PRO E  4  48  ? 63.401  52.175 -25.687 1.00 38.39  ? 848  PRO C O     1 
ATOM   7751  C  CB    . PRO E  4  48  ? 64.043  50.505 -22.962 1.00 36.07  ? 848  PRO C CB    1 
ATOM   7752  C  CG    . PRO E  4  48  ? 64.781  51.140 -21.836 1.00 38.55  ? 848  PRO C CG    1 
ATOM   7753  C  CD    . PRO E  4  48  ? 66.223  50.924 -22.212 1.00 38.06  ? 848  PRO C CD    1 
ATOM   7754  N  N     . VAL E  4  49  ? 64.795  53.384 -24.398 1.00 37.58  ? 849  VAL C N     1 
ATOM   7755  C  CA    . VAL E  4  49  ? 64.336  54.655 -24.956 1.00 37.60  ? 849  VAL C CA    1 
ATOM   7756  C  C     . VAL E  4  49  ? 64.862  54.782 -26.376 1.00 36.68  ? 849  VAL C C     1 
ATOM   7757  O  O     . VAL E  4  49  ? 64.130  55.143 -27.300 1.00 36.62  ? 849  VAL C O     1 
ATOM   7758  C  CB    . VAL E  4  49  ? 64.840  55.875 -24.140 1.00 38.87  ? 849  VAL C CB    1 
ATOM   7759  C  CG1   . VAL E  4  49  ? 64.598  57.177 -24.938 1.00 37.42  ? 849  VAL C CG1   1 
ATOM   7760  C  CG2   . VAL E  4  49  ? 64.114  55.945 -22.804 1.00 38.53  ? 849  VAL C CG2   1 
ATOM   7761  N  N     . TYR E  4  50  ? 66.149  54.505 -26.532 1.00 35.71  ? 850  TYR C N     1 
ATOM   7762  C  CA    . TYR E  4  50  ? 66.802  54.578 -27.831 1.00 35.88  ? 850  TYR C CA    1 
ATOM   7763  C  C     . TYR E  4  50  ? 66.153  53.568 -28.792 1.00 36.76  ? 850  TYR C C     1 
ATOM   7764  O  O     . TYR E  4  50  ? 65.769  53.911 -29.921 1.00 36.79  ? 850  TYR C O     1 
ATOM   7765  C  CB    . TYR E  4  50  ? 68.300  54.291 -27.666 1.00 35.76  ? 850  TYR C CB    1 
ATOM   7766  C  CG    . TYR E  4  50  ? 69.166  54.776 -28.808 1.00 39.17  ? 850  TYR C CG    1 
ATOM   7767  C  CD1   . TYR E  4  50  ? 70.096  55.796 -28.615 1.00 36.34  ? 850  TYR C CD1   1 
ATOM   7768  C  CD2   . TYR E  4  50  ? 69.074  54.201 -30.074 1.00 37.77  ? 850  TYR C CD2   1 
ATOM   7769  C  CE1   . TYR E  4  50  ? 70.916  56.231 -29.644 1.00 39.24  ? 850  TYR C CE1   1 
ATOM   7770  C  CE2   . TYR E  4  50  ? 69.886  54.629 -31.112 1.00 37.56  ? 850  TYR C CE2   1 
ATOM   7771  C  CZ    . TYR E  4  50  ? 70.807  55.642 -30.894 1.00 39.54  ? 850  TYR C CZ    1 
ATOM   7772  O  OH    . TYR E  4  50  ? 71.631  56.052 -31.919 1.00 39.03  ? 850  TYR C OH    1 
ATOM   7773  N  N     . LEU E  4  51  ? 65.979  52.337 -28.320 1.00 35.38  ? 851  LEU C N     1 
ATOM   7774  C  CA    . LEU E  4  51  ? 65.375  51.287 -29.143 1.00 33.97  ? 851  LEU C CA    1 
ATOM   7775  C  C     . LEU E  4  51  ? 63.932  51.608 -29.546 1.00 33.72  ? 851  LEU C C     1 
ATOM   7776  O  O     . LEU E  4  51  ? 63.544  51.424 -30.709 1.00 36.21  ? 851  LEU C O     1 
ATOM   7777  C  CB    . LEU E  4  51  ? 65.445  49.935 -28.418 1.00 33.59  ? 851  LEU C CB    1 
ATOM   7778  C  CG    . LEU E  4  51  ? 64.925  48.704 -29.170 1.00 35.36  ? 851  LEU C CG    1 
ATOM   7779  C  CD1   . LEU E  4  51  ? 65.575  48.598 -30.572 1.00 31.53  ? 851  LEU C CD1   1 
ATOM   7780  C  CD2   . LEU E  4  51  ? 65.224  47.458 -28.338 1.00 33.68  ? 851  LEU C CD2   1 
ATOM   7781  N  N     . ALA E  4  52  ? 63.124  52.079 -28.603 1.00 31.57  ? 852  ALA C N     1 
ATOM   7782  C  CA    . ALA E  4  52  ? 61.742  52.425 -28.944 1.00 33.11  ? 852  ALA C CA    1 
ATOM   7783  C  C     . ALA E  4  52  ? 61.731  53.521 -30.017 1.00 33.17  ? 852  ALA C C     1 
ATOM   7784  O  O     . ALA E  4  52  ? 60.933  53.481 -30.951 1.00 36.13  ? 852  ALA C O     1 
ATOM   7785  C  CB    . ALA E  4  52  ? 60.979  52.879 -27.711 1.00 33.14  ? 852  ALA C CB    1 
ATOM   7786  N  N     . ALA E  4  53  ? 62.670  54.454 -29.929 1.00 33.31  ? 853  ALA C N     1 
ATOM   7787  C  CA    . ALA E  4  53  ? 62.746  55.549 -30.902 1.00 34.31  ? 853  ALA C CA    1 
ATOM   7788  C  C     . ALA E  4  53  ? 63.047  55.025 -32.302 1.00 34.62  ? 853  ALA C C     1 
ATOM   7789  O  O     . ALA E  4  53  ? 62.485  55.495 -33.294 1.00 32.51  ? 853  ALA C O     1 
ATOM   7790  C  CB    . ALA E  4  53  ? 63.828  56.541 -30.494 1.00 30.80  ? 853  ALA C CB    1 
ATOM   7791  N  N     . VAL E  4  54  ? 63.980  54.084 -32.378 1.00 34.17  ? 854  VAL C N     1 
ATOM   7792  C  CA    . VAL E  4  54  ? 64.375  53.523 -33.656 1.00 34.09  ? 854  VAL C CA    1 
ATOM   7793  C  C     . VAL E  4  54  ? 63.244  52.717 -34.280 1.00 34.44  ? 854  VAL C C     1 
ATOM   7794  O  O     . VAL E  4  54  ? 62.985  52.843 -35.478 1.00 36.35  ? 854  VAL C O     1 
ATOM   7795  C  CB    . VAL E  4  54  ? 65.674  52.691 -33.521 1.00 35.60  ? 854  VAL C CB    1 
ATOM   7796  C  CG1   . VAL E  4  54  ? 65.954  51.910 -34.796 1.00 35.00  ? 854  VAL C CG1   1 
ATOM   7797  C  CG2   . VAL E  4  54  ? 66.841  53.623 -33.218 1.00 35.98  ? 854  VAL C CG2   1 
ATOM   7798  N  N     . LEU E  4  55  ? 62.548  51.932 -33.465 1.00 32.71  ? 855  LEU C N     1 
ATOM   7799  C  CA    . LEU E  4  55  ? 61.440  51.133 -33.961 1.00 32.93  ? 855  LEU C CA    1 
ATOM   7800  C  C     . LEU E  4  55  ? 60.352  52.070 -34.471 1.00 35.49  ? 855  LEU C C     1 
ATOM   7801  O  O     . LEU E  4  55  ? 59.727  51.815 -35.501 1.00 32.16  ? 855  LEU C O     1 
ATOM   7802  C  CB    . LEU E  4  55  ? 60.875  50.239 -32.853 1.00 32.10  ? 855  LEU C CB    1 
ATOM   7803  C  CG    . LEU E  4  55  ? 61.812  49.145 -32.322 1.00 33.37  ? 855  LEU C CG    1 
ATOM   7804  C  CD1   . LEU E  4  55  ? 61.142  48.440 -31.156 1.00 33.51  ? 855  LEU C CD1   1 
ATOM   7805  C  CD2   . LEU E  4  55  ? 62.152  48.147 -33.441 1.00 35.01  ? 855  LEU C CD2   1 
ATOM   7806  N  N     . GLU E  4  56  ? 60.091  53.130 -33.711 1.00 34.27  ? 856  GLU C N     1 
ATOM   7807  C  CA    . GLU E  4  56  ? 59.080  54.094 -34.108 1.00 35.79  ? 856  GLU C CA    1 
ATOM   7808  C  C     . GLU E  4  56  ? 59.468  54.770 -35.417 1.00 33.34  ? 856  GLU C C     1 
ATOM   7809  O  O     . GLU E  4  56  ? 58.635  54.951 -36.287 1.00 35.66  ? 856  GLU C O     1 
ATOM   7810  C  CB    . GLU E  4  56  ? 58.889  55.156 -33.020 1.00 37.49  ? 856  GLU C CB    1 
ATOM   7811  C  CG    . GLU E  4  56  ? 57.856  56.214 -33.388 1.00 40.04  ? 856  GLU C CG    1 
ATOM   7812  C  CD    . GLU E  4  56  ? 57.646  57.222 -32.271 1.00 46.12  ? 856  GLU C CD    1 
ATOM   7813  O  OE1   . GLU E  4  56  ? 57.472  56.788 -31.099 1.00 46.24  ? 856  GLU C OE1   1 
ATOM   7814  O  OE2   . GLU E  4  56  ? 57.679  58.440 -32.563 1.00 42.90  ? 856  GLU C OE2   1 
ATOM   7815  N  N     . TYR E  4  57  ? 60.740  55.124 -35.558 1.00 33.34  ? 857  TYR C N     1 
ATOM   7816  C  CA    . TYR E  4  57  ? 61.197  55.781 -36.767 1.00 34.61  ? 857  TYR C CA    1 
ATOM   7817  C  C     . TYR E  4  57  ? 61.092  54.877 -37.994 1.00 35.41  ? 857  TYR C C     1 
ATOM   7818  O  O     . TYR E  4  57  ? 60.682  55.332 -39.060 1.00 33.80  ? 857  TYR C O     1 
ATOM   7819  C  CB    . TYR E  4  57  ? 62.638  56.265 -36.619 1.00 36.54  ? 857  TYR C CB    1 
ATOM   7820  C  CG    . TYR E  4  57  ? 63.306  56.528 -37.949 1.00 40.75  ? 857  TYR C CG    1 
ATOM   7821  C  CD1   . TYR E  4  57  ? 63.004  57.675 -38.698 1.00 43.70  ? 857  TYR C CD1   1 
ATOM   7822  C  CD2   . TYR E  4  57  ? 64.217  55.618 -38.476 1.00 42.77  ? 857  TYR C CD2   1 
ATOM   7823  C  CE1   . TYR E  4  57  ? 63.597  57.897 -39.940 1.00 45.03  ? 857  TYR C CE1   1 
ATOM   7824  C  CE2   . TYR E  4  57  ? 64.816  55.826 -39.710 1.00 45.53  ? 857  TYR C CE2   1 
ATOM   7825  C  CZ    . TYR E  4  57  ? 64.502  56.968 -40.440 1.00 47.55  ? 857  TYR C CZ    1 
ATOM   7826  O  OH    . TYR E  4  57  ? 65.100  57.169 -41.661 1.00 48.56  ? 857  TYR C OH    1 
ATOM   7827  N  N     . LEU E  4  58  ? 61.483  53.613 -37.858 1.00 30.59  ? 858  LEU C N     1 
ATOM   7828  C  CA    . LEU E  4  58  ? 61.415  52.697 -38.992 1.00 32.06  ? 858  LEU C CA    1 
ATOM   7829  C  C     . LEU E  4  58  ? 59.986  52.460 -39.440 1.00 30.05  ? 858  LEU C C     1 
ATOM   7830  O  O     . LEU E  4  58  ? 59.703  52.335 -40.635 1.00 34.27  ? 858  LEU C O     1 
ATOM   7831  C  CB    . LEU E  4  58  ? 62.114  51.365 -38.689 1.00 29.94  ? 858  LEU C CB    1 
ATOM   7832  C  CG    . LEU E  4  58  ? 63.632  51.449 -38.512 1.00 33.02  ? 858  LEU C CG    1 
ATOM   7833  C  CD1   . LEU E  4  58  ? 64.182  50.127 -38.010 1.00 32.46  ? 858  LEU C CD1   1 
ATOM   7834  C  CD2   . LEU E  4  58  ? 64.296  51.854 -39.842 1.00 34.63  ? 858  LEU C CD2   1 
ATOM   7835  N  N     . THR E  4  59  ? 59.071  52.374 -38.461 1.00 29.86  ? 859  THR C N     1 
ATOM   7836  C  CA    . THR E  4  59  ? 57.644  52.193 -38.754 1.00 32.83  ? 859  THR C CA    1 
ATOM   7837  C  C     . THR E  4  59  ? 57.119  53.386 -39.564 1.00 33.85  ? 859  THR C C     1 
ATOM   7838  O  O     . THR E  4  59  ? 56.400  53.221 -40.553 1.00 35.24  ? 859  THR C O     1 
ATOM   7839  C  CB    . THR E  4  59  ? 56.865  52.112 -37.464 1.00 34.72  ? 859  THR C CB    1 
ATOM   7840  O  OG1   . THR E  4  59  ? 57.301  50.963 -36.740 1.00 39.16  ? 859  THR C OG1   1 
ATOM   7841  C  CG2   . THR E  4  59  ? 55.368  52.073 -37.716 1.00 34.70  ? 859  THR C CG2   1 
ATOM   7842  N  N     . ALA E  4  60  ? 57.489  54.590 -39.122 1.00 32.93  ? 860  ALA C N     1 
ATOM   7843  C  CA    . ALA E  4  60  ? 57.089  55.838 -39.780 1.00 34.15  ? 860  ALA C CA    1 
ATOM   7844  C  C     . ALA E  4  60  ? 57.568  55.818 -41.219 1.00 30.49  ? 860  ALA C C     1 
ATOM   7845  O  O     . ALA E  4  60  ? 56.800  56.051 -42.133 1.00 32.25  ? 860  ALA C O     1 
ATOM   7846  C  CB    . ALA E  4  60  ? 57.702  57.041 -39.041 1.00 29.51  ? 860  ALA C CB    1 
ATOM   7847  N  N     . GLU E  4  61  ? 58.819  55.425 -41.413 1.00 32.90  ? 861  GLU C N     1 
ATOM   7848  C  CA    . GLU E  4  61  ? 59.402  55.359 -42.745 1.00 34.36  ? 861  GLU C CA    1 
ATOM   7849  C  C     . GLU E  4  61  ? 58.632  54.402 -43.689 1.00 34.09  ? 861  GLU C C     1 
ATOM   7850  O  O     . GLU E  4  61  ? 58.271  54.764 -44.809 1.00 33.68  ? 861  GLU C O     1 
ATOM   7851  C  CB    . GLU E  4  61  ? 60.863  54.928 -42.623 1.00 38.31  ? 861  GLU C CB    1 
ATOM   7852  C  CG    . GLU E  4  61  ? 61.622  54.903 -43.924 1.00 47.05  ? 861  GLU C CG    1 
ATOM   7853  C  CD    . GLU E  4  61  ? 61.770  56.284 -44.550 1.00 54.15  ? 861  GLU C CD    1 
ATOM   7854  O  OE1   . GLU E  4  61  ? 61.642  57.299 -43.820 1.00 57.54  ? 861  GLU C OE1   1 
ATOM   7855  O  OE2   . GLU E  4  61  ? 62.022  56.348 -45.775 1.00 55.78  ? 861  GLU C OE2   1 
ATOM   7856  N  N     . ILE E  4  62  ? 58.337  53.196 -43.219 1.00 34.05  ? 862  ILE C N     1 
ATOM   7857  C  CA    . ILE E  4  62  ? 57.634  52.239 -44.075 1.00 32.18  ? 862  ILE C CA    1 
ATOM   7858  C  C     . ILE E  4  62  ? 56.170  52.637 -44.266 1.00 30.85  ? 862  ILE C C     1 
ATOM   7859  O  O     . ILE E  4  62  ? 55.626  52.477 -45.355 1.00 32.28  ? 862  ILE C O     1 
ATOM   7860  C  CB    . ILE E  4  62  ? 57.753  50.786 -43.530 1.00 33.59  ? 862  ILE C CB    1 
ATOM   7861  C  CG1   . ILE E  4  62  ? 57.196  49.777 -44.543 1.00 36.35  ? 862  ILE C CG1   1 
ATOM   7862  C  CG2   . ILE E  4  62  ? 56.986  50.635 -42.242 1.00 31.57  ? 862  ILE C CG2   1 
ATOM   7863  C  CD1   . ILE E  4  62  ? 57.398  48.315 -44.098 1.00 38.09  ? 862  ILE C CD1   1 
ATOM   7864  N  N     . LEU E  4  63  ? 55.538  53.189 -43.232 1.00 30.23  ? 863  LEU C N     1 
ATOM   7865  C  CA    . LEU E  4  63  ? 54.142  53.612 -43.375 1.00 30.55  ? 863  LEU C CA    1 
ATOM   7866  C  C     . LEU E  4  63  ? 54.025  54.810 -44.329 1.00 31.15  ? 863  LEU C C     1 
ATOM   7867  O  O     . LEU E  4  63  ? 53.052  54.932 -45.080 1.00 32.11  ? 863  LEU C O     1 
ATOM   7868  C  CB    . LEU E  4  63  ? 53.523  53.947 -42.016 1.00 30.87  ? 863  LEU C CB    1 
ATOM   7869  C  CG    . LEU E  4  63  ? 53.233  52.744 -41.118 1.00 31.73  ? 863  LEU C CG    1 
ATOM   7870  C  CD1   . LEU E  4  63  ? 52.645  53.216 -39.786 1.00 33.20  ? 863  LEU C CD1   1 
ATOM   7871  C  CD2   . LEU E  4  63  ? 52.264  51.817 -41.824 1.00 33.64  ? 863  LEU C CD2   1 
ATOM   7872  N  N     . GLU E  4  64  ? 55.021  55.683 -44.309 1.00 29.20  ? 864  GLU C N     1 
ATOM   7873  C  CA    . GLU E  4  64  ? 55.004  56.839 -45.202 1.00 31.96  ? 864  GLU C CA    1 
ATOM   7874  C  C     . GLU E  4  64  ? 54.991  56.317 -46.634 1.00 31.42  ? 864  GLU C C     1 
ATOM   7875  O  O     . GLU E  4  64  ? 54.153  56.707 -47.438 1.00 30.11  ? 864  GLU C O     1 
ATOM   7876  C  CB    . GLU E  4  64  ? 56.256  57.699 -45.007 1.00 29.33  ? 864  GLU C CB    1 
ATOM   7877  C  CG    . GLU E  4  64  ? 56.415  58.798 -46.051 1.00 40.34  ? 864  GLU C CG    1 
ATOM   7878  C  CD    . GLU E  4  64  ? 55.440  59.974 -45.862 1.00 43.29  ? 864  GLU C CD    1 
ATOM   7879  O  OE1   . GLU E  4  64  ? 55.194  60.706 -46.840 1.00 48.79  ? 864  GLU C OE1   1 
ATOM   7880  O  OE2   . GLU E  4  64  ? 54.921  60.173 -44.742 1.00 45.77  ? 864  GLU C OE2   1 
ATOM   7881  N  N     . LEU E  4  65  ? 55.948  55.447 -46.947 1.00 32.20  ? 865  LEU C N     1 
ATOM   7882  C  CA    . LEU E  4  65  ? 56.058  54.874 -48.289 1.00 32.56  ? 865  LEU C CA    1 
ATOM   7883  C  C     . LEU E  4  65  ? 54.863  53.994 -48.687 1.00 30.87  ? 865  LEU C C     1 
ATOM   7884  O  O     . LEU E  4  65  ? 54.427  54.028 -49.837 1.00 30.92  ? 865  LEU C O     1 
ATOM   7885  C  CB    . LEU E  4  65  ? 57.371  54.087 -48.424 1.00 33.14  ? 865  LEU C CB    1 
ATOM   7886  C  CG    . LEU E  4  65  ? 58.629  54.939 -48.179 1.00 35.26  ? 865  LEU C CG    1 
ATOM   7887  C  CD1   . LEU E  4  65  ? 59.885  54.086 -48.153 1.00 33.98  ? 865  LEU C CD1   1 
ATOM   7888  C  CD2   . LEU E  4  65  ? 58.732  56.009 -49.235 1.00 37.76  ? 865  LEU C CD2   1 
ATOM   7889  N  N     . ALA E  4  66  ? 54.327  53.223 -47.742 1.00 31.72  ? 866  ALA C N     1 
ATOM   7890  C  CA    . ALA E  4  66  ? 53.182  52.357 -48.048 1.00 34.23  ? 866  ALA C CA    1 
ATOM   7891  C  C     . ALA E  4  66  ? 51.939  53.206 -48.305 1.00 34.14  ? 866  ALA C C     1 
ATOM   7892  O  O     . ALA E  4  66  ? 51.165  52.919 -49.210 1.00 31.39  ? 866  ALA C O     1 
ATOM   7893  C  CB    . ALA E  4  66  ? 52.925  51.366 -46.922 1.00 33.14  ? 866  ALA C CB    1 
ATOM   7894  N  N     . GLY E  4  67  ? 51.734  54.237 -47.486 1.00 33.72  ? 867  GLY C N     1 
ATOM   7895  C  CA    . GLY E  4  67  ? 50.586  55.098 -47.715 1.00 31.33  ? 867  GLY C CA    1 
ATOM   7896  C  C     . GLY E  4  67  ? 50.693  55.723 -49.101 1.00 31.60  ? 867  GLY C C     1 
ATOM   7897  O  O     . GLY E  4  67  ? 49.698  55.862 -49.801 1.00 34.95  ? 867  GLY C O     1 
ATOM   7898  N  N     . ASN E  4  68  ? 51.899  56.104 -49.509 1.00 31.38  ? 868  ASN C N     1 
ATOM   7899  C  CA    . ASN E  4  68  ? 52.063  56.697 -50.839 1.00 34.63  ? 868  ASN C CA    1 
ATOM   7900  C  C     . ASN E  4  68  ? 51.718  55.676 -51.931 1.00 36.26  ? 868  ASN C C     1 
ATOM   7901  O  O     . ASN E  4  68  ? 51.130  56.025 -52.959 1.00 37.17  ? 868  ASN C O     1 
ATOM   7902  C  CB    . ASN E  4  68  ? 53.494  57.202 -51.063 1.00 34.31  ? 868  ASN C CB    1 
ATOM   7903  C  CG    . ASN E  4  68  ? 53.831  58.444 -50.241 1.00 37.88  ? 868  ASN C CG    1 
ATOM   7904  O  OD1   . ASN E  4  68  ? 52.975  59.047 -49.600 1.00 39.45  ? 868  ASN C OD1   1 
ATOM   7905  N  ND2   . ASN E  4  68  ? 55.103  58.798 -50.233 1.00 35.73  ? 868  ASN C ND2   1 
ATOM   7906  N  N     . ALA E  4  69  ? 52.105  54.417 -51.722 1.00 35.94  ? 869  ALA C N     1 
ATOM   7907  C  CA    . ALA E  4  69  ? 51.805  53.381 -52.710 1.00 34.04  ? 869  ALA C CA    1 
ATOM   7908  C  C     . ALA E  4  69  ? 50.294  53.205 -52.760 1.00 34.84  ? 869  ALA C C     1 
ATOM   7909  O  O     . ALA E  4  69  ? 49.711  53.037 -53.835 1.00 34.84  ? 869  ALA C O     1 
ATOM   7910  C  CB    . ALA E  4  69  ? 52.492  52.060 -52.339 1.00 33.96  ? 869  ALA C CB    1 
ATOM   7911  N  N     . ALA E  4  70  ? 49.653  53.228 -51.598 1.00 35.02  ? 870  ALA C N     1 
ATOM   7912  C  CA    . ALA E  4  70  ? 48.198  53.085 -51.557 1.00 37.58  ? 870  ALA C CA    1 
ATOM   7913  C  C     . ALA E  4  70  ? 47.555  54.224 -52.366 1.00 39.94  ? 870  ALA C C     1 
ATOM   7914  O  O     . ALA E  4  70  ? 46.727  53.989 -53.251 1.00 38.30  ? 870  ALA C O     1 
ATOM   7915  C  CB    . ALA E  4  70  ? 47.699  53.102 -50.107 1.00 37.08  ? 870  ALA C CB    1 
ATOM   7916  N  N     . ARG E  4  71  ? 47.958  55.458 -52.084 1.00 42.39  ? 871  ARG C N     1 
ATOM   7917  C  CA    . ARG E  4  71  ? 47.415  56.600 -52.819 1.00 46.00  ? 871  ARG C CA    1 
ATOM   7918  C  C     . ARG E  4  71  ? 47.629  56.417 -54.324 1.00 46.52  ? 871  ARG C C     1 
ATOM   7919  O  O     . ARG E  4  71  ? 46.722  56.653 -55.119 1.00 44.11  ? 871  ARG C O     1 
ATOM   7920  C  CB    . ARG E  4  71  ? 48.060  57.910 -52.352 1.00 49.70  ? 871  ARG C CB    1 
ATOM   7921  C  CG    . ARG E  4  71  ? 47.487  59.158 -53.031 1.00 55.43  ? 871  ARG C CG    1 
ATOM   7922  C  CD    . ARG E  4  71  ? 48.053  60.445 -52.426 1.00 60.28  ? 871  ARG C CD    1 
ATOM   7923  N  NE    . ARG E  4  71  ? 47.377  60.800 -51.176 1.00 65.49  ? 871  ARG C NE    1 
ATOM   7924  C  CZ    . ARG E  4  71  ? 47.477  61.985 -50.571 1.00 68.77  ? 871  ARG C CZ    1 
ATOM   7925  N  NH1   . ARG E  4  71  ? 48.226  62.950 -51.098 1.00 67.33  ? 871  ARG C NH1   1 
ATOM   7926  N  NH2   . ARG E  4  71  ? 46.837  62.202 -49.425 1.00 69.72  ? 871  ARG C NH2   1 
ATOM   7927  N  N     . ASP E  4  72  ? 48.826  55.984 -54.706 1.00 48.62  ? 872  ASP C N     1 
ATOM   7928  C  CA    . ASP E  4  72  ? 49.142  55.762 -56.117 1.00 50.97  ? 872  ASP C CA    1 
ATOM   7929  C  C     . ASP E  4  72  ? 48.132  54.815 -56.777 1.00 52.41  ? 872  ASP C C     1 
ATOM   7930  O  O     . ASP E  4  72  ? 47.823  54.961 -57.955 1.00 53.70  ? 872  ASP C O     1 
ATOM   7931  C  CB    . ASP E  4  72  ? 50.537  55.143 -56.277 1.00 51.89  ? 872  ASP C CB    1 
ATOM   7932  C  CG    . ASP E  4  72  ? 51.667  56.105 -55.932 1.00 55.46  ? 872  ASP C CG    1 
ATOM   7933  O  OD1   . ASP E  4  72  ? 51.439  57.337 -55.867 1.00 53.69  ? 872  ASP C OD1   1 
ATOM   7934  O  OD2   . ASP E  4  72  ? 52.805  55.611 -55.745 1.00 54.32  ? 872  ASP C OD2   1 
ATOM   7935  N  N     . ASN E  4  73  ? 47.672  53.812 -56.035 1.00 52.60  ? 873  ASN C N     1 
ATOM   7936  C  CA    . ASN E  4  73  ? 46.724  52.839 -56.569 1.00 55.10  ? 873  ASN C CA    1 
ATOM   7937  C  C     . ASN E  4  73  ? 45.287  53.219 -56.263 1.00 55.46  ? 873  ASN C C     1 
ATOM   7938  O  O     . ASN E  4  73  ? 44.385  52.377 -56.303 1.00 53.77  ? 873  ASN C O     1 
ATOM   7939  C  CB    . ASN E  4  73  ? 47.032  51.438 -56.033 1.00 57.46  ? 873  ASN C CB    1 
ATOM   7940  C  CG    . ASN E  4  73  ? 48.420  50.956 -56.429 1.00 62.19  ? 873  ASN C CG    1 
ATOM   7941  O  OD1   . ASN E  4  73  ? 48.655  50.581 -57.581 1.00 65.00  ? 873  ASN C OD1   1 
ATOM   7942  N  ND2   . ASN E  4  73  ? 49.357  50.988 -55.480 1.00 62.15  ? 873  ASN C ND2   1 
ATOM   7943  N  N     . LYS E  4  74  ? 45.093  54.497 -55.946 1.00 55.14  ? 874  LYS C N     1 
ATOM   7944  C  CA    . LYS E  4  74  ? 43.777  55.038 -55.637 1.00 55.20  ? 874  LYS C CA    1 
ATOM   7945  C  C     . LYS E  4  74  ? 43.051  54.343 -54.489 1.00 53.36  ? 874  LYS C C     1 
ATOM   7946  O  O     . LYS E  4  74  ? 41.820  54.278 -54.478 1.00 53.54  ? 874  LYS C O     1 
ATOM   7947  C  CB    . LYS E  4  74  ? 42.909  55.029 -56.893 1.00 59.40  ? 874  LYS C CB    1 
ATOM   7948  C  CG    . LYS E  4  74  ? 43.530  55.792 -58.059 1.00 62.69  ? 874  LYS C CG    1 
ATOM   7949  C  CD    . LYS E  4  74  ? 42.642  55.741 -59.292 1.00 67.44  ? 874  LYS C CD    1 
ATOM   7950  C  CE    . LYS E  4  74  ? 43.287  56.465 -60.469 1.00 69.75  ? 874  LYS C CE    1 
ATOM   7951  N  NZ    . LYS E  4  74  ? 42.410  56.441 -61.682 1.00 72.75  ? 874  LYS C NZ    1 
ATOM   7952  N  N     . LYS E  4  75  ? 43.810  53.853 -53.513 1.00 50.65  ? 875  LYS C N     1 
ATOM   7953  C  CA    . LYS E  4  75  ? 43.225  53.180 -52.359 1.00 47.55  ? 875  LYS C CA    1 
ATOM   7954  C  C     . LYS E  4  75  ? 43.409  54.025 -51.103 1.00 46.51  ? 875  LYS C C     1 
ATOM   7955  O  O     . LYS E  4  75  ? 44.377  54.772 -50.977 1.00 44.79  ? 875  LYS C O     1 
ATOM   7956  C  CB    . LYS E  4  75  ? 43.874  51.812 -52.146 1.00 48.40  ? 875  LYS C CB    1 
ATOM   7957  C  CG    . LYS E  4  75  ? 43.760  50.870 -53.332 1.00 50.92  ? 875  LYS C CG    1 
ATOM   7958  C  CD    . LYS E  4  75  ? 42.311  50.536 -53.638 1.00 54.19  ? 875  LYS C CD    1 
ATOM   7959  C  CE    . LYS E  4  75  ? 42.198  49.430 -54.700 1.00 56.95  ? 875  LYS C CE    1 
ATOM   7960  N  NZ    . LYS E  4  75  ? 43.031  49.700 -55.908 1.00 59.48  ? 875  LYS C NZ    1 
ATOM   7961  N  N     . THR E  4  76  ? 42.493  53.862 -50.159 1.00 45.06  ? 876  THR C N     1 
ATOM   7962  C  CA    . THR E  4  76  ? 42.539  54.586 -48.901 1.00 47.73  ? 876  THR C CA    1 
ATOM   7963  C  C     . THR E  4  76  ? 43.083  53.706 -47.781 1.00 45.52  ? 876  THR C C     1 
ATOM   7964  O  O     . THR E  4  76  ? 43.582  54.203 -46.772 1.00 44.68  ? 876  THR C O     1 
ATOM   7965  C  CB    . THR E  4  76  ? 41.133  55.119 -48.542 1.00 50.34  ? 876  THR C CB    1 
ATOM   7966  O  OG1   . THR E  4  76  ? 41.102  56.536 -48.753 1.00 54.85  ? 876  THR C OG1   1 
ATOM   7967  C  CG2   . THR E  4  76  ? 40.757  54.792 -47.102 1.00 53.88  ? 876  THR C CG2   1 
ATOM   7968  N  N     . ARG E  4  77  ? 43.000  52.393 -47.974 1.00 41.28  ? 877  ARG C N     1 
ATOM   7969  C  CA    . ARG E  4  77  ? 43.481  51.452 -46.975 1.00 38.74  ? 877  ARG C CA    1 
ATOM   7970  C  C     . ARG E  4  77  ? 44.770  50.739 -47.418 1.00 36.21  ? 877  ARG C C     1 
ATOM   7971  O  O     . ARG E  4  77  ? 44.843  50.175 -48.499 1.00 35.70  ? 877  ARG C O     1 
ATOM   7972  C  CB    . ARG E  4  77  ? 42.386  50.421 -46.684 1.00 40.21  ? 877  ARG C CB    1 
ATOM   7973  C  CG    . ARG E  4  77  ? 42.696  49.468 -45.548 1.00 46.08  ? 877  ARG C CG    1 
ATOM   7974  C  CD    . ARG E  4  77  ? 41.586  48.421 -45.379 1.00 47.12  ? 877  ARG C CD    1 
ATOM   7975  N  NE    . ARG E  4  77  ? 40.346  49.028 -44.900 1.00 49.70  ? 877  ARG C NE    1 
ATOM   7976  C  CZ    . ARG E  4  77  ? 39.153  48.859 -45.468 1.00 51.14  ? 877  ARG C CZ    1 
ATOM   7977  N  NH1   . ARG E  4  77  ? 39.031  48.092 -46.545 1.00 52.25  ? 877  ARG C NH1   1 
ATOM   7978  N  NH2   . ARG E  4  77  ? 38.084  49.471 -44.967 1.00 49.17  ? 877  ARG C NH2   1 
ATOM   7979  N  N     . ILE E  4  78  ? 45.786  50.768 -46.572 1.00 34.74  ? 878  ILE C N     1 
ATOM   7980  C  CA    . ILE E  4  78  ? 47.048  50.095 -46.865 1.00 32.57  ? 878  ILE C CA    1 
ATOM   7981  C  C     . ILE E  4  78  ? 46.874  48.561 -46.730 1.00 32.03  ? 878  ILE C C     1 
ATOM   7982  O  O     . ILE E  4  78  ? 46.346  48.072 -45.719 1.00 30.09  ? 878  ILE C O     1 
ATOM   7983  C  CB    . ILE E  4  78  ? 48.136  50.549 -45.874 1.00 30.93  ? 878  ILE C CB    1 
ATOM   7984  C  CG1   . ILE E  4  78  ? 48.631  51.960 -46.224 1.00 30.95  ? 878  ILE C CG1   1 
ATOM   7985  C  CG2   . ILE E  4  78  ? 49.294  49.545 -45.848 1.00 32.69  ? 878  ILE C CG2   1 
ATOM   7986  C  CD1   . ILE E  4  78  ? 49.434  52.620 -45.085 1.00 28.25  ? 878  ILE C CD1   1 
ATOM   7987  N  N     . ILE E  4  79  ? 47.253  47.821 -47.764 1.00 31.27  ? 879  ILE C N     1 
ATOM   7988  C  CA    . ILE E  4  79  ? 47.177  46.353 -47.706 1.00 30.91  ? 879  ILE C CA    1 
ATOM   7989  C  C     . ILE E  4  79  ? 48.598  45.806 -47.881 1.00 31.29  ? 879  ILE C C     1 
ATOM   7990  O  O     . ILE E  4  79  ? 49.507  46.576 -48.212 1.00 29.05  ? 879  ILE C O     1 
ATOM   7991  C  CB    . ILE E  4  79  ? 46.218  45.761 -48.789 1.00 31.69  ? 879  ILE C CB    1 
ATOM   7992  C  CG1   . ILE E  4  79  ? 46.713  46.075 -50.199 1.00 31.09  ? 879  ILE C CG1   1 
ATOM   7993  C  CG2   . ILE E  4  79  ? 44.802  46.297 -48.578 1.00 34.33  ? 879  ILE C CG2   1 
ATOM   7994  C  CD1   . ILE E  4  79  ? 45.913  45.369 -51.300 1.00 32.37  ? 879  ILE C CD1   1 
ATOM   7995  N  N     . PRO E  4  80  ? 48.803  44.468 -47.726 1.00 30.93  ? 880  PRO C N     1 
ATOM   7996  C  CA    . PRO E  4  80  ? 50.155  43.905 -47.880 1.00 27.67  ? 880  PRO C CA    1 
ATOM   7997  C  C     . PRO E  4  80  ? 50.858  44.316 -49.177 1.00 26.60  ? 880  PRO C C     1 
ATOM   7998  O  O     . PRO E  4  80  ? 52.044  44.616 -49.173 1.00 27.64  ? 880  PRO C O     1 
ATOM   7999  C  CB    . PRO E  4  80  ? 49.904  42.388 -47.820 1.00 29.33  ? 880  PRO C CB    1 
ATOM   8000  C  CG    . PRO E  4  80  ? 48.768  42.290 -46.824 1.00 31.94  ? 880  PRO C CG    1 
ATOM   8001  C  CD    . PRO E  4  80  ? 47.836  43.415 -47.332 1.00 28.52  ? 880  PRO C CD    1 
ATOM   8002  N  N     . ARG E  4  81  ? 50.124  44.317 -50.283 1.00 26.15  ? 881  ARG C N     1 
ATOM   8003  C  CA    . ARG E  4  81  ? 50.682  44.712 -51.577 1.00 28.88  ? 881  ARG C CA    1 
ATOM   8004  C  C     . ARG E  4  81  ? 51.349  46.106 -51.476 1.00 28.70  ? 881  ARG C C     1 
ATOM   8005  O  O     . ARG E  4  81  ? 52.397  46.364 -52.063 1.00 29.15  ? 881  ARG C O     1 
ATOM   8006  C  CB    . ARG E  4  81  ? 49.553  44.762 -52.616 1.00 29.02  ? 881  ARG C CB    1 
ATOM   8007  C  CG    . ARG E  4  81  ? 49.968  45.337 -53.961 1.00 32.80  ? 881  ARG C CG    1 
ATOM   8008  C  CD    . ARG E  4  81  ? 51.072  44.499 -54.591 1.00 35.11  ? 881  ARG C CD    1 
ATOM   8009  N  NE    . ARG E  4  81  ? 51.276  44.771 -56.008 1.00 33.31  ? 881  ARG C NE    1 
ATOM   8010  C  CZ    . ARG E  4  81  ? 52.184  44.142 -56.751 1.00 37.26  ? 881  ARG C CZ    1 
ATOM   8011  N  NH1   . ARG E  4  81  ? 52.966  43.217 -56.201 1.00 36.32  ? 881  ARG C NH1   1 
ATOM   8012  N  NH2   . ARG E  4  81  ? 52.309  44.417 -58.042 1.00 33.75  ? 881  ARG C NH2   1 
ATOM   8013  N  N     . HIS E  4  82  ? 50.722  47.010 -50.747 1.00 29.48  ? 882  HIS C N     1 
ATOM   8014  C  CA    . HIS E  4  82  ? 51.295  48.351 -50.633 1.00 28.99  ? 882  HIS C CA    1 
ATOM   8015  C  C     . HIS E  4  82  ? 52.578  48.319 -49.810 1.00 30.06  ? 882  HIS C C     1 
ATOM   8016  O  O     . HIS E  4  82  ? 53.523  49.073 -50.091 1.00 30.47  ? 882  HIS C O     1 
ATOM   8017  C  CB    . HIS E  4  82  ? 50.289  49.320 -50.022 1.00 26.25  ? 882  HIS C CB    1 
ATOM   8018  C  CG    . HIS E  4  82  ? 49.028  49.457 -50.820 1.00 25.54  ? 882  HIS C CG    1 
ATOM   8019  N  ND1   . HIS E  4  82  ? 47.776  49.480 -50.238 1.00 29.40  ? 882  HIS C ND1   1 
ATOM   8020  C  CD2   . HIS E  4  82  ? 48.822  49.530 -52.157 1.00 27.54  ? 882  HIS C CD2   1 
ATOM   8021  C  CE1   . HIS E  4  82  ? 46.853  49.553 -51.183 1.00 28.95  ? 882  HIS C CE1   1 
ATOM   8022  N  NE2   . HIS E  4  82  ? 47.463  49.584 -52.358 1.00 31.66  ? 882  HIS C NE2   1 
ATOM   8023  N  N     . LEU E  4  83  ? 52.594  47.490 -48.766 1.00 25.93  ? 883  LEU C N     1 
ATOM   8024  C  CA    . LEU E  4  83  ? 53.800  47.372 -47.960 1.00 27.18  ? 883  LEU C CA    1 
ATOM   8025  C  C     . LEU E  4  83  ? 54.910  46.790 -48.833 1.00 26.11  ? 883  LEU C C     1 
ATOM   8026  O  O     . LEU E  4  83  ? 56.053  47.248 -48.779 1.00 28.74  ? 883  LEU C O     1 
ATOM   8027  C  CB    . LEU E  4  83  ? 53.566  46.492 -46.724 1.00 26.89  ? 883  LEU C CB    1 
ATOM   8028  C  CG    . LEU E  4  83  ? 52.609  47.105 -45.690 1.00 32.19  ? 883  LEU C CG    1 
ATOM   8029  C  CD1   . LEU E  4  83  ? 52.185  46.087 -44.618 1.00 25.44  ? 883  LEU C CD1   1 
ATOM   8030  C  CD2   . LEU E  4  83  ? 53.258  48.342 -45.061 1.00 28.42  ? 883  LEU C CD2   1 
ATOM   8031  N  N     . GLN E  4  84  ? 54.581  45.803 -49.665 1.00 27.59  ? 884  GLN C N     1 
ATOM   8032  C  CA    . GLN E  4  84  ? 55.609  45.201 -50.528 1.00 27.86  ? 884  GLN C CA    1 
ATOM   8033  C  C     . GLN E  4  84  ? 56.099  46.198 -51.579 1.00 29.54  ? 884  GLN C C     1 
ATOM   8034  O  O     . GLN E  4  84  ? 57.293  46.313 -51.824 1.00 28.39  ? 884  GLN C O     1 
ATOM   8035  C  CB    . GLN E  4  84  ? 55.074  43.935 -51.221 1.00 30.33  ? 884  GLN C CB    1 
ATOM   8036  C  CG    . GLN E  4  84  ? 55.952  43.434 -52.371 1.00 28.93  ? 884  GLN C CG    1 
ATOM   8037  C  CD    . GLN E  4  84  ? 57.122  42.562 -51.906 1.00 34.56  ? 884  GLN C CD    1 
ATOM   8038  O  OE1   . GLN E  4  84  ? 57.612  42.696 -50.777 1.00 26.94  ? 884  GLN C OE1   1 
ATOM   8039  N  NE2   . GLN E  4  84  ? 57.590  41.669 -52.799 1.00 30.26  ? 884  GLN C NE2   1 
ATOM   8040  N  N     . LEU E  4  85  ? 55.175  46.915 -52.216 1.00 30.27  ? 885  LEU C N     1 
ATOM   8041  C  CA    . LEU E  4  85  ? 55.570  47.905 -53.218 1.00 30.79  ? 885  LEU C CA    1 
ATOM   8042  C  C     . LEU E  4  85  ? 56.514  48.943 -52.603 1.00 30.92  ? 885  LEU C C     1 
ATOM   8043  O  O     . LEU E  4  85  ? 57.533  49.287 -53.185 1.00 32.46  ? 885  LEU C O     1 
ATOM   8044  C  CB    . LEU E  4  85  ? 54.331  48.606 -53.784 1.00 34.02  ? 885  LEU C CB    1 
ATOM   8045  C  CG    . LEU E  4  85  ? 53.451  47.801 -54.740 1.00 35.70  ? 885  LEU C CG    1 
ATOM   8046  C  CD1   . LEU E  4  85  ? 52.219  48.629 -55.150 1.00 34.86  ? 885  LEU C CD1   1 
ATOM   8047  C  CD2   . LEU E  4  85  ? 54.267  47.412 -55.966 1.00 33.37  ? 885  LEU C CD2   1 
ATOM   8048  N  N     . ALA E  4  86  ? 56.198  49.396 -51.395 1.00 32.78  ? 886  ALA C N     1 
ATOM   8049  C  CA    . ALA E  4  86  ? 57.030  50.389 -50.703 1.00 31.69  ? 886  ALA C CA    1 
ATOM   8050  C  C     . ALA E  4  86  ? 58.428  49.856 -50.386 1.00 31.92  ? 886  ALA C C     1 
ATOM   8051  O  O     . ALA E  4  86  ? 59.434  50.495 -50.668 1.00 27.45  ? 886  ALA C O     1 
ATOM   8052  C  CB    . ALA E  4  86  ? 56.342  50.836 -49.420 1.00 31.92  ? 886  ALA C CB    1 
ATOM   8053  N  N     . VAL E  4  87  ? 58.494  48.665 -49.803 1.00 31.68  ? 887  VAL C N     1 
ATOM   8054  C  CA    . VAL E  4  87  ? 59.783  48.083 -49.460 1.00 27.94  ? 887  VAL C CA    1 
ATOM   8055  C  C     . VAL E  4  87  ? 60.665  47.790 -50.665 1.00 28.61  ? 887  VAL C C     1 
ATOM   8056  O  O     . VAL E  4  87  ? 61.824  48.205 -50.706 1.00 28.95  ? 887  VAL C O     1 
ATOM   8057  C  CB    . VAL E  4  87  ? 59.592  46.783 -48.649 1.00 30.39  ? 887  VAL C CB    1 
ATOM   8058  C  CG1   . VAL E  4  87  ? 60.897  46.006 -48.576 1.00 26.12  ? 887  VAL C CG1   1 
ATOM   8059  C  CG2   . VAL E  4  87  ? 59.085  47.121 -47.252 1.00 28.65  ? 887  VAL C CG2   1 
ATOM   8060  N  N     . ARG E  4  88  ? 60.106  47.138 -51.682 1.00 27.98  ? 888  ARG C N     1 
ATOM   8061  C  CA    . ARG E  4  88  ? 60.915  46.771 -52.835 1.00 28.71  ? 888  ARG C CA    1 
ATOM   8062  C  C     . ARG E  4  88  ? 61.333  47.926 -53.736 1.00 29.44  ? 888  ARG C C     1 
ATOM   8063  O  O     . ARG E  4  88  ? 62.325  47.824 -54.436 1.00 30.05  ? 888  ARG C O     1 
ATOM   8064  C  CB    . ARG E  4  88  ? 60.251  45.647 -53.648 1.00 25.12  ? 888  ARG C CB    1 
ATOM   8065  C  CG    . ARG E  4  88  ? 59.874  44.409 -52.809 1.00 25.29  ? 888  ARG C CG    1 
ATOM   8066  C  CD    . ARG E  4  88  ? 61.088  43.801 -52.056 1.00 27.57  ? 888  ARG C CD    1 
ATOM   8067  N  NE    . ARG E  4  88  ? 60.669  42.880 -50.992 1.00 29.50  ? 888  ARG C NE    1 
ATOM   8068  C  CZ    . ARG E  4  88  ? 61.447  42.481 -49.985 1.00 29.13  ? 888  ARG C CZ    1 
ATOM   8069  N  NH1   . ARG E  4  88  ? 62.705  42.900 -49.877 1.00 26.00  ? 888  ARG C NH1   1 
ATOM   8070  N  NH2   . ARG E  4  88  ? 60.942  41.696 -49.051 1.00 30.02  ? 888  ARG C NH2   1 
ATOM   8071  N  N     . ASN E  4  89  ? 60.574  49.012 -53.746 1.00 31.16  ? 889  ASN C N     1 
ATOM   8072  C  CA    . ASN E  4  89  ? 60.951  50.160 -54.578 1.00 34.60  ? 889  ASN C CA    1 
ATOM   8073  C  C     . ASN E  4  89  ? 61.920  51.083 -53.838 1.00 36.96  ? 889  ASN C C     1 
ATOM   8074  O  O     . ASN E  4  89  ? 62.374  52.087 -54.385 1.00 39.10  ? 889  ASN C O     1 
ATOM   8075  C  CB    . ASN E  4  89  ? 59.710  50.956 -54.982 1.00 32.78  ? 889  ASN C CB    1 
ATOM   8076  C  CG    . ASN E  4  89  ? 58.996  50.348 -56.167 1.00 34.58  ? 889  ASN C CG    1 
ATOM   8077  O  OD1   . ASN E  4  89  ? 59.615  50.052 -57.192 1.00 36.82  ? 889  ASN C OD1   1 
ATOM   8078  N  ND2   . ASN E  4  89  ? 57.691  50.159 -56.039 1.00 32.90  ? 889  ASN C ND2   1 
ATOM   8079  N  N     . ASP E  4  90  ? 62.215  50.749 -52.585 1.00 37.75  ? 890  ASP C N     1 
ATOM   8080  C  CA    . ASP E  4  90  ? 63.104  51.568 -51.759 1.00 37.49  ? 890  ASP C CA    1 
ATOM   8081  C  C     . ASP E  4  90  ? 64.395  50.801 -51.489 1.00 38.36  ? 890  ASP C C     1 
ATOM   8082  O  O     . ASP E  4  90  ? 64.395  49.806 -50.754 1.00 36.05  ? 890  ASP C O     1 
ATOM   8083  C  CB    . ASP E  4  90  ? 62.400  51.901 -50.442 1.00 39.32  ? 890  ASP C CB    1 
ATOM   8084  C  CG    . ASP E  4  90  ? 63.150  52.937 -49.620 1.00 45.05  ? 890  ASP C CG    1 
ATOM   8085  O  OD1   . ASP E  4  90  ? 63.323  54.082 -50.092 1.00 48.78  ? 890  ASP C OD1   1 
ATOM   8086  O  OD2   . ASP E  4  90  ? 63.558  52.607 -48.497 1.00 45.68  ? 890  ASP C OD2   1 
ATOM   8087  N  N     . GLU E  4  91  ? 65.502  51.297 -52.035 1.00 36.60  ? 891  GLU C N     1 
ATOM   8088  C  CA    . GLU E  4  91  ? 66.786  50.622 -51.893 1.00 39.84  ? 891  GLU C CA    1 
ATOM   8089  C  C     . GLU E  4  91  ? 67.177  50.138 -50.503 1.00 38.63  ? 891  GLU C C     1 
ATOM   8090  O  O     . GLU E  4  91  ? 67.559  48.978 -50.336 1.00 36.12  ? 891  GLU C O     1 
ATOM   8091  C  CB    . GLU E  4  91  ? 67.919  51.479 -52.455 1.00 45.00  ? 891  GLU C CB    1 
ATOM   8092  C  CG    . GLU E  4  91  ? 67.969  51.519 -53.964 1.00 55.62  ? 891  GLU C CG    1 
ATOM   8093  C  CD    . GLU E  4  91  ? 69.294  52.060 -54.483 1.00 61.53  ? 891  GLU C CD    1 
ATOM   8094  O  OE1   . GLU E  4  91  ? 70.166  52.421 -53.652 1.00 63.42  ? 891  GLU C OE1   1 
ATOM   8095  O  OE2   . GLU E  4  91  ? 69.466  52.113 -55.724 1.00 64.52  ? 891  GLU C OE2   1 
ATOM   8096  N  N     . GLU E  4  92  ? 67.127  51.024 -49.512 1.00 35.95  ? 892  GLU C N     1 
ATOM   8097  C  CA    . GLU E  4  92  ? 67.529  50.628 -48.159 1.00 37.55  ? 892  GLU C CA    1 
ATOM   8098  C  C     . GLU E  4  92  ? 66.577  49.678 -47.442 1.00 33.87  ? 892  GLU C C     1 
ATOM   8099  O  O     . GLU E  4  92  ? 67.030  48.762 -46.757 1.00 34.75  ? 892  GLU C O     1 
ATOM   8100  C  CB    . GLU E  4  92  ? 67.885  51.851 -47.302 1.00 39.94  ? 892  GLU C CB    1 
ATOM   8101  C  CG    . GLU E  4  92  ? 69.018  52.671 -47.932 1.00 47.68  ? 892  GLU C CG    1 
ATOM   8102  C  CD    . GLU E  4  92  ? 69.492  53.830 -47.075 1.00 53.22  ? 892  GLU C CD    1 
ATOM   8103  O  OE1   . GLU E  4  92  ? 68.659  54.484 -46.412 1.00 54.41  ? 892  GLU C OE1   1 
ATOM   8104  O  OE2   . GLU E  4  92  ? 70.711  54.099 -47.078 1.00 57.97  ? 892  GLU C OE2   1 
ATOM   8105  N  N     . LEU E  4  93  ? 65.274  49.906 -47.568 1.00 30.98  ? 893  LEU C N     1 
ATOM   8106  C  CA    . LEU E  4  93  ? 64.310  49.013 -46.940 1.00 33.76  ? 893  LEU C CA    1 
ATOM   8107  C  C     . LEU E  4  93  ? 64.409  47.642 -47.619 1.00 33.18  ? 893  LEU C C     1 
ATOM   8108  O  O     . LEU E  4  93  ? 64.314  46.609 -46.962 1.00 33.05  ? 893  LEU C O     1 
ATOM   8109  C  CB    . LEU E  4  93  ? 62.884  49.553 -47.061 1.00 33.79  ? 893  LEU C CB    1 
ATOM   8110  C  CG    . LEU E  4  93  ? 62.470  50.676 -46.097 1.00 36.54  ? 893  LEU C CG    1 
ATOM   8111  C  CD1   . LEU E  4  93  ? 61.059  51.091 -46.430 1.00 35.93  ? 893  LEU C CD1   1 
ATOM   8112  C  CD2   . LEU E  4  93  ? 62.533  50.209 -44.637 1.00 33.03  ? 893  LEU C CD2   1 
ATOM   8113  N  N     . ASN E  4  94  ? 64.604  47.642 -48.932 1.00 29.71  ? 894  ASN C N     1 
ATOM   8114  C  CA    . ASN E  4  94  ? 64.734  46.396 -49.677 1.00 32.71  ? 894  ASN C CA    1 
ATOM   8115  C  C     . ASN E  4  94  ? 65.921  45.585 -49.152 1.00 35.55  ? 894  ASN C C     1 
ATOM   8116  O  O     . ASN E  4  94  ? 65.847  44.359 -49.037 1.00 32.94  ? 894  ASN C O     1 
ATOM   8117  C  CB    . ASN E  4  94  ? 64.918  46.659 -51.169 1.00 27.35  ? 894  ASN C CB    1 
ATOM   8118  C  CG    . ASN E  4  94  ? 64.988  45.367 -51.980 1.00 34.08  ? 894  ASN C CG    1 
ATOM   8119  O  OD1   . ASN E  4  94  ? 64.067  44.547 -51.953 1.00 29.13  ? 894  ASN C OD1   1 
ATOM   8120  N  ND2   . ASN E  4  94  ? 66.086  45.179 -52.691 1.00 30.96  ? 894  ASN C ND2   1 
ATOM   8121  N  N     . LYS E  4  95  ? 67.015  46.275 -48.835 1.00 35.96  ? 895  LYS C N     1 
ATOM   8122  C  CA    . LYS E  4  95  ? 68.203  45.609 -48.308 1.00 37.75  ? 895  LYS C CA    1 
ATOM   8123  C  C     . LYS E  4  95  ? 67.964  45.135 -46.865 1.00 37.31  ? 895  LYS C C     1 
ATOM   8124  O  O     . LYS E  4  95  ? 68.322  44.016 -46.494 1.00 35.12  ? 895  LYS C O     1 
ATOM   8125  C  CB    . LYS E  4  95  ? 69.410  46.552 -48.372 1.00 43.75  ? 895  LYS C CB    1 
ATOM   8126  C  CG    . LYS E  4  95  ? 70.660  46.002 -47.708 1.00 48.31  ? 895  LYS C CG    1 
ATOM   8127  C  CD    . LYS E  4  95  ? 71.070  44.683 -48.336 1.00 55.39  ? 895  LYS C CD    1 
ATOM   8128  C  CE    . LYS E  4  95  ? 72.273  44.075 -47.630 1.00 58.33  ? 895  LYS C CE    1 
ATOM   8129  N  NZ    . LYS E  4  95  ? 72.195  42.590 -47.642 1.00 61.27  ? 895  LYS C NZ    1 
ATOM   8130  N  N     . LEU E  4  96  ? 67.338  45.982 -46.055 1.00 33.44  ? 896  LEU C N     1 
ATOM   8131  C  CA    . LEU E  4  96  ? 67.044  45.616 -44.675 1.00 30.00  ? 896  LEU C CA    1 
ATOM   8132  C  C     . LEU E  4  96  ? 66.163  44.363 -44.635 1.00 30.92  ? 896  LEU C C     1 
ATOM   8133  O  O     . LEU E  4  96  ? 66.324  43.503 -43.766 1.00 30.04  ? 896  LEU C O     1 
ATOM   8134  C  CB    . LEU E  4  96  ? 66.314  46.761 -43.961 1.00 31.36  ? 896  LEU C CB    1 
ATOM   8135  C  CG    . LEU E  4  96  ? 65.833  46.448 -42.539 1.00 33.51  ? 896  LEU C CG    1 
ATOM   8136  C  CD1   . LEU E  4  96  ? 67.051  46.170 -41.646 1.00 35.30  ? 896  LEU C CD1   1 
ATOM   8137  C  CD2   . LEU E  4  96  ? 65.005  47.623 -41.975 1.00 31.79  ? 896  LEU C CD2   1 
ATOM   8138  N  N     . LEU E  4  97  ? 65.208  44.290 -45.557 1.00 28.21  ? 897  LEU C N     1 
ATOM   8139  C  CA    . LEU E  4  97  ? 64.283  43.154 -45.641 1.00 29.61  ? 897  LEU C CA    1 
ATOM   8140  C  C     . LEU E  4  97  ? 64.628  42.226 -46.817 1.00 29.40  ? 897  LEU C C     1 
ATOM   8141  O  O     . LEU E  4  97  ? 63.745  41.612 -47.409 1.00 32.47  ? 897  LEU C O     1 
ATOM   8142  C  CB    . LEU E  4  97  ? 62.847  43.680 -45.787 1.00 25.33  ? 897  LEU C CB    1 
ATOM   8143  C  CG    . LEU E  4  97  ? 62.419  44.635 -44.655 1.00 31.01  ? 897  LEU C CG    1 
ATOM   8144  C  CD1   . LEU E  4  97  ? 61.016  45.209 -44.895 1.00 31.67  ? 897  LEU C CD1   1 
ATOM   8145  C  CD2   . LEU E  4  97  ? 62.459  43.895 -43.334 1.00 29.47  ? 897  LEU C CD2   1 
ATOM   8146  N  N     . GLY E  4  98  ? 65.911  42.124 -47.146 1.00 31.22  ? 898  GLY C N     1 
ATOM   8147  C  CA    . GLY E  4  98  ? 66.327  41.297 -48.272 1.00 31.71  ? 898  GLY C CA    1 
ATOM   8148  C  C     . GLY E  4  98  ? 65.997  39.813 -48.165 1.00 33.26  ? 898  GLY C C     1 
ATOM   8149  O  O     . GLY E  4  98  ? 65.857  39.133 -49.172 1.00 33.73  ? 898  GLY C O     1 
ATOM   8150  N  N     . ARG E  4  99  ? 65.852  39.316 -46.946 1.00 32.29  ? 899  ARG C N     1 
ATOM   8151  C  CA    . ARG E  4  99  ? 65.547  37.908 -46.731 1.00 35.51  ? 899  ARG C CA    1 
ATOM   8152  C  C     . ARG E  4  99  ? 64.210  37.764 -46.026 1.00 35.72  ? 899  ARG C C     1 
ATOM   8153  O  O     . ARG E  4  99  ? 64.008  36.858 -45.225 1.00 33.50  ? 899  ARG C O     1 
ATOM   8154  C  CB    . ARG E  4  99  ? 66.649  37.259 -45.891 1.00 39.52  ? 899  ARG C CB    1 
ATOM   8155  C  CG    . ARG E  4  99  ? 68.019  37.308 -46.548 1.00 46.71  ? 899  ARG C CG    1 
ATOM   8156  C  CD    . ARG E  4  99  ? 67.947  36.785 -47.969 1.00 55.78  ? 899  ARG C CD    1 
ATOM   8157  N  NE    . ARG E  4  99  ? 69.208  36.949 -48.689 1.00 65.07  ? 899  ARG C NE    1 
ATOM   8158  C  CZ    . ARG E  4  99  ? 70.300  36.227 -48.455 1.00 68.92  ? 899  ARG C CZ    1 
ATOM   8159  N  NH1   . ARG E  4  99  ? 70.286  35.287 -47.514 1.00 71.07  ? 899  ARG C NH1   1 
ATOM   8160  N  NH2   . ARG E  4  99  ? 71.403  36.437 -49.168 1.00 70.32  ? 899  ARG C NH2   1 
ATOM   8161  N  N     . VAL E  4  100 ? 63.296  38.681 -46.316 1.00 31.98  ? 900  VAL C N     1 
ATOM   8162  C  CA    . VAL E  4  100 ? 61.992  38.638 -45.693 1.00 28.60  ? 900  VAL C CA    1 
ATOM   8163  C  C     . VAL E  4  100 ? 60.934  38.477 -46.760 1.00 29.10  ? 900  VAL C C     1 
ATOM   8164  O  O     . VAL E  4  100 ? 61.036  39.070 -47.831 1.00 25.82  ? 900  VAL C O     1 
ATOM   8165  C  CB    . VAL E  4  100 ? 61.727  39.957 -44.916 1.00 31.55  ? 900  VAL C CB    1 
ATOM   8166  C  CG1   . VAL E  4  100 ? 60.251  40.114 -44.609 1.00 29.74  ? 900  VAL C CG1   1 
ATOM   8167  C  CG2   . VAL E  4  100 ? 62.558  39.990 -43.639 1.00 28.62  ? 900  VAL C CG2   1 
ATOM   8168  N  N     . THR E  4  101 ? 59.907  37.684 -46.467 1.00 28.36  ? 901  THR C N     1 
ATOM   8169  C  CA    . THR E  4  101 ? 58.817  37.506 -47.414 1.00 27.89  ? 901  THR C CA    1 
ATOM   8170  C  C     . THR E  4  101 ? 57.571  38.144 -46.810 1.00 29.10  ? 901  THR C C     1 
ATOM   8171  O  O     . THR E  4  101 ? 57.173  37.805 -45.699 1.00 28.91  ? 901  THR C O     1 
ATOM   8172  C  CB    . THR E  4  101 ? 58.497  36.008 -47.664 1.00 29.76  ? 901  THR C CB    1 
ATOM   8173  O  OG1   . THR E  4  101 ? 59.614  35.367 -48.295 1.00 33.59  ? 901  THR C OG1   1 
ATOM   8174  C  CG2   . THR E  4  101 ? 57.261  35.874 -48.554 1.00 26.11  ? 901  THR C CG2   1 
ATOM   8175  N  N     . ILE E  4  102 ? 56.966  39.077 -47.537 1.00 30.36  ? 902  ILE C N     1 
ATOM   8176  C  CA    . ILE E  4  102 ? 55.744  39.717 -47.070 1.00 28.32  ? 902  ILE C CA    1 
ATOM   8177  C  C     . ILE E  4  102 ? 54.565  38.946 -47.675 1.00 27.85  ? 902  ILE C C     1 
ATOM   8178  O  O     . ILE E  4  102 ? 54.374  38.958 -48.886 1.00 26.37  ? 902  ILE C O     1 
ATOM   8179  C  CB    . ILE E  4  102 ? 55.682  41.200 -47.517 1.00 29.70  ? 902  ILE C CB    1 
ATOM   8180  C  CG1   . ILE E  4  102 ? 56.721  42.021 -46.736 1.00 32.44  ? 902  ILE C CG1   1 
ATOM   8181  C  CG2   . ILE E  4  102 ? 54.278  41.743 -47.308 1.00 28.96  ? 902  ILE C CG2   1 
ATOM   8182  C  CD1   . ILE E  4  102 ? 56.968  43.392 -47.296 1.00 34.99  ? 902  ILE C CD1   1 
ATOM   8183  N  N     . ALA E  4  103 ? 53.788  38.263 -46.838 1.00 30.09  ? 903  ALA C N     1 
ATOM   8184  C  CA    . ALA E  4  103 ? 52.638  37.491 -47.320 1.00 31.45  ? 903  ALA C CA    1 
ATOM   8185  C  C     . ALA E  4  103 ? 51.666  38.366 -48.118 1.00 34.45  ? 903  ALA C C     1 
ATOM   8186  O  O     . ALA E  4  103 ? 51.377  39.503 -47.729 1.00 31.06  ? 903  ALA C O     1 
ATOM   8187  C  CB    . ALA E  4  103 ? 51.906  36.847 -46.145 1.00 30.94  ? 903  ALA C CB    1 
ATOM   8188  N  N     . GLN E  4  104 ? 51.135  37.806 -49.204 1.00 32.69  ? 904  GLN C N     1 
ATOM   8189  C  CA    . GLN E  4  104 ? 50.200  38.503 -50.078 1.00 35.88  ? 904  GLN C CA    1 
ATOM   8190  C  C     . GLN E  4  104 ? 50.764  39.802 -50.647 1.00 35.15  ? 904  GLN C C     1 
ATOM   8191  O  O     . GLN E  4  104 ? 50.022  40.747 -50.947 1.00 34.57  ? 904  GLN C O     1 
ATOM   8192  C  CB    . GLN E  4  104 ? 48.871  38.767 -49.362 1.00 39.67  ? 904  GLN C CB    1 
ATOM   8193  C  CG    . GLN E  4  104 ? 47.943  37.558 -49.342 1.00 46.47  ? 904  GLN C CG    1 
ATOM   8194  C  CD    . GLN E  4  104 ? 47.579  37.093 -50.761 1.00 49.16  ? 904  GLN C CD    1 
ATOM   8195  O  OE1   . GLN E  4  104 ? 46.820  37.769 -51.471 1.00 50.04  ? 904  GLN C OE1   1 
ATOM   8196  N  NE2   . GLN E  4  104 ? 48.149  35.962 -51.187 1.00 44.91  ? 904  GLN C NE2   1 
ATOM   8197  N  N     . GLY E  4  105 ? 52.077  39.835 -50.832 1.00 35.20  ? 905  GLY C N     1 
ATOM   8198  C  CA    . GLY E  4  105 ? 52.698  41.031 -51.372 1.00 32.71  ? 905  GLY C CA    1 
ATOM   8199  C  C     . GLY E  4  105 ? 52.937  40.999 -52.869 1.00 33.23  ? 905  GLY C C     1 
ATOM   8200  O  O     . GLY E  4  105 ? 53.128  42.054 -53.492 1.00 30.39  ? 905  GLY C O     1 
ATOM   8201  N  N     . GLY E  4  106 ? 52.924  39.808 -53.469 1.00 29.47  ? 906  GLY C N     1 
ATOM   8202  C  CA    . GLY E  4  106 ? 53.194  39.754 -54.897 1.00 26.28  ? 906  GLY C CA    1 
ATOM   8203  C  C     . GLY E  4  106 ? 54.619  40.217 -55.176 1.00 27.32  ? 906  GLY C C     1 
ATOM   8204  O  O     . GLY E  4  106 ? 55.471  40.194 -54.285 1.00 27.38  ? 906  GLY C O     1 
ATOM   8205  N  N     . VAL E  4  107 ? 54.882  40.667 -56.399 1.00 26.44  ? 907  VAL C N     1 
ATOM   8206  C  CA    . VAL E  4  107 ? 56.217  41.121 -56.776 1.00 29.52  ? 907  VAL C CA    1 
ATOM   8207  C  C     . VAL E  4  107 ? 56.116  42.413 -57.587 1.00 32.31  ? 907  VAL C C     1 
ATOM   8208  O  O     . VAL E  4  107 ? 55.027  42.824 -57.983 1.00 30.80  ? 907  VAL C O     1 
ATOM   8209  C  CB    . VAL E  4  107 ? 56.943  40.077 -57.664 1.00 31.78  ? 907  VAL C CB    1 
ATOM   8210  C  CG1   . VAL E  4  107 ? 57.001  38.715 -56.952 1.00 33.59  ? 907  VAL C CG1   1 
ATOM   8211  C  CG2   . VAL E  4  107 ? 56.239  39.954 -59.017 1.00 28.98  ? 907  VAL C CG2   1 
ATOM   8212  N  N     . LEU E  4  108 ? 57.258  43.032 -57.857 1.00 31.84  ? 908  LEU C N     1 
ATOM   8213  C  CA    . LEU E  4  108 ? 57.274  44.258 -58.647 1.00 35.93  ? 908  LEU C CA    1 
ATOM   8214  C  C     . LEU E  4  108 ? 57.154  43.912 -60.130 1.00 36.56  ? 908  LEU C C     1 
ATOM   8215  O  O     . LEU E  4  108 ? 57.782  42.965 -60.592 1.00 36.46  ? 908  LEU C O     1 
ATOM   8216  C  CB    . LEU E  4  108 ? 58.605  44.980 -58.463 1.00 36.95  ? 908  LEU C CB    1 
ATOM   8217  C  CG    . LEU E  4  108 ? 58.963  45.614 -57.127 1.00 38.93  ? 908  LEU C CG    1 
ATOM   8218  C  CD1   . LEU E  4  108 ? 60.247  46.438 -57.303 1.00 39.29  ? 908  LEU C CD1   1 
ATOM   8219  C  CD2   . LEU E  4  108 ? 57.810  46.499 -56.671 1.00 37.83  ? 908  LEU C CD2   1 
ATOM   8220  N  N     . PRO E  4  109 ? 56.332  44.655 -60.890 1.00 38.28  ? 909  PRO C N     1 
ATOM   8221  C  CA    . PRO E  4  109 ? 56.218  44.345 -62.319 1.00 40.45  ? 909  PRO C CA    1 
ATOM   8222  C  C     . PRO E  4  109 ? 57.611  44.517 -62.919 1.00 42.21  ? 909  PRO C C     1 
ATOM   8223  O  O     . PRO E  4  109 ? 58.279  45.512 -62.649 1.00 42.43  ? 909  PRO C O     1 
ATOM   8224  C  CB    . PRO E  4  109 ? 55.267  45.432 -62.818 1.00 42.99  ? 909  PRO C CB    1 
ATOM   8225  C  CG    . PRO E  4  109 ? 54.352  45.621 -61.639 1.00 43.45  ? 909  PRO C CG    1 
ATOM   8226  C  CD    . PRO E  4  109 ? 55.333  45.660 -60.488 1.00 40.45  ? 909  PRO C CD    1 
ATOM   8227  N  N     . ASN E  4  110 ? 58.074  43.545 -63.696 1.00 41.08  ? 910  ASN C N     1 
ATOM   8228  C  CA    . ASN E  4  110 ? 59.411  43.634 -64.278 1.00 42.87  ? 910  ASN C CA    1 
ATOM   8229  C  C     . ASN E  4  110 ? 59.602  42.533 -65.332 1.00 43.13  ? 910  ASN C C     1 
ATOM   8230  O  O     . ASN E  4  110 ? 59.636  41.352 -65.003 1.00 42.71  ? 910  ASN C O     1 
ATOM   8231  C  CB    . ASN E  4  110 ? 60.451  43.492 -63.154 1.00 46.38  ? 910  ASN C CB    1 
ATOM   8232  C  CG    . ASN E  4  110 ? 61.876  43.703 -63.634 1.00 51.23  ? 910  ASN C CG    1 
ATOM   8233  O  OD1   . ASN E  4  110 ? 62.128  44.479 -64.558 1.00 55.72  ? 910  ASN C OD1   1 
ATOM   8234  N  ND2   . ASN E  4  110 ? 62.819  43.023 -62.995 1.00 50.70  ? 910  ASN C ND2   1 
ATOM   8235  N  N     . ILE E  4  111 ? 59.677  42.936 -66.593 1.00 42.85  ? 911  ILE C N     1 
ATOM   8236  C  CA    . ILE E  4  111 ? 59.856  42.024 -67.695 1.00 42.24  ? 911  ILE C CA    1 
ATOM   8237  C  C     . ILE E  4  111 ? 61.238  42.265 -68.330 1.00 43.41  ? 911  ILE C C     1 
ATOM   8238  O  O     . ILE E  4  111 ? 61.563  43.398 -68.647 1.00 43.51  ? 911  ILE C O     1 
ATOM   8239  C  CB    . ILE E  4  111 ? 58.763  42.266 -68.780 1.00 43.27  ? 911  ILE C CB    1 
ATOM   8240  C  CG1   . ILE E  4  111 ? 57.369  42.111 -68.172 1.00 43.61  ? 911  ILE C CG1   1 
ATOM   8241  C  CG2   . ILE E  4  111 ? 58.947  41.326 -69.954 1.00 43.62  ? 911  ILE C CG2   1 
ATOM   8242  C  CD1   . ILE E  4  111 ? 56.207  42.399 -69.111 1.00 42.46  ? 911  ILE C CD1   1 
ATOM   8243  N  N     . GLN E  4  112 ? 62.088  41.272 -68.442 1.00 40.51  ? 912  GLN C N     1 
ATOM   8244  C  CA    . GLN E  4  112 ? 63.406  41.488 -69.076 1.00 42.16  ? 912  GLN C CA    1 
ATOM   8245  C  C     . GLN E  4  112 ? 63.300  41.961 -70.535 1.00 43.26  ? 912  GLN C C     1 
ATOM   8246  O  O     . GLN E  4  112 ? 62.515  41.413 -71.350 1.00 41.79  ? 912  GLN C O     1 
ATOM   8247  C  CB    . GLN E  4  112 ? 64.199  40.196 -69.076 1.00 42.78  ? 912  GLN C CB    1 
ATOM   8248  C  CG    . GLN E  4  112 ? 64.490  39.615 -67.661 1.00 45.03  ? 912  GLN C CG    1 
ATOM   8249  C  CD    . GLN E  4  112 ? 65.167  40.599 -66.722 1.00 47.30  ? 912  GLN C CD    1 
ATOM   8250  O  OE1   . GLN E  4  112 ? 66.256  41.092 -67.001 1.00 45.79  ? 912  GLN C OE1   1 
ATOM   8251  N  NE2   . GLN E  4  112 ? 64.518  40.882 -65.594 1.00 50.71  ? 912  GLN C NE2   1 
ATOM   8252  N  N     . SER E  4  113 ? 64.072  43.028 -70.831 1.00 42.93  ? 913  SER C N     1 
ATOM   8253  C  CA    . SER E  4  113 ? 64.083  43.616 -72.165 1.00 44.64  ? 913  SER C CA    1 
ATOM   8254  C  C     . SER E  4  113 ? 64.012  42.655 -73.343 1.00 43.60  ? 913  SER C C     1 
ATOM   8255  O  O     . SER E  4  113 ? 63.171  42.830 -74.245 1.00 43.96  ? 913  SER C O     1 
ATOM   8256  C  CB    . SER E  4  113 ? 65.261  44.597 -72.371 1.00 45.97  ? 913  SER C CB    1 
ATOM   8257  O  OG    . SER E  4  113 ? 65.224  45.543 -71.341 1.00 50.85  ? 913  SER C OG    1 
ATOM   8258  N  N     . VAL E  4  114 ? 64.882  41.652 -73.374 1.00 43.03  ? 914  VAL C N     1 
ATOM   8259  C  CA    . VAL E  4  114 ? 64.905  40.709 -74.496 1.00 43.42  ? 914  VAL C CA    1 
ATOM   8260  C  C     . VAL E  4  114 ? 63.623  39.952 -74.756 1.00 42.89  ? 914  VAL C C     1 
ATOM   8261  O  O     . VAL E  4  114 ? 63.438  39.407 -75.843 1.00 43.67  ? 914  VAL C O     1 
ATOM   8262  C  CB    . VAL E  4  114 ? 66.039  39.687 -74.348 1.00 46.28  ? 914  VAL C CB    1 
ATOM   8263  C  CG1   . VAL E  4  114 ? 67.379  40.400 -74.393 1.00 49.40  ? 914  VAL C CG1   1 
ATOM   8264  C  CG2   . VAL E  4  114 ? 65.875  38.911 -73.044 1.00 46.40  ? 914  VAL C CG2   1 
ATOM   8265  N  N     . LEU E  4  115 ? 62.731  39.932 -73.770 1.00 41.85  ? 915  LEU C N     1 
ATOM   8266  C  CA    . LEU E  4  115 ? 61.468  39.216 -73.910 1.00 42.89  ? 915  LEU C CA    1 
ATOM   8267  C  C     . LEU E  4  115 ? 60.394  40.019 -74.641 1.00 44.10  ? 915  LEU C C     1 
ATOM   8268  O  O     . LEU E  4  115 ? 59.385  39.463 -75.066 1.00 43.75  ? 915  LEU C O     1 
ATOM   8269  C  CB    . LEU E  4  115 ? 60.955  38.761 -72.533 1.00 37.70  ? 915  LEU C CB    1 
ATOM   8270  C  CG    . LEU E  4  115 ? 61.913  37.817 -71.782 1.00 40.37  ? 915  LEU C CG    1 
ATOM   8271  C  CD1   . LEU E  4  115 ? 61.254  37.353 -70.491 1.00 38.22  ? 915  LEU C CD1   1 
ATOM   8272  C  CD2   . LEU E  4  115 ? 62.263  36.607 -72.654 1.00 37.26  ? 915  LEU C CD2   1 
ATOM   8273  N  N     . LEU E  4  116 ? 60.598  41.327 -74.758 1.00 46.82  ? 916  LEU C N     1 
ATOM   8274  C  CA    . LEU E  4  116 ? 59.635  42.189 -75.445 1.00 51.49  ? 916  LEU C CA    1 
ATOM   8275  C  C     . LEU E  4  116 ? 59.594  41.908 -76.946 1.00 55.07  ? 916  LEU C C     1 
ATOM   8276  O  O     . LEU E  4  116 ? 60.565  41.425 -77.526 1.00 54.73  ? 916  LEU C O     1 
ATOM   8277  C  CB    . LEU E  4  116 ? 59.964  43.663 -75.207 1.00 50.19  ? 916  LEU C CB    1 
ATOM   8278  C  CG    . LEU E  4  116 ? 59.973  44.105 -73.744 1.00 50.55  ? 916  LEU C CG    1 
ATOM   8279  C  CD1   . LEU E  4  116 ? 60.368  45.579 -73.643 1.00 49.89  ? 916  LEU C CD1   1 
ATOM   8280  C  CD2   . LEU E  4  116 ? 58.609  43.848 -73.124 1.00 46.60  ? 916  LEU C CD2   1 
ATOM   8281  N  N     . PRO E  4  117 ? 58.459  42.214 -77.593 1.00 60.66  ? 917  PRO C N     1 
ATOM   8282  C  CA    . PRO E  4  117 ? 58.248  42.007 -79.032 1.00 65.49  ? 917  PRO C CA    1 
ATOM   8283  C  C     . PRO E  4  117 ? 59.056  42.938 -79.951 1.00 70.57  ? 917  PRO C C     1 
ATOM   8284  O  O     . PRO E  4  117 ? 59.801  43.809 -79.489 1.00 69.49  ? 917  PRO C O     1 
ATOM   8285  C  CB    . PRO E  4  117 ? 56.746  42.268 -79.199 1.00 63.76  ? 917  PRO C CB    1 
ATOM   8286  C  CG    . PRO E  4  117 ? 56.182  42.038 -77.828 1.00 62.99  ? 917  PRO C CG    1 
ATOM   8287  C  CD    . PRO E  4  117 ? 57.215  42.669 -76.951 1.00 60.88  ? 917  PRO C CD    1 
ATOM   8288  N  N     . LYS E  4  118 ? 58.863  42.738 -81.257 1.00 76.87  ? 918  LYS C N     1 
ATOM   8289  C  CA    . LYS E  4  118 ? 59.498  43.505 -82.335 1.00 82.22  ? 918  LYS C CA    1 
ATOM   8290  C  C     . LYS E  4  118 ? 60.990  43.794 -82.189 1.00 84.72  ? 918  LYS C C     1 
ATOM   8291  O  O     . LYS E  4  118 ? 61.680  43.012 -81.491 1.00 85.53  ? 918  LYS C O     1 
ATOM   8292  C  CB    . LYS E  4  118 ? 58.737  44.814 -82.596 1.00 83.35  ? 918  LYS C CB    1 
ATOM   8293  C  CG    . LYS E  4  118 ? 58.967  45.902 -81.559 1.00 87.52  ? 918  LYS C CG    1 
ATOM   8294  C  CD    . LYS E  4  118 ? 58.377  47.230 -82.011 1.00 90.20  ? 918  LYS C CD    1 
ATOM   8295  C  CE    . LYS E  4  118 ? 58.604  48.319 -80.976 1.00 91.27  ? 918  LYS C CE    1 
ATOM   8296  N  NZ    . LYS E  4  118 ? 57.471  49.284 -80.932 1.00 91.94  ? 918  LYS C NZ    1 
ATOM   8297  N  N     . ASP F  5  22  ? 32.828  34.148 -13.686 1.00 110.33 ? 1222 ASP D N     1 
ATOM   8298  C  CA    . ASP F  5  22  ? 31.992  33.161 -12.939 1.00 115.74 ? 1222 ASP D CA    1 
ATOM   8299  C  C     . ASP F  5  22  ? 31.794  31.869 -13.711 1.00 120.43 ? 1222 ASP D C     1 
ATOM   8300  O  O     . ASP F  5  22  ? 32.203  31.760 -14.864 1.00 120.33 ? 1222 ASP D O     1 
ATOM   8301  C  CB    . ASP F  5  22  ? 30.630  33.775 -12.632 1.00 114.65 ? 1222 ASP D CB    1 
ATOM   8302  C  CG    . ASP F  5  22  ? 30.731  35.035 -11.757 1.00 106.70 ? 1222 ASP D CG    1 
ATOM   8303  O  OD1   . ASP F  5  22  ? 31.796  35.236 -11.063 1.00 104.05 ? 1222 ASP D OD1   1 
ATOM   8304  O  OD2   . ASP F  5  22  ? 29.743  35.851 -11.712 1.00 103.70 ? 1222 ASP D OD2   1 
ATOM   8305  N  N     . GLY F  5  23  ? 31.164  30.895 -13.058 1.00 124.84 ? 1223 GLY D N     1 
ATOM   8306  C  CA    . GLY F  5  23  ? 30.898  29.611 -13.684 1.00 130.77 ? 1223 GLY D CA    1 
ATOM   8307  C  C     . GLY F  5  23  ? 32.119  28.721 -13.833 1.00 134.50 ? 1223 GLY D C     1 
ATOM   8308  O  O     . GLY F  5  23  ? 32.104  27.556 -13.435 1.00 136.44 ? 1223 GLY D O     1 
ATOM   8309  N  N     . LYS F  5  24  ? 33.163  29.272 -14.447 1.00 136.31 ? 1224 LYS D N     1 
ATOM   8310  C  CA    . LYS F  5  24  ? 34.435  28.594 -14.681 1.00 137.01 ? 1224 LYS D CA    1 
ATOM   8311  C  C     . LYS F  5  24  ? 34.981  29.287 -15.910 1.00 136.87 ? 1224 LYS D C     1 
ATOM   8312  O  O     . LYS F  5  24  ? 35.483  28.661 -16.855 1.00 137.01 ? 1224 LYS D O     1 
ATOM   8313  C  CB    . LYS F  5  24  ? 34.241  27.104 -14.950 1.00 137.65 ? 1224 LYS D CB    1 
ATOM   8314  C  CG    . LYS F  5  24  ? 35.473  26.285 -14.635 1.00 138.30 ? 1224 LYS D CG    1 
ATOM   8315  C  CD    . LYS F  5  24  ? 35.940  26.535 -13.210 1.00 138.67 ? 1224 LYS D CD    1 
ATOM   8316  C  CE    . LYS F  5  24  ? 37.032  25.563 -12.801 1.00 139.14 ? 1224 LYS D CE    1 
ATOM   8317  N  NZ    . LYS F  5  24  ? 37.111  25.433 -11.317 1.00 139.43 ? 1224 LYS D NZ    1 
ATOM   8318  N  N     . LYS F  5  25  ? 34.794  30.605 -15.889 1.00 136.35 ? 1225 LYS D N     1 
ATOM   8319  C  CA    . LYS F  5  25  ? 35.214  31.510 -16.945 1.00 135.53 ? 1225 LYS D CA    1 
ATOM   8320  C  C     . LYS F  5  25  ? 36.632  31.196 -17.323 1.00 134.61 ? 1225 LYS D C     1 
ATOM   8321  O  O     . LYS F  5  25  ? 37.335  30.455 -16.626 1.00 134.90 ? 1225 LYS D O     1 
ATOM   8322  C  CB    . LYS F  5  25  ? 35.210  32.952 -16.417 1.00 136.07 ? 1225 LYS D CB    1 
ATOM   8323  C  CG    . LYS F  5  25  ? 36.112  33.114 -15.186 1.00 136.50 ? 1225 LYS D CG    1 
ATOM   8324  C  CD    . LYS F  5  25  ? 36.810  34.467 -15.142 1.00 136.79 ? 1225 LYS D CD    1 
ATOM   8325  C  CE    . LYS F  5  25  ? 37.912  34.492 -14.082 1.00 137.11 ? 1225 LYS D CE    1 
ATOM   8326  N  NZ    . LYS F  5  25  ? 37.433  35.023 -12.774 1.00 137.10 ? 1225 LYS D NZ    1 
ATOM   8327  N  N     . ARG F  5  26  ? 37.079  31.767 -18.428 1.00 133.07 ? 1226 ARG D N     1 
ATOM   8328  C  CA    . ARG F  5  26  ? 38.452  31.545 -18.737 1.00 131.17 ? 1226 ARG D CA    1 
ATOM   8329  C  C     . ARG F  5  26  ? 39.157  32.582 -19.525 1.00 129.34 ? 1226 ARG D C     1 
ATOM   8330  O  O     . ARG F  5  26  ? 38.914  32.808 -20.708 1.00 129.04 ? 1226 ARG D O     1 
ATOM   8331  C  CB    . ARG F  5  26  ? 38.789  30.119 -19.118 1.00 131.95 ? 1226 ARG D CB    1 
ATOM   8332  C  CG    . ARG F  5  26  ? 39.837  29.598 -18.137 1.00 132.87 ? 1226 ARG D CG    1 
ATOM   8333  C  CD    . ARG F  5  26  ? 39.375  28.344 -17.448 1.00 133.73 ? 1226 ARG D CD    1 
ATOM   8334  N  NE    . ARG F  5  26  ? 39.371  27.248 -18.401 1.00 134.41 ? 1226 ARG D NE    1 
ATOM   8335  C  CZ    . ARG F  5  26  ? 39.607  25.980 -18.095 1.00 134.79 ? 1226 ARG D CZ    1 
ATOM   8336  N  NH1   . ARG F  5  26  ? 39.860  25.620 -16.843 1.00 135.14 ? 1226 ARG D NH1   1 
ATOM   8337  N  NH2   . ARG F  5  26  ? 39.640  25.083 -19.065 1.00 135.27 ? 1226 ARG D NH2   1 
ATOM   8338  N  N     . ARG F  5  27  ? 39.886  33.338 -18.717 1.00 127.13 ? 1227 ARG D N     1 
ATOM   8339  C  CA    . ARG F  5  27  ? 40.713  34.454 -19.116 1.00 124.88 ? 1227 ARG D CA    1 
ATOM   8340  C  C     . ARG F  5  27  ? 41.728  34.086 -20.174 1.00 122.59 ? 1227 ARG D C     1 
ATOM   8341  O  O     . ARG F  5  27  ? 42.874  33.764 -19.866 1.00 122.46 ? 1227 ARG D O     1 
ATOM   8342  C  CB    . ARG F  5  27  ? 41.437  35.005 -17.889 1.00 125.91 ? 1227 ARG D CB    1 
ATOM   8343  C  CG    . ARG F  5  27  ? 42.514  36.058 -18.155 1.00 126.72 ? 1227 ARG D CG    1 
ATOM   8344  C  CD    . ARG F  5  27  ? 43.924  35.481 -17.983 1.00 127.22 ? 1227 ARG D CD    1 
ATOM   8345  N  NE    . ARG F  5  27  ? 44.975  36.457 -18.257 1.00 127.71 ? 1227 ARG D NE    1 
ATOM   8346  C  CZ    . ARG F  5  27  ? 46.256  36.139 -18.405 1.00 128.23 ? 1227 ARG D CZ    1 
ATOM   8347  N  NH1   . ARG F  5  27  ? 46.639  34.874 -18.303 1.00 128.18 ? 1227 ARG D NH1   1 
ATOM   8348  N  NH2   . ARG F  5  27  ? 47.152  37.080 -18.662 1.00 128.52 ? 1227 ARG D NH2   1 
ATOM   8349  N  N     . LYS F  5  28  ? 41.309  34.126 -21.429 1.00 119.54 ? 1228 LYS D N     1 
ATOM   8350  C  CA    . LYS F  5  28  ? 42.229  33.825 -22.501 1.00 116.38 ? 1228 LYS D CA    1 
ATOM   8351  C  C     . LYS F  5  28  ? 43.408  34.768 -22.289 1.00 113.51 ? 1228 LYS D C     1 
ATOM   8352  O  O     . LYS F  5  28  ? 43.230  35.987 -22.259 1.00 113.34 ? 1228 LYS D O     1 
ATOM   8353  C  CB    . LYS F  5  28  ? 41.552  34.099 -23.834 1.00 117.06 ? 1228 LYS D CB    1 
ATOM   8354  C  CG    . LYS F  5  28  ? 42.412  33.787 -25.024 1.00 117.92 ? 1228 LYS D CG    1 
ATOM   8355  C  CD    . LYS F  5  28  ? 41.610  33.917 -26.292 1.00 119.18 ? 1228 LYS D CD    1 
ATOM   8356  C  CE    . LYS F  5  28  ? 42.497  33.782 -27.510 1.00 120.15 ? 1228 LYS D CE    1 
ATOM   8357  N  NZ    . LYS F  5  28  ? 41.705  33.869 -28.764 1.00 121.13 ? 1228 LYS D NZ    1 
ATOM   8358  N  N     . THR F  5  29  ? 44.592  34.202 -22.062 1.00 109.95 ? 1229 THR D N     1 
ATOM   8359  C  CA    . THR F  5  29  ? 45.784  35.011 -21.835 1.00 105.82 ? 1229 THR D CA    1 
ATOM   8360  C  C     . THR F  5  29  ? 45.926  36.030 -22.955 1.00 102.97 ? 1229 THR D C     1 
ATOM   8361  O  O     . THR F  5  29  ? 45.937  35.679 -24.136 1.00 102.54 ? 1229 THR D O     1 
ATOM   8362  C  CB    . THR F  5  29  ? 47.060  34.151 -21.750 1.00 106.23 ? 1229 THR D CB    1 
ATOM   8363  O  OG1   . THR F  5  29  ? 48.182  34.993 -21.455 1.00 106.97 ? 1229 THR D OG1   1 
ATOM   8364  C  CG2   . THR F  5  29  ? 47.312  33.434 -23.059 1.00 106.05 ? 1229 THR D CG2   1 
ATOM   8365  N  N     . ARG F  5  30  ? 46.007  37.299 -22.571 1.00 99.23  ? 1230 ARG D N     1 
ATOM   8366  C  CA    . ARG F  5  30  ? 46.123  38.388 -23.529 1.00 95.26  ? 1230 ARG D CA    1 
ATOM   8367  C  C     . ARG F  5  30  ? 47.410  38.358 -24.347 1.00 91.74  ? 1230 ARG D C     1 
ATOM   8368  O  O     . ARG F  5  30  ? 48.492  38.087 -23.823 1.00 91.35  ? 1230 ARG D O     1 
ATOM   8369  C  CB    . ARG F  5  30  ? 45.994  39.733 -22.812 1.00 95.80  ? 1230 ARG D CB    1 
ATOM   8370  C  CG    . ARG F  5  30  ? 46.991  39.923 -21.684 1.00 96.68  ? 1230 ARG D CG    1 
ATOM   8371  C  CD    . ARG F  5  30  ? 46.850  41.294 -21.054 1.00 97.25  ? 1230 ARG D CD    1 
ATOM   8372  N  NE    . ARG F  5  30  ? 48.010  42.136 -21.324 1.00 97.03  ? 1230 ARG D NE    1 
ATOM   8373  C  CZ    . ARG F  5  30  ? 48.034  43.450 -21.138 1.00 97.41  ? 1230 ARG D CZ    1 
ATOM   8374  N  NH1   . ARG F  5  30  ? 46.955  44.076 -20.683 1.00 97.71  ? 1230 ARG D NH1   1 
ATOM   8375  N  NH2   . ARG F  5  30  ? 49.136  44.139 -21.404 1.00 97.03  ? 1230 ARG D NH2   1 
ATOM   8376  N  N     . LYS F  5  31  ? 47.274  38.631 -25.640 1.00 87.14  ? 1231 LYS D N     1 
ATOM   8377  C  CA    . LYS F  5  31  ? 48.410  38.659 -26.547 1.00 82.53  ? 1231 LYS D CA    1 
ATOM   8378  C  C     . LYS F  5  31  ? 48.697  40.099 -26.962 1.00 78.00  ? 1231 LYS D C     1 
ATOM   8379  O  O     . LYS F  5  31  ? 47.865  40.757 -27.579 1.00 77.45  ? 1231 LYS D O     1 
ATOM   8380  C  CB    . LYS F  5  31  ? 48.130  37.781 -27.767 1.00 84.09  ? 1231 LYS D CB    1 
ATOM   8381  C  CG    . LYS F  5  31  ? 46.740  37.956 -28.353 1.00 86.50  ? 1231 LYS D CG    1 
ATOM   8382  C  CD    . LYS F  5  31  ? 46.449  36.893 -29.403 1.00 88.73  ? 1231 LYS D CD    1 
ATOM   8383  C  CE    . LYS F  5  31  ? 45.024  37.002 -29.933 1.00 90.38  ? 1231 LYS D CE    1 
ATOM   8384  N  NZ    . LYS F  5  31  ? 44.922  36.589 -31.366 1.00 91.34  ? 1231 LYS D NZ    1 
ATOM   8385  N  N     . GLU F  5  32  ? 49.875  40.588 -26.596 1.00 73.13  ? 1232 GLU D N     1 
ATOM   8386  C  CA    . GLU F  5  32  ? 50.271  41.953 -26.915 1.00 69.11  ? 1232 GLU D CA    1 
ATOM   8387  C  C     . GLU F  5  32  ? 50.777  42.139 -28.342 1.00 64.41  ? 1232 GLU D C     1 
ATOM   8388  O  O     . GLU F  5  32  ? 51.306  41.214 -28.956 1.00 63.41  ? 1232 GLU D O     1 
ATOM   8389  C  CB    . GLU F  5  32  ? 51.348  42.425 -25.941 1.00 71.37  ? 1232 GLU D CB    1 
ATOM   8390  C  CG    . GLU F  5  32  ? 50.915  42.442 -24.489 1.00 76.44  ? 1232 GLU D CG    1 
ATOM   8391  C  CD    . GLU F  5  32  ? 52.038  42.866 -23.561 1.00 79.70  ? 1232 GLU D CD    1 
ATOM   8392  O  OE1   . GLU F  5  32  ? 53.207  42.869 -24.009 1.00 80.64  ? 1232 GLU D OE1   1 
ATOM   8393  O  OE2   . GLU F  5  32  ? 51.750  43.198 -22.387 1.00 81.50  ? 1232 GLU D OE2   1 
ATOM   8394  N  N     . SER F  5  33  ? 50.612  43.351 -28.861 1.00 58.44  ? 1233 SER D N     1 
ATOM   8395  C  CA    . SER F  5  33  ? 51.080  43.680 -30.201 1.00 53.01  ? 1233 SER D CA    1 
ATOM   8396  C  C     . SER F  5  33  ? 51.359  45.171 -30.256 1.00 49.92  ? 1233 SER D C     1 
ATOM   8397  O  O     . SER F  5  33  ? 50.950  45.913 -29.369 1.00 46.71  ? 1233 SER D O     1 
ATOM   8398  C  CB    . SER F  5  33  ? 50.046  43.302 -31.263 1.00 50.62  ? 1233 SER D CB    1 
ATOM   8399  O  OG    . SER F  5  33  ? 49.153  44.365 -31.521 1.00 50.33  ? 1233 SER D OG    1 
ATOM   8400  N  N     . TYR F  5  34  ? 52.082  45.596 -31.285 1.00 46.23  ? 1234 TYR D N     1 
ATOM   8401  C  CA    . TYR F  5  34  ? 52.416  46.997 -31.462 1.00 44.09  ? 1234 TYR D CA    1 
ATOM   8402  C  C     . TYR F  5  34  ? 51.340  47.734 -32.235 1.00 42.64  ? 1234 TYR D C     1 
ATOM   8403  O  O     . TYR F  5  34  ? 51.486  48.927 -32.510 1.00 42.42  ? 1234 TYR D O     1 
ATOM   8404  C  CB    . TYR F  5  34  ? 53.746  47.126 -32.199 1.00 41.79  ? 1234 TYR D CB    1 
ATOM   8405  C  CG    . TYR F  5  34  ? 54.933  46.713 -31.367 1.00 43.34  ? 1234 TYR D CG    1 
ATOM   8406  C  CD1   . TYR F  5  34  ? 55.499  45.446 -31.499 1.00 41.32  ? 1234 TYR D CD1   1 
ATOM   8407  C  CD2   . TYR F  5  34  ? 55.515  47.603 -30.461 1.00 44.16  ? 1234 TYR D CD2   1 
ATOM   8408  C  CE1   . TYR F  5  34  ? 56.619  45.076 -30.757 1.00 39.72  ? 1234 TYR D CE1   1 
ATOM   8409  C  CE2   . TYR F  5  34  ? 56.635  47.239 -29.714 1.00 41.99  ? 1234 TYR D CE2   1 
ATOM   8410  C  CZ    . TYR F  5  34  ? 57.179  45.977 -29.872 1.00 41.76  ? 1234 TYR D CZ    1 
ATOM   8411  O  OH    . TYR F  5  34  ? 58.292  45.620 -29.158 1.00 42.70  ? 1234 TYR D OH    1 
ATOM   8412  N  N     . ALA F  5  35  ? 50.232  47.047 -32.509 1.00 40.29  ? 1235 ALA D N     1 
ATOM   8413  C  CA    . ALA F  5  35  ? 49.135  47.614 -33.291 1.00 43.26  ? 1235 ALA D CA    1 
ATOM   8414  C  C     . ALA F  5  35  ? 48.700  49.049 -32.972 1.00 43.67  ? 1235 ALA D C     1 
ATOM   8415  O  O     . ALA F  5  35  ? 48.697  49.901 -33.866 1.00 44.64  ? 1235 ALA D O     1 
ATOM   8416  C  CB    . ALA F  5  35  ? 47.924  46.672 -33.289 1.00 43.14  ? 1235 ALA D CB    1 
ATOM   8417  N  N     . ILE F  5  36  ? 48.327  49.324 -31.724 1.00 43.94  ? 1236 ILE D N     1 
ATOM   8418  C  CA    . ILE F  5  36  ? 47.882  50.676 -31.355 1.00 45.05  ? 1236 ILE D CA    1 
ATOM   8419  C  C     . ILE F  5  36  ? 48.966  51.737 -31.570 1.00 44.38  ? 1236 ILE D C     1 
ATOM   8420  O  O     . ILE F  5  36  ? 48.680  52.871 -31.962 1.00 46.20  ? 1236 ILE D O     1 
ATOM   8421  C  CB    . ILE F  5  36  ? 47.377  50.741 -29.898 1.00 46.97  ? 1236 ILE D CB    1 
ATOM   8422  C  CG1   . ILE F  5  36  ? 48.538  50.582 -28.919 1.00 47.65  ? 1236 ILE D CG1   1 
ATOM   8423  C  CG2   . ILE F  5  36  ? 46.334  49.655 -29.660 1.00 47.70  ? 1236 ILE D CG2   1 
ATOM   8424  C  CD1   . ILE F  5  36  ? 48.125  50.746 -27.470 1.00 51.96  ? 1236 ILE D CD1   1 
ATOM   8425  N  N     . TYR F  5  37  ? 50.218  51.360 -31.357 1.00 42.18  ? 1237 TYR D N     1 
ATOM   8426  C  CA    . TYR F  5  37  ? 51.302  52.303 -31.558 1.00 41.95  ? 1237 TYR D CA    1 
ATOM   8427  C  C     . TYR F  5  37  ? 51.545  52.499 -33.052 1.00 41.63  ? 1237 TYR D C     1 
ATOM   8428  O  O     . TYR F  5  37  ? 51.805  53.619 -33.513 1.00 41.77  ? 1237 TYR D O     1 
ATOM   8429  C  CB    . TYR F  5  37  ? 52.546  51.804 -30.838 1.00 43.36  ? 1237 TYR D CB    1 
ATOM   8430  C  CG    . TYR F  5  37  ? 52.247  51.433 -29.411 1.00 46.91  ? 1237 TYR D CG    1 
ATOM   8431  C  CD1   . TYR F  5  37  ? 52.123  50.093 -29.035 1.00 48.35  ? 1237 TYR D CD1   1 
ATOM   8432  C  CD2   . TYR F  5  37  ? 52.043  52.416 -28.439 1.00 46.83  ? 1237 TYR D CD2   1 
ATOM   8433  C  CE1   . TYR F  5  37  ? 51.803  49.734 -27.733 1.00 50.58  ? 1237 TYR D CE1   1 
ATOM   8434  C  CE2   . TYR F  5  37  ? 51.719  52.067 -27.124 1.00 49.07  ? 1237 TYR D CE2   1 
ATOM   8435  C  CZ    . TYR F  5  37  ? 51.599  50.721 -26.779 1.00 51.32  ? 1237 TYR D CZ    1 
ATOM   8436  O  OH    . TYR F  5  37  ? 51.263  50.351 -25.492 1.00 52.51  ? 1237 TYR D OH    1 
ATOM   8437  N  N     . VAL F  5  38  ? 51.434  51.417 -33.821 1.00 39.04  ? 1238 VAL D N     1 
ATOM   8438  C  CA    . VAL F  5  38  ? 51.621  51.521 -35.264 1.00 36.89  ? 1238 VAL D CA    1 
ATOM   8439  C  C     . VAL F  5  38  ? 50.515  52.435 -35.809 1.00 37.61  ? 1238 VAL D C     1 
ATOM   8440  O  O     . VAL F  5  38  ? 50.763  53.282 -36.658 1.00 35.76  ? 1238 VAL D O     1 
ATOM   8441  C  CB    . VAL F  5  38  ? 51.535  50.138 -35.968 1.00 36.06  ? 1238 VAL D CB    1 
ATOM   8442  C  CG1   . VAL F  5  38  ? 51.457  50.325 -37.481 1.00 34.40  ? 1238 VAL D CG1   1 
ATOM   8443  C  CG2   . VAL F  5  38  ? 52.754  49.262 -35.598 1.00 31.75  ? 1238 VAL D CG2   1 
ATOM   8444  N  N     A TYR F  5  39  ? 49.298  52.241 -35.310 0.50 38.13  ? 1239 TYR D N     1 
ATOM   8445  N  N     B TYR F  5  39  ? 49.290  52.241 -35.329 0.50 38.74  ? 1239 TYR D N     1 
ATOM   8446  C  CA    A TYR F  5  39  ? 48.145  53.045 -35.713 0.50 40.52  ? 1239 TYR D CA    1 
ATOM   8447  C  CA    B TYR F  5  39  ? 48.167  53.048 -35.795 0.50 41.36  ? 1239 TYR D CA    1 
ATOM   8448  C  C     A TYR F  5  39  ? 48.389  54.536 -35.507 0.50 39.85  ? 1239 TYR D C     1 
ATOM   8449  C  C     B TYR F  5  39  ? 48.298  54.543 -35.461 0.50 40.44  ? 1239 TYR D C     1 
ATOM   8450  O  O     A TYR F  5  39  ? 48.047  55.362 -36.355 0.50 40.53  ? 1239 TYR D O     1 
ATOM   8451  O  O     B TYR F  5  39  ? 47.738  55.383 -36.165 0.50 41.02  ? 1239 TYR D O     1 
ATOM   8452  C  CB    A TYR F  5  39  ? 46.921  52.682 -34.867 0.50 41.79  ? 1239 TYR D CB    1 
ATOM   8453  C  CB    B TYR F  5  39  ? 46.838  52.491 -35.288 0.50 43.90  ? 1239 TYR D CB    1 
ATOM   8454  C  CG    A TYR F  5  39  ? 46.061  51.564 -35.403 0.50 44.13  ? 1239 TYR D CG    1 
ATOM   8455  C  CG    B TYR F  5  39  ? 45.652  53.028 -36.052 0.50 46.47  ? 1239 TYR D CG    1 
ATOM   8456  C  CD1   A TYR F  5  39  ? 45.777  50.442 -34.615 0.50 45.18  ? 1239 TYR D CD1   1 
ATOM   8457  C  CD1   B TYR F  5  39  ? 45.439  52.677 -37.387 0.50 48.04  ? 1239 TYR D CD1   1 
ATOM   8458  C  CD2   A TYR F  5  39  ? 45.500  51.636 -36.680 0.50 43.74  ? 1239 TYR D CD2   1 
ATOM   8459  C  CD2   B TYR F  5  39  ? 44.759  53.913 -35.452 0.50 48.22  ? 1239 TYR D CD2   1 
ATOM   8460  C  CE1   A TYR F  5  39  ? 44.956  49.424 -35.078 0.50 44.71  ? 1239 TYR D CE1   1 
ATOM   8461  C  CE1   B TYR F  5  39  ? 44.362  53.201 -38.109 0.50 51.25  ? 1239 TYR D CE1   1 
ATOM   8462  C  CE2   A TYR F  5  39  ? 44.676  50.617 -37.157 0.50 44.24  ? 1239 TYR D CE2   1 
ATOM   8463  C  CE2   B TYR F  5  39  ? 43.680  54.441 -36.162 0.50 50.91  ? 1239 TYR D CE2   1 
ATOM   8464  C  CZ    A TYR F  5  39  ? 44.409  49.517 -36.349 0.50 44.62  ? 1239 TYR D CZ    1 
ATOM   8465  C  CZ    B TYR F  5  39  ? 43.489  54.081 -37.489 0.50 51.65  ? 1239 TYR D CZ    1 
ATOM   8466  O  OH    A TYR F  5  39  ? 43.595  48.512 -36.806 0.50 45.42  ? 1239 TYR D OH    1 
ATOM   8467  O  OH    B TYR F  5  39  ? 42.427  54.603 -38.188 0.50 54.84  ? 1239 TYR D OH    1 
ATOM   8468  N  N     . LYS F  5  40  ? 48.989  54.869 -34.372 1.00 40.00  ? 1240 LYS D N     1 
ATOM   8469  C  CA    . LYS F  5  40  ? 49.233  56.270 -34.010 1.00 41.79  ? 1240 LYS D CA    1 
ATOM   8470  C  C     . LYS F  5  40  ? 50.201  56.894 -35.004 1.00 42.97  ? 1240 LYS D C     1 
ATOM   8471  O  O     . LYS F  5  40  ? 49.983  58.005 -35.506 1.00 42.28  ? 1240 LYS D O     1 
ATOM   8472  C  CB    . LYS F  5  40  ? 49.828  56.373 -32.608 1.00 42.36  ? 1240 LYS D CB    1 
ATOM   8473  C  CG    . LYS F  5  40  ? 48.860  56.012 -31.495 1.00 46.52  ? 1240 LYS D CG    1 
ATOM   8474  C  CD    . LYS F  5  40  ? 49.545  56.087 -30.130 1.00 51.93  ? 1240 LYS D CD    1 
ATOM   8475  C  CE    . LYS F  5  40  ? 48.567  55.807 -28.997 1.00 53.71  ? 1240 LYS D CE    1 
ATOM   8476  N  NZ    . LYS F  5  40  ? 48.868  56.669 -27.818 1.00 57.99  ? 1240 LYS D NZ    1 
ATOM   8477  N  N     . VAL F  5  41  ? 51.287  56.176 -35.285 1.00 41.74  ? 1241 VAL D N     1 
ATOM   8478  C  CA    . VAL F  5  41  ? 52.282  56.667 -36.226 1.00 39.02  ? 1241 VAL D CA    1 
ATOM   8479  C  C     . VAL F  5  41  ? 51.683  56.819 -37.624 1.00 40.19  ? 1241 VAL D C     1 
ATOM   8480  O  O     . VAL F  5  41  ? 51.978  57.789 -38.338 1.00 40.84  ? 1241 VAL D O     1 
ATOM   8481  C  CB    . VAL F  5  41  ? 53.518  55.743 -36.296 1.00 39.92  ? 1241 VAL D CB    1 
ATOM   8482  C  CG1   . VAL F  5  41  ? 54.491  56.263 -37.348 1.00 34.99  ? 1241 VAL D CG1   1 
ATOM   8483  C  CG2   . VAL F  5  41  ? 54.200  55.657 -34.929 1.00 37.88  ? 1241 VAL D CG2   1 
ATOM   8484  N  N     . LEU F  5  42  ? 50.824  55.875 -38.008 1.00 38.55  ? 1242 LEU D N     1 
ATOM   8485  C  CA    . LEU F  5  42  ? 50.206  55.935 -39.327 1.00 39.17  ? 1242 LEU D CA    1 
ATOM   8486  C  C     . LEU F  5  42  ? 49.425  57.253 -39.520 1.00 41.15  ? 1242 LEU D C     1 
ATOM   8487  O  O     . LEU F  5  42  ? 49.494  57.895 -40.571 1.00 39.39  ? 1242 LEU D O     1 
ATOM   8488  C  CB    . LEU F  5  42  ? 49.257  54.752 -39.544 1.00 36.33  ? 1242 LEU D CB    1 
ATOM   8489  C  CG    . LEU F  5  42  ? 48.388  54.850 -40.802 1.00 36.50  ? 1242 LEU D CG    1 
ATOM   8490  C  CD1   . LEU F  5  42  ? 49.249  54.944 -42.051 1.00 33.47  ? 1242 LEU D CD1   1 
ATOM   8491  C  CD2   . LEU F  5  42  ? 47.446  53.663 -40.873 1.00 37.45  ? 1242 LEU D CD2   1 
ATOM   8492  N  N     . LYS F  5  43  ? 48.640  57.618 -38.515 1.00 40.73  ? 1243 LYS D N     1 
ATOM   8493  C  CA    . LYS F  5  43  ? 47.835  58.835 -38.585 1.00 46.50  ? 1243 LYS D CA    1 
ATOM   8494  C  C     . LYS F  5  43  ? 48.713  60.080 -38.594 1.00 44.52  ? 1243 LYS D C     1 
ATOM   8495  O  O     . LYS F  5  43  ? 48.333  61.125 -39.134 1.00 47.09  ? 1243 LYS D O     1 
ATOM   8496  C  CB    . LYS F  5  43  ? 46.865  58.882 -37.407 1.00 48.81  ? 1243 LYS D CB    1 
ATOM   8497  C  CG    . LYS F  5  43  ? 46.006  57.622 -37.229 1.00 53.66  ? 1243 LYS D CG    1 
ATOM   8498  C  CD    . LYS F  5  43  ? 44.794  57.577 -38.162 1.00 55.85  ? 1243 LYS D CD    1 
ATOM   8499  C  CE    . LYS F  5  43  ? 45.131  57.099 -39.559 1.00 56.84  ? 1243 LYS D CE    1 
ATOM   8500  N  NZ    . LYS F  5  43  ? 44.023  57.383 -40.513 1.00 58.32  ? 1243 LYS D NZ    1 
ATOM   8501  N  N     . GLN F  5  44  ? 49.871  59.999 -37.950 1.00 41.70  ? 1244 GLN D N     1 
ATOM   8502  C  CA    . GLN F  5  44  ? 50.779  61.150 -37.953 1.00 39.56  ? 1244 GLN D CA    1 
ATOM   8503  C  C     . GLN F  5  44  ? 51.276  61.381 -39.383 1.00 38.79  ? 1244 GLN D C     1 
ATOM   8504  O  O     . GLN F  5  44  ? 51.349  62.524 -39.859 1.00 36.65  ? 1244 GLN D O     1 
ATOM   8505  C  CB    . GLN F  5  44  ? 52.014  60.916 -37.053 1.00 38.86  ? 1244 GLN D CB    1 
ATOM   8506  C  CG    . GLN F  5  44  ? 51.801  60.979 -35.551 1.00 43.29  ? 1244 GLN D CG    1 
ATOM   8507  C  CD    . GLN F  5  44  ? 53.095  60.849 -34.787 1.00 44.96  ? 1244 GLN D CD    1 
ATOM   8508  O  OE1   . GLN F  5  44  ? 54.054  60.150 -35.212 1.00 47.65  ? 1244 GLN D OE1   1 
ATOM   8509  N  NE2   . GLN F  5  44  ? 53.131  61.540 -33.653 1.00 43.94  ? 1244 GLN D NE2   1 
ATOM   8510  N  N     . VAL F  5  45  ? 51.583  60.295 -40.096 1.00 35.86  ? 1245 VAL D N     1 
ATOM   8511  C  CA    . VAL F  5  45  ? 52.111  60.443 -41.450 1.00 33.54  ? 1245 VAL D CA    1 
ATOM   8512  C  C     . VAL F  5  45  ? 51.071  60.567 -42.553 1.00 33.24  ? 1245 VAL D C     1 
ATOM   8513  O  O     . VAL F  5  45  ? 51.283  61.269 -43.529 1.00 36.05  ? 1245 VAL D O     1 
ATOM   8514  C  CB    . VAL F  5  45  ? 53.113  59.310 -41.800 1.00 32.62  ? 1245 VAL D CB    1 
ATOM   8515  C  CG1   . VAL F  5  45  ? 54.210  59.262 -40.742 1.00 30.49  ? 1245 VAL D CG1   1 
ATOM   8516  C  CG2   . VAL F  5  45  ? 52.384  57.975 -41.929 1.00 30.40  ? 1245 VAL D CG2   1 
ATOM   8517  N  N     . HIS F  5  46  ? 49.952  59.872 -42.397 1.00 34.06  ? 1246 HIS D N     1 
ATOM   8518  C  CA    . HIS F  5  46  ? 48.874  59.896 -43.385 1.00 36.14  ? 1246 HIS D CA    1 
ATOM   8519  C  C     . HIS F  5  46  ? 47.550  59.903 -42.617 1.00 37.96  ? 1246 HIS D C     1 
ATOM   8520  O  O     . HIS F  5  46  ? 46.898  58.865 -42.469 1.00 38.07  ? 1246 HIS D O     1 
ATOM   8521  C  CB    . HIS F  5  46  ? 48.931  58.653 -44.283 1.00 36.41  ? 1246 HIS D CB    1 
ATOM   8522  C  CG    . HIS F  5  46  ? 50.124  58.596 -45.189 1.00 35.91  ? 1246 HIS D CG    1 
ATOM   8523  N  ND1   . HIS F  5  46  ? 50.338  59.506 -46.204 1.00 35.77  ? 1246 HIS D ND1   1 
ATOM   8524  C  CD2   . HIS F  5  46  ? 51.106  57.669 -45.304 1.00 36.34  ? 1246 HIS D CD2   1 
ATOM   8525  C  CE1   . HIS F  5  46  ? 51.393  59.136 -46.910 1.00 36.96  ? 1246 HIS D CE1   1 
ATOM   8526  N  NE2   . HIS F  5  46  ? 51.877  58.024 -46.384 1.00 36.63  ? 1246 HIS D NE2   1 
ATOM   8527  N  N     . PRO F  5  47  ? 47.110  61.092 -42.168 1.00 39.28  ? 1247 PRO D N     1 
ATOM   8528  C  CA    . PRO F  5  47  ? 45.869  61.283 -41.403 1.00 38.89  ? 1247 PRO D CA    1 
ATOM   8529  C  C     . PRO F  5  47  ? 44.612  60.590 -41.927 1.00 40.47  ? 1247 PRO D C     1 
ATOM   8530  O  O     . PRO F  5  47  ? 43.799  60.102 -41.145 1.00 42.39  ? 1247 PRO D O     1 
ATOM   8531  C  CB    . PRO F  5  47  ? 45.700  62.812 -41.395 1.00 40.31  ? 1247 PRO D CB    1 
ATOM   8532  C  CG    . PRO F  5  47  ? 47.115  63.307 -41.413 1.00 40.56  ? 1247 PRO D CG    1 
ATOM   8533  C  CD    . PRO F  5  47  ? 47.763  62.386 -42.448 1.00 37.30  ? 1247 PRO D CD    1 
ATOM   8534  N  N     . ASP F  5  48  ? 44.447  60.530 -43.239 1.00 41.40  ? 1248 ASP D N     1 
ATOM   8535  C  CA    . ASP F  5  48  ? 43.247  59.922 -43.794 1.00 43.61  ? 1248 ASP D CA    1 
ATOM   8536  C  C     . ASP F  5  48  ? 43.448  58.541 -44.439 1.00 44.14  ? 1248 ASP D C     1 
ATOM   8537  O  O     . ASP F  5  48  ? 42.655  58.126 -45.286 1.00 44.00  ? 1248 ASP D O     1 
ATOM   8538  C  CB    . ASP F  5  48  ? 42.612  60.893 -44.796 1.00 46.81  ? 1248 ASP D CB    1 
ATOM   8539  C  CG    . ASP F  5  48  ? 42.387  62.282 -44.192 1.00 51.70  ? 1248 ASP D CG    1 
ATOM   8540  O  OD1   . ASP F  5  48  ? 42.243  62.375 -42.953 1.00 52.63  ? 1248 ASP D OD1   1 
ATOM   8541  O  OD2   . ASP F  5  48  ? 42.380  63.277 -44.946 1.00 51.95  ? 1248 ASP D OD2   1 
ATOM   8542  N  N     . THR F  5  49  ? 44.467  57.813 -43.996 1.00 41.77  ? 1249 THR D N     1 
ATOM   8543  C  CA    . THR F  5  49  ? 44.762  56.496 -44.556 1.00 38.97  ? 1249 THR D CA    1 
ATOM   8544  C  C     . THR F  5  49  ? 44.560  55.418 -43.489 1.00 36.08  ? 1249 THR D C     1 
ATOM   8545  O  O     . THR F  5  49  ? 44.962  55.592 -42.343 1.00 36.68  ? 1249 THR D O     1 
ATOM   8546  C  CB    . THR F  5  49  ? 46.235  56.435 -45.059 1.00 39.82  ? 1249 THR D CB    1 
ATOM   8547  O  OG1   . THR F  5  49  ? 46.426  57.368 -46.131 1.00 38.75  ? 1249 THR D OG1   1 
ATOM   8548  C  CG2   . THR F  5  49  ? 46.608  55.017 -45.539 1.00 39.41  ? 1249 THR D CG2   1 
ATOM   8549  N  N     . GLY F  5  50  ? 43.882  54.338 -43.855 1.00 36.17  ? 1250 GLY D N     1 
ATOM   8550  C  CA    . GLY F  5  50  ? 43.681  53.238 -42.923 1.00 36.76  ? 1250 GLY D CA    1 
ATOM   8551  C  C     . GLY F  5  50  ? 44.674  52.105 -43.207 1.00 37.78  ? 1250 GLY D C     1 
ATOM   8552  O  O     . GLY F  5  50  ? 45.597  52.272 -44.008 1.00 36.44  ? 1250 GLY D O     1 
ATOM   8553  N  N     . ILE F  5  51  ? 44.485  50.955 -42.563 1.00 37.34  ? 1251 ILE D N     1 
ATOM   8554  C  CA    . ILE F  5  51  ? 45.364  49.798 -42.758 1.00 38.11  ? 1251 ILE D CA    1 
ATOM   8555  C  C     . ILE F  5  51  ? 44.594  48.506 -42.430 1.00 38.53  ? 1251 ILE D C     1 
ATOM   8556  O  O     . ILE F  5  51  ? 43.964  48.405 -41.380 1.00 38.13  ? 1251 ILE D O     1 
ATOM   8557  C  CB    . ILE F  5  51  ? 46.631  49.916 -41.875 1.00 39.15  ? 1251 ILE D CB    1 
ATOM   8558  C  CG1   . ILE F  5  51  ? 47.642  48.820 -42.220 1.00 35.74  ? 1251 ILE D CG1   1 
ATOM   8559  C  CG2   . ILE F  5  51  ? 46.258  49.864 -40.381 1.00 37.62  ? 1251 ILE D CG2   1 
ATOM   8560  C  CD1   . ILE F  5  51  ? 48.951  48.917 -41.417 1.00 32.12  ? 1251 ILE D CD1   1 
ATOM   8561  N  N     . SER F  5  52  ? 44.593  47.551 -43.360 1.00 38.51  ? 1252 SER D N     1 
ATOM   8562  C  CA    . SER F  5  52  ? 43.880  46.288 -43.169 1.00 38.11  ? 1252 SER D CA    1 
ATOM   8563  C  C     . SER F  5  52  ? 44.489  45.490 -42.027 1.00 38.99  ? 1252 SER D C     1 
ATOM   8564  O  O     . SER F  5  52  ? 45.601  45.775 -41.596 1.00 36.96  ? 1252 SER D O     1 
ATOM   8565  C  CB    . SER F  5  52  ? 43.906  45.452 -44.457 1.00 38.65  ? 1252 SER D CB    1 
ATOM   8566  O  OG    . SER F  5  52  ? 45.197  44.911 -44.707 1.00 38.14  ? 1252 SER D OG    1 
ATOM   8567  N  N     . SER F  5  53  ? 43.755  44.507 -41.509 1.00 39.18  ? 1253 SER D N     1 
ATOM   8568  C  CA    . SER F  5  53  ? 44.306  43.711 -40.417 1.00 40.62  ? 1253 SER D CA    1 
ATOM   8569  C  C     . SER F  5  53  ? 45.509  42.886 -40.882 1.00 39.43  ? 1253 SER D C     1 
ATOM   8570  O  O     . SER F  5  53  ? 46.479  42.723 -40.138 1.00 38.32  ? 1253 SER D O     1 
ATOM   8571  C  CB    . SER F  5  53  ? 43.233  42.819 -39.780 1.00 43.17  ? 1253 SER D CB    1 
ATOM   8572  O  OG    . SER F  5  53  ? 42.576  42.052 -40.767 1.00 48.62  ? 1253 SER D OG    1 
ATOM   8573  N  N     . LYS F  5  54  ? 45.472  42.405 -42.124 1.00 38.69  ? 1254 LYS D N     1 
ATOM   8574  C  CA    . LYS F  5  54  ? 46.587  41.617 -42.643 1.00 37.97  ? 1254 LYS D CA    1 
ATOM   8575  C  C     . LYS F  5  54  ? 47.850  42.475 -42.719 1.00 37.24  ? 1254 LYS D C     1 
ATOM   8576  O  O     . LYS F  5  54  ? 48.930  42.026 -42.341 1.00 34.43  ? 1254 LYS D O     1 
ATOM   8577  C  CB    . LYS F  5  54  ? 46.238  41.018 -44.009 1.00 43.20  ? 1254 LYS D CB    1 
ATOM   8578  C  CG    . LYS F  5  54  ? 45.123  39.973 -43.936 1.00 47.95  ? 1254 LYS D CG    1 
ATOM   8579  C  CD    . LYS F  5  54  ? 44.759  39.416 -45.310 1.00 55.88  ? 1254 LYS D CD    1 
ATOM   8580  C  CE    . LYS F  5  54  ? 43.647  38.355 -45.223 1.00 58.08  ? 1254 LYS D CE    1 
ATOM   8581  N  NZ    . LYS F  5  54  ? 43.281  37.815 -46.573 1.00 61.71  ? 1254 LYS D NZ    1 
ATOM   8582  N  N     . ALA F  5  55  ? 47.705  43.727 -43.152 1.00 34.33  ? 1255 ALA D N     1 
ATOM   8583  C  CA    . ALA F  5  55  ? 48.855  44.634 -43.228 1.00 31.04  ? 1255 ALA D CA    1 
ATOM   8584  C  C     . ALA F  5  55  ? 49.380  44.947 -41.835 1.00 32.06  ? 1255 ALA D C     1 
ATOM   8585  O  O     . ALA F  5  55  ? 50.593  45.061 -41.628 1.00 32.90  ? 1255 ALA D O     1 
ATOM   8586  C  CB    . ALA F  5  55  ? 48.476  45.928 -43.947 1.00 31.04  ? 1255 ALA D CB    1 
ATOM   8587  N  N     . MET F  5  56  ? 48.472  45.085 -40.873 1.00 32.18  ? 1256 MET D N     1 
ATOM   8588  C  CA    . MET F  5  56  ? 48.878  45.373 -39.499 1.00 33.38  ? 1256 MET D CA    1 
ATOM   8589  C  C     . MET F  5  56  ? 49.666  44.179 -38.956 1.00 32.76  ? 1256 MET D C     1 
ATOM   8590  O  O     . MET F  5  56  ? 50.650  44.356 -38.246 1.00 35.42  ? 1256 MET D O     1 
ATOM   8591  C  CB    . MET F  5  56  ? 47.666  45.654 -38.605 1.00 33.57  ? 1256 MET D CB    1 
ATOM   8592  C  CG    . MET F  5  56  ? 48.028  46.042 -37.184 1.00 36.40  ? 1256 MET D CG    1 
ATOM   8593  S  SD    . MET F  5  56  ? 49.116  47.492 -37.085 1.00 41.32  ? 1256 MET D SD    1 
ATOM   8594  C  CE    . MET F  5  56  ? 47.877  48.832 -37.025 1.00 40.19  ? 1256 MET D CE    1 
ATOM   8595  N  N     . SER F  5  57  ? 49.240  42.968 -39.298 1.00 32.03  ? 1257 SER D N     1 
ATOM   8596  C  CA    . SER F  5  57  ? 49.963  41.780 -38.839 1.00 33.75  ? 1257 SER D CA    1 
ATOM   8597  C  C     . SER F  5  57  ? 51.372  41.817 -39.429 1.00 31.09  ? 1257 SER D C     1 
ATOM   8598  O  O     . SER F  5  57  ? 52.345  41.486 -38.760 1.00 32.17  ? 1257 SER D O     1 
ATOM   8599  C  CB    . SER F  5  57  ? 49.257  40.497 -39.272 1.00 32.96  ? 1257 SER D CB    1 
ATOM   8600  O  OG    . SER F  5  57  ? 49.964  39.389 -38.753 1.00 39.42  ? 1257 SER D OG    1 
ATOM   8601  N  N     . ILE F  5  58  ? 51.480  42.260 -40.679 1.00 30.24  ? 1258 ILE D N     1 
ATOM   8602  C  CA    . ILE F  5  58  ? 52.787  42.380 -41.298 1.00 30.74  ? 1258 ILE D CA    1 
ATOM   8603  C  C     . ILE F  5  58  ? 53.634  43.433 -40.575 1.00 31.68  ? 1258 ILE D C     1 
ATOM   8604  O  O     . ILE F  5  58  ? 54.825  43.219 -40.333 1.00 29.96  ? 1258 ILE D O     1 
ATOM   8605  C  CB    . ILE F  5  58  ? 52.683  42.703 -42.792 1.00 31.06  ? 1258 ILE D CB    1 
ATOM   8606  C  CG1   . ILE F  5  58  ? 52.200  41.443 -43.527 1.00 34.33  ? 1258 ILE D CG1   1 
ATOM   8607  C  CG2   . ILE F  5  58  ? 54.049  43.134 -43.329 1.00 30.08  ? 1258 ILE D CG2   1 
ATOM   8608  C  CD1   . ILE F  5  58  ? 51.679  41.701 -44.900 1.00 34.03  ? 1258 ILE D CD1   1 
ATOM   8609  N  N     . MET F  5  59  ? 53.008  44.544 -40.187 1.00 30.56  ? 1259 MET D N     1 
ATOM   8610  C  CA    . MET F  5  59  ? 53.727  45.614 -39.485 1.00 30.39  ? 1259 MET D CA    1 
ATOM   8611  C  C     . MET F  5  59  ? 54.162  45.110 -38.108 1.00 28.80  ? 1259 MET D C     1 
ATOM   8612  O  O     . MET F  5  59  ? 55.259  45.416 -37.628 1.00 27.66  ? 1259 MET D O     1 
ATOM   8613  C  CB    . MET F  5  59  ? 52.818  46.850 -39.328 1.00 30.24  ? 1259 MET D CB    1 
ATOM   8614  C  CG    . MET F  5  59  ? 52.594  47.625 -40.620 1.00 29.54  ? 1259 MET D CG    1 
ATOM   8615  S  SD    . MET F  5  59  ? 54.141  48.193 -41.308 1.00 35.79  ? 1259 MET D SD    1 
ATOM   8616  C  CE    . MET F  5  59  ? 54.737  49.298 -39.967 1.00 34.07  ? 1259 MET D CE    1 
ATOM   8617  N  N     . ASN F  5  60  ? 53.303  44.323 -37.474 1.00 28.89  ? 1260 ASN D N     1 
ATOM   8618  C  CA    . ASN F  5  60  ? 53.648  43.797 -36.164 1.00 31.35  ? 1260 ASN D CA    1 
ATOM   8619  C  C     . ASN F  5  60  ? 54.847  42.855 -36.285 1.00 33.07  ? 1260 ASN D C     1 
ATOM   8620  O  O     . ASN F  5  60  ? 55.718  42.841 -35.420 1.00 32.81  ? 1260 ASN D O     1 
ATOM   8621  C  CB    . ASN F  5  60  ? 52.464  43.086 -35.527 1.00 34.54  ? 1260 ASN D CB    1 
ATOM   8622  C  CG    . ASN F  5  60  ? 52.683  42.825 -34.050 1.00 41.38  ? 1260 ASN D CG    1 
ATOM   8623  O  OD1   . ASN F  5  60  ? 52.956  43.750 -33.275 1.00 42.82  ? 1260 ASN D OD1   1 
ATOM   8624  N  ND2   . ASN F  5  60  ? 52.606  41.560 -33.655 1.00 40.99  ? 1260 ASN D ND2   1 
ATOM   8625  N  N     . SER F  5  61  ? 54.884  42.062 -37.358 1.00 34.09  ? 1261 SER D N     1 
ATOM   8626  C  CA    . SER F  5  61  ? 56.008  41.146 -37.584 1.00 33.91  ? 1261 SER D CA    1 
ATOM   8627  C  C     . SER F  5  61  ? 57.267  41.960 -37.845 1.00 33.32  ? 1261 SER D C     1 
ATOM   8628  O  O     . SER F  5  61  ? 58.345  41.602 -37.401 1.00 32.34  ? 1261 SER D O     1 
ATOM   8629  C  CB    . SER F  5  61  ? 55.760  40.258 -38.796 1.00 30.06  ? 1261 SER D CB    1 
ATOM   8630  O  OG    . SER F  5  61  ? 54.808  39.270 -38.485 1.00 36.62  ? 1261 SER D OG    1 
ATOM   8631  N  N     . PHE F  5  62  ? 57.125  43.058 -38.584 1.00 31.55  ? 1262 PHE D N     1 
ATOM   8632  C  CA    . PHE F  5  62  ? 58.274  43.906 -38.884 1.00 31.87  ? 1262 PHE D CA    1 
ATOM   8633  C  C     . PHE F  5  62  ? 58.915  44.483 -37.610 1.00 30.67  ? 1262 PHE D C     1 
ATOM   8634  O  O     . PHE F  5  62  ? 60.120  44.367 -37.404 1.00 30.73  ? 1262 PHE D O     1 
ATOM   8635  C  CB    . PHE F  5  62  ? 57.845  45.038 -39.825 1.00 33.47  ? 1262 PHE D CB    1 
ATOM   8636  C  CG    . PHE F  5  62  ? 58.908  46.072 -40.064 1.00 33.28  ? 1262 PHE D CG    1 
ATOM   8637  C  CD1   . PHE F  5  62  ? 60.073  45.749 -40.756 1.00 35.36  ? 1262 PHE D CD1   1 
ATOM   8638  C  CD2   . PHE F  5  62  ? 58.724  47.389 -39.626 1.00 36.76  ? 1262 PHE D CD2   1 
ATOM   8639  C  CE1   . PHE F  5  62  ? 61.055  46.730 -41.019 1.00 37.10  ? 1262 PHE D CE1   1 
ATOM   8640  C  CE2   . PHE F  5  62  ? 59.688  48.381 -39.880 1.00 38.72  ? 1262 PHE D CE2   1 
ATOM   8641  C  CZ    . PHE F  5  62  ? 60.858  48.049 -40.581 1.00 36.47  ? 1262 PHE D CZ    1 
ATOM   8642  N  N     . VAL F  5  63  ? 58.105  45.066 -36.734 1.00 30.60  ? 1263 VAL D N     1 
ATOM   8643  C  CA    . VAL F  5  63  ? 58.642  45.655 -35.507 1.00 30.50  ? 1263 VAL D CA    1 
ATOM   8644  C  C     . VAL F  5  63  ? 59.338  44.605 -34.625 1.00 32.34  ? 1263 VAL D C     1 
ATOM   8645  O  O     . VAL F  5  63  ? 60.398  44.868 -34.072 1.00 30.97  ? 1263 VAL D O     1 
ATOM   8646  C  CB    . VAL F  5  63  ? 57.544  46.377 -34.686 1.00 28.72  ? 1263 VAL D CB    1 
ATOM   8647  C  CG1   . VAL F  5  63  ? 58.164  46.988 -33.437 1.00 28.60  ? 1263 VAL D CG1   1 
ATOM   8648  C  CG2   . VAL F  5  63  ? 56.871  47.483 -35.538 1.00 31.28  ? 1263 VAL D CG2   1 
ATOM   8649  N  N     . ASN F  5  64  ? 58.734  43.426 -34.485 1.00 32.61  ? 1264 ASN D N     1 
ATOM   8650  C  CA    . ASN F  5  64  ? 59.338  42.355 -33.675 1.00 33.96  ? 1264 ASN D CA    1 
ATOM   8651  C  C     . ASN F  5  64  ? 60.625  41.872 -34.299 1.00 31.09  ? 1264 ASN D C     1 
ATOM   8652  O  O     . ASN F  5  64  ? 61.597  41.606 -33.609 1.00 34.96  ? 1264 ASN D O     1 
ATOM   8653  C  CB    . ASN F  5  64  ? 58.392  41.154 -33.547 1.00 36.53  ? 1264 ASN D CB    1 
ATOM   8654  C  CG    . ASN F  5  64  ? 57.260  41.407 -32.568 1.00 41.39  ? 1264 ASN D CG    1 
ATOM   8655  O  OD1   . ASN F  5  64  ? 57.477  41.957 -31.494 1.00 43.89  ? 1264 ASN D OD1   1 
ATOM   8656  N  ND2   . ASN F  5  64  ? 56.045  41.007 -32.937 1.00 44.20  ? 1264 ASN D ND2   1 
ATOM   8657  N  N     . ASP F  5  65  ? 60.630  41.758 -35.620 1.00 34.63  ? 1265 ASP D N     1 
ATOM   8658  C  CA    . ASP F  5  65  ? 61.815  41.301 -36.333 1.00 33.10  ? 1265 ASP D CA    1 
ATOM   8659  C  C     . ASP F  5  65  ? 62.979  42.266 -36.090 1.00 34.60  ? 1265 ASP D C     1 
ATOM   8660  O  O     . ASP F  5  65  ? 64.056  41.862 -35.649 1.00 32.93  ? 1265 ASP D O     1 
ATOM   8661  C  CB    . ASP F  5  65  ? 61.506  41.200 -37.821 1.00 34.46  ? 1265 ASP D CB    1 
ATOM   8662  C  CG    . ASP F  5  65  ? 62.616  40.519 -38.605 1.00 37.75  ? 1265 ASP D CG    1 
ATOM   8663  O  OD1   . ASP F  5  65  ? 63.349  39.702 -38.003 1.00 42.00  ? 1265 ASP D OD1   1 
ATOM   8664  O  OD2   . ASP F  5  65  ? 62.750  40.790 -39.821 1.00 34.52  ? 1265 ASP D OD2   1 
ATOM   8665  N  N     . VAL F  5  66  ? 62.747  43.556 -36.327 1.00 33.75  ? 1266 VAL D N     1 
ATOM   8666  C  CA    . VAL F  5  66  ? 63.800  44.551 -36.128 1.00 32.78  ? 1266 VAL D CA    1 
ATOM   8667  C  C     . VAL F  5  66  ? 64.212  44.614 -34.660 1.00 31.61  ? 1266 VAL D C     1 
ATOM   8668  O  O     . VAL F  5  66  ? 65.394  44.742 -34.346 1.00 30.72  ? 1266 VAL D O     1 
ATOM   8669  C  CB    . VAL F  5  66  ? 63.365  45.943 -36.631 1.00 33.81  ? 1266 VAL D CB    1 
ATOM   8670  C  CG1   . VAL F  5  66  ? 64.434  46.978 -36.300 1.00 34.16  ? 1266 VAL D CG1   1 
ATOM   8671  C  CG2   . VAL F  5  66  ? 63.126  45.883 -38.137 1.00 32.80  ? 1266 VAL D CG2   1 
ATOM   8672  N  N     . PHE F  5  67  ? 63.241  44.518 -33.757 1.00 32.95  ? 1267 PHE D N     1 
ATOM   8673  C  CA    . PHE F  5  67  ? 63.564  44.512 -32.332 1.00 34.47  ? 1267 PHE D CA    1 
ATOM   8674  C  C     . PHE F  5  67  ? 64.567  43.379 -32.049 1.00 35.33  ? 1267 PHE D C     1 
ATOM   8675  O  O     . PHE F  5  67  ? 65.619  43.603 -31.457 1.00 34.17  ? 1267 PHE D O     1 
ATOM   8676  C  CB    . PHE F  5  67  ? 62.303  44.281 -31.494 1.00 36.96  ? 1267 PHE D CB    1 
ATOM   8677  C  CG    . PHE F  5  67  ? 62.571  44.141 -30.019 1.00 40.32  ? 1267 PHE D CG    1 
ATOM   8678  C  CD1   . PHE F  5  67  ? 62.357  45.208 -29.157 1.00 42.86  ? 1267 PHE D CD1   1 
ATOM   8679  C  CD2   . PHE F  5  67  ? 63.058  42.945 -29.494 1.00 44.36  ? 1267 PHE D CD2   1 
ATOM   8680  C  CE1   . PHE F  5  67  ? 62.624  45.097 -27.802 1.00 43.60  ? 1267 PHE D CE1   1 
ATOM   8681  C  CE2   . PHE F  5  67  ? 63.329  42.824 -28.136 1.00 45.95  ? 1267 PHE D CE2   1 
ATOM   8682  C  CZ    . PHE F  5  67  ? 63.110  43.908 -27.288 1.00 44.64  ? 1267 PHE D CZ    1 
ATOM   8683  N  N     . GLU F  5  68  ? 64.229  42.162 -32.472 1.00 35.53  ? 1268 GLU D N     1 
ATOM   8684  C  CA    . GLU F  5  68  ? 65.091  40.996 -32.249 1.00 36.84  ? 1268 GLU D CA    1 
ATOM   8685  C  C     . GLU F  5  68  ? 66.467  41.177 -32.872 1.00 34.98  ? 1268 GLU D C     1 
ATOM   8686  O  O     . GLU F  5  68  ? 67.486  40.872 -32.258 1.00 35.40  ? 1268 GLU D O     1 
ATOM   8687  C  CB    . GLU F  5  68  ? 64.441  39.735 -32.821 1.00 40.39  ? 1268 GLU D CB    1 
ATOM   8688  C  CG    . GLU F  5  68  ? 63.180  39.309 -32.105 1.00 50.24  ? 1268 GLU D CG    1 
ATOM   8689  C  CD    . GLU F  5  68  ? 62.484  38.140 -32.797 1.00 57.01  ? 1268 GLU D CD    1 
ATOM   8690  O  OE1   . GLU F  5  68  ? 61.383  37.750 -32.343 1.00 58.82  ? 1268 GLU D OE1   1 
ATOM   8691  O  OE2   . GLU F  5  68  ? 63.038  37.617 -33.796 1.00 59.24  ? 1268 GLU D OE2   1 
ATOM   8692  N  N     . ARG F  5  69  ? 66.506  41.689 -34.093 1.00 33.15  ? 1269 ARG D N     1 
ATOM   8693  C  CA    . ARG F  5  69  ? 67.789  41.891 -34.741 1.00 34.67  ? 1269 ARG D CA    1 
ATOM   8694  C  C     . ARG F  5  69  ? 68.653  42.916 -34.019 1.00 34.22  ? 1269 ARG D C     1 
ATOM   8695  O  O     . ARG F  5  69  ? 69.833  42.679 -33.791 1.00 34.62  ? 1269 ARG D O     1 
ATOM   8696  C  CB    . ARG F  5  69  ? 67.598  42.296 -36.194 1.00 33.94  ? 1269 ARG D CB    1 
ATOM   8697  C  CG    . ARG F  5  69  ? 67.090  41.174 -37.066 1.00 37.35  ? 1269 ARG D CG    1 
ATOM   8698  C  CD    . ARG F  5  69  ? 67.380  41.527 -38.511 1.00 40.27  ? 1269 ARG D CD    1 
ATOM   8699  N  NE    . ARG F  5  69  ? 66.206  41.455 -39.349 1.00 37.24  ? 1269 ARG D NE    1 
ATOM   8700  C  CZ    . ARG F  5  69  ? 66.175  41.877 -40.610 1.00 39.54  ? 1269 ARG D CZ    1 
ATOM   8701  N  NH1   . ARG F  5  69  ? 67.263  42.409 -41.168 1.00 33.36  ? 1269 ARG D NH1   1 
ATOM   8702  N  NH2   . ARG F  5  69  ? 65.070  41.717 -41.328 1.00 39.58  ? 1269 ARG D NH2   1 
ATOM   8703  N  N     . ILE F  5  70  ? 68.088  44.076 -33.694 1.00 34.41  ? 1270 ILE D N     1 
ATOM   8704  C  CA    . ILE F  5  70  ? 68.878  45.082 -32.989 1.00 32.89  ? 1270 ILE D CA    1 
ATOM   8705  C  C     . ILE F  5  70  ? 69.298  44.553 -31.617 1.00 32.99  ? 1270 ILE D C     1 
ATOM   8706  O  O     . ILE F  5  70  ? 70.467  44.630 -31.255 1.00 34.79  ? 1270 ILE D O     1 
ATOM   8707  C  CB    . ILE F  5  70  ? 68.109  46.413 -32.819 1.00 34.50  ? 1270 ILE D CB    1 
ATOM   8708  C  CG1   . ILE F  5  70  ? 67.956  47.110 -34.183 1.00 34.23  ? 1270 ILE D CG1   1 
ATOM   8709  C  CG2   . ILE F  5  70  ? 68.846  47.309 -31.810 1.00 33.45  ? 1270 ILE D CG2   1 
ATOM   8710  C  CD1   . ILE F  5  70  ? 66.987  48.289 -34.181 1.00 37.68  ? 1270 ILE D CD1   1 
ATOM   8711  N  N     . ALA F  5  71  ? 68.357  43.987 -30.865 1.00 34.07  ? 1271 ALA D N     1 
ATOM   8712  C  CA    . ALA F  5  71  ? 68.682  43.459 -29.535 1.00 34.79  ? 1271 ALA D CA    1 
ATOM   8713  C  C     . ALA F  5  71  ? 69.768  42.378 -29.623 1.00 33.97  ? 1271 ALA D C     1 
ATOM   8714  O  O     . ALA F  5  71  ? 70.710  42.370 -28.841 1.00 34.27  ? 1271 ALA D O     1 
ATOM   8715  C  CB    . ALA F  5  71  ? 67.440  42.913 -28.855 1.00 33.18  ? 1271 ALA D CB    1 
ATOM   8716  N  N     . GLY F  5  72  ? 69.653  41.505 -30.619 1.00 35.88  ? 1272 GLY D N     1 
ATOM   8717  C  CA    . GLY F  5  72  ? 70.642  40.451 -30.803 1.00 36.58  ? 1272 GLY D CA    1 
ATOM   8718  C  C     . GLY F  5  72  ? 72.026  41.006 -31.096 1.00 38.93  ? 1272 GLY D C     1 
ATOM   8719  O  O     . GLY F  5  72  ? 73.017  40.540 -30.525 1.00 39.42  ? 1272 GLY D O     1 
ATOM   8720  N  N     . GLU F  5  73  ? 72.110  41.981 -32.001 1.00 38.62  ? 1273 GLU D N     1 
ATOM   8721  C  CA    . GLU F  5  73  ? 73.399  42.589 -32.320 1.00 40.36  ? 1273 GLU D CA    1 
ATOM   8722  C  C     . GLU F  5  73  ? 73.947  43.255 -31.066 1.00 39.28  ? 1273 GLU D C     1 
ATOM   8723  O  O     . GLU F  5  73  ? 75.142  43.194 -30.802 1.00 38.67  ? 1273 GLU D O     1 
ATOM   8724  C  CB    . GLU F  5  73  ? 73.270  43.645 -33.425 1.00 42.39  ? 1273 GLU D CB    1 
ATOM   8725  C  CG    . GLU F  5  73  ? 72.896  43.100 -34.786 1.00 50.31  ? 1273 GLU D CG    1 
ATOM   8726  C  CD    . GLU F  5  73  ? 74.079  42.550 -35.564 1.00 53.11  ? 1273 GLU D CD    1 
ATOM   8727  O  OE1   . GLU F  5  73  ? 75.236  42.731 -35.120 1.00 53.99  ? 1273 GLU D OE1   1 
ATOM   8728  O  OE2   . GLU F  5  73  ? 73.842  41.935 -36.629 1.00 55.08  ? 1273 GLU D OE2   1 
ATOM   8729  N  N     . ALA F  5  74  ? 73.077  43.909 -30.302 1.00 38.88  ? 1274 ALA D N     1 
ATOM   8730  C  CA    . ALA F  5  74  ? 73.512  44.583 -29.073 1.00 39.07  ? 1274 ALA D CA    1 
ATOM   8731  C  C     . ALA F  5  74  ? 74.029  43.564 -28.056 1.00 37.69  ? 1274 ALA D C     1 
ATOM   8732  O  O     . ALA F  5  74  ? 75.034  43.798 -27.388 1.00 37.86  ? 1274 ALA D O     1 
ATOM   8733  C  CB    . ALA F  5  74  ? 72.362  45.401 -28.468 1.00 38.43  ? 1274 ALA D CB    1 
ATOM   8734  N  N     . SER F  5  75  ? 73.334  42.437 -27.950 1.00 37.93  ? 1275 SER D N     1 
ATOM   8735  C  CA    . SER F  5  75  ? 73.724  41.368 -27.027 1.00 40.73  ? 1275 SER D CA    1 
ATOM   8736  C  C     . SER F  5  75  ? 75.142  40.857 -27.322 1.00 42.29  ? 1275 SER D C     1 
ATOM   8737  O  O     . SER F  5  75  ? 75.990  40.838 -26.436 1.00 41.85  ? 1275 SER D O     1 
ATOM   8738  C  CB    . SER F  5  75  ? 72.726  40.215 -27.113 1.00 40.02  ? 1275 SER D CB    1 
ATOM   8739  O  OG    . SER F  5  75  ? 73.068  39.197 -26.198 1.00 42.90  ? 1275 SER D OG    1 
ATOM   8740  N  N     . ARG F  5  76  ? 75.399  40.480 -28.576 1.00 45.06  ? 1276 ARG D N     1 
ATOM   8741  C  CA    . ARG F  5  76  ? 76.719  39.985 -28.988 1.00 46.14  ? 1276 ARG D CA    1 
ATOM   8742  C  C     . ARG F  5  76  ? 77.766  41.053 -28.722 1.00 46.44  ? 1276 ARG D C     1 
ATOM   8743  O  O     . ARG F  5  76  ? 78.820  40.783 -28.144 1.00 45.51  ? 1276 ARG D O     1 
ATOM   8744  C  CB    . ARG F  5  76  ? 76.736  39.641 -30.487 1.00 47.95  ? 1276 ARG D CB    1 
ATOM   8745  C  CG    . ARG F  5  76  ? 76.061  38.330 -30.856 1.00 50.76  ? 1276 ARG D CG    1 
ATOM   8746  C  CD    . ARG F  5  76  ? 75.797  38.241 -32.358 1.00 54.98  ? 1276 ARG D CD    1 
ATOM   8747  N  NE    . ARG F  5  76  ? 74.415  37.843 -32.609 1.00 58.63  ? 1276 ARG D NE    1 
ATOM   8748  C  CZ    . ARG F  5  76  ? 73.525  38.568 -33.277 1.00 58.35  ? 1276 ARG D CZ    1 
ATOM   8749  N  NH1   . ARG F  5  76  ? 73.863  39.742 -33.788 1.00 61.94  ? 1276 ARG D NH1   1 
ATOM   8750  N  NH2   . ARG F  5  76  ? 72.275  38.140 -33.382 1.00 61.38  ? 1276 ARG D NH2   1 
ATOM   8751  N  N     . LEU F  5  77  ? 77.466  42.271 -29.156 1.00 45.74  ? 1277 LEU D N     1 
ATOM   8752  C  CA    . LEU F  5  77  ? 78.372  43.393 -28.969 1.00 45.91  ? 1277 LEU D CA    1 
ATOM   8753  C  C     . LEU F  5  77  ? 78.799  43.533 -27.499 1.00 45.77  ? 1277 LEU D C     1 
ATOM   8754  O  O     . LEU F  5  77  ? 79.980  43.705 -27.199 1.00 45.72  ? 1277 LEU D O     1 
ATOM   8755  C  CB    . LEU F  5  77  ? 77.713  44.679 -29.464 1.00 45.07  ? 1277 LEU D CB    1 
ATOM   8756  C  CG    . LEU F  5  77  ? 78.578  45.939 -29.436 1.00 48.38  ? 1277 LEU D CG    1 
ATOM   8757  C  CD1   . LEU F  5  77  ? 79.829  45.748 -30.276 1.00 45.27  ? 1277 LEU D CD1   1 
ATOM   8758  C  CD2   . LEU F  5  77  ? 77.764  47.122 -29.937 1.00 50.13  ? 1277 LEU D CD2   1 
ATOM   8759  N  N     . ALA F  5  78  ? 77.838  43.481 -26.585 1.00 45.27  ? 1278 ALA D N     1 
ATOM   8760  C  CA    . ALA F  5  78  ? 78.154  43.585 -25.165 1.00 46.98  ? 1278 ALA D CA    1 
ATOM   8761  C  C     . ALA F  5  78  ? 79.089  42.432 -24.789 1.00 47.84  ? 1278 ALA D C     1 
ATOM   8762  O  O     . ALA F  5  78  ? 80.113  42.631 -24.146 1.00 46.99  ? 1278 ALA D O     1 
ATOM   8763  C  CB    . ALA F  5  78  ? 76.875  43.515 -24.333 1.00 45.88  ? 1278 ALA D CB    1 
ATOM   8764  N  N     . HIS F  5  79  ? 78.739  41.229 -25.225 1.00 49.21  ? 1279 HIS D N     1 
ATOM   8765  C  CA    . HIS F  5  79  ? 79.546  40.053 -24.931 1.00 51.83  ? 1279 HIS D CA    1 
ATOM   8766  C  C     . HIS F  5  79  ? 80.962  40.167 -25.470 1.00 50.72  ? 1279 HIS D C     1 
ATOM   8767  O  O     . HIS F  5  79  ? 81.916  39.886 -24.758 1.00 51.24  ? 1279 HIS D O     1 
ATOM   8768  C  CB    . HIS F  5  79  ? 78.863  38.788 -25.460 1.00 55.20  ? 1279 HIS D CB    1 
ATOM   8769  C  CG    . HIS F  5  79  ? 77.647  38.391 -24.681 1.00 59.37  ? 1279 HIS D CG    1 
ATOM   8770  N  ND1   . HIS F  5  79  ? 77.660  38.237 -23.311 1.00 63.33  ? 1279 HIS D ND1   1 
ATOM   8771  C  CD2   . HIS F  5  79  ? 76.381  38.120 -25.078 1.00 61.69  ? 1279 HIS D CD2   1 
ATOM   8772  C  CE1   . HIS F  5  79  ? 76.453  37.889 -22.897 1.00 63.23  ? 1279 HIS D CE1   1 
ATOM   8773  N  NE2   . HIS F  5  79  ? 75.659  37.812 -23.949 1.00 63.06  ? 1279 HIS D NE2   1 
ATOM   8774  N  N     . TYR F  5  80  ? 81.103  40.597 -26.719 1.00 50.41  ? 1280 TYR D N     1 
ATOM   8775  C  CA    . TYR F  5  80  ? 82.422  40.743 -27.324 1.00 51.90  ? 1280 TYR D CA    1 
ATOM   8776  C  C     . TYR F  5  80  ? 83.320  41.651 -26.498 1.00 52.56  ? 1280 TYR D C     1 
ATOM   8777  O  O     . TYR F  5  80  ? 84.538  41.482 -26.499 1.00 53.48  ? 1280 TYR D O     1 
ATOM   8778  C  CB    . TYR F  5  80  ? 82.328  41.323 -28.745 1.00 52.25  ? 1280 TYR D CB    1 
ATOM   8779  C  CG    . TYR F  5  80  ? 81.564  40.481 -29.749 1.00 54.56  ? 1280 TYR D CG    1 
ATOM   8780  C  CD1   . TYR F  5  80  ? 81.128  41.036 -30.955 1.00 55.16  ? 1280 TYR D CD1   1 
ATOM   8781  C  CD2   . TYR F  5  80  ? 81.282  39.135 -29.504 1.00 55.62  ? 1280 TYR D CD2   1 
ATOM   8782  C  CE1   . TYR F  5  80  ? 80.434  40.276 -31.894 1.00 55.97  ? 1280 TYR D CE1   1 
ATOM   8783  C  CE2   . TYR F  5  80  ? 80.585  38.364 -30.438 1.00 58.31  ? 1280 TYR D CE2   1 
ATOM   8784  C  CZ    . TYR F  5  80  ? 80.165  38.944 -31.633 1.00 57.93  ? 1280 TYR D CZ    1 
ATOM   8785  O  OH    . TYR F  5  80  ? 79.482  38.192 -32.568 1.00 59.28  ? 1280 TYR D OH    1 
ATOM   8786  N  N     . ASN F  5  81  ? 82.725  42.637 -25.832 1.00 52.33  ? 1281 ASN D N     1 
ATOM   8787  C  CA    . ASN F  5  81  ? 83.487  43.582 -25.024 1.00 52.52  ? 1281 ASN D CA    1 
ATOM   8788  C  C     . ASN F  5  81  ? 83.446  43.268 -23.532 1.00 54.13  ? 1281 ASN D C     1 
ATOM   8789  O  O     . ASN F  5  81  ? 83.782  44.114 -22.697 1.00 54.66  ? 1281 ASN D O     1 
ATOM   8790  C  CB    . ASN F  5  81  ? 83.007  45.011 -25.277 1.00 51.53  ? 1281 ASN D CB    1 
ATOM   8791  C  CG    . ASN F  5  81  ? 83.362  45.507 -26.666 1.00 51.85  ? 1281 ASN D CG    1 
ATOM   8792  O  OD1   . ASN F  5  81  ? 84.428  46.085 -26.880 1.00 50.42  ? 1281 ASN D OD1   1 
ATOM   8793  N  ND2   . ASN F  5  81  ? 82.468  45.278 -27.622 1.00 53.18  ? 1281 ASN D ND2   1 
ATOM   8794  N  N     . LYS F  5  82  ? 83.016  42.056 -23.202 1.00 54.56  ? 1282 LYS D N     1 
ATOM   8795  C  CA    . LYS F  5  82  ? 82.951  41.615 -21.812 1.00 57.39  ? 1282 LYS D CA    1 
ATOM   8796  C  C     . LYS F  5  82  ? 82.177  42.558 -20.891 1.00 56.99  ? 1282 LYS D C     1 
ATOM   8797  O  O     . LYS F  5  82  ? 82.632  42.889 -19.802 1.00 56.99  ? 1282 LYS D O     1 
ATOM   8798  C  CB    . LYS F  5  82  ? 84.368  41.390 -21.271 1.00 58.77  ? 1282 LYS D CB    1 
ATOM   8799  C  CG    . LYS F  5  82  ? 85.152  40.345 -22.053 1.00 63.06  ? 1282 LYS D CG    1 
ATOM   8800  C  CD    . LYS F  5  82  ? 86.536  40.136 -21.474 1.00 67.57  ? 1282 LYS D CD    1 
ATOM   8801  C  CE    . LYS F  5  82  ? 87.387  39.258 -22.384 1.00 70.38  ? 1282 LYS D CE    1 
ATOM   8802  N  NZ    . LYS F  5  82  ? 88.851  39.548 -22.221 1.00 72.57  ? 1282 LYS D NZ    1 
ATOM   8803  N  N     . ARG F  5  83  ? 81.013  43.002 -21.350 1.00 57.19  ? 1283 ARG D N     1 
ATOM   8804  C  CA    . ARG F  5  83  ? 80.160  43.884 -20.569 1.00 56.43  ? 1283 ARG D CA    1 
ATOM   8805  C  C     . ARG F  5  83  ? 78.891  43.103 -20.288 1.00 54.83  ? 1283 ARG D C     1 
ATOM   8806  O  O     . ARG F  5  83  ? 78.497  42.254 -21.079 1.00 56.16  ? 1283 ARG D O     1 
ATOM   8807  C  CB    . ARG F  5  83  ? 79.817  45.140 -21.368 1.00 59.18  ? 1283 ARG D CB    1 
ATOM   8808  C  CG    . ARG F  5  83  ? 81.019  45.986 -21.746 1.00 63.97  ? 1283 ARG D CG    1 
ATOM   8809  C  CD    . ARG F  5  83  ? 81.758  46.470 -20.509 1.00 68.65  ? 1283 ARG D CD    1 
ATOM   8810  N  NE    . ARG F  5  83  ? 82.740  47.499 -20.833 1.00 72.07  ? 1283 ARG D NE    1 
ATOM   8811  C  CZ    . ARG F  5  83  ? 84.025  47.438 -20.499 1.00 73.77  ? 1283 ARG D CZ    1 
ATOM   8812  N  NH1   . ARG F  5  83  ? 84.491  46.393 -19.823 1.00 74.93  ? 1283 ARG D NH1   1 
ATOM   8813  N  NH2   . ARG F  5  83  ? 84.847  48.414 -20.860 1.00 75.11  ? 1283 ARG D NH2   1 
ATOM   8814  N  N     . SER F  5  84  ? 78.245  43.379 -19.166 1.00 52.41  ? 1284 SER D N     1 
ATOM   8815  C  CA    . SER F  5  84  ? 77.019  42.666 -18.837 1.00 50.74  ? 1284 SER D CA    1 
ATOM   8816  C  C     . SER F  5  84  ? 75.802  43.577 -18.915 1.00 48.68  ? 1284 SER D C     1 
ATOM   8817  O  O     . SER F  5  84  ? 74.696  43.184 -18.557 1.00 47.49  ? 1284 SER D O     1 
ATOM   8818  C  CB    . SER F  5  84  ? 77.136  42.022 -17.449 1.00 52.14  ? 1284 SER D CB    1 
ATOM   8819  O  OG    . SER F  5  84  ? 77.862  42.853 -16.559 1.00 52.09  ? 1284 SER D OG    1 
ATOM   8820  N  N     . THR F  5  85  ? 76.002  44.768 -19.470 1.00 47.63  ? 1285 THR D N     1 
ATOM   8821  C  CA    . THR F  5  85  ? 74.921  45.737 -19.586 1.00 46.76  ? 1285 THR D CA    1 
ATOM   8822  C  C     . THR F  5  85  ? 74.692  46.250 -21.008 1.00 45.16  ? 1285 THR D C     1 
ATOM   8823  O  O     . THR F  5  85  ? 75.635  46.635 -21.704 1.00 43.29  ? 1285 THR D O     1 
ATOM   8824  C  CB    . THR F  5  85  ? 75.208  46.982 -18.714 1.00 48.63  ? 1285 THR D CB    1 
ATOM   8825  O  OG1   . THR F  5  85  ? 75.697  46.567 -17.435 1.00 50.40  ? 1285 THR D OG1   1 
ATOM   8826  C  CG2   . THR F  5  85  ? 73.933  47.809 -18.521 1.00 47.94  ? 1285 THR D CG2   1 
ATOM   8827  N  N     . ILE F  5  86  ? 73.435  46.267 -21.434 1.00 41.74  ? 1286 ILE D N     1 
ATOM   8828  C  CA    . ILE F  5  86  ? 73.120  46.805 -22.747 1.00 41.63  ? 1286 ILE D CA    1 
ATOM   8829  C  C     . ILE F  5  86  ? 72.659  48.236 -22.513 1.00 41.42  ? 1286 ILE D C     1 
ATOM   8830  O  O     . ILE F  5  86  ? 71.628  48.463 -21.887 1.00 40.00  ? 1286 ILE D O     1 
ATOM   8831  C  CB    . ILE F  5  86  ? 72.006  46.010 -23.463 1.00 39.24  ? 1286 ILE D CB    1 
ATOM   8832  C  CG1   . ILE F  5  86  ? 72.574  44.685 -23.986 1.00 42.94  ? 1286 ILE D CG1   1 
ATOM   8833  C  CG2   . ILE F  5  86  ? 71.420  46.830 -24.613 1.00 36.33  ? 1286 ILE D CG2   1 
ATOM   8834  C  CD1   . ILE F  5  86  ? 71.543  43.791 -24.668 1.00 41.47  ? 1286 ILE D CD1   1 
ATOM   8835  N  N     . THR F  5  87  ? 73.455  49.192 -22.971 1.00 40.74  ? 1287 THR D N     1 
ATOM   8836  C  CA    . THR F  5  87  ? 73.114  50.601 -22.814 1.00 42.93  ? 1287 THR D CA    1 
ATOM   8837  C  C     . THR F  5  87  ? 72.754  51.187 -24.170 1.00 42.83  ? 1287 THR D C     1 
ATOM   8838  O  O     . THR F  5  87  ? 72.869  50.507 -25.197 1.00 41.04  ? 1287 THR D O     1 
ATOM   8839  C  CB    . THR F  5  87  ? 74.294  51.393 -22.239 1.00 43.77  ? 1287 THR D CB    1 
ATOM   8840  O  OG1   . THR F  5  87  ? 75.339  51.465 -23.218 1.00 45.29  ? 1287 THR D OG1   1 
ATOM   8841  C  CG2   . THR F  5  87  ? 74.836  50.694 -20.994 1.00 45.90  ? 1287 THR D CG2   1 
ATOM   8842  N  N     . SER F  5  88  ? 72.355  52.455 -24.178 1.00 40.05  ? 1288 SER D N     1 
ATOM   8843  C  CA    . SER F  5  88  ? 71.984  53.108 -25.423 1.00 42.22  ? 1288 SER D CA    1 
ATOM   8844  C  C     . SER F  5  88  ? 73.152  53.083 -26.389 1.00 41.47  ? 1288 SER D C     1 
ATOM   8845  O  O     . SER F  5  88  ? 72.959  53.080 -27.604 1.00 42.79  ? 1288 SER D O     1 
ATOM   8846  C  CB    . SER F  5  88  ? 71.523  54.550 -25.177 1.00 41.05  ? 1288 SER D CB    1 
ATOM   8847  O  OG    . SER F  5  88  ? 72.557  55.326 -24.624 1.00 43.73  ? 1288 SER D OG    1 
ATOM   8848  N  N     . ARG F  5  89  ? 74.365  53.026 -25.850 1.00 41.76  ? 1289 ARG D N     1 
ATOM   8849  C  CA    . ARG F  5  89  ? 75.553  52.991 -26.695 1.00 43.62  ? 1289 ARG D CA    1 
ATOM   8850  C  C     . ARG F  5  89  ? 75.640  51.680 -27.498 1.00 44.37  ? 1289 ARG D C     1 
ATOM   8851  O  O     . ARG F  5  89  ? 76.071  51.685 -28.650 1.00 40.53  ? 1289 ARG D O     1 
ATOM   8852  C  CB    . ARG F  5  89  ? 76.818  53.201 -25.870 1.00 48.01  ? 1289 ARG D CB    1 
ATOM   8853  C  CG    . ARG F  5  89  ? 78.013  53.557 -26.731 1.00 53.01  ? 1289 ARG D CG    1 
ATOM   8854  C  CD    . ARG F  5  89  ? 79.194  54.033 -25.900 1.00 56.80  ? 1289 ARG D CD    1 
ATOM   8855  N  NE    . ARG F  5  89  ? 80.332  54.336 -26.761 1.00 58.33  ? 1289 ARG D NE    1 
ATOM   8856  C  CZ    . ARG F  5  89  ? 81.229  53.437 -27.151 1.00 57.96  ? 1289 ARG D CZ    1 
ATOM   8857  N  NH1   . ARG F  5  89  ? 81.127  52.179 -26.744 1.00 55.92  ? 1289 ARG D NH1   1 
ATOM   8858  N  NH2   . ARG F  5  89  ? 82.206  53.792 -27.980 1.00 57.37  ? 1289 ARG D NH2   1 
ATOM   8859  N  N     . GLU F  5  90  ? 75.224  50.569 -26.888 1.00 43.64  ? 1290 GLU D N     1 
ATOM   8860  C  CA    . GLU F  5  90  ? 75.226  49.271 -27.568 1.00 43.61  ? 1290 GLU D CA    1 
ATOM   8861  C  C     . GLU F  5  90  ? 74.135  49.306 -28.635 1.00 42.41  ? 1290 GLU D C     1 
ATOM   8862  O  O     . GLU F  5  90  ? 74.342  48.839 -29.760 1.00 41.20  ? 1290 GLU D O     1 
ATOM   8863  C  CB    . GLU F  5  90  ? 74.909  48.135 -26.588 1.00 46.26  ? 1290 GLU D CB    1 
ATOM   8864  C  CG    . GLU F  5  90  ? 75.571  48.274 -25.232 1.00 56.51  ? 1290 GLU D CG    1 
ATOM   8865  C  CD    . GLU F  5  90  ? 77.068  48.306 -25.339 1.00 60.37  ? 1290 GLU D CD    1 
ATOM   8866  O  OE1   . GLU F  5  90  ? 77.611  47.486 -26.107 1.00 66.25  ? 1290 GLU D OE1   1 
ATOM   8867  O  OE2   . GLU F  5  90  ? 77.701  49.152 -24.678 1.00 60.54  ? 1290 GLU D OE2   1 
ATOM   8868  N  N     . ILE F  5  91  ? 72.970  49.851 -28.276 1.00 39.57  ? 1291 ILE D N     1 
ATOM   8869  C  CA    . ILE F  5  91  ? 71.861  49.937 -29.218 1.00 38.04  ? 1291 ILE D CA    1 
ATOM   8870  C  C     . ILE F  5  91  ? 72.287  50.759 -30.436 1.00 37.80  ? 1291 ILE D C     1 
ATOM   8871  O  O     . ILE F  5  91  ? 72.021  50.382 -31.578 1.00 35.79  ? 1291 ILE D O     1 
ATOM   8872  C  CB    . ILE F  5  91  ? 70.595  50.588 -28.581 1.00 38.03  ? 1291 ILE D CB    1 
ATOM   8873  C  CG1   . ILE F  5  91  ? 70.115  49.782 -27.361 1.00 37.59  ? 1291 ILE D CG1   1 
ATOM   8874  C  CG2   . ILE F  5  91  ? 69.471  50.682 -29.620 1.00 36.42  ? 1291 ILE D CG2   1 
ATOM   8875  C  CD1   . ILE F  5  91  ? 69.608  48.358 -27.666 1.00 36.06  ? 1291 ILE D CD1   1 
ATOM   8876  N  N     . GLN F  5  92  ? 72.972  51.871 -30.187 1.00 36.79  ? 1292 GLN D N     1 
ATOM   8877  C  CA    . GLN F  5  92  ? 73.425  52.742 -31.271 1.00 35.79  ? 1292 GLN D CA    1 
ATOM   8878  C  C     . GLN F  5  92  ? 74.382  52.019 -32.206 1.00 34.67  ? 1292 GLN D C     1 
ATOM   8879  O  O     . GLN F  5  92  ? 74.258  52.106 -33.418 1.00 35.16  ? 1292 GLN D O     1 
ATOM   8880  C  CB    . GLN F  5  92  ? 74.086  54.008 -30.715 1.00 36.60  ? 1292 GLN D CB    1 
ATOM   8881  C  CG    . GLN F  5  92  ? 74.663  54.905 -31.782 1.00 37.14  ? 1292 GLN D CG    1 
ATOM   8882  C  CD    . GLN F  5  92  ? 74.945  56.313 -31.261 1.00 42.44  ? 1292 GLN D CD    1 
ATOM   8883  O  OE1   . GLN F  5  92  ? 76.093  56.671 -31.016 1.00 45.35  ? 1292 GLN D OE1   1 
ATOM   8884  N  NE2   . GLN F  5  92  ? 73.895  57.108 -31.090 1.00 37.57  ? 1292 GLN D NE2   1 
ATOM   8885  N  N     . THR F  5  93  ? 75.348  51.308 -31.650 1.00 35.03  ? 1293 THR D N     1 
ATOM   8886  C  CA    . THR F  5  93  ? 76.281  50.586 -32.500 1.00 37.17  ? 1293 THR D CA    1 
ATOM   8887  C  C     . THR F  5  93  ? 75.552  49.482 -33.270 1.00 36.27  ? 1293 THR D C     1 
ATOM   8888  O  O     . THR F  5  93  ? 75.809  49.275 -34.455 1.00 35.90  ? 1293 THR D O     1 
ATOM   8889  C  CB    . THR F  5  93  ? 77.437  50.004 -31.678 1.00 39.45  ? 1293 THR D CB    1 
ATOM   8890  O  OG1   . THR F  5  93  ? 78.194  51.077 -31.105 1.00 38.05  ? 1293 THR D OG1   1 
ATOM   8891  C  CG2   . THR F  5  93  ? 78.359  49.165 -32.556 1.00 38.38  ? 1293 THR D CG2   1 
ATOM   8892  N  N     . ALA F  5  94  ? 74.621  48.800 -32.601 1.00 36.16  ? 1294 ALA D N     1 
ATOM   8893  C  CA    . ALA F  5  94  ? 73.856  47.734 -33.239 1.00 36.18  ? 1294 ALA D CA    1 
ATOM   8894  C  C     . ALA F  5  94  ? 73.064  48.320 -34.411 1.00 37.04  ? 1294 ALA D C     1 
ATOM   8895  O  O     . ALA F  5  94  ? 72.975  47.714 -35.482 1.00 37.65  ? 1294 ALA D O     1 
ATOM   8896  C  CB    . ALA F  5  94  ? 72.913  47.075 -32.235 1.00 33.23  ? 1294 ALA D CB    1 
ATOM   8897  N  N     . VAL F  5  95  ? 72.488  49.503 -34.209 1.00 35.74  ? 1295 VAL D N     1 
ATOM   8898  C  CA    . VAL F  5  95  ? 71.729  50.153 -35.273 1.00 34.27  ? 1295 VAL D CA    1 
ATOM   8899  C  C     . VAL F  5  95  ? 72.628  50.461 -36.486 1.00 33.71  ? 1295 VAL D C     1 
ATOM   8900  O  O     . VAL F  5  95  ? 72.222  50.278 -37.635 1.00 33.65  ? 1295 VAL D O     1 
ATOM   8901  C  CB    . VAL F  5  95  ? 71.065  51.471 -34.777 1.00 36.70  ? 1295 VAL D CB    1 
ATOM   8902  C  CG1   . VAL F  5  95  ? 70.525  52.256 -35.955 1.00 34.53  ? 1295 VAL D CG1   1 
ATOM   8903  C  CG2   . VAL F  5  95  ? 69.935  51.164 -33.785 1.00 33.61  ? 1295 VAL D CG2   1 
ATOM   8904  N  N     A ARG F  5  96  ? 73.850  50.918 -36.232 0.50 32.55  ? 1296 ARG D N     1 
ATOM   8905  N  N     B ARG F  5  96  ? 73.851  50.906 -36.219 0.50 34.56  ? 1296 ARG D N     1 
ATOM   8906  C  CA    A ARG F  5  96  ? 74.763  51.236 -37.329 0.50 32.68  ? 1296 ARG D CA    1 
ATOM   8907  C  CA    B ARG F  5  96  ? 74.792  51.238 -37.287 0.50 36.11  ? 1296 ARG D CA    1 
ATOM   8908  C  C     A ARG F  5  96  ? 75.203  49.989 -38.093 0.50 33.87  ? 1296 ARG D C     1 
ATOM   8909  C  C     B ARG F  5  96  ? 75.221  50.001 -38.076 0.50 36.05  ? 1296 ARG D C     1 
ATOM   8910  O  O     A ARG F  5  96  ? 75.430  50.037 -39.302 0.50 34.61  ? 1296 ARG D O     1 
ATOM   8911  O  O     B ARG F  5  96  ? 75.456  50.068 -39.285 0.50 36.56  ? 1296 ARG D O     1 
ATOM   8912  C  CB    A ARG F  5  96  ? 75.992  51.999 -36.822 0.50 31.20  ? 1296 ARG D CB    1 
ATOM   8913  C  CB    B ARG F  5  96  ? 76.028  51.932 -36.704 0.50 38.23  ? 1296 ARG D CB    1 
ATOM   8914  C  CG    A ARG F  5  96  ? 75.697  53.425 -36.389 0.50 31.67  ? 1296 ARG D CG    1 
ATOM   8915  C  CG    B ARG F  5  96  ? 77.071  52.313 -37.733 0.50 43.86  ? 1296 ARG D CG    1 
ATOM   8916  C  CD    A ARG F  5  96  ? 76.974  54.154 -35.996 0.50 33.19  ? 1296 ARG D CD    1 
ATOM   8917  C  CD    B ARG F  5  96  ? 78.277  53.004 -37.086 0.50 48.15  ? 1296 ARG D CD    1 
ATOM   8918  N  NE    A ARG F  5  96  ? 76.740  55.574 -35.738 0.50 34.93  ? 1296 ARG D NE    1 
ATOM   8919  N  NE    B ARG F  5  96  ? 79.289  53.401 -38.064 0.50 51.02  ? 1296 ARG D NE    1 
ATOM   8920  C  CZ    A ARG F  5  96  ? 77.191  56.236 -34.674 0.50 34.87  ? 1296 ARG D CZ    1 
ATOM   8921  C  CZ    B ARG F  5  96  ? 80.413  54.043 -37.757 0.50 54.39  ? 1296 ARG D CZ    1 
ATOM   8922  N  NH1   A ARG F  5  96  ? 77.906  55.618 -33.740 0.50 32.91  ? 1296 ARG D NH1   1 
ATOM   8923  N  NH1   B ARG F  5  96  ? 80.676  54.357 -36.495 0.50 55.40  ? 1296 ARG D NH1   1 
ATOM   8924  N  NH2   A ARG F  5  96  ? 76.949  57.534 -34.560 0.50 35.89  ? 1296 ARG D NH2   1 
ATOM   8925  N  NH2   B ARG F  5  96  ? 81.264  54.393 -38.713 0.50 56.78  ? 1296 ARG D NH2   1 
ATOM   8926  N  N     . LEU F  5  97  ? 75.354  48.883 -37.375 1.00 34.95  ? 1297 LEU D N     1 
ATOM   8927  C  CA    . LEU F  5  97  ? 75.759  47.631 -37.996 1.00 36.00  ? 1297 LEU D CA    1 
ATOM   8928  C  C     . LEU F  5  97  ? 74.623  47.022 -38.808 1.00 36.89  ? 1297 LEU D C     1 
ATOM   8929  O  O     . LEU F  5  97  ? 74.849  46.459 -39.874 1.00 39.00  ? 1297 LEU D O     1 
ATOM   8930  C  CB    . LEU F  5  97  ? 76.164  46.617 -36.917 1.00 35.73  ? 1297 LEU D CB    1 
ATOM   8931  C  CG    . LEU F  5  97  ? 77.475  46.850 -36.161 1.00 33.98  ? 1297 LEU D CG    1 
ATOM   8932  C  CD1   . LEU F  5  97  ? 77.540  45.971 -34.913 1.00 35.56  ? 1297 LEU D CD1   1 
ATOM   8933  C  CD2   . LEU F  5  97  ? 78.657  46.608 -37.080 1.00 33.99  ? 1297 LEU D CD2   1 
ATOM   8934  N  N     A LEU F  5  98  ? 73.398  47.162 -38.310 0.50 37.85  ? 1298 LEU D N     1 
ATOM   8935  N  N     B LEU F  5  98  ? 73.398  47.153 -38.302 0.50 37.82  ? 1298 LEU D N     1 
ATOM   8936  C  CA    A LEU F  5  98  ? 72.225  46.590 -38.967 0.50 36.90  ? 1298 LEU D CA    1 
ATOM   8937  C  CA    B LEU F  5  98  ? 72.217  46.578 -38.951 0.50 36.74  ? 1298 LEU D CA    1 
ATOM   8938  C  C     A LEU F  5  98  ? 71.580  47.369 -40.100 0.50 38.77  ? 1298 LEU D C     1 
ATOM   8939  C  C     B LEU F  5  98  ? 71.561  47.361 -40.085 0.50 38.81  ? 1298 LEU D C     1 
ATOM   8940  O  O     A LEU F  5  98  ? 71.203  46.796 -41.124 0.50 38.60  ? 1298 LEU D O     1 
ATOM   8941  O  O     B LEU F  5  98  ? 71.147  46.778 -41.091 0.50 38.87  ? 1298 LEU D O     1 
ATOM   8942  C  CB    A LEU F  5  98  ? 71.158  46.274 -37.921 0.50 34.74  ? 1298 LEU D CB    1 
ATOM   8943  C  CB    B LEU F  5  98  ? 71.147  46.264 -37.901 0.50 33.55  ? 1298 LEU D CB    1 
ATOM   8944  C  CG    A LEU F  5  98  ? 71.572  45.198 -36.925 0.50 34.57  ? 1298 LEU D CG    1 
ATOM   8945  C  CG    B LEU F  5  98  ? 69.928  45.487 -38.404 0.50 32.72  ? 1298 LEU D CG    1 
ATOM   8946  C  CD1   A LEU F  5  98  ? 70.504  45.017 -35.865 0.50 33.33  ? 1298 LEU D CD1   1 
ATOM   8947  C  CD1   B LEU F  5  98  ? 70.354  44.058 -38.721 0.50 31.52  ? 1298 LEU D CD1   1 
ATOM   8948  C  CD2   A LEU F  5  98  ? 71.795  43.895 -37.697 0.50 34.60  ? 1298 LEU D CD2   1 
ATOM   8949  C  CD2   B LEU F  5  98  ? 68.815  45.494 -37.371 0.50 27.99  ? 1298 LEU D CD2   1 
ATOM   8950  N  N     . LEU F  5  99  ? 71.394  48.668 -39.907 1.00 38.46  ? 1299 LEU D N     1 
ATOM   8951  C  CA    . LEU F  5  99  ? 70.739  49.491 -40.932 1.00 41.70  ? 1299 LEU D CA    1 
ATOM   8952  C  C     . LEU F  5  99  ? 71.568  50.041 -42.104 1.00 43.48  ? 1299 LEU D C     1 
ATOM   8953  O  O     . LEU F  5  99  ? 72.636  50.563 -41.925 1.00 44.53  ? 1299 LEU D O     1 
ATOM   8954  C  CB    . LEU F  5  99  ? 69.974  50.639 -40.265 1.00 41.11  ? 1299 LEU D CB    1 
ATOM   8955  C  CG    . LEU F  5  99  ? 68.954  50.285 -39.174 1.00 42.75  ? 1299 LEU D CG    1 
ATOM   8956  C  CD1   . LEU F  5  99  ? 68.220  51.558 -38.785 1.00 42.83  ? 1299 LEU D CD1   1 
ATOM   8957  C  CD2   . LEU F  5  99  ? 67.950  49.241 -39.640 1.00 42.07  ? 1299 LEU D CD2   1 
ATOM   8958  N  N     . PRO F  5  100 ? 71.033  49.993 -43.317 1.00 45.45  ? 1300 PRO D N     1 
ATOM   8959  C  CA    . PRO F  5  100 ? 71.789  50.518 -44.454 1.00 46.46  ? 1300 PRO D CA    1 
ATOM   8960  C  C     . PRO F  5  100 ? 71.875  52.048 -44.376 1.00 46.80  ? 1300 PRO D C     1 
ATOM   8961  O  O     . PRO F  5  100 ? 71.011  52.726 -43.808 1.00 48.32  ? 1300 PRO D O     1 
ATOM   8962  C  CB    . PRO F  5  100 ? 70.976  50.053 -45.666 1.00 46.56  ? 1300 PRO D CB    1 
ATOM   8963  C  CG    . PRO F  5  100 ? 69.572  49.907 -45.116 1.00 47.45  ? 1300 PRO D CG    1 
ATOM   8964  C  CD    . PRO F  5  100 ? 69.782  49.350 -43.733 1.00 45.91  ? 1300 PRO D CD    1 
ATOM   8965  N  N     . GLY F  5  101 ? 72.990  52.558 -44.859 1.00 48.35  ? 1301 GLY D N     1 
ATOM   8966  C  CA    . GLY F  5  101 ? 73.255  53.989 -44.909 1.00 47.22  ? 1301 GLY D CA    1 
ATOM   8967  C  C     . GLY F  5  101 ? 72.332  55.036 -44.319 1.00 47.65  ? 1301 GLY D C     1 
ATOM   8968  O  O     . GLY F  5  101 ? 72.411  55.382 -43.130 1.00 47.10  ? 1301 GLY D O     1 
ATOM   8969  N  N     . GLU F  5  102 ? 71.493  55.597 -45.174 1.00 48.50  ? 1302 GLU D N     1 
ATOM   8970  C  CA    . GLU F  5  102 ? 70.573  56.655 -44.769 1.00 49.76  ? 1302 GLU D CA    1 
ATOM   8971  C  C     . GLU F  5  102 ? 69.618  56.318 -43.614 1.00 48.39  ? 1302 GLU D C     1 
ATOM   8972  O  O     . GLU F  5  102 ? 69.313  57.185 -42.791 1.00 47.02  ? 1302 GLU D O     1 
ATOM   8973  C  CB    . GLU F  5  102 ? 69.786  57.141 -45.980 1.00 55.13  ? 1302 GLU D CB    1 
ATOM   8974  C  CG    . GLU F  5  102 ? 69.274  58.552 -45.824 1.00 63.61  ? 1302 GLU D CG    1 
ATOM   8975  C  CD    . GLU F  5  102 ? 70.383  59.545 -45.495 1.00 68.37  ? 1302 GLU D CD    1 
ATOM   8976  O  OE1   . GLU F  5  102 ? 71.450  59.502 -46.147 1.00 69.36  ? 1302 GLU D OE1   1 
ATOM   8977  O  OE2   . GLU F  5  102 ? 70.187  60.368 -44.573 1.00 73.52  ? 1302 GLU D OE2   1 
ATOM   8978  N  N     . LEU F  5  103 ? 69.135  55.078 -43.555 1.00 42.93  ? 1303 LEU D N     1 
ATOM   8979  C  CA    . LEU F  5  103 ? 68.232  54.680 -42.477 1.00 39.79  ? 1303 LEU D CA    1 
ATOM   8980  C  C     . LEU F  5  103 ? 68.962  54.743 -41.143 1.00 39.77  ? 1303 LEU D C     1 
ATOM   8981  O  O     . LEU F  5  103 ? 68.406  55.200 -40.143 1.00 39.10  ? 1303 LEU D O     1 
ATOM   8982  C  CB    . LEU F  5  103 ? 67.697  53.256 -42.693 1.00 40.80  ? 1303 LEU D CB    1 
ATOM   8983  C  CG    . LEU F  5  103 ? 66.580  53.040 -43.718 1.00 40.56  ? 1303 LEU D CG    1 
ATOM   8984  C  CD1   . LEU F  5  103 ? 66.186  51.559 -43.737 1.00 37.54  ? 1303 LEU D CD1   1 
ATOM   8985  C  CD2   . LEU F  5  103 ? 65.374  53.912 -43.362 1.00 38.43  ? 1303 LEU D CD2   1 
ATOM   8986  N  N     . ALA F  5  104 ? 70.206  54.267 -41.124 1.00 38.88  ? 1304 ALA D N     1 
ATOM   8987  C  CA    . ALA F  5  104 ? 70.998  54.283 -39.896 1.00 40.24  ? 1304 ALA D CA    1 
ATOM   8988  C  C     . ALA F  5  104 ? 71.173  55.719 -39.392 1.00 42.52  ? 1304 ALA D C     1 
ATOM   8989  O  O     . ALA F  5  104 ? 70.901  56.010 -38.229 1.00 42.74  ? 1304 ALA D O     1 
ATOM   8990  C  CB    . ALA F  5  104 ? 72.352  53.641 -40.128 1.00 37.88  ? 1304 ALA D CB    1 
ATOM   8991  N  N     . LYS F  5  105 ? 71.589  56.612 -40.284 1.00 43.79  ? 1305 LYS D N     1 
ATOM   8992  C  CA    . LYS F  5  105 ? 71.788  58.011 -39.927 1.00 46.00  ? 1305 LYS D CA    1 
ATOM   8993  C  C     . LYS F  5  105 ? 70.563  58.629 -39.276 1.00 45.62  ? 1305 LYS D C     1 
ATOM   8994  O  O     . LYS F  5  105 ? 70.667  59.250 -38.220 1.00 46.36  ? 1305 LYS D O     1 
ATOM   8995  C  CB    . LYS F  5  105 ? 72.221  58.821 -41.148 1.00 50.55  ? 1305 LYS D CB    1 
ATOM   8996  C  CG    . LYS F  5  105 ? 73.664  58.523 -41.570 1.00 58.70  ? 1305 LYS D CG    1 
ATOM   8997  C  CD    . LYS F  5  105 ? 74.125  59.357 -42.771 1.00 63.59  ? 1305 LYS D CD    1 
ATOM   8998  C  CE    . LYS F  5  105 ? 73.525  58.854 -44.079 1.00 68.59  ? 1305 LYS D CE    1 
ATOM   8999  N  NZ    . LYS F  5  105 ? 74.568  58.541 -45.112 1.00 69.75  ? 1305 LYS D NZ    1 
ATOM   9000  N  N     . HIS F  5  106 ? 69.389  58.405 -39.854 1.00 44.19  ? 1306 HIS D N     1 
ATOM   9001  C  CA    . HIS F  5  106 ? 68.181  58.970 -39.279 1.00 44.00  ? 1306 HIS D CA    1 
ATOM   9002  C  C     . HIS F  5  106 ? 67.732  58.279 -37.997 1.00 43.99  ? 1306 HIS D C     1 
ATOM   9003  O  O     . HIS F  5  106 ? 67.194  58.926 -37.082 1.00 39.58  ? 1306 HIS D O     1 
ATOM   9004  C  CB    . HIS F  5  106 ? 67.061  59.008 -40.312 1.00 46.06  ? 1306 HIS D CB    1 
ATOM   9005  C  CG    . HIS F  5  106 ? 67.265  60.043 -41.375 1.00 51.83  ? 1306 HIS D CG    1 
ATOM   9006  N  ND1   . HIS F  5  106 ? 66.933  59.833 -42.695 1.00 55.43  ? 1306 HIS D ND1   1 
ATOM   9007  C  CD2   . HIS F  5  106 ? 67.772  61.297 -41.310 1.00 52.88  ? 1306 HIS D CD2   1 
ATOM   9008  C  CE1   . HIS F  5  106 ? 67.224  60.913 -43.398 1.00 54.60  ? 1306 HIS D CE1   1 
ATOM   9009  N  NE2   . HIS F  5  106 ? 67.735  61.815 -42.581 1.00 55.51  ? 1306 HIS D NE2   1 
ATOM   9010  N  N     . ALA F  5  107 ? 67.943  56.966 -37.933 1.00 41.72  ? 1307 ALA D N     1 
ATOM   9011  C  CA    . ALA F  5  107 ? 67.567  56.207 -36.747 1.00 41.09  ? 1307 ALA D CA    1 
ATOM   9012  C  C     . ALA F  5  107 ? 68.414  56.702 -35.569 1.00 41.20  ? 1307 ALA D C     1 
ATOM   9013  O  O     . ALA F  5  107 ? 67.904  56.918 -34.468 1.00 41.89  ? 1307 ALA D O     1 
ATOM   9014  C  CB    . ALA F  5  107 ? 67.790  54.702 -36.980 1.00 38.69  ? 1307 ALA D CB    1 
ATOM   9015  N  N     . VAL F  5  108 ? 69.707  56.889 -35.816 1.00 41.80  ? 1308 VAL D N     1 
ATOM   9016  C  CA    . VAL F  5  108 ? 70.636  57.360 -34.790 1.00 44.04  ? 1308 VAL D CA    1 
ATOM   9017  C  C     . VAL F  5  108 ? 70.222  58.721 -34.227 1.00 45.13  ? 1308 VAL D C     1 
ATOM   9018  O  O     . VAL F  5  108 ? 70.302  58.939 -33.021 1.00 43.33  ? 1308 VAL D O     1 
ATOM   9019  C  CB    . VAL F  5  108 ? 72.078  57.444 -35.341 1.00 44.34  ? 1308 VAL D CB    1 
ATOM   9020  C  CG1   . VAL F  5  108 ? 72.996  58.151 -34.340 1.00 44.63  ? 1308 VAL D CG1   1 
ATOM   9021  C  CG2   . VAL F  5  108 ? 72.603  56.042 -35.631 1.00 41.83  ? 1308 VAL D CG2   1 
ATOM   9022  N  N     . SER F  5  109 ? 69.770  59.622 -35.101 1.00 45.41  ? 1309 SER D N     1 
ATOM   9023  C  CA    . SER F  5  109 ? 69.335  60.954 -34.675 1.00 47.39  ? 1309 SER D CA    1 
ATOM   9024  C  C     . SER F  5  109 ? 68.086  60.862 -33.826 1.00 47.04  ? 1309 SER D C     1 
ATOM   9025  O  O     . SER F  5  109 ? 67.992  61.509 -32.789 1.00 46.88  ? 1309 SER D O     1 
ATOM   9026  C  CB    . SER F  5  109 ? 69.070  61.862 -35.880 1.00 47.92  ? 1309 SER D CB    1 
ATOM   9027  O  OG    . SER F  5  109 ? 70.276  62.109 -36.573 1.00 51.82  ? 1309 SER D OG    1 
ATOM   9028  N  N     . GLU F  5  110 ? 67.115  60.077 -34.275 1.00 45.75  ? 1310 GLU D N     1 
ATOM   9029  C  CA    . GLU F  5  110 ? 65.885  59.906 -33.512 1.00 46.64  ? 1310 GLU D CA    1 
ATOM   9030  C  C     . GLU F  5  110 ? 66.223  59.288 -32.156 1.00 45.57  ? 1310 GLU D C     1 
ATOM   9031  O  O     . GLU F  5  110 ? 65.736  59.737 -31.115 1.00 44.02  ? 1310 GLU D O     1 
ATOM   9032  C  CB    . GLU F  5  110 ? 64.915  58.996 -34.262 1.00 50.01  ? 1310 GLU D CB    1 
ATOM   9033  C  CG    . GLU F  5  110 ? 64.459  59.543 -35.596 1.00 57.69  ? 1310 GLU D CG    1 
ATOM   9034  C  CD    . GLU F  5  110 ? 63.199  60.378 -35.486 1.00 62.70  ? 1310 GLU D CD    1 
ATOM   9035  O  OE1   . GLU F  5  110 ? 63.267  61.494 -34.920 1.00 64.30  ? 1310 GLU D OE1   1 
ATOM   9036  O  OE2   . GLU F  5  110 ? 62.138  59.911 -35.968 1.00 65.44  ? 1310 GLU D OE2   1 
ATOM   9037  N  N     . GLY F  5  111 ? 67.083  58.271 -32.172 1.00 42.59  ? 1311 GLY D N     1 
ATOM   9038  C  CA    . GLY F  5  111 ? 67.461  57.607 -30.933 1.00 42.76  ? 1311 GLY D CA    1 
ATOM   9039  C  C     . GLY F  5  111 ? 68.173  58.539 -29.973 1.00 42.82  ? 1311 GLY D C     1 
ATOM   9040  O  O     . GLY F  5  111 ? 67.802  58.650 -28.808 1.00 42.41  ? 1311 GLY D O     1 
ATOM   9041  N  N     . THR F  5  112 ? 69.197  59.216 -30.471 1.00 44.30  ? 1312 THR D N     1 
ATOM   9042  C  CA    . THR F  5  112 ? 69.965  60.148 -29.662 1.00 47.20  ? 1312 THR D CA    1 
ATOM   9043  C  C     . THR F  5  112 ? 69.057  61.236 -29.091 1.00 47.01  ? 1312 THR D C     1 
ATOM   9044  O  O     . THR F  5  112 ? 69.102  61.533 -27.900 1.00 46.92  ? 1312 THR D O     1 
ATOM   9045  C  CB    . THR F  5  112 ? 71.068  60.821 -30.492 1.00 47.86  ? 1312 THR D CB    1 
ATOM   9046  O  OG1   . THR F  5  112 ? 71.904  59.817 -31.080 1.00 50.70  ? 1312 THR D OG1   1 
ATOM   9047  C  CG2   . THR F  5  112 ? 71.918  61.719 -29.609 1.00 48.71  ? 1312 THR D CG2   1 
ATOM   9048  N  N     . LYS F  5  113 ? 68.210  61.800 -29.943 1.00 45.22  ? 1313 LYS D N     1 
ATOM   9049  C  CA    . LYS F  5  113 ? 67.302  62.855 -29.529 1.00 46.96  ? 1313 LYS D CA    1 
ATOM   9050  C  C     . LYS F  5  113 ? 66.373  62.382 -28.409 1.00 45.68  ? 1313 LYS D C     1 
ATOM   9051  O  O     . LYS F  5  113 ? 66.160  63.094 -27.420 1.00 43.40  ? 1313 LYS D O     1 
ATOM   9052  C  CB    . LYS F  5  113 ? 66.491  63.339 -30.734 1.00 50.82  ? 1313 LYS D CB    1 
ATOM   9053  C  CG    . LYS F  5  113 ? 65.705  64.610 -30.491 1.00 58.44  ? 1313 LYS D CG    1 
ATOM   9054  C  CD    . LYS F  5  113 ? 65.136  65.161 -31.796 1.00 63.27  ? 1313 LYS D CD    1 
ATOM   9055  C  CE    . LYS F  5  113 ? 64.606  66.582 -31.610 1.00 68.00  ? 1313 LYS D CE    1 
ATOM   9056  N  NZ    . LYS F  5  113 ? 63.111  66.627 -31.523 1.00 71.18  ? 1313 LYS D NZ    1 
ATOM   9057  N  N     . ALA F  5  114 ? 65.826  61.181 -28.566 1.00 40.54  ? 1314 ALA D N     1 
ATOM   9058  C  CA    . ALA F  5  114 ? 64.918  60.621 -27.576 1.00 40.54  ? 1314 ALA D CA    1 
ATOM   9059  C  C     . ALA F  5  114 ? 65.598  60.466 -26.213 1.00 41.20  ? 1314 ALA D C     1 
ATOM   9060  O  O     . ALA F  5  114 ? 65.014  60.790 -25.179 1.00 41.31  ? 1314 ALA D O     1 
ATOM   9061  C  CB    . ALA F  5  114 ? 64.369  59.274 -28.059 1.00 39.52  ? 1314 ALA D CB    1 
ATOM   9062  N  N     . VAL F  5  115 ? 66.832  59.972 -26.219 1.00 41.17  ? 1315 VAL D N     1 
ATOM   9063  C  CA    . VAL F  5  115 ? 67.594  59.767 -24.988 1.00 43.08  ? 1315 VAL D CA    1 
ATOM   9064  C  C     . VAL F  5  115 ? 67.939  61.102 -24.328 1.00 44.67  ? 1315 VAL D C     1 
ATOM   9065  O  O     . VAL F  5  115 ? 67.750  61.268 -23.127 1.00 44.79  ? 1315 VAL D O     1 
ATOM   9066  C  CB    . VAL F  5  115 ? 68.900  58.974 -25.255 1.00 43.04  ? 1315 VAL D CB    1 
ATOM   9067  C  CG1   . VAL F  5  115 ? 69.785  58.983 -24.024 1.00 42.90  ? 1315 VAL D CG1   1 
ATOM   9068  C  CG2   . VAL F  5  115 ? 68.575  57.540 -25.670 1.00 43.44  ? 1315 VAL D CG2   1 
ATOM   9069  N  N     . THR F  5  116 ? 68.461  62.040 -25.108 1.00 45.58  ? 1316 THR D N     1 
ATOM   9070  C  CA    . THR F  5  116 ? 68.803  63.351 -24.572 1.00 49.21  ? 1316 THR D CA    1 
ATOM   9071  C  C     . THR F  5  116 ? 67.573  64.031 -23.963 1.00 50.43  ? 1316 THR D C     1 
ATOM   9072  O  O     . THR F  5  116 ? 67.675  64.671 -22.914 1.00 52.15  ? 1316 THR D O     1 
ATOM   9073  C  CB    . THR F  5  116 ? 69.410  64.259 -25.649 1.00 49.52  ? 1316 THR D CB    1 
ATOM   9074  O  OG1   . THR F  5  116 ? 70.577  63.628 -26.185 1.00 48.83  ? 1316 THR D OG1   1 
ATOM   9075  C  CG2   . THR F  5  116 ? 69.810  65.610 -25.057 1.00 50.72  ? 1316 THR D CG2   1 
ATOM   9076  N  N     . LYS F  5  117 ? 66.411  63.871 -24.596 1.00 50.18  ? 1317 LYS D N     1 
ATOM   9077  C  CA    . LYS F  5  117 ? 65.186  64.474 -24.081 1.00 51.61  ? 1317 LYS D CA    1 
ATOM   9078  C  C     . LYS F  5  117 ? 64.747  63.784 -22.804 1.00 53.07  ? 1317 LYS D C     1 
ATOM   9079  O  O     . LYS F  5  117 ? 64.371  64.439 -21.826 1.00 52.04  ? 1317 LYS D O     1 
ATOM   9080  C  CB    . LYS F  5  117 ? 64.046  64.410 -25.100 1.00 52.99  ? 1317 LYS D CB    1 
ATOM   9081  C  CG    . LYS F  5  117 ? 62.728  64.945 -24.543 1.00 53.20  ? 1317 LYS D CG    1 
ATOM   9082  C  CD    . LYS F  5  117 ? 61.634  64.985 -25.586 1.00 56.17  ? 1317 LYS D CD    1 
ATOM   9083  C  CE    . LYS F  5  117 ? 60.393  65.682 -25.040 1.00 58.88  ? 1317 LYS D CE    1 
ATOM   9084  N  NZ    . LYS F  5  117 ? 59.204  64.789 -25.043 1.00 59.31  ? 1317 LYS D NZ    1 
ATOM   9085  N  N     . TYR F  5  118 ? 64.764  62.458 -22.828 1.00 51.89  ? 1318 TYR D N     1 
ATOM   9086  C  CA    . TYR F  5  118 ? 64.366  61.675 -21.676 1.00 53.14  ? 1318 TYR D CA    1 
ATOM   9087  C  C     . TYR F  5  118 ? 65.205  61.979 -20.438 1.00 55.45  ? 1318 TYR D C     1 
ATOM   9088  O  O     . TYR F  5  118 ? 64.686  61.977 -19.304 1.00 54.09  ? 1318 TYR D O     1 
ATOM   9089  C  CB    . TYR F  5  118 ? 64.442  60.186 -22.008 1.00 52.87  ? 1318 TYR D CB    1 
ATOM   9090  C  CG    . TYR F  5  118 ? 64.193  59.264 -20.840 1.00 50.48  ? 1318 TYR D CG    1 
ATOM   9091  C  CD1   . TYR F  5  118 ? 62.899  58.862 -20.505 1.00 50.21  ? 1318 TYR D CD1   1 
ATOM   9092  C  CD2   . TYR F  5  118 ? 65.256  58.780 -20.079 1.00 48.97  ? 1318 TYR D CD2   1 
ATOM   9093  C  CE1   . TYR F  5  118 ? 62.669  58.003 -19.441 1.00 51.22  ? 1318 TYR D CE1   1 
ATOM   9094  C  CE2   . TYR F  5  118 ? 65.041  57.918 -19.017 1.00 50.80  ? 1318 TYR D CE2   1 
ATOM   9095  C  CZ    . TYR F  5  118 ? 63.749  57.534 -18.706 1.00 52.41  ? 1318 TYR D CZ    1 
ATOM   9096  O  OH    . TYR F  5  118 ? 63.539  56.662 -17.672 1.00 57.03  ? 1318 TYR D OH    1 
ATOM   9097  N  N     . THR F  5  119 ? 66.491  62.247 -20.647 1.00 58.23  ? 1319 THR D N     1 
ATOM   9098  C  CA    . THR F  5  119 ? 67.361  62.534 -19.521 1.00 64.35  ? 1319 THR D CA    1 
ATOM   9099  C  C     . THR F  5  119 ? 67.267  63.972 -19.006 1.00 67.88  ? 1319 THR D C     1 
ATOM   9100  O  O     . THR F  5  119 ? 67.934  64.337 -18.039 1.00 68.79  ? 1319 THR D O     1 
ATOM   9101  C  CB    . THR F  5  119 ? 68.829  62.161 -19.846 1.00 63.89  ? 1319 THR D CB    1 
ATOM   9102  O  OG1   . THR F  5  119 ? 69.349  63.038 -20.855 1.00 64.07  ? 1319 THR D OG1   1 
ATOM   9103  C  CG2   . THR F  5  119 ? 68.881  60.726 -20.359 1.00 63.31  ? 1319 THR D CG2   1 
ATOM   9104  N  N     . SER F  5  120 ? 66.471  64.805 -19.671 1.00 71.39  ? 1320 SER D N     1 
ATOM   9105  C  CA    . SER F  5  120 ? 66.312  66.182 -19.227 1.00 75.66  ? 1320 SER D CA    1 
ATOM   9106  C  C     . SER F  5  120 ? 64.939  66.268 -18.603 1.00 79.57  ? 1320 SER D C     1 
ATOM   9107  O  O     . SER F  5  120 ? 64.483  67.350 -18.280 1.00 80.70  ? 1320 SER D O     1 
ATOM   9108  C  CB    . SER F  5  120 ? 66.439  67.171 -20.413 1.00 74.47  ? 1320 SER D CB    1 
ATOM   9109  O  OG    . SER F  5  120 ? 65.333  67.036 -21.289 1.00 72.05  ? 1320 SER D OG    1 
ATOM   9110  N  N     . ALA F  5  121 ? 64.308  65.119 -18.365 1.00 83.92  ? 1321 ALA D N     1 
ATOM   9111  C  CA    . ALA F  5  121 ? 62.956  65.123 -17.796 1.00 88.04  ? 1321 ALA D CA    1 
ATOM   9112  C  C     . ALA F  5  121 ? 62.678  64.459 -16.436 1.00 91.29  ? 1321 ALA D C     1 
ATOM   9113  O  O     . ALA F  5  121 ? 61.651  63.786 -16.276 1.00 91.58  ? 1321 ALA D O     1 
ATOM   9114  C  CB    . ALA F  5  121 ? 61.957  64.607 -18.827 1.00 88.09  ? 1321 ALA D CB    1 
ATOM   9115  N  N     . LYS F  5  122 ? 63.562  64.657 -15.459 1.00 94.14  ? 1322 LYS D N     1 
ATOM   9116  C  CA    . LYS F  5  122 ? 63.357  64.094 -14.118 1.00 97.28  ? 1322 LYS D CA    1 
ATOM   9117  C  C     . LYS F  5  122 ? 64.433  64.528 -13.121 1.00 98.48  ? 1322 LYS D C     1 
ATOM   9118  O  O     . LYS F  5  122 ? 65.041  63.646 -12.474 1.00 98.86  ? 1322 LYS D O     1 
ATOM   9119  C  CB    . LYS F  5  122 ? 63.250  62.559 -14.154 1.00 98.37  ? 1322 LYS D CB    1 
ATOM   9120  C  CG    . LYS F  5  122 ? 62.724  61.960 -12.846 1.00 99.88  ? 1322 LYS D CG    1 
ATOM   9121  C  CD    . LYS F  5  122 ? 62.495  60.457 -12.928 1.00 101.47 ? 1322 LYS D CD    1 
ATOM   9122  C  CE    . LYS F  5  122 ? 61.912  59.929 -11.620 1.00 102.70 ? 1322 LYS D CE    1 
ATOM   9123  N  NZ    . LYS F  5  122 ? 61.686  58.454 -11.628 1.00 103.04 ? 1322 LYS D NZ    1 
ATOM   9124  O  OXT   . LYS F  5  122 ? 64.643  65.754 -12.985 1.00 99.45  ? 1322 LYS D OXT   1 
ATOM   9125  N  N     . LYS G  2  37  ? 39.388  32.324 -91.582 1.00 81.29  ? 637  LYS E N     1 
ATOM   9126  C  CA    . LYS G  2  37  ? 39.742  33.757 -91.413 1.00 81.31  ? 637  LYS E CA    1 
ATOM   9127  C  C     . LYS G  2  37  ? 40.103  34.086 -89.955 1.00 83.51  ? 637  LYS E C     1 
ATOM   9128  O  O     . LYS G  2  37  ? 40.616  35.166 -89.672 1.00 83.36  ? 637  LYS E O     1 
ATOM   9129  C  CB    . LYS G  2  37  ? 38.561  34.631 -91.887 1.00 79.92  ? 637  LYS E CB    1 
ATOM   9130  C  CG    . LYS G  2  37  ? 38.939  35.641 -92.939 1.00 79.25  ? 637  LYS E CG    1 
ATOM   9131  C  CD    . LYS G  2  37  ? 40.044  36.561 -92.445 1.00 79.30  ? 637  LYS E CD    1 
ATOM   9132  C  CE    . LYS G  2  37  ? 40.316  37.685 -93.436 1.00 79.93  ? 637  LYS E CE    1 
ATOM   9133  N  NZ    . LYS G  2  37  ? 41.514  38.495 -93.016 1.00 81.76  ? 637  LYS E NZ    1 
ATOM   9134  N  N     . PRO G  2  38  ? 39.684  33.215 -89.003 1.00 81.41  ? 638  PRO E N     1 
ATOM   9135  C  CA    . PRO G  2  38  ? 39.894  33.260 -87.565 1.00 81.36  ? 638  PRO E CA    1 
ATOM   9136  C  C     . PRO G  2  38  ? 41.114  33.955 -86.998 1.00 80.51  ? 638  PRO E C     1 
ATOM   9137  O  O     . PRO G  2  38  ? 42.221  34.034 -87.576 1.00 80.84  ? 638  PRO E O     1 
ATOM   9138  C  CB    . PRO G  2  38  ? 39.844  31.794 -87.208 1.00 81.19  ? 638  PRO E CB    1 
ATOM   9139  C  CG    . PRO G  2  38  ? 38.574  31.421 -87.913 1.00 82.12  ? 638  PRO E CG    1 
ATOM   9140  C  CD    . PRO G  2  38  ? 38.700  32.153 -89.273 1.00 82.95  ? 638  PRO E CD    1 
ATOM   9141  N  N     . HIS G  2  39  ? 40.861  34.532 -85.845 1.00 77.96  ? 639  HIS E N     1 
ATOM   9142  C  CA    . HIS G  2  39  ? 41.874  35.273 -85.181 1.00 75.02  ? 639  HIS E CA    1 
ATOM   9143  C  C     . HIS G  2  39  ? 42.748  34.425 -84.293 1.00 71.17  ? 639  HIS E C     1 
ATOM   9144  O  O     . HIS G  2  39  ? 42.297  33.448 -83.700 1.00 71.07  ? 639  HIS E O     1 
ATOM   9145  C  CB    . HIS G  2  39  ? 41.250  36.416 -84.402 1.00 77.67  ? 639  HIS E CB    1 
ATOM   9146  C  CG    . HIS G  2  39  ? 42.262  37.311 -83.775 1.00 80.42  ? 639  HIS E CG    1 
ATOM   9147  N  ND1   . HIS G  2  39  ? 42.900  37.003 -82.590 1.00 80.93  ? 639  HIS E ND1   1 
ATOM   9148  C  CD2   . HIS G  2  39  ? 42.772  38.498 -84.179 1.00 81.66  ? 639  HIS E CD2   1 
ATOM   9149  C  CE1   . HIS G  2  39  ? 43.753  37.967 -82.291 1.00 81.65  ? 639  HIS E CE1   1 
ATOM   9150  N  NE2   . HIS G  2  39  ? 43.695  38.887 -83.239 1.00 81.80  ? 639  HIS E NE2   1 
ATOM   9151  N  N     . ARG G  2  40  ? 44.021  34.792 -84.230 1.00 66.23  ? 640  ARG E N     1 
ATOM   9152  C  CA    . ARG G  2  40  ? 44.976  34.048 -83.427 1.00 61.07  ? 640  ARG E CA    1 
ATOM   9153  C  C     . ARG G  2  40  ? 46.169  34.917 -83.068 1.00 56.82  ? 640  ARG E C     1 
ATOM   9154  O  O     . ARG G  2  40  ? 46.776  35.547 -83.935 1.00 55.81  ? 640  ARG E O     1 
ATOM   9155  C  CB    . ARG G  2  40  ? 45.438  32.795 -84.189 1.00 61.06  ? 640  ARG E CB    1 
ATOM   9156  C  CG    . ARG G  2  40  ? 46.606  32.080 -83.546 1.00 63.34  ? 640  ARG E CG    1 
ATOM   9157  C  CD    . ARG G  2  40  ? 46.898  30.762 -84.246 1.00 62.72  ? 640  ARG E CD    1 
ATOM   9158  N  NE    . ARG G  2  40  ? 45.898  29.761 -83.900 1.00 61.25  ? 640  ARG E NE    1 
ATOM   9159  C  CZ    . ARG G  2  40  ? 46.063  28.817 -82.978 1.00 60.30  ? 640  ARG E CZ    1 
ATOM   9160  N  NH1   . ARG G  2  40  ? 47.204  28.725 -82.303 1.00 58.68  ? 640  ARG E NH1   1 
ATOM   9161  N  NH2   . ARG G  2  40  ? 45.064  27.993 -82.698 1.00 59.15  ? 640  ARG E NH2   1 
ATOM   9162  N  N     . TYR G  2  41  ? 46.454  35.012 -81.775 1.00 50.96  ? 641  TYR E N     1 
ATOM   9163  C  CA    . TYR G  2  41  ? 47.597  35.796 -81.322 1.00 47.88  ? 641  TYR E CA    1 
ATOM   9164  C  C     . TYR G  2  41  ? 48.872  35.008 -81.601 1.00 45.82  ? 641  TYR E C     1 
ATOM   9165  O  O     . TYR G  2  41  ? 48.858  33.781 -81.617 1.00 45.80  ? 641  TYR E O     1 
ATOM   9166  C  CB    . TYR G  2  41  ? 47.482  36.131 -79.828 1.00 45.42  ? 641  TYR E CB    1 
ATOM   9167  C  CG    . TYR G  2  41  ? 46.446  37.196 -79.518 1.00 44.60  ? 641  TYR E CG    1 
ATOM   9168  C  CD1   . TYR G  2  41  ? 45.253  36.868 -78.876 1.00 44.47  ? 641  TYR E CD1   1 
ATOM   9169  C  CD2   . TYR G  2  41  ? 46.651  38.532 -79.895 1.00 44.52  ? 641  TYR E CD2   1 
ATOM   9170  C  CE1   . TYR G  2  41  ? 44.284  37.843 -78.617 1.00 44.68  ? 641  TYR E CE1   1 
ATOM   9171  C  CE2   . TYR G  2  41  ? 45.688  39.516 -79.646 1.00 43.46  ? 641  TYR E CE2   1 
ATOM   9172  C  CZ    . TYR G  2  41  ? 44.508  39.161 -79.007 1.00 46.07  ? 641  TYR E CZ    1 
ATOM   9173  O  OH    . TYR G  2  41  ? 43.540  40.106 -78.754 1.00 44.79  ? 641  TYR E OH    1 
ATOM   9174  N  N     . ARG G  2  42  ? 49.962  35.711 -81.883 1.00 44.61  ? 642  ARG E N     1 
ATOM   9175  C  CA    . ARG G  2  42  ? 51.228  35.047 -82.162 1.00 44.33  ? 642  ARG E CA    1 
ATOM   9176  C  C     . ARG G  2  42  ? 51.808  34.454 -80.867 1.00 44.70  ? 642  ARG E C     1 
ATOM   9177  O  O     . ARG G  2  42  ? 51.576  34.977 -79.774 1.00 42.31  ? 642  ARG E O     1 
ATOM   9178  C  CB    . ARG G  2  42  ? 52.217  36.042 -82.764 1.00 48.01  ? 642  ARG E CB    1 
ATOM   9179  C  CG    . ARG G  2  42  ? 51.718  36.739 -84.024 1.00 52.89  ? 642  ARG E CG    1 
ATOM   9180  C  CD    . ARG G  2  42  ? 52.708  37.810 -84.478 1.00 57.33  ? 642  ARG E CD    1 
ATOM   9181  N  NE    . ARG G  2  42  ? 53.942  37.233 -85.010 1.00 62.37  ? 642  ARG E NE    1 
ATOM   9182  C  CZ    . ARG G  2  42  ? 55.030  37.937 -85.314 1.00 64.82  ? 642  ARG E CZ    1 
ATOM   9183  N  NH1   . ARG G  2  42  ? 55.041  39.252 -85.135 1.00 66.71  ? 642  ARG E NH1   1 
ATOM   9184  N  NH2   . ARG G  2  42  ? 56.101  37.332 -85.813 1.00 65.68  ? 642  ARG E NH2   1 
ATOM   9185  N  N     . PRO G  2  43  ? 52.586  33.364 -80.980 1.00 44.62  ? 643  PRO E N     1 
ATOM   9186  C  CA    . PRO G  2  43  ? 53.183  32.732 -79.799 1.00 44.03  ? 643  PRO E CA    1 
ATOM   9187  C  C     . PRO G  2  43  ? 54.054  33.720 -79.041 1.00 43.77  ? 643  PRO E C     1 
ATOM   9188  O  O     . PRO G  2  43  ? 54.940  34.360 -79.620 1.00 45.60  ? 643  PRO E O     1 
ATOM   9189  C  CB    . PRO G  2  43  ? 54.005  31.586 -80.401 1.00 42.87  ? 643  PRO E CB    1 
ATOM   9190  C  CG    . PRO G  2  43  ? 54.340  32.090 -81.776 1.00 45.13  ? 643  PRO E CG    1 
ATOM   9191  C  CD    . PRO G  2  43  ? 53.036  32.694 -82.212 1.00 44.61  ? 643  PRO E CD    1 
ATOM   9192  N  N     . GLY G  2  44  ? 53.771  33.861 -77.750 1.00 43.21  ? 644  GLY E N     1 
ATOM   9193  C  CA    . GLY G  2  44  ? 54.523  34.788 -76.923 1.00 41.69  ? 644  GLY E CA    1 
ATOM   9194  C  C     . GLY G  2  44  ? 53.689  35.985 -76.499 1.00 39.79  ? 644  GLY E C     1 
ATOM   9195  O  O     . GLY G  2  44  ? 53.912  36.551 -75.430 1.00 40.24  ? 644  GLY E O     1 
ATOM   9196  N  N     . THR G  2  45  ? 52.705  36.348 -77.319 1.00 37.16  ? 645  THR E N     1 
ATOM   9197  C  CA    . THR G  2  45  ? 51.840  37.496 -77.037 1.00 37.59  ? 645  THR E CA    1 
ATOM   9198  C  C     . THR G  2  45  ? 50.995  37.293 -75.789 1.00 36.44  ? 645  THR E C     1 
ATOM   9199  O  O     . THR G  2  45  ? 50.967  38.147 -74.899 1.00 36.43  ? 645  THR E O     1 
ATOM   9200  C  CB    . THR G  2  45  ? 50.931  37.810 -78.251 1.00 38.94  ? 645  THR E CB    1 
ATOM   9201  O  OG1   . THR G  2  45  ? 51.749  38.208 -79.361 1.00 41.32  ? 645  THR E OG1   1 
ATOM   9202  C  CG2   . THR G  2  45  ? 49.957  38.922 -77.927 1.00 38.78  ? 645  THR E CG2   1 
ATOM   9203  N  N     . VAL G  2  46  ? 50.324  36.150 -75.711 1.00 35.71  ? 646  VAL E N     1 
ATOM   9204  C  CA    . VAL G  2  46  ? 49.496  35.847 -74.556 1.00 34.02  ? 646  VAL E CA    1 
ATOM   9205  C  C     . VAL G  2  46  ? 50.390  35.595 -73.337 1.00 35.37  ? 646  VAL E C     1 
ATOM   9206  O  O     . VAL G  2  46  ? 50.014  35.918 -72.204 1.00 34.08  ? 646  VAL E O     1 
ATOM   9207  C  CB    . VAL G  2  46  ? 48.601  34.618 -74.830 1.00 36.38  ? 646  VAL E CB    1 
ATOM   9208  C  CG1   . VAL G  2  46  ? 47.739  34.277 -73.601 1.00 36.64  ? 646  VAL E CG1   1 
ATOM   9209  C  CG2   . VAL G  2  46  ? 47.704  34.908 -76.026 1.00 37.78  ? 646  VAL E CG2   1 
ATOM   9210  N  N     . ALA G  2  47  ? 51.565  35.008 -73.575 1.00 34.46  ? 647  ALA E N     1 
ATOM   9211  C  CA    . ALA G  2  47  ? 52.509  34.730 -72.497 1.00 35.39  ? 647  ALA E CA    1 
ATOM   9212  C  C     . ALA G  2  47  ? 52.882  36.056 -71.825 1.00 35.06  ? 647  ALA E C     1 
ATOM   9213  O  O     . ALA G  2  47  ? 52.860  36.177 -70.595 1.00 33.21  ? 647  ALA E O     1 
ATOM   9214  C  CB    . ALA G  2  47  ? 53.753  34.052 -73.045 1.00 32.39  ? 647  ALA E CB    1 
ATOM   9215  N  N     . LEU G  2  48  ? 53.206  37.055 -72.644 1.00 36.11  ? 648  LEU E N     1 
ATOM   9216  C  CA    . LEU G  2  48  ? 53.563  38.373 -72.124 1.00 36.30  ? 648  LEU E CA    1 
ATOM   9217  C  C     . LEU G  2  48  ? 52.387  38.989 -71.390 1.00 35.66  ? 648  LEU E C     1 
ATOM   9218  O  O     . LEU G  2  48  ? 52.573  39.663 -70.385 1.00 39.16  ? 648  LEU E O     1 
ATOM   9219  C  CB    . LEU G  2  48  ? 54.035  39.298 -73.251 1.00 37.21  ? 648  LEU E CB    1 
ATOM   9220  C  CG    . LEU G  2  48  ? 55.472  39.046 -73.724 1.00 39.84  ? 648  LEU E CG    1 
ATOM   9221  C  CD1   . LEU G  2  48  ? 55.738  39.752 -75.057 1.00 41.43  ? 648  LEU E CD1   1 
ATOM   9222  C  CD2   . LEU G  2  48  ? 56.455  39.528 -72.651 1.00 41.65  ? 648  LEU E CD2   1 
ATOM   9223  N  N     . ARG G  2  49  ? 51.178  38.739 -71.880 1.00 34.70  ? 649  ARG E N     1 
ATOM   9224  C  CA    . ARG G  2  49  ? 49.977  39.267 -71.258 1.00 36.48  ? 649  ARG E CA    1 
ATOM   9225  C  C     . ARG G  2  49  ? 49.815  38.641 -69.887 1.00 36.88  ? 649  ARG E C     1 
ATOM   9226  O  O     . ARG G  2  49  ? 49.384  39.312 -68.951 1.00 33.53  ? 649  ARG E O     1 
ATOM   9227  C  CB    . ARG G  2  49  ? 48.751  38.926 -72.106 1.00 39.80  ? 649  ARG E CB    1 
ATOM   9228  C  CG    . ARG G  2  49  ? 47.417  39.291 -71.491 1.00 46.09  ? 649  ARG E CG    1 
ATOM   9229  C  CD    . ARG G  2  49  ? 46.263  38.723 -72.322 1.00 50.83  ? 649  ARG E CD    1 
ATOM   9230  N  NE    . ARG G  2  49  ? 46.387  39.087 -73.730 1.00 52.22  ? 649  ARG E NE    1 
ATOM   9231  C  CZ    . ARG G  2  49  ? 45.866  38.394 -74.738 1.00 54.55  ? 649  ARG E CZ    1 
ATOM   9232  N  NH1   . ARG G  2  49  ? 45.169  37.285 -74.516 1.00 54.00  ? 649  ARG E NH1   1 
ATOM   9233  N  NH2   . ARG G  2  49  ? 46.064  38.807 -75.981 1.00 54.95  ? 649  ARG E NH2   1 
ATOM   9234  N  N     . GLU G  2  50  ? 50.111  37.334 -69.794 1.00 33.08  ? 650  GLU E N     1 
ATOM   9235  C  CA    . GLU G  2  50  ? 50.010  36.605 -68.533 1.00 34.13  ? 650  GLU E CA    1 
ATOM   9236  C  C     . GLU G  2  50  ? 51.033  37.140 -67.535 1.00 31.61  ? 650  GLU E C     1 
ATOM   9237  O  O     . GLU G  2  50  ? 50.729  37.279 -66.357 1.00 33.36  ? 650  GLU E O     1 
ATOM   9238  C  CB    . GLU G  2  50  ? 50.197  35.084 -68.744 1.00 35.07  ? 650  GLU E CB    1 
ATOM   9239  C  CG    . GLU G  2  50  ? 48.993  34.450 -69.425 1.00 38.04  ? 650  GLU E CG    1 
ATOM   9240  C  CD    . GLU G  2  50  ? 49.201  32.981 -69.745 1.00 45.04  ? 650  GLU E CD    1 
ATOM   9241  O  OE1   . GLU G  2  50  ? 48.303  32.401 -70.395 1.00 48.57  ? 650  GLU E OE1   1 
ATOM   9242  O  OE2   . GLU G  2  50  ? 50.259  32.410 -69.365 1.00 43.75  ? 650  GLU E OE2   1 
ATOM   9243  N  N     . ILE G  2  51  ? 52.236  37.453 -68.007 1.00 30.55  ? 651  ILE E N     1 
ATOM   9244  C  CA    . ILE G  2  51  ? 53.253  37.975 -67.106 1.00 31.42  ? 651  ILE E CA    1 
ATOM   9245  C  C     . ILE G  2  51  ? 52.743  39.254 -66.452 1.00 32.23  ? 651  ILE E C     1 
ATOM   9246  O  O     . ILE G  2  51  ? 52.761  39.386 -65.229 1.00 31.30  ? 651  ILE E O     1 
ATOM   9247  C  CB    . ILE G  2  51  ? 54.586  38.237 -67.837 1.00 31.11  ? 651  ILE E CB    1 
ATOM   9248  C  CG1   . ILE G  2  51  ? 55.199  36.898 -68.292 1.00 32.21  ? 651  ILE E CG1   1 
ATOM   9249  C  CG2   . ILE G  2  51  ? 55.561  38.985 -66.915 1.00 31.30  ? 651  ILE E CG2   1 
ATOM   9250  C  CD1   . ILE G  2  51  ? 56.388  37.048 -69.242 1.00 30.13  ? 651  ILE E CD1   1 
ATOM   9251  N  N     A ARG G  2  52  ? 52.240  40.177 -67.269 0.50 33.71  ? 652  ARG E N     1 
ATOM   9252  N  N     B ARG G  2  52  ? 52.230  40.170 -67.269 0.50 33.82  ? 652  ARG E N     1 
ATOM   9253  C  CA    A ARG G  2  52  ? 51.739  41.440 -66.748 0.50 35.09  ? 652  ARG E CA    1 
ATOM   9254  C  CA    B ARG G  2  52  ? 51.729  41.435 -66.756 0.50 35.28  ? 652  ARG E CA    1 
ATOM   9255  C  C     A ARG G  2  52  ? 50.593  41.216 -65.783 0.50 34.51  ? 652  ARG E C     1 
ATOM   9256  C  C     B ARG G  2  52  ? 50.594  41.214 -65.782 0.50 34.64  ? 652  ARG E C     1 
ATOM   9257  O  O     A ARG G  2  52  ? 50.522  41.855 -64.732 0.50 34.84  ? 652  ARG E O     1 
ATOM   9258  O  O     B ARG G  2  52  ? 50.532  41.847 -64.727 0.50 34.89  ? 652  ARG E O     1 
ATOM   9259  C  CB    A ARG G  2  52  ? 51.307  42.369 -67.890 0.50 35.99  ? 652  ARG E CB    1 
ATOM   9260  C  CB    B ARG G  2  52  ? 51.275  42.340 -67.905 0.50 36.51  ? 652  ARG E CB    1 
ATOM   9261  C  CG    A ARG G  2  52  ? 52.469  42.884 -68.739 0.50 38.33  ? 652  ARG E CG    1 
ATOM   9262  C  CG    B ARG G  2  52  ? 52.402  42.702 -68.860 0.50 39.02  ? 652  ARG E CG    1 
ATOM   9263  C  CD    A ARG G  2  52  ? 51.992  43.848 -69.824 0.50 39.41  ? 652  ARG E CD    1 
ATOM   9264  C  CD    B ARG G  2  52  ? 51.948  43.681 -69.938 0.50 40.36  ? 652  ARG E CD    1 
ATOM   9265  N  NE    A ARG G  2  52  ? 52.745  43.676 -71.065 0.50 42.22  ? 652  ARG E NE    1 
ATOM   9266  N  NE    B ARG G  2  52  ? 53.006  43.910 -70.925 0.50 41.01  ? 652  ARG E NE    1 
ATOM   9267  C  CZ    A ARG G  2  52  ? 53.937  44.218 -71.294 0.50 40.60  ? 652  ARG E CZ    1 
ATOM   9268  C  CZ    B ARG G  2  52  ? 53.035  43.366 -72.145 0.50 39.18  ? 652  ARG E CZ    1 
ATOM   9269  N  NH1   A ARG G  2  52  ? 54.508  44.973 -70.365 0.50 43.25  ? 652  ARG E NH1   1 
ATOM   9270  N  NH1   B ARG G  2  52  ? 52.080  42.565 -72.557 0.50 37.13  ? 652  ARG E NH1   1 
ATOM   9271  N  NH2   A ARG G  2  52  ? 54.570  43.994 -72.436 0.50 38.87  ? 652  ARG E NH2   1 
ATOM   9272  N  NH2   B ARG G  2  52  ? 54.052  43.582 -72.952 0.50 41.89  ? 652  ARG E NH2   1 
ATOM   9273  N  N     . ARG G  2  53  ? 49.701  40.297 -66.129 1.00 33.95  ? 653  ARG E N     1 
ATOM   9274  C  CA    . ARG G  2  53  ? 48.570  40.008 -65.273 1.00 34.41  ? 653  ARG E CA    1 
ATOM   9275  C  C     . ARG G  2  53  ? 49.007  39.492 -63.894 1.00 34.63  ? 653  ARG E C     1 
ATOM   9276  O  O     . ARG G  2  53  ? 48.573  39.994 -62.854 1.00 35.82  ? 653  ARG E O     1 
ATOM   9277  C  CB    . ARG G  2  53  ? 47.654  38.970 -65.934 1.00 38.08  ? 653  ARG E CB    1 
ATOM   9278  C  CG    . ARG G  2  53  ? 46.459  38.612 -65.063 1.00 40.80  ? 653  ARG E CG    1 
ATOM   9279  C  CD    . ARG G  2  53  ? 45.657  37.430 -65.603 1.00 47.13  ? 653  ARG E CD    1 
ATOM   9280  N  NE    . ARG G  2  53  ? 44.736  36.944 -64.578 1.00 51.89  ? 653  ARG E NE    1 
ATOM   9281  C  CZ    . ARG G  2  53  ? 44.006  35.837 -64.677 1.00 53.96  ? 653  ARG E CZ    1 
ATOM   9282  N  NH1   . ARG G  2  53  ? 44.079  35.077 -65.764 1.00 54.80  ? 653  ARG E NH1   1 
ATOM   9283  N  NH2   . ARG G  2  53  ? 43.204  35.489 -63.680 1.00 54.51  ? 653  ARG E NH2   1 
ATOM   9284  N  N     . TYR G  2  54  ? 49.872  38.484 -63.881 1.00 33.14  ? 654  TYR E N     1 
ATOM   9285  C  CA    . TYR G  2  54  ? 50.301  37.902 -62.611 1.00 32.09  ? 654  TYR E CA    1 
ATOM   9286  C  C     . TYR G  2  54  ? 51.283  38.744 -61.793 1.00 31.47  ? 654  TYR E C     1 
ATOM   9287  O  O     . TYR G  2  54  ? 51.327  38.639 -60.560 1.00 31.59  ? 654  TYR E O     1 
ATOM   9288  C  CB    . TYR G  2  54  ? 50.787  36.460 -62.829 1.00 31.03  ? 654  TYR E CB    1 
ATOM   9289  C  CG    . TYR G  2  54  ? 49.637  35.548 -63.265 1.00 32.12  ? 654  TYR E CG    1 
ATOM   9290  C  CD1   . TYR G  2  54  ? 49.603  34.977 -64.539 1.00 32.47  ? 654  TYR E CD1   1 
ATOM   9291  C  CD2   . TYR G  2  54  ? 48.557  35.316 -62.414 1.00 32.85  ? 654  TYR E CD2   1 
ATOM   9292  C  CE1   . TYR G  2  54  ? 48.508  34.192 -64.952 1.00 34.42  ? 654  TYR E CE1   1 
ATOM   9293  C  CE2   . TYR G  2  54  ? 47.462  34.546 -62.812 1.00 35.03  ? 654  TYR E CE2   1 
ATOM   9294  C  CZ    . TYR G  2  54  ? 47.446  33.991 -64.079 1.00 34.82  ? 654  TYR E CZ    1 
ATOM   9295  O  OH    . TYR G  2  54  ? 46.357  33.268 -64.486 1.00 38.98  ? 654  TYR E OH    1 
ATOM   9296  N  N     . GLN G  2  55  ? 52.063  39.588 -62.459 1.00 30.52  ? 655  GLN E N     1 
ATOM   9297  C  CA    . GLN G  2  55  ? 52.982  40.450 -61.715 1.00 31.58  ? 655  GLN E CA    1 
ATOM   9298  C  C     . GLN G  2  55  ? 52.226  41.594 -61.037 1.00 34.83  ? 655  GLN E C     1 
ATOM   9299  O  O     . GLN G  2  55  ? 52.736  42.231 -60.115 1.00 37.32  ? 655  GLN E O     1 
ATOM   9300  C  CB    . GLN G  2  55  ? 54.088  40.981 -62.612 1.00 31.41  ? 655  GLN E CB    1 
ATOM   9301  C  CG    . GLN G  2  55  ? 55.129  39.912 -62.909 1.00 30.91  ? 655  GLN E CG    1 
ATOM   9302  C  CD    . GLN G  2  55  ? 56.337  40.453 -63.621 1.00 33.75  ? 655  GLN E CD    1 
ATOM   9303  O  OE1   . GLN G  2  55  ? 56.286  41.539 -64.210 1.00 31.91  ? 655  GLN E OE1   1 
ATOM   9304  N  NE2   . GLN G  2  55  ? 57.433  39.682 -63.611 1.00 33.51  ? 655  GLN E NE2   1 
ATOM   9305  N  N     . LYS G  2  56  ? 50.986  41.806 -61.467 1.00 36.65  ? 656  LYS E N     1 
ATOM   9306  C  CA    . LYS G  2  56  ? 50.141  42.858 -60.922 1.00 39.28  ? 656  LYS E CA    1 
ATOM   9307  C  C     . LYS G  2  56  ? 49.304  42.391 -59.743 1.00 39.07  ? 656  LYS E C     1 
ATOM   9308  O  O     . LYS G  2  56  ? 48.897  43.197 -58.904 1.00 39.99  ? 656  LYS E O     1 
ATOM   9309  C  CB    . LYS G  2  56  ? 49.210  43.388 -62.016 1.00 46.02  ? 656  LYS E CB    1 
ATOM   9310  C  CG    . LYS G  2  56  ? 48.212  44.415 -61.539 1.00 52.63  ? 656  LYS E CG    1 
ATOM   9311  C  CD    . LYS G  2  56  ? 47.402  45.000 -62.694 1.00 58.94  ? 656  LYS E CD    1 
ATOM   9312  C  CE    . LYS G  2  56  ? 46.388  46.041 -62.183 1.00 62.90  ? 656  LYS E CE    1 
ATOM   9313  N  NZ    . LYS G  2  56  ? 45.681  46.758 -63.294 1.00 64.07  ? 656  LYS E NZ    1 
ATOM   9314  N  N     . SER G  2  57  ? 49.053  41.087 -59.669 1.00 37.68  ? 657  SER E N     1 
ATOM   9315  C  CA    . SER G  2  57  ? 48.234  40.548 -58.591 1.00 34.19  ? 657  SER E CA    1 
ATOM   9316  C  C     . SER G  2  57  ? 49.045  39.872 -57.484 1.00 33.97  ? 657  SER E C     1 
ATOM   9317  O  O     . SER G  2  57  ? 50.250  39.659 -57.615 1.00 34.50  ? 657  SER E O     1 
ATOM   9318  C  CB    . SER G  2  57  ? 47.205  39.577 -59.171 1.00 38.28  ? 657  SER E CB    1 
ATOM   9319  O  OG    . SER G  2  57  ? 47.853  38.471 -59.773 1.00 38.04  ? 657  SER E OG    1 
ATOM   9320  N  N     . THR G  2  58  ? 48.377  39.488 -56.406 1.00 31.62  ? 658  THR E N     1 
ATOM   9321  C  CA    . THR G  2  58  ? 49.080  38.864 -55.295 1.00 33.44  ? 658  THR E CA    1 
ATOM   9322  C  C     . THR G  2  58  ? 48.451  37.541 -54.850 1.00 33.92  ? 658  THR E C     1 
ATOM   9323  O  O     . THR G  2  58  ? 48.922  36.927 -53.914 1.00 33.30  ? 658  THR E O     1 
ATOM   9324  C  CB    . THR G  2  58  ? 49.062  39.785 -54.065 1.00 33.65  ? 658  THR E CB    1 
ATOM   9325  O  OG1   . THR G  2  58  ? 47.714  39.883 -53.585 1.00 35.32  ? 658  THR E OG1   1 
ATOM   9326  C  CG2   . THR G  2  58  ? 49.561  41.177 -54.431 1.00 35.09  ? 658  THR E CG2   1 
ATOM   9327  N  N     . GLU G  2  59  ? 47.343  37.143 -55.448 1.00 33.74  ? 659  GLU E N     1 
ATOM   9328  C  CA    . GLU G  2  59  ? 46.713  35.894 -55.030 1.00 35.90  ? 659  GLU E CA    1 
ATOM   9329  C  C     . GLU G  2  59  ? 47.596  34.654 -55.248 1.00 33.04  ? 659  GLU E C     1 
ATOM   9330  O  O     . GLU G  2  59  ? 48.413  34.600 -56.169 1.00 31.72  ? 659  GLU E O     1 
ATOM   9331  C  CB    . GLU G  2  59  ? 45.375  35.695 -55.744 1.00 37.65  ? 659  GLU E CB    1 
ATOM   9332  C  CG    . GLU G  2  59  ? 45.464  35.047 -57.125 1.00 43.42  ? 659  GLU E CG    1 
ATOM   9333  C  CD    . GLU G  2  59  ? 45.988  35.987 -58.197 1.00 49.77  ? 659  GLU E CD    1 
ATOM   9334  O  OE1   . GLU G  2  59  ? 46.622  37.014 -57.853 1.00 52.89  ? 659  GLU E OE1   1 
ATOM   9335  O  OE2   . GLU G  2  59  ? 45.760  35.696 -59.391 1.00 50.29  ? 659  GLU E OE2   1 
ATOM   9336  N  N     . LEU G  2  60  ? 47.451  33.675 -54.367 1.00 32.56  ? 660  LEU E N     1 
ATOM   9337  C  CA    . LEU G  2  60  ? 48.204  32.430 -54.507 1.00 34.02  ? 660  LEU E CA    1 
ATOM   9338  C  C     . LEU G  2  60  ? 47.833  31.796 -55.846 1.00 32.49  ? 660  LEU E C     1 
ATOM   9339  O  O     . LEU G  2  60  ? 46.688  31.886 -56.296 1.00 33.22  ? 660  LEU E O     1 
ATOM   9340  C  CB    . LEU G  2  60  ? 47.899  31.490 -53.343 1.00 34.35  ? 660  LEU E CB    1 
ATOM   9341  C  CG    . LEU G  2  60  ? 48.381  32.083 -52.014 1.00 38.37  ? 660  LEU E CG    1 
ATOM   9342  C  CD1   . LEU G  2  60  ? 48.053  31.138 -50.869 1.00 40.73  ? 660  LEU E CD1   1 
ATOM   9343  C  CD2   . LEU G  2  60  ? 49.894  32.341 -52.077 1.00 39.95  ? 660  LEU E CD2   1 
ATOM   9344  N  N     . LEU G  2  61  ? 48.812  31.170 -56.483 1.00 32.52  ? 661  LEU E N     1 
ATOM   9345  C  CA    . LEU G  2  61  ? 48.617  30.580 -57.799 1.00 31.61  ? 661  LEU E CA    1 
ATOM   9346  C  C     . LEU G  2  61  ? 48.441  29.059 -57.843 1.00 33.58  ? 661  LEU E C     1 
ATOM   9347  O  O     . LEU G  2  61  ? 48.089  28.505 -58.888 1.00 30.78  ? 661  LEU E O     1 
ATOM   9348  C  CB    . LEU G  2  61  ? 49.767  31.026 -58.696 1.00 30.57  ? 661  LEU E CB    1 
ATOM   9349  C  CG    . LEU G  2  61  ? 49.896  32.565 -58.698 1.00 33.64  ? 661  LEU E CG    1 
ATOM   9350  C  CD1   . LEU G  2  61  ? 51.187  33.021 -59.387 1.00 33.44  ? 661  LEU E CD1   1 
ATOM   9351  C  CD2   . LEU G  2  61  ? 48.657  33.172 -59.377 1.00 31.98  ? 661  LEU E CD2   1 
ATOM   9352  N  N     . ILE G  2  62  ? 48.742  28.384 -56.736 1.00 32.58  ? 662  ILE E N     1 
ATOM   9353  C  CA    . ILE G  2  62  ? 48.564  26.937 -56.678 1.00 32.06  ? 662  ILE E CA    1 
ATOM   9354  C  C     . ILE G  2  62  ? 47.206  26.657 -56.032 1.00 33.53  ? 662  ILE E C     1 
ATOM   9355  O  O     . ILE G  2  62  ? 46.853  27.306 -55.064 1.00 32.97  ? 662  ILE E O     1 
ATOM   9356  C  CB    . ILE G  2  62  ? 49.668  26.246 -55.823 1.00 31.62  ? 662  ILE E CB    1 
ATOM   9357  C  CG1   . ILE G  2  62  ? 51.045  26.462 -56.454 1.00 29.98  ? 662  ILE E CG1   1 
ATOM   9358  C  CG2   . ILE G  2  62  ? 49.395  24.717 -55.728 1.00 31.48  ? 662  ILE E CG2   1 
ATOM   9359  C  CD1   . ILE G  2  62  ? 52.190  25.867 -55.640 1.00 30.73  ? 662  ILE E CD1   1 
ATOM   9360  N  N     . ARG G  2  63  ? 46.444  25.711 -56.577 1.00 34.64  ? 663  ARG E N     1 
ATOM   9361  C  CA    . ARG G  2  63  ? 45.154  25.332 -56.005 1.00 36.71  ? 663  ARG E CA    1 
ATOM   9362  C  C     . ARG G  2  63  ? 45.348  25.013 -54.514 1.00 36.03  ? 663  ARG E C     1 
ATOM   9363  O  O     . ARG G  2  63  ? 46.264  24.273 -54.147 1.00 36.13  ? 663  ARG E O     1 
ATOM   9364  C  CB    . ARG G  2  63  ? 44.598  24.119 -56.743 1.00 42.14  ? 663  ARG E CB    1 
ATOM   9365  C  CG    . ARG G  2  63  ? 44.257  24.349 -58.231 1.00 48.86  ? 663  ARG E CG    1 
ATOM   9366  C  CD    . ARG G  2  63  ? 43.013  25.210 -58.369 1.00 54.74  ? 663  ARG E CD    1 
ATOM   9367  N  NE    . ARG G  2  63  ? 43.363  26.623 -58.303 1.00 62.28  ? 663  ARG E NE    1 
ATOM   9368  C  CZ    . ARG G  2  63  ? 42.590  27.574 -57.792 1.00 64.64  ? 663  ARG E CZ    1 
ATOM   9369  N  NH1   . ARG G  2  63  ? 41.403  27.264 -57.288 1.00 65.84  ? 663  ARG E NH1   1 
ATOM   9370  N  NH2   . ARG G  2  63  ? 43.003  28.840 -57.802 1.00 66.08  ? 663  ARG E NH2   1 
ATOM   9371  N  N     A LYS G  2  64  ? 44.478  25.572 -53.662 0.50 36.35  ? 664  LYS E N     1 
ATOM   9372  N  N     B LYS G  2  64  ? 44.473  25.537 -53.697 0.50 36.50  ? 664  LYS E N     1 
ATOM   9373  C  CA    A LYS G  2  64  ? 44.591  25.357 -52.215 0.50 36.45  ? 664  LYS E CA    1 
ATOM   9374  C  CA    B LYS G  2  64  ? 44.536  25.380 -52.252 0.50 36.45  ? 664  LYS E CA    1 
ATOM   9375  C  C     A LYS G  2  64  ? 44.469  23.911 -51.692 0.50 38.21  ? 664  LYS E C     1 
ATOM   9376  C  C     B LYS G  2  64  ? 44.476  23.949 -51.715 0.50 38.55  ? 664  LYS E C     1 
ATOM   9377  O  O     A LYS G  2  64  ? 45.259  23.471 -50.866 0.50 37.06  ? 664  LYS E O     1 
ATOM   9378  O  O     B LYS G  2  64  ? 45.380  23.534 -50.964 0.50 38.00  ? 664  LYS E O     1 
ATOM   9379  C  CB    A LYS G  2  64  ? 43.581  26.224 -51.463 0.50 37.13  ? 664  LYS E CB    1 
ATOM   9380  C  CB    B LYS G  2  64  ? 43.429  26.221 -51.615 0.50 36.67  ? 664  LYS E CB    1 
ATOM   9381  C  CG    A LYS G  2  64  ? 43.723  27.734 -51.571 0.50 40.23  ? 664  LYS E CG    1 
ATOM   9382  C  CG    B LYS G  2  64  ? 43.423  26.174 -50.122 0.50 37.50  ? 664  LYS E CG    1 
ATOM   9383  C  CD    A LYS G  2  64  ? 45.036  28.217 -51.022 0.50 41.45  ? 664  LYS E CD    1 
ATOM   9384  C  CD    B LYS G  2  64  ? 42.273  26.987 -49.586 0.50 40.52  ? 664  LYS E CD    1 
ATOM   9385  C  CE    A LYS G  2  64  ? 45.188  29.699 -51.272 0.50 45.09  ? 664  LYS E CE    1 
ATOM   9386  C  CE    B LYS G  2  64  ? 42.110  26.787 -48.102 0.50 40.10  ? 664  LYS E CE    1 
ATOM   9387  N  NZ    A LYS G  2  64  ? 43.950  30.438 -50.888 0.50 42.92  ? 664  LYS E NZ    1 
ATOM   9388  N  NZ    B LYS G  2  64  ? 40.806  27.344 -47.671 0.50 46.76  ? 664  LYS E NZ    1 
ATOM   9389  N  N     . LEU G  2  65  ? 43.414  23.215 -52.061 1.00 38.73  ? 665  LEU E N     1 
ATOM   9390  C  CA    . LEU G  2  65  ? 43.237  21.843 -51.582 1.00 38.42  ? 665  LEU E CA    1 
ATOM   9391  C  C     . LEU G  2  65  ? 44.395  20.938 -52.003 1.00 37.67  ? 665  LEU E C     1 
ATOM   9392  O  O     . LEU G  2  65  ? 44.972  20.242 -51.171 1.00 37.66  ? 665  LEU E O     1 
ATOM   9393  C  CB    . LEU G  2  65  ? 41.890  21.260 -52.018 1.00 40.16  ? 665  LEU E CB    1 
ATOM   9394  C  CG    . LEU G  2  65  ? 41.565  19.813 -51.605 1.00 39.44  ? 665  LEU E CG    1 
ATOM   9395  C  CD1   . LEU G  2  65  ? 41.668  19.646 -50.094 1.00 38.60  ? 665  LEU E CD1   1 
ATOM   9396  C  CD2   . LEU G  2  65  ? 40.155  19.444 -52.065 1.00 41.54  ? 665  LEU E CD2   1 
ATOM   9397  N  N     . PRO G  2  66  ? 44.751  20.928 -53.300 1.00 37.36  ? 666  PRO E N     1 
ATOM   9398  C  CA    . PRO G  2  66  ? 45.871  20.066 -53.699 1.00 35.80  ? 666  PRO E CA    1 
ATOM   9399  C  C     . PRO G  2  66  ? 47.139  20.383 -52.892 1.00 35.74  ? 666  PRO E C     1 
ATOM   9400  O  O     . PRO G  2  66  ? 47.861  19.472 -52.479 1.00 31.37  ? 666  PRO E O     1 
ATOM   9401  C  CB    . PRO G  2  66  ? 46.055  20.408 -55.175 1.00 36.02  ? 666  PRO E CB    1 
ATOM   9402  C  CG    . PRO G  2  66  ? 44.655  20.707 -55.629 1.00 35.90  ? 666  PRO E CG    1 
ATOM   9403  C  CD    . PRO G  2  66  ? 44.120  21.554 -54.476 1.00 37.59  ? 666  PRO E CD    1 
ATOM   9404  N  N     . PHE G  2  67  ? 47.429  21.669 -52.674 1.00 34.32  ? 667  PHE E N     1 
ATOM   9405  C  CA    . PHE G  2  67  ? 48.623  22.012 -51.899 1.00 32.86  ? 667  PHE E CA    1 
ATOM   9406  C  C     . PHE G  2  67  ? 48.522  21.436 -50.483 1.00 32.24  ? 667  PHE E C     1 
ATOM   9407  O  O     . PHE G  2  67  ? 49.489  20.869 -49.971 1.00 29.01  ? 667  PHE E O     1 
ATOM   9408  C  CB    . PHE G  2  67  ? 48.837  23.521 -51.816 1.00 32.79  ? 667  PHE E CB    1 
ATOM   9409  C  CG    . PHE G  2  67  ? 50.140  23.908 -51.164 1.00 30.85  ? 667  PHE E CG    1 
ATOM   9410  C  CD1   . PHE G  2  67  ? 51.329  23.894 -51.893 1.00 29.97  ? 667  PHE E CD1   1 
ATOM   9411  C  CD2   . PHE G  2  67  ? 50.175  24.299 -49.835 1.00 29.05  ? 667  PHE E CD2   1 
ATOM   9412  C  CE1   . PHE G  2  67  ? 52.538  24.272 -51.295 1.00 28.13  ? 667  PHE E CE1   1 
ATOM   9413  C  CE2   . PHE G  2  67  ? 51.378  24.678 -49.227 1.00 29.87  ? 667  PHE E CE2   1 
ATOM   9414  C  CZ    . PHE G  2  67  ? 52.557  24.664 -49.959 1.00 28.87  ? 667  PHE E CZ    1 
ATOM   9415  N  N     . GLN G  2  68  ? 47.352  21.576 -49.859 1.00 33.23  ? 668  GLN E N     1 
ATOM   9416  C  CA    . GLN G  2  68  ? 47.154  21.043 -48.508 1.00 37.97  ? 668  GLN E CA    1 
ATOM   9417  C  C     . GLN G  2  68  ? 47.439  19.527 -48.401 1.00 37.00  ? 668  GLN E C     1 
ATOM   9418  O  O     . GLN G  2  68  ? 48.046  19.067 -47.433 1.00 36.08  ? 668  GLN E O     1 
ATOM   9419  C  CB    . GLN G  2  68  ? 45.744  21.342 -48.003 1.00 41.24  ? 668  GLN E CB    1 
ATOM   9420  C  CG    . GLN G  2  68  ? 45.556  20.942 -46.557 1.00 50.32  ? 668  GLN E CG    1 
ATOM   9421  C  CD    . GLN G  2  68  ? 44.208  21.343 -46.012 1.00 55.53  ? 668  GLN E CD    1 
ATOM   9422  O  OE1   . GLN G  2  68  ? 43.321  20.507 -45.845 1.00 59.15  ? 668  GLN E OE1   1 
ATOM   9423  N  NE2   . GLN G  2  68  ? 44.049  22.626 -45.714 1.00 57.37  ? 668  GLN E NE2   1 
ATOM   9424  N  N     . ARG G  2  69  ? 47.016  18.760 -49.399 1.00 35.93  ? 669  ARG E N     1 
ATOM   9425  C  CA    . ARG G  2  69  ? 47.262  17.316 -49.395 1.00 39.10  ? 669  ARG E CA    1 
ATOM   9426  C  C     . ARG G  2  69  ? 48.736  17.020 -49.476 1.00 38.23  ? 669  ARG E C     1 
ATOM   9427  O  O     . ARG G  2  69  ? 49.224  16.061 -48.873 1.00 37.45  ? 669  ARG E O     1 
ATOM   9428  C  CB    . ARG G  2  69  ? 46.644  16.673 -50.615 1.00 40.44  ? 669  ARG E CB    1 
ATOM   9429  C  CG    . ARG G  2  69  ? 45.282  16.149 -50.394 1.00 46.25  ? 669  ARG E CG    1 
ATOM   9430  C  CD    . ARG G  2  69  ? 44.861  15.420 -51.645 1.00 49.55  ? 669  ARG E CD    1 
ATOM   9431  N  NE    . ARG G  2  69  ? 43.534  15.845 -52.020 1.00 50.91  ? 669  ARG E NE    1 
ATOM   9432  C  CZ    . ARG G  2  69  ? 43.220  16.415 -53.175 1.00 51.47  ? 669  ARG E CZ    1 
ATOM   9433  N  NH1   . ARG G  2  69  ? 44.139  16.630 -54.104 1.00 49.99  ? 669  ARG E NH1   1 
ATOM   9434  N  NH2   . ARG G  2  69  ? 41.971  16.795 -53.381 1.00 51.83  ? 669  ARG E NH2   1 
ATOM   9435  N  N     . LEU G  2  70  ? 49.412  17.784 -50.329 1.00 33.94  ? 670  LEU E N     1 
ATOM   9436  C  CA    . LEU G  2  70  ? 50.835  17.617 -50.517 1.00 33.04  ? 670  LEU E CA    1 
ATOM   9437  C  C     . LEU G  2  70  ? 51.510  17.805 -49.174 1.00 32.29  ? 670  LEU E C     1 
ATOM   9438  O  O     . LEU G  2  70  ? 52.329  16.983 -48.776 1.00 32.98  ? 670  LEU E O     1 
ATOM   9439  C  CB    . LEU G  2  70  ? 51.359  18.637 -51.525 1.00 34.22  ? 670  LEU E CB    1 
ATOM   9440  C  CG    . LEU G  2  70  ? 52.869  18.616 -51.719 1.00 34.43  ? 670  LEU E CG    1 
ATOM   9441  C  CD1   . LEU G  2  70  ? 53.293  17.209 -52.151 1.00 32.57  ? 670  LEU E CD1   1 
ATOM   9442  C  CD2   . LEU G  2  70  ? 53.267  19.660 -52.752 1.00 31.71  ? 670  LEU E CD2   1 
ATOM   9443  N  N     . VAL G  2  71  ? 51.137  18.880 -48.474 1.00 31.82  ? 671  VAL E N     1 
ATOM   9444  C  CA    . VAL G  2  71  ? 51.697  19.184 -47.162 1.00 31.52  ? 671  VAL E CA    1 
ATOM   9445  C  C     . VAL G  2  71  ? 51.396  18.044 -46.184 1.00 32.50  ? 671  VAL E C     1 
ATOM   9446  O  O     . VAL G  2  71  ? 52.279  17.604 -45.464 1.00 30.66  ? 671  VAL E O     1 
ATOM   9447  C  CB    . VAL G  2  71  ? 51.139  20.517 -46.588 1.00 29.45  ? 671  VAL E CB    1 
ATOM   9448  C  CG1   . VAL G  2  71  ? 51.447  20.635 -45.091 1.00 28.93  ? 671  VAL E CG1   1 
ATOM   9449  C  CG2   . VAL G  2  71  ? 51.756  21.714 -47.347 1.00 33.18  ? 671  VAL E CG2   1 
ATOM   9450  N  N     . ARG G  2  72  ? 50.140  17.595 -46.137 1.00 33.42  ? 672  ARG E N     1 
ATOM   9451  C  CA    . ARG G  2  72  ? 49.760  16.502 -45.238 1.00 35.98  ? 672  ARG E CA    1 
ATOM   9452  C  C     . ARG G  2  72  ? 50.487  15.196 -45.590 1.00 34.92  ? 672  ARG E C     1 
ATOM   9453  O  O     . ARG G  2  72  ? 50.953  14.482 -44.702 1.00 37.41  ? 672  ARG E O     1 
ATOM   9454  C  CB    . ARG G  2  72  ? 48.240  16.303 -45.242 1.00 38.46  ? 672  ARG E CB    1 
ATOM   9455  C  CG    . ARG G  2  72  ? 47.498  17.404 -44.513 1.00 40.95  ? 672  ARG E CG    1 
ATOM   9456  C  CD    . ARG G  2  72  ? 45.996  17.227 -44.614 1.00 45.95  ? 672  ARG E CD    1 
ATOM   9457  N  NE    . ARG G  2  72  ? 45.280  18.422 -44.176 1.00 47.80  ? 672  ARG E NE    1 
ATOM   9458  C  CZ    . ARG G  2  72  ? 45.082  18.757 -42.904 1.00 50.18  ? 672  ARG E CZ    1 
ATOM   9459  N  NH1   . ARG G  2  72  ? 45.547  17.987 -41.923 1.00 47.70  ? 672  ARG E NH1   1 
ATOM   9460  N  NH2   . ARG G  2  72  ? 44.411  19.863 -42.611 1.00 48.67  ? 672  ARG E NH2   1 
ATOM   9461  N  N     . GLU G  2  73  ? 50.648  14.925 -46.882 1.00 34.83  ? 673  GLU E N     1 
ATOM   9462  C  CA    . GLU G  2  73  ? 51.342  13.714 -47.308 1.00 34.92  ? 673  GLU E CA    1 
ATOM   9463  C  C     . GLU G  2  73  ? 52.802  13.754 -46.843 1.00 36.84  ? 673  GLU E C     1 
ATOM   9464  O  O     . GLU G  2  73  ? 53.299  12.803 -46.244 1.00 36.03  ? 673  GLU E O     1 
ATOM   9465  C  CB    . GLU G  2  73  ? 51.294  13.580 -48.822 1.00 36.34  ? 673  GLU E CB    1 
ATOM   9466  C  CG    . GLU G  2  73  ? 52.034  12.361 -49.359 1.00 37.24  ? 673  GLU E CG    1 
ATOM   9467  C  CD    . GLU G  2  73  ? 52.051  12.304 -50.882 1.00 39.50  ? 673  GLU E CD    1 
ATOM   9468  O  OE1   . GLU G  2  73  ? 50.967  12.404 -51.504 1.00 41.83  ? 673  GLU E OE1   1 
ATOM   9469  O  OE2   . GLU G  2  73  ? 53.150  12.148 -51.458 1.00 41.60  ? 673  GLU E OE2   1 
ATOM   9470  N  N     . ILE G  2  74  ? 53.487  14.865 -47.111 1.00 35.83  ? 674  ILE E N     1 
ATOM   9471  C  CA    . ILE G  2  74  ? 54.882  14.997 -46.703 1.00 32.47  ? 674  ILE E CA    1 
ATOM   9472  C  C     . ILE G  2  74  ? 55.039  14.947 -45.187 1.00 32.39  ? 674  ILE E C     1 
ATOM   9473  O  O     . ILE G  2  74  ? 55.940  14.278 -44.680 1.00 33.79  ? 674  ILE E O     1 
ATOM   9474  C  CB    . ILE G  2  74  ? 55.515  16.326 -47.222 1.00 33.91  ? 674  ILE E CB    1 
ATOM   9475  C  CG1   . ILE G  2  74  ? 55.669  16.281 -48.743 1.00 33.78  ? 674  ILE E CG1   1 
ATOM   9476  C  CG2   . ILE G  2  74  ? 56.874  16.572 -46.557 1.00 30.28  ? 674  ILE E CG2   1 
ATOM   9477  C  CD1   . ILE G  2  74  ? 56.112  17.641 -49.364 1.00 34.39  ? 674  ILE E CD1   1 
ATOM   9478  N  N     . ALA G  2  75  ? 54.177  15.665 -44.463 1.00 31.54  ? 675  ALA E N     1 
ATOM   9479  C  CA    . ALA G  2  75  ? 54.272  15.701 -43.007 1.00 32.18  ? 675  ALA E CA    1 
ATOM   9480  C  C     . ALA G  2  75  ? 54.067  14.301 -42.419 1.00 35.69  ? 675  ALA E C     1 
ATOM   9481  O  O     . ALA G  2  75  ? 54.735  13.915 -41.468 1.00 33.20  ? 675  ALA E O     1 
ATOM   9482  C  CB    . ALA G  2  75  ? 53.239  16.645 -42.433 1.00 31.32  ? 675  ALA E CB    1 
ATOM   9483  N  N     . GLN G  2  76  ? 53.114  13.576 -42.989 1.00 36.99  ? 676  GLN E N     1 
ATOM   9484  C  CA    . GLN G  2  76  ? 52.763  12.233 -42.549 1.00 40.25  ? 676  GLN E CA    1 
ATOM   9485  C  C     . GLN G  2  76  ? 53.941  11.283 -42.656 1.00 39.33  ? 676  GLN E C     1 
ATOM   9486  O  O     . GLN G  2  76  ? 54.128  10.434 -41.791 1.00 40.33  ? 676  GLN E O     1 
ATOM   9487  C  CB    . GLN G  2  76  ? 51.593  11.716 -43.379 1.00 41.84  ? 676  GLN E CB    1 
ATOM   9488  C  CG    . GLN G  2  76  ? 50.931  10.460 -42.839 1.00 46.29  ? 676  GLN E CG    1 
ATOM   9489  C  CD    . GLN G  2  76  ? 49.766  10.054 -43.702 1.00 44.67  ? 676  GLN E CD    1 
ATOM   9490  O  OE1   . GLN G  2  76  ? 49.920  9.903  -44.904 1.00 46.70  ? 676  GLN E OE1   1 
ATOM   9491  N  NE2   . GLN G  2  76  ? 48.589  9.907  -43.104 1.00 47.09  ? 676  GLN E NE2   1 
ATOM   9492  N  N     . ASP G  2  77  ? 54.736  11.427 -43.713 1.00 39.18  ? 677  ASP E N     1 
ATOM   9493  C  CA    . ASP G  2  77  ? 55.900  10.569 -43.885 1.00 40.96  ? 677  ASP E CA    1 
ATOM   9494  C  C     . ASP G  2  77  ? 56.939  10.839 -42.801 1.00 42.93  ? 677  ASP E C     1 
ATOM   9495  O  O     . ASP G  2  77  ? 57.733  9.971  -42.463 1.00 42.30  ? 677  ASP E O     1 
ATOM   9496  C  CB    . ASP G  2  77  ? 56.491  10.723 -45.294 1.00 40.23  ? 677  ASP E CB    1 
ATOM   9497  C  CG    . ASP G  2  77  ? 55.628  10.025 -46.368 1.00 42.21  ? 677  ASP E CG    1 
ATOM   9498  O  OD1   . ASP G  2  77  ? 54.912  9.066  -45.997 1.00 37.82  ? 677  ASP E OD1   1 
ATOM   9499  O  OD2   . ASP G  2  77  ? 55.649  10.433 -47.556 1.00 40.64  ? 677  ASP E OD2   1 
ATOM   9500  N  N     A PHE G  2  78  ? 56.927  12.053 -42.260 0.50 41.49  ? 678  PHE E N     1 
ATOM   9501  N  N     B PHE G  2  78  ? 56.920  12.049 -42.255 0.50 43.62  ? 678  PHE E N     1 
ATOM   9502  C  CA    A PHE G  2  78  ? 57.859  12.420 -41.202 0.50 41.80  ? 678  PHE E CA    1 
ATOM   9503  C  CA    B PHE G  2  78  ? 57.862  12.418 -41.209 0.50 45.31  ? 678  PHE E CA    1 
ATOM   9504  C  C     A PHE G  2  78  ? 57.316  11.982 -39.850 0.50 43.28  ? 678  PHE E C     1 
ATOM   9505  C  C     B PHE G  2  78  ? 57.322  12.006 -39.844 0.50 45.65  ? 678  PHE E C     1 
ATOM   9506  O  O     A PHE G  2  78  ? 58.048  11.432 -39.032 0.50 43.29  ? 678  PHE E O     1 
ATOM   9507  O  O     B PHE G  2  78  ? 58.059  11.476 -39.018 0.50 45.70  ? 678  PHE E O     1 
ATOM   9508  C  CB    A PHE G  2  78  ? 58.078  13.937 -41.157 0.50 39.51  ? 678  PHE E CB    1 
ATOM   9509  C  CB    B PHE G  2  78  ? 58.117  13.928 -41.235 0.50 46.92  ? 678  PHE E CB    1 
ATOM   9510  C  CG    A PHE G  2  78  ? 58.981  14.462 -42.232 0.50 37.00  ? 678  PHE E CG    1 
ATOM   9511  C  CG    B PHE G  2  78  ? 59.153  14.390 -40.250 0.50 48.75  ? 678  PHE E CG    1 
ATOM   9512  C  CD1   A PHE G  2  78  ? 58.655  15.628 -42.915 0.50 36.09  ? 678  PHE E CD1   1 
ATOM   9513  C  CD1   B PHE G  2  78  ? 60.497  14.450 -40.609 0.50 50.64  ? 678  PHE E CD1   1 
ATOM   9514  C  CD2   A PHE G  2  78  ? 60.184  13.832 -42.526 0.50 37.32  ? 678  PHE E CD2   1 
ATOM   9515  C  CD2   B PHE G  2  78  ? 58.789  14.792 -38.969 0.50 48.63  ? 678  PHE E CD2   1 
ATOM   9516  C  CE1   A PHE G  2  78  ? 59.510  16.168 -43.875 0.50 32.63  ? 678  PHE E CE1   1 
ATOM   9517  C  CE1   B PHE G  2  78  ? 61.461  14.911 -39.699 0.50 50.68  ? 678  PHE E CE1   1 
ATOM   9518  C  CE2   A PHE G  2  78  ? 61.047  14.365 -43.488 0.50 36.97  ? 678  PHE E CE2   1 
ATOM   9519  C  CE2   B PHE G  2  78  ? 59.748  15.252 -38.060 0.50 48.17  ? 678  PHE E CE2   1 
ATOM   9520  C  CZ    A PHE G  2  78  ? 60.702  15.543 -44.163 0.50 35.76  ? 678  PHE E CZ    1 
ATOM   9521  C  CZ    B PHE G  2  78  ? 61.079  15.311 -38.428 0.50 48.05  ? 678  PHE E CZ    1 
ATOM   9522  N  N     . LYS G  2  79  ? 56.027  12.220 -39.626 1.00 44.45  ? 679  LYS E N     1 
ATOM   9523  C  CA    . LYS G  2  79  ? 55.397  11.880 -38.353 1.00 47.23  ? 679  LYS E CA    1 
ATOM   9524  C  C     . LYS G  2  79  ? 53.899  11.682 -38.546 1.00 49.24  ? 679  LYS E C     1 
ATOM   9525  O  O     . LYS G  2  79  ? 53.213  12.568 -39.064 1.00 47.01  ? 679  LYS E O     1 
ATOM   9526  C  CB    . LYS G  2  79  ? 55.627  13.025 -37.363 1.00 49.38  ? 679  LYS E CB    1 
ATOM   9527  C  CG    . LYS G  2  79  ? 55.875  12.606 -35.935 1.00 54.18  ? 679  LYS E CG    1 
ATOM   9528  C  CD    . LYS G  2  79  ? 54.615  12.157 -35.248 1.00 59.12  ? 679  LYS E CD    1 
ATOM   9529  C  CE    . LYS G  2  79  ? 54.901  11.762 -33.807 1.00 59.98  ? 679  LYS E CE    1 
ATOM   9530  N  NZ    . LYS G  2  79  ? 53.636  11.608 -33.040 1.00 64.21  ? 679  LYS E NZ    1 
ATOM   9531  N  N     . THR G  2  80  ? 53.393  10.525 -38.124 1.00 49.78  ? 680  THR E N     1 
ATOM   9532  C  CA    . THR G  2  80  ? 51.971  10.204 -38.267 1.00 51.35  ? 680  THR E CA    1 
ATOM   9533  C  C     . THR G  2  80  ? 51.113  10.887 -37.216 1.00 51.40  ? 680  THR E C     1 
ATOM   9534  O  O     . THR G  2  80  ? 51.620  11.369 -36.206 1.00 53.49  ? 680  THR E O     1 
ATOM   9535  C  CB    . THR G  2  80  ? 51.717  8.677  -38.139 1.00 54.03  ? 680  THR E CB    1 
ATOM   9536  O  OG1   . THR G  2  80  ? 52.267  8.208  -36.899 1.00 55.59  ? 680  THR E OG1   1 
ATOM   9537  C  CG2   . THR G  2  80  ? 52.355  7.919  -39.295 1.00 54.87  ? 680  THR E CG2   1 
ATOM   9538  N  N     . ASP G  2  81  ? 49.809  10.926 -37.470 1.00 52.64  ? 681  ASP E N     1 
ATOM   9539  C  CA    . ASP G  2  81  ? 48.850  11.508 -36.539 1.00 55.60  ? 681  ASP E CA    1 
ATOM   9540  C  C     . ASP G  2  81  ? 48.999  13.001 -36.254 1.00 54.42  ? 681  ASP E C     1 
ATOM   9541  O  O     . ASP G  2  81  ? 48.646  13.468 -35.165 1.00 55.20  ? 681  ASP E O     1 
ATOM   9542  C  CB    . ASP G  2  81  ? 48.871  10.736 -35.214 1.00 60.25  ? 681  ASP E CB    1 
ATOM   9543  C  CG    . ASP G  2  81  ? 48.612  9.250  -35.401 1.00 65.44  ? 681  ASP E CG    1 
ATOM   9544  O  OD1   . ASP G  2  81  ? 49.525  8.445  -35.102 1.00 68.58  ? 681  ASP E OD1   1 
ATOM   9545  O  OD2   . ASP G  2  81  ? 47.504  8.887  -35.857 1.00 67.48  ? 681  ASP E OD2   1 
ATOM   9546  N  N     . LEU G  2  82  ? 49.486  13.757 -37.231 1.00 51.59  ? 682  LEU E N     1 
ATOM   9547  C  CA    . LEU G  2  82  ? 49.643  15.200 -37.048 1.00 48.26  ? 682  LEU E CA    1 
ATOM   9548  C  C     . LEU G  2  82  ? 48.413  15.961 -37.524 1.00 46.21  ? 682  LEU E C     1 
ATOM   9549  O  O     . LEU G  2  82  ? 47.752  15.552 -38.475 1.00 45.93  ? 682  LEU E O     1 
ATOM   9550  C  CB    . LEU G  2  82  ? 50.854  15.714 -37.834 1.00 45.10  ? 682  LEU E CB    1 
ATOM   9551  C  CG    . LEU G  2  82  ? 52.272  15.371 -37.377 1.00 44.38  ? 682  LEU E CG    1 
ATOM   9552  C  CD1   . LEU G  2  82  ? 53.271  15.771 -38.460 1.00 43.27  ? 682  LEU E CD1   1 
ATOM   9553  C  CD2   . LEU G  2  82  ? 52.583  16.074 -36.068 1.00 41.72  ? 682  LEU E CD2   1 
ATOM   9554  N  N     . ARG G  2  83  ? 48.098  17.052 -36.835 1.00 45.27  ? 683  ARG E N     1 
ATOM   9555  C  CA    . ARG G  2  83  ? 46.994  17.930 -37.224 1.00 45.46  ? 683  ARG E CA    1 
ATOM   9556  C  C     . ARG G  2  83  ? 47.671  19.237 -37.693 1.00 44.49  ? 683  ARG E C     1 
ATOM   9557  O  O     . ARG G  2  83  ? 48.832  19.494 -37.364 1.00 42.73  ? 683  ARG E O     1 
ATOM   9558  C  CB    . ARG G  2  83  ? 46.090  18.241 -36.024 1.00 48.87  ? 683  ARG E CB    1 
ATOM   9559  C  CG    . ARG G  2  83  ? 45.456  17.017 -35.382 1.00 56.08  ? 683  ARG E CG    1 
ATOM   9560  C  CD    . ARG G  2  83  ? 44.277  17.388 -34.493 1.00 58.46  ? 683  ARG E CD    1 
ATOM   9561  N  NE    . ARG G  2  83  ? 43.157  16.500 -34.772 1.00 65.85  ? 683  ARG E NE    1 
ATOM   9562  C  CZ    . ARG G  2  83  ? 41.884  16.876 -34.815 1.00 67.62  ? 683  ARG E CZ    1 
ATOM   9563  N  NH1   . ARG G  2  83  ? 41.546  18.140 -34.585 1.00 68.40  ? 683  ARG E NH1   1 
ATOM   9564  N  NH2   . ARG G  2  83  ? 40.954  15.990 -35.141 1.00 69.20  ? 683  ARG E NH2   1 
ATOM   9565  N  N     . PHE G  2  84  ? 46.932  20.080 -38.402 1.00 42.18  ? 684  PHE E N     1 
ATOM   9566  C  CA    . PHE G  2  84  ? 47.470  21.351 -38.893 1.00 40.75  ? 684  PHE E CA    1 
ATOM   9567  C  C     . PHE G  2  84  ? 46.479  22.490 -38.689 1.00 39.92  ? 684  PHE E C     1 
ATOM   9568  O  O     . PHE G  2  84  ? 45.296  22.330 -38.974 1.00 41.15  ? 684  PHE E O     1 
ATOM   9569  C  CB    . PHE G  2  84  ? 47.736  21.271 -40.404 1.00 39.92  ? 684  PHE E CB    1 
ATOM   9570  C  CG    . PHE G  2  84  ? 49.084  20.720 -40.772 1.00 38.02  ? 684  PHE E CG    1 
ATOM   9571  C  CD1   . PHE G  2  84  ? 49.268  19.354 -40.941 1.00 38.31  ? 684  PHE E CD1   1 
ATOM   9572  C  CD2   . PHE G  2  84  ? 50.164  21.576 -40.985 1.00 35.51  ? 684  PHE E CD2   1 
ATOM   9573  C  CE1   . PHE G  2  84  ? 50.513  18.840 -41.321 1.00 38.97  ? 684  PHE E CE1   1 
ATOM   9574  C  CE2   . PHE G  2  84  ? 51.410  21.080 -41.365 1.00 37.07  ? 684  PHE E CE2   1 
ATOM   9575  C  CZ    . PHE G  2  84  ? 51.591  19.711 -41.534 1.00 37.90  ? 684  PHE E CZ    1 
ATOM   9576  N  N     . GLN G  2  85  ? 46.946  23.623 -38.170 1.00 39.65  ? 685  GLN E N     1 
ATOM   9577  C  CA    . GLN G  2  85  ? 46.077  24.794 -38.044 1.00 39.13  ? 685  GLN E CA    1 
ATOM   9578  C  C     . GLN G  2  85  ? 45.940  25.236 -39.502 1.00 38.59  ? 685  GLN E C     1 
ATOM   9579  O  O     . GLN G  2  85  ? 46.869  25.057 -40.295 1.00 36.60  ? 685  GLN E O     1 
ATOM   9580  C  CB    . GLN G  2  85  ? 46.758  25.918 -37.242 1.00 40.24  ? 685  GLN E CB    1 
ATOM   9581  C  CG    . GLN G  2  85  ? 46.860  25.672 -35.735 1.00 43.22  ? 685  GLN E CG    1 
ATOM   9582  C  CD    . GLN G  2  85  ? 47.427  26.873 -34.975 1.00 47.73  ? 685  GLN E CD    1 
ATOM   9583  O  OE1   . GLN G  2  85  ? 48.145  27.708 -35.544 1.00 48.57  ? 685  GLN E OE1   1 
ATOM   9584  N  NE2   . GLN G  2  85  ? 47.108  26.962 -33.681 1.00 44.24  ? 685  GLN E NE2   1 
ATOM   9585  N  N     . SER G  2  86  ? 44.797  25.782 -39.884 1.00 38.45  ? 686  SER E N     1 
ATOM   9586  C  CA    . SER G  2  86  ? 44.643  26.202 -41.268 1.00 38.22  ? 686  SER E CA    1 
ATOM   9587  C  C     . SER G  2  86  ? 45.668  27.281 -41.650 1.00 36.87  ? 686  SER E C     1 
ATOM   9588  O  O     . SER G  2  86  ? 46.107  27.342 -42.793 1.00 36.28  ? 686  SER E O     1 
ATOM   9589  C  CB    . SER G  2  86  ? 43.223  26.698 -41.538 1.00 39.07  ? 686  SER E CB    1 
ATOM   9590  O  OG    . SER G  2  86  ? 42.925  27.843 -40.762 1.00 46.67  ? 686  SER E OG    1 
ATOM   9591  N  N     . SER G  2  87  ? 46.055  28.121 -40.696 1.00 34.86  ? 687  SER E N     1 
ATOM   9592  C  CA    . SER G  2  87  ? 47.030  29.166 -40.979 1.00 34.82  ? 687  SER E CA    1 
ATOM   9593  C  C     . SER G  2  87  ? 48.437  28.585 -41.175 1.00 34.34  ? 687  SER E C     1 
ATOM   9594  O  O     . SER G  2  87  ? 49.281  29.222 -41.794 1.00 34.36  ? 687  SER E O     1 
ATOM   9595  C  CB    . SER G  2  87  ? 47.040  30.231 -39.875 1.00 35.30  ? 687  SER E CB    1 
ATOM   9596  O  OG    . SER G  2  87  ? 47.474  29.680 -38.641 1.00 42.73  ? 687  SER E OG    1 
ATOM   9597  N  N     . ALA G  2  88  ? 48.707  27.400 -40.624 1.00 32.61  ? 688  ALA E N     1 
ATOM   9598  C  CA    . ALA G  2  88  ? 50.021  26.790 -40.805 1.00 30.67  ? 688  ALA E CA    1 
ATOM   9599  C  C     . ALA G  2  88  ? 50.158  26.400 -42.267 1.00 31.51  ? 688  ALA E C     1 
ATOM   9600  O  O     . ALA G  2  88  ? 51.208  26.595 -42.877 1.00 29.93  ? 688  ALA E O     1 
ATOM   9601  C  CB    . ALA G  2  88  ? 50.190  25.556 -39.912 1.00 34.28  ? 688  ALA E CB    1 
ATOM   9602  N  N     . VAL G  2  89  ? 49.082  25.875 -42.842 1.00 30.88  ? 689  VAL E N     1 
ATOM   9603  C  CA    . VAL G  2  89  ? 49.119  25.475 -44.241 1.00 31.68  ? 689  VAL E CA    1 
ATOM   9604  C  C     . VAL G  2  89  ? 49.252  26.695 -45.159 1.00 32.90  ? 689  VAL E C     1 
ATOM   9605  O  O     . VAL G  2  89  ? 49.953  26.624 -46.154 1.00 31.71  ? 689  VAL E O     1 
ATOM   9606  C  CB    . VAL G  2  89  ? 47.875  24.649 -44.640 1.00 32.87  ? 689  VAL E CB    1 
ATOM   9607  C  CG1   . VAL G  2  89  ? 47.942  24.292 -46.138 1.00 30.47  ? 689  VAL E CG1   1 
ATOM   9608  C  CG2   . VAL G  2  89  ? 47.819  23.349 -43.806 1.00 33.93  ? 689  VAL E CG2   1 
ATOM   9609  N  N     A MET G  2  90  ? 48.578  27.800 -44.820 0.50 32.75  ? 690  MET E N     1 
ATOM   9610  N  N     B MET G  2  90  ? 48.564  27.779 -44.835 0.50 33.10  ? 690  MET E N     1 
ATOM   9611  C  CA    A MET G  2  90  ? 48.625  29.015 -45.622 0.50 33.91  ? 690  MET E CA    1 
ATOM   9612  C  CA    B MET G  2  90  ? 48.645  28.997 -45.647 0.50 34.29  ? 690  MET E CA    1 
ATOM   9613  C  C     A MET G  2  90  ? 50.012  29.634 -45.572 0.50 32.44  ? 690  MET E C     1 
ATOM   9614  C  C     B MET G  2  90  ? 50.058  29.571 -45.582 0.50 32.98  ? 690  MET E C     1 
ATOM   9615  O  O     A MET G  2  90  ? 50.495  30.138 -46.594 0.50 33.83  ? 690  MET E O     1 
ATOM   9616  O  O     B MET G  2  90  ? 50.597  30.019 -46.583 0.50 34.48  ? 690  MET E O     1 
ATOM   9617  C  CB    A MET G  2  90  ? 47.575  30.004 -45.120 0.50 35.82  ? 690  MET E CB    1 
ATOM   9618  C  CB    B MET G  2  90  ? 47.646  30.085 -45.197 0.50 36.61  ? 690  MET E CB    1 
ATOM   9619  C  CG    A MET G  2  90  ? 46.148  29.544 -45.318 0.50 39.80  ? 690  MET E CG    1 
ATOM   9620  C  CG    B MET G  2  90  ? 46.187  29.684 -45.267 0.50 39.59  ? 690  MET E CG    1 
ATOM   9621  S  SD    A MET G  2  90  ? 45.911  28.734 -46.903 0.50 45.39  ? 690  MET E SD    1 
ATOM   9622  S  SD    B MET G  2  90  ? 45.067  31.067 -44.848 0.50 46.25  ? 690  MET E SD    1 
ATOM   9623  C  CE    A MET G  2  90  ? 46.223  30.024 -48.015 0.50 41.25  ? 690  MET E CE    1 
ATOM   9624  C  CE    B MET G  2  90  ? 45.581  31.437 -43.143 0.50 34.78  ? 690  MET E CE    1 
ATOM   9625  N  N     . ALA G  2  91  ? 50.653  29.561 -44.393 1.00 32.67  ? 691  ALA E N     1 
ATOM   9626  C  CA    . ALA G  2  91  ? 52.008  30.086 -44.213 1.00 31.67  ? 691  ALA E CA    1 
ATOM   9627  C  C     . ALA G  2  91  ? 52.960  29.288 -45.107 1.00 31.75  ? 691  ALA E C     1 
ATOM   9628  O  O     . ALA G  2  91  ? 53.805  29.865 -45.800 1.00 29.62  ? 691  ALA E O     1 
ATOM   9629  C  CB    . ALA G  2  91  ? 52.439  29.998 -42.763 1.00 30.01  ? 691  ALA E CB    1 
ATOM   9630  N  N     . LEU G  2  92  ? 52.797  27.965 -45.125 1.00 29.36  ? 692  LEU E N     1 
ATOM   9631  C  CA    . LEU G  2  92  ? 53.624  27.119 -45.980 1.00 29.04  ? 692  LEU E CA    1 
ATOM   9632  C  C     . LEU G  2  92  ? 53.395  27.461 -47.455 1.00 29.09  ? 692  LEU E C     1 
ATOM   9633  O  O     . LEU G  2  92  ? 54.345  27.470 -48.241 1.00 30.22  ? 692  LEU E O     1 
ATOM   9634  C  CB    . LEU G  2  92  ? 53.322  25.628 -45.759 1.00 27.23  ? 692  LEU E CB    1 
ATOM   9635  C  CG    . LEU G  2  92  ? 53.884  25.016 -44.468 1.00 30.87  ? 692  LEU E CG    1 
ATOM   9636  C  CD1   . LEU G  2  92  ? 53.229  23.657 -44.161 1.00 33.39  ? 692  LEU E CD1   1 
ATOM   9637  C  CD2   . LEU G  2  92  ? 55.391  24.845 -44.613 1.00 26.59  ? 692  LEU E CD2   1 
ATOM   9638  N  N     . GLN G  2  93  ? 52.143  27.705 -47.842 1.00 28.27  ? 693  GLN E N     1 
ATOM   9639  C  CA    . GLN G  2  93  ? 51.861  28.022 -49.239 1.00 28.59  ? 693  GLN E CA    1 
ATOM   9640  C  C     . GLN G  2  93  ? 52.415  29.383 -49.652 1.00 27.98  ? 693  GLN E C     1 
ATOM   9641  O  O     . GLN G  2  93  ? 52.939  29.523 -50.749 1.00 30.08  ? 693  GLN E O     1 
ATOM   9642  C  CB    . GLN G  2  93  ? 50.361  27.955 -49.565 1.00 30.30  ? 693  GLN E CB    1 
ATOM   9643  C  CG    . GLN G  2  93  ? 50.140  27.897 -51.069 1.00 31.44  ? 693  GLN E CG    1 
ATOM   9644  C  CD    . GLN G  2  93  ? 48.705  27.576 -51.479 1.00 37.21  ? 693  GLN E CD    1 
ATOM   9645  O  OE1   . GLN G  2  93  ? 47.866  27.196 -50.655 1.00 33.49  ? 693  GLN E OE1   1 
ATOM   9646  N  NE2   . GLN G  2  93  ? 48.419  27.746 -52.769 1.00 35.59  ? 693  GLN E NE2   1 
ATOM   9647  N  N     . GLU G  2  94  ? 52.256  30.396 -48.799 1.00 29.69  ? 694  GLU E N     1 
ATOM   9648  C  CA    . GLU G  2  94  ? 52.801  31.732 -49.110 1.00 28.07  ? 694  GLU E CA    1 
ATOM   9649  C  C     . GLU G  2  94  ? 54.320  31.623 -49.241 1.00 27.09  ? 694  GLU E C     1 
ATOM   9650  O  O     . GLU G  2  94  ? 54.925  32.156 -50.174 1.00 27.49  ? 694  GLU E O     1 
ATOM   9651  C  CB    . GLU G  2  94  ? 52.455  32.723 -47.994 1.00 28.06  ? 694  GLU E CB    1 
ATOM   9652  C  CG    . GLU G  2  94  ? 50.973  33.091 -47.933 1.00 31.86  ? 694  GLU E CG    1 
ATOM   9653  C  CD    . GLU G  2  94  ? 50.588  34.183 -48.935 1.00 37.46  ? 694  GLU E CD    1 
ATOM   9654  O  OE1   . GLU G  2  94  ? 51.489  34.842 -49.513 1.00 36.29  ? 694  GLU E OE1   1 
ATOM   9655  O  OE2   . GLU G  2  94  ? 49.370  34.401 -49.124 1.00 42.25  ? 694  GLU E OE2   1 
ATOM   9656  N  N     . ALA G  2  95  ? 54.944  30.891 -48.327 1.00 25.52  ? 695  ALA E N     1 
ATOM   9657  C  CA    . ALA G  2  95  ? 56.409  30.728 -48.387 1.00 26.71  ? 695  ALA E CA    1 
ATOM   9658  C  C     . ALA G  2  95  ? 56.836  29.929 -49.615 1.00 26.43  ? 695  ALA E C     1 
ATOM   9659  O  O     . ALA G  2  95  ? 57.792  30.282 -50.301 1.00 27.35  ? 695  ALA E O     1 
ATOM   9660  C  CB    . ALA G  2  95  ? 56.922  30.055 -47.139 1.00 28.51  ? 695  ALA E CB    1 
ATOM   9661  N  N     . SER G  2  96  ? 56.099  28.868 -49.921 1.00 26.85  ? 696  SER E N     1 
ATOM   9662  C  CA    . SER G  2  96  ? 56.453  28.028 -51.066 1.00 27.40  ? 696  SER E CA    1 
ATOM   9663  C  C     . SER G  2  96  ? 56.340  28.780 -52.387 1.00 24.55  ? 696  SER E C     1 
ATOM   9664  O  O     . SER G  2  96  ? 57.186  28.637 -53.254 1.00 26.59  ? 696  SER E O     1 
ATOM   9665  C  CB    . SER G  2  96  ? 55.564  26.769 -51.123 1.00 29.99  ? 696  SER E CB    1 
ATOM   9666  O  OG    . SER G  2  96  ? 55.812  25.890 -50.034 1.00 30.53  ? 696  SER E OG    1 
ATOM   9667  N  N     . GLU G  2  97  ? 55.267  29.544 -52.553 1.00 26.80  ? 697  GLU E N     1 
ATOM   9668  C  CA    . GLU G  2  97  ? 55.084  30.285 -53.797 1.00 26.27  ? 697  GLU E CA    1 
ATOM   9669  C  C     . GLU G  2  97  ? 56.105  31.397 -53.970 1.00 26.22  ? 697  GLU E C     1 
ATOM   9670  O  O     . GLU G  2  97  ? 56.594  31.593 -55.078 1.00 27.72  ? 697  GLU E O     1 
ATOM   9671  C  CB    . GLU G  2  97  ? 53.644  30.797 -53.951 1.00 28.71  ? 697  GLU E CB    1 
ATOM   9672  C  CG    . GLU G  2  97  ? 52.622  29.638 -54.065 1.00 33.33  ? 697  GLU E CG    1 
ATOM   9673  C  CD    . GLU G  2  97  ? 51.284  30.038 -54.684 1.00 36.98  ? 697  GLU E CD    1 
ATOM   9674  O  OE1   . GLU G  2  97  ? 51.198  31.106 -55.347 1.00 36.47  ? 697  GLU E OE1   1 
ATOM   9675  O  OE2   . GLU G  2  97  ? 50.317  29.256 -54.524 1.00 39.39  ? 697  GLU E OE2   1 
ATOM   9676  N  N     . ALA G  2  98  ? 56.465  32.073 -52.872 1.00 26.70  ? 698  ALA E N     1 
ATOM   9677  C  CA    . ALA G  2  98  ? 57.453  33.153 -52.921 1.00 26.45  ? 698  ALA E CA    1 
ATOM   9678  C  C     . ALA G  2  98  ? 58.796  32.544 -53.323 1.00 28.24  ? 698  ALA E C     1 
ATOM   9679  O  O     . ALA G  2  98  ? 59.510  33.084 -54.181 1.00 27.64  ? 698  ALA E O     1 
ATOM   9680  C  CB    . ALA G  2  98  ? 57.568  33.829 -51.560 1.00 26.57  ? 698  ALA E CB    1 
ATOM   9681  N  N     . TYR G  2  99  ? 59.118  31.386 -52.734 1.00 25.94  ? 699  TYR E N     1 
ATOM   9682  C  CA    . TYR G  2  99  ? 60.372  30.706 -53.064 1.00 24.01  ? 699  TYR E CA    1 
ATOM   9683  C  C     . TYR G  2  99  ? 60.417  30.345 -54.553 1.00 22.18  ? 699  TYR E C     1 
ATOM   9684  O  O     . TYR G  2  99  ? 61.391  30.635 -55.240 1.00 25.98  ? 699  TYR E O     1 
ATOM   9685  C  CB    . TYR G  2  99  ? 60.545  29.430 -52.213 1.00 27.51  ? 699  TYR E CB    1 
ATOM   9686  C  CG    . TYR G  2  99  ? 61.626  28.503 -52.720 1.00 28.55  ? 699  TYR E CG    1 
ATOM   9687  C  CD1   . TYR G  2  99  ? 62.969  28.750 -52.443 1.00 27.64  ? 699  TYR E CD1   1 
ATOM   9688  C  CD2   . TYR G  2  99  ? 61.303  27.374 -53.484 1.00 30.78  ? 699  TYR E CD2   1 
ATOM   9689  C  CE1   . TYR G  2  99  ? 63.987  27.898 -52.915 1.00 30.45  ? 699  TYR E CE1   1 
ATOM   9690  C  CE2   . TYR G  2  99  ? 62.305  26.508 -53.957 1.00 30.89  ? 699  TYR E CE2   1 
ATOM   9691  C  CZ    . TYR G  2  99  ? 63.642  26.775 -53.675 1.00 30.57  ? 699  TYR E CZ    1 
ATOM   9692  O  OH    . TYR G  2  99  ? 64.625  25.948 -54.168 1.00 34.52  ? 699  TYR E OH    1 
ATOM   9693  N  N     . LEU G  2  100 ? 59.348  29.746 -55.065 1.00 25.24  ? 700  LEU E N     1 
ATOM   9694  C  CA    . LEU G  2  100 ? 59.318  29.333 -56.481 1.00 24.13  ? 700  LEU E CA    1 
ATOM   9695  C  C     . LEU G  2  100 ? 59.352  30.517 -57.467 1.00 24.89  ? 700  LEU E C     1 
ATOM   9696  O  O     . LEU G  2  100 ? 59.998  30.440 -58.513 1.00 26.41  ? 700  LEU E O     1 
ATOM   9697  C  CB    . LEU G  2  100 ? 58.087  28.461 -56.756 1.00 24.49  ? 700  LEU E CB    1 
ATOM   9698  C  CG    . LEU G  2  100 ? 58.122  27.032 -56.169 1.00 28.51  ? 700  LEU E CG    1 
ATOM   9699  C  CD1   . LEU G  2  100 ? 56.848  26.283 -56.569 1.00 26.67  ? 700  LEU E CD1   1 
ATOM   9700  C  CD2   . LEU G  2  100 ? 59.365  26.268 -56.683 1.00 23.90  ? 700  LEU E CD2   1 
ATOM   9701  N  N     . VAL G  2  101 ? 58.592  31.569 -57.171 1.00 25.63  ? 701  VAL E N     1 
ATOM   9702  C  CA    . VAL G  2  101 ? 58.583  32.760 -58.030 1.00 24.75  ? 701  VAL E CA    1 
ATOM   9703  C  C     . VAL G  2  101 ? 59.990  33.360 -58.140 1.00 24.04  ? 701  VAL E C     1 
ATOM   9704  O  O     . VAL G  2  101 ? 60.476  33.629 -59.239 1.00 27.38  ? 701  VAL E O     1 
ATOM   9705  C  CB    . VAL G  2  101 ? 57.593  33.842 -57.512 1.00 25.81  ? 701  VAL E CB    1 
ATOM   9706  C  CG1   . VAL G  2  101 ? 57.756  35.153 -58.319 1.00 25.89  ? 701  VAL E CG1   1 
ATOM   9707  C  CG2   . VAL G  2  101 ? 56.172  33.328 -57.652 1.00 26.55  ? 701  VAL E CG2   1 
ATOM   9708  N  N     . ALA G  2  102 ? 60.658  33.525 -57.007 1.00 26.70  ? 702  ALA E N     1 
ATOM   9709  C  CA    . ALA G  2  102 ? 62.011  34.090 -56.987 1.00 27.46  ? 702  ALA E CA    1 
ATOM   9710  C  C     . ALA G  2  102 ? 62.978  33.141 -57.695 1.00 30.28  ? 702  ALA E C     1 
ATOM   9711  O  O     . ALA G  2  102 ? 63.932  33.570 -58.342 1.00 29.38  ? 702  ALA E O     1 
ATOM   9712  C  CB    . ALA G  2  102 ? 62.460  34.335 -55.554 1.00 28.30  ? 702  ALA E CB    1 
ATOM   9713  N  N     . LEU G  2  103 ? 62.742  31.843 -57.564 1.00 29.57  ? 703  LEU E N     1 
ATOM   9714  C  CA    . LEU G  2  103 ? 63.613  30.886 -58.236 1.00 26.82  ? 703  LEU E CA    1 
ATOM   9715  C  C     . LEU G  2  103 ? 63.410  30.999 -59.752 1.00 25.84  ? 703  LEU E C     1 
ATOM   9716  O  O     . LEU G  2  103 ? 64.373  30.946 -60.507 1.00 26.66  ? 703  LEU E O     1 
ATOM   9717  C  CB    . LEU G  2  103 ? 63.320  29.464 -57.767 1.00 26.66  ? 703  LEU E CB    1 
ATOM   9718  C  CG    . LEU G  2  103 ? 64.129  28.385 -58.481 1.00 29.17  ? 703  LEU E CG    1 
ATOM   9719  C  CD1   . LEU G  2  103 ? 65.624  28.641 -58.352 1.00 27.88  ? 703  LEU E CD1   1 
ATOM   9720  C  CD2   . LEU G  2  103 ? 63.766  27.027 -57.901 1.00 27.16  ? 703  LEU E CD2   1 
ATOM   9721  N  N     . PHE G  2  104 ? 62.166  31.190 -60.194 1.00 26.11  ? 704  PHE E N     1 
ATOM   9722  C  CA    . PHE G  2  104 ? 61.898  31.320 -61.631 1.00 26.59  ? 704  PHE E CA    1 
ATOM   9723  C  C     . PHE G  2  104 ? 62.532  32.594 -62.187 1.00 26.91  ? 704  PHE E C     1 
ATOM   9724  O  O     . PHE G  2  104 ? 62.946  32.623 -63.349 1.00 27.12  ? 704  PHE E O     1 
ATOM   9725  C  CB    . PHE G  2  104 ? 60.399  31.285 -61.945 1.00 27.00  ? 704  PHE E CB    1 
ATOM   9726  C  CG    . PHE G  2  104 ? 59.819  29.887 -62.008 1.00 27.44  ? 704  PHE E CG    1 
ATOM   9727  C  CD1   . PHE G  2  104 ? 58.717  29.535 -61.231 1.00 26.92  ? 704  PHE E CD1   1 
ATOM   9728  C  CD2   . PHE G  2  104 ? 60.376  28.930 -62.852 1.00 25.79  ? 704  PHE E CD2   1 
ATOM   9729  C  CE1   . PHE G  2  104 ? 58.172  28.231 -61.292 1.00 30.75  ? 704  PHE E CE1   1 
ATOM   9730  C  CE2   . PHE G  2  104 ? 59.850  27.631 -62.925 1.00 27.74  ? 704  PHE E CE2   1 
ATOM   9731  C  CZ    . PHE G  2  104 ? 58.743  27.285 -62.140 1.00 27.51  ? 704  PHE E CZ    1 
ATOM   9732  N  N     . GLU G  2  105 ? 62.644  33.634 -61.359 1.00 27.75  ? 705  GLU E N     1 
ATOM   9733  C  CA    . GLU G  2  105 ? 63.290  34.872 -61.831 1.00 29.29  ? 705  GLU E CA    1 
ATOM   9734  C  C     . GLU G  2  105 ? 64.768  34.546 -62.096 1.00 29.61  ? 705  GLU E C     1 
ATOM   9735  O  O     . GLU G  2  105 ? 65.293  34.863 -63.160 1.00 31.04  ? 705  GLU E O     1 
ATOM   9736  C  CB    . GLU G  2  105 ? 63.183  36.010 -60.796 1.00 29.62  ? 705  GLU E CB    1 
ATOM   9737  C  CG    . GLU G  2  105 ? 61.763  36.468 -60.481 1.00 36.10  ? 705  GLU E CG    1 
ATOM   9738  C  CD    . GLU G  2  105 ? 61.712  37.424 -59.281 1.00 45.96  ? 705  GLU E CD    1 
ATOM   9739  O  OE1   . GLU G  2  105 ? 62.787  37.697 -58.681 1.00 49.78  ? 705  GLU E OE1   1 
ATOM   9740  O  OE2   . GLU G  2  105 ? 60.601  37.891 -58.930 1.00 46.15  ? 705  GLU E OE2   1 
ATOM   9741  N  N     . ASP G  2  106 ? 65.429  33.886 -61.137 1.00 30.57  ? 706  ASP E N     1 
ATOM   9742  C  CA    . ASP G  2  106 ? 66.849  33.505 -61.294 1.00 29.35  ? 706  ASP E CA    1 
ATOM   9743  C  C     . ASP G  2  106 ? 67.067  32.564 -62.501 1.00 28.77  ? 706  ASP E C     1 
ATOM   9744  O  O     . ASP G  2  106 ? 68.021  32.703 -63.270 1.00 28.58  ? 706  ASP E O     1 
ATOM   9745  C  CB    . ASP G  2  106 ? 67.363  32.833 -60.019 1.00 29.82  ? 706  ASP E CB    1 
ATOM   9746  C  CG    . ASP G  2  106 ? 67.540  33.822 -58.864 1.00 36.34  ? 706  ASP E CG    1 
ATOM   9747  O  OD1   . ASP G  2  106 ? 67.381  35.043 -59.098 1.00 36.18  ? 706  ASP E OD1   1 
ATOM   9748  O  OD2   . ASP G  2  106 ? 67.848  33.381 -57.732 1.00 36.57  ? 706  ASP E OD2   1 
ATOM   9749  N  N     . THR G  2  107 ? 66.135  31.641 -62.672 1.00 27.65  ? 707  THR E N     1 
ATOM   9750  C  CA    . THR G  2  107 ? 66.167  30.666 -63.761 1.00 25.84  ? 707  THR E CA    1 
ATOM   9751  C  C     . THR G  2  107 ? 66.066  31.382 -65.105 1.00 25.62  ? 707  THR E C     1 
ATOM   9752  O  O     . THR G  2  107 ? 66.777  31.056 -66.042 1.00 27.42  ? 707  THR E O     1 
ATOM   9753  C  CB    . THR G  2  107 ? 64.984  29.693 -63.596 1.00 27.80  ? 707  THR E CB    1 
ATOM   9754  O  OG1   . THR G  2  107 ? 65.123  29.010 -62.345 1.00 27.11  ? 707  THR E OG1   1 
ATOM   9755  C  CG2   . THR G  2  107 ? 64.932  28.688 -64.736 1.00 29.05  ? 707  THR E CG2   1 
ATOM   9756  N  N     . ASN G  2  108 ? 65.138  32.328 -65.195 1.00 27.56  ? 708  ASN E N     1 
ATOM   9757  C  CA    . ASN G  2  108 ? 64.951  33.130 -66.406 1.00 28.58  ? 708  ASN E CA    1 
ATOM   9758  C  C     . ASN G  2  108 ? 66.279  33.829 -66.735 1.00 30.50  ? 708  ASN E C     1 
ATOM   9759  O  O     . ASN G  2  108 ? 66.702  33.874 -67.892 1.00 29.69  ? 708  ASN E O     1 
ATOM   9760  C  CB    . ASN G  2  108 ? 63.868  34.185 -66.160 1.00 29.66  ? 708  ASN E CB    1 
ATOM   9761  C  CG    . ASN G  2  108 ? 63.175  34.603 -67.432 1.00 33.89  ? 708  ASN E CG    1 
ATOM   9762  O  OD1   . ASN G  2  108 ? 63.105  33.828 -68.390 1.00 34.41  ? 708  ASN E OD1   1 
ATOM   9763  N  ND2   . ASN G  2  108 ? 62.637  35.814 -67.445 1.00 32.64  ? 708  ASN E ND2   1 
ATOM   9764  N  N     . LEU G  2  109 ? 66.942  34.374 -65.714 1.00 30.28  ? 709  LEU E N     1 
ATOM   9765  C  CA    . LEU G  2  109 ? 68.228  35.038 -65.938 1.00 29.67  ? 709  LEU E CA    1 
ATOM   9766  C  C     . LEU G  2  109 ? 69.265  34.071 -66.525 1.00 31.24  ? 709  LEU E C     1 
ATOM   9767  O  O     . LEU G  2  109 ? 70.022  34.451 -67.417 1.00 28.99  ? 709  LEU E O     1 
ATOM   9768  C  CB    . LEU G  2  109 ? 68.760  35.684 -64.648 1.00 30.25  ? 709  LEU E CB    1 
ATOM   9769  C  CG    . LEU G  2  109 ? 67.993  36.935 -64.191 1.00 32.09  ? 709  LEU E CG    1 
ATOM   9770  C  CD1   . LEU G  2  109 ? 68.626  37.509 -62.926 1.00 33.84  ? 709  LEU E CD1   1 
ATOM   9771  C  CD2   . LEU G  2  109 ? 68.002  37.979 -65.305 1.00 32.04  ? 709  LEU E CD2   1 
ATOM   9772  N  N     . CYS G  2  110 ? 69.302  32.828 -66.030 1.00 30.91  ? 710  CYS E N     1 
ATOM   9773  C  CA    . CYS G  2  110 ? 70.257  31.850 -66.555 1.00 32.88  ? 710  CYS E CA    1 
ATOM   9774  C  C     . CYS G  2  110 ? 69.933  31.488 -68.008 1.00 33.12  ? 710  CYS E C     1 
ATOM   9775  O  O     . CYS G  2  110 ? 70.839  31.290 -68.806 1.00 33.60  ? 710  CYS E O     1 
ATOM   9776  C  CB    . CYS G  2  110 ? 70.316  30.586 -65.674 1.00 32.18  ? 710  CYS E CB    1 
ATOM   9777  S  SG    . CYS G  2  110 ? 70.852  30.916 -63.960 1.00 31.95  ? 710  CYS E SG    1 
ATOM   9778  N  N     . ALA G  2  111 ? 68.649  31.389 -68.343 1.00 33.75  ? 711  ALA E N     1 
ATOM   9779  C  CA    . ALA G  2  111 ? 68.260  31.067 -69.714 1.00 32.81  ? 711  ALA E CA    1 
A