data_1S3C
# 
_entry.id   1S3C 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.351 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1S3C         pdb_00001s3c 10.2210/pdb1s3c/pdb 
RCSB  RCSB021314   ?            ?                   
WWPDB D_1000021314 ?            ?                   
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1S3C 
_pdbx_database_status.recvd_initial_deposition_date   2004-01-13 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'DeMel, S.'     1 
'Edwards, B.F.' 2 
# 
_citation.id                        primary 
_citation.title                     
'Arginine 60 in the ArsC arsenate reductase of E. coli plasmid R773 determines the chemical nature of the bound As(III) product.' 
_citation.journal_abbrev            'Protein Sci.' 
_citation.journal_volume            13 
_citation.page_first                2330 
_citation.page_last                 2340 
_citation.year                      2004 
_citation.journal_id_ASTM           PRCIEI 
_citation.country                   US 
_citation.journal_id_ISSN           0961-8368 
_citation.journal_id_CSD            0795 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15295115 
_citation.pdbx_database_id_DOI      10.1110/ps.04787204 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'DeMel, S.'     1 ? 
primary 'Shi, J.'       2 ? 
primary 'Martin, P.'    3 ? 
primary 'Rosen, B.P.'   4 ? 
primary 'Edwards, B.F.' 5 ? 
# 
_cell.entry_id           1S3C 
_cell.length_a           86.475 
_cell.length_b           86.475 
_cell.length_c           116.139 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1S3C 
_symmetry.space_group_name_H-M             'P 61 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                178 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Arsenate reductase' 15833.175 1   1.20.4.1 C12S ? ? 
2 non-polymer syn 'SULFATE ION'        96.063    3   ?        ?    ? ? 
3 non-polymer syn 'CESIUM ION'         132.905   3   ?        ?    ? ? 
4 water       nat water                18.015    276 ?        ?    ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Arsenical pump modifier' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSNITIYHNPASGTSRNTLEMIRNSGTEPTIILYLENPPSRDELVKLIADMGISVRALLRKNVEPYEQLGLAEDKFTDDQ
LIDFMLQHPILINRPIVVTPLGTRLCRPSEVVLDILQDAQKGAFTKEDGEKVVDEAGKRLK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSNITIYHNPASGTSRNTLEMIRNSGTEPTIILYLENPPSRDELVKLIADMGISVRALLRKNVEPYEQLGLAEDKFTDDQ
LIDFMLQHPILINRPIVVTPLGTRLCRPSEVVLDILQDAQKGAFTKEDGEKVVDEAGKRLK
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   ASN n 
1 4   ILE n 
1 5   THR n 
1 6   ILE n 
1 7   TYR n 
1 8   HIS n 
1 9   ASN n 
1 10  PRO n 
1 11  ALA n 
1 12  SER n 
1 13  GLY n 
1 14  THR n 
1 15  SER n 
1 16  ARG n 
1 17  ASN n 
1 18  THR n 
1 19  LEU n 
1 20  GLU n 
1 21  MET n 
1 22  ILE n 
1 23  ARG n 
1 24  ASN n 
1 25  SER n 
1 26  GLY n 
1 27  THR n 
1 28  GLU n 
1 29  PRO n 
1 30  THR n 
1 31  ILE n 
1 32  ILE n 
1 33  LEU n 
1 34  TYR n 
1 35  LEU n 
1 36  GLU n 
1 37  ASN n 
1 38  PRO n 
1 39  PRO n 
1 40  SER n 
1 41  ARG n 
1 42  ASP n 
1 43  GLU n 
1 44  LEU n 
1 45  VAL n 
1 46  LYS n 
1 47  LEU n 
1 48  ILE n 
1 49  ALA n 
1 50  ASP n 
1 51  MET n 
1 52  GLY n 
1 53  ILE n 
1 54  SER n 
1 55  VAL n 
1 56  ARG n 
1 57  ALA n 
1 58  LEU n 
1 59  LEU n 
1 60  ARG n 
1 61  LYS n 
1 62  ASN n 
1 63  VAL n 
1 64  GLU n 
1 65  PRO n 
1 66  TYR n 
1 67  GLU n 
1 68  GLN n 
1 69  LEU n 
1 70  GLY n 
1 71  LEU n 
1 72  ALA n 
1 73  GLU n 
1 74  ASP n 
1 75  LYS n 
1 76  PHE n 
1 77  THR n 
1 78  ASP n 
1 79  ASP n 
1 80  GLN n 
1 81  LEU n 
1 82  ILE n 
1 83  ASP n 
1 84  PHE n 
1 85  MET n 
1 86  LEU n 
1 87  GLN n 
1 88  HIS n 
1 89  PRO n 
1 90  ILE n 
1 91  LEU n 
1 92  ILE n 
1 93  ASN n 
1 94  ARG n 
1 95  PRO n 
1 96  ILE n 
1 97  VAL n 
1 98  VAL n 
1 99  THR n 
1 100 PRO n 
1 101 LEU n 
1 102 GLY n 
1 103 THR n 
1 104 ARG n 
1 105 LEU n 
1 106 CYS n 
1 107 ARG n 
1 108 PRO n 
1 109 SER n 
1 110 GLU n 
1 111 VAL n 
1 112 VAL n 
1 113 LEU n 
1 114 ASP n 
1 115 ILE n 
1 116 LEU n 
1 117 GLN n 
1 118 ASP n 
1 119 ALA n 
1 120 GLN n 
1 121 LYS n 
1 122 GLY n 
1 123 ALA n 
1 124 PHE n 
1 125 THR n 
1 126 LYS n 
1 127 GLU n 
1 128 ASP n 
1 129 GLY n 
1 130 GLU n 
1 131 LYS n 
1 132 VAL n 
1 133 VAL n 
1 134 ASP n 
1 135 GLU n 
1 136 ALA n 
1 137 GLY n 
1 138 LYS n 
1 139 ARG n 
1 140 LEU n 
1 141 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli ' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     562 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ARSC1_ECOLI 
_struct_ref.pdbx_db_accession          P08692 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSNITIYHNPACGTSRNTLEMIRNSGTEPTIILYLENPPSRDELVKLIADMGISVRALLRKNVEPYEQLGLAEDKFTDDQ
LIDFMLQHPILINRPIVVTPLGTRLCRPSEVVLDILQDAQKGAFTKEDGEKVVDEAGKRLK
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1S3C 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 141 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P08692 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  141 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       141 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1S3C 
_struct_ref_seq_dif.mon_id                       SER 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      12 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P08692 
_struct_ref_seq_dif.db_mon_id                    CYS 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          12 
_struct_ref_seq_dif.details                      'engineered mutation' 
_struct_ref_seq_dif.pdbx_auth_seq_num            12 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CS  non-polymer         . 'CESIUM ION'    ? 'Cs 1'           132.905 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1S3C 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   57.9 
_exptl_crystal.description           ? 
_exptl_crystal.density_Matthews      2.92 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.8 
_exptl_crystal_grow.pdbx_details    'CESIUM SULFATE, ACETATE, pH 4.8, VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           93.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI(111) DOUBLE-CRYSTAL' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 17-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   17-ID 
_diffrn_source.pdbx_wavelength             1.0000 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1S3C 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.000 
_reflns.d_resolution_high            1.25 
_reflns.number_obs                   71887 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         81.5 
_reflns.pdbx_Rmerge_I_obs            0.1172 
_reflns.pdbx_Rsym_value              0.1172 
_reflns.pdbx_netI_over_sigmaI        7.2000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              10.2 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.25 
_reflns_shell.d_res_low              1.28 
_reflns_shell.percent_possible_all   66.00 
_reflns_shell.Rmerge_I_obs           0.677 
_reflns_shell.pdbx_Rsym_value        0.677 
_reflns_shell.meanI_over_sigI_obs    0.6200 
_reflns_shell.pdbx_redundancy        5.20 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1S3C 
_refine.ls_number_reflns_obs                     58388 
_refine.ls_number_reflns_all                     58388 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            1.25 
_refine.ls_percent_reflns_obs                    82.1 
_refine.ls_R_factor_obs                          0.1464 
_refine.ls_R_factor_all                          0.1482 
_refine.ls_R_factor_R_work                       0.1464 
_refine.ls_R_factor_R_free                       0.2393 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.8 
_refine.ls_number_reflns_R_free                  3358 
_refine.ls_number_parameters                     12836 
_refine.ls_number_restraints                     15250 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'ANISOTROPIC REFINEMENT REDUCED FREE R (NO CUTOFF) BY ?' 
_refine.pdbx_starting_model                      'NATIVE STRUCTURE' 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1S3C 
_refine_analyze.Luzzati_coordinate_error_obs    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      10 
_refine_analyze.occupancy_sum_hydrogen          1112.00 
_refine_analyze.occupancy_sum_non_hydrogen      1352.61 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1085 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         18 
_refine_hist.number_atoms_solvent             276 
_refine_hist.number_atoms_total               1379 
_refine_hist.d_res_high                       1.25 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
s_bond_d               0.014  ? ? ? 'X-RAY DIFFRACTION' ? 
s_angle_d              0.034  ? ? ? 'X-RAY DIFFRACTION' ? 
s_similar_dist         0.000  ? ? ? 'X-RAY DIFFRACTION' ? 
s_from_restr_planes    0.0300 ? ? ? 'X-RAY DIFFRACTION' ? 
s_zero_chiral_vol      0.062  ? ? ? 'X-RAY DIFFRACTION' ? 
s_non_zero_chiral_vol  0.082  ? ? ? 'X-RAY DIFFRACTION' ? 
s_anti_bump_dis_restr  0.053  ? ? ? 'X-RAY DIFFRACTION' ? 
s_rigid_bond_adp_cmpnt 0.004  ? ? ? 'X-RAY DIFFRACTION' ? 
s_similar_adp_cmpnt    0.060  ? ? ? 'X-RAY DIFFRACTION' ? 
s_approx_iso_adps      0.104  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_pdbx_refine.entry_id                                    1S3C 
_pdbx_refine.R_factor_all_no_cutoff                      0.1482 
_pdbx_refine.R_factor_obs_no_cutoff                      0.1464 
_pdbx_refine.free_R_factor_no_cutoff                     0.2393 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     5.8 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            3358 
_pdbx_refine.R_factor_all_4sig_cutoff                    0.1124 
_pdbx_refine.R_factor_obs_4sig_cutoff                    0.1105 
_pdbx_refine.free_R_factor_4sig_cutoff                   0.1844 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   5.4 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          1515 
_pdbx_refine.number_reflns_obs_4sig_cutoff               28004 
_pdbx_refine.number_reflns_obs_no_cutoff                 58388 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.free_R_error_no_cutoff                      ? 
# 
_struct.entry_id                  1S3C 
_struct.title                     'ARSENATE REDUCTASE C12S MUTANT FROM E. COLI' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1S3C 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            'ARSC, REDUCTASE, ARSENITE, ARSENATE, OXIDOREDUCTASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 12  ? SER A 25  ? SER A 12  SER A 25  1 ? 14 
HELX_P HELX_P2 2 SER A 40  ? GLY A 52  ? SER A 40  GLY A 52  1 ? 13 
HELX_P HELX_P3 3 SER A 54  ? LEU A 59  ? SER A 54  LEU A 59  1 ? 6  
HELX_P HELX_P4 4 VAL A 63  ? LEU A 69  ? VAL A 63  LEU A 69  1 ? 7  
HELX_P HELX_P5 5 THR A 77  ? HIS A 88  ? THR A 77  HIS A 88  1 ? 12 
HELX_P HELX_P6 6 PRO A 89  ? ILE A 92  ? PRO A 89  ILE A 92  5 ? 4  
HELX_P HELX_P7 7 PRO A 108 ? ILE A 115 ? PRO A 108 ILE A 115 5 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1  metalc ? ? A PRO 38  O   ? ? ? 1_555  F CS  . CS ? ? A PRO 38  A CS  302  1_555  ? ? ? ? ? ? ? 3.123 ? ? 
metalc2  metalc ? ? A SER 40  N   ? ? ? 1_555  F CS  . CS ? ? A SER 40  A CS  302  1_555  ? ? ? ? ? ? ? 3.898 ? ? 
metalc3  metalc ? ? A GLU 64  OE2 ? ? ? 1_555  G CS  . CS ? ? A GLU 64  A CS  303  1_555  ? ? ? ? ? ? ? 3.251 ? ? 
metalc4  metalc ? ? A GLN 87  NE2 ? ? ? 8_676  G CS  . CS ? ? A GLN 87  A CS  303  1_555  ? ? ? ? ? ? ? 3.844 ? ? 
metalc5  metalc ? ? A LEU 113 O   ? ? ? 1_555  E CS  . CS ? ? A LEU 113 A CS  301  1_555  ? ? ? ? ? ? ? 3.213 ? ? 
metalc6  metalc ? ? A LEU 113 O   ? ? ? 10_665 E CS  . CS ? ? A LEU 113 A CS  301  1_555  ? ? ? ? ? ? ? 3.212 ? ? 
metalc7  metalc ? ? A ASP 114 O   ? ? ? 1_555  E CS  . CS ? ? A ASP 114 A CS  301  1_555  ? ? ? ? ? ? ? 3.242 ? ? 
metalc8  metalc ? ? A ASP 114 O   ? ? ? 10_665 E CS  . CS ? ? A ASP 114 A CS  301  1_555  ? ? ? ? ? ? ? 3.243 ? ? 
metalc9  metalc ? ? A LEU 116 O   ? ? ? 1_555  E CS  . CS ? ? A LEU 116 A CS  301  1_555  ? ? ? ? ? ? ? 3.121 ? ? 
metalc10 metalc ? ? A LEU 116 O   ? ? ? 10_665 E CS  . CS ? ? A LEU 116 A CS  301  1_555  ? ? ? ? ? ? ? 3.121 ? ? 
metalc11 metalc ? ? E CS  .   CS  ? ? ? 1_555  H HOH . O  ? ? A CS  301 A HOH 1025 1_555  ? ? ? ? ? ? ? 3.337 ? ? 
metalc12 metalc ? ? E CS  .   CS  ? ? ? 1_555  H HOH . O  ? ? A CS  301 A HOH 1025 10_665 ? ? ? ? ? ? ? 3.337 ? ? 
metalc13 metalc ? ? F CS  .   CS  ? ? ? 1_555  H HOH . O  ? ? A CS  302 A HOH 1024 1_555  ? ? ? ? ? ? ? 3.193 ? ? 
metalc14 metalc ? ? F CS  .   CS  ? ? ? 1_555  H HOH . O  ? ? A CS  302 A HOH 1098 1_555  ? ? ? ? ? ? ? 3.266 ? ? 
metalc15 metalc ? ? F CS  .   CS  ? ? ? 1_555  H HOH . O  ? ? A CS  302 A HOH 1157 1_555  ? ? ? ? ? ? ? 2.846 ? ? 
metalc16 metalc ? ? G CS  .   CS  ? ? ? 1_555  H HOH . O  ? ? A CS  303 A HOH 1071 1_555  ? ? ? ? ? ? ? 3.441 ? ? 
metalc17 metalc ? ? G CS  .   CS  ? ? ? 1_555  H HOH . O  ? ? A CS  303 A HOH 1104 1_555  ? ? ? ? ? ? ? 3.324 ? ? 
metalc18 metalc ? ? G CS  .   CS  ? ? ? 1_555  H HOH . O  ? ? A CS  303 A HOH 1210 12_566 ? ? ? ? ? ? ? 3.745 ? ? 
metalc19 metalc ? ? G CS  .   CS  ? ? ? 1_555  H HOH . O  ? ? A CS  303 A HOH 1233 12_566 ? ? ? ? ? ? ? 3.938 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ARG 94  A . ? ARG 94  A PRO 95  A ? PRO 95  A 1 -7.92 
2 ARG 107 A . ? ARG 107 A PRO 108 A ? PRO 108 A 1 -0.24 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 30  ? ILE A 32  ? THR A 30  ILE A 32  
A 2 THR A 5   ? TYR A 7   ? THR A 5   TYR A 7   
A 3 ILE A 96  ? THR A 99  ? ILE A 96  THR A 99  
A 4 GLY A 102 ? LEU A 105 ? GLY A 102 LEU A 105 
B 1 PHE A 124 ? THR A 125 ? PHE A 124 THR A 125 
B 2 LYS A 131 ? VAL A 133 ? LYS A 131 VAL A 133 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ILE A 32  ? O ILE A 32  N ILE A 6   ? N ILE A 6   
A 2 3 N TYR A 7   ? N TYR A 7   O ILE A 96  ? O ILE A 96  
A 3 4 N THR A 99  ? N THR A 99  O GLY A 102 ? O GLY A 102 
B 1 2 N PHE A 124 ? N PHE A 124 O VAL A 132 ? O VAL A 132 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A SO4 201 ? 10 'BINDING SITE FOR RESIDUE SO4 A 201' 
AC2 Software A SO4 202 ? 5  'BINDING SITE FOR RESIDUE SO4 A 202' 
AC3 Software A SO4 203 ? 9  'BINDING SITE FOR RESIDUE SO4 A 203' 
AC4 Software A CS  301 ? 6  'BINDING SITE FOR RESIDUE CS A 301'  
AC5 Software A CS  302 ? 3  'BINDING SITE FOR RESIDUE CS A 302'  
AC6 Software A CS  303 ? 1  'BINDING SITE FOR RESIDUE CS A 303'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 10 SER A 12  ? SER A 12   . ? 1_555  ? 
2  AC1 10 GLY A 13  ? GLY A 13   . ? 1_555  ? 
3  AC1 10 THR A 14  ? THR A 14   . ? 1_555  ? 
4  AC1 10 ARG A 60  ? ARG A 60   . ? 1_555  ? 
5  AC1 10 ASN A 62  ? ASN A 62   . ? 12_566 ? 
6  AC1 10 ARG A 94  ? ARG A 94   . ? 1_555  ? 
7  AC1 10 ARG A 107 ? ARG A 107  . ? 1_555  ? 
8  AC1 10 HOH H .   ? HOH A 1008 . ? 12_566 ? 
9  AC1 10 HOH H .   ? HOH A 1063 . ? 1_555  ? 
10 AC1 10 HOH H .   ? HOH A 1131 . ? 1_555  ? 
11 AC2 5  ARG A 60  ? ARG A 60   . ? 1_555  ? 
12 AC2 5  ARG A 60  ? ARG A 60   . ? 12_566 ? 
13 AC2 5  ASN A 62  ? ASN A 62   . ? 1_555  ? 
14 AC2 5  ASN A 62  ? ASN A 62   . ? 12_566 ? 
15 AC2 5  HOH H .   ? HOH A 1101 . ? 1_555  ? 
16 AC3 9  THR A 14  ? THR A 14   . ? 1_555  ? 
17 AC3 9  ASN A 17  ? ASN A 17   . ? 1_555  ? 
18 AC3 9  PRO A 108 ? PRO A 108  . ? 1_555  ? 
19 AC3 9  SER A 109 ? SER A 109  . ? 1_555  ? 
20 AC3 9  LYS A 126 ? LYS A 126  . ? 1_555  ? 
21 AC3 9  HOH H .   ? HOH A 1035 . ? 1_555  ? 
22 AC3 9  HOH H .   ? HOH A 1070 . ? 1_555  ? 
23 AC3 9  HOH H .   ? HOH A 1106 . ? 1_555  ? 
24 AC3 9  HOH H .   ? HOH A 1111 . ? 1_555  ? 
25 AC4 6  LEU A 113 ? LEU A 113  . ? 10_665 ? 
26 AC4 6  LEU A 113 ? LEU A 113  . ? 1_555  ? 
27 AC4 6  ASP A 114 ? ASP A 114  . ? 10_665 ? 
28 AC4 6  ASP A 114 ? ASP A 114  . ? 1_555  ? 
29 AC4 6  LEU A 116 ? LEU A 116  . ? 1_555  ? 
30 AC4 6  LEU A 116 ? LEU A 116  . ? 10_665 ? 
31 AC5 3  PRO A 38  ? PRO A 38   . ? 1_555  ? 
32 AC5 3  GLU A 43  ? GLU A 43   . ? 1_555  ? 
33 AC5 3  HOH H .   ? HOH A 1157 . ? 1_555  ? 
34 AC6 1  GLU A 64  ? GLU A 64   . ? 1_555  ? 
# 
_database_PDB_matrix.entry_id          1S3C 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.000000 
_database_PDB_matrix.origx_vector[2]   0.000000 
_database_PDB_matrix.origx_vector[3]   0.000000 
# 
_atom_sites.entry_id                    1S3C 
_atom_sites.fract_transf_matrix[1][1]   0.011564 
_atom_sites.fract_transf_matrix[1][2]   0.006676 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013353 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008610 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CS 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ASN A 1 3   ? 32.005 45.301 45.590 1.00 39.72  ? 3    ASN A N   1 
ATOM   2    C  CA  . ASN A 1 3   ? 31.954 46.759 45.700 1.00 31.36  ? 3    ASN A CA  1 
ATOM   3    C  C   . ASN A 1 3   ? 30.661 47.339 46.266 1.00 21.04  ? 3    ASN A C   1 
ATOM   4    O  O   . ASN A 1 3   ? 29.612 47.433 45.641 1.00 19.67  ? 3    ASN A O   1 
ATOM   5    C  CB  . ASN A 1 3   ? 32.072 47.454 44.354 1.00 49.47  ? 3    ASN A CB  1 
ATOM   6    C  CG  . ASN A 1 3   ? 32.432 48.939 44.445 1.00 77.91  ? 3    ASN A CG  1 
ATOM   7    O  OD1 . ASN A 1 3   ? 32.506 49.625 43.376 1.00 139.21 ? 3    ASN A OD1 1 
ATOM   8    N  ND2 . ASN A 1 3   ? 32.676 49.549 45.615 1.00 92.31  ? 3    ASN A ND2 1 
ATOM   9    N  N   . ILE A 1 4   ? 30.778 47.753 47.502 1.00 14.48  ? 4    ILE A N   1 
ATOM   10   C  CA  . ILE A 1 4   ? 29.638 48.032 48.312 1.00 10.96  ? 4    ILE A CA  1 
ATOM   11   C  C   . ILE A 1 4   ? 29.847 49.414 48.934 1.00 11.34  ? 4    ILE A C   1 
ATOM   12   O  O   . ILE A 1 4   ? 30.950 49.714 49.389 1.00 12.80  ? 4    ILE A O   1 
ATOM   13   C  CB  . ILE A 1 4   ? 29.487 46.977 49.449 1.00 11.30  ? 4    ILE A CB  1 
ATOM   14   C  CG1 . ILE A 1 4   ? 29.402 45.541 48.934 1.00 13.93  ? 4    ILE A CG1 1 
ATOM   15   C  CG2 . ILE A 1 4   ? 28.338 47.304 50.394 1.00 11.54  ? 4    ILE A CG2 1 
ATOM   16   C  CD1 . ILE A 1 4   ? 29.245 44.511 50.017 1.00 17.54  ? 4    ILE A CD1 1 
ATOM   17   N  N   . THR A 1 5   ? 28.783 50.188 48.937 1.00 10.67  ? 5    THR A N   1 
ATOM   18   C  CA  . THR A 1 5   ? 28.755 51.474 49.627 1.00 11.30  ? 5    THR A CA  1 
ATOM   19   C  C   . THR A 1 5   ? 27.625 51.490 50.659 1.00 10.40  ? 5    THR A C   1 
ATOM   20   O  O   . THR A 1 5   ? 26.517 51.043 50.368 1.00 11.47  ? 5    THR A O   1 
ATOM   21   C  CB  . THR A 1 5   ? 28.532 52.588 48.591 1.00 12.88  ? 5    THR A CB  1 
ATOM   22   O  OG1 . THR A 1 5   ? 29.626 52.556 47.653 1.00 19.18  ? 5    THR A OG1 1 
ATOM   23   C  CG2 . THR A 1 5   ? 28.476 53.992 49.198 1.00 17.32  ? 5    THR A CG2 1 
ATOM   24   N  N   . ILE A 1 6   ? 27.911 52.054 51.843 1.00 9.88   ? 6    ILE A N   1 
ATOM   25   C  CA  . ILE A 1 6   ? 26.864 52.275 52.827 1.00 9.60   ? 6    ILE A CA  1 
ATOM   26   C  C   . ILE A 1 6   ? 26.871 53.774 53.199 1.00 9.13   ? 6    ILE A C   1 
ATOM   27   O  O   . ILE A 1 6   ? 27.938 54.368 53.494 1.00 11.18  ? 6    ILE A O   1 
ATOM   28   C  CB  . ILE A 1 6   ? 26.997 51.377 54.076 1.00 9.12   ? 6    ILE A CB  1 
ATOM   29   C  CG1 . ILE A 1 6   ? 25.928 51.662 55.137 1.00 8.99   ? 6    ILE A CG1 1 
ATOM   30   C  CG2 . ILE A 1 6   ? 28.391 51.503 54.680 1.00 10.33  ? 6    ILE A CG2 1 
ATOM   31   C  CD1 . ILE A 1 6   ? 25.853 50.772 56.329 1.00 10.95  ? 6    ILE A CD1 1 
ATOM   32   N  N   . TYR A 1 7   ? 25.679 54.363 53.157 1.00 9.05   ? 7    TYR A N   1 
ATOM   33   C  CA  . TYR A 1 7   ? 25.412 55.703 53.691 1.00 8.53   ? 7    TYR A CA  1 
ATOM   34   C  C   . TYR A 1 7   ? 25.058 55.480 55.166 1.00 8.68   ? 7    TYR A C   1 
ATOM   35   O  O   . TYR A 1 7   ? 23.967 55.065 55.541 1.00 10.49  ? 7    TYR A O   1 
ATOM   36   C  CB  . TYR A 1 7   ? 24.303 56.396 52.896 1.00 9.41   ? 7    TYR A CB  1 
ATOM   37   C  CG  . TYR A 1 7   ? 24.698 56.687 51.477 1.00 9.70   ? 7    TYR A CG  1 
ATOM   38   C  CD1 . TYR A 1 7   ? 24.534 55.738 50.460 1.00 10.93  ? 7    TYR A CD1 1 
ATOM   39   C  CD2 . TYR A 1 7   ? 25.236 57.911 51.134 1.00 11.37  ? 7    TYR A CD2 1 
ATOM   40   C  CE1 . TYR A 1 7   ? 24.904 56.027 49.162 1.00 11.59  ? 7    TYR A CE1 1 
ATOM   41   C  CE2 . TYR A 1 7   ? 25.623 58.220 49.815 1.00 13.50  ? 7    TYR A CE2 1 
ATOM   42   C  CZ  . TYR A 1 7   ? 25.439 57.251 48.846 1.00 12.20  ? 7    TYR A CZ  1 
ATOM   43   O  OH  . TYR A 1 7   ? 25.809 57.514 47.540 1.00 14.60  ? 7    TYR A OH  1 
ATOM   44   N  N   . HIS A 1 8   ? 26.071 55.723 55.981 1.00 8.99   ? 8    HIS A N   1 
ATOM   45   C  CA  . HIS A 1 8   ? 26.099 55.337 57.400 1.00 9.50   ? 8    HIS A CA  1 
ATOM   46   C  C   . HIS A 1 8   ? 26.002 56.485 58.394 1.00 9.72   ? 8    HIS A C   1 
ATOM   47   O  O   . HIS A 1 8   ? 26.558 57.583 58.158 1.00 11.09  ? 8    HIS A O   1 
ATOM   48   C  CB  . HIS A 1 8   ? 27.444 54.662 57.674 1.00 10.32  ? 8    HIS A CB  1 
ATOM   49   C  CG  . HIS A 1 8   ? 27.748 54.159 59.036 1.00 10.60  ? 8    HIS A CG  1 
ATOM   50   N  ND1 . HIS A 1 8   ? 26.894 53.285 59.681 1.00 12.55  ? 8    HIS A ND1 1 
ATOM   51   C  CD2 . HIS A 1 8   ? 28.778 54.320 59.880 1.00 13.39  ? 8    HIS A CD2 1 
ATOM   52   C  CE1 . HIS A 1 8   ? 27.382 52.949 60.860 1.00 13.08  ? 8    HIS A CE1 1 
ATOM   53   N  NE2 . HIS A 1 8   ? 28.545 53.573 61.008 1.00 12.85  ? 8    HIS A NE2 1 
ATOM   54   N  N   . ASN A 1 9   ? 25.388 56.358 59.536 1.00 10.71  ? 9    ASN A N   1 
ATOM   55   C  CA  . ASN A 1 9   ? 25.217 57.168 60.688 1.00 9.73   ? 9    ASN A CA  1 
ATOM   56   C  C   . ASN A 1 9   ? 25.690 56.307 61.844 1.00 9.79   ? 9    ASN A C   1 
ATOM   57   O  O   . ASN A 1 9   ? 24.970 55.440 62.287 1.00 10.44  ? 9    ASN A O   1 
ATOM   58   C  CB  . ASN A 1 9   ? 23.774 57.584 60.874 1.00 11.41  ? 9    ASN A CB  1 
ATOM   59   C  CG  . ASN A 1 9   ? 23.513 58.630 61.909 1.00 12.42  ? 9    ASN A CG  1 
ATOM   60   O  OD1 . ASN A 1 9   ? 22.465 59.325 62.043 1.00 17.94  ? 9    ASN A OD1 1 
ATOM   61   N  ND2 . ASN A 1 9   ? 24.520 58.881 62.703 1.00 11.19  ? 9    ASN A ND2 1 
ATOM   62   N  N   . PRO A 1 10  ? 26.875 56.605 62.342 1.00 10.84  ? 10   PRO A N   1 
ATOM   63   C  CA  . PRO A 1 10  ? 27.316 55.865 63.519 1.00 12.43  ? 10   PRO A CA  1 
ATOM   64   C  C   . PRO A 1 10  ? 26.430 55.916 64.706 1.00 12.79  ? 10   PRO A C   1 
ATOM   65   O  O   . PRO A 1 10  ? 26.598 55.123 65.671 1.00 13.64  ? 10   PRO A O   1 
ATOM   66   C  CB  . PRO A 1 10  ? 28.605 56.644 63.840 1.00 15.59  ? 10   PRO A CB  1 
ATOM   67   C  CG  . PRO A 1 10  ? 29.087 57.196 62.556 1.00 17.23  ? 10   PRO A CG  1 
ATOM   68   C  CD  . PRO A 1 10  ? 27.835 57.592 61.821 1.00 13.17  ? 10   PRO A CD  1 
ATOM   69   N  N   . ALA A 1 11  ? 25.542 56.816 64.894 1.00 11.73  ? 11   ALA A N   1 
ATOM   70   C  CA  . ALA A 1 11  ? 24.632 57.053 65.993 1.00 13.17  ? 11   ALA A CA  1 
ATOM   71   C  C   . ALA A 1 11  ? 23.302 56.371 65.750 1.00 14.07  ? 11   ALA A C   1 
ATOM   72   O  O   . ALA A 1 11  ? 22.347 56.566 66.487 1.00 21.82  ? 11   ALA A O   1 
ATOM   73   C  CB  . ALA A 1 11  ? 24.445 58.548 66.231 1.00 14.20  ? 11   ALA A CB  1 
ATOM   74   N  N   . SER A 1 12  ? 23.261 55.541 64.736 1.00 11.68  ? 12   SER A N   1 
ATOM   75   C  CA  . SER A 1 12  ? 22.098 54.728 64.449 1.00 11.19  ? 12   SER A CA  1 
ATOM   76   C  C   . SER A 1 12  ? 22.347 53.253 64.713 1.00 9.59   ? 12   SER A C   1 
ATOM   77   O  O   . SER A 1 12  ? 23.258 52.687 64.118 1.00 10.15  ? 12   SER A O   1 
ATOM   78   C  CB  . SER A 1 12  ? 21.793 54.916 62.961 1.00 10.82  ? 12   SER A CB  1 
ATOM   79   O  OG  . SER A 1 12  ? 20.936 53.881 62.478 1.00 11.38  ? 12   SER A OG  1 
ATOM   80   N  N   . GLY A 1 13  ? 21.554 52.625 65.579 1.00 9.99   ? 13   GLY A N   1 
ATOM   81   C  CA  . GLY A 1 13  ? 21.723 51.184 65.799 1.00 11.17  ? 13   GLY A CA  1 
ATOM   82   C  C   . GLY A 1 13  ? 21.407 50.375 64.547 1.00 9.91   ? 13   GLY A C   1 
ATOM   83   O  O   . GLY A 1 13  ? 22.082 49.382 64.284 1.00 11.34  ? 13   GLY A O   1 
ATOM   84   N  N   . THR A 1 14  ? 20.406 50.813 63.755 1.00 8.62   ? 14   THR A N   1 
ATOM   85   C  CA  . THR A 1 14  ? 20.119 50.091 62.515 1.00 8.66   ? 14   THR A CA  1 
ATOM   86   C  C   . THR A 1 14  ? 21.314 50.131 61.563 1.00 8.55   ? 14   THR A C   1 
ATOM   87   O  O   . THR A 1 14  ? 21.686 49.114 60.951 1.00 8.84   ? 14   THR A O   1 
ATOM   88   C  CB  . THR A 1 14  ? 18.863 50.670 61.856 1.00 10.44  ? 14   THR A CB  1 
ATOM   89   O  OG1 . THR A 1 14  ? 17.756 50.617 62.804 1.00 12.51  ? 14   THR A OG1 1 
ATOM   90   C  CG2 . THR A 1 14  ? 18.468 49.933 60.587 1.00 9.91   ? 14   THR A CG2 1 
ATOM   91   N  N   . SER A 1 15  ? 21.923 51.332 61.473 1.00 8.13   ? 15   SER A N   1 
ATOM   92   C  CA  . SER A 1 15  ? 23.077 51.448 60.607 1.00 7.98   ? 15   SER A CA  1 
ATOM   93   C  C   . SER A 1 15  ? 24.286 50.661 61.092 1.00 9.65   ? 15   SER A C   1 
ATOM   94   O  O   . SER A 1 15  ? 24.984 50.049 60.287 1.00 8.86   ? 15   SER A O   1 
ATOM   95   C  CB  . SER A 1 15  ? 23.411 52.929 60.442 1.00 9.78   ? 15   SER A CB  1 
ATOM   96   O  OG  . SER A 1 15  ? 24.128 53.132 59.288 1.00 10.80  ? 15   SER A OG  1 
ATOM   97   N  N   . ARG A 1 16  ? 24.516 50.675 62.405 1.00 9.51   ? 16   ARG A N   1 
ATOM   98   C  CA  . ARG A 1 16  ? 25.620 49.894 62.922 1.00 9.39   ? 16   ARG A CA  1 
ATOM   99   C  C   . ARG A 1 16  ? 25.380 48.409 62.674 1.00 8.28   ? 16   ARG A C   1 
ATOM   100  O  O   . ARG A 1 16  ? 26.316 47.683 62.253 1.00 9.55   ? 16   ARG A O   1 
ATOM   101  C  CB  . ARG A 1 16  ? 25.818 50.142 64.425 1.00 9.69   ? 16   ARG A CB  1 
ATOM   102  C  CG  . ARG A 1 16  ? 26.332 51.502 64.807 1.00 10.11  ? 16   ARG A CG  1 
ATOM   103  C  CD  . ARG A 1 16  ? 26.718 51.603 66.252 1.00 11.73  ? 16   ARG A CD  1 
ATOM   104  N  NE  . ARG A 1 16  ? 25.568 51.349 67.121 1.00 11.61  ? 16   ARG A NE  1 
ATOM   105  C  CZ  . ARG A 1 16  ? 24.646 52.168 67.569 1.00 11.14  ? 16   ARG A CZ  1 
ATOM   106  N  NH1 . ARG A 1 16  ? 24.718 53.445 67.214 1.00 12.94  ? 16   ARG A NH1 1 
ATOM   107  N  NH2 . ARG A 1 16  ? 23.663 51.746 68.359 1.00 12.94  ? 16   ARG A NH2 1 
ATOM   108  N  N   . ASN A 1 17  ? 24.169 47.877 62.917 1.00 8.26   ? 17   ASN A N   1 
ATOM   109  C  CA  . ASN A 1 17  ? 23.886 46.465 62.630 1.00 7.63   ? 17   ASN A CA  1 
ATOM   110  C  C   . ASN A 1 17  ? 24.094 46.124 61.157 1.00 7.48   ? 17   ASN A C   1 
ATOM   111  O  O   . ASN A 1 17  ? 24.631 45.057 60.851 1.00 9.24   ? 17   ASN A O   1 
ATOM   112  C  CB  . ASN A 1 17  ? 22.462 46.108 63.040 1.00 9.72   ? 17   ASN A CB  1 
ATOM   113  C  CG  . ASN A 1 17  ? 22.284 45.844 64.536 1.00 9.31   ? 17   ASN A CG  1 
ATOM   114  O  OD1 . ASN A 1 17  ? 23.147 45.347 65.262 1.00 9.48   ? 17   ASN A OD1 1 
ATOM   115  N  ND2 . ASN A 1 17  ? 21.092 46.200 65.025 1.00 9.91   ? 17   ASN A ND2 1 
ATOM   116  N  N   . THR A 1 18  ? 23.628 47.050 60.281 1.00 9.27   ? 18   THR A N   1 
ATOM   117  C  CA  . THR A 1 18  ? 23.812 46.815 58.826 1.00 8.52   ? 18   THR A CA  1 
ATOM   118  C  C   . THR A 1 18  ? 25.281 46.737 58.458 1.00 7.65   ? 18   THR A C   1 
ATOM   119  O  O   . THR A 1 18  ? 25.697 45.837 57.706 1.00 9.17   ? 18   THR A O   1 
ATOM   120  C  CB  . THR A 1 18  ? 23.090 47.916 58.024 1.00 8.75   ? 18   THR A CB  1 
ATOM   121  O  OG1 . THR A 1 18  ? 21.706 47.992 58.357 1.00 9.61   ? 18   THR A OG1 1 
ATOM   122  C  CG2 . THR A 1 18  ? 23.196 47.615 56.517 1.00 9.23   ? 18   THR A CG2 1 
ATOM   123  N  N   . LEU A 1 19  ? 26.051 47.716 58.961 1.00 8.48   ? 19   LEU A N   1 
ATOM   124  C  CA  . LEU A 1 19  ? 27.486 47.739 58.653 1.00 9.49   ? 19   LEU A CA  1 
ATOM   125  C  C   . LEU A 1 19  ? 28.143 46.445 59.126 1.00 8.45   ? 19   LEU A C   1 
ATOM   126  O  O   . LEU A 1 19  ? 28.972 45.869 58.395 1.00 9.83   ? 19   LEU A O   1 
ATOM   127  C  CB  . LEU A 1 19  ? 28.085 48.972 59.308 1.00 9.26   ? 19   LEU A CB  1 
ATOM   128  C  CG  . LEU A 1 19  ? 29.605 49.115 59.188 1.00 10.21  ? 19   LEU A CG  1 
ATOM   129  C  CD1 . LEU A 1 19  ? 30.080 49.028 57.728 1.00 11.69  ? 19   LEU A CD1 1 
ATOM   130  C  CD2 . LEU A 1 19  ? 30.045 50.430 59.797 1.00 12.07  ? 19   LEU A CD2 1 
ATOM   131  N  N   . GLU A 1 20  ? 27.811 45.967 60.324 1.00 8.91   ? 20   GLU A N   1 
ATOM   132  C  CA  . GLU A 1 20  ? 28.421 44.685 60.777 1.00 9.96   ? 20   GLU A CA  1 
ATOM   133  C  C   . GLU A 1 20  ? 27.947 43.483 59.971 1.00 9.08   ? 20   GLU A C   1 
ATOM   134  O  O   . GLU A 1 20  ? 28.718 42.554 59.731 1.00 9.18   ? 20   GLU A O   1 
ATOM   135  C  CB  . GLU A 1 20  ? 28.244 44.485 62.286 1.00 11.24  ? 20   GLU A CB  1 
ATOM   136  C  CG  . GLU A 1 20  ? 28.835 45.576 63.154 1.00 9.73   ? 20   GLU A CG  1 
ATOM   137  C  CD  . GLU A 1 20  ? 30.294 45.927 63.120 1.00 12.67  ? 20   GLU A CD  1 
ATOM   138  O  OE1 . GLU A 1 20  ? 30.950 45.892 62.106 1.00 16.16  ? 20   GLU A OE1 1 
ATOM   139  O  OE2 . GLU A 1 20  ? 30.759 46.298 64.263 1.00 15.20  ? 20   GLU A OE2 1 
ATOM   140  N  N   . MET A 1 21  ? 26.706 43.475 59.465 1.00 9.47   ? 21   MET A N   1 
ATOM   141  C  CA  . MET A 1 21  ? 26.287 42.393 58.574 1.00 8.68   ? 21   MET A CA  1 
ATOM   142  C  C   . MET A 1 21  ? 27.056 42.452 57.263 1.00 8.44   ? 21   MET A C   1 
ATOM   143  O  O   . MET A 1 21  ? 27.420 41.381 56.734 1.00 10.00  ? 21   MET A O   1 
ATOM   144  C  CB  . MET A 1 21  ? 24.766 42.397 58.324 1.00 10.16  ? 21   MET A CB  1 
ATOM   145  C  CG  . MET A 1 21  ? 24.050 41.543 59.356 1.00 16.71  ? 21   MET A CG  1 
ATOM   146  S  SD  . MET A 1 21  ? 22.267 41.451 59.089 1.00 15.70  ? 21   MET A SD  1 
ATOM   147  C  CE  . MET A 1 21  ? 21.763 42.997 59.775 1.00 18.87  ? 21   MET A CE  1 
ATOM   148  N  N   . ILE A 1 22  ? 27.297 43.632 56.689 1.00 8.74   ? 22   ILE A N   1 
ATOM   149  C  CA  . ILE A 1 22  ? 28.122 43.726 55.479 1.00 9.24   ? 22   ILE A CA  1 
ATOM   150  C  C   . ILE A 1 22  ? 29.495 43.083 55.713 1.00 9.00   ? 22   ILE A C   1 
ATOM   151  O  O   . ILE A 1 22  ? 30.026 42.277 54.955 1.00 10.10  ? 22   ILE A O   1 
ATOM   152  C  CB  . ILE A 1 22  ? 28.259 45.175 54.993 1.00 9.18   ? 22   ILE A CB  1 
ATOM   153  C  CG1 . ILE A 1 22  ? 26.944 45.811 54.554 1.00 9.67   ? 22   ILE A CG1 1 
ATOM   154  C  CG2 . ILE A 1 22  ? 29.266 45.248 53.853 1.00 9.74   ? 22   ILE A CG2 1 
ATOM   155  C  CD1 . ILE A 1 22  ? 27.001 47.320 54.369 1.00 10.30  ? 22   ILE A CD1 1 
ATOM   156  N  N   . ARG A 1 23  ? 30.107 43.443 56.847 1.00 8.79   ? 23   ARG A N   1 
ATOM   157  C  CA  . ARG A 1 23  ? 31.437 42.951 57.174 1.00 9.35   ? 23   ARG A CA  1 
ATOM   158  C  C   . ARG A 1 23  ? 31.443 41.457 57.380 1.00 10.04  ? 23   ARG A C   1 
ATOM   159  O  O   . ARG A 1 23  ? 32.424 40.788 57.014 1.00 11.50  ? 23   ARG A O   1 
ATOM   160  C  CB  . ARG A 1 23  ? 31.990 43.667 58.423 1.00 10.94  ? 23   ARG A CB  1 
ATOM   161  C  CG  . ARG A 1 23  ? 32.331 45.123 58.143 1.00 9.86   ? 23   ARG A CG  1 
ATOM   162  C  CD  . ARG A 1 23  ? 32.706 45.907 59.355 1.00 12.84  ? 23   ARG A CD  1 
ATOM   163  N  NE  . ARG A 1 23  ? 33.319 47.202 59.072 1.00 12.19  ? 23   ARG A NE  1 
ATOM   164  C  CZ  . ARG A 1 23  ? 33.282 48.262 59.836 1.00 9.41   ? 23   ARG A CZ  1 
ATOM   165  N  NH1 . ARG A 1 23  ? 32.628 48.277 60.976 1.00 11.20  ? 23   ARG A NH1 1 
ATOM   166  N  NH2 . ARG A 1 23  ? 33.923 49.317 59.378 1.00 12.59  ? 23   ARG A NH2 1 
ATOM   167  N  N   . ASN A 1 24  ? 30.345 40.974 57.955 1.00 9.25   ? 24   ASN A N   1 
ATOM   168  C  CA  . ASN A 1 24  ? 30.208 39.515 58.209 1.00 10.21  ? 24   ASN A CA  1 
ATOM   169  C  C   . ASN A 1 24  ? 30.021 38.727 56.908 1.00 10.78  ? 24   ASN A C   1 
ATOM   170  O  O   . ASN A 1 24  ? 30.068 37.490 56.927 1.00 11.36  ? 24   ASN A O   1 
ATOM   171  C  CB  . ASN A 1 24  ? 29.094 39.225 59.203 1.00 10.85  ? 24   ASN A CB  1 
ATOM   172  C  CG  . ASN A 1 24  ? 29.058 37.818 59.759 1.00 11.47  ? 24   ASN A CG  1 
ATOM   173  O  OD1 . ASN A 1 24  ? 27.993 37.131 59.858 1.00 14.52  ? 24   ASN A OD1 1 
ATOM   174  N  ND2 . ASN A 1 24  ? 30.192 37.294 60.168 1.00 11.47  ? 24   ASN A ND2 1 
ATOM   175  N  N   . SER A 1 25  ? 29.832 39.390 55.768 1.00 10.16  ? 25   SER A N   1 
ATOM   176  C  CA  . SER A 1 25  ? 29.803 38.734 54.476 1.00 11.24  ? 25   SER A CA  1 
ATOM   177  C  C   . SER A 1 25  ? 31.192 38.763 53.868 1.00 12.71  ? 25   SER A C   1 
ATOM   178  O  O   . SER A 1 25  ? 31.415 38.185 52.792 1.00 14.36  ? 25   SER A O   1 
ATOM   179  C  CB  . SER A 1 25  ? 28.811 39.378 53.507 1.00 11.62  ? 25   SER A CB  1 
ATOM   180  O  OG  . SER A 1 25  ? 29.342 40.567 52.916 1.00 12.99  ? 25   SER A OG  1 
ATOM   181  N  N   . GLY A 1 26  ? 32.141 39.374 54.541 1.00 13.98  ? 26   GLY A N   1 
ATOM   182  C  CA  . GLY A 1 26  ? 33.507 39.279 54.091 1.00 13.40  ? 26   GLY A CA  1 
ATOM   183  C  C   . GLY A 1 26  ? 33.952 40.503 53.326 1.00 14.80  ? 26   GLY A C   1 
ATOM   184  O  O   . GLY A 1 26  ? 35.061 40.462 52.728 1.00 19.98  ? 26   GLY A O   1 
ATOM   185  N  N   . THR A 1 27  ? 33.162 41.550 53.318 1.00 16.17  ? 27   THR A N   1 
ATOM   186  C  CA  . THR A 1 27  ? 33.529 42.737 52.568 1.00 14.56  ? 27   THR A CA  1 
ATOM   187  C  C   . THR A 1 27  ? 33.591 43.969 53.470 1.00 15.61  ? 27   THR A C   1 
ATOM   188  O  O   . THR A 1 27  ? 32.700 44.183 54.282 1.00 16.61  ? 27   THR A O   1 
ATOM   189  C  CB  . THR A 1 27  ? 32.531 42.975 51.418 1.00 20.37  ? 27   THR A CB  1 
ATOM   190  O  OG1 . THR A 1 27  ? 32.707 42.035 50.365 1.00 25.11  ? 27   THR A OG1 1 
ATOM   191  C  CG2 . THR A 1 27  ? 32.803 44.319 50.737 1.00 24.24  ? 27   THR A CG2 1 
ATOM   192  N  N   . GLU A 1 28  ? 34.643 44.793 53.317 1.00 13.53  ? 28   GLU A N   1 
ATOM   193  C  CA  . GLU A 1 28  ? 34.668 46.120 53.903 1.00 12.60  ? 28   GLU A CA  1 
ATOM   194  C  C   . GLU A 1 28  ? 34.106 47.115 52.905 1.00 13.48  ? 28   GLU A C   1 
ATOM   195  O  O   . GLU A 1 28  ? 34.677 47.323 51.834 1.00 15.32  ? 28   GLU A O   1 
ATOM   196  C  CB  . GLU A 1 28  ? 36.071 46.589 54.289 1.00 15.63  ? 28   GLU A CB  1 
ATOM   197  C  CG  . GLU A 1 28  ? 36.124 47.960 54.963 1.00 15.54  ? 28   GLU A CG  1 
ATOM   198  C  CD  . GLU A 1 28  ? 35.504 48.029 56.359 1.00 17.31  ? 28   GLU A CD  1 
ATOM   199  O  OE1 . GLU A 1 28  ? 35.387 49.176 56.886 1.00 18.39  ? 28   GLU A OE1 1 
ATOM   200  O  OE2 . GLU A 1 28  ? 35.156 46.963 56.899 1.00 16.53  ? 28   GLU A OE2 1 
ATOM   201  N  N   . PRO A 1 29  ? 32.997 47.752 53.245 1.00 11.62  ? 29   PRO A N   1 
ATOM   202  C  CA  . PRO A 1 29  ? 32.386 48.706 52.290 1.00 11.34  ? 29   PRO A CA  1 
ATOM   203  C  C   . PRO A 1 29  ? 33.072 50.067 52.324 1.00 11.86  ? 29   PRO A C   1 
ATOM   204  O  O   . PRO A 1 29  ? 33.766 50.432 53.294 1.00 14.29  ? 29   PRO A O   1 
ATOM   205  C  CB  . PRO A 1 29  ? 30.962 48.781 52.812 1.00 12.06  ? 29   PRO A CB  1 
ATOM   206  C  CG  . PRO A 1 29  ? 31.135 48.634 54.312 1.00 11.96  ? 29   PRO A CG  1 
ATOM   207  C  CD  . PRO A 1 29  ? 32.244 47.638 54.519 1.00 12.11  ? 29   PRO A CD  1 
ATOM   208  N  N   . THR A 1 30  ? 32.836 50.846 51.274 1.00 13.23  ? 30   THR A N   1 
ATOM   209  C  CA  . THR A 1 30  ? 33.035 52.285 51.336 1.00 12.24  ? 30   THR A CA  1 
ATOM   210  C  C   . THR A 1 30  ? 31.956 52.866 52.222 1.00 11.54  ? 30   THR A C   1 
ATOM   211  O  O   . THR A 1 30  ? 30.778 52.616 52.041 1.00 13.20  ? 30   THR A O   1 
ATOM   212  C  CB  . THR A 1 30  ? 32.903 52.890 49.924 1.00 15.14  ? 30   THR A CB  1 
ATOM   213  O  OG1 . THR A 1 30  ? 33.909 52.317 49.081 1.00 18.00  ? 30   THR A OG1 1 
ATOM   214  C  CG2 . THR A 1 30  ? 33.080 54.405 50.001 1.00 18.76  ? 30   THR A CG2 1 
ATOM   215  N  N   . ILE A 1 31  ? 32.384 53.632 53.203 1.00 11.60  ? 31   ILE A N   1 
ATOM   216  C  CA  . ILE A 1 31  ? 31.456 54.254 54.181 1.00 10.76  ? 31   ILE A CA  1 
ATOM   217  C  C   . ILE A 1 31  ? 31.320 55.735 53.871 1.00 10.85  ? 31   ILE A C   1 
ATOM   218  O  O   . ILE A 1 31  ? 32.317 56.490 53.880 1.00 14.17  ? 31   ILE A O   1 
ATOM   219  C  CB  . ILE A 1 31  ? 31.958 53.975 55.606 1.00 10.54  ? 31   ILE A CB  1 
ATOM   220  C  CG1 . ILE A 1 31  ? 32.116 52.468 55.886 1.00 13.29  ? 31   ILE A CG1 1 
ATOM   221  C  CG2 . ILE A 1 31  ? 31.052 54.691 56.610 1.00 13.80  ? 31   ILE A CG2 1 
ATOM   222  C  CD1 . ILE A 1 31  ? 32.796 52.154 57.203 1.00 16.55  ? 31   ILE A CD1 1 
ATOM   223  N  N   . ILE A 1 32  ? 30.108 56.167 53.562 1.00 10.98  ? 32   ILE A N   1 
ATOM   224  C  CA  . ILE A 1 32  ? 29.859 57.607 53.384 1.00 11.64  ? 32   ILE A CA  1 
ATOM   225  C  C   . ILE A 1 32  ? 29.063 58.082 54.588 1.00 11.30  ? 32   ILE A C   1 
ATOM   226  O  O   . ILE A 1 32  ? 27.981 57.566 54.898 1.00 11.55  ? 32   ILE A O   1 
ATOM   227  C  CB  . ILE A 1 32  ? 29.121 57.886 52.077 1.00 11.61  ? 32   ILE A CB  1 
ATOM   228  C  CG1 . ILE A 1 32  ? 29.949 57.396 50.892 1.00 13.40  ? 32   ILE A CG1 1 
ATOM   229  C  CG2 . ILE A 1 32  ? 28.745 59.347 51.951 1.00 15.03  ? 32   ILE A CG2 1 
ATOM   230  C  CD1 . ILE A 1 32  ? 29.213 57.550 49.552 1.00 19.29  ? 32   ILE A CD1 1 
ATOM   231  N  N   . LEU A 1 33  ? 29.626 59.070 55.280 1.00 10.87  ? 33   LEU A N   1 
ATOM   232  C  CA  . LEU A 1 33  ? 28.909 59.685 56.418 1.00 10.85  ? 33   LEU A CA  1 
ATOM   233  C  C   . LEU A 1 33  ? 27.994 60.756 55.829 1.00 10.11  ? 33   LEU A C   1 
ATOM   234  O  O   . LEU A 1 33  ? 28.410 61.901 55.644 1.00 12.44  ? 33   LEU A O   1 
ATOM   235  C  CB  . LEU A 1 33  ? 29.892 60.248 57.431 1.00 14.03  ? 33   LEU A CB  1 
ATOM   236  C  CG  . LEU A 1 33  ? 30.814 59.192 58.045 1.00 14.71  ? 33   LEU A CG  1 
ATOM   237  C  CD1 . LEU A 1 33  ? 31.908 59.876 58.862 1.00 14.88  ? 33   LEU A CD1 1 
ATOM   238  C  CD2 . LEU A 1 33  ? 30.073 58.178 58.896 1.00 17.14  ? 33   LEU A CD2 1 
ATOM   239  N  N   . TYR A 1 34  ? 26.773 60.346 55.481 1.00 10.22  ? 34   TYR A N   1 
ATOM   240  C  CA  . TYR A 1 34  ? 25.836 61.142 54.699 1.00 10.59  ? 34   TYR A CA  1 
ATOM   241  C  C   . TYR A 1 34  ? 25.467 62.451 55.385 1.00 11.37  ? 34   TYR A C   1 
ATOM   242  O  O   . TYR A 1 34  ? 25.025 63.409 54.720 1.00 11.33  ? 34   TYR A O   1 
ATOM   243  C  CB  . TYR A 1 34  ? 24.575 60.322 54.230 1.00 11.06  ? 34   TYR A CB  1 
ATOM   244  C  CG  . TYR A 1 34  ? 23.684 60.004 55.413 1.00 9.37   ? 34   TYR A CG  1 
ATOM   245  C  CD1 . TYR A 1 34  ? 22.644 60.850 55.802 1.00 10.43  ? 34   TYR A CD1 1 
ATOM   246  C  CD2 . TYR A 1 34  ? 23.919 58.866 56.174 1.00 9.51   ? 34   TYR A CD2 1 
ATOM   247  C  CE1 . TYR A 1 34  ? 21.830 60.567 56.906 1.00 10.46  ? 34   TYR A CE1 1 
ATOM   248  C  CE2 . TYR A 1 34  ? 23.103 58.629 57.282 1.00 9.56   ? 34   TYR A CE2 1 
ATOM   249  C  CZ  . TYR A 1 34  ? 22.070 59.436 57.640 1.00 10.14  ? 34   TYR A CZ  1 
ATOM   250  O  OH  . TYR A 1 34  ? 21.313 59.174 58.776 1.00 10.88  ? 34   TYR A OH  1 
ATOM   251  N  N   . LEU A 1 35  ? 25.564 62.505 56.710 1.00 11.88  ? 35   LEU A N   1 
ATOM   252  C  CA  . LEU A 1 35  ? 25.168 63.732 57.408 1.00 12.61  ? 35   LEU A CA  1 
ATOM   253  C  C   . LEU A 1 35  ? 26.133 64.844 57.041 1.00 14.40  ? 35   LEU A C   1 
ATOM   254  O  O   . LEU A 1 35  ? 25.772 66.017 57.025 1.00 17.80  ? 35   LEU A O   1 
ATOM   255  C  CB  . LEU A 1 35  ? 25.099 63.492 58.904 1.00 12.50  ? 35   LEU A CB  1 
ATOM   256  C  CG  . LEU A 1 35  ? 23.954 62.618 59.409 1.00 12.56  ? 35   LEU A CG  1 
ATOM   257  C  CD1 . LEU A 1 35  ? 24.074 62.420 60.916 1.00 19.93  ? 35   LEU A CD1 1 
ATOM   258  C  CD2 . LEU A 1 35  ? 22.583 63.192 59.108 1.00 15.09  ? 35   LEU A CD2 1 
ATOM   259  N  N   . GLU A 1 36  ? 27.373 64.456 56.746 1.00 13.60  ? 36   GLU A N   1 
ATOM   260  C  CA  . GLU A 1 36  ? 28.401 65.420 56.399 1.00 17.78  ? 36   GLU A CA  1 
ATOM   261  C  C   . GLU A 1 36  ? 28.723 65.436 54.916 1.00 19.03  ? 36   GLU A C   1 
ATOM   262  O  O   . GLU A 1 36  ? 29.178 66.452 54.417 1.00 19.75  ? 36   GLU A O   1 
ATOM   263  C  CB  . GLU A 1 36  ? 29.614 65.122 57.248 1.00 29.09  ? 36   GLU A CB  1 
ATOM   264  C  CG  . GLU A 1 36  ? 30.838 64.356 56.964 1.00 43.03  ? 36   GLU A CG  1 
ATOM   265  C  CD  . GLU A 1 36  ? 31.761 64.406 58.199 1.00 57.06  ? 36   GLU A CD  1 
ATOM   266  O  OE1 . GLU A 1 36  ? 31.332 63.849 59.221 1.00 61.27  ? 36   GLU A OE1 1 
ATOM   267  O  OE2 . GLU A 1 36  ? 32.842 65.034 58.073 1.00 80.31  ? 36   GLU A OE2 1 
ATOM   268  N  N   . ASN A 1 37  ? 28.474 64.360 54.218 1.00 16.52  ? 37   ASN A N   1 
ATOM   269  C  CA  . ASN A 1 37  ? 28.795 64.222 52.827 1.00 14.99  ? 37   ASN A CA  1 
ATOM   270  C  C   . ASN A 1 37  ? 27.588 63.609 52.106 1.00 14.95  ? 37   ASN A C   1 
ATOM   271  O  O   . ASN A 1 37  ? 27.680 62.453 51.686 1.00 14.32  ? 37   ASN A O   1 
ATOM   272  C  CB  . ASN A 1 37  ? 29.995 63.312 52.562 1.00 22.96  ? 37   ASN A CB  1 
ATOM   273  C  CG  . ASN A 1 37  ? 31.281 63.863 53.124 1.00 26.61  ? 37   ASN A CG  1 
ATOM   274  O  OD1 . ASN A 1 37  ? 31.767 64.876 52.601 1.00 51.01  ? 37   ASN A OD1 1 
ATOM   275  N  ND2 . ASN A 1 37  ? 31.826 63.226 54.176 1.00 33.90  ? 37   ASN A ND2 1 
ATOM   276  N  N   . PRO A 1 38  ? 26.497 64.337 52.032 1.00 14.25  ? 38   PRO A N   1 
ATOM   277  C  CA  . PRO A 1 38  ? 25.297 63.764 51.396 1.00 13.83  ? 38   PRO A CA  1 
ATOM   278  C  C   . PRO A 1 38  ? 25.473 63.494 49.918 1.00 12.81  ? 38   PRO A C   1 
ATOM   279  O  O   . PRO A 1 38  ? 26.350 64.092 49.271 1.00 14.69  ? 38   PRO A O   1 
ATOM   280  C  CB  . PRO A 1 38  ? 24.258 64.852 51.661 1.00 16.65  ? 38   PRO A CB  1 
ATOM   281  C  CG  . PRO A 1 38  ? 25.043 66.087 51.840 1.00 18.10  ? 38   PRO A CG  1 
ATOM   282  C  CD  . PRO A 1 38  ? 26.269 65.662 52.596 1.00 18.74  ? 38   PRO A CD  1 
ATOM   283  N  N   . PRO A 1 39  ? 24.657 62.602 49.385 1.00 13.07  ? 39   PRO A N   1 
ATOM   284  C  CA  . PRO A 1 39  ? 24.729 62.354 47.916 1.00 13.06  ? 39   PRO A CA  1 
ATOM   285  C  C   . PRO A 1 39  ? 24.348 63.633 47.194 1.00 14.70  ? 39   PRO A C   1 
ATOM   286  O  O   . PRO A 1 39  ? 23.686 64.539 47.704 1.00 15.33  ? 39   PRO A O   1 
ATOM   287  C  CB  . PRO A 1 39  ? 23.682 61.287 47.696 1.00 14.46  ? 39   PRO A CB  1 
ATOM   288  C  CG  . PRO A 1 39  ? 22.766 61.427 48.887 1.00 15.77  ? 39   PRO A CG  1 
ATOM   289  C  CD  . PRO A 1 39  ? 23.618 61.816 50.053 1.00 14.34  ? 39   PRO A CD  1 
ATOM   290  N  N   . SER A 1 40  ? 24.757 63.738 45.933 1.00 14.83  ? 40   SER A N   1 
ATOM   291  C  CA  . SER A 1 40  ? 24.258 64.812 45.078 1.00 13.60  ? 40   SER A CA  1 
ATOM   292  C  C   . SER A 1 40  ? 22.803 64.559 44.668 1.00 12.90  ? 40   SER A C   1 
ATOM   293  O  O   . SER A 1 40  ? 22.273 63.490 44.909 1.00 13.17  ? 40   SER A O   1 
ATOM   294  C  CB  . SER A 1 40  ? 25.087 64.949 43.823 1.00 17.11  ? 40   SER A CB  1 
ATOM   295  O  OG  . SER A 1 40  ? 24.996 63.815 43.057 1.00 19.30  ? 40   SER A OG  1 
ATOM   296  N  N   . ARG A 1 41  ? 22.214 65.585 44.064 1.00 12.22  ? 41   ARG A N   1 
ATOM   297  C  CA  . ARG A 1 41  ? 20.812 65.361 43.715 1.00 12.51  ? 41   ARG A CA  1 
ATOM   298  C  C   . ARG A 1 41  ? 20.645 64.195 42.763 1.00 12.46  ? 41   ARG A C   1 
ATOM   299  O  O   . ARG A 1 41  ? 19.793 63.348 42.884 1.00 13.21  ? 41   ARG A O   1 
ATOM   300  C  CB  . ARG A 1 41  ? 20.259 66.677 43.115 1.00 11.63  ? 41   ARG A CB  1 
ATOM   301  C  CG  . ARG A 1 41  ? 18.785 66.695 42.928 1.00 14.14  ? 41   ARG A CG  1 
ATOM   302  C  CD  . ARG A 1 41  ? 18.188 68.013 42.511 1.00 13.96  ? 41   ARG A CD  1 
ATOM   303  N  NE  . ARG A 1 41  ? 16.815 68.114 42.970 1.00 14.49  ? 41   ARG A NE  1 
ATOM   304  C  CZ  . ARG A 1 41  ? 15.765 67.479 42.501 1.00 11.15  ? 41   ARG A CZ  1 
ATOM   305  N  NH1 . ARG A 1 41  ? 15.928 66.684 41.458 1.00 14.99  ? 41   ARG A NH1 1 
ATOM   306  N  NH2 . ARG A 1 41  ? 14.538 67.591 42.965 1.00 15.60  ? 41   ARG A NH2 1 
ATOM   307  N  N   . ASP A 1 42  ? 21.546 64.212 41.767 1.00 14.10  ? 42   ASP A N   1 
ATOM   308  C  CA  . ASP A 1 42  ? 21.403 63.142 40.786 1.00 14.57  ? 42   ASP A CA  1 
ATOM   309  C  C   . ASP A 1 42  ? 21.522 61.745 41.375 1.00 15.79  ? 42   ASP A C   1 
ATOM   310  O  O   . ASP A 1 42  ? 20.836 60.781 41.064 1.00 15.57  ? 42   ASP A O   1 
ATOM   311  C  CB  . ASP A 1 42  ? 22.430 63.308 39.646 1.00 22.35  ? 42   ASP A CB  1 
ATOM   312  C  CG  . ASP A 1 42  ? 22.037 64.322 38.623 1.00 31.55  ? 42   ASP A CG  1 
ATOM   313  O  OD1 . ASP A 1 42  ? 20.836 64.644 38.505 1.00 40.71  ? 42   ASP A OD1 1 
ATOM   314  O  OD2 . ASP A 1 42  ? 22.908 64.831 37.881 1.00 43.55  ? 42   ASP A OD2 1 
ATOM   315  N  N   . GLU A 1 43  ? 22.460 61.549 42.247 1.00 14.33  ? 43   GLU A N   1 
ATOM   316  C  CA  . GLU A 1 43  ? 22.805 60.362 42.999 1.00 13.36  ? 43   GLU A CA  1 
ATOM   317  C  C   . GLU A 1 43  ? 21.588 60.043 43.881 1.00 12.58  ? 43   GLU A C   1 
ATOM   318  O  O   . GLU A 1 43  ? 21.147 58.876 43.862 1.00 12.83  ? 43   GLU A O   1 
ATOM   319  C  CB  A GLU A 1 43  ? 24.075 60.611 43.829 0.56 19.04  ? 43   GLU A CB  1 
ATOM   320  C  CB  B GLU A 1 43  ? 24.071 60.322 43.829 0.44 14.02  ? 43   GLU A CB  1 
ATOM   321  C  CG  A GLU A 1 43  ? 25.506 60.689 43.376 0.56 21.00  ? 43   GLU A CG  1 
ATOM   322  C  CG  B GLU A 1 43  ? 24.448 58.917 44.292 0.44 13.30  ? 43   GLU A CG  1 
ATOM   323  C  CD  A GLU A 1 43  ? 26.730 61.091 44.170 0.56 16.44  ? 43   GLU A CD  1 
ATOM   324  C  CD  B GLU A 1 43  ? 24.440 57.836 43.228 0.44 19.57  ? 43   GLU A CD  1 
ATOM   325  O  OE1 A GLU A 1 43  ? 26.691 61.690 45.242 0.56 11.70  ? 43   GLU A OE1 1 
ATOM   326  O  OE1 B GLU A 1 43  ? 24.917 57.984 42.082 0.44 19.34  ? 43   GLU A OE1 1 
ATOM   327  O  OE2 A GLU A 1 43  ? 27.899 60.900 43.782 0.56 20.70  ? 43   GLU A OE2 1 
ATOM   328  O  OE2 B GLU A 1 43  ? 23.929 56.766 43.572 0.44 27.92  ? 43   GLU A OE2 1 
ATOM   329  N  N   . LEU A 1 44  ? 21.031 61.021 44.592 1.00 12.85  ? 44   LEU A N   1 
ATOM   330  C  CA  . LEU A 1 44  ? 19.879 60.672 45.445 1.00 11.35  ? 44   LEU A CA  1 
ATOM   331  C  C   . LEU A 1 44  ? 18.681 60.230 44.633 1.00 13.18  ? 44   LEU A C   1 
ATOM   332  O  O   . LEU A 1 44  ? 17.967 59.304 44.994 1.00 11.82  ? 44   LEU A O   1 
ATOM   333  C  CB  . LEU A 1 44  ? 19.557 61.871 46.308 1.00 12.12  ? 44   LEU A CB  1 
ATOM   334  C  CG  . LEU A 1 44  ? 18.406 61.639 47.293 1.00 11.16  ? 44   LEU A CG  1 
ATOM   335  C  CD1 . LEU A 1 44  ? 18.628 60.460 48.223 1.00 13.14  ? 44   LEU A CD1 1 
ATOM   336  C  CD2 . LEU A 1 44  ? 18.169 62.915 48.129 1.00 14.26  ? 44   LEU A CD2 1 
ATOM   337  N  N   . VAL A 1 45  ? 18.456 60.883 43.507 1.00 12.90  ? 45   VAL A N   1 
ATOM   338  C  CA  . VAL A 1 45  ? 17.332 60.434 42.661 1.00 13.33  ? 45   VAL A CA  1 
ATOM   339  C  C   . VAL A 1 45  ? 17.484 59.005 42.186 1.00 13.26  ? 45   VAL A C   1 
ATOM   340  O  O   . VAL A 1 45  ? 16.563 58.176 42.141 1.00 15.80  ? 45   VAL A O   1 
ATOM   341  C  CB  . VAL A 1 45  ? 17.191 61.376 41.454 1.00 16.31  ? 45   VAL A CB  1 
ATOM   342  C  CG1 . VAL A 1 45  ? 16.279 60.774 40.376 1.00 21.93  ? 45   VAL A CG1 1 
ATOM   343  C  CG2 . VAL A 1 45  ? 16.667 62.742 41.896 1.00 19.20  ? 45   VAL A CG2 1 
ATOM   344  N  N   . LYS A 1 46  ? 18.713 58.644 41.819 1.00 14.01  ? 46   LYS A N   1 
ATOM   345  C  CA  . LYS A 1 46  ? 19.020 57.273 41.398 1.00 14.38  ? 46   LYS A CA  1 
ATOM   346  C  C   . LYS A 1 46  ? 18.862 56.266 42.524 1.00 14.07  ? 46   LYS A C   1 
ATOM   347  O  O   . LYS A 1 46  ? 18.362 55.141 42.377 1.00 15.96  ? 46   LYS A O   1 
ATOM   348  C  CB  . LYS A 1 46  ? 20.440 57.265 40.839 1.00 16.39  ? 46   LYS A CB  1 
ATOM   349  C  CG  . LYS A 1 46  ? 20.873 55.863 40.377 1.00 27.33  ? 46   LYS A CG  1 
ATOM   350  C  CD  . LYS A 1 46  ? 22.269 55.858 39.765 1.00 41.25  ? 46   LYS A CD  1 
ATOM   351  C  CE  . LYS A 1 46  ? 22.873 54.463 39.692 1.00 48.93  ? 46   LYS A CE  1 
ATOM   352  N  NZ  . LYS A 1 46  ? 24.383 54.458 39.725 1.00 75.77  ? 46   LYS A NZ  1 
ATOM   353  N  N   . LEU A 1 47  ? 19.308 56.650 43.716 1.00 14.17  ? 47   LEU A N   1 
ATOM   354  C  CA  . LEU A 1 47  ? 19.173 55.751 44.885 1.00 12.68  ? 47   LEU A CA  1 
ATOM   355  C  C   . LEU A 1 47  ? 17.705 55.449 45.131 1.00 13.36  ? 47   LEU A C   1 
ATOM   356  O  O   . LEU A 1 47  ? 17.361 54.298 45.352 1.00 12.85  ? 47   LEU A O   1 
ATOM   357  C  CB  . LEU A 1 47  ? 19.803 56.341 46.147 1.00 11.94  ? 47   LEU A CB  1 
ATOM   358  C  CG  . LEU A 1 47  ? 21.326 56.516 46.201 1.00 11.83  ? 47   LEU A CG  1 
ATOM   359  C  CD1 . LEU A 1 47  ? 21.743 57.417 47.364 1.00 14.03  ? 47   LEU A CD1 1 
ATOM   360  C  CD2 . LEU A 1 47  ? 22.073 55.187 46.251 1.00 14.83  ? 47   LEU A CD2 1 
ATOM   361  N  N   . ILE A 1 48  ? 16.923 56.520 45.101 1.00 12.31  ? 48   ILE A N   1 
ATOM   362  C  CA  . ILE A 1 48  ? 15.494 56.299 45.366 1.00 13.22  ? 48   ILE A CA  1 
ATOM   363  C  C   . ILE A 1 48  ? 14.892 55.391 44.314 1.00 13.24  ? 48   ILE A C   1 
ATOM   364  O  O   . ILE A 1 48  ? 14.143 54.467 44.629 1.00 14.80  ? 48   ILE A O   1 
ATOM   365  C  CB  . ILE A 1 48  ? 14.764 57.648 45.466 1.00 14.11  ? 48   ILE A CB  1 
ATOM   366  C  CG1 . ILE A 1 48  ? 15.267 58.392 46.725 1.00 14.36  ? 48   ILE A CG1 1 
ATOM   367  C  CG2 . ILE A 1 48  ? 13.250 57.440 45.406 1.00 19.15  ? 48   ILE A CG2 1 
ATOM   368  C  CD1 . ILE A 1 48  ? 14.885 59.853 46.754 1.00 15.21  ? 48   ILE A CD1 1 
ATOM   369  N  N   . ALA A 1 49  ? 15.202 55.665 43.038 1.00 15.59  ? 49   ALA A N   1 
ATOM   370  C  CA  . ALA A 1 49  ? 14.722 54.786 41.993 1.00 15.80  ? 49   ALA A CA  1 
ATOM   371  C  C   . ALA A 1 49  ? 15.131 53.339 42.234 1.00 16.51  ? 49   ALA A C   1 
ATOM   372  O  O   . ALA A 1 49  ? 14.302 52.435 42.109 1.00 19.55  ? 49   ALA A O   1 
ATOM   373  C  CB  . ALA A 1 49  ? 15.235 55.316 40.645 1.00 19.52  ? 49   ALA A CB  1 
ATOM   374  N  N   . ASP A 1 50  ? 16.390 53.122 42.553 1.00 15.44  ? 50   ASP A N   1 
ATOM   375  C  CA  . ASP A 1 50  ? 16.844 51.747 42.695 1.00 14.09  ? 50   ASP A CA  1 
ATOM   376  C  C   . ASP A 1 50  ? 16.266 51.102 43.927 1.00 15.16  ? 50   ASP A C   1 
ATOM   377  O  O   . ASP A 1 50  ? 16.123 49.884 43.943 1.00 15.58  ? 50   ASP A O   1 
ATOM   378  C  CB  . ASP A 1 50  ? 18.343 51.792 42.678 1.00 15.74  ? 50   ASP A CB  1 
ATOM   379  C  CG  . ASP A 1 50  ? 18.962 52.152 41.360 1.00 20.30  ? 50   ASP A CG  1 
ATOM   380  O  OD1 . ASP A 1 50  ? 20.201 52.354 41.309 1.00 21.09  ? 50   ASP A OD1 1 
ATOM   381  O  OD2 . ASP A 1 50  ? 18.261 52.243 40.320 1.00 22.13  ? 50   ASP A OD2 1 
ATOM   382  N  N   . MET A 1 51  ? 15.948 51.849 44.958 1.00 15.39  ? 51   MET A N   1 
ATOM   383  C  CA  . MET A 1 51  ? 15.458 51.257 46.211 1.00 16.71  ? 51   MET A CA  1 
ATOM   384  C  C   . MET A 1 51  ? 14.021 50.785 46.137 1.00 17.71  ? 51   MET A C   1 
ATOM   385  O  O   . MET A 1 51  ? 13.579 50.054 47.050 1.00 21.87  ? 51   MET A O   1 
ATOM   386  C  CB  A MET A 1 51  ? 15.511 52.301 47.338 0.72 17.30  ? 51   MET A CB  1 
ATOM   387  C  CB  B MET A 1 51  ? 15.587 52.292 47.336 0.28 14.95  ? 51   MET A CB  1 
ATOM   388  C  CG  A MET A 1 51  ? 16.867 52.472 47.948 0.72 19.31  ? 51   MET A CG  1 
ATOM   389  C  CG  B MET A 1 51  ? 17.011 52.414 47.836 0.28 13.20  ? 51   MET A CG  1 
ATOM   390  S  SD  A MET A 1 51  ? 16.747 53.556 49.430 0.72 29.52  ? 51   MET A SD  1 
ATOM   391  S  SD  B MET A 1 51  ? 17.075 53.392 49.363 0.28 11.12  ? 51   MET A SD  1 
ATOM   392  C  CE  A MET A 1 51  ? 17.127 55.120 48.690 0.72 13.12  ? 51   MET A CE  1 
ATOM   393  C  CE  B MET A 1 51  ? 15.943 54.714 48.942 0.28 13.38  ? 51   MET A CE  1 
ATOM   394  N  N   . GLY A 1 52  ? 13.309 51.253 45.112 1.00 20.11  ? 52   GLY A N   1 
ATOM   395  C  CA  . GLY A 1 52  ? 11.925 50.869 44.937 1.00 23.27  ? 52   GLY A CA  1 
ATOM   396  C  C   . GLY A 1 52  ? 10.913 51.402 45.926 1.00 25.61  ? 52   GLY A C   1 
ATOM   397  O  O   . GLY A 1 52  ? 9.753  50.962 46.018 1.00 33.00  ? 52   GLY A O   1 
ATOM   398  N  N   . ILE A 1 53  ? 11.285 52.403 46.711 1.00 20.10  ? 53   ILE A N   1 
ATOM   399  C  CA  . ILE A 1 53  ? 10.343 53.042 47.643 1.00 16.29  ? 53   ILE A CA  1 
ATOM   400  C  C   . ILE A 1 53  ? 9.978  54.454 47.203 1.00 14.34  ? 53   ILE A C   1 
ATOM   401  O  O   . ILE A 1 53  ? 10.624 55.049 46.325 1.00 16.73  ? 53   ILE A O   1 
ATOM   402  C  CB  . ILE A 1 53  ? 10.951 53.052 49.057 1.00 18.66  ? 53   ILE A CB  1 
ATOM   403  C  CG1 . ILE A 1 53  ? 12.116 54.031 49.227 1.00 23.74  ? 53   ILE A CG1 1 
ATOM   404  C  CG2 . ILE A 1 53  ? 11.358 51.660 49.447 1.00 24.29  ? 53   ILE A CG2 1 
ATOM   405  C  CD1 . ILE A 1 53  ? 12.659 54.056 50.663 1.00 26.61  ? 53   ILE A CD1 1 
ATOM   406  N  N   . SER A 1 54  ? 8.939  55.033 47.803 1.00 13.23  ? 54   SER A N   1 
ATOM   407  C  CA  . SER A 1 54  ? 8.638  56.430 47.488 1.00 14.39  ? 54   SER A CA  1 
ATOM   408  C  C   . SER A 1 54  ? 9.587  57.406 48.148 1.00 12.97  ? 54   SER A C   1 
ATOM   409  O  O   . SER A 1 54  ? 10.222 57.002 49.115 1.00 12.65  ? 54   SER A O   1 
ATOM   410  C  CB  . SER A 1 54  ? 7.233  56.771 47.981 1.00 14.48  ? 54   SER A CB  1 
ATOM   411  O  OG  . SER A 1 54  ? 7.157  56.822 49.400 1.00 16.41  ? 54   SER A OG  1 
ATOM   412  N  N   . VAL A 1 55  ? 9.607  58.621 47.631 1.00 12.45  ? 55   VAL A N   1 
ATOM   413  C  CA  . VAL A 1 55  ? 10.433 59.633 48.244 1.00 11.24  ? 55   VAL A CA  1 
ATOM   414  C  C   . VAL A 1 55  ? 10.011 59.844 49.680 1.00 10.76  ? 55   VAL A C   1 
ATOM   415  O  O   . VAL A 1 55  ? 10.821 59.906 50.597 1.00 11.44  ? 55   VAL A O   1 
ATOM   416  C  CB  . VAL A 1 55  ? 10.360 60.947 47.469 1.00 11.99  ? 55   VAL A CB  1 
ATOM   417  C  CG1 . VAL A 1 55  ? 11.159 61.995 48.176 1.00 13.35  ? 55   VAL A CG1 1 
ATOM   418  C  CG2 . VAL A 1 55  ? 10.897 60.723 46.077 1.00 15.78  ? 55   VAL A CG2 1 
ATOM   419  N  N   . ARG A 1 56  ? 8.716  59.930 49.917 1.00 10.56  ? 56   ARG A N   1 
ATOM   420  C  CA  . ARG A 1 56  ? 8.264  60.112 51.313 1.00 11.12  ? 56   ARG A CA  1 
ATOM   421  C  C   . ARG A 1 56  ? 8.657  58.965 52.226 1.00 11.62  ? 56   ARG A C   1 
ATOM   422  O  O   . ARG A 1 56  ? 8.935  59.187 53.412 1.00 13.15  ? 56   ARG A O   1 
ATOM   423  C  CB  . ARG A 1 56  ? 6.744  60.335 51.329 1.00 12.39  ? 56   ARG A CB  1 
ATOM   424  C  CG  . ARG A 1 56  ? 6.140  60.402 52.725 1.00 14.68  ? 56   ARG A CG  1 
ATOM   425  C  CD  . ARG A 1 56  ? 4.723  60.941 52.756 1.00 13.82  ? 56   ARG A CD  1 
ATOM   426  N  NE  . ARG A 1 56  ? 4.599  62.335 52.456 1.00 13.54  ? 56   ARG A NE  1 
ATOM   427  C  CZ  . ARG A 1 56  ? 4.785  63.315 53.346 1.00 11.58  ? 56   ARG A CZ  1 
ATOM   428  N  NH1 . ARG A 1 56  ? 4.635  64.566 52.970 1.00 13.96  ? 56   ARG A NH1 1 
ATOM   429  N  NH2 . ARG A 1 56  ? 5.119  63.055 54.600 1.00 13.41  ? 56   ARG A NH2 1 
ATOM   430  N  N   . ALA A 1 57  ? 8.713  57.756 51.709 1.00 11.56  ? 57   ALA A N   1 
ATOM   431  C  CA  . ALA A 1 57  ? 9.066  56.626 52.550 1.00 11.65  ? 57   ALA A CA  1 
ATOM   432  C  C   . ALA A 1 57  ? 10.506 56.696 53.016 1.00 11.18  ? 57   ALA A C   1 
ATOM   433  O  O   . ALA A 1 57  ? 10.883 56.028 54.008 1.00 14.69  ? 57   ALA A O   1 
ATOM   434  C  CB  . ALA A 1 57  ? 8.848  55.345 51.804 1.00 14.92  ? 57   ALA A CB  1 
ATOM   435  N  N   . LEU A 1 58  ? 11.308 57.502 52.332 1.00 11.33  ? 58   LEU A N   1 
ATOM   436  C  CA  . LEU A 1 58  ? 12.695 57.661 52.792 1.00 11.58  ? 58   LEU A CA  1 
ATOM   437  C  C   . LEU A 1 58  ? 12.846 58.714 53.870 1.00 11.83  ? 58   LEU A C   1 
ATOM   438  O  O   . LEU A 1 58  ? 13.905 58.800 54.521 1.00 11.77  ? 58   LEU A O   1 
ATOM   439  C  CB  . LEU A 1 58  ? 13.567 58.026 51.576 1.00 12.65  ? 58   LEU A CB  1 
ATOM   440  C  CG  . LEU A 1 58  ? 15.079 58.159 51.801 1.00 11.50  ? 58   LEU A CG  1 
ATOM   441  C  CD1 . LEU A 1 58  ? 15.705 56.915 52.416 1.00 13.12  ? 58   LEU A CD1 1 
ATOM   442  C  CD2 . LEU A 1 58  ? 15.779 58.533 50.484 1.00 14.73  ? 58   LEU A CD2 1 
ATOM   443  N  N   . LEU A 1 59  ? 11.841 59.554 54.136 1.00 11.28  ? 59   LEU A N   1 
ATOM   444  C  CA  . LEU A 1 59  ? 11.957 60.594 55.129 1.00 10.51  ? 59   LEU A CA  1 
ATOM   445  C  C   . LEU A 1 59  ? 11.959 60.033 56.564 1.00 10.36  ? 59   LEU A C   1 
ATOM   446  O  O   . LEU A 1 59  ? 11.115 59.249 56.983 1.00 13.73  ? 59   LEU A O   1 
ATOM   447  C  CB  . LEU A 1 59  ? 10.797 61.582 55.107 1.00 12.58  ? 59   LEU A CB  1 
ATOM   448  C  CG  . LEU A 1 59  ? 10.692 62.545 53.932 1.00 12.17  ? 59   LEU A CG  1 
ATOM   449  C  CD1 . LEU A 1 59  ? 9.319  63.219 54.025 1.00 12.80  ? 59   LEU A CD1 1 
ATOM   450  C  CD2 . LEU A 1 59  ? 11.788 63.605 53.903 1.00 14.17  ? 59   LEU A CD2 1 
ATOM   451  N  N   . ARG A 1 60  ? 12.966 60.467 57.318 1.00 10.35  ? 60   ARG A N   1 
ATOM   452  C  CA  . ARG A 1 60  ? 13.045 60.131 58.721 1.00 10.17  ? 60   ARG A CA  1 
ATOM   453  C  C   . ARG A 1 60  ? 12.225 61.107 59.556 1.00 9.73   ? 60   ARG A C   1 
ATOM   454  O  O   . ARG A 1 60  ? 12.402 62.329 59.477 1.00 10.77  ? 60   ARG A O   1 
ATOM   455  C  CB  . ARG A 1 60  ? 14.493 60.195 59.222 1.00 12.85  ? 60   ARG A CB  1 
ATOM   456  C  CG  . ARG A 1 60  ? 14.562 59.518 60.588 1.00 16.07  ? 60   ARG A CG  1 
ATOM   457  C  CD  . ARG A 1 60  ? 15.885 59.156 61.043 1.00 16.24  ? 60   ARG A CD  1 
ATOM   458  N  NE  . ARG A 1 60  ? 15.854 58.628 62.390 1.00 15.73  ? 60   ARG A NE  1 
ATOM   459  C  CZ  . ARG A 1 60  ? 15.722 57.383 62.807 1.00 14.30  ? 60   ARG A CZ  1 
ATOM   460  N  NH1 . ARG A 1 60  ? 15.591 56.430 61.922 1.00 14.33  ? 60   ARG A NH1 1 
ATOM   461  N  NH2 . ARG A 1 60  ? 15.728 57.121 64.103 1.00 16.06  ? 60   ARG A NH2 1 
ATOM   462  N  N   . LYS A 1 61  ? 11.352 60.514 60.376 1.00 12.38  ? 61   LYS A N   1 
ATOM   463  C  CA  . LYS A 1 61  ? 10.507 61.332 61.240 1.00 11.98  ? 61   LYS A CA  1 
ATOM   464  C  C   . LYS A 1 61  ? 11.224 61.642 62.544 1.00 14.00  ? 61   LYS A C   1 
ATOM   465  O  O   . LYS A 1 61  ? 12.323 61.138 62.863 1.00 15.04  ? 61   LYS A O   1 
ATOM   466  C  CB  . LYS A 1 61  ? 9.204  60.590 61.448 1.00 12.83  ? 61   LYS A CB  1 
ATOM   467  C  CG  . LYS A 1 61  ? 8.441  60.111 60.216 1.00 16.32  ? 61   LYS A CG  1 
ATOM   468  C  CD  . LYS A 1 61  ? 7.120  59.427 60.599 1.00 21.45  ? 61   LYS A CD  1 
ATOM   469  C  CE  . LYS A 1 61  ? 6.247  58.954 59.476 1.00 23.41  ? 61   LYS A CE  1 
ATOM   470  N  NZ  . LYS A 1 61  ? 5.016  58.202 59.903 1.00 40.25  ? 61   LYS A NZ  1 
ATOM   471  N  N   . ASN A 1 62  ? 10.691 62.457 63.413 1.00 14.91  ? 62   ASN A N   1 
ATOM   472  C  CA  . ASN A 1 62  ? 11.274 62.726 64.737 1.00 12.58  ? 62   ASN A CA  1 
ATOM   473  C  C   . ASN A 1 62  ? 12.648 63.356 64.679 1.00 10.75  ? 62   ASN A C   1 
ATOM   474  O  O   . ASN A 1 62  ? 13.462 63.163 65.579 1.00 16.19  ? 62   ASN A O   1 
ATOM   475  C  CB  . ASN A 1 62  ? 11.269 61.474 65.635 1.00 16.08  ? 62   ASN A CB  1 
ATOM   476  C  CG  . ASN A 1 62  ? 11.253 61.906 67.105 1.00 16.06  ? 62   ASN A CG  1 
ATOM   477  O  OD1 . ASN A 1 62  ? 10.560 62.840 67.485 1.00 17.91  ? 62   ASN A OD1 1 
ATOM   478  N  ND2 . ASN A 1 62  ? 12.030 61.190 67.964 1.00 15.73  ? 62   ASN A ND2 1 
ATOM   479  N  N   . VAL A 1 63  ? 12.892 64.164 63.650 1.00 10.48  ? 63   VAL A N   1 
ATOM   480  C  CA  . VAL A 1 63  ? 14.061 64.988 63.538 1.00 9.65   ? 63   VAL A CA  1 
ATOM   481  C  C   . VAL A 1 63  ? 13.652 66.449 63.330 1.00 8.82   ? 63   VAL A C   1 
ATOM   482  O  O   . VAL A 1 63  ? 12.566 66.697 62.833 1.00 10.34  ? 63   VAL A O   1 
ATOM   483  C  CB  . VAL A 1 63  ? 15.046 64.501 62.454 1.00 9.82   ? 63   VAL A CB  1 
ATOM   484  C  CG1 . VAL A 1 63  ? 15.482 63.075 62.773 1.00 14.49  ? 63   VAL A CG1 1 
ATOM   485  C  CG2 . VAL A 1 63  ? 14.497 64.606 61.058 1.00 11.02  ? 63   VAL A CG2 1 
ATOM   486  N  N   . GLU A 1 64  ? 14.507 67.384 63.720 1.00 9.94   ? 64   GLU A N   1 
ATOM   487  C  CA  . GLU A 1 64  ? 14.109 68.800 63.753 1.00 10.39  ? 64   GLU A CA  1 
ATOM   488  C  C   . GLU A 1 64  ? 13.553 69.326 62.449 1.00 10.42  ? 64   GLU A C   1 
ATOM   489  O  O   . GLU A 1 64  ? 12.504 69.956 62.495 1.00 11.17  ? 64   GLU A O   1 
ATOM   490  C  CB  . GLU A 1 64  ? 15.304 69.629 64.236 1.00 11.54  ? 64   GLU A CB  1 
ATOM   491  C  CG  . GLU A 1 64  ? 14.990 71.096 64.441 1.00 13.17  ? 64   GLU A CG  1 
ATOM   492  C  CD  . GLU A 1 64  ? 16.012 71.857 65.231 1.00 18.99  ? 64   GLU A CD  1 
ATOM   493  O  OE1 . GLU A 1 64  ? 15.875 73.078 65.478 1.00 20.67  ? 64   GLU A OE1 1 
ATOM   494  O  OE2 . GLU A 1 64  ? 17.027 71.282 65.676 1.00 20.06  ? 64   GLU A OE2 1 
ATOM   495  N  N   . PRO A 1 65  ? 14.193 69.136 61.284 1.00 9.86   ? 65   PRO A N   1 
ATOM   496  C  CA  . PRO A 1 65  ? 13.593 69.712 60.073 1.00 10.01  ? 65   PRO A CA  1 
ATOM   497  C  C   . PRO A 1 65  ? 12.293 69.025 59.704 1.00 9.47   ? 65   PRO A C   1 
ATOM   498  O  O   . PRO A 1 65  ? 11.401 69.656 59.096 1.00 11.07  ? 65   PRO A O   1 
ATOM   499  C  CB  . PRO A 1 65  ? 14.656 69.487 59.003 1.00 12.11  ? 65   PRO A CB  1 
ATOM   500  C  CG  . PRO A 1 65  ? 15.576 68.444 59.565 1.00 14.47  ? 65   PRO A CG  1 
ATOM   501  C  CD  . PRO A 1 65  ? 15.514 68.532 61.044 1.00 10.68  ? 65   PRO A CD  1 
ATOM   502  N  N   . TYR A 1 66  ? 12.123 67.750 60.003 1.00 10.17  ? 66   TYR A N   1 
ATOM   503  C  CA  . TYR A 1 66  ? 10.812 67.117 59.688 1.00 9.72   ? 66   TYR A CA  1 
ATOM   504  C  C   . TYR A 1 66  ? 9.685  67.828 60.433 1.00 10.11  ? 66   TYR A C   1 
ATOM   505  O  O   . TYR A 1 66  ? 8.604  68.074 59.897 1.00 10.59  ? 66   TYR A O   1 
ATOM   506  C  CB  . TYR A 1 66  ? 10.836 65.622 60.005 1.00 9.88   ? 66   TYR A CB  1 
ATOM   507  C  CG  . TYR A 1 66  ? 9.662  64.805 59.576 1.00 10.18  ? 66   TYR A CG  1 
ATOM   508  C  CD1 . TYR A 1 66  ? 8.529  64.707 60.363 1.00 11.20  ? 66   TYR A CD1 1 
ATOM   509  C  CD2 . TYR A 1 66  ? 9.641  64.116 58.370 1.00 10.50  ? 66   TYR A CD2 1 
ATOM   510  C  CE1 . TYR A 1 66  ? 7.426  63.953 59.983 1.00 12.88  ? 66   TYR A CE1 1 
ATOM   511  C  CE2 . TYR A 1 66  ? 8.558  63.364 57.979 1.00 11.99  ? 66   TYR A CE2 1 
ATOM   512  C  CZ  . TYR A 1 66  ? 7.441  63.275 58.779 1.00 12.74  ? 66   TYR A CZ  1 
ATOM   513  O  OH  . TYR A 1 66  ? 6.316  62.560 58.455 1.00 13.73  ? 66   TYR A OH  1 
ATOM   514  N  N   . GLU A 1 67  ? 9.967  68.160 61.694 1.00 10.61  ? 67   GLU A N   1 
ATOM   515  C  CA  . GLU A 1 67  ? 8.987  68.812 62.572 1.00 11.06  ? 67   GLU A CA  1 
ATOM   516  C  C   . GLU A 1 67  ? 8.761  70.243 62.117 1.00 10.79  ? 67   GLU A C   1 
ATOM   517  O  O   . GLU A 1 67  ? 7.619  70.652 61.853 1.00 11.48  ? 67   GLU A O   1 
ATOM   518  C  CB  A GLU A 1 67  ? 9.488  68.683 64.025 0.58 13.41  ? 67   GLU A CB  1 
ATOM   519  C  CB  B GLU A 1 67  ? 9.399  68.775 64.040 0.42 11.58  ? 67   GLU A CB  1 
ATOM   520  C  CG  A GLU A 1 67  ? 9.653  67.301 64.621 0.58 16.46  ? 67   GLU A CG  1 
ATOM   521  C  CG  B GLU A 1 67  ? 9.760  67.362 64.471 0.42 17.32  ? 67   GLU A CG  1 
ATOM   522  C  CD  A GLU A 1 67  ? 10.655 66.899 65.678 0.58 16.55  ? 67   GLU A CD  1 
ATOM   523  C  CD  B GLU A 1 67  ? 8.594  66.462 64.786 0.42 17.33  ? 67   GLU A CD  1 
ATOM   524  O  OE1 A GLU A 1 67  ? 10.532 65.795 66.360 0.58 19.30  ? 67   GLU A OE1 1 
ATOM   525  O  OE1 B GLU A 1 67  ? 8.794  65.437 65.485 0.42 23.95  ? 67   GLU A OE1 1 
ATOM   526  O  OE2 A GLU A 1 67  ? 11.684 67.577 65.957 0.58 21.33  ? 67   GLU A OE2 1 
ATOM   527  O  OE2 B GLU A 1 67  ? 7.462  66.749 64.355 0.42 17.01  ? 67   GLU A OE2 1 
ATOM   528  N  N   . GLN A 1 68  ? 9.820  71.008 61.961 1.00 10.36  ? 68   GLN A N   1 
ATOM   529  C  CA  . GLN A 1 68  ? 9.696  72.444 61.758 1.00 11.20  ? 68   GLN A CA  1 
ATOM   530  C  C   . GLN A 1 68  ? 9.255  72.792 60.344 1.00 11.52  ? 68   GLN A C   1 
ATOM   531  O  O   . GLN A 1 68  ? 8.608  73.811 60.129 1.00 12.42  ? 68   GLN A O   1 
ATOM   532  C  CB  . GLN A 1 68  ? 11.047 73.120 62.069 1.00 10.26  ? 68   GLN A CB  1 
ATOM   533  C  CG  . GLN A 1 68  ? 11.413 73.019 63.539 1.00 12.05  ? 68   GLN A CG  1 
ATOM   534  C  CD  . GLN A 1 68  ? 12.724 73.719 63.865 1.00 12.98  ? 68   GLN A CD  1 
ATOM   535  O  OE1 . GLN A 1 68  ? 13.487 74.048 62.962 1.00 15.00  ? 68   GLN A OE1 1 
ATOM   536  N  NE2 . GLN A 1 68  ? 12.999 73.942 65.161 1.00 15.65  ? 68   GLN A NE2 1 
ATOM   537  N  N   . LEU A 1 69  ? 9.635  71.974 59.370 1.00 9.93   ? 69   LEU A N   1 
ATOM   538  C  CA  . LEU A 1 69  ? 9.168  72.192 57.997 1.00 9.37   ? 69   LEU A CA  1 
ATOM   539  C  C   . LEU A 1 69  ? 7.795  71.594 57.760 1.00 9.85   ? 69   LEU A C   1 
ATOM   540  O  O   . LEU A 1 69  ? 7.197  71.760 56.692 1.00 11.43  ? 69   LEU A O   1 
ATOM   541  C  CB  . LEU A 1 69  ? 10.169 71.582 57.014 1.00 10.33  ? 69   LEU A CB  1 
ATOM   542  C  CG  . LEU A 1 69  ? 11.530 72.265 56.975 1.00 11.07  ? 69   LEU A CG  1 
ATOM   543  C  CD1 . LEU A 1 69  ? 12.509 71.327 56.269 1.00 14.05  ? 69   LEU A CD1 1 
ATOM   544  C  CD2 . LEU A 1 69  ? 11.465 73.673 56.368 1.00 15.13  ? 69   LEU A CD2 1 
ATOM   545  N  N   . GLY A 1 70  ? 7.224  70.885 58.734 1.00 10.94  ? 70   GLY A N   1 
ATOM   546  C  CA  . GLY A 1 70  ? 5.845  70.435 58.563 1.00 11.65  ? 70   GLY A CA  1 
ATOM   547  C  C   . GLY A 1 70  ? 5.641  69.281 57.610 1.00 9.80   ? 70   GLY A C   1 
ATOM   548  O  O   . GLY A 1 70  ? 4.570  69.143 56.995 1.00 11.30  ? 70   GLY A O   1 
ATOM   549  N  N   . LEU A 1 71  ? 6.651  68.423 57.516 1.00 10.34  ? 71   LEU A N   1 
ATOM   550  C  CA  . LEU A 1 71  ? 6.689  67.437 56.430 1.00 12.18  ? 71   LEU A CA  1 
ATOM   551  C  C   . LEU A 1 71  ? 5.693  66.284 56.628 1.00 11.14  ? 71   LEU A C   1 
ATOM   552  O  O   . LEU A 1 71  ? 5.449  65.527 55.671 1.00 12.75  ? 71   LEU A O   1 
ATOM   553  C  CB  . LEU A 1 71  ? 8.120  66.901 56.218 1.00 11.98  ? 71   LEU A CB  1 
ATOM   554  C  CG  . LEU A 1 71  ? 9.192  67.923 55.841 1.00 10.22  ? 71   LEU A CG  1 
ATOM   555  C  CD1 . LEU A 1 71  ? 10.518 67.252 55.519 1.00 12.38  ? 71   LEU A CD1 1 
ATOM   556  C  CD2 . LEU A 1 71  ? 8.733  68.823 54.691 1.00 12.71  ? 71   LEU A CD2 1 
ATOM   557  N  N   . ALA A 1 72  ? 5.141  66.174 57.842 1.00 10.82  ? 72   ALA A N   1 
ATOM   558  C  CA  . ALA A 1 72  ? 4.143  65.157 58.048 1.00 12.26  ? 72   ALA A CA  1 
ATOM   559  C  C   . ALA A 1 72  ? 2.933  65.451 57.169 1.00 13.19  ? 72   ALA A C   1 
ATOM   560  O  O   . ALA A 1 72  ? 2.188  64.523 56.822 1.00 16.34  ? 72   ALA A O   1 
ATOM   561  C  CB  . ALA A 1 72  ? 3.682  65.085 59.496 1.00 15.03  ? 72   ALA A CB  1 
ATOM   562  N  N   . GLU A 1 73  ? 2.685  66.700 56.815 1.00 13.16  ? 73   GLU A N   1 
ATOM   563  C  CA  . GLU A 1 73  ? 1.515  67.103 56.048 1.00 13.43  ? 73   GLU A CA  1 
ATOM   564  C  C   . GLU A 1 73  ? 1.735  66.757 54.577 1.00 12.70  ? 73   GLU A C   1 
ATOM   565  O  O   . GLU A 1 73  ? 2.802  66.895 54.029 1.00 13.13  ? 73   GLU A O   1 
ATOM   566  C  CB  . GLU A 1 73  ? 1.176  68.585 56.132 1.00 17.33  ? 73   GLU A CB  1 
ATOM   567  C  CG  . GLU A 1 73  ? 0.869  69.188 57.486 1.00 36.47  ? 73   GLU A CG  1 
ATOM   568  C  CD  . GLU A 1 73  ? 0.543  70.685 57.326 1.00 50.55  ? 73   GLU A CD  1 
ATOM   569  O  OE1 . GLU A 1 73  ? 0.955  71.481 58.191 1.00 96.37  ? 73   GLU A OE1 1 
ATOM   570  O  OE2 . GLU A 1 73  ? -0.090 71.009 56.286 1.00 64.41  ? 73   GLU A OE2 1 
ATOM   571  N  N   . ASP A 1 74  ? 0.660  66.334 53.907 1.00 14.27  ? 74   ASP A N   1 
ATOM   572  C  CA  . ASP A 1 74  ? 0.717  65.969 52.506 1.00 14.29  ? 74   ASP A CA  1 
ATOM   573  C  C   . ASP A 1 74  ? 0.526  67.166 51.563 1.00 13.07  ? 74   ASP A C   1 
ATOM   574  O  O   . ASP A 1 74  ? -0.441 67.328 50.832 1.00 19.13  ? 74   ASP A O   1 
ATOM   575  C  CB  . ASP A 1 74  ? -0.348 64.934 52.173 1.00 18.90  ? 74   ASP A CB  1 
ATOM   576  C  CG  . ASP A 1 74  ? -0.263 64.366 50.772 1.00 21.62  ? 74   ASP A CG  1 
ATOM   577  O  OD1 . ASP A 1 74  ? -1.247 63.741 50.304 1.00 28.26  ? 74   ASP A OD1 1 
ATOM   578  O  OD2 . ASP A 1 74  ? 0.774  64.498 50.094 1.00 25.56  ? 74   ASP A OD2 1 
ATOM   579  N  N   . LYS A 1 75  ? 1.499  68.048 51.593 1.00 12.84  ? 75   LYS A N   1 
ATOM   580  C  CA  . LYS A 1 75  ? 1.482  69.273 50.818 1.00 13.88  ? 75   LYS A CA  1 
ATOM   581  C  C   . LYS A 1 75  ? 2.809  69.443 50.070 1.00 10.37  ? 75   LYS A C   1 
ATOM   582  O  O   . LYS A 1 75  ? 3.154  70.596 49.686 1.00 11.85  ? 75   LYS A O   1 
ATOM   583  C  CB  A LYS A 1 75  ? 1.382  70.482 51.763 0.33 18.17  ? 75   LYS A CB  1 
ATOM   584  C  CB  B LYS A 1 75  ? 1.009  70.414 51.699 0.67 17.25  ? 75   LYS A CB  1 
ATOM   585  C  CG  A LYS A 1 75  ? 0.486  70.463 52.967 0.33 18.41  ? 75   LYS A CG  1 
ATOM   586  C  CG  B LYS A 1 75  ? 1.876  71.160 52.633 0.67 21.77  ? 75   LYS A CG  1 
ATOM   587  C  CD  A LYS A 1 75  ? 0.278  71.810 53.634 0.33 27.56  ? 75   LYS A CD  1 
ATOM   588  C  CD  B LYS A 1 75  ? 1.084  71.945 53.697 0.67 31.51  ? 75   LYS A CD  1 
ATOM   589  C  CE  A LYS A 1 75  ? 1.533  72.332 54.324 0.33 32.88  ? 75   LYS A CE  1 
ATOM   590  C  CE  B LYS A 1 75  ? 0.997  73.426 53.377 0.67 38.73  ? 75   LYS A CE  1 
ATOM   591  N  NZ  A LYS A 1 75  ? 1.256  73.484 55.247 0.33 41.79  ? 75   LYS A NZ  1 
ATOM   592  N  NZ  B LYS A 1 75  ? 0.394  74.321 54.435 0.67 36.53  ? 75   LYS A NZ  1 
ATOM   593  N  N   . PHE A 1 76  ? 3.579  68.365 49.808 1.00 10.59  ? 76   PHE A N   1 
ATOM   594  C  CA  . PHE A 1 76  ? 4.903  68.456 49.187 1.00 10.05  ? 76   PHE A CA  1 
ATOM   595  C  C   . PHE A 1 76  ? 5.025  67.500 48.015 1.00 10.60  ? 76   PHE A C   1 
ATOM   596  O  O   . PHE A 1 76  ? 4.661  66.334 48.142 1.00 12.65  ? 76   PHE A O   1 
ATOM   597  C  CB  . PHE A 1 76  ? 6.001  68.152 50.216 1.00 9.89   ? 76   PHE A CB  1 
ATOM   598  C  CG  . PHE A 1 76  ? 5.886  69.006 51.457 1.00 10.40  ? 76   PHE A CG  1 
ATOM   599  C  CD1 . PHE A 1 76  ? 5.167  68.543 52.548 1.00 10.02  ? 76   PHE A CD1 1 
ATOM   600  C  CD2 . PHE A 1 76  ? 6.462  70.253 51.489 1.00 9.66   ? 76   PHE A CD2 1 
ATOM   601  C  CE1 . PHE A 1 76  ? 5.041  69.351 53.677 1.00 11.57  ? 76   PHE A CE1 1 
ATOM   602  C  CE2 . PHE A 1 76  ? 6.345  71.072 52.605 1.00 8.77   ? 76   PHE A CE2 1 
ATOM   603  C  CZ  . PHE A 1 76  ? 5.622  70.602 53.681 1.00 10.31  ? 76   PHE A CZ  1 
ATOM   604  N  N   . THR A 1 77  ? 5.524  68.001 46.882 1.00 9.72   ? 77   THR A N   1 
ATOM   605  C  CA  . THR A 1 77  ? 5.763  67.082 45.812 1.00 10.74  ? 77   THR A CA  1 
ATOM   606  C  C   . THR A 1 77  ? 7.046  66.298 46.131 1.00 11.02  ? 77   THR A C   1 
ATOM   607  O  O   . THR A 1 77  ? 7.854  66.571 46.993 1.00 10.37  ? 77   THR A O   1 
ATOM   608  C  CB  . THR A 1 77  ? 5.978  67.795 44.481 1.00 10.99  ? 77   THR A CB  1 
ATOM   609  O  OG1 . THR A 1 77  ? 7.119  68.656 44.638 1.00 11.22  ? 77   THR A OG1 1 
ATOM   610  C  CG2 . THR A 1 77  ? 4.912  68.790 44.076 1.00 11.22  ? 77   THR A CG2 1 
ATOM   611  N  N   . ASP A 1 78  ? 7.238  65.237 45.334 1.00 10.49  ? 78   ASP A N   1 
ATOM   612  C  CA  . ASP A 1 78  ? 8.446  64.434 45.473 1.00 11.48  ? 78   ASP A CA  1 
ATOM   613  C  C   . ASP A 1 78  ? 9.706  65.272 45.311 1.00 10.80  ? 78   ASP A C   1 
ATOM   614  O  O   . ASP A 1 78  ? 10.651 65.088 46.091 1.00 11.06  ? 78   ASP A O   1 
ATOM   615  C  CB  . ASP A 1 78  ? 8.461  63.294 44.470 1.00 15.19  ? 78   ASP A CB  1 
ATOM   616  C  CG  . ASP A 1 78  ? 7.559  62.166 44.925 1.00 15.01  ? 78   ASP A CG  1 
ATOM   617  O  OD1 . ASP A 1 78  ? 7.432  61.195 44.140 1.00 20.90  ? 78   ASP A OD1 1 
ATOM   618  O  OD2 . ASP A 1 78  ? 6.954  62.217 46.022 1.00 18.64  ? 78   ASP A OD2 1 
ATOM   619  N  N   . ASP A 1 79  ? 9.782  66.176 44.343 1.00 10.92  ? 79   ASP A N   1 
ATOM   620  C  CA  . ASP A 1 79  ? 11.015 66.958 44.152 1.00 9.74   ? 79   ASP A CA  1 
ATOM   621  C  C   . ASP A 1 79  ? 11.259 67.945 45.250 1.00 9.37   ? 79   ASP A C   1 
ATOM   622  O  O   . ASP A 1 79  ? 12.349 68.250 45.684 1.00 10.70  ? 79   ASP A O   1 
ATOM   623  C  CB  . ASP A 1 79  ? 10.959 67.620 42.782 1.00 13.13  ? 79   ASP A CB  1 
ATOM   624  C  CG  . ASP A 1 79  ? 11.346 66.531 41.774 1.00 14.60  ? 79   ASP A CG  1 
ATOM   625  O  OD1 . ASP A 1 79  ? 10.445 66.108 41.009 1.00 16.35  ? 79   ASP A OD1 1 
ATOM   626  O  OD2 . ASP A 1 79  ? 12.524 66.082 41.769 1.00 19.50  ? 79   ASP A OD2 1 
ATOM   627  N  N   . GLN A 1 80  ? 10.304 68.545 45.872 1.00 9.69   ? 80   GLN A N   1 
ATOM   628  C  CA  . GLN A 1 80  ? 10.288 69.375 47.053 1.00 8.10   ? 80   GLN A CA  1 
ATOM   629  C  C   . GLN A 1 80  ? 10.900 68.562 48.216 1.00 8.76   ? 80   GLN A C   1 
ATOM   630  O  O   . GLN A 1 80  ? 11.819 69.061 48.873 1.00 9.93   ? 80   GLN A O   1 
ATOM   631  C  CB  . GLN A 1 80  ? 8.938  69.986 47.495 1.00 8.73   ? 80   GLN A CB  1 
ATOM   632  C  CG  . GLN A 1 80  ? 8.455  71.084 46.548 1.00 10.05  ? 80   GLN A CG  1 
ATOM   633  C  CD  . GLN A 1 80  ? 7.033  71.525 46.804 1.00 9.15   ? 80   GLN A CD  1 
ATOM   634  O  OE1 . GLN A 1 80  ? 6.148  70.756 47.204 1.00 10.41  ? 80   GLN A OE1 1 
ATOM   635  N  NE2 . GLN A 1 80  ? 6.837  72.821 46.574 1.00 9.15   ? 80   GLN A NE2 1 
ATOM   636  N  N   . LEU A 1 81  ? 10.452 67.330 48.412 1.00 9.64   ? 81   LEU A N   1 
ATOM   637  C  CA  . LEU A 1 81  ? 11.023 66.461 49.450 1.00 8.91   ? 81   LEU A CA  1 
ATOM   638  C  C   . LEU A 1 81  ? 12.469 66.101 49.157 1.00 8.31   ? 81   LEU A C   1 
ATOM   639  O  O   . LEU A 1 81  ? 13.243 66.147 50.114 1.00 10.45  ? 81   LEU A O   1 
ATOM   640  C  CB  . LEU A 1 81  ? 10.169 65.214 49.640 1.00 10.00  ? 81   LEU A CB  1 
ATOM   641  C  CG  . LEU A 1 81  ? 8.716  65.472 50.190 1.00 9.72   ? 81   LEU A CG  1 
ATOM   642  C  CD1 . LEU A 1 81  ? 7.928  64.155 50.225 1.00 11.29  ? 81   LEU A CD1 1 
ATOM   643  C  CD2 . LEU A 1 81  ? 8.679  66.228 51.515 1.00 10.89  ? 81   LEU A CD2 1 
ATOM   644  N  N   . ILE A 1 82  ? 12.810 65.763 47.923 1.00 8.81   ? 82   ILE A N   1 
ATOM   645  C  CA  . ILE A 1 82  ? 14.194 65.514 47.596 1.00 9.39   ? 82   ILE A CA  1 
ATOM   646  C  C   . ILE A 1 82  ? 15.092 66.703 47.925 1.00 9.23   ? 82   ILE A C   1 
ATOM   647  O  O   . ILE A 1 82  ? 16.172 66.584 48.510 1.00 10.04  ? 82   ILE A O   1 
ATOM   648  C  CB  A ILE A 1 82  ? 14.319 65.088 46.132 0.87 9.97   ? 82   ILE A CB  1 
ATOM   649  C  CB  B ILE A 1 82  ? 14.340 65.310 46.070 0.13 9.62   ? 82   ILE A CB  1 
ATOM   650  C  CG1 A ILE A 1 82  ? 13.737 63.698 45.842 0.87 12.36  ? 82   ILE A CG1 1 
ATOM   651  C  CG1 B ILE A 1 82  ? 13.878 63.949 45.566 0.13 9.68   ? 82   ILE A CG1 1 
ATOM   652  C  CG2 A ILE A 1 82  ? 15.769 65.145 45.640 0.87 12.21  ? 82   ILE A CG2 1 
ATOM   653  C  CG2 B ILE A 1 82  ? 15.770 65.631 45.644 0.13 5.76   ? 82   ILE A CG2 1 
ATOM   654  C  CD1 A ILE A 1 82  ? 13.538 63.432 44.342 0.87 15.35  ? 82   ILE A CD1 1 
ATOM   655  C  CD1 B ILE A 1 82  ? 14.958 62.896 45.498 0.13 9.72   ? 82   ILE A CD1 1 
ATOM   656  N  N   . ASP A 1 83  ? 14.680 67.914 47.575 1.00 8.86   ? 83   ASP A N   1 
ATOM   657  C  CA  . ASP A 1 83  ? 15.480 69.091 47.831 1.00 10.07  ? 83   ASP A CA  1 
ATOM   658  C  C   . ASP A 1 83  ? 15.571 69.368 49.336 1.00 10.53  ? 83   ASP A C   1 
ATOM   659  O  O   . ASP A 1 83  ? 16.627 69.819 49.803 1.00 11.60  ? 83   ASP A O   1 
ATOM   660  C  CB  . ASP A 1 83  ? 14.920 70.260 47.017 1.00 11.75  ? 83   ASP A CB  1 
ATOM   661  C  CG  . ASP A 1 83  ? 15.348 70.061 45.562 1.00 13.09  ? 83   ASP A CG  1 
ATOM   662  O  OD1 . ASP A 1 83  ? 14.481 70.148 44.654 1.00 15.13  ? 83   ASP A OD1 1 
ATOM   663  O  OD2 . ASP A 1 83  ? 16.556 69.826 45.285 1.00 16.31  ? 83   ASP A OD2 1 
ATOM   664  N  N   . PHE A 1 84  ? 14.528 69.084 50.107 1.00 9.91   ? 84   PHE A N   1 
ATOM   665  C  CA  . PHE A 1 84  ? 14.689 69.156 51.555 1.00 9.26   ? 84   PHE A CA  1 
ATOM   666  C  C   . PHE A 1 84  ? 15.712 68.165 52.093 1.00 8.89   ? 84   PHE A C   1 
ATOM   667  O  O   . PHE A 1 84  ? 16.491 68.516 53.005 1.00 9.74   ? 84   PHE A O   1 
ATOM   668  C  CB  . PHE A 1 84  ? 13.372 68.961 52.292 1.00 9.33   ? 84   PHE A CB  1 
ATOM   669  C  CG  . PHE A 1 84  ? 12.414 70.144 52.260 1.00 9.64   ? 84   PHE A CG  1 
ATOM   670  C  CD1 . PHE A 1 84  ? 12.827 71.418 52.600 1.00 10.80  ? 84   PHE A CD1 1 
ATOM   671  C  CD2 . PHE A 1 84  ? 11.084 70.005 51.910 1.00 11.01  ? 84   PHE A CD2 1 
ATOM   672  C  CE1 . PHE A 1 84  ? 11.940 72.485 52.572 1.00 13.66  ? 84   PHE A CE1 1 
ATOM   673  C  CE2 . PHE A 1 84  ? 10.202 71.078 51.879 1.00 11.14  ? 84   PHE A CE2 1 
ATOM   674  C  CZ  . PHE A 1 84  ? 10.617 72.334 52.202 1.00 11.58  ? 84   PHE A CZ  1 
ATOM   675  N  N   . MET A 1 85  ? 15.728 66.948 51.586 1.00 10.29  ? 85   MET A N   1 
ATOM   676  C  CA  . MET A 1 85  ? 16.715 65.952 52.023 1.00 9.89   ? 85   MET A CA  1 
ATOM   677  C  C   . MET A 1 85  ? 18.132 66.444 51.732 1.00 10.85  ? 85   MET A C   1 
ATOM   678  O  O   . MET A 1 85  ? 19.042 66.217 52.542 1.00 12.28  ? 85   MET A O   1 
ATOM   679  C  CB  A MET A 1 85  ? 16.537 64.616 51.302 0.50 10.96  ? 85   MET A CB  1 
ATOM   680  C  CB  B MET A 1 85  ? 16.414 64.566 51.409 0.50 10.82  ? 85   MET A CB  1 
ATOM   681  C  CG  A MET A 1 85  ? 15.319 63.820 51.773 0.50 11.74  ? 85   MET A CG  1 
ATOM   682  C  CG  B MET A 1 85  ? 15.267 63.815 52.095 0.50 11.30  ? 85   MET A CG  1 
ATOM   683  S  SD  A MET A 1 85  ? 14.995 62.505 50.579 0.50 13.38  ? 85   MET A SD  1 
ATOM   684  S  SD  B MET A 1 85  ? 14.931 62.123 51.557 0.50 12.79  ? 85   MET A SD  1 
ATOM   685  C  CE  A MET A 1 85  ? 13.564 61.712 51.320 0.50 17.46  ? 85   MET A CE  1 
ATOM   686  C  CE  B MET A 1 85  ? 13.349 62.279 50.745 0.50 34.54  ? 85   MET A CE  1 
ATOM   687  N  N   . LEU A 1 86  ? 18.311 67.065 50.564 1.00 10.83  ? 86   LEU A N   1 
ATOM   688  C  CA  . LEU A 1 86  ? 19.668 67.534 50.234 1.00 11.36  ? 86   LEU A CA  1 
ATOM   689  C  C   . LEU A 1 86  ? 20.162 68.672 51.108 1.00 11.91  ? 86   LEU A C   1 
ATOM   690  O  O   . LEU A 1 86  ? 21.349 68.774 51.432 1.00 14.90  ? 86   LEU A O   1 
ATOM   691  C  CB  . LEU A 1 86  ? 19.778 67.955 48.772 1.00 12.37  ? 86   LEU A CB  1 
ATOM   692  C  CG  . LEU A 1 86  ? 19.591 66.805 47.800 1.00 13.59  ? 86   LEU A CG  1 
ATOM   693  C  CD1 . LEU A 1 86  ? 19.272 67.348 46.399 1.00 20.68  ? 86   LEU A CD1 1 
ATOM   694  C  CD2 . LEU A 1 86  ? 20.801 65.916 47.731 1.00 18.08  ? 86   LEU A CD2 1 
ATOM   695  N  N   . GLN A 1 87  ? 19.207 69.502 51.522 1.00 11.76  ? 87   GLN A N   1 
ATOM   696  C  CA  . GLN A 1 87  ? 19.543 70.662 52.350 1.00 13.17  ? 87   GLN A CA  1 
ATOM   697  C  C   . GLN A 1 87  ? 19.587 70.302 53.815 1.00 12.42  ? 87   GLN A C   1 
ATOM   698  O  O   . GLN A 1 87  ? 20.232 71.050 54.580 1.00 13.43  ? 87   GLN A O   1 
ATOM   699  C  CB  . GLN A 1 87  ? 18.527 71.773 52.115 1.00 15.78  ? 87   GLN A CB  1 
ATOM   700  C  CG  . GLN A 1 87  ? 18.574 72.354 50.672 1.00 19.67  ? 87   GLN A CG  1 
ATOM   701  C  CD  . GLN A 1 87  ? 19.937 72.745 50.165 1.00 27.09  ? 87   GLN A CD  1 
ATOM   702  O  OE1 . GLN A 1 87  ? 20.370 72.403 49.059 1.00 41.68  ? 87   GLN A OE1 1 
ATOM   703  N  NE2 . GLN A 1 87  ? 20.703 73.468 50.940 1.00 35.08  ? 87   GLN A NE2 1 
ATOM   704  N  N   . HIS A 1 88  ? 18.959 69.207 54.227 1.00 10.14  ? 88   HIS A N   1 
ATOM   705  C  CA  . HIS A 1 88  ? 18.881 68.758 55.616 1.00 9.41   ? 88   HIS A CA  1 
ATOM   706  C  C   . HIS A 1 88  ? 19.107 67.248 55.635 1.00 10.08  ? 88   HIS A C   1 
ATOM   707  O  O   . HIS A 1 88  ? 18.114 66.504 55.764 1.00 10.23  ? 88   HIS A O   1 
ATOM   708  C  CB  . HIS A 1 88  ? 17.533 69.177 56.230 1.00 10.56  ? 88   HIS A CB  1 
ATOM   709  C  CG  . HIS A 1 88  ? 17.148 70.618 56.004 1.00 13.05  ? 88   HIS A CG  1 
ATOM   710  N  ND1 . HIS A 1 88  ? 17.530 71.692 56.768 1.00 18.58  ? 88   HIS A ND1 1 
ATOM   711  C  CD2 . HIS A 1 88  ? 16.390 71.178 55.012 1.00 16.88  ? 88   HIS A CD2 1 
ATOM   712  C  CE1 . HIS A 1 88  ? 17.046 72.833 56.298 1.00 19.89  ? 88   HIS A CE1 1 
ATOM   713  N  NE2 . HIS A 1 88  ? 16.351 72.529 55.228 1.00 18.00  ? 88   HIS A NE2 1 
ATOM   714  N  N   . PRO A 1 89  ? 20.326 66.757 55.466 1.00 10.66  ? 89   PRO A N   1 
ATOM   715  C  CA  . PRO A 1 89  ? 20.550 65.315 55.292 1.00 10.88  ? 89   PRO A CA  1 
ATOM   716  C  C   . PRO A 1 89  ? 20.074 64.405 56.418 1.00 8.98   ? 89   PRO A C   1 
ATOM   717  O  O   . PRO A 1 89  ? 19.882 63.218 56.172 1.00 10.59  ? 89   PRO A O   1 
ATOM   718  C  CB  . PRO A 1 89  ? 22.075 65.244 55.078 1.00 13.61  ? 89   PRO A CB  1 
ATOM   719  C  CG  . PRO A 1 89  ? 22.524 66.604 54.645 1.00 15.07  ? 89   PRO A CG  1 
ATOM   720  C  CD  . PRO A 1 89  ? 21.575 67.555 55.294 1.00 12.29  ? 89   PRO A CD  1 
ATOM   721  N  N   . ILE A 1 90  ? 19.832 64.948 57.626 1.00 10.38  ? 90   ILE A N   1 
ATOM   722  C  CA  . ILE A 1 90  ? 19.263 64.127 58.692 1.00 10.49  ? 90   ILE A CA  1 
ATOM   723  C  C   . ILE A 1 90  ? 17.884 63.604 58.339 1.00 10.36  ? 90   ILE A C   1 
ATOM   724  O  O   . ILE A 1 90  ? 17.412 62.613 58.887 1.00 10.83  ? 90   ILE A O   1 
ATOM   725  C  CB  A ILE A 1 90  ? 19.185 64.887 60.026 0.28 13.66  ? 90   ILE A CB  1 
ATOM   726  C  CB  B ILE A 1 90  ? 19.220 64.939 59.998 0.72 11.50  ? 90   ILE A CB  1 
ATOM   727  C  CG1 A ILE A 1 90  ? 18.970 63.933 61.204 0.28 15.21  ? 90   ILE A CG1 1 
ATOM   728  C  CG1 B ILE A 1 90  ? 18.945 64.098 61.244 0.72 13.12  ? 90   ILE A CG1 1 
ATOM   729  C  CG2 A ILE A 1 90  ? 18.120 65.963 60.001 0.28 14.41  ? 90   ILE A CG2 1 
ATOM   730  C  CG2 B ILE A 1 90  ? 18.208 66.066 59.871 0.72 14.48  ? 90   ILE A CG2 1 
ATOM   731  C  CD1 A ILE A 1 90  ? 19.005 64.618 62.547 0.28 11.00  ? 90   ILE A CD1 1 
ATOM   732  C  CD1 B ILE A 1 90  ? 20.002 63.043 61.539 0.72 18.87  ? 90   ILE A CD1 1 
ATOM   733  N  N   . LEU A 1 91  ? 17.229 64.237 57.350 1.00 8.96   ? 91   LEU A N   1 
ATOM   734  C  CA  . LEU A 1 91  ? 15.965 63.734 56.844 1.00 9.43   ? 91   LEU A CA  1 
ATOM   735  C  C   . LEU A 1 91  ? 16.080 62.447 56.033 1.00 9.05   ? 91   LEU A C   1 
ATOM   736  O  O   . LEU A 1 91  ? 15.024 61.794 55.830 1.00 10.62  ? 91   LEU A O   1 
ATOM   737  C  CB  . LEU A 1 91  ? 15.291 64.759 55.922 1.00 9.53   ? 91   LEU A CB  1 
ATOM   738  C  CG  . LEU A 1 91  ? 14.696 66.016 56.543 1.00 9.52   ? 91   LEU A CG  1 
ATOM   739  C  CD1 . LEU A 1 91  ? 14.252 67.005 55.463 1.00 12.10  ? 91   LEU A CD1 1 
ATOM   740  C  CD2 . LEU A 1 91  ? 13.542 65.619 57.435 1.00 11.37  ? 91   LEU A CD2 1 
ATOM   741  N  N   . ILE A 1 92  ? 17.276 62.108 55.565 1.00 8.56   ? 92   ILE A N   1 
ATOM   742  C  CA  . ILE A 1 92  ? 17.433 60.885 54.792 1.00 9.55   ? 92   ILE A CA  1 
ATOM   743  C  C   . ILE A 1 92  ? 17.491 59.704 55.755 1.00 8.41   ? 92   ILE A C   1 
ATOM   744  O  O   . ILE A 1 92  ? 18.453 59.576 56.538 1.00 9.47   ? 92   ILE A O   1 
ATOM   745  C  CB  . ILE A 1 92  ? 18.694 60.942 53.929 1.00 9.60   ? 92   ILE A CB  1 
ATOM   746  C  CG1 . ILE A 1 92  ? 18.724 62.132 53.005 1.00 10.86  ? 92   ILE A CG1 1 
ATOM   747  C  CG2 . ILE A 1 92  ? 18.801 59.629 53.143 1.00 11.94  ? 92   ILE A CG2 1 
ATOM   748  C  CD1 . ILE A 1 92  ? 20.023 62.394 52.268 1.00 12.90  ? 92   ILE A CD1 1 
ATOM   749  N  N   . ASN A 1 93  ? 16.490 58.812 55.715 1.00 8.90   ? 93   ASN A N   1 
ATOM   750  C  CA  . ASN A 1 93  ? 16.569 57.678 56.645 1.00 9.96   ? 93   ASN A CA  1 
ATOM   751  C  C   . ASN A 1 93  ? 17.721 56.769 56.261 1.00 10.44  ? 93   ASN A C   1 
ATOM   752  O  O   . ASN A 1 93  ? 18.302 56.855 55.161 1.00 10.72  ? 93   ASN A O   1 
ATOM   753  C  CB  . ASN A 1 93  ? 15.235 56.930 56.764 1.00 10.27  ? 93   ASN A CB  1 
ATOM   754  C  CG  . ASN A 1 93  ? 14.917 56.417 58.162 1.00 9.28   ? 93   ASN A CG  1 
ATOM   755  O  OD1 . ASN A 1 93  ? 15.785 56.338 59.020 1.00 11.19  ? 93   ASN A OD1 1 
ATOM   756  N  ND2 . ASN A 1 93  ? 13.648 56.064 58.376 1.00 11.51  ? 93   ASN A ND2 1 
ATOM   757  N  N   . ARG A 1 94  ? 18.092 55.886 57.211 1.00 9.50   ? 94   ARG A N   1 
ATOM   758  C  CA  . ARG A 1 94  ? 19.376 55.244 57.184 1.00 8.64   ? 94   ARG A CA  1 
ATOM   759  C  C   . ARG A 1 94  ? 19.326 53.795 57.648 1.00 8.73   ? 94   ARG A C   1 
ATOM   760  O  O   . ARG A 1 94  ? 18.474 53.454 58.474 1.00 9.88   ? 94   ARG A O   1 
ATOM   761  C  CB  . ARG A 1 94  ? 20.362 56.086 58.044 1.00 9.36   ? 94   ARG A CB  1 
ATOM   762  C  CG  . ARG A 1 94  ? 20.156 56.050 59.534 1.00 9.91   ? 94   ARG A CG  1 
ATOM   763  C  CD  . ARG A 1 94  ? 18.942 56.747 60.050 1.00 11.61  ? 94   ARG A CD  1 
ATOM   764  N  NE  . ARG A 1 94  ? 18.964 56.866 61.514 1.00 11.68  ? 94   ARG A NE  1 
ATOM   765  C  CZ  . ARG A 1 94  ? 19.112 57.950 62.227 1.00 12.12  ? 94   ARG A CZ  1 
ATOM   766  N  NH1 . ARG A 1 94  ? 19.284 59.176 61.694 1.00 14.20  ? 94   ARG A NH1 1 
ATOM   767  N  NH2 . ARG A 1 94  ? 19.081 57.778 63.557 1.00 14.53  ? 94   ARG A NH2 1 
ATOM   768  N  N   . PRO A 1 95  ? 20.247 52.937 57.187 1.00 8.56   ? 95   PRO A N   1 
ATOM   769  C  CA  . PRO A 1 95  ? 21.225 53.207 56.140 1.00 8.70   ? 95   PRO A CA  1 
ATOM   770  C  C   . PRO A 1 95  ? 20.726 52.821 54.753 1.00 8.40   ? 95   PRO A C   1 
ATOM   771  O  O   . PRO A 1 95  ? 19.955 51.888 54.595 1.00 12.05  ? 95   PRO A O   1 
ATOM   772  C  CB  . PRO A 1 95  ? 22.402 52.265 56.524 1.00 9.70   ? 95   PRO A CB  1 
ATOM   773  C  CG  . PRO A 1 95  ? 21.718 51.047 57.065 1.00 10.60  ? 95   PRO A CG  1 
ATOM   774  C  CD  . PRO A 1 95  ? 20.472 51.586 57.745 1.00 9.70   ? 95   PRO A CD  1 
ATOM   775  N  N   . ILE A 1 96  ? 21.234 53.527 53.765 1.00 9.28   ? 96   ILE A N   1 
ATOM   776  C  CA  . ILE A 1 96  ? 21.086 53.123 52.360 1.00 8.96   ? 96   ILE A CA  1 
ATOM   777  C  C   . ILE A 1 96  ? 22.360 52.348 51.994 1.00 8.64   ? 96   ILE A C   1 
ATOM   778  O  O   . ILE A 1 96  ? 23.504 52.811 52.280 1.00 10.25  ? 96   ILE A O   1 
ATOM   779  C  CB  . ILE A 1 96  ? 20.918 54.336 51.444 1.00 9.75   ? 96   ILE A CB  1 
ATOM   780  C  CG1 . ILE A 1 96  ? 19.668 55.136 51.753 1.00 10.34  ? 96   ILE A CG1 1 
ATOM   781  C  CG2 . ILE A 1 96  ? 20.979 53.960 49.968 1.00 11.60  ? 96   ILE A CG2 1 
ATOM   782  C  CD1 . ILE A 1 96  ? 19.693 56.530 51.126 1.00 14.20  ? 96   ILE A CD1 1 
ATOM   783  N  N   . VAL A 1 97  ? 22.221 51.186 51.402 1.00 9.08   ? 97   VAL A N   1 
ATOM   784  C  CA  . VAL A 1 97  ? 23.325 50.334 50.963 1.00 9.10   ? 97   VAL A CA  1 
ATOM   785  C  C   . VAL A 1 97  ? 23.190 50.041 49.467 1.00 9.38   ? 97   VAL A C   1 
ATOM   786  O  O   . VAL A 1 97  ? 22.103 49.700 49.002 1.00 10.39  ? 97   VAL A O   1 
ATOM   787  C  CB  . VAL A 1 97  ? 23.394 49.011 51.767 1.00 9.44   ? 97   VAL A CB  1 
ATOM   788  C  CG1 . VAL A 1 97  ? 24.528 48.116 51.276 1.00 10.22  ? 97   VAL A CG1 1 
ATOM   789  C  CG2 . VAL A 1 97  ? 23.568 49.280 53.269 1.00 11.02  ? 97   VAL A CG2 1 
ATOM   790  N  N   . VAL A 1 98  ? 24.322 50.181 48.780 1.00 10.36  ? 98   VAL A N   1 
ATOM   791  C  CA  . VAL A 1 98  ? 24.425 49.880 47.355 1.00 10.21  ? 98   VAL A CA  1 
ATOM   792  C  C   . VAL A 1 98  ? 25.440 48.750 47.175 1.00 10.41  ? 98   VAL A C   1 
ATOM   793  O  O   . VAL A 1 98  ? 26.581 48.838 47.666 1.00 10.50  ? 98   VAL A O   1 
ATOM   794  C  CB  . VAL A 1 98  ? 24.923 51.069 46.538 1.00 11.31  ? 98   VAL A CB  1 
ATOM   795  C  CG1 . VAL A 1 98  ? 24.890 50.727 45.050 1.00 16.47  ? 98   VAL A CG1 1 
ATOM   796  C  CG2 . VAL A 1 98  ? 24.086 52.298 46.806 1.00 14.35  ? 98   VAL A CG2 1 
ATOM   797  N  N   . THR A 1 99  ? 25.041 47.672 46.489 1.00 12.35  ? 99   THR A N   1 
ATOM   798  C  CA  . THR A 1 99  ? 25.949 46.601 46.106 1.00 12.80  ? 99   THR A CA  1 
ATOM   799  C  C   . THR A 1 99  ? 25.767 46.314 44.609 1.00 12.44  ? 99   THR A C   1 
ATOM   800  O  O   . THR A 1 99  ? 24.866 46.895 43.965 1.00 13.25  ? 99   THR A O   1 
ATOM   801  C  CB  . THR A 1 99  ? 25.689 45.303 46.881 1.00 13.02  ? 99   THR A CB  1 
ATOM   802  O  OG1 . THR A 1 99  ? 24.508 44.666 46.325 1.00 15.83  ? 99   THR A OG1 1 
ATOM   803  C  CG2 . THR A 1 99  ? 25.416 45.527 48.363 1.00 12.99  ? 99   THR A CG2 1 
ATOM   804  N  N   . PRO A 1 100 ? 26.583 45.446 44.018 1.00 13.05  ? 100  PRO A N   1 
ATOM   805  C  CA  . PRO A 1 100 ? 26.325 45.102 42.608 1.00 14.44  ? 100  PRO A CA  1 
ATOM   806  C  C   . PRO A 1 100 ? 24.996 44.479 42.297 1.00 15.73  ? 100  PRO A C   1 
ATOM   807  O  O   . PRO A 1 100 ? 24.535 44.506 41.143 1.00 16.32  ? 100  PRO A O   1 
ATOM   808  C  CB  . PRO A 1 100 ? 27.429 44.074 42.297 1.00 19.07  ? 100  PRO A CB  1 
ATOM   809  C  CG  . PRO A 1 100 ? 28.552 44.475 43.234 1.00 19.00  ? 100  PRO A CG  1 
ATOM   810  C  CD  . PRO A 1 100 ? 27.840 44.809 44.498 1.00 16.03  ? 100  PRO A CD  1 
ATOM   811  N  N   . LEU A 1 101 ? 24.360 43.801 43.204 1.00 14.81  ? 101  LEU A N   1 
ATOM   812  C  CA  . LEU A 1 101 ? 22.997 43.342 43.151 1.00 14.71  ? 101  LEU A CA  1 
ATOM   813  C  C   . LEU A 1 101 ? 21.879 44.339 43.299 1.00 13.83  ? 101  LEU A C   1 
ATOM   814  O  O   . LEU A 1 101 ? 20.755 44.080 42.806 1.00 17.76  ? 101  LEU A O   1 
ATOM   815  C  CB  . LEU A 1 101 ? 22.811 42.249 44.205 1.00 14.73  ? 101  LEU A CB  1 
ATOM   816  C  CG  . LEU A 1 101 ? 23.536 40.952 43.962 1.00 15.78  ? 101  LEU A CG  1 
ATOM   817  C  CD1 . LEU A 1 101 ? 23.190 39.922 45.047 1.00 15.92  ? 101  LEU A CD1 1 
ATOM   818  C  CD2 . LEU A 1 101 ? 23.200 40.333 42.620 1.00 17.47  ? 101  LEU A CD2 1 
ATOM   819  N  N   . GLY A 1 102 ? 22.085 45.463 43.917 1.00 13.12  ? 102  GLY A N   1 
ATOM   820  C  CA  . GLY A 1 102 ? 20.995 46.401 44.098 1.00 12.93  ? 102  GLY A CA  1 
ATOM   821  C  C   . GLY A 1 102 ? 21.220 47.396 45.218 1.00 11.43  ? 102  GLY A C   1 
ATOM   822  O  O   . GLY A 1 102 ? 22.277 47.453 45.823 1.00 12.78  ? 102  GLY A O   1 
ATOM   823  N  N   . THR A 1 103 ? 20.199 48.183 45.497 1.00 10.97  ? 103  THR A N   1 
ATOM   824  C  CA  . THR A 1 103 ? 20.204 49.223 46.531 1.00 10.54  ? 103  THR A CA  1 
ATOM   825  C  C   . THR A 1 103 ? 18.973 49.047 47.411 1.00 10.74  ? 103  THR A C   1 
ATOM   826  O  O   . THR A 1 103 ? 17.866 48.784 46.928 1.00 11.81  ? 103  THR A O   1 
ATOM   827  C  CB  . THR A 1 103 ? 20.134 50.584 45.841 1.00 10.28  ? 103  THR A CB  1 
ATOM   828  O  OG1 . THR A 1 103 ? 21.238 50.763 44.927 1.00 13.48  ? 103  THR A OG1 1 
ATOM   829  C  CG2 . THR A 1 103 ? 20.151 51.688 46.872 1.00 12.82  ? 103  THR A CG2 1 
ATOM   830  N  N   . ARG A 1 104 ? 19.157 49.238 48.732 1.00 9.93   ? 104  ARG A N   1 
ATOM   831  C  CA  . ARG A 1 104 ? 18.051 49.123 49.647 1.00 9.54   ? 104  ARG A CA  1 
ATOM   832  C  C   . ARG A 1 104 ? 18.225 50.123 50.793 1.00 8.54   ? 104  ARG A C   1 
ATOM   833  O  O   . ARG A 1 104 ? 19.339 50.403 51.263 1.00 10.47  ? 104  ARG A O   1 
ATOM   834  C  CB  . ARG A 1 104 ? 17.983 47.772 50.306 1.00 11.44  ? 104  ARG A CB  1 
ATOM   835  C  CG  . ARG A 1 104 ? 17.678 46.596 49.428 1.00 13.13  ? 104  ARG A CG  1 
ATOM   836  C  CD  . ARG A 1 104 ? 16.236 46.554 48.967 1.00 19.00  ? 104  ARG A CD  1 
ATOM   837  N  NE  . ARG A 1 104 ? 16.041 45.224 48.311 1.00 22.33  ? 104  ARG A NE  1 
ATOM   838  C  CZ  . ARG A 1 104 ? 16.506 44.993 47.107 1.00 22.22  ? 104  ARG A CZ  1 
ATOM   839  N  NH1 . ARG A 1 104 ? 17.172 45.944 46.422 1.00 30.34  ? 104  ARG A NH1 1 
ATOM   840  N  NH2 . ARG A 1 104 ? 16.285 43.760 46.624 1.00 28.46  ? 104  ARG A NH2 1 
ATOM   841  N  N   . LEU A 1 105 ? 17.070 50.599 51.245 1.00 9.67   ? 105  LEU A N   1 
ATOM   842  C  CA  . LEU A 1 105 ? 16.988 51.215 52.574 1.00 9.61   ? 105  LEU A CA  1 
ATOM   843  C  C   . LEU A 1 105 ? 16.904 50.046 53.557 1.00 9.30   ? 105  LEU A C   1 
ATOM   844  O  O   . LEU A 1 105 ? 15.913 49.303 53.564 1.00 10.35  ? 105  LEU A O   1 
ATOM   845  C  CB  . LEU A 1 105 ? 15.773 52.129 52.701 1.00 9.72   ? 105  LEU A CB  1 
ATOM   846  C  CG  . LEU A 1 105 ? 15.507 52.658 54.111 1.00 10.32  ? 105  LEU A CG  1 
ATOM   847  C  CD1 . LEU A 1 105 ? 16.678 53.521 54.537 1.00 12.54  ? 105  LEU A CD1 1 
ATOM   848  C  CD2 . LEU A 1 105 ? 14.176 53.411 54.137 1.00 12.97  ? 105  LEU A CD2 1 
ATOM   849  N  N   . CYS A 1 106 ? 17.923 49.844 54.395 1.00 10.02  ? 106  CYS A N   1 
ATOM   850  C  CA  . CYS A 1 106 ? 18.052 48.634 55.225 1.00 10.15  ? 106  CYS A CA  1 
ATOM   851  C  C   . CYS A 1 106 ? 17.430 48.854 56.588 1.00 10.27  ? 106  CYS A C   1 
ATOM   852  O  O   . CYS A 1 106 ? 18.126 48.894 57.577 1.00 10.08  ? 106  CYS A O   1 
ATOM   853  C  CB  . CYS A 1 106 ? 19.505 48.169 55.315 1.00 11.09  ? 106  CYS A CB  1 
ATOM   854  S  SG  . CYS A 1 106 ? 20.238 47.756 53.676 1.00 12.67  ? 106  CYS A SG  1 
ATOM   855  N  N   . ARG A 1 107 ? 16.097 48.979 56.538 1.00 10.92  ? 107  ARG A N   1 
ATOM   856  C  CA  . ARG A 1 107 ? 15.279 49.062 57.744 1.00 11.03  ? 107  ARG A CA  1 
ATOM   857  C  C   . ARG A 1 107 ? 14.204 48.022 57.605 1.00 11.40  ? 107  ARG A C   1 
ATOM   858  O  O   . ARG A 1 107 ? 13.327 48.171 56.753 1.00 12.55  ? 107  ARG A O   1 
ATOM   859  C  CB  . ARG A 1 107 ? 14.732 50.459 57.887 1.00 12.44  ? 107  ARG A CB  1 
ATOM   860  C  CG  . ARG A 1 107 ? 15.770 51.543 57.964 1.00 10.98  ? 107  ARG A CG  1 
ATOM   861  C  CD  . ARG A 1 107 ? 15.178 52.894 58.418 1.00 12.14  ? 107  ARG A CD  1 
ATOM   862  N  NE  . ARG A 1 107 ? 14.712 52.927 59.769 1.00 11.84  ? 107  ARG A NE  1 
ATOM   863  C  CZ  . ARG A 1 107 ? 15.448 53.132 60.862 1.00 9.92   ? 107  ARG A CZ  1 
ATOM   864  N  NH1 . ARG A 1 107 ? 16.745 53.336 60.748 1.00 9.96   ? 107  ARG A NH1 1 
ATOM   865  N  NH2 . ARG A 1 107 ? 14.960 53.135 62.088 1.00 15.30  ? 107  ARG A NH2 1 
ATOM   866  N  N   . PRO A 1 108 ? 14.255 46.944 58.386 1.00 11.04  ? 108  PRO A N   1 
ATOM   867  C  CA  . PRO A 1 108 ? 15.266 46.629 59.398 1.00 11.06  ? 108  PRO A CA  1 
ATOM   868  C  C   . PRO A 1 108 ? 16.567 46.214 58.728 1.00 10.65  ? 108  PRO A C   1 
ATOM   869  O  O   . PRO A 1 108 ? 16.638 45.991 57.529 1.00 10.43  ? 108  PRO A O   1 
ATOM   870  C  CB  . PRO A 1 108 ? 14.665 45.456 60.170 1.00 14.00  ? 108  PRO A CB  1 
ATOM   871  C  CG  . PRO A 1 108 ? 13.801 44.785 59.189 1.00 18.02  ? 108  PRO A CG  1 
ATOM   872  C  CD  . PRO A 1 108 ? 13.235 45.884 58.303 1.00 13.88  ? 108  PRO A CD  1 
ATOM   873  N  N   . SER A 1 109 ? 17.625 46.150 59.509 1.00 10.69  ? 109  SER A N   1 
ATOM   874  C  CA  . SER A 1 109 ? 18.979 45.964 59.018 1.00 10.45  ? 109  SER A CA  1 
ATOM   875  C  C   . SER A 1 109 ? 19.113 44.718 58.170 1.00 9.71   ? 109  SER A C   1 
ATOM   876  O  O   . SER A 1 109 ? 19.874 44.719 57.193 1.00 10.74  ? 109  SER A O   1 
ATOM   877  C  CB  . SER A 1 109 ? 19.944 45.910 60.206 1.00 10.26  ? 109  SER A CB  1 
ATOM   878  O  OG  . SER A 1 109 ? 19.680 44.966 61.188 1.00 12.16  ? 109  SER A OG  1 
ATOM   879  N  N   . GLU A 1 110 ? 18.385 43.666 58.502 1.00 9.90   ? 110  GLU A N   1 
ATOM   880  C  CA  . GLU A 1 110 ? 18.560 42.396 57.794 1.00 11.80  ? 110  GLU A CA  1 
ATOM   881  C  C   . GLU A 1 110 ? 18.039 42.425 56.376 1.00 9.50   ? 110  GLU A C   1 
ATOM   882  O  O   . GLU A 1 110 ? 18.294 41.454 55.643 1.00 11.40  ? 110  GLU A O   1 
ATOM   883  C  CB  . GLU A 1 110 ? 17.943 41.283 58.621 1.00 14.67  ? 110  GLU A CB  1 
ATOM   884  C  CG  . GLU A 1 110 ? 16.478 41.314 58.836 1.00 15.44  ? 110  GLU A CG  1 
ATOM   885  C  CD  . GLU A 1 110 ? 15.988 41.993 60.091 1.00 19.33  ? 110  GLU A CD  1 
ATOM   886  O  OE1 . GLU A 1 110 ? 14.812 41.743 60.471 1.00 19.20  ? 110  GLU A OE1 1 
ATOM   887  O  OE2 . GLU A 1 110 ? 16.734 42.776 60.679 1.00 14.93  ? 110  GLU A OE2 1 
ATOM   888  N  N   . VAL A 1 111 ? 17.366 43.500 55.979 1.00 10.43  ? 111  VAL A N   1 
ATOM   889  C  CA  . VAL A 1 111 ? 17.094 43.695 54.541 1.00 10.72  ? 111  VAL A CA  1 
ATOM   890  C  C   . VAL A 1 111 ? 18.362 43.618 53.705 1.00 9.99   ? 111  VAL A C   1 
ATOM   891  O  O   . VAL A 1 111 ? 18.346 43.196 52.543 1.00 10.43  ? 111  VAL A O   1 
ATOM   892  C  CB  . VAL A 1 111 ? 16.395 45.062 54.380 1.00 11.12  ? 111  VAL A CB  1 
ATOM   893  C  CG1 . VAL A 1 111 ? 16.389 45.555 52.907 1.00 13.72  ? 111  VAL A CG1 1 
ATOM   894  C  CG2 . VAL A 1 111 ? 14.979 44.999 54.959 1.00 12.50  ? 111  VAL A CG2 1 
ATOM   895  N  N   . VAL A 1 112 ? 19.504 44.009 54.286 1.00 8.78   ? 112  VAL A N   1 
ATOM   896  C  CA  . VAL A 1 112 ? 20.763 44.036 53.545 1.00 9.36   ? 112  VAL A CA  1 
ATOM   897  C  C   . VAL A 1 112 ? 21.090 42.643 53.051 1.00 9.07   ? 112  VAL A C   1 
ATOM   898  O  O   . VAL A 1 112 ? 21.805 42.530 52.040 1.00 10.20  ? 112  VAL A O   1 
ATOM   899  C  CB  . VAL A 1 112 ? 21.926 44.638 54.357 1.00 8.94   ? 112  VAL A CB  1 
ATOM   900  C  CG1 . VAL A 1 112 ? 22.422 43.700 55.465 1.00 8.57   ? 112  VAL A CG1 1 
ATOM   901  C  CG2 . VAL A 1 112 ? 23.085 45.093 53.454 1.00 10.40  ? 112  VAL A CG2 1 
ATOM   902  N  N   . LEU A 1 113 ? 20.571 41.602 53.706 1.00 10.05  ? 113  LEU A N   1 
ATOM   903  C  CA  . LEU A 1 113 ? 20.881 40.231 53.249 1.00 10.83  ? 113  LEU A CA  1 
ATOM   904  C  C   . LEU A 1 113 ? 20.386 39.975 51.847 1.00 11.08  ? 113  LEU A C   1 
ATOM   905  O  O   . LEU A 1 113 ? 20.922 39.085 51.141 1.00 12.44  ? 113  LEU A O   1 
ATOM   906  C  CB  . LEU A 1 113 ? 20.310 39.197 54.203 1.00 10.22  ? 113  LEU A CB  1 
ATOM   907  C  CG  . LEU A 1 113 ? 20.914 39.309 55.630 1.00 11.50  ? 113  LEU A CG  1 
ATOM   908  C  CD1 . LEU A 1 113 ? 20.173 38.351 56.522 1.00 15.09  ? 113  LEU A CD1 1 
ATOM   909  C  CD2 . LEU A 1 113 ? 22.413 39.066 55.619 1.00 13.23  ? 113  LEU A CD2 1 
ATOM   910  N  N   . ASP A 1 114 ? 19.424 40.754 51.376 1.00 11.93  ? 114  ASP A N   1 
ATOM   911  C  CA  . ASP A 1 114 ? 18.924 40.562 49.994 1.00 13.02  ? 114  ASP A CA  1 
ATOM   912  C  C   . ASP A 1 114 ? 19.969 40.937 48.936 1.00 12.26  ? 114  ASP A C   1 
ATOM   913  O  O   . ASP A 1 114 ? 19.988 40.347 47.851 1.00 14.06  ? 114  ASP A O   1 
ATOM   914  C  CB  . ASP A 1 114 ? 17.709 41.417 49.726 1.00 16.57  ? 114  ASP A CB  1 
ATOM   915  C  CG  . ASP A 1 114 ? 16.430 41.120 50.446 1.00 26.17  ? 114  ASP A CG  1 
ATOM   916  O  OD1 . ASP A 1 114 ? 15.432 41.856 50.129 1.00 47.69  ? 114  ASP A OD1 1 
ATOM   917  O  OD2 . ASP A 1 114 ? 16.358 40.211 51.312 1.00 36.67  ? 114  ASP A OD2 1 
ATOM   918  N  N   . ILE A 1 115 ? 20.795 41.948 49.249 1.00 10.80  ? 115  ILE A N   1 
ATOM   919  C  CA  . ILE A 1 115 ? 21.696 42.487 48.242 1.00 10.10  ? 115  ILE A CA  1 
ATOM   920  C  C   . ILE A 1 115 ? 23.159 42.174 48.446 1.00 10.55  ? 115  ILE A C   1 
ATOM   921  O  O   . ILE A 1 115 ? 23.977 42.460 47.565 1.00 12.18  ? 115  ILE A O   1 
ATOM   922  C  CB  . ILE A 1 115 ? 21.489 44.002 48.118 1.00 12.18  ? 115  ILE A CB  1 
ATOM   923  C  CG1 . ILE A 1 115 ? 21.578 44.768 49.435 1.00 11.62  ? 115  ILE A CG1 1 
ATOM   924  C  CG2 . ILE A 1 115 ? 20.165 44.291 47.413 1.00 12.50  ? 115  ILE A CG2 1 
ATOM   925  C  CD1 . ILE A 1 115 ? 21.605 46.285 49.263 1.00 14.87  ? 115  ILE A CD1 1 
ATOM   926  N  N   . LEU A 1 116 ? 23.491 41.526 49.551 1.00 10.25  ? 116  LEU A N   1 
ATOM   927  C  CA  . LEU A 1 116 ? 24.855 40.993 49.721 1.00 9.65   ? 116  LEU A CA  1 
ATOM   928  C  C   . LEU A 1 116 ? 25.074 39.746 48.850 1.00 9.91   ? 116  LEU A C   1 
ATOM   929  O  O   . LEU A 1 116 ? 24.284 38.804 48.903 1.00 11.75  ? 116  LEU A O   1 
ATOM   930  C  CB  . LEU A 1 116 ? 25.099 40.692 51.195 1.00 9.70   ? 116  LEU A CB  1 
ATOM   931  C  CG  . LEU A 1 116 ? 25.161 41.919 52.098 1.00 9.67   ? 116  LEU A CG  1 
ATOM   932  C  CD1 . LEU A 1 116 ? 25.207 41.551 53.568 1.00 9.67   ? 116  LEU A CD1 1 
ATOM   933  C  CD2 . LEU A 1 116 ? 26.365 42.768 51.735 1.00 11.00  ? 116  LEU A CD2 1 
ATOM   934  N  N   . GLN A 1 117 ? 26.152 39.746 48.051 1.00 11.60  ? 117  GLN A N   1 
ATOM   935  C  CA  . GLN A 1 117 ? 26.408 38.656 47.155 1.00 12.83  ? 117  GLN A CA  1 
ATOM   936  C  C   . GLN A 1 117 ? 26.892 37.412 47.844 1.00 12.03  ? 117  GLN A C   1 
ATOM   937  O  O   . GLN A 1 117 ? 26.576 36.314 47.395 1.00 13.27  ? 117  GLN A O   1 
ATOM   938  C  CB  . GLN A 1 117 ? 27.528 39.029 46.147 1.00 14.13  ? 117  GLN A CB  1 
ATOM   939  C  CG  . GLN A 1 117 ? 27.029 40.106 45.226 1.00 17.79  ? 117  GLN A CG  1 
ATOM   940  C  CD  . GLN A 1 117 ? 28.192 40.723 44.466 1.00 18.87  ? 117  GLN A CD  1 
ATOM   941  O  OE1 . GLN A 1 117 ? 29.064 41.350 45.075 1.00 26.82  ? 117  GLN A OE1 1 
ATOM   942  N  NE2 . GLN A 1 117 ? 28.187 40.541 43.163 1.00 24.84  ? 117  GLN A NE2 1 
ATOM   943  N  N   . ASP A 1 118 ? 27.690 37.586 48.900 1.00 13.26  ? 118  ASP A N   1 
ATOM   944  C  CA  . ASP A 1 118 ? 28.255 36.431 49.559 1.00 12.20  ? 118  ASP A CA  1 
ATOM   945  C  C   . ASP A 1 118 ? 27.550 36.211 50.875 1.00 12.07  ? 118  ASP A C   1 
ATOM   946  O  O   . ASP A 1 118 ? 27.168 37.194 51.535 1.00 11.93  ? 118  ASP A O   1 
ATOM   947  C  CB  . ASP A 1 118 ? 29.749 36.645 49.804 1.00 13.52  ? 118  ASP A CB  1 
ATOM   948  C  CG  . ASP A 1 118 ? 30.406 37.067 48.485 1.00 22.46  ? 118  ASP A CG  1 
ATOM   949  O  OD1 . ASP A 1 118 ? 30.171 36.407 47.456 1.00 22.53  ? 118  ASP A OD1 1 
ATOM   950  O  OD2 . ASP A 1 118 ? 31.125 38.100 48.492 1.00 36.23  ? 118  ASP A OD2 1 
ATOM   951  N  N   . ALA A 1 119 ? 27.365 34.965 51.265 1.00 13.00  ? 119  ALA A N   1 
ATOM   952  C  CA  . ALA A 1 119 ? 26.649 34.580 52.461 1.00 12.30  ? 119  ALA A CA  1 
ATOM   953  C  C   . ALA A 1 119 ? 27.360 35.007 53.744 1.00 11.97  ? 119  ALA A C   1 
ATOM   954  O  O   . ALA A 1 119 ? 28.587 35.133 53.777 1.00 12.17  ? 119  ALA A O   1 
ATOM   955  C  CB  . ALA A 1 119 ? 26.447 33.092 52.441 1.00 15.08  ? 119  ALA A CB  1 
ATOM   956  N  N   . GLN A 1 120 ? 26.523 35.228 54.777 1.00 11.22  ? 120  GLN A N   1 
ATOM   957  C  CA  . GLN A 1 120 ? 27.145 35.491 56.076 1.00 9.62   ? 120  GLN A CA  1 
ATOM   958  C  C   . GLN A 1 120 ? 28.113 34.374 56.411 1.00 10.05  ? 120  GLN A C   1 
ATOM   959  O  O   . GLN A 1 120 ? 27.810 33.203 56.203 1.00 11.41  ? 120  GLN A O   1 
ATOM   960  C  CB  . GLN A 1 120 ? 26.040 35.548 57.136 1.00 10.98  ? 120  GLN A CB  1 
ATOM   961  C  CG  . GLN A 1 120 ? 25.042 36.705 56.956 1.00 11.63  ? 120  GLN A CG  1 
ATOM   962  C  CD  . GLN A 1 120 ? 25.686 38.041 57.257 1.00 11.18  ? 120  GLN A CD  1 
ATOM   963  O  OE1 . GLN A 1 120 ? 25.921 38.371 58.436 1.00 11.49  ? 120  GLN A OE1 1 
ATOM   964  N  NE2 . GLN A 1 120 ? 25.970 38.843 56.229 1.00 9.62   ? 120  GLN A NE2 1 
ATOM   965  N  N   . LYS A 1 121 ? 29.264 34.755 56.952 1.00 11.36  ? 121  LYS A N   1 
ATOM   966  C  CA  . LYS A 1 121 ? 30.296 33.800 57.233 1.00 11.57  ? 121  LYS A CA  1 
ATOM   967  C  C   . LYS A 1 121 ? 30.093 33.010 58.504 1.00 13.68  ? 121  LYS A C   1 
ATOM   968  O  O   . LYS A 1 121 ? 30.800 32.024 58.765 1.00 21.67  ? 121  LYS A O   1 
ATOM   969  C  CB  . LYS A 1 121 ? 31.691 34.478 57.284 1.00 15.05  ? 121  LYS A CB  1 
ATOM   970  C  CG  . LYS A 1 121 ? 32.058 34.917 55.851 1.00 20.55  ? 121  LYS A CG  1 
ATOM   971  C  CD  . LYS A 1 121 ? 33.205 35.881 55.813 1.00 30.96  ? 121  LYS A CD  1 
ATOM   972  C  CE  . LYS A 1 121 ? 34.467 35.239 56.370 1.00 43.81  ? 121  LYS A CE  1 
ATOM   973  N  NZ  . LYS A 1 121 ? 35.519 36.321 56.503 1.00 57.89  ? 121  LYS A NZ  1 
ATOM   974  N  N   . GLY A 1 122 ? 29.180 33.386 59.338 1.00 14.57  ? 122  GLY A N   1 
ATOM   975  C  CA  . GLY A 1 122 ? 28.806 32.680 60.567 1.00 14.20  ? 122  GLY A CA  1 
ATOM   976  C  C   . GLY A 1 122 ? 27.575 33.351 61.148 1.00 13.18  ? 122  GLY A C   1 
ATOM   977  O  O   . GLY A 1 122 ? 27.050 34.270 60.552 1.00 12.80  ? 122  GLY A O   1 
ATOM   978  N  N   . ALA A 1 123 ? 27.147 32.892 62.293 1.00 12.34  ? 123  ALA A N   1 
ATOM   979  C  CA  . ALA A 1 123 ? 25.947 33.419 62.928 1.00 12.19  ? 123  ALA A CA  1 
ATOM   980  C  C   . ALA A 1 123 ? 26.079 34.919 63.109 1.00 12.14  ? 123  ALA A C   1 
ATOM   981  O  O   . ALA A 1 123 ? 27.178 35.475 63.314 1.00 12.70  ? 123  ALA A O   1 
ATOM   982  C  CB  . ALA A 1 123 ? 25.741 32.758 64.292 1.00 12.30  ? 123  ALA A CB  1 
ATOM   983  N  N   . PHE A 1 124 ? 24.980 35.619 63.066 1.00 9.97   ? 124  PHE A N   1 
ATOM   984  C  CA  . PHE A 1 124 ? 24.846 37.045 63.302 1.00 9.69   ? 124  PHE A CA  1 
ATOM   985  C  C   . PHE A 1 124 ? 23.688 37.336 64.276 1.00 9.97   ? 124  PHE A C   1 
ATOM   986  O  O   . PHE A 1 124 ? 22.558 36.923 64.022 1.00 10.25  ? 124  PHE A O   1 
ATOM   987  C  CB  . PHE A 1 124 ? 24.617 37.851 62.011 1.00 9.84   ? 124  PHE A CB  1 
ATOM   988  C  CG  . PHE A 1 124 ? 24.827 39.339 62.269 1.00 9.84   ? 124  PHE A CG  1 
ATOM   989  C  CD1 . PHE A 1 124 ? 23.762 40.151 62.617 1.00 11.26  ? 124  PHE A CD1 1 
ATOM   990  C  CD2 . PHE A 1 124 ? 26.090 39.920 62.196 1.00 11.76  ? 124  PHE A CD2 1 
ATOM   991  C  CE1 . PHE A 1 124 ? 23.969 41.483 62.931 1.00 10.96  ? 124  PHE A CE1 1 
ATOM   992  C  CE2 . PHE A 1 124 ? 26.260 41.241 62.475 1.00 10.75  ? 124  PHE A CE2 1 
ATOM   993  C  CZ  . PHE A 1 124 ? 25.215 42.069 62.817 1.00 11.94  ? 124  PHE A CZ  1 
ATOM   994  N  N   . THR A 1 125 ? 24.049 38.084 65.328 1.00 9.31   ? 125  THR A N   1 
ATOM   995  C  CA  . THR A 1 125 ? 23.158 38.571 66.351 1.00 9.27   ? 125  THR A CA  1 
ATOM   996  C  C   . THR A 1 125 ? 23.273 40.083 66.416 1.00 9.60   ? 125  THR A C   1 
ATOM   997  O  O   . THR A 1 125 ? 24.394 40.593 66.506 1.00 9.20   ? 125  THR A O   1 
ATOM   998  C  CB  . THR A 1 125 ? 23.481 37.895 67.688 1.00 9.79   ? 125  THR A CB  1 
ATOM   999  O  OG1 . THR A 1 125 ? 23.343 36.462 67.562 1.00 12.63  ? 125  THR A OG1 1 
ATOM   1000 C  CG2 . THR A 1 125 ? 22.573 38.389 68.799 1.00 11.86  ? 125  THR A CG2 1 
ATOM   1001 N  N   . LYS A 1 126 ? 22.128 40.769 66.351 1.00 8.93   ? 126  LYS A N   1 
ATOM   1002 C  CA  . LYS A 1 126 ? 22.128 42.215 66.454 1.00 8.45   ? 126  LYS A CA  1 
ATOM   1003 C  C   . LYS A 1 126 ? 22.653 42.676 67.818 1.00 9.08   ? 126  LYS A C   1 
ATOM   1004 O  O   . LYS A 1 126 ? 22.758 41.924 68.794 1.00 9.40   ? 126  LYS A O   1 
ATOM   1005 C  CB  . LYS A 1 126 ? 20.716 42.764 66.253 1.00 10.56  ? 126  LYS A CB  1 
ATOM   1006 C  CG  . LYS A 1 126 ? 20.112 42.508 64.898 1.00 11.17  ? 126  LYS A CG  1 
ATOM   1007 C  CD  . LYS A 1 126 ? 18.719 43.163 64.772 1.00 12.59  ? 126  LYS A CD  1 
ATOM   1008 C  CE  . LYS A 1 126 ? 18.050 42.747 63.471 1.00 12.86  ? 126  LYS A CE  1 
ATOM   1009 N  NZ  . LYS A 1 126 ? 16.742 43.401 63.320 1.00 13.07  ? 126  LYS A NZ  1 
ATOM   1010 N  N   . GLU A 1 127 ? 22.974 43.989 67.912 1.00 9.79   ? 127  GLU A N   1 
ATOM   1011 C  CA  . GLU A 1 127 ? 23.455 44.572 69.156 1.00 9.96   ? 127  GLU A CA  1 
ATOM   1012 C  C   . GLU A 1 127 ? 22.565 44.239 70.355 1.00 10.35  ? 127  GLU A C   1 
ATOM   1013 O  O   . GLU A 1 127 ? 23.054 43.940 71.450 1.00 13.01  ? 127  GLU A O   1 
ATOM   1014 C  CB  . GLU A 1 127 ? 23.462 46.099 69.131 1.00 16.97  ? 127  GLU A CB  1 
ATOM   1015 C  CG  . GLU A 1 127 ? 24.458 46.720 68.253 1.00 19.86  ? 127  GLU A CG  1 
ATOM   1016 C  CD  . GLU A 1 127 ? 24.475 48.255 68.273 1.00 15.22  ? 127  GLU A CD  1 
ATOM   1017 O  OE1 . GLU A 1 127 ? 23.471 48.939 68.565 1.00 17.88  ? 127  GLU A OE1 1 
ATOM   1018 O  OE2 . GLU A 1 127 ? 25.610 48.698 67.975 1.00 14.33  ? 127  GLU A OE2 1 
ATOM   1019 N  N   . ASP A 1 128 ? 21.257 44.307 70.175 1.00 11.35  ? 128  ASP A N   1 
ATOM   1020 C  CA  . ASP A 1 128 ? 20.318 44.086 71.284 1.00 12.89  ? 128  ASP A CA  1 
ATOM   1021 C  C   . ASP A 1 128 ? 20.062 42.618 71.595 1.00 12.00  ? 128  ASP A C   1 
ATOM   1022 O  O   . ASP A 1 128 ? 19.244 42.314 72.479 1.00 14.75  ? 128  ASP A O   1 
ATOM   1023 C  CB  . ASP A 1 128 ? 18.978 44.812 70.998 1.00 14.67  ? 128  ASP A CB  1 
ATOM   1024 C  CG  . ASP A 1 128 ? 18.120 44.130 69.940 1.00 16.22  ? 128  ASP A CG  1 
ATOM   1025 O  OD1 . ASP A 1 128 ? 18.559 43.192 69.258 1.00 15.19  ? 128  ASP A OD1 1 
ATOM   1026 O  OD2 . ASP A 1 128 ? 16.947 44.560 69.834 1.00 20.90  ? 128  ASP A OD2 1 
ATOM   1027 N  N   . GLY A 1 129 ? 20.759 41.704 70.895 1.00 12.43  ? 129  GLY A N   1 
ATOM   1028 C  CA  . GLY A 1 129 ? 20.600 40.288 71.193 1.00 12.67  ? 129  GLY A CA  1 
ATOM   1029 C  C   . GLY A 1 129 ? 19.674 39.536 70.267 1.00 13.38  ? 129  GLY A C   1 
ATOM   1030 O  O   . GLY A 1 129 ? 19.535 38.318 70.386 1.00 13.52  ? 129  GLY A O   1 
ATOM   1031 N  N   . GLU A 1 130 ? 18.995 40.215 69.301 1.00 12.64  ? 130  GLU A N   1 
ATOM   1032 C  CA  . GLU A 1 130 ? 18.125 39.583 68.316 1.00 12.83  ? 130  GLU A CA  1 
ATOM   1033 C  C   . GLU A 1 130 ? 18.971 38.756 67.355 1.00 11.82  ? 130  GLU A C   1 
ATOM   1034 O  O   . GLU A 1 130 ? 19.811 39.243 66.616 1.00 11.40  ? 130  GLU A O   1 
ATOM   1035 C  CB  . GLU A 1 130 ? 17.302 40.635 67.565 1.00 16.06  ? 130  GLU A CB  1 
ATOM   1036 C  CG  . GLU A 1 130 ? 16.388 40.002 66.522 1.00 24.29  ? 130  GLU A CG  1 
ATOM   1037 C  CD  . GLU A 1 130 ? 15.705 40.923 65.529 1.00 32.72  ? 130  GLU A CD  1 
ATOM   1038 O  OE1 . GLU A 1 130 ? 15.557 42.139 65.781 1.00 28.76  ? 130  GLU A OE1 1 
ATOM   1039 O  OE2 . GLU A 1 130 ? 15.270 40.463 64.419 1.00 48.51  ? 130  GLU A OE2 1 
ATOM   1040 N  N   . LYS A 1 131 ? 18.725 37.462 67.342 1.00 13.24  ? 131  LYS A N   1 
ATOM   1041 C  CA  . LYS A 1 131 ? 19.455 36.560 66.438 1.00 13.59  ? 131  LYS A CA  1 
ATOM   1042 C  C   . LYS A 1 131 ? 18.923 36.709 65.022 1.00 14.01  ? 131  LYS A C   1 
ATOM   1043 O  O   . LYS A 1 131 ? 17.686 36.644 64.862 1.00 18.76  ? 131  LYS A O   1 
ATOM   1044 C  CB  A LYS A 1 131 ? 19.323 35.122 66.915 0.69 19.00  ? 131  LYS A CB  1 
ATOM   1045 C  CB  B LYS A 1 131 ? 19.295 35.134 66.917 0.31 19.35  ? 131  LYS A CB  1 
ATOM   1046 C  CG  A LYS A 1 131 ? 19.589 34.924 68.397 0.69 19.61  ? 131  LYS A CG  1 
ATOM   1047 C  CG  B LYS A 1 131 ? 20.202 34.615 68.007 0.31 25.28  ? 131  LYS A CG  1 
ATOM   1048 C  CD  A LYS A 1 131 ? 19.145 33.576 68.924 0.69 27.19  ? 131  LYS A CD  1 
ATOM   1049 C  CD  B LYS A 1 131 ? 20.039 33.100 68.133 0.31 30.65  ? 131  LYS A CD  1 
ATOM   1050 C  CE  A LYS A 1 131 ? 19.387 33.365 70.410 0.69 30.70  ? 131  LYS A CE  1 
ATOM   1051 C  CE  B LYS A 1 131 ? 19.727 32.639 69.551 0.31 31.02  ? 131  LYS A CE  1 
ATOM   1052 N  NZ  A LYS A 1 131 ? 19.440 34.600 71.247 0.69 69.46  ? 131  LYS A NZ  1 
ATOM   1053 N  NZ  B LYS A 1 131 ? 18.418 31.939 69.659 0.31 33.76  ? 131  LYS A NZ  1 
ATOM   1054 N  N   . VAL A 1 132 ? 19.755 36.915 64.037 1.00 12.02  ? 132  VAL A N   1 
ATOM   1055 C  CA  . VAL A 1 132 ? 19.354 37.126 62.655 1.00 12.67  ? 132  VAL A CA  1 
ATOM   1056 C  C   . VAL A 1 132 ? 19.617 35.885 61.811 1.00 13.22  ? 132  VAL A C   1 
ATOM   1057 O  O   . VAL A 1 132 ? 18.710 35.394 61.124 1.00 13.64  ? 132  VAL A O   1 
ATOM   1058 C  CB  . VAL A 1 132 ? 20.123 38.308 62.044 1.00 16.57  ? 132  VAL A CB  1 
ATOM   1059 C  CG1 . VAL A 1 132 ? 19.678 38.569 60.604 1.00 22.75  ? 132  VAL A CG1 1 
ATOM   1060 C  CG2 . VAL A 1 132 ? 19.875 39.519 62.874 1.00 16.40  ? 132  VAL A CG2 1 
ATOM   1061 N  N   . VAL A 1 133 ? 20.849 35.376 61.836 1.00 13.48  ? 133  VAL A N   1 
ATOM   1062 C  CA  . VAL A 1 133 ? 21.162 34.150 61.091 1.00 12.14  ? 133  VAL A CA  1 
ATOM   1063 C  C   . VAL A 1 133 ? 21.930 33.261 62.069 1.00 12.30  ? 133  VAL A C   1 
ATOM   1064 O  O   . VAL A 1 133 ? 22.707 33.730 62.870 1.00 11.36  ? 133  VAL A O   1 
ATOM   1065 C  CB  . VAL A 1 133 ? 21.960 34.276 59.779 1.00 16.68  ? 133  VAL A CB  1 
ATOM   1066 C  CG1 . VAL A 1 133 ? 21.183 35.180 58.813 1.00 25.85  ? 133  VAL A CG1 1 
ATOM   1067 C  CG2 . VAL A 1 133 ? 23.329 34.771 60.009 1.00 28.40  ? 133  VAL A CG2 1 
ATOM   1068 N  N   . ASP A 1 134 ? 21.652 31.965 61.954 1.00 15.66  ? 134  ASP A N   1 
ATOM   1069 C  CA  . ASP A 1 134 ? 22.387 31.017 62.791 1.00 18.18  ? 134  ASP A CA  1 
ATOM   1070 C  C   . ASP A 1 134 ? 23.675 30.547 62.127 1.00 16.61  ? 134  ASP A C   1 
ATOM   1071 O  O   . ASP A 1 134 ? 24.013 30.972 61.044 1.00 15.66  ? 134  ASP A O   1 
ATOM   1072 C  CB  . ASP A 1 134 ? 21.513 29.822 63.088 1.00 22.66  ? 134  ASP A CB  1 
ATOM   1073 C  CG  . ASP A 1 134 ? 21.131 28.892 61.967 1.00 25.05  ? 134  ASP A CG  1 
ATOM   1074 O  OD1 . ASP A 1 134 ? 20.272 27.989 62.183 1.00 62.10  ? 134  ASP A OD1 1 
ATOM   1075 O  OD2 . ASP A 1 134 ? 21.689 29.027 60.872 1.00 28.42  ? 134  ASP A OD2 1 
ATOM   1076 N  N   . GLU A 1 135 ? 24.381 29.645 62.823 1.00 19.89  ? 135  GLU A N   1 
ATOM   1077 C  CA  . GLU A 1 135 ? 25.658 29.248 62.316 1.00 22.29  ? 135  GLU A CA  1 
ATOM   1078 C  C   . GLU A 1 135 ? 25.579 28.556 60.968 1.00 25.68  ? 135  GLU A C   1 
ATOM   1079 O  O   . GLU A 1 135 ? 26.486 28.680 60.169 1.00 31.63  ? 135  GLU A O   1 
ATOM   1080 C  CB  . GLU A 1 135 ? 26.368 28.301 63.279 1.00 33.15  ? 135  GLU A CB  1 
ATOM   1081 C  CG  . GLU A 1 135 ? 27.551 28.972 63.942 1.00 47.06  ? 135  GLU A CG  1 
ATOM   1082 C  CD  . GLU A 1 135 ? 28.370 29.984 63.150 1.00 55.62  ? 135  GLU A CD  1 
ATOM   1083 O  OE1 . GLU A 1 135 ? 28.346 29.877 61.893 1.00 108.20 ? 135  GLU A OE1 1 
ATOM   1084 O  OE2 . GLU A 1 135 ? 29.051 30.878 63.741 1.00 32.70  ? 135  GLU A OE2 1 
ATOM   1085 N  N   . ALA A 1 136 ? 24.502 27.862 60.761 1.00 24.09  ? 136  ALA A N   1 
ATOM   1086 C  CA  . ALA A 1 136 ? 24.165 27.199 59.512 1.00 27.82  ? 136  ALA A CA  1 
ATOM   1087 C  C   . ALA A 1 136 ? 23.727 28.111 58.371 1.00 23.25  ? 136  ALA A C   1 
ATOM   1088 O  O   . ALA A 1 136 ? 23.612 27.727 57.214 1.00 35.06  ? 136  ALA A O   1 
ATOM   1089 C  CB  . ALA A 1 136 ? 23.027 26.205 59.796 1.00 33.88  ? 136  ALA A CB  1 
ATOM   1090 N  N   . GLY A 1 137 ? 23.449 29.351 58.667 1.00 20.76  ? 137  GLY A N   1 
ATOM   1091 C  CA  . GLY A 1 137 ? 23.110 30.360 57.719 1.00 19.99  ? 137  GLY A CA  1 
ATOM   1092 C  C   . GLY A 1 137 ? 21.634 30.610 57.490 1.00 16.72  ? 137  GLY A C   1 
ATOM   1093 O  O   . GLY A 1 137 ? 21.216 31.405 56.639 1.00 17.70  ? 137  GLY A O   1 
ATOM   1094 N  N   . LYS A 1 138 ? 20.818 29.929 58.263 1.00 18.50  ? 138  LYS A N   1 
ATOM   1095 C  CA  . LYS A 1 138 ? 19.377 30.051 58.200 1.00 18.93  ? 138  LYS A CA  1 
ATOM   1096 C  C   . LYS A 1 138 ? 18.964 31.340 58.890 1.00 18.93  ? 138  LYS A C   1 
ATOM   1097 O  O   . LYS A 1 138 ? 19.381 31.679 59.986 1.00 17.26  ? 138  LYS A O   1 
ATOM   1098 C  CB  . LYS A 1 138 ? 18.747 28.858 58.915 1.00 27.14  ? 138  LYS A CB  1 
ATOM   1099 C  CG  . LYS A 1 138 ? 17.267 28.862 58.650 1.00 33.34  ? 138  LYS A CG  1 
ATOM   1100 C  CD  . LYS A 1 138 ? 16.526 27.961 59.627 1.00 63.08  ? 138  LYS A CD  1 
ATOM   1101 C  CE  . LYS A 1 138 ? 15.030 28.261 59.492 1.00 76.02  ? 138  LYS A CE  1 
ATOM   1102 N  NZ  . LYS A 1 138 ? 14.320 28.155 60.812 1.00 106.89 ? 138  LYS A NZ  1 
ATOM   1103 N  N   . ARG A 1 139 ? 18.116 32.080 58.223 1.00 19.20  ? 139  ARG A N   1 
ATOM   1104 C  CA  . ARG A 1 139 ? 17.483 33.278 58.744 1.00 21.70  ? 139  ARG A CA  1 
ATOM   1105 C  C   . ARG A 1 139 ? 16.458 32.928 59.813 1.00 25.12  ? 139  ARG A C   1 
ATOM   1106 O  O   . ARG A 1 139 ? 15.628 32.040 59.574 1.00 37.97  ? 139  ARG A O   1 
ATOM   1107 C  CB  A ARG A 1 139 ? 16.780 34.031 57.621 0.53 27.09  ? 139  ARG A CB  1 
ATOM   1108 C  CB  B ARG A 1 139 ? 16.828 34.039 57.594 0.47 27.63  ? 139  ARG A CB  1 
ATOM   1109 C  CG  A ARG A 1 139 ? 17.519 35.293 57.254 0.53 29.63  ? 139  ARG A CG  1 
ATOM   1110 C  CG  B ARG A 1 139 ? 16.925 35.533 57.522 0.47 27.45  ? 139  ARG A CG  1 
ATOM   1111 C  CD  A ARG A 1 139 ? 17.388 36.315 58.363 0.53 26.55  ? 139  ARG A CD  1 
ATOM   1112 C  CD  B ARG A 1 139 ? 15.740 36.267 58.069 0.47 29.53  ? 139  ARG A CD  1 
ATOM   1113 N  NE  A ARG A 1 139 ? 16.138 37.029 58.467 0.53 28.07  ? 139  ARG A NE  1 
ATOM   1114 N  NE  B ARG A 1 139 ? 15.044 37.276 57.282 0.47 36.91  ? 139  ARG A NE  1 
ATOM   1115 C  CZ  A ARG A 1 139 ? 15.490 37.439 59.547 0.53 31.00  ? 139  ARG A CZ  1 
ATOM   1116 C  CZ  B ARG A 1 139 ? 15.418 38.283 56.532 0.47 34.03  ? 139  ARG A CZ  1 
ATOM   1117 N  NH1 A ARG A 1 139 ? 15.953 37.222 60.762 0.53 26.10  ? 139  ARG A NH1 1 
ATOM   1118 N  NH1 B ARG A 1 139 ? 16.709 38.483 56.411 0.47 37.42  ? 139  ARG A NH1 1 
ATOM   1119 N  NH2 A ARG A 1 139 ? 14.342 38.083 59.393 0.53 26.25  ? 139  ARG A NH2 1 
ATOM   1120 N  NH2 B ARG A 1 139 ? 14.548 39.068 55.935 0.47 41.39  ? 139  ARG A NH2 1 
ATOM   1121 N  N   . LEU A 1 140 ? 16.464 33.587 60.964 1.00 28.58  ? 140  LEU A N   1 
ATOM   1122 C  CA  . LEU A 1 140 ? 15.439 33.270 61.964 1.00 28.69  ? 140  LEU A CA  1 
ATOM   1123 C  C   . LEU A 1 140 ? 14.184 34.122 61.972 1.00 36.34  ? 140  LEU A C   1 
ATOM   1124 O  O   . LEU A 1 140 ? 14.200 35.342 62.023 1.00 49.94  ? 140  LEU A O   1 
ATOM   1125 C  CB  . LEU A 1 140 ? 16.178 33.305 63.323 1.00 29.80  ? 140  LEU A CB  1 
ATOM   1126 C  CG  . LEU A 1 140 ? 17.466 32.484 63.188 1.00 32.09  ? 140  LEU A CG  1 
ATOM   1127 C  CD1 . LEU A 1 140 ? 18.281 32.666 64.423 1.00 37.14  ? 140  LEU A CD1 1 
ATOM   1128 C  CD2 . LEU A 1 140 ? 17.172 31.015 62.945 1.00 44.69  ? 140  LEU A CD2 1 
HETATM 1129 S  S   . SO4 B 2 .   ? 17.947 54.262 64.374 0.99 11.25  ? 201  SO4 A S   1 
HETATM 1130 O  O1  . SO4 B 2 .   ? 18.321 54.398 62.940 0.99 11.47  ? 201  SO4 A O1  1 
HETATM 1131 O  O2  . SO4 B 2 .   ? 18.488 55.428 65.099 0.99 13.12  ? 201  SO4 A O2  1 
HETATM 1132 O  O3  . SO4 B 2 .   ? 16.518 54.202 64.456 0.99 12.95  ? 201  SO4 A O3  1 
HETATM 1133 O  O4  . SO4 B 2 .   ? 18.551 53.000 64.870 0.99 11.93  ? 201  SO4 A O4  1 
HETATM 1134 S  S   . SO4 C 2 .   ? 14.932 58.547 67.748 0.36 17.82  ? 202  SO4 A S   1 
HETATM 1135 O  O1  . SO4 C 2 .   ? 16.053 58.205 66.847 0.36 18.69  ? 202  SO4 A O1  1 
HETATM 1136 O  O2  . SO4 C 2 .   ? 15.225 59.559 68.787 0.36 20.14  ? 202  SO4 A O2  1 
HETATM 1137 O  O3  . SO4 C 2 .   ? 13.858 59.044 66.869 0.36 20.36  ? 202  SO4 A O3  1 
HETATM 1138 O  O4  . SO4 C 2 .   ? 14.408 57.320 68.379 0.36 22.73  ? 202  SO4 A O4  1 
HETATM 1139 S  S   A SO4 D 2 .   ? 17.411 47.042 63.557 0.62 15.85  ? 203  SO4 A S   1 
HETATM 1140 S  S   B SO4 D 2 .   ? 17.372 47.010 63.510 0.38 15.74  ? 203  SO4 A S   1 
HETATM 1141 O  O1  A SO4 D 2 .   ? 16.583 48.123 62.983 0.62 27.85  ? 203  SO4 A O1  1 
HETATM 1142 O  O1  B SO4 D 2 .   ? 17.197 48.456 63.859 0.38 28.40  ? 203  SO4 A O1  1 
HETATM 1143 O  O2  A SO4 D 2 .   ? 17.759 46.071 62.498 0.62 27.70  ? 203  SO4 A O2  1 
HETATM 1144 O  O2  B SO4 D 2 .   ? 16.797 46.806 62.171 0.38 28.36  ? 203  SO4 A O2  1 
HETATM 1145 O  O3  A SO4 D 2 .   ? 18.627 47.593 64.171 0.62 21.72  ? 203  SO4 A O3  1 
HETATM 1146 O  O3  B SO4 D 2 .   ? 18.830 46.811 63.487 0.38 22.55  ? 203  SO4 A O3  1 
HETATM 1147 O  O4  . SO4 D 2 .   ? 16.687 46.181 64.513 0.50 10.97  ? 203  SO4 A O4  1 
HETATM 1148 CS CS  . CS  E 3 .   ? 21.485 37.522 48.391 0.51 12.10  ? 301  CS  A CS  1 
HETATM 1149 CS CS  . CS  F 3 .   ? 28.499 63.900 47.013 0.20 23.45  ? 302  CS  A CS  1 
HETATM 1150 CS CS  . CS  G 3 .   ? 19.938 72.550 64.979 0.19 40.52  ? 303  CS  A CS  1 
HETATM 1151 O  O   . HOH H 4 .   ? 20.055 45.820 67.865 1.00 12.21  ? 1001 HOH A O   1 
HETATM 1152 O  O   . HOH H 4 .   ? 25.912 44.962 65.104 1.00 9.67   ? 1002 HOH A O   1 
HETATM 1153 O  O   . HOH H 4 .   ? 25.313 38.069 53.544 1.00 10.85  ? 1003 HOH A O   1 
HETATM 1154 O  O   . HOH H 4 .   ? 18.861 60.314 59.054 1.00 11.05  ? 1004 HOH A O   1 
HETATM 1155 O  O   . HOH H 4 .   ? 7.690  76.071 61.283 1.00 13.23  ? 1005 HOH A O   1 
HETATM 1156 O  O   . HOH H 4 .   ? 25.830 44.320 71.714 1.00 11.60  ? 1006 HOH A O   1 
HETATM 1157 O  O   . HOH H 4 .   ? 26.498 60.376 58.669 1.00 12.31  ? 1007 HOH A O   1 
HETATM 1158 O  O   . HOH H 4 .   ? 9.192  63.537 70.006 1.00 12.36  ? 1008 HOH A O   1 
HETATM 1159 O  O   . HOH H 4 .   ? 4.962  72.877 49.758 1.00 13.76  ? 1009 HOH A O   1 
HETATM 1160 O  O   . HOH H 4 .   ? 8.048  66.603 41.827 1.00 12.74  ? 1010 HOH A O   1 
HETATM 1161 O  O   . HOH H 4 .   ? 18.108 43.652 74.668 1.00 16.71  ? 1011 HOH A O   1 
HETATM 1162 O  O   . HOH H 4 .   ? 5.910  67.405 60.479 1.00 11.68  ? 1012 HOH A O   1 
HETATM 1163 O  O   . HOH H 4 .   ? 27.097 47.251 66.322 1.00 14.41  ? 1013 HOH A O   1 
HETATM 1164 O  O   . HOH H 4 .   ? 22.860 37.279 52.315 1.00 12.48  ? 1014 HOH A O   1 
HETATM 1165 O  O   . HOH H 4 .   ? 3.536  70.914 46.599 1.00 11.18  ? 1015 HOH A O   1 
HETATM 1166 O  O   . HOH H 4 .   ? 23.729 35.121 54.299 1.00 15.55  ? 1016 HOH A O   1 
HETATM 1167 O  O   . HOH H 4 .   ? 27.357 59.830 47.219 1.00 16.86  ? 1017 HOH A O   1 
HETATM 1168 O  O   . HOH H 4 .   ? 21.181 56.633 54.616 1.00 15.73  ? 1018 HOH A O   1 
HETATM 1169 O  O   . HOH H 4 .   ? 6.357  60.850 56.273 1.00 16.80  ? 1019 HOH A O   1 
HETATM 1170 O  O   . HOH H 4 .   ? 7.979  69.228 42.191 1.00 11.88  ? 1020 HOH A O   1 
HETATM 1171 O  O   . HOH H 4 .   ? 14.736 49.645 49.821 1.00 14.34  ? 1021 HOH A O   1 
HETATM 1172 O  O   . HOH H 4 .   ? 31.928 60.468 54.321 1.00 16.69  ? 1022 HOH A O   1 
HETATM 1173 O  O   . HOH H 4 .   ? 3.387  65.421 50.441 1.00 14.17  ? 1023 HOH A O   1 
HETATM 1174 O  O   . HOH H 4 .   ? 28.347 61.500 49.113 1.00 16.84  ? 1024 HOH A O   1 
HETATM 1175 O  O   . HOH H 4 .   ? 23.892 35.944 46.703 1.00 14.02  ? 1025 HOH A O   1 
HETATM 1176 O  O   . HOH H 4 .   ? 10.068 73.155 48.681 1.00 12.46  ? 1026 HOH A O   1 
HETATM 1177 O  O   . HOH H 4 .   ? 7.737  73.130 50.044 1.00 11.19  ? 1027 HOH A O   1 
HETATM 1178 O  O   . HOH H 4 .   ? 6.590  60.290 47.847 1.00 15.47  ? 1028 HOH A O   1 
HETATM 1179 O  O   . HOH H 4 .   ? 27.992 61.192 61.009 1.00 16.04  ? 1029 HOH A O   1 
HETATM 1180 O  O   . HOH H 4 .   ? 22.985 32.620 54.976 1.00 17.17  ? 1030 HOH A O   1 
HETATM 1181 O  O   . HOH H 4 .   ? 22.403 43.179 74.257 1.00 16.40  ? 1031 HOH A O   1 
HETATM 1182 O  O   . HOH H 4 .   ? 24.121 40.853 71.274 1.00 14.33  ? 1032 HOH A O   1 
HETATM 1183 O  O   . HOH H 4 .   ? 32.851 37.683 59.981 1.00 20.03  ? 1033 HOH A O   1 
HETATM 1184 O  O   . HOH H 4 .   ? 12.449 71.806 49.035 1.00 13.72  ? 1034 HOH A O   1 
HETATM 1185 O  O   . HOH H 4 .   ? 18.630 49.113 66.386 1.00 17.62  ? 1035 HOH A O   1 
HETATM 1186 O  O   . HOH H 4 .   ? 28.977 40.361 50.022 1.00 15.84  ? 1036 HOH A O   1 
HETATM 1187 O  O   . HOH H 4 .   ? 33.506 47.494 48.970 1.00 18.66  ? 1037 HOH A O   1 
HETATM 1188 O  O   . HOH H 4 .   ? 11.437 56.495 56.548 1.00 17.21  ? 1038 HOH A O   1 
HETATM 1189 O  O   . HOH H 4 .   ? 15.552 75.855 63.228 1.00 16.68  ? 1039 HOH A O   1 
HETATM 1190 O  O   . HOH H 4 .   ? 7.908  63.502 63.682 1.00 16.89  ? 1040 HOH A O   1 
HETATM 1191 O  O   . HOH H 4 .   ? 29.049 33.860 47.112 1.00 17.48  ? 1041 HOH A O   1 
HETATM 1192 O  O   . HOH H 4 .   ? 5.845  65.748 62.690 1.00 18.41  ? 1042 HOH A O   1 
HETATM 1193 O  O   . HOH H 4 .   ? 8.476  58.921 56.039 1.00 16.10  ? 1043 HOH A O   1 
HETATM 1194 O  O   . HOH H 4 .   ? 27.836 42.056 48.072 1.00 16.61  ? 1044 HOH A O   1 
HETATM 1195 O  O   . HOH H 4 .   ? 32.711 50.668 62.557 1.00 19.90  ? 1045 HOH A O   1 
HETATM 1196 O  O   . HOH H 4 .   ? 22.673 35.150 69.937 1.00 16.94  ? 1046 HOH A O   1 
HETATM 1197 O  O   . HOH H 4 .   ? 21.663 52.874 43.348 1.00 19.28  ? 1047 HOH A O   1 
HETATM 1198 O  O   . HOH H 4 .   ? 28.022 35.932 66.087 1.00 16.03  ? 1048 HOH A O   1 
HETATM 1199 O  O   . HOH H 4 .   ? 21.174 49.657 42.455 1.00 23.12  ? 1049 HOH A O   1 
HETATM 1200 O  O   . HOH H 4 .   ? 4.066  62.192 49.540 1.00 17.60  ? 1050 HOH A O   1 
HETATM 1201 O  O   . HOH H 4 .   ? 22.054 54.496 68.591 1.00 18.96  ? 1051 HOH A O   1 
HETATM 1202 O  O   . HOH H 4 .   ? 17.496 37.730 51.650 1.00 24.64  ? 1052 HOH A O   1 
HETATM 1203 O  O   . HOH H 4 .   ? 7.996  58.708 45.032 1.00 23.86  ? 1053 HOH A O   1 
HETATM 1204 O  O   . HOH H 4 .   ? 20.980 67.597 58.603 1.00 20.98  ? 1054 HOH A O   1 
HETATM 1205 O  O   . HOH H 4 .   ? 5.178  64.323 43.633 1.00 16.58  ? 1055 HOH A O   1 
HETATM 1206 O  O   . HOH H 4 .   ? 17.941 47.698 43.684 1.00 17.35  ? 1056 HOH A O   1 
HETATM 1207 O  O   . HOH H 4 .   ? 25.529 35.111 66.967 1.00 16.43  ? 1057 HOH A O   1 
HETATM 1208 O  O   . HOH H 4 .   ? 10.936 57.599 60.689 1.00 21.48  ? 1058 HOH A O   1 
HETATM 1209 O  O   . HOH H 4 .   ? 23.377 66.357 40.934 1.00 21.81  ? 1059 HOH A O   1 
HETATM 1210 O  O   . HOH H 4 .   ? 5.198  63.576 47.523 1.00 19.17  ? 1060 HOH A O   1 
HETATM 1211 O  O   . HOH H 4 .   ? 17.094 66.559 64.820 1.00 18.72  ? 1061 HOH A O   1 
HETATM 1212 O  O   . HOH H 4 .   ? 7.406  53.150 49.314 1.00 23.92  ? 1062 HOH A O   1 
HETATM 1213 O  O   . HOH H 4 .   ? 18.803 56.913 67.669 1.00 22.46  ? 1063 HOH A O   1 
HETATM 1214 O  O   . HOH H 4 .   ? 15.042 72.840 50.441 1.00 22.29  ? 1064 HOH A O   1 
HETATM 1215 O  O   . HOH H 4 .   ? 21.078 36.440 71.628 1.00 21.68  ? 1065 HOH A O   1 
HETATM 1216 O  O   . HOH H 4 .   ? 20.797 48.347 67.943 1.00 24.05  ? 1066 HOH A O   1 
HETATM 1217 O  O   . HOH H 4 .   ? 33.801 52.053 60.663 1.00 19.35  ? 1067 HOH A O   1 
HETATM 1218 O  O   . HOH H 4 .   ? 12.449 55.368 61.014 1.00 19.51  ? 1068 HOH A O   1 
HETATM 1219 O  O   . HOH H 4 .   ? 21.633 61.121 64.245 1.00 26.23  ? 1069 HOH A O   1 
HETATM 1220 O  O   . HOH H 4 .   ? 17.460 45.762 67.027 1.00 18.12  ? 1070 HOH A O   1 
HETATM 1221 O  O   . HOH H 4 .   ? 17.633 74.180 66.947 1.00 27.82  ? 1071 HOH A O   1 
HETATM 1222 O  O   . HOH H 4 .   ? 21.887 34.335 65.791 1.00 25.33  ? 1072 HOH A O   1 
HETATM 1223 O  O   . HOH H 4 .   ? 2.593  72.256 60.338 1.00 28.68  ? 1073 HOH A O   1 
HETATM 1224 O  O   . HOH H 4 .   ? 32.533 60.275 51.713 1.00 27.80  ? 1074 HOH A O   1 
HETATM 1225 O  O   . HOH H 4 .   ? 13.754 42.804 62.490 1.00 27.59  ? 1075 HOH A O   1 
HETATM 1226 O  O   . HOH H 4 .   ? 13.902 58.773 41.723 1.00 20.62  ? 1076 HOH A O   1 
HETATM 1227 O  O   . HOH H 4 .   ? 26.273 60.786 63.502 1.00 21.84  ? 1077 HOH A O   1 
HETATM 1228 O  O   . HOH H 4 .   ? 15.612 43.547 67.718 1.00 24.10  ? 1078 HOH A O   1 
HETATM 1229 O  O   . HOH H 4 .   ? 29.427 48.466 66.043 1.00 24.93  ? 1079 HOH A O   1 
HETATM 1230 O  O   . HOH H 4 .   ? 35.279 54.228 53.379 1.00 20.97  ? 1080 HOH A O   1 
HETATM 1231 O  O   . HOH H 4 .   ? 22.038 27.596 55.339 1.00 27.51  ? 1081 HOH A O   1 
HETATM 1232 O  O   . HOH H 4 .   ? 4.864  75.455 61.649 1.00 34.25  ? 1082 HOH A O   1 
HETATM 1233 O  O   . HOH H 4 .   ? 14.494 72.994 60.618 1.00 28.75  ? 1083 HOH A O   1 
HETATM 1234 O  O   . HOH H 4 .   ? 25.528 32.003 56.057 1.00 24.87  ? 1084 HOH A O   1 
HETATM 1235 O  O   . HOH H 4 .   ? 24.385 67.137 48.019 1.00 24.03  ? 1085 HOH A O   1 
HETATM 1236 O  O   . HOH H 4 .   ? 18.179 68.820 66.305 1.00 27.48  ? 1086 HOH A O   1 
HETATM 1237 O  O   . HOH H 4 .   ? 27.816 30.056 57.514 1.00 29.81  ? 1087 HOH A O   1 
HETATM 1238 O  O   . HOH H 4 .   ? 30.077 52.886 63.373 1.00 27.94  ? 1088 HOH A O   1 
HETATM 1239 O  O   . HOH H 4 .   ? 13.565 48.934 52.217 1.00 28.08  ? 1089 HOH A O   1 
HETATM 1240 O  O   . HOH H 4 .   ? -1.775 68.840 48.841 1.00 32.30  ? 1090 HOH A O   1 
HETATM 1241 O  O   . HOH H 4 .   ? 13.614 64.563 40.316 1.00 34.84  ? 1091 HOH A O   1 
HETATM 1242 O  O   . HOH H 4 .   ? 11.362 46.754 55.264 1.00 31.26  ? 1092 HOH A O   1 
HETATM 1243 O  O   . HOH H 4 .   ? 37.165 43.869 51.489 1.00 40.10  ? 1093 HOH A O   1 
HETATM 1244 O  O   . HOH H 4 .   ? 32.214 54.723 60.222 1.00 29.19  ? 1094 HOH A O   1 
HETATM 1245 O  O   . HOH H 4 .   ? 18.245 66.532 39.437 1.00 29.49  ? 1095 HOH A O   1 
HETATM 1246 O  O   . HOH H 4 .   ? -2.146 65.901 55.271 1.00 32.71  ? 1096 HOH A O   1 
HETATM 1247 O  O   . HOH H 4 .   ? 23.721 68.212 43.799 1.00 26.58  ? 1097 HOH A O   1 
HETATM 1248 O  O   . HOH H 4 .   ? 28.373 65.809 49.660 1.00 29.29  ? 1098 HOH A O   1 
HETATM 1249 O  O   . HOH H 4 .   ? 23.844 29.691 65.768 1.00 29.06  ? 1099 HOH A O   1 
HETATM 1250 O  O   . HOH H 4 .   ? 29.715 34.620 63.821 1.00 30.94  ? 1100 HOH A O   1 
HETATM 1251 O  O   . HOH H 4 .   ? 15.118 60.422 64.600 1.00 41.02  ? 1101 HOH A O   1 
HETATM 1252 O  O   . HOH H 4 .   ? 18.446 71.391 46.946 1.00 36.28  ? 1102 HOH A O   1 
HETATM 1253 O  O   . HOH H 4 .   ? 33.823 57.373 56.029 1.00 25.05  ? 1103 HOH A O   1 
HETATM 1254 O  O   . HOH H 4 .   ? 17.872 74.393 63.139 1.00 32.68  ? 1104 HOH A O   1 
HETATM 1255 O  O   . HOH H 4 .   ? 34.995 41.896 56.549 1.00 35.47  ? 1105 HOH A O   1 
HETATM 1256 O  O   . HOH H 4 .   ? 14.847 49.176 61.703 1.00 28.23  ? 1106 HOH A O   1 
HETATM 1257 O  O   . HOH H 4 .   ? 33.654 57.695 51.824 1.00 27.20  ? 1107 HOH A O   1 
HETATM 1258 O  O   . HOH H 4 .   ? 10.331 53.712 54.949 1.00 31.41  ? 1108 HOH A O   1 
HETATM 1259 O  O   . HOH H 4 .   ? 32.250 39.287 50.552 1.00 31.32  ? 1109 HOH A O   1 
HETATM 1260 O  O   . HOH H 4 .   ? 3.756  59.222 48.598 1.00 31.54  ? 1110 HOH A O   1 
HETATM 1261 O  O   . HOH H 4 .   ? 14.759 48.482 65.756 1.00 41.60  ? 1111 HOH A O   1 
HETATM 1262 O  O   . HOH H 4 .   ? 12.229 60.706 42.361 1.00 37.36  ? 1112 HOH A O   1 
HETATM 1263 O  O   . HOH H 4 .   ? 0.643  66.353 47.769 1.00 30.55  ? 1113 HOH A O   1 
HETATM 1264 O  O   . HOH H 4 .   ? 30.634 35.344 61.870 1.00 33.38  ? 1114 HOH A O   1 
HETATM 1265 O  O   . HOH H 4 .   ? 6.302  65.298 66.761 1.00 27.21  ? 1115 HOH A O   1 
HETATM 1266 O  O   . HOH H 4 .   ? 19.735 60.638 38.602 1.00 35.87  ? 1116 HOH A O   1 
HETATM 1267 O  O   . HOH H 4 .   ? 33.889 56.058 58.659 1.00 32.25  ? 1117 HOH A O   1 
HETATM 1268 O  O   . HOH H 4 .   ? 11.574 52.691 57.088 1.00 31.66  ? 1118 HOH A O   1 
HETATM 1269 O  O   . HOH H 4 .   ? 26.295 30.343 67.100 1.00 38.62  ? 1119 HOH A O   1 
HETATM 1270 O  O   . HOH H 4 .   ? 11.646 57.003 42.023 1.00 25.54  ? 1120 HOH A O   1 
HETATM 1271 O  O   . HOH H 4 .   ? 22.118 31.802 66.632 1.00 34.18  ? 1121 HOH A O   1 
HETATM 1272 O  O   . HOH H 4 .   ? 23.452 68.845 49.895 1.00 29.79  ? 1122 HOH A O   1 
HETATM 1273 O  O   . HOH H 4 .   ? 4.495  61.725 60.212 1.00 29.55  ? 1123 HOH A O   1 
HETATM 1274 O  O   . HOH H 4 .   ? 24.029 54.311 42.984 1.00 30.71  ? 1124 HOH A O   1 
HETATM 1275 O  O   . HOH H 4 .   ? 14.423 47.317 44.651 1.00 33.90  ? 1125 HOH A O   1 
HETATM 1276 O  O   . HOH H 4 .   ? 3.927  59.446 56.262 1.00 34.26  ? 1126 HOH A O   1 
HETATM 1277 O  O   . HOH H 4 .   ? 23.798 67.414 58.545 1.00 29.80  ? 1127 HOH A O   1 
HETATM 1278 O  O   . HOH H 4 .   ? 11.311 54.435 43.789 1.00 32.81  ? 1128 HOH A O   1 
HETATM 1279 O  O   . HOH H 4 .   ? 29.636 58.592 45.702 1.00 39.56  ? 1129 HOH A O   1 
HETATM 1280 O  O   . HOH H 4 .   ? 23.132 46.913 40.085 1.00 46.46  ? 1130 HOH A O   1 
HETATM 1281 O  O   . HOH H 4 .   ? 19.605 53.693 67.534 1.00 33.93  ? 1131 HOH A O   1 
HETATM 1282 O  O   . HOH H 4 .   ? 35.815 51.245 55.344 1.00 33.12  ? 1132 HOH A O   1 
HETATM 1283 O  O   . HOH H 4 .   ? 16.575 36.300 69.128 1.00 31.52  ? 1133 HOH A O   1 
HETATM 1284 O  O   . HOH H 4 .   ? 2.432  64.441 46.514 1.00 38.09  ? 1134 HOH A O   1 
HETATM 1285 O  O   . HOH H 4 .   ? 28.842 60.435 64.995 1.00 48.69  ? 1135 HOH A O   1 
HETATM 1286 O  O   . HOH H 4 .   ? 16.399 39.845 54.367 1.00 34.64  ? 1136 HOH A O   1 
HETATM 1287 O  O   . HOH H 4 .   ? 30.934 54.915 46.554 1.00 43.24  ? 1137 HOH A O   1 
HETATM 1288 O  O   . HOH H 4 .   ? 33.417 57.654 48.836 1.00 49.49  ? 1138 HOH A O   1 
HETATM 1289 O  O   . HOH H 4 .   ? 23.363 71.496 48.909 0.50 36.15  ? 1139 HOH A O   1 
HETATM 1290 O  O   . HOH H 4 .   ? 33.095 33.276 61.063 1.00 46.67  ? 1140 HOH A O   1 
HETATM 1291 O  O   . HOH H 4 .   ? 28.893 50.884 45.570 1.00 27.99  ? 1141 HOH A O   1 
HETATM 1292 O  O   . HOH H 4 .   ? 17.863 44.074 44.077 1.00 37.59  ? 1142 HOH A O   1 
HETATM 1293 O  O   . HOH H 4 .   ? 33.839 59.734 55.359 1.00 48.85  ? 1143 HOH A O   1 
HETATM 1294 O  O   . HOH H 4 .   ? 10.893 53.745 60.616 1.00 43.27  ? 1144 HOH A O   1 
HETATM 1295 O  O   . HOH H 4 .   ? 30.362 33.846 52.384 1.00 32.83  ? 1145 HOH A O   1 
HETATM 1296 O  O   . HOH H 4 .   ? 23.205 70.052 52.917 1.00 30.70  ? 1146 HOH A O   1 
HETATM 1297 O  O   . HOH H 4 .   ? 26.006 31.529 59.074 1.00 29.67  ? 1147 HOH A O   1 
HETATM 1298 O  O   . HOH H 4 .   ? 2.389  61.781 57.923 1.00 35.68  ? 1148 HOH A O   1 
HETATM 1299 O  O   . HOH H 4 .   ? 5.913  74.210 58.987 1.00 59.69  ? 1149 HOH A O   1 
HETATM 1300 O  O   . HOH H 4 .   ? 34.585 38.753 57.726 1.00 37.56  ? 1150 HOH A O   1 
HETATM 1301 O  O   . HOH H 4 .   ? 1.528  62.846 54.691 1.00 41.29  ? 1151 HOH A O   1 
HETATM 1302 O  O   . HOH H 4 .   ? 12.659 41.195 58.867 0.50 23.92  ? 1152 HOH A O   1 
HETATM 1303 O  O   . HOH H 4 .   ? 28.596 31.072 66.115 1.00 45.01  ? 1153 HOH A O   1 
HETATM 1304 O  O   . HOH H 4 .   ? 30.706 44.375 40.167 1.00 38.82  ? 1154 HOH A O   1 
HETATM 1305 O  O   . HOH H 4 .   ? 11.187 50.174 56.956 1.00 46.60  ? 1155 HOH A O   1 
HETATM 1306 O  O   . HOH H 4 .   ? 16.009 73.950 45.179 1.00 37.63  ? 1156 HOH A O   1 
HETATM 1307 O  O   . HOH H 4 .   ? 27.344 66.501 46.956 1.00 43.50  ? 1157 HOH A O   1 
HETATM 1308 O  O   . HOH H 4 .   ? 12.949 55.011 64.017 1.00 40.99  ? 1158 HOH A O   1 
HETATM 1309 O  O   . HOH H 4 .   ? 24.052 48.491 42.047 1.00 45.78  ? 1159 HOH A O   1 
HETATM 1310 O  O   . HOH H 4 .   ? 5.363  62.234 41.108 1.00 52.97  ? 1160 HOH A O   1 
HETATM 1311 O  O   . HOH H 4 .   ? 9.685  60.328 42.251 1.00 41.86  ? 1161 HOH A O   1 
HETATM 1312 O  O   . HOH H 4 .   ? 30.624 42.918 46.620 1.00 44.54  ? 1162 HOH A O   1 
HETATM 1313 O  O   . HOH H 4 .   ? 12.381 49.083 60.701 1.00 43.32  ? 1163 HOH A O   1 
HETATM 1314 O  O   . HOH H 4 .   ? 26.267 55.745 45.686 1.00 47.66  ? 1164 HOH A O   1 
HETATM 1315 O  O   . HOH H 4 .   ? 23.672 32.811 70.002 1.00 38.60  ? 1165 HOH A O   1 
HETATM 1316 O  O   . HOH H 4 .   ? 36.184 54.130 56.619 0.50 37.65  ? 1166 HOH A O   1 
HETATM 1317 O  O   . HOH H 4 .   ? 32.861 31.004 56.762 1.00 65.58  ? 1167 HOH A O   1 
HETATM 1318 O  O   . HOH H 4 .   ? 3.991  61.377 44.888 1.00 53.54  ? 1168 HOH A O   1 
HETATM 1319 O  O   . HOH H 4 .   ? 33.831 49.720 47.910 1.00 34.40  ? 1169 HOH A O   1 
HETATM 1320 O  O   . HOH H 4 .   ? 36.056 59.796 53.037 0.50 39.35  ? 1170 HOH A O   1 
HETATM 1321 O  O   . HOH H 4 .   ? 18.016 64.217 65.483 1.00 33.11  ? 1171 HOH A O   1 
HETATM 1322 O  O   . HOH H 4 .   ? 24.952 62.847 64.514 1.00 43.98  ? 1172 HOH A O   1 
HETATM 1323 O  O   . HOH H 4 .   ? 30.344 60.767 62.223 1.00 38.30  ? 1173 HOH A O   1 
HETATM 1324 O  O   . HOH H 4 .   ? 3.118  71.473 56.586 1.00 32.01  ? 1174 HOH A O   1 
HETATM 1325 O  O   . HOH H 4 .   ? 11.534 51.837 61.700 1.00 38.02  ? 1175 HOH A O   1 
HETATM 1326 O  O   . HOH H 4 .   ? 26.103 68.220 55.460 1.00 36.17  ? 1176 HOH A O   1 
HETATM 1327 O  O   . HOH H 4 .   ? 12.275 58.260 63.637 1.00 45.15  ? 1177 HOH A O   1 
HETATM 1328 O  O   . HOH H 4 .   ? 1.071  74.889 58.069 0.50 50.57  ? 1178 HOH A O   1 
HETATM 1329 O  O   . HOH H 4 .   ? 15.435 35.434 66.273 1.00 48.31  ? 1179 HOH A O   1 
HETATM 1330 O  O   . HOH H 4 .   ? 9.763  55.624 58.441 1.00 46.14  ? 1180 HOH A O   1 
HETATM 1331 O  O   . HOH H 4 .   ? 17.057 72.025 61.583 1.00 44.43  ? 1181 HOH A O   1 
HETATM 1332 O  O   . HOH H 4 .   ? 16.337 73.806 47.955 1.00 40.33  ? 1182 HOH A O   1 
HETATM 1333 O  O   . HOH H 4 .   ? 32.278 58.603 62.417 1.00 41.08  ? 1183 HOH A O   1 
HETATM 1334 O  O   . HOH H 4 .   ? 31.219 60.994 49.390 1.00 34.07  ? 1184 HOH A O   1 
HETATM 1335 O  O   . HOH H 4 .   ? 13.842 58.406 38.879 1.00 35.20  ? 1185 HOH A O   1 
HETATM 1336 O  O   . HOH H 4 .   ? 23.878 70.199 55.577 1.00 45.87  ? 1186 HOH A O   1 
HETATM 1337 O  O   . HOH H 4 .   ? 29.250 47.058 40.717 1.00 48.98  ? 1187 HOH A O   1 
HETATM 1338 O  O   . HOH H 4 .   ? 30.781 37.628 42.329 1.00 44.90  ? 1188 HOH A O   1 
HETATM 1339 O  O   . HOH H 4 .   ? 0.964  62.464 48.209 0.50 45.08  ? 1189 HOH A O   1 
HETATM 1340 O  O   . HOH H 4 .   ? 18.880 68.645 62.717 1.00 47.54  ? 1190 HOH A O   1 
HETATM 1341 O  O   . HOH H 4 .   ? 20.867 59.246 66.653 1.00 47.47  ? 1191 HOH A O   1 
HETATM 1342 O  O   . HOH H 4 .   ? 13.631 52.907 65.244 1.00 48.11  ? 1192 HOH A O   1 
HETATM 1343 O  O   . HOH H 4 .   ? 16.985 37.248 54.261 1.00 37.22  ? 1193 HOH A O   1 
HETATM 1344 O  O   . HOH H 4 .   ? 28.215 48.736 43.777 1.00 49.70  ? 1194 HOH A O   1 
HETATM 1345 O  O   . HOH H 4 .   ? 9.905  57.177 43.828 1.00 41.91  ? 1195 HOH A O   1 
HETATM 1346 O  O   . HOH H 4 .   ? 15.755 42.445 74.364 0.50 25.95  ? 1196 HOH A O   1 
HETATM 1347 O  O   . HOH H 4 .   ? 24.757 51.170 41.578 1.00 54.09  ? 1197 HOH A O   1 
HETATM 1348 O  O   . HOH H 4 .   ? 20.373 72.179 44.757 0.50 40.11  ? 1198 HOH A O   1 
HETATM 1349 O  O   . HOH H 4 .   ? 29.114 30.993 55.032 0.50 33.18  ? 1199 HOH A O   1 
HETATM 1350 O  O   . HOH H 4 .   ? 11.610 49.954 52.820 1.00 50.02  ? 1200 HOH A O   1 
HETATM 1351 O  O   . HOH H 4 .   ? 13.659 46.515 69.567 1.00 49.23  ? 1201 HOH A O   1 
HETATM 1352 O  O   . HOH H 4 .   ? 22.194 70.048 42.748 0.50 35.52  ? 1202 HOH A O   1 
HETATM 1353 O  O   . HOH H 4 .   ? 31.063 37.216 45.169 0.50 25.62  ? 1203 HOH A O   1 
HETATM 1354 O  O   . HOH H 4 .   ? 26.433 65.040 40.471 1.00 55.20  ? 1204 HOH A O   1 
HETATM 1355 O  O   . HOH H 4 .   ? 23.009 66.607 61.732 1.00 63.43  ? 1205 HOH A O   1 
HETATM 1356 O  O   . HOH H 4 .   ? 23.571 26.606 63.411 1.00 51.68  ? 1206 HOH A O   1 
HETATM 1357 O  O   . HOH H 4 .   ? 35.939 44.545 57.213 1.00 30.98  ? 1207 HOH A O   1 
HETATM 1358 O  O   . HOH H 4 .   ? 18.445 71.368 59.425 1.00 46.06  ? 1208 HOH A O   1 
HETATM 1359 O  O   . HOH H 4 .   ? 7.792  51.847 51.633 0.50 32.23  ? 1209 HOH A O   1 
HETATM 1360 O  O   . HOH H 4 .   ? 29.200 54.682 66.987 1.00 52.33  ? 1210 HOH A O   1 
HETATM 1361 O  O   . HOH H 4 .   ? 12.105 47.035 48.242 1.00 54.82  ? 1211 HOH A O   1 
HETATM 1362 O  O   . HOH H 4 .   ? 14.013 41.428 52.851 1.00 44.29  ? 1212 HOH A O   1 
HETATM 1363 O  O   . HOH H 4 .   ? 32.397 54.972 63.100 1.00 45.77  ? 1213 HOH A O   1 
HETATM 1364 O  O   . HOH H 4 .   ? 8.132  63.304 66.628 1.00 41.06  ? 1214 HOH A O   1 
HETATM 1365 O  O   . HOH H 4 .   ? 17.178 37.242 72.333 1.00 56.83  ? 1215 HOH A O   1 
HETATM 1366 O  O   . HOH H 4 .   ? 20.324 70.317 58.731 1.00 43.26  ? 1216 HOH A O   1 
HETATM 1367 O  O   . HOH H 4 .   ? 32.026 51.772 46.532 1.00 45.51  ? 1217 HOH A O   1 
HETATM 1368 O  O   . HOH H 4 .   ? 11.619 43.236 56.087 1.00 50.64  ? 1218 HOH A O   1 
HETATM 1369 O  O   . HOH H 4 .   ? 20.822 70.231 40.765 1.00 39.76  ? 1219 HOH A O   1 
HETATM 1370 O  O   . HOH H 4 .   ? 24.651 60.370 69.678 0.50 32.65  ? 1220 HOH A O   1 
HETATM 1371 O  O   . HOH H 4 .   ? 29.359 28.853 58.886 0.50 33.19  ? 1221 HOH A O   1 
HETATM 1372 O  O   . HOH H 4 .   ? 13.016 45.115 66.855 1.00 62.22  ? 1222 HOH A O   1 
HETATM 1373 O  O   . HOH H 4 .   ? 30.069 68.277 52.280 0.50 32.96  ? 1223 HOH A O   1 
HETATM 1374 O  O   . HOH H 4 .   ? 27.082 53.880 44.618 1.00 55.32  ? 1224 HOH A O   1 
HETATM 1375 O  O   . HOH H 4 .   ? 34.141 58.154 61.150 0.50 45.03  ? 1225 HOH A O   1 
HETATM 1376 O  O   . HOH H 4 .   ? 19.731 65.806 35.909 1.00 47.70  ? 1226 HOH A O   1 
HETATM 1377 O  O   . HOH H 4 .   ? 14.784 44.788 72.385 1.00 41.43  ? 1227 HOH A O   1 
HETATM 1378 O  O   . HOH H 4 .   ? 22.363 65.037 63.552 1.00 49.37  ? 1228 HOH A O   1 
HETATM 1379 O  O   . HOH H 4 .   ? -2.179 63.163 47.791 1.00 54.03  ? 1229 HOH A O   1 
HETATM 1380 O  O   . HOH H 4 .   ? 34.985 61.806 51.568 0.50 30.27  ? 1230 HOH A O   1 
HETATM 1381 O  O   . HOH H 4 .   ? 9.422  62.698 40.258 1.00 46.91  ? 1231 HOH A O   1 
HETATM 1382 O  O   . HOH H 4 .   ? 36.766 52.819 50.147 1.00 57.37  ? 1232 HOH A O   1 
HETATM 1383 O  O   . HOH H 4 .   ? 27.079 58.477 68.902 0.50 50.73  ? 1233 HOH A O   1 
HETATM 1384 O  O   . HOH H 4 .   ? 31.558 56.922 66.494 0.50 41.57  ? 1234 HOH A O   1 
HETATM 1385 O  O   . HOH H 4 .   ? -1.607 71.803 54.754 0.50 43.72  ? 1235 HOH A O   1 
HETATM 1386 O  O   . HOH H 4 .   ? 15.624 38.365 63.126 1.00 59.41  ? 1236 HOH A O   1 
HETATM 1387 O  O   . HOH H 4 .   ? 19.024 27.905 64.846 0.50 32.71  ? 1237 HOH A O   1 
HETATM 1388 O  O   . HOH H 4 .   ? 7.117  56.691 56.657 1.00 42.50  ? 1238 HOH A O   1 
HETATM 1389 O  O   . HOH H 4 .   ? 3.892  57.493 57.622 0.50 31.30  ? 1239 HOH A O   1 
HETATM 1390 O  O   . HOH H 4 .   ? 20.536 67.857 39.402 1.00 51.57  ? 1240 HOH A O   1 
HETATM 1391 O  O   . HOH H 4 .   ? 25.577 69.190 53.243 0.50 33.31  ? 1241 HOH A O   1 
HETATM 1392 O  O   . HOH H 4 .   ? 23.025 27.619 66.288 1.00 54.50  ? 1242 HOH A O   1 
HETATM 1393 O  O   . HOH H 4 .   ? 13.463 49.453 41.674 1.00 45.17  ? 1243 HOH A O   1 
HETATM 1394 O  O   . HOH H 4 .   ? 35.871 49.465 46.831 0.50 28.57  ? 1244 HOH A O   1 
HETATM 1395 O  O   . HOH H 4 .   ? 19.460 69.858 60.793 0.50 31.41  ? 1245 HOH A O   1 
HETATM 1396 O  O   . HOH H 4 .   ? 1.103  60.531 52.173 0.50 48.31  ? 1246 HOH A O   1 
HETATM 1397 O  O   . HOH H 4 .   ? 18.126 58.385 37.833 1.00 48.66  ? 1247 HOH A O   1 
HETATM 1398 O  O   . HOH H 4 .   ? 5.113  56.785 52.939 1.00 53.38  ? 1248 HOH A O   1 
HETATM 1399 O  O   . HOH H 4 .   ? 12.541 52.556 67.538 0.50 36.84  ? 1249 HOH A O   1 
HETATM 1400 O  O   . HOH H 4 .   ? 36.965 49.311 51.430 1.00 51.05  ? 1250 HOH A O   1 
HETATM 1401 O  O   . HOH H 4 .   ? 35.462 39.970 49.594 1.00 39.80  ? 1251 HOH A O   1 
HETATM 1402 O  O   . HOH H 4 .   ? 18.487 60.600 67.748 0.50 45.62  ? 1252 HOH A O   1 
HETATM 1403 O  O   . HOH H 4 .   ? 6.732  51.536 46.857 0.50 39.02  ? 1253 HOH A O   1 
HETATM 1404 O  O   . HOH H 4 .   ? 22.741 59.416 37.713 0.50 33.22  ? 1254 HOH A O   1 
HETATM 1405 O  O   . HOH H 4 .   ? 12.558 42.202 65.114 0.50 38.96  ? 1255 HOH A O   1 
HETATM 1406 O  O   . HOH H 4 .   ? 13.640 45.545 63.823 1.00 50.46  ? 1256 HOH A O   1 
HETATM 1407 O  O   . HOH H 4 .   ? 32.730 35.163 52.355 0.50 37.78  ? 1257 HOH A O   1 
HETATM 1408 O  O   . HOH H 4 .   ? 25.799 69.921 50.691 1.00 53.83  ? 1258 HOH A O   1 
HETATM 1409 O  O   . HOH H 4 .   ? 22.363 67.598 37.326 0.50 38.38  ? 1259 HOH A O   1 
HETATM 1410 O  O   . HOH H 4 .   ? 24.454 59.608 39.894 1.00 48.92  ? 1260 HOH A O   1 
HETATM 1411 O  O   . HOH H 4 .   ? 32.394 62.808 61.323 0.50 37.56  ? 1261 HOH A O   1 
HETATM 1412 O  O   . HOH H 4 .   ? 26.239 25.014 62.123 0.50 38.05  ? 1262 HOH A O   1 
HETATM 1413 O  O   . HOH H 4 .   ? 12.164 33.983 59.500 0.50 33.94  ? 1263 HOH A O   1 
HETATM 1414 O  O   . HOH H 4 .   ? 15.776 74.276 59.040 1.00 59.59  ? 1264 HOH A O   1 
HETATM 1415 O  O   . HOH H 4 .   ? 12.625 62.373 40.832 1.00 48.63  ? 1265 HOH A O   1 
HETATM 1416 O  O   . HOH H 4 .   ? 15.629 54.381 37.042 0.50 37.54  ? 1266 HOH A O   1 
HETATM 1417 O  O   . HOH H 4 .   ? 9.490  48.497 48.558 0.50 38.08  ? 1267 HOH A O   1 
HETATM 1418 O  O   . HOH H 4 .   ? 20.883 32.165 73.439 0.50 37.41  ? 1268 HOH A O   1 
HETATM 1419 O  O   . HOH H 4 .   ? -0.039 76.721 54.949 0.50 35.15  ? 1269 HOH A O   1 
HETATM 1420 O  O   . HOH H 4 .   ? 36.677 56.783 51.308 0.50 44.04  ? 1270 HOH A O   1 
HETATM 1421 O  O   . HOH H 4 .   ? 37.580 41.803 54.252 0.50 35.36  ? 1271 HOH A O   1 
HETATM 1422 O  O   . HOH H 4 .   ? 4.180  57.491 50.029 1.00 43.15  ? 1272 HOH A O   1 
HETATM 1423 O  O   . HOH H 4 .   ? 12.122 52.207 59.512 1.00 49.80  ? 1273 HOH A O   1 
HETATM 1424 O  O   . HOH H 4 .   ? 29.323 49.276 63.342 1.00 36.98  ? 1274 HOH A O   1 
HETATM 1425 O  O   . HOH H 4 .   ? 18.080 60.741 64.503 1.00 37.77  ? 1275 HOH A O   1 
HETATM 1426 O  O   . HOH H 4 .   ? 7.524  53.384 44.346 0.50 43.76  ? 1276 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N   . ASN A 3   ? 0.4763 0.4300 0.6031 0.1468  0.3131  -0.1892 3    ASN A N   
2    C  CA  . ASN A 3   ? 0.3924 0.4380 0.3610 0.1580  0.1257  -0.1635 3    ASN A CA  
3    C  C   . ASN A 3   ? 0.2901 0.3071 0.2024 0.0922  0.0154  -0.1283 3    ASN A C   
4    O  O   . ASN A 3   ? 0.2938 0.3583 0.0952 -0.0264 0.0438  -0.0276 3    ASN A O   
5    C  CB  . ASN A 3   ? 0.4644 0.7923 0.6229 0.0198  0.3357  0.1314  3    ASN A CB  
6    C  CG  . ASN A 3   ? 1.3661 0.9322 0.6621 -0.3891 0.2272  0.1588  3    ASN A CG  
7    O  OD1 . ASN A 3   ? 2.9122 1.4353 0.9419 -1.2902 0.1055  0.4955  3    ASN A OD1 
8    N  ND2 . ASN A 3   ? 1.5231 1.2270 0.7572 -0.3716 0.9621  -0.3319 3    ASN A ND2 
9    N  N   . ILE A 4   ? 0.1845 0.2194 0.1464 -0.0169 0.0449  -0.0362 4    ILE A N   
10   C  CA  . ILE A 4   ? 0.1497 0.1427 0.1243 0.0156  0.0053  0.0051  4    ILE A CA  
11   C  C   . ILE A 4   ? 0.1553 0.1428 0.1328 0.0099  -0.0132 0.0067  4    ILE A C   
12   O  O   . ILE A 4   ? 0.1533 0.2011 0.1318 0.0064  -0.0129 -0.0211 4    ILE A O   
13   C  CB  . ILE A 4   ? 0.1529 0.1524 0.1238 -0.0035 -0.0063 0.0030  4    ILE A CB  
14   C  CG1 . ILE A 4   ? 0.1943 0.1361 0.1988 0.0195  0.0077  0.0102  4    ILE A CG1 
15   C  CG2 . ILE A 4   ? 0.1503 0.1844 0.1038 -0.0107 -0.0124 -0.0017 4    ILE A CG2 
16   C  CD1 . ILE A 4   ? 0.2985 0.1649 0.2030 -0.0058 0.0377  0.0224  4    ILE A CD1 
17   N  N   . THR A 5   ? 0.1503 0.1632 0.0921 0.0095  -0.0041 -0.0306 5    THR A N   
18   C  CA  . THR A 5   ? 0.1775 0.1553 0.0964 0.0043  0.0209  -0.0201 5    THR A CA  
19   C  C   . THR A 5   ? 0.1627 0.1473 0.0850 -0.0211 0.0130  -0.0265 5    THR A C   
20   O  O   . THR A 5   ? 0.1674 0.1586 0.1099 -0.0227 -0.0123 -0.0329 5    THR A O   
21   C  CB  . THR A 5   ? 0.2361 0.1626 0.0908 -0.0144 0.0290  -0.0109 5    THR A CB  
22   O  OG1 . THR A 5   ? 0.3012 0.2906 0.1372 0.0050  0.0903  0.0146  5    THR A OG1 
23   C  CG2 . THR A 5   ? 0.3378 0.1590 0.1613 0.0113  0.0028  -0.0159 5    THR A CG2 
24   N  N   . ILE A 6   ? 0.1229 0.1609 0.0917 0.0001  -0.0018 -0.0235 6    ILE A N   
25   C  CA  . ILE A 6   ? 0.1495 0.1345 0.0807 0.0418  0.0113  -0.0011 6    ILE A CA  
26   C  C   . ILE A 6   ? 0.1256 0.1324 0.0891 0.0119  0.0065  0.0094  6    ILE A C   
27   O  O   . ILE A 6   ? 0.1218 0.1732 0.1298 0.0105  -0.0127 0.0047  6    ILE A O   
28   C  CB  . ILE A 6   ? 0.1222 0.1256 0.0987 0.0436  -0.0073 0.0032  6    ILE A CB  
29   C  CG1 . ILE A 6   ? 0.1349 0.1070 0.0998 -0.0084 0.0134  0.0129  6    ILE A CG1 
30   C  CG2 . ILE A 6   ? 0.1289 0.1302 0.1335 0.0281  -0.0142 0.0096  6    ILE A CG2 
31   C  CD1 . ILE A 6   ? 0.1918 0.1338 0.0905 -0.0130 -0.0256 0.0241  6    ILE A CD1 
32   N  N   . TYR A 7   ? 0.1281 0.1328 0.0830 0.0253  -0.0164 -0.0295 7    TYR A N   
33   C  CA  . TYR A 7   ? 0.1374 0.1064 0.0804 -0.0038 -0.0162 -0.0063 7    TYR A CA  
34   C  C   . TYR A 7   ? 0.1157 0.1403 0.0739 0.0024  -0.0093 -0.0250 7    TYR A C   
35   O  O   . TYR A 7   ? 0.1216 0.1609 0.1160 -0.0032 0.0022  -0.0063 7    TYR A O   
36   C  CB  . TYR A 7   ? 0.1515 0.1129 0.0932 0.0109  -0.0049 0.0110  7    TYR A CB  
37   C  CG  . TYR A 7   ? 0.1536 0.1310 0.0838 0.0130  -0.0020 0.0044  7    TYR A CG  
38   C  CD1 . TYR A 7   ? 0.1845 0.1562 0.0748 -0.0138 -0.0343 0.0102  7    TYR A CD1 
39   C  CD2 . TYR A 7   ? 0.2193 0.1334 0.0794 -0.0007 -0.0377 0.0289  7    TYR A CD2 
40   C  CE1 . TYR A 7   ? 0.1980 0.1522 0.0903 0.0070  0.0105  0.0046  7    TYR A CE1 
41   C  CE2 . TYR A 7   ? 0.2416 0.1733 0.0980 -0.0356 -0.0012 0.0161  7    TYR A CE2 
42   C  CZ  . TYR A 7   ? 0.1705 0.2048 0.0882 -0.0425 -0.0164 0.0132  7    TYR A CZ  
43   O  OH  . TYR A 7   ? 0.2390 0.2153 0.1003 -0.0218 0.0152  0.0273  7    TYR A OH  
44   N  N   . HIS A 8   ? 0.1508 0.1129 0.0780 -0.0089 -0.0269 -0.0256 8    HIS A N   
45   C  CA  . HIS A 8   ? 0.1403 0.1433 0.0775 0.0023  -0.0192 -0.0125 8    HIS A CA  
46   C  C   . HIS A 8   ? 0.1766 0.1364 0.0562 -0.0093 -0.0375 -0.0123 8    HIS A C   
47   O  O   . HIS A 8   ? 0.1903 0.1345 0.0964 -0.0107 -0.0166 0.0085  8    HIS A O   
48   C  CB  . HIS A 8   ? 0.1407 0.1423 0.1092 -0.0097 -0.0158 0.0151  8    HIS A CB  
49   C  CG  . HIS A 8   ? 0.1767 0.1104 0.1155 0.0004  -0.0310 0.0108  8    HIS A CG  
50   N  ND1 . HIS A 8   ? 0.2204 0.1575 0.0991 -0.0389 -0.0401 0.0171  8    HIS A ND1 
51   C  CD2 . HIS A 8   ? 0.1905 0.2363 0.0821 -0.0417 -0.0172 0.0117  8    HIS A CD2 
52   C  CE1 . HIS A 8   ? 0.1929 0.2047 0.0995 -0.0252 -0.0202 0.0205  8    HIS A CE1 
53   N  NE2 . HIS A 8   ? 0.1768 0.1906 0.1210 -0.0068 -0.0339 0.0266  8    HIS A NE2 
54   N  N   . ASN A 9   ? 0.1980 0.1219 0.0870 0.0026  -0.0039 -0.0021 9    ASN A N   
55   C  CA  . ASN A 9   ? 0.1579 0.1474 0.0644 -0.0261 -0.0122 -0.0148 9    ASN A CA  
56   C  C   . ASN A 9   ? 0.1725 0.1124 0.0872 0.0042  -0.0052 -0.0175 9    ASN A C   
57   O  O   . ASN A 9   ? 0.1810 0.1224 0.0934 -0.0057 -0.0217 -0.0124 9    ASN A O   
58   C  CB  . ASN A 9   ? 0.1649 0.1631 0.1057 0.0008  -0.0317 -0.0352 9    ASN A CB  
59   C  CG  . ASN A 9   ? 0.1847 0.1347 0.1526 -0.0021 -0.0173 -0.0408 9    ASN A CG  
60   O  OD1 . ASN A 9   ? 0.2019 0.2432 0.2365 0.0493  -0.0007 -0.0658 9    ASN A OD1 
61   N  ND2 . ASN A 9   ? 0.2110 0.1008 0.1135 0.0194  -0.0167 -0.0357 9    ASN A ND2 
62   N  N   . PRO A 10  ? 0.1922 0.1044 0.1153 -0.0005 -0.0298 0.0052  10   PRO A N   
63   C  CA  . PRO A 10  ? 0.2108 0.1596 0.1017 0.0076  -0.0313 0.0059  10   PRO A CA  
64   C  C   . PRO A 10  ? 0.2306 0.1430 0.1123 0.0028  -0.0163 -0.0021 10   PRO A C   
65   O  O   . PRO A 10  ? 0.2498 0.1377 0.1308 -0.0112 -0.0100 0.0151  10   PRO A O   
66   C  CB  . PRO A 10  ? 0.1982 0.2389 0.1555 -0.0016 -0.0534 0.0232  10   PRO A CB  
67   C  CG  . PRO A 10  ? 0.1985 0.2517 0.2044 -0.0234 -0.0391 0.0563  10   PRO A CG  
68   C  CD  . PRO A 10  ? 0.1856 0.1688 0.1459 -0.0240 -0.0256 0.0181  10   PRO A CD  
69   N  N   . ALA A 11  ? 0.2402 0.1082 0.0972 -0.0212 -0.0156 -0.0145 11   ALA A N   
70   C  CA  . ALA A 11  ? 0.2490 0.1422 0.1091 -0.0021 -0.0179 -0.0334 11   ALA A CA  
71   C  C   . ALA A 11  ? 0.2680 0.1687 0.0978 -0.0427 0.0241  -0.0522 11   ALA A C   
72   O  O   . ALA A 11  ? 0.3511 0.3084 0.1695 -0.1383 0.1206  -0.1367 11   ALA A O   
73   C  CB  . ALA A 11  ? 0.2563 0.1351 0.1480 -0.0219 0.0367  -0.0222 11   ALA A CB  
74   N  N   . SER A 12  ? 0.2218 0.1340 0.0881 0.0200  -0.0264 -0.0322 12   SER A N   
75   C  CA  . SER A 12  ? 0.2181 0.1161 0.0910 0.0233  -0.0374 -0.0111 12   SER A CA  
76   C  C   . SER A 12  ? 0.1768 0.1215 0.0661 0.0324  -0.0009 -0.0059 12   SER A C   
77   O  O   . SER A 12  ? 0.1799 0.1403 0.0655 0.0334  -0.0037 -0.0121 12   SER A O   
78   C  CB  . SER A 12  ? 0.2140 0.1054 0.0918 0.0435  -0.0405 -0.0176 12   SER A CB  
79   O  OG  . SER A 12  ? 0.1784 0.1730 0.0809 0.0069  -0.0146 -0.0141 12   SER A OG  
80   N  N   . GLY A 13  ? 0.1738 0.1354 0.0703 -0.0079 -0.0107 -0.0274 13   GLY A N   
81   C  CA  . GLY A 13  ? 0.2025 0.1360 0.0860 -0.0486 -0.0117 -0.0179 13   GLY A CA  
82   C  C   . GLY A 13  ? 0.1878 0.1132 0.0757 0.0121  -0.0256 -0.0101 13   GLY A C   
83   O  O   . GLY A 13  ? 0.1814 0.1367 0.1128 0.0234  -0.0205 -0.0167 13   GLY A O   
84   N  N   . THR A 14  ? 0.1670 0.1018 0.0588 0.0036  -0.0027 0.0017  14   THR A N   
85   C  CA  . THR A 14  ? 0.1476 0.1237 0.0578 0.0260  -0.0090 -0.0020 14   THR A CA  
86   C  C   . THR A 14  ? 0.1338 0.1200 0.0711 0.0106  -0.0138 -0.0253 14   THR A C   
87   O  O   . THR A 14  ? 0.1520 0.1078 0.0761 0.0012  -0.0027 -0.0259 14   THR A O   
88   C  CB  . THR A 14  ? 0.1334 0.1480 0.1155 0.0158  -0.0242 -0.0296 14   THR A CB  
89   O  OG1 . THR A 14  ? 0.1495 0.2001 0.1256 0.0449  -0.0086 -0.0243 14   THR A OG1 
90   C  CG2 . THR A 14  ? 0.1412 0.1247 0.1105 -0.0037 -0.0345 -0.0221 14   THR A CG2 
91   N  N   . SER A 15  ? 0.1440 0.0964 0.0687 0.0323  -0.0103 -0.0187 15   SER A N   
92   C  CA  . SER A 15  ? 0.1394 0.1123 0.0517 0.0005  -0.0275 -0.0277 15   SER A CA  
93   C  C   . SER A 15  ? 0.1333 0.1800 0.0535 0.0235  -0.0080 0.0036  15   SER A C   
94   O  O   . SER A 15  ? 0.1336 0.1343 0.0686 0.0048  -0.0166 -0.0113 15   SER A O   
95   C  CB  . SER A 15  ? 0.1773 0.1141 0.0801 -0.0004 0.0103  -0.0530 15   SER A CB  
96   O  OG  . SER A 15  ? 0.1825 0.1449 0.0830 0.0121  0.0077  0.0056  15   SER A OG  
97   N  N   . ARG A 16  ? 0.1777 0.1230 0.0606 0.0234  -0.0243 0.0018  16   ARG A N   
98   C  CA  . ARG A 16  ? 0.1728 0.1129 0.0713 0.0041  -0.0297 0.0147  16   ARG A CA  
99   C  C   . ARG A 16  ? 0.1227 0.1199 0.0719 0.0062  -0.0384 0.0111  16   ARG A C   
100  O  O   . ARG A 16  ? 0.1248 0.1245 0.1136 0.0030  -0.0185 0.0036  16   ARG A O   
101  C  CB  . ARG A 16  ? 0.1838 0.1110 0.0735 0.0229  -0.0334 0.0125  16   ARG A CB  
102  C  CG  . ARG A 16  ? 0.1567 0.1479 0.0795 0.0003  -0.0156 -0.0145 16   ARG A CG  
103  C  CD  . ARG A 16  ? 0.1776 0.1822 0.0859 -0.0174 -0.0309 -0.0073 16   ARG A CD  
104  N  NE  . ARG A 16  ? 0.1981 0.1624 0.0806 -0.0042 -0.0173 -0.0004 16   ARG A NE  
105  C  CZ  . ARG A 16  ? 0.1901 0.1613 0.0719 -0.0080 -0.0305 -0.0081 16   ARG A CZ  
106  N  NH1 . ARG A 16  ? 0.2386 0.1707 0.0823 0.0156  -0.0275 0.0030  16   ARG A NH1 
107  N  NH2 . ARG A 16  ? 0.1831 0.2086 0.1000 -0.0170 -0.0203 -0.0123 16   ARG A NH2 
108  N  N   . ASN A 17  ? 0.1220 0.1277 0.0641 0.0087  -0.0287 -0.0114 17   ASN A N   
109  C  CA  . ASN A 17  ? 0.1203 0.1194 0.0501 0.0067  -0.0173 0.0057  17   ASN A CA  
110  C  C   . ASN A 17  ? 0.1088 0.1168 0.0587 0.0136  -0.0147 -0.0013 17   ASN A C   
111  O  O   . ASN A 17  ? 0.1288 0.1362 0.0860 0.0346  0.0016  -0.0042 17   ASN A O   
112  C  CB  . ASN A 17  ? 0.1446 0.1605 0.0641 -0.0184 0.0019  -0.0169 17   ASN A CB  
113  C  CG  . ASN A 17  ? 0.1463 0.1362 0.0712 -0.0121 0.0048  -0.0024 17   ASN A CG  
114  O  OD1 . ASN A 17  ? 0.1629 0.1232 0.0741 0.0062  -0.0059 -0.0107 17   ASN A OD1 
115  N  ND2 . ASN A 17  ? 0.1660 0.1391 0.0713 0.0176  0.0132  0.0075  17   ASN A ND2 
116  N  N   . THR A 18  ? 0.1660 0.1384 0.0479 0.0293  -0.0128 0.0040  18   THR A N   
117  C  CA  . THR A 18  ? 0.1275 0.1410 0.0552 0.0005  -0.0095 0.0145  18   THR A CA  
118  C  C   . THR A 18  ? 0.1317 0.1008 0.0581 0.0094  -0.0192 0.0061  18   THR A C   
119  O  O   . THR A 18  ? 0.1555 0.1234 0.0696 0.0179  -0.0171 -0.0191 18   THR A O   
120  C  CB  . THR A 18  ? 0.1344 0.1380 0.0600 0.0187  -0.0020 0.0144  18   THR A CB  
121  O  OG1 . THR A 18  ? 0.1393 0.1460 0.0797 0.0226  0.0002  0.0157  18   THR A OG1 
122  C  CG2 . THR A 18  ? 0.1390 0.1600 0.0517 -0.0172 -0.0139 0.0174  18   THR A CG2 
123  N  N   . LEU A 19  ? 0.1355 0.1122 0.0746 -0.0034 -0.0272 0.0025  19   LEU A N   
124  C  CA  . LEU A 19  ? 0.1403 0.1225 0.0976 -0.0087 -0.0193 -0.0040 19   LEU A CA  
125  C  C   . LEU A 19  ? 0.1225 0.1216 0.0770 -0.0057 -0.0046 -0.0102 19   LEU A C   
126  O  O   . LEU A 19  ? 0.1543 0.1419 0.0774 0.0013  0.0071  -0.0194 19   LEU A O   
127  C  CB  . LEU A 19  ? 0.1386 0.1272 0.0859 -0.0102 -0.0221 -0.0106 19   LEU A CB  
128  C  CG  . LEU A 19  ? 0.1358 0.1313 0.1210 -0.0047 -0.0057 -0.0297 19   LEU A CG  
129  C  CD1 . LEU A 19  ? 0.1608 0.1559 0.1276 0.0230  0.0059  0.0113  19   LEU A CD1 
130  C  CD2 . LEU A 19  ? 0.1558 0.1276 0.1751 -0.0131 -0.0550 -0.0166 19   LEU A CD2 
131  N  N   . GLU A 20  ? 0.1396 0.1218 0.0773 0.0131  0.0021  -0.0088 20   GLU A N   
132  C  CA  . GLU A 20  ? 0.1630 0.1252 0.0903 0.0149  -0.0145 -0.0060 20   GLU A CA  
133  C  C   . GLU A 20  ? 0.1322 0.1130 0.0998 0.0077  -0.0051 0.0030  20   GLU A C   
134  O  O   . GLU A 20  ? 0.1413 0.1303 0.0773 0.0267  -0.0317 -0.0084 20   GLU A O   
135  C  CB  . GLU A 20  ? 0.2180 0.1109 0.0984 0.0095  -0.0116 -0.0002 20   GLU A CB  
136  C  CG  . GLU A 20  ? 0.1565 0.1241 0.0890 0.0367  -0.0199 -0.0055 20   GLU A CG  
137  C  CD  . GLU A 20  ? 0.1525 0.2376 0.0912 0.0331  -0.0427 -0.0083 20   GLU A CD  
138  O  OE1 . GLU A 20  ? 0.1613 0.3417 0.1108 -0.0286 -0.0201 -0.0310 20   GLU A OE1 
139  O  OE2 . GLU A 20  ? 0.2099 0.2602 0.1074 0.0114  -0.0690 -0.0112 20   GLU A OE2 
140  N  N   . MET A 21  ? 0.1450 0.1113 0.1035 0.0396  -0.0134 -0.0208 21   MET A N   
141  C  CA  . MET A 21  ? 0.1400 0.1043 0.0857 0.0230  -0.0225 0.0077  21   MET A CA  
142  C  C   . MET A 21  ? 0.1334 0.1099 0.0775 0.0126  -0.0270 -0.0023 21   MET A C   
143  O  O   . MET A 21  ? 0.1589 0.1207 0.1003 0.0054  -0.0149 -0.0189 21   MET A O   
144  C  CB  . MET A 21  ? 0.1387 0.1152 0.1320 0.0386  -0.0142 0.0014  21   MET A CB  
145  C  CG  . MET A 21  ? 0.1586 0.3662 0.1102 -0.0380 -0.0224 0.0575  21   MET A CG  
146  S  SD  . MET A 21  ? 0.1534 0.2503 0.1927 -0.0037 -0.0175 -0.0127 21   MET A SD  
147  C  CE  . MET A 21  ? 0.2484 0.1963 0.2721 0.0013  -0.1655 -0.0402 21   MET A CE  
148  N  N   . ILE A 22  ? 0.1185 0.1195 0.0940 0.0181  -0.0086 0.0017  22   ILE A N   
149  C  CA  . ILE A 22  ? 0.1361 0.1296 0.0852 -0.0037 -0.0071 -0.0114 22   ILE A CA  
150  C  C   . ILE A 22  ? 0.1355 0.1500 0.0564 0.0022  0.0094  0.0062  22   ILE A C   
151  O  O   . ILE A 22  ? 0.1392 0.1563 0.0885 0.0000  -0.0059 -0.0297 22   ILE A O   
152  C  CB  . ILE A 22  ? 0.1322 0.1348 0.0820 -0.0035 -0.0076 -0.0086 22   ILE A CB  
153  C  CG1 . ILE A 22  ? 0.1468 0.1499 0.0707 0.0071  -0.0043 0.0052  22   ILE A CG1 
154  C  CG2 . ILE A 22  ? 0.1467 0.1431 0.0804 -0.0121 -0.0008 -0.0159 22   ILE A CG2 
155  C  CD1 . ILE A 22  ? 0.1345 0.1486 0.1082 -0.0093 -0.0340 0.0124  22   ILE A CD1 
156  N  N   . ARG A 23  ? 0.1124 0.1370 0.0844 -0.0042 0.0085  -0.0274 23   ARG A N   
157  C  CA  . ARG A 23  ? 0.0945 0.1484 0.1125 -0.0136 0.0158  -0.0436 23   ARG A CA  
158  C  C   . ARG A 23  ? 0.1235 0.1479 0.1102 -0.0020 -0.0250 -0.0206 23   ARG A C   
159  O  O   . ARG A 23  ? 0.1301 0.1650 0.1420 0.0228  -0.0113 0.0179  23   ARG A O   
160  C  CB  . ARG A 23  ? 0.1377 0.1419 0.1362 -0.0114 -0.0305 -0.0194 23   ARG A CB  
161  C  CG  . ARG A 23  ? 0.1302 0.1447 0.0998 -0.0158 -0.0394 -0.0195 23   ARG A CG  
162  C  CD  . ARG A 23  ? 0.2006 0.1755 0.1119 -0.0513 -0.0247 -0.0410 23   ARG A CD  
163  N  NE  . ARG A 23  ? 0.1902 0.1653 0.1078 -0.0359 -0.0227 -0.0391 23   ARG A NE  
164  C  CZ  . ARG A 23  ? 0.1297 0.1351 0.0928 -0.0027 -0.0298 -0.0133 23   ARG A CZ  
165  N  NH1 . ARG A 23  ? 0.1401 0.1804 0.1052 -0.0045 -0.0170 -0.0163 23   ARG A NH1 
166  N  NH2 . ARG A 23  ? 0.1780 0.1715 0.1290 -0.0519 -0.0335 -0.0077 23   ARG A NH2 
167  N  N   . ASN A 24  ? 0.1319 0.1250 0.0944 0.0133  -0.0223 -0.0157 24   ASN A N   
168  C  CA  . ASN A 24  ? 0.1611 0.1324 0.0945 -0.0018 -0.0366 -0.0105 24   ASN A CA  
169  C  C   . ASN A 24  ? 0.1844 0.1229 0.1022 0.0268  -0.0383 -0.0193 24   ASN A C   
170  O  O   . ASN A 24  ? 0.1755 0.1276 0.1285 0.0164  -0.0071 -0.0179 24   ASN A O   
171  C  CB  . ASN A 24  ? 0.1672 0.1499 0.0951 0.0078  -0.0327 0.0114  24   ASN A CB  
172  C  CG  . ASN A 24  ? 0.1999 0.1441 0.0919 -0.0092 -0.0251 -0.0076 24   ASN A CG  
173  O  OD1 . ASN A 24  ? 0.2176 0.1675 0.1663 -0.0345 0.0102  -0.0372 24   ASN A OD1 
174  N  ND2 . ASN A 24  ? 0.2196 0.1114 0.1049 -0.0056 -0.0374 0.0093  24   ASN A ND2 
175  N  N   . SER A 25  ? 0.1627 0.1289 0.0945 0.0323  -0.0392 -0.0297 25   SER A N   
176  C  CA  . SER A 25  ? 0.1597 0.1727 0.0946 0.0311  -0.0188 -0.0392 25   SER A CA  
177  C  C   . SER A 25  ? 0.1721 0.1426 0.1683 0.0298  0.0092  -0.0541 25   SER A C   
178  O  O   . SER A 25  ? 0.1715 0.2171 0.1571 0.0256  0.0165  -0.0561 25   SER A O   
179  C  CB  . SER A 25  ? 0.1719 0.1734 0.0961 -0.0063 -0.0417 -0.0258 25   SER A CB  
180  O  OG  . SER A 25  ? 0.2268 0.1549 0.1121 -0.0064 -0.0299 -0.0355 25   SER A OG  
181  N  N   . GLY A 26  ? 0.1741 0.1968 0.1601 -0.0008 0.0072  -0.0377 26   GLY A N   
182  C  CA  . GLY A 26  ? 0.1770 0.1725 0.1595 0.0187  -0.0056 -0.0494 26   GLY A CA  
183  C  C   . GLY A 26  ? 0.1891 0.2041 0.1691 0.0271  0.0404  -0.0294 26   GLY A C   
184  O  O   . GLY A 26  ? 0.2233 0.2799 0.2558 0.0293  0.0857  -0.0294 26   GLY A O   
185  N  N   . THR A 27  ? 0.2190 0.1982 0.1974 0.0396  0.0254  -0.0047 27   THR A N   
186  C  CA  . THR A 27  ? 0.1539 0.2082 0.1913 0.0131  0.0084  -0.0170 27   THR A CA  
187  C  C   . THR A 27  ? 0.1856 0.2092 0.1983 0.0203  0.0261  -0.0279 27   THR A C   
188  O  O   . THR A 27  ? 0.1931 0.2406 0.1975 0.0354  0.0430  -0.0002 27   THR A O   
189  C  CB  . THR A 27  ? 0.3153 0.2013 0.2573 0.0310  -0.0931 -0.0067 27   THR A CB  
190  O  OG1 . THR A 27  ? 0.4970 0.2414 0.2157 0.0113  -0.1053 -0.0063 27   THR A OG1 
191  C  CG2 . THR A 27  ? 0.3792 0.2289 0.3131 0.0063  -0.1172 0.0288  27   THR A CG2 
192  N  N   . GLU A 28  ? 0.1767 0.2042 0.1331 0.0304  0.0238  -0.0437 28   GLU A N   
193  C  CA  . GLU A 28  ? 0.1454 0.2159 0.1175 0.0413  -0.0218 -0.0547 28   GLU A CA  
194  C  C   . GLU A 28  ? 0.1665 0.2128 0.1328 0.0324  0.0105  -0.0193 28   GLU A C   
195  O  O   . GLU A 28  ? 0.1856 0.2168 0.1796 0.0423  0.0520  -0.0018 28   GLU A O   
196  C  CB  . GLU A 28  ? 0.1658 0.2736 0.1546 -0.0131 -0.0147 -0.0103 28   GLU A CB  
197  C  CG  . GLU A 28  ? 0.1427 0.2805 0.1673 -0.0401 -0.0159 -0.0188 28   GLU A CG  
198  C  CD  . GLU A 28  ? 0.2525 0.2465 0.1586 -0.0467 -0.0027 -0.0210 28   GLU A CD  
199  O  OE1 . GLU A 28  ? 0.2389 0.2327 0.2270 -0.0128 0.0152  -0.0284 28   GLU A OE1 
200  O  OE2 . GLU A 28  ? 0.2439 0.2263 0.1579 -0.0050 0.0121  -0.0219 28   GLU A OE2 
201  N  N   . PRO A 29  ? 0.1675 0.1505 0.1234 0.0112  0.0190  -0.0048 29   PRO A N   
202  C  CA  . PRO A 29  ? 0.1812 0.1445 0.1050 0.0170  0.0070  -0.0288 29   PRO A CA  
203  C  C   . PRO A 29  ? 0.1514 0.1519 0.1473 0.0231  -0.0407 0.0027  29   PRO A C   
204  O  O   . PRO A 29  ? 0.1791 0.2227 0.1410 -0.0272 -0.0366 -0.0105 29   PRO A O   
205  C  CB  . PRO A 29  ? 0.1782 0.1721 0.1079 0.0149  0.0070  -0.0102 29   PRO A CB  
206  C  CG  . PRO A 29  ? 0.1974 0.1454 0.1116 0.0337  0.0180  -0.0091 29   PRO A CG  
207  C  CD  . PRO A 29  ? 0.1829 0.1430 0.1342 0.0286  0.0246  0.0039  29   PRO A CD  
208  N  N   . THR A 30  ? 0.2114 0.1793 0.1119 0.0112  0.0094  0.0083  30   THR A N   
209  C  CA  . THR A 30  ? 0.1447 0.1729 0.1476 0.0337  0.0134  0.0249  30   THR A CA  
210  C  C   . THR A 30  ? 0.1284 0.1886 0.1217 0.0198  -0.0082 0.0022  30   THR A C   
211  O  O   . THR A 30  ? 0.1309 0.2393 0.1313 0.0005  0.0024  -0.0358 30   THR A O   
212  C  CB  . THR A 30  ? 0.2018 0.2164 0.1572 -0.0174 0.0508  0.0479  30   THR A CB  
213  O  OG1 . THR A 30  ? 0.2376 0.2651 0.1813 -0.0205 0.0722  0.0058  30   THR A OG1 
214  C  CG2 . THR A 30  ? 0.3296 0.2055 0.1776 -0.0060 0.0412  0.0589  30   THR A CG2 
215  N  N   . ILE A 31  ? 0.1249 0.1685 0.1472 0.0191  -0.0178 0.0052  31   ILE A N   
216  C  CA  . ILE A 31  ? 0.1340 0.1572 0.1176 -0.0134 -0.0039 0.0051  31   ILE A CA  
217  C  C   . ILE A 31  ? 0.1390 0.1496 0.1236 -0.0137 -0.0026 -0.0082 31   ILE A C   
218  O  O   . ILE A 31  ? 0.1403 0.1556 0.2425 -0.0194 -0.0211 -0.0035 31   ILE A O   
219  C  CB  . ILE A 31  ? 0.0867 0.1729 0.1409 0.0185  -0.0254 -0.0086 31   ILE A CB  
220  C  CG1 . ILE A 31  ? 0.1549 0.1877 0.1622 0.0557  -0.0426 -0.0009 31   ILE A CG1 
221  C  CG2 . ILE A 31  ? 0.1780 0.2118 0.1345 0.0482  -0.0129 -0.0349 31   ILE A CG2 
222  C  CD1 . ILE A 31  ? 0.1887 0.2450 0.1951 -0.0005 -0.0635 0.0652  31   ILE A CD1 
223  N  N   . ILE A 32  ? 0.1355 0.1310 0.1508 -0.0145 0.0051  -0.0112 32   ILE A N   
224  C  CA  . ILE A 32  ? 0.1687 0.1321 0.1415 -0.0096 -0.0136 -0.0217 32   ILE A CA  
225  C  C   . ILE A 32  ? 0.1829 0.1131 0.1333 0.0030  -0.0067 0.0046  32   ILE A C   
226  O  O   . ILE A 32  ? 0.1853 0.1407 0.1127 -0.0069 -0.0171 0.0192  32   ILE A O   
227  C  CB  . ILE A 32  ? 0.1469 0.1610 0.1331 -0.0110 0.0092  0.0049  32   ILE A CB  
228  C  CG1 . ILE A 32  ? 0.1962 0.1763 0.1366 -0.0109 0.0250  0.0110  32   ILE A CG1 
229  C  CG2 . ILE A 32  ? 0.2522 0.1709 0.1478 0.0181  0.0305  0.0262  32   ILE A CG2 
230  C  CD1 . ILE A 32  ? 0.3301 0.2683 0.1347 -0.0521 -0.0243 -0.0354 32   ILE A CD1 
231  N  N   . LEU A 33  ? 0.1873 0.1102 0.1155 0.0035  0.0024  0.0105  33   LEU A N   
232  C  CA  . LEU A 33  ? 0.1419 0.1607 0.1095 -0.0030 -0.0271 -0.0127 33   LEU A CA  
233  C  C   . LEU A 33  ? 0.1385 0.1479 0.0976 -0.0030 -0.0114 -0.0082 33   LEU A C   
234  O  O   . LEU A 33  ? 0.1745 0.1415 0.1568 -0.0061 -0.0138 -0.0184 33   LEU A O   
235  C  CB  . LEU A 33  ? 0.1979 0.1639 0.1714 -0.0121 -0.0836 -0.0209 33   LEU A CB  
236  C  CG  . LEU A 33  ? 0.1703 0.1888 0.1997 -0.0326 -0.0793 0.0299  33   LEU A CG  
237  C  CD1 . LEU A 33  ? 0.1887 0.2147 0.1618 -0.0200 -0.0713 0.0006  33   LEU A CD1 
238  C  CD2 . LEU A 33  ? 0.1638 0.2680 0.2197 -0.0298 -0.0542 0.0718  33   LEU A CD2 
239  N  N   . TYR A 34  ? 0.1418 0.1509 0.0958 0.0038  -0.0184 -0.0088 34   TYR A N   
240  C  CA  . TYR A 34  ? 0.1467 0.1466 0.1090 0.0108  -0.0165 -0.0059 34   TYR A CA  
241  C  C   . TYR A 34  ? 0.1928 0.1442 0.0948 0.0185  0.0170  0.0142  34   TYR A C   
242  O  O   . TYR A 34  ? 0.1618 0.1425 0.1261 0.0037  -0.0164 0.0232  34   TYR A O   
243  C  CB  . TYR A 34  ? 0.1325 0.1867 0.1010 -0.0101 -0.0103 0.0236  34   TYR A CB  
244  C  CG  . TYR A 34  ? 0.1766 0.1255 0.0540 -0.0074 -0.0116 -0.0258 34   TYR A CG  
245  C  CD1 . TYR A 34  ? 0.1410 0.1429 0.1124 -0.0084 -0.0019 0.0130  34   TYR A CD1 
246  C  CD2 . TYR A 34  ? 0.1715 0.1180 0.0719 -0.0082 -0.0045 -0.0158 34   TYR A CD2 
247  C  CE1 . TYR A 34  ? 0.1468 0.1258 0.1249 0.0070  0.0090  0.0177  34   TYR A CE1 
248  C  CE2 . TYR A 34  ? 0.1519 0.1199 0.0916 0.0073  -0.0027 -0.0087 34   TYR A CE2 
249  C  CZ  . TYR A 34  ? 0.1464 0.1262 0.1127 0.0161  0.0024  0.0159  34   TYR A CZ  
250  O  OH  . TYR A 34  ? 0.1708 0.1382 0.1044 0.0191  0.0107  0.0077  34   TYR A OH  
251  N  N   . LEU A 35  ? 0.2052 0.1418 0.1043 0.0096  -0.0083 -0.0010 35   LEU A N   
252  C  CA  . LEU A 35  ? 0.1990 0.1592 0.1208 0.0115  -0.0070 -0.0192 35   LEU A CA  
253  C  C   . LEU A 35  ? 0.2554 0.1458 0.1459 -0.0023 0.0075  -0.0220 35   LEU A C   
254  O  O   . LEU A 35  ? 0.2883 0.1585 0.2294 0.0197  0.0153  -0.0024 35   LEU A O   
255  C  CB  . LEU A 35  ? 0.1947 0.1543 0.1257 0.0397  -0.0053 -0.0157 35   LEU A CB  
256  C  CG  . LEU A 35  ? 0.2051 0.1525 0.1197 0.0353  -0.0141 0.0057  35   LEU A CG  
257  C  CD1 . LEU A 35  ? 0.2878 0.3423 0.1273 -0.0053 -0.0122 0.0437  35   LEU A CD1 
258  C  CD2 . LEU A 35  ? 0.1885 0.2333 0.1517 0.0640  0.0154  -0.0368 35   LEU A CD2 
259  N  N   . GLU A 36  ? 0.2501 0.1060 0.1607 -0.0313 0.0217  -0.0116 36   GLU A N   
260  C  CA  . GLU A 36  ? 0.2869 0.2049 0.1837 -0.1122 -0.0151 -0.0278 36   GLU A CA  
261  C  C   . GLU A 36  ? 0.2746 0.2113 0.2371 -0.0955 0.0977  -0.0442 36   GLU A C   
262  O  O   . GLU A 36  ? 0.2740 0.2443 0.2321 -0.1363 0.0274  -0.0173 36   GLU A O   
263  C  CB  . GLU A 36  ? 0.3390 0.3360 0.4304 -0.1286 -0.1344 0.0333  36   GLU A CB  
264  C  CG  . GLU A 36  ? 0.4935 0.3722 0.7693 0.0601  -0.2489 0.0229  36   GLU A CG  
265  C  CD  . GLU A 36  ? 0.6044 0.5408 1.0229 -0.0042 -0.4672 0.1150  36   GLU A CD  
266  O  OE1 . GLU A 36  ? 1.0325 0.3424 0.9530 -0.2739 -0.6882 0.1259  36   GLU A OE1 
267  O  OE2 . GLU A 36  ? 0.4214 1.3165 1.3135 -0.0411 -0.4351 0.2507  36   GLU A OE2 
268  N  N   . ASN A 37  ? 0.3063 0.1783 0.1430 -0.0493 -0.0193 0.0231  37   ASN A N   
269  C  CA  . ASN A 37  ? 0.2539 0.1591 0.1564 -0.0071 0.0051  0.0361  37   ASN A CA  
270  C  C   . ASN A 37  ? 0.2537 0.2028 0.1113 -0.0006 -0.0030 0.0348  37   ASN A C   
271  O  O   . ASN A 37  ? 0.1730 0.2174 0.1536 -0.0028 0.0063  0.0100  37   ASN A O   
272  C  CB  . ASN A 37  ? 0.2542 0.3056 0.3127 0.0613  0.0304  0.0647  37   ASN A CB  
273  C  CG  . ASN A 37  ? 0.2273 0.4200 0.3640 -0.0144 0.0936  0.0788  37   ASN A CG  
274  O  OD1 . ASN A 37  ? 0.6990 0.7562 0.4828 -0.3862 0.0119  0.2377  37   ASN A OD1 
275  N  ND2 . ASN A 37  ? 0.4562 0.4621 0.3698 -0.0954 -0.1126 0.0113  37   ASN A ND2 
276  N  N   . PRO A 38  ? 0.2496 0.1707 0.1210 -0.0131 0.0202  0.0137  38   PRO A N   
277  C  CA  . PRO A 38  ? 0.2293 0.1682 0.1282 0.0169  0.0244  0.0081  38   PRO A CA  
278  C  C   . PRO A 38  ? 0.1417 0.2210 0.1240 0.0264  0.0179  0.0112  38   PRO A C   
279  O  O   . PRO A 38  ? 0.1914 0.2096 0.1573 0.0131  0.0399  0.0196  38   PRO A O   
280  C  CB  . PRO A 38  ? 0.2583 0.1899 0.1843 0.0289  0.0384  -0.0311 38   PRO A CB  
281  C  CG  . PRO A 38  ? 0.2909 0.1832 0.2134 0.0206  0.0385  -0.0343 38   PRO A CG  
282  C  CD  . PRO A 38  ? 0.3121 0.2006 0.1993 -0.0038 0.0070  -0.0351 38   PRO A CD  
283  N  N   . PRO A 39  ? 0.1924 0.1907 0.1136 0.0178  0.0104  0.0282  39   PRO A N   
284  C  CA  . PRO A 39  ? 0.1593 0.2272 0.1096 0.0296  -0.0177 0.0401  39   PRO A CA  
285  C  C   . PRO A 39  ? 0.2180 0.2141 0.1264 0.0440  0.0253  0.0448  39   PRO A C   
286  O  O   . PRO A 39  ? 0.2092 0.2240 0.1494 0.0419  0.0223  0.0245  39   PRO A O   
287  C  CB  . PRO A 39  ? 0.1968 0.2014 0.1511 0.0271  0.0015  0.0005  39   PRO A CB  
288  C  CG  . PRO A 39  ? 0.2144 0.2589 0.1258 -0.0197 0.0035  0.0382  39   PRO A CG  
289  C  CD  . PRO A 39  ? 0.1872 0.2212 0.1363 -0.0001 0.0070  0.0299  39   PRO A CD  
290  N  N   . SER A 40  ? 0.2306 0.2003 0.1327 0.0504  0.0251  0.0459  40   SER A N   
291  C  CA  . SER A 40  ? 0.1782 0.1920 0.1465 0.0319  0.0512  0.0614  40   SER A CA  
292  C  C   . SER A 40  ? 0.2047 0.1622 0.1232 0.0131  0.0190  0.0310  40   SER A C   
293  O  O   . SER A 40  ? 0.2390 0.1610 0.1005 0.0038  -0.0046 0.0384  40   SER A O   
294  C  CB  . SER A 40  ? 0.2351 0.2785 0.1366 0.0293  0.0671  0.0553  40   SER A CB  
295  O  OG  . SER A 40  ? 0.2877 0.3132 0.1324 0.0516  0.0428  0.0346  40   SER A OG  
296  N  N   . ARG A 41  ? 0.1819 0.1632 0.1193 0.0026  0.0301  0.0443  41   ARG A N   
297  C  CA  . ARG A 41  ? 0.1815 0.1476 0.1461 0.0080  0.0269  0.0135  41   ARG A CA  
298  C  C   . ARG A 41  ? 0.1987 0.1461 0.1285 0.0128  0.0283  0.0256  41   ARG A C   
299  O  O   . ARG A 41  ? 0.2034 0.1748 0.1236 -0.0156 -0.0073 0.0174  41   ARG A O   
300  C  CB  . ARG A 41  ? 0.1757 0.1510 0.1154 0.0004  0.0343  0.0157  41   ARG A CB  
301  C  CG  . ARG A 41  ? 0.1821 0.1859 0.1692 -0.0082 -0.0041 0.0578  41   ARG A CG  
302  C  CD  . ARG A 41  ? 0.2009 0.1631 0.1665 -0.0248 -0.0299 0.0542  41   ARG A CD  
303  N  NE  . ARG A 41  ? 0.1995 0.1893 0.1618 0.0049  -0.0485 0.0462  41   ARG A NE  
304  C  CZ  . ARG A 41  ? 0.1710 0.1577 0.0949 0.0420  -0.0241 0.0307  41   ARG A CZ  
305  N  NH1 . ARG A 41  ? 0.2554 0.1991 0.1149 0.0663  -0.0329 0.0084  41   ARG A NH1 
306  N  NH2 . ARG A 41  ? 0.1746 0.2086 0.2096 0.0594  0.0035  0.0328  41   ARG A NH2 
307  N  N   . ASP A 42  ? 0.2088 0.2026 0.1244 0.0233  0.0312  0.0201  42   ASP A N   
308  C  CA  . ASP A 42  ? 0.2445 0.1870 0.1223 0.0355  0.0338  0.0275  42   ASP A CA  
309  C  C   . ASP A 42  ? 0.2584 0.1956 0.1460 0.0127  -0.0117 0.0505  42   ASP A C   
310  O  O   . ASP A 42  ? 0.2845 0.1940 0.1129 0.0116  0.0069  0.0233  42   ASP A O   
311  C  CB  . ASP A 42  ? 0.4279 0.2759 0.1455 0.0125  0.1282  0.0274  42   ASP A CB  
312  C  CG  . ASP A 42  ? 0.5994 0.4272 0.1721 0.0039  0.0983  0.1166  42   ASP A CG  
313  O  OD1 . ASP A 42  ? 0.7044 0.5658 0.2766 0.2204  0.1300  0.1884  42   ASP A OD1 
314  O  OD2 . ASP A 42  ? 0.8060 0.4639 0.3846 -0.0007 0.2468  0.2201  42   ASP A OD2 
315  N  N   . GLU A 43  ? 0.2166 0.2048 0.1231 0.0424  0.0298  0.0255  43   GLU A N   
316  C  CA  . GLU A 43  ? 0.1924 0.1961 0.1193 0.0265  0.0158  0.0206  43   GLU A CA  
317  C  C   . GLU A 43  ? 0.1776 0.1750 0.1254 0.0218  0.0079  0.0086  43   GLU A C   
318  O  O   . GLU A 43  ? 0.1970 0.1704 0.1201 0.0281  0.0155  0.0054  43   GLU A O   
319  C  CB  A GLU A 43  ? 0.1942 0.2954 0.2340 -0.0285 -0.0258 0.0973  43   GLU A CB  
320  C  CB  B GLU A 43  ? 0.1707 0.1669 0.1952 0.0356  0.0142  0.0170  43   GLU A CB  
321  C  CG  A GLU A 43  ? 0.2124 0.3393 0.2461 -0.0668 -0.0006 -0.0317 43   GLU A CG  
322  C  CG  B GLU A 43  ? 0.1538 0.1484 0.2033 -0.0073 0.0040  0.0268  43   GLU A CG  
323  C  CD  A GLU A 43  ? 0.1382 0.2426 0.2437 0.1412  -0.0283 -0.0501 43   GLU A CD  
324  C  CD  B GLU A 43  ? 0.2376 0.1902 0.3156 0.0359  0.0272  -0.0519 43   GLU A CD  
325  O  OE1 A GLU A 43  ? 0.1646 0.1411 0.1390 0.0525  -0.0131 0.0652  43   GLU A OE1 
326  O  OE1 B GLU A 43  ? 0.2580 0.2028 0.2742 0.1228  -0.0115 -0.0502 43   GLU A OE1 
327  O  OE2 A GLU A 43  ? 0.1561 0.4236 0.2070 0.0398  0.0859  0.0881  43   GLU A OE2 
328  O  OE2 B GLU A 43  ? 0.3736 0.1560 0.5310 0.0227  0.2333  -0.1452 43   GLU A OE2 
329  N  N   . LEU A 44  ? 0.2195 0.1666 0.1019 0.0204  0.0202  0.0134  44   LEU A N   
330  C  CA  . LEU A 44  ? 0.1617 0.1452 0.1242 0.0416  -0.0111 0.0135  44   LEU A CA  
331  C  C   . LEU A 44  ? 0.2177 0.1391 0.1441 0.0198  -0.0525 0.0332  44   LEU A C   
332  O  O   . LEU A 44  ? 0.1832 0.1481 0.1177 0.0278  -0.0136 0.0042  44   LEU A O   
333  C  CB  . LEU A 44  ? 0.1941 0.1436 0.1227 0.0149  0.0219  0.0105  44   LEU A CB  
334  C  CG  . LEU A 44  ? 0.1373 0.1725 0.1142 0.0090  -0.0157 0.0083  44   LEU A CG  
335  C  CD1 . LEU A 44  ? 0.1686 0.2347 0.0959 0.0492  0.0262  0.0426  44   LEU A CD1 
336  C  CD2 . LEU A 44  ? 0.2133 0.2251 0.1035 0.0340  0.0019  -0.0177 44   LEU A CD2 
337  N  N   . VAL A 45  ? 0.2338 0.1482 0.1083 0.0486  -0.0254 0.0109  45   VAL A N   
338  C  CA  . VAL A 45  ? 0.2381 0.1804 0.0879 0.0460  -0.0205 0.0098  45   VAL A CA  
339  C  C   . VAL A 45  ? 0.2223 0.1777 0.1037 0.0499  -0.0482 0.0048  45   VAL A C   
340  O  O   . VAL A 45  ? 0.2536 0.2124 0.1344 0.0162  -0.0143 -0.0194 45   VAL A O   
341  C  CB  . VAL A 45  ? 0.3424 0.1748 0.1026 0.0287  -0.0530 0.0123  45   VAL A CB  
342  C  CG1 . VAL A 45  ? 0.5094 0.1960 0.1276 -0.0127 -0.1284 0.0220  45   VAL A CG1 
343  C  CG2 . VAL A 45  ? 0.4055 0.1471 0.1769 0.0176  -0.0379 0.0131  45   VAL A CG2 
344  N  N   . LYS A 46  ? 0.2491 0.1804 0.1029 0.0391  -0.0038 0.0054  46   LYS A N   
345  C  CA  . LYS A 46  ? 0.2609 0.1911 0.0943 0.0733  -0.0312 0.0105  46   LYS A CA  
346  C  C   . LYS A 46  ? 0.2319 0.1918 0.1108 0.0391  -0.0419 0.0217  46   LYS A C   
347  O  O   . LYS A 46  ? 0.2511 0.2057 0.1496 0.0138  0.0268  -0.0294 46   LYS A O   
348  C  CB  . LYS A 46  ? 0.2892 0.2391 0.0946 0.0773  0.0122  0.0120  46   LYS A CB  
349  C  CG  . LYS A 46  ? 0.4810 0.2891 0.2684 0.1016  0.1889  -0.0361 46   LYS A CG  
350  C  CD  . LYS A 46  ? 0.5823 0.4909 0.4942 0.1103  0.3489  -0.1323 46   LYS A CD  
351  C  CE  . LYS A 46  ? 0.6607 0.5138 0.6848 0.1400  0.4930  -0.1956 46   LYS A CE  
352  N  NZ  . LYS A 46  ? 0.6706 0.8014 1.4071 0.2759  0.3655  -0.3356 46   LYS A NZ  
353  N  N   . LEU A 47  ? 0.2329 0.1979 0.1076 0.0336  -0.0303 0.0209  47   LEU A N   
354  C  CA  . LEU A 47  ? 0.2224 0.1722 0.0874 0.0188  -0.0116 -0.0082 47   LEU A CA  
355  C  C   . LEU A 47  ? 0.2155 0.1642 0.1279 0.0197  -0.0257 -0.0114 47   LEU A C   
356  O  O   . LEU A 47  ? 0.1942 0.1607 0.1333 0.0370  -0.0248 -0.0085 47   LEU A O   
357  C  CB  . LEU A 47  ? 0.2064 0.1528 0.0945 0.0329  -0.0143 -0.0133 47   LEU A CB  
358  C  CG  . LEU A 47  ? 0.2111 0.1093 0.1289 0.0108  -0.0117 0.0156  47   LEU A CG  
359  C  CD1 . LEU A 47  ? 0.2357 0.1399 0.1575 0.0212  -0.0485 -0.0066 47   LEU A CD1 
360  C  CD2 . LEU A 47  ? 0.2266 0.1547 0.1821 0.0539  -0.0102 -0.0116 47   LEU A CD2 
361  N  N   . ILE A 48  ? 0.2116 0.1392 0.1170 0.0026  -0.0108 -0.0287 48   ILE A N   
362  C  CA  . ILE A 48  ? 0.2158 0.1586 0.1280 0.0048  0.0056  -0.0523 48   ILE A CA  
363  C  C   . ILE A 48  ? 0.2215 0.1455 0.1359 0.0052  -0.0204 -0.0348 48   ILE A C   
364  O  O   . ILE A 48  ? 0.2112 0.1785 0.1725 -0.0136 -0.0627 -0.0042 48   ILE A O   
365  C  CB  . ILE A 48  ? 0.2326 0.1709 0.1328 0.0218  0.0002  -0.0605 48   ILE A CB  
366  C  CG1 . ILE A 48  ? 0.2575 0.1480 0.1400 -0.0319 0.0117  -0.0483 48   ILE A CG1 
367  C  CG2 . ILE A 48  ? 0.2358 0.1957 0.2961 0.0386  -0.0969 -0.0253 48   ILE A CG2 
368  C  CD1 . ILE A 48  ? 0.1717 0.1828 0.2232 0.0114  -0.0458 -0.0997 48   ILE A CD1 
369  N  N   . ALA A 49  ? 0.2499 0.2252 0.1173 -0.0109 -0.0641 -0.0112 49   ALA A N   
370  C  CA  . ALA A 49  ? 0.2133 0.2507 0.1364 0.0386  -0.0891 -0.0333 49   ALA A CA  
371  C  C   . ALA A 49  ? 0.2265 0.2337 0.1671 0.0293  -0.0491 -0.0391 49   ALA A C   
372  O  O   . ALA A 49  ? 0.2204 0.2578 0.2646 0.0265  -0.0780 -0.0230 49   ALA A O   
373  C  CB  . ALA A 49  ? 0.3195 0.2975 0.1245 -0.0338 -0.1158 -0.0184 49   ALA A CB  
374  N  N   . ASP A 50  ? 0.2400 0.1749 0.1716 0.0231  -0.0813 -0.0447 50   ASP A N   
375  C  CA  . ASP A 50  ? 0.2486 0.1750 0.1118 0.0172  -0.0591 -0.0518 50   ASP A CA  
376  C  C   . ASP A 50  ? 0.2541 0.1781 0.1439 -0.0073 -0.0286 -0.0600 50   ASP A C   
377  O  O   . ASP A 50  ? 0.2153 0.1791 0.1976 -0.0063 -0.0398 -0.0449 50   ASP A O   
378  C  CB  . ASP A 50  ? 0.2456 0.2034 0.1489 0.0363  -0.0326 0.0054  50   ASP A CB  
379  C  CG  . ASP A 50  ? 0.2982 0.3098 0.1634 0.0048  -0.0292 0.0553  50   ASP A CG  
380  O  OD1 . ASP A 50  ? 0.2950 0.3556 0.1509 0.0166  0.0004  0.0125  50   ASP A OD1 
381  O  OD2 . ASP A 50  ? 0.3014 0.3994 0.1400 0.0767  -0.0113 -0.0256 50   ASP A OD2 
382  N  N   . MET A 51  ? 0.2370 0.2007 0.1471 0.0335  -0.0080 -0.0415 51   MET A N   
383  C  CA  . MET A 51  ? 0.2193 0.2470 0.1686 0.0388  0.0089  -0.0230 51   MET A CA  
384  C  C   . MET A 51  ? 0.2122 0.2633 0.1973 0.0440  0.0423  -0.0945 51   MET A C   
385  O  O   . MET A 51  ? 0.2932 0.2107 0.3273 -0.0314 0.0197  -0.0475 51   MET A O   
386  C  CB  A MET A 51  ? 0.3136 0.2094 0.1344 -0.0443 0.0421  0.0158  51   MET A CB  
387  C  CB  B MET A 51  ? 0.2243 0.2164 0.1274 0.0239  0.0027  0.0163  51   MET A CB  
388  C  CG  A MET A 51  ? 0.3518 0.2294 0.1524 -0.0760 0.0005  0.0332  51   MET A CG  
389  C  CG  B MET A 51  ? 0.1969 0.1625 0.1423 0.0533  0.0314  -0.0006 51   MET A CG  
390  S  SD  A MET A 51  ? 0.6233 0.3275 0.1707 -0.2015 0.0282  -0.0222 51   MET A SD  
391  S  SD  B MET A 51  ? 0.1278 0.1918 0.1027 0.0953  0.0156  0.0234  51   MET A SD  
392  C  CE  A MET A 51  ? 0.1538 0.2384 0.1063 0.0385  -0.0291 -0.0151 51   MET A CE  
393  C  CE  B MET A 51  ? 0.3901 0.0514 0.0668 0.0712  -0.1842 -0.0006 51   MET A CE  
394  N  N   . GLY A 52  ? 0.2519 0.3167 0.1954 0.0009  -0.0318 -0.1395 52   GLY A N   
395  C  CA  . GLY A 52  ? 0.2517 0.3371 0.2953 -0.0015 -0.0273 -0.1808 52   GLY A CA  
396  C  C   . GLY A 52  ? 0.2661 0.3373 0.3698 -0.0413 0.0182  -0.2219 52   GLY A C   
397  O  O   . GLY A 52  ? 0.3262 0.3858 0.5420 -0.1153 0.1121  -0.3125 52   GLY A O   
398  N  N   . ILE A 53  ? 0.2183 0.2252 0.3203 0.0469  -0.0590 -0.1396 53   ILE A N   
399  C  CA  . ILE A 53  ? 0.2360 0.1511 0.2318 0.0159  -0.0422 -0.0628 53   ILE A CA  
400  C  C   . ILE A 53  ? 0.1850 0.1658 0.1941 0.0129  -0.0240 -0.0401 53   ILE A C   
401  O  O   . ILE A 53  ? 0.2135 0.2168 0.2054 0.0148  0.0088  -0.0313 53   ILE A O   
402  C  CB  . ILE A 53  ? 0.3004 0.1409 0.2675 0.0577  -0.1063 -0.0608 53   ILE A CB  
403  C  CG1 . ILE A 53  ? 0.3296 0.2294 0.3430 0.0137  -0.1667 -0.0468 53   ILE A CG1 
404  C  CG2 . ILE A 53  ? 0.4052 0.1666 0.3513 0.1078  -0.1002 -0.0379 53   ILE A CG2 
405  C  CD1 . ILE A 53  ? 0.3636 0.2719 0.3756 0.0528  -0.2196 -0.0493 53   ILE A CD1 
406  N  N   . SER A 54  ? 0.1590 0.1572 0.1867 0.0002  -0.0287 -0.0188 54   SER A N   
407  C  CA  . SER A 54  ? 0.2004 0.1616 0.1850 0.0187  -0.0433 -0.0304 54   SER A CA  
408  C  C   . SER A 54  ? 0.1755 0.1425 0.1748 0.0257  -0.0293 -0.0249 54   SER A C   
409  O  O   . SER A 54  ? 0.1874 0.1396 0.1538 0.0034  -0.0197 -0.0114 54   SER A O   
410  C  CB  . SER A 54  ? 0.1844 0.1803 0.1856 0.0240  -0.0751 -0.0518 54   SER A CB  
411  O  OG  . SER A 54  ? 0.2095 0.2340 0.1799 0.0028  -0.0489 -0.0540 54   SER A OG  
412  N  N   . VAL A 55  ? 0.1683 0.1759 0.1288 0.0056  -0.0227 0.0013  55   VAL A N   
413  C  CA  . VAL A 55  ? 0.1489 0.1362 0.1422 0.0284  -0.0118 -0.0010 55   VAL A CA  
414  C  C   . VAL A 55  ? 0.1468 0.1230 0.1392 -0.0025 -0.0089 0.0015  55   VAL A C   
415  O  O   . VAL A 55  ? 0.1566 0.1272 0.1507 0.0004  -0.0260 0.0115  55   VAL A O   
416  C  CB  . VAL A 55  ? 0.1397 0.1736 0.1422 0.0202  -0.0265 0.0277  55   VAL A CB  
417  C  CG1 . VAL A 55  ? 0.1880 0.1542 0.1650 -0.0135 -0.0069 0.0327  55   VAL A CG1 
418  C  CG2 . VAL A 55  ? 0.2371 0.2090 0.1535 0.0043  0.0000  0.0225  55   VAL A CG2 
419  N  N   . ARG A 56  ? 0.1505 0.1379 0.1129 -0.0049 -0.0132 0.0102  56   ARG A N   
420  C  CA  . ARG A 56  ? 0.1697 0.1241 0.1286 0.0087  -0.0010 -0.0114 56   ARG A CA  
421  C  C   . ARG A 56  ? 0.2096 0.1382 0.0938 0.0073  0.0096  -0.0061 56   ARG A C   
422  O  O   . ARG A 56  ? 0.1547 0.2306 0.1145 0.0155  -0.0217 -0.0261 56   ARG A O   
423  C  CB  . ARG A 56  ? 0.1742 0.1684 0.1280 0.0086  0.0003  -0.0392 56   ARG A CB  
424  C  CG  . ARG A 56  ? 0.2100 0.1749 0.1728 0.0213  0.0541  0.0131  56   ARG A CG  
425  C  CD  . ARG A 56  ? 0.1992 0.1480 0.1779 -0.0010 0.0503  -0.0044 56   ARG A CD  
426  N  NE  . ARG A 56  ? 0.2234 0.1526 0.1386 0.0112  -0.0212 -0.0118 56   ARG A NE  
427  C  CZ  . ARG A 56  ? 0.1753 0.1377 0.1269 -0.0073 -0.0273 0.0114  56   ARG A CZ  
428  N  NH1 . ARG A 56  ? 0.2436 0.1389 0.1480 0.0219  -0.0004 0.0219  56   ARG A NH1 
429  N  NH2 . ARG A 56  ? 0.2257 0.1673 0.1166 -0.0068 -0.0175 0.0174  56   ARG A NH2 
430  N  N   . ALA A 57  ? 0.1776 0.1251 0.1366 -0.0083 -0.0168 0.0091  57   ALA A N   
431  C  CA  . ALA A 57  ? 0.1781 0.1363 0.1284 0.0076  -0.0034 0.0048  57   ALA A CA  
432  C  C   . ALA A 57  ? 0.1767 0.1159 0.1320 0.0063  -0.0030 0.0100  57   ALA A C   
433  O  O   . ALA A 57  ? 0.2480 0.1526 0.1575 -0.0363 -0.0560 0.0478  57   ALA A O   
434  C  CB  . ALA A 57  ? 0.2346 0.1311 0.2012 -0.0041 -0.0389 -0.0150 57   ALA A CB  
435  N  N   . LEU A 58  ? 0.1851 0.1436 0.1019 -0.0068 -0.0110 0.0084  58   LEU A N   
436  C  CA  . LEU A 58  ? 0.1809 0.1609 0.0979 -0.0162 0.0001  -0.0097 58   LEU A CA  
437  C  C   . LEU A 58  ? 0.1784 0.1388 0.1324 0.0142  -0.0248 -0.0117 58   LEU A C   
438  O  O   . LEU A 58  ? 0.1828 0.1515 0.1127 0.0234  -0.0262 -0.0173 58   LEU A O   
439  C  CB  . LEU A 58  ? 0.2039 0.1534 0.1236 -0.0293 0.0072  0.0153  58   LEU A CB  
440  C  CG  . LEU A 58  ? 0.1953 0.1427 0.0988 -0.0084 0.0224  0.0025  58   LEU A CG  
441  C  CD1 . LEU A 58  ? 0.2047 0.1372 0.1568 -0.0034 0.0360  0.0126  58   LEU A CD1 
442  C  CD2 . LEU A 58  ? 0.2349 0.2092 0.1155 -0.0302 0.0368  0.0168  58   LEU A CD2 
443  N  N   . LEU A 59  ? 0.1564 0.1763 0.0961 0.0040  -0.0072 -0.0079 59   LEU A N   
444  C  CA  . LEU A 59  ? 0.1613 0.1365 0.1016 0.0222  -0.0334 0.0031  59   LEU A CA  
445  C  C   . LEU A 59  ? 0.1868 0.1079 0.0990 0.0239  -0.0057 0.0008  59   LEU A C   
446  O  O   . LEU A 59  ? 0.2000 0.1808 0.1408 -0.0194 -0.0255 0.0250  59   LEU A O   
447  C  CB  . LEU A 59  ? 0.1709 0.1576 0.1493 0.0372  -0.0091 0.0386  59   LEU A CB  
448  C  CG  . LEU A 59  ? 0.1429 0.1684 0.1509 0.0120  -0.0207 0.0512  59   LEU A CG  
449  C  CD1 . LEU A 59  ? 0.1455 0.1795 0.1614 0.0143  -0.0426 0.0453  59   LEU A CD1 
450  C  CD2 . LEU A 59  ? 0.1485 0.1848 0.2053 0.0012  0.0098  0.0340  59   LEU A CD2 
451  N  N   . ARG A 60  ? 0.1749 0.1396 0.0786 0.0133  0.0003  0.0200  60   ARG A N   
452  C  CA  . ARG A 60  ? 0.1866 0.1180 0.0817 0.0296  0.0141  0.0130  60   ARG A CA  
453  C  C   . ARG A 60  ? 0.1549 0.1179 0.0967 0.0085  0.0164  0.0094  60   ARG A C   
454  O  O   . ARG A 60  ? 0.1706 0.1180 0.1207 0.0167  0.0116  -0.0148 60   ARG A O   
455  C  CB  . ARG A 60  ? 0.1997 0.2094 0.0790 0.0848  -0.0079 -0.0290 60   ARG A CB  
456  C  CG  . ARG A 60  ? 0.2220 0.3203 0.0681 0.0730  0.0100  -0.0070 60   ARG A CG  
457  C  CD  . ARG A 60  ? 0.2530 0.2579 0.1063 0.1152  0.0210  0.0467  60   ARG A CD  
458  N  NE  . ARG A 60  ? 0.2990 0.1995 0.0990 0.0733  0.0053  0.0206  60   ARG A NE  
459  C  CZ  . ARG A 60  ? 0.2596 0.1862 0.0977 0.0786  -0.0103 0.0125  60   ARG A CZ  
460  N  NH1 . ARG A 60  ? 0.2390 0.2193 0.0860 0.0315  -0.0101 0.0037  60   ARG A NH1 
461  N  NH2 . ARG A 60  ? 0.3423 0.1775 0.0904 0.0387  0.0046  0.0022  60   ARG A NH2 
462  N  N   . LYS A 61  ? 0.1835 0.1867 0.1003 -0.0009 0.0354  0.0200  61   LYS A N   
463  C  CA  . LYS A 61  ? 0.1661 0.1742 0.1147 -0.0069 0.0297  0.0161  61   LYS A CA  
464  C  C   . LYS A 61  ? 0.1929 0.2145 0.1245 -0.0295 0.0266  -0.0125 61   LYS A C   
465  O  O   . LYS A 61  ? 0.2460 0.1920 0.1335 0.0016  -0.0232 -0.0175 61   LYS A O   
466  C  CB  . LYS A 61  ? 0.1686 0.1573 0.1616 -0.0045 0.0358  -0.0111 61   LYS A CB  
467  C  CG  . LYS A 61  ? 0.2086 0.2107 0.2010 -0.0169 -0.0203 -0.0082 61   LYS A CG  
468  C  CD  . LYS A 61  ? 0.2457 0.3663 0.2031 -0.0837 -0.0282 -0.0154 61   LYS A CD  
469  C  CE  . LYS A 61  ? 0.2382 0.3666 0.2845 -0.0475 -0.0903 -0.0249 61   LYS A CE  
470  N  NZ  . LYS A 61  ? 0.3958 0.5982 0.5355 -0.2692 -0.1076 0.0203  61   LYS A NZ  
471  N  N   . ASN A 62  ? 0.2213 0.1957 0.1494 -0.0094 -0.0008 -0.0179 62   ASN A N   
472  C  CA  . ASN A 62  ? 0.2070 0.1547 0.1163 -0.0238 0.0402  0.0023  62   ASN A CA  
473  C  C   . ASN A 62  ? 0.1585 0.1653 0.0846 0.0262  0.0253  0.0269  62   ASN A C   
474  O  O   . ASN A 62  ? 0.2322 0.2537 0.1291 -0.0154 -0.0213 0.0851  62   ASN A O   
475  C  CB  . ASN A 62  ? 0.3163 0.1677 0.1270 -0.0468 0.0396  0.0133  62   ASN A CB  
476  C  CG  . ASN A 62  ? 0.3034 0.1805 0.1265 0.0195  0.0311  0.0132  62   ASN A CG  
477  O  OD1 . ASN A 62  ? 0.3382 0.2073 0.1349 0.0718  -0.0257 0.0066  62   ASN A OD1 
478  N  ND2 . ASN A 62  ? 0.3279 0.1449 0.1248 0.0569  0.0349  -0.0245 62   ASN A ND2 
479  N  N   . VAL A 63  ? 0.1380 0.1633 0.0967 -0.0036 -0.0048 0.0292  63   VAL A N   
480  C  CA  . VAL A 63  ? 0.1007 0.1539 0.1119 0.0214  -0.0123 0.0246  63   VAL A CA  
481  C  C   . VAL A 63  ? 0.1127 0.1512 0.0712 0.0209  0.0050  0.0233  63   VAL A C   
482  O  O   . VAL A 63  ? 0.1378 0.1516 0.1033 0.0210  -0.0241 0.0378  63   VAL A O   
483  C  CB  . VAL A 63  ? 0.1096 0.1465 0.1169 0.0176  -0.0173 0.0013  63   VAL A CB  
484  C  CG1 . VAL A 63  ? 0.2140 0.1782 0.1584 0.0726  0.0141  0.0219  63   VAL A CG1 
485  C  CG2 . VAL A 63  ? 0.1277 0.1728 0.1183 0.0257  -0.0239 -0.0174 63   VAL A CG2 
486  N  N   . GLU A 64  ? 0.1283 0.1565 0.0930 0.0041  0.0118  0.0243  64   GLU A N   
487  C  CA  . GLU A 64  ? 0.1553 0.1578 0.0816 0.0049  0.0167  0.0145  64   GLU A CA  
488  C  C   . GLU A 64  ? 0.1496 0.1538 0.0923 0.0019  0.0253  0.0371  64   GLU A C   
489  O  O   . GLU A 64  ? 0.1661 0.1469 0.1115 0.0157  0.0076  0.0072  64   GLU A O   
490  C  CB  . GLU A 64  ? 0.1848 0.1696 0.0843 -0.0189 0.0179  0.0267  64   GLU A CB  
491  C  CG  . GLU A 64  ? 0.2430 0.1519 0.1054 -0.0314 0.0057  0.0458  64   GLU A CG  
492  C  CD  . GLU A 64  ? 0.3685 0.1525 0.2004 -0.0777 -0.1008 0.0868  64   GLU A CD  
493  O  OE1 . GLU A 64  ? 0.3347 0.1843 0.2664 -0.0887 -0.0275 0.0218  64   GLU A OE1 
494  O  OE2 . GLU A 64  ? 0.2975 0.2513 0.2134 -0.0561 -0.0642 0.0233  64   GLU A OE2 
495  N  N   . PRO A 65  ? 0.1513 0.1413 0.0820 0.0133  0.0048  0.0251  65   PRO A N   
496  C  CA  . PRO A 65  ? 0.1600 0.1386 0.0817 0.0028  -0.0002 0.0242  65   PRO A CA  
497  C  C   . PRO A 65  ? 0.1573 0.1202 0.0823 0.0164  0.0018  0.0088  65   PRO A C   
498  O  O   . PRO A 65  ? 0.1764 0.1461 0.0980 0.0215  -0.0130 0.0228  65   PRO A O   
499  C  CB  . PRO A 65  ? 0.1674 0.2000 0.0929 0.0148  0.0106  0.0331  65   PRO A CB  
500  C  CG  . PRO A 65  ? 0.2168 0.2425 0.0905 0.0748  0.0174  0.0176  65   PRO A CG  
501  C  CD  . PRO A 65  ? 0.1627 0.1535 0.0895 0.0242  0.0075  0.0124  65   PRO A CD  
502  N  N   . TYR A 66  ? 0.1675 0.1180 0.1009 0.0117  -0.0052 0.0055  66   TYR A N   
503  C  CA  . TYR A 66  ? 0.1630 0.1129 0.0933 0.0149  0.0142  0.0062  66   TYR A CA  
504  C  C   . TYR A 66  ? 0.1710 0.1362 0.0768 0.0344  0.0074  0.0077  66   TYR A C   
505  O  O   . TYR A 66  ? 0.1729 0.1344 0.0952 0.0293  -0.0068 0.0172  66   TYR A O   
506  C  CB  . TYR A 66  ? 0.1670 0.1150 0.0932 0.0197  0.0142  0.0189  66   TYR A CB  
507  C  CG  . TYR A 66  ? 0.1720 0.1142 0.1005 0.0065  0.0167  0.0351  66   TYR A CG  
508  C  CD1 . TYR A 66  ? 0.1815 0.1258 0.1184 0.0027  0.0267  0.0025  66   TYR A CD1 
509  C  CD2 . TYR A 66  ? 0.1820 0.1223 0.0946 -0.0060 0.0182  0.0326  66   TYR A CD2 
510  C  CE1 . TYR A 66  ? 0.1946 0.1282 0.1666 -0.0232 0.0355  0.0061  66   TYR A CE1 
511  C  CE2 . TYR A 66  ? 0.1911 0.1240 0.1406 -0.0037 0.0039  0.0203  66   TYR A CE2 
512  C  CZ  . TYR A 66  ? 0.2011 0.1484 0.1347 -0.0384 0.0089  0.0223  66   TYR A CZ  
513  O  OH  . TYR A 66  ? 0.1899 0.1286 0.2030 -0.0131 -0.0040 0.0090  66   TYR A OH  
514  N  N   . GLU A 67  ? 0.1633 0.1557 0.0840 0.0345  0.0058  0.0027  67   GLU A N   
515  C  CA  . GLU A 67  ? 0.1801 0.1431 0.0968 -0.0030 0.0419  -0.0193 67   GLU A CA  
516  C  C   . GLU A 67  ? 0.1446 0.1346 0.1306 -0.0019 0.0210  -0.0346 67   GLU A C   
517  O  O   . GLU A 67  ? 0.1397 0.1831 0.1133 -0.0068 0.0228  0.0118  67   GLU A O   
518  C  CB  A GLU A 67  ? 0.2375 0.1770 0.0952 -0.0328 0.0273  -0.0186 67   GLU A CB  
519  C  CB  B GLU A 67  ? 0.1403 0.1888 0.1110 0.0276  0.0188  -0.0363 67   GLU A CB  
520  C  CG  A GLU A 67  ? 0.3126 0.1992 0.1136 0.0020  0.0576  0.0122  67   GLU A CG  
521  C  CG  B GLU A 67  ? 0.3057 0.1974 0.1550 0.0160  -0.0443 -0.0021 67   GLU A CG  
522  C  CD  A GLU A 67  ? 0.3615 0.0982 0.1690 -0.0412 -0.0295 -0.0355 67   GLU A CD  
523  C  CD  B GLU A 67  ? 0.2932 0.1736 0.1916 0.0282  -0.0633 0.0105  67   GLU A CD  
524  O  OE1 A GLU A 67  ? 0.2708 0.1139 0.3484 0.0177  -0.0175 0.0379  67   GLU A OE1 
525  O  OE1 B GLU A 67  ? 0.2480 0.2633 0.3985 0.0005  -0.1396 0.1387  67   GLU A OE1 
526  O  OE2 A GLU A 67  ? 0.4152 0.3345 0.0608 -0.1953 0.0478  -0.0254 67   GLU A OE2 
527  O  OE2 B GLU A 67  ? 0.2963 0.1479 0.2023 0.0407  -0.0449 0.0670  67   GLU A OE2 
528  N  N   . GLN A 68  ? 0.1371 0.1290 0.1275 0.0035  -0.0194 -0.0100 68   GLN A N   
529  C  CA  . GLN A 68  ? 0.2072 0.1263 0.0919 -0.0063 -0.0132 -0.0234 68   GLN A CA  
530  C  C   . GLN A 68  ? 0.1867 0.1470 0.1038 0.0084  -0.0234 -0.0116 68   GLN A C   
531  O  O   . GLN A 68  ? 0.2002 0.1399 0.1319 0.0107  -0.0100 -0.0074 68   GLN A O   
532  C  CB  . GLN A 68  ? 0.2031 0.1007 0.0860 0.0049  -0.0191 0.0048  68   GLN A CB  
533  C  CG  . GLN A 68  ? 0.1876 0.1809 0.0895 -0.0222 -0.0143 0.0070  68   GLN A CG  
534  C  CD  . GLN A 68  ? 0.2111 0.1942 0.0878 -0.0509 -0.0020 -0.0048 68   GLN A CD  
535  O  OE1 . GLN A 68  ? 0.2396 0.2047 0.1258 -0.0467 0.0286  0.0353  68   GLN A OE1 
536  N  NE2 . GLN A 68  ? 0.2474 0.2495 0.0976 -0.0581 -0.0351 -0.0010 68   GLN A NE2 
537  N  N   . LEU A 69  ? 0.1389 0.1596 0.0789 0.0300  -0.0107 0.0177  69   LEU A N   
538  C  CA  . LEU A 69  ? 0.1560 0.1194 0.0805 0.0133  -0.0095 0.0192  69   LEU A CA  
539  C  C   . LEU A 69  ? 0.1523 0.1224 0.0996 0.0222  -0.0182 0.0129  69   LEU A C   
540  O  O   . LEU A 69  ? 0.1699 0.1612 0.1033 -0.0010 -0.0248 0.0010  69   LEU A O   
541  C  CB  . LEU A 69  ? 0.1724 0.1384 0.0817 -0.0036 0.0042  0.0076  69   LEU A CB  
542  C  CG  . LEU A 69  ? 0.1418 0.1281 0.1507 0.0264  -0.0125 0.0269  69   LEU A CG  
543  C  CD1 . LEU A 69  ? 0.1739 0.1829 0.1769 0.0565  -0.0037 0.0064  69   LEU A CD1 
544  C  CD2 . LEU A 69  ? 0.2386 0.1236 0.2125 0.0065  0.0321  0.0434  69   LEU A CD2 
545  N  N   . GLY A 70  ? 0.1621 0.1347 0.1188 -0.0041 -0.0189 0.0188  70   GLY A N   
546  C  CA  . GLY A 70  ? 0.1558 0.1451 0.1420 0.0067  -0.0138 0.0102  70   GLY A CA  
547  C  C   . GLY A 70  ? 0.1316 0.1306 0.1104 -0.0133 0.0104  0.0300  70   GLY A C   
548  O  O   . GLY A 70  ? 0.1367 0.1748 0.1178 0.0079  -0.0039 0.0085  70   GLY A O   
549  N  N   . LEU A 71  ? 0.1459 0.1401 0.1069 0.0030  -0.0202 0.0235  71   LEU A N   
550  C  CA  . LEU A 71  ? 0.1871 0.1441 0.1318 -0.0087 0.0257  0.0099  71   LEU A CA  
551  C  C   . LEU A 71  ? 0.1632 0.1525 0.1076 -0.0044 0.0121  -0.0037 71   LEU A C   
552  O  O   . LEU A 71  ? 0.2333 0.1388 0.1123 -0.0012 0.0154  -0.0077 71   LEU A O   
553  C  CB  . LEU A 71  ? 0.1689 0.1993 0.0868 -0.0130 0.0043  0.0011  71   LEU A CB  
554  C  CG  . LEU A 71  ? 0.1617 0.1346 0.0920 0.0273  0.0033  0.0104  71   LEU A CG  
555  C  CD1 . LEU A 71  ? 0.1629 0.1724 0.1350 0.0379  0.0187  -0.0060 71   LEU A CD1 
556  C  CD2 . LEU A 71  ? 0.2382 0.1510 0.0937 0.0338  -0.0302 0.0093  71   LEU A CD2 
557  N  N   . ALA A 72  ? 0.1654 0.1404 0.1051 0.0036  0.0135  0.0089  72   ALA A N   
558  C  CA  . ALA A 72  ? 0.1708 0.1753 0.1197 -0.0128 0.0106  0.0133  72   ALA A CA  
559  C  C   . ALA A 72  ? 0.1944 0.1889 0.1181 -0.0212 -0.0145 0.0029  72   ALA A C   
560  O  O   . ALA A 72  ? 0.2134 0.2064 0.2011 -0.0417 -0.0267 0.0067  72   ALA A O   
561  C  CB  . ALA A 72  ? 0.2313 0.2155 0.1244 -0.0026 0.0148  0.0824  72   ALA A CB  
562  N  N   . GLU A 73  ? 0.1796 0.1996 0.1207 -0.0263 -0.0098 0.0190  73   GLU A N   
563  C  CA  . GLU A 73  ? 0.1757 0.2258 0.1089 -0.0067 0.0034  0.0185  73   GLU A CA  
564  C  C   . GLU A 73  ? 0.1796 0.1957 0.1073 -0.0162 0.0031  0.0226  73   GLU A C   
565  O  O   . GLU A 73  ? 0.2006 0.1686 0.1296 -0.0306 0.0270  0.0203  73   GLU A O   
566  C  CB  . GLU A 73  ? 0.2652 0.2480 0.1452 0.0645  0.0728  0.0236  73   GLU A CB  
567  C  CG  . GLU A 73  ? 0.6088 0.4440 0.3328 -0.0201 0.1607  -0.2059 73   GLU A CG  
568  C  CD  . GLU A 73  ? 0.7882 0.4537 0.6788 0.0875  0.2148  -0.2952 73   GLU A CD  
569  O  OE1 . GLU A 73  ? 1.6393 0.5713 1.4511 -0.2730 -0.0967 -0.5331 73   GLU A OE1 
570  O  OE2 . GLU A 73  ? 0.6185 0.7091 1.1197 0.1683  0.1050  0.0723  73   GLU A OE2 
571  N  N   . ASP A 74  ? 0.2062 0.2068 0.1294 -0.0348 -0.0156 0.0235  74   ASP A N   
572  C  CA  . ASP A 74  ? 0.2197 0.2044 0.1188 -0.0723 -0.0067 0.0366  74   ASP A CA  
573  C  C   . ASP A 74  ? 0.1556 0.2098 0.1313 -0.0255 -0.0110 0.0296  74   ASP A C   
574  O  O   . ASP A 74  ? 0.1975 0.3091 0.2202 -0.0247 -0.0701 0.0488  74   ASP A O   
575  C  CB  . ASP A 74  ? 0.2900 0.2691 0.1590 -0.1289 -0.0689 0.0567  74   ASP A CB  
576  C  CG  . ASP A 74  ? 0.3768 0.2725 0.1721 -0.1484 -0.0642 0.0333  74   ASP A CG  
577  O  OD1 . ASP A 74  ? 0.3991 0.4323 0.2425 -0.1788 -0.0683 -0.0546 74   ASP A OD1 
578  O  OD2 . ASP A 74  ? 0.4124 0.3305 0.2282 -0.1587 -0.0072 -0.0459 74   ASP A OD2 
579  N  N   . LYS A 75  ? 0.1699 0.1745 0.1433 -0.0201 -0.0009 0.0480  75   LYS A N   
580  C  CA  . LYS A 75  ? 0.2059 0.1791 0.1425 0.0471  0.0479  0.0579  75   LYS A CA  
581  C  C   . LYS A 75  ? 0.1525 0.1366 0.1047 0.0246  -0.0205 0.0563  75   LYS A C   
582  O  O   . LYS A 75  ? 0.1997 0.1220 0.1286 -0.0015 -0.0161 0.0196  75   LYS A O   
583  C  CB  A LYS A 75  ? 0.3242 0.1814 0.1848 0.0634  0.0770  0.0458  75   LYS A CB  
584  C  CB  B LYS A 75  ? 0.2971 0.1923 0.1658 0.0210  0.0720  0.0219  75   LYS A CB  
585  C  CG  A LYS A 75  ? 0.3964 0.1584 0.1448 0.0561  0.0759  0.0527  75   LYS A CG  
586  C  CG  B LYS A 75  ? 0.4421 0.2941 0.0908 -0.0217 0.0078  0.0469  75   LYS A CG  
587  C  CD  A LYS A 75  ? 0.6032 0.2452 0.1987 0.0576  0.0865  -0.0484 75   LYS A CD  
588  C  CD  B LYS A 75  ? 0.6527 0.3323 0.2124 0.0173  0.0445  -0.0616 75   LYS A CD  
589  C  CE  A LYS A 75  ? 0.7477 0.3144 0.1872 0.0053  -0.0102 -0.0567 75   LYS A CE  
590  C  CE  B LYS A 75  ? 0.8315 0.3186 0.3215 0.0057  0.0185  -0.0744 75   LYS A CE  
591  N  NZ  A LYS A 75  ? 1.0171 0.2573 0.3135 0.0337  -0.0792 -0.0752 75   LYS A NZ  
592  N  NZ  B LYS A 75  ? 0.9302 0.3144 0.1434 0.1333  -0.0817 0.0214  75   LYS A NZ  
593  N  N   . PHE A 76  ? 0.1404 0.1348 0.1272 0.0161  -0.0170 0.0414  76   PHE A N   
594  C  CA  . PHE A 76  ? 0.1425 0.1269 0.1124 0.0059  -0.0191 0.0161  76   PHE A CA  
595  C  C   . PHE A 76  ? 0.1811 0.1155 0.1061 -0.0120 -0.0132 0.0258  76   PHE A C   
596  O  O   . PHE A 76  ? 0.2458 0.1214 0.1133 -0.0290 0.0178  0.0217  76   PHE A O   
597  C  CB  . PHE A 76  ? 0.1385 0.1241 0.1133 0.0284  -0.0097 0.0133  76   PHE A CB  
598  C  CG  . PHE A 76  ? 0.1601 0.1439 0.0910 -0.0103 -0.0091 0.0193  76   PHE A CG  
599  C  CD1 . PHE A 76  ? 0.1541 0.1433 0.0835 -0.0253 -0.0311 0.0286  76   PHE A CD1 
600  C  CD2 . PHE A 76  ? 0.1077 0.1771 0.0822 -0.0360 0.0007  0.0070  76   PHE A CD2 
601  C  CE1 . PHE A 76  ? 0.1887 0.1675 0.0833 -0.0247 -0.0030 0.0227  76   PHE A CE1 
602  C  CE2 . PHE A 76  ? 0.1180 0.1287 0.0864 0.0214  -0.0071 0.0262  76   PHE A CE2 
603  C  CZ  . PHE A 76  ? 0.1754 0.1547 0.0617 -0.0068 -0.0088 0.0144  76   PHE A CZ  
604  N  N   . THR A 77  ? 0.1438 0.1271 0.0986 -0.0256 -0.0344 0.0264  77   THR A N   
605  C  CA  . THR A 77  ? 0.1629 0.1506 0.0946 -0.0195 -0.0246 0.0159  77   THR A CA  
606  C  C   . THR A 77  ? 0.1696 0.1813 0.0678 -0.0073 -0.0112 0.0102  77   THR A C   
607  O  O   . THR A 77  ? 0.1675 0.1336 0.0929 -0.0072 -0.0230 0.0097  77   THR A O   
608  C  CB  . THR A 77  ? 0.1966 0.1001 0.1210 -0.0152 -0.0036 0.0160  77   THR A CB  
609  O  OG1 . THR A 77  ? 0.1873 0.1215 0.1176 -0.0043 -0.0151 0.0150  77   THR A OG1 
610  C  CG2 . THR A 77  ? 0.1942 0.1238 0.1083 -0.0077 -0.0318 0.0022  77   THR A CG2 
611  N  N   . ASP A 78  ? 0.1646 0.1492 0.0849 -0.0120 -0.0477 0.0213  78   ASP A N   
612  C  CA  . ASP A 78  ? 0.1857 0.1547 0.0959 0.0011  -0.0398 0.0147  78   ASP A CA  
613  C  C   . ASP A 78  ? 0.1644 0.1743 0.0716 0.0145  0.0036  0.0009  78   ASP A C   
614  O  O   . ASP A 78  ? 0.1940 0.1243 0.1021 -0.0133 -0.0323 0.0016  78   ASP A O   
615  C  CB  . ASP A 78  ? 0.2898 0.1473 0.1399 0.0117  -0.0474 -0.0048 78   ASP A CB  
616  C  CG  . ASP A 78  ? 0.2467 0.1585 0.1651 0.0057  -0.0759 -0.0080 78   ASP A CG  
617  O  OD1 . ASP A 78  ? 0.3671 0.2086 0.2184 -0.0478 -0.0792 -0.0463 78   ASP A OD1 
618  O  OD2 . ASP A 78  ? 0.2511 0.2150 0.2422 0.0007  -0.0029 -0.0127 78   ASP A OD2 
619  N  N   . ASP A 79  ? 0.1705 0.1709 0.0734 -0.0012 -0.0186 -0.0008 79   ASP A N   
620  C  CA  . ASP A 79  ? 0.1518 0.1358 0.0823 0.0248  -0.0022 -0.0090 79   ASP A CA  
621  C  C   . ASP A 79  ? 0.1684 0.1219 0.0657 0.0115  0.0082  0.0026  79   ASP A C   
622  O  O   . ASP A 79  ? 0.1670 0.1427 0.0970 0.0046  -0.0082 -0.0005 79   ASP A O   
623  C  CB  . ASP A 79  ? 0.1915 0.2438 0.0637 -0.0066 0.0126  0.0068  79   ASP A CB  
624  C  CG  . ASP A 79  ? 0.2335 0.2468 0.0746 0.0124  -0.0144 -0.0017 79   ASP A CG  
625  O  OD1 . ASP A 79  ? 0.2727 0.2181 0.1305 -0.0164 -0.0361 0.0025  79   ASP A OD1 
626  O  OD2 . ASP A 79  ? 0.2717 0.2593 0.2099 0.0668  -0.0482 -0.0608 79   ASP A OD2 
627  N  N   . GLN A 80  ? 0.1813 0.1167 0.0701 0.0122  0.0077  0.0025  80   GLN A N   
628  C  CA  . GLN A 80  ? 0.1310 0.0944 0.0825 0.0074  -0.0095 -0.0028 80   GLN A CA  
629  C  C   . GLN A 80  ? 0.1273 0.1238 0.0816 0.0101  -0.0076 0.0170  80   GLN A C   
630  O  O   . GLN A 80  ? 0.1435 0.1382 0.0956 0.0021  -0.0177 0.0126  80   GLN A O   
631  C  CB  . GLN A 80  ? 0.1337 0.1050 0.0931 0.0178  -0.0112 0.0044  80   GLN A CB  
632  C  CG  . GLN A 80  ? 0.1334 0.1265 0.1218 0.0087  -0.0334 0.0250  80   GLN A CG  
633  C  CD  . GLN A 80  ? 0.1330 0.1134 0.1014 0.0046  -0.0403 0.0398  80   GLN A CD  
634  O  OE1 . GLN A 80  ? 0.1599 0.1278 0.1079 -0.0094 -0.0048 0.0294  80   GLN A OE1 
635  N  NE2 . GLN A 80  ? 0.1536 0.1103 0.0839 0.0078  -0.0117 0.0259  80   GLN A NE2 
636  N  N   . LEU A 81  ? 0.1541 0.1200 0.0923 0.0104  -0.0177 0.0175  81   LEU A N   
637  C  CA  . LEU A 81  ? 0.1426 0.1175 0.0785 0.0045  0.0058  0.0155  81   LEU A CA  
638  C  C   . LEU A 81  ? 0.1340 0.1076 0.0744 -0.0053 -0.0117 0.0171  81   LEU A C   
639  O  O   . LEU A 81  ? 0.1590 0.1629 0.0751 -0.0180 -0.0275 0.0235  81   LEU A O   
640  C  CB  . LEU A 81  ? 0.1418 0.1487 0.0893 -0.0225 -0.0164 0.0310  81   LEU A CB  
641  C  CG  . LEU A 81  ? 0.1481 0.1261 0.0950 -0.0165 -0.0095 0.0212  81   LEU A CG  
642  C  CD1 . LEU A 81  ? 0.1381 0.1261 0.1647 -0.0165 0.0054  -0.0050 81   LEU A CD1 
643  C  CD2 . LEU A 81  ? 0.1579 0.1516 0.1045 -0.0323 -0.0103 0.0044  81   LEU A CD2 
644  N  N   . ILE A 82  ? 0.1205 0.1391 0.0753 0.0058  -0.0105 0.0044  82   ILE A N   
645  C  CA  . ILE A 82  ? 0.1315 0.1338 0.0917 0.0315  -0.0155 0.0211  82   ILE A CA  
646  C  C   . ILE A 82  ? 0.1093 0.1505 0.0910 0.0212  0.0094  0.0241  82   ILE A C   
647  O  O   . ILE A 82  ? 0.1417 0.1557 0.0843 0.0202  -0.0156 0.0253  82   ILE A O   
648  C  CB  A ILE A 82  ? 0.1617 0.1257 0.0916 0.0336  0.0100  0.0248  82   ILE A CB  
649  C  CB  B ILE A 82  ? 0.1484 0.1213 0.0958 0.0346  0.0108  0.0206  82   ILE A CB  
650  C  CG1 A ILE A 82  ? 0.1719 0.1805 0.1172 -0.0199 0.0124  -0.0077 82   ILE A CG1 
651  C  CG1 B ILE A 82  ? 0.1052 0.1385 0.1243 0.0466  0.0002  -0.0073 82   ILE A CG1 
652  C  CG2 A ILE A 82  ? 0.1713 0.1644 0.1281 -0.0095 0.0212  -0.0141 82   ILE A CG2 
653  C  CG2 B ILE A 82  ? 0.1020 0.0948 0.0219 0.0679  -0.0734 0.0801  82   ILE A CG2 
654  C  CD1 A ILE A 82  ? 0.2098 0.2461 0.1273 0.0111  0.0098  -0.0421 82   ILE A CD1 
655  C  CD1 B ILE A 82  ? 0.0706 0.1105 0.1881 0.0179  -0.1063 -0.0013 82   ILE A CD1 
656  N  N   . ASP A 83  ? 0.1194 0.1425 0.0748 0.0010  -0.0193 0.0187  83   ASP A N   
657  C  CA  . ASP A 83  ? 0.1338 0.1604 0.0885 -0.0216 -0.0200 0.0183  83   ASP A CA  
658  C  C   . ASP A 83  ? 0.1722 0.1340 0.0940 -0.0212 -0.0148 0.0117  83   ASP A C   
659  O  O   . ASP A 83  ? 0.1722 0.1921 0.0764 -0.0155 -0.0198 0.0030  83   ASP A O   
660  C  CB  . ASP A 83  ? 0.1982 0.1457 0.1027 -0.0051 0.0011  0.0258  83   ASP A CB  
661  C  CG  . ASP A 83  ? 0.1494 0.2471 0.1007 -0.0115 0.0001  0.0533  83   ASP A CG  
662  O  OD1 . ASP A 83  ? 0.1892 0.2705 0.1153 0.0095  -0.0262 0.0365  83   ASP A OD1 
663  O  OD2 . ASP A 83  ? 0.1729 0.2953 0.1515 0.0411  0.0198  0.0696  83   ASP A OD2 
664  N  N   . PHE A 84  ? 0.1598 0.1333 0.0835 0.0149  -0.0119 0.0112  84   PHE A N   
665  C  CA  . PHE A 84  ? 0.1515 0.1088 0.0916 -0.0014 -0.0168 0.0004  84   PHE A CA  
666  C  C   . PHE A 84  ? 0.1493 0.0979 0.0905 -0.0148 -0.0081 0.0232  84   PHE A C   
667  O  O   . PHE A 84  ? 0.1356 0.1325 0.1020 0.0071  -0.0115 0.0020  84   PHE A O   
668  C  CB  . PHE A 84  ? 0.1537 0.1085 0.0924 0.0009  -0.0136 0.0205  84   PHE A CB  
669  C  CG  . PHE A 84  ? 0.1736 0.1105 0.0824 0.0144  0.0008  0.0306  84   PHE A CG  
670  C  CD1 . PHE A 84  ? 0.1685 0.1096 0.1321 0.0113  0.0224  0.0268  84   PHE A CD1 
671  C  CD2 . PHE A 84  ? 0.1711 0.1197 0.1275 0.0332  -0.0013 -0.0176 84   PHE A CD2 
672  C  CE1 . PHE A 84  ? 0.2104 0.1259 0.1829 0.0365  -0.0048 0.0010  84   PHE A CE1 
673  C  CE2 . PHE A 84  ? 0.1782 0.1165 0.1286 0.0317  0.0340  0.0317  84   PHE A CE2 
674  C  CZ  . PHE A 84  ? 0.1986 0.1090 0.1323 0.0459  0.0115  0.0287  84   PHE A CZ  
675  N  N   . MET A 85  ? 0.1951 0.1125 0.0834 0.0219  -0.0130 0.0063  85   MET A N   
676  C  CA  . MET A 85  ? 0.1716 0.1239 0.0804 0.0173  0.0023  0.0078  85   MET A CA  
677  C  C   . MET A 85  ? 0.1769 0.1760 0.0594 -0.0028 -0.0086 0.0116  85   MET A C   
678  O  O   . MET A 85  ? 0.1881 0.2037 0.0750 0.0146  -0.0264 0.0090  85   MET A O   
679  C  CB  A MET A 85  ? 0.2041 0.1127 0.0995 0.0219  -0.0001 0.0085  85   MET A CB  
680  C  CB  B MET A 85  ? 0.2086 0.1088 0.0937 0.0223  -0.0566 0.0235  85   MET A CB  
681  C  CG  A MET A 85  ? 0.1814 0.1181 0.1467 0.0214  -0.0171 0.0032  85   MET A CG  
682  C  CG  B MET A 85  ? 0.1506 0.1448 0.1340 0.0040  -0.0636 -0.0333 85   MET A CG  
683  S  SD  A MET A 85  ? 0.2533 0.1519 0.1031 -0.0242 0.0285  0.0025  85   MET A SD  
684  S  SD  B MET A 85  ? 0.1797 0.1268 0.1796 0.0118  -0.0242 -0.0263 85   MET A SD  
685  C  CE  A MET A 85  ? 0.0172 0.2130 0.4331 0.0352  -0.0292 -0.0217 85   MET A CE  
686  C  CE  B MET A 85  ? 0.3616 0.2841 0.6667 -0.0650 -0.3486 -0.0774 85   MET A CE  
687  N  N   . LEU A 86  ? 0.1625 0.1903 0.0585 -0.0013 -0.0076 0.0152  86   LEU A N   
688  C  CA  . LEU A 86  ? 0.1626 0.1577 0.1112 0.0052  -0.0036 0.0357  86   LEU A CA  
689  C  C   . LEU A 86  ? 0.1643 0.1858 0.1025 -0.0119 -0.0063 0.0311  86   LEU A C   
690  O  O   . LEU A 86  ? 0.1646 0.2422 0.1594 -0.0241 -0.0161 0.0263  86   LEU A O   
691  C  CB  . LEU A 86  ? 0.1697 0.2011 0.0992 -0.0248 0.0092  0.0179  86   LEU A CB  
692  C  CG  . LEU A 86  ? 0.1820 0.1999 0.1345 0.0242  -0.0428 0.0036  86   LEU A CG  
693  C  CD1 . LEU A 86  ? 0.3297 0.3486 0.1077 -0.0126 -0.0521 0.0156  86   LEU A CD1 
694  C  CD2 . LEU A 86  ? 0.1635 0.2800 0.2436 0.0370  0.0268  -0.0221 86   LEU A CD2 
695  N  N   . GLN A 87  ? 0.1707 0.1862 0.0898 -0.0238 0.0009  0.0073  87   GLN A N   
696  C  CA  . GLN A 87  ? 0.2214 0.1763 0.1027 -0.0511 -0.0072 0.0165  87   GLN A CA  
697  C  C   . GLN A 87  ? 0.1755 0.2019 0.0945 -0.0560 0.0000  0.0050  87   GLN A C   
698  O  O   . GLN A 87  ? 0.2132 0.1902 0.1068 -0.0626 -0.0064 0.0044  87   GLN A O   
699  C  CB  . GLN A 87  ? 0.2954 0.1526 0.1516 -0.0355 -0.0174 0.0229  87   GLN A CB  
700  C  CG  . GLN A 87  ? 0.3331 0.2366 0.1777 -0.0160 -0.0110 0.0754  87   GLN A CG  
701  C  CD  . GLN A 87  ? 0.4348 0.3981 0.1966 -0.1800 0.0246  0.0387  87   GLN A CD  
702  O  OE1 . GLN A 87  ? 0.4882 0.8768 0.2187 -0.0064 0.0919  0.0753  87   GLN A OE1 
703  N  NE2 . GLN A 87  ? 0.5656 0.4177 0.3496 -0.2530 -0.2475 0.2385  87   GLN A NE2 
704  N  N   . HIS A 88  ? 0.1367 0.1696 0.0791 -0.0220 -0.0189 0.0022  88   HIS A N   
705  C  CA  . HIS A 88  ? 0.1499 0.1325 0.0753 -0.0070 -0.0043 -0.0130 88   HIS A CA  
706  C  C   . HIS A 88  ? 0.1652 0.1361 0.0819 -0.0111 0.0173  -0.0170 88   HIS A C   
707  O  O   . HIS A 88  ? 0.1553 0.1309 0.1027 -0.0012 -0.0164 0.0137  88   HIS A O   
708  C  CB  . HIS A 88  ? 0.1473 0.1535 0.1006 0.0120  -0.0002 0.0278  88   HIS A CB  
709  C  CG  . HIS A 88  ? 0.1933 0.1578 0.1446 0.0281  0.0183  0.0151  88   HIS A CG  
710  N  ND1 . HIS A 88  ? 0.3149 0.1670 0.2239 0.0199  -0.0066 -0.0173 88   HIS A ND1 
711  C  CD2 . HIS A 88  ? 0.2534 0.1527 0.2353 0.0525  -0.0335 0.0421  88   HIS A CD2 
712  C  CE1 . HIS A 88  ? 0.2945 0.1705 0.2907 0.0586  0.0205  -0.0211 88   HIS A CE1 
713  N  NE2 . HIS A 88  ? 0.2552 0.1595 0.2691 0.0639  0.0348  0.0214  88   HIS A NE2 
714  N  N   . PRO A 89  ? 0.1583 0.1407 0.1059 0.0020  -0.0046 0.0042  89   PRO A N   
715  C  CA  . PRO A 89  ? 0.1634 0.1457 0.1043 0.0029  0.0156  0.0028  89   PRO A CA  
716  C  C   . PRO A 89  ? 0.1104 0.1326 0.0980 0.0472  0.0047  0.0079  89   PRO A C   
717  O  O   . PRO A 89  ? 0.1680 0.1295 0.1051 0.0362  0.0101  0.0064  89   PRO A O   
718  C  CB  . PRO A 89  ? 0.1723 0.1774 0.1674 0.0301  0.0489  0.0621  89   PRO A CB  
719  C  CG  . PRO A 89  ? 0.1450 0.1523 0.2753 0.0024  0.0071  0.0145  89   PRO A CG  
720  C  CD  . PRO A 89  ? 0.1641 0.1645 0.1386 -0.0145 0.0035  0.0096  89   PRO A CD  
721  N  N   . ILE A 90  ? 0.1630 0.1423 0.0891 0.0101  -0.0067 0.0019  90   ILE A N   
722  C  CA  . ILE A 90  ? 0.1817 0.1433 0.0734 0.0098  -0.0130 0.0038  90   ILE A CA  
723  C  C   . ILE A 90  ? 0.1735 0.1657 0.0546 0.0054  0.0118  0.0136  90   ILE A C   
724  O  O   . ILE A 90  ? 0.1463 0.1809 0.0843 0.0218  0.0113  0.0446  90   ILE A O   
725  C  CB  A ILE A 90  ? 0.2402 0.1873 0.0917 -0.0279 0.0140  -0.0233 90   ILE A CB  
726  C  CB  B ILE A 90  ? 0.1744 0.1629 0.0999 0.0050  0.0185  -0.0210 90   ILE A CB  
727  C  CG1 A ILE A 90  ? 0.2934 0.2042 0.0805 -0.0742 0.0413  -0.0380 90   ILE A CG1 
728  C  CG1 B ILE A 90  ? 0.1997 0.2074 0.0914 -0.0271 0.0333  -0.0236 90   ILE A CG1 
729  C  CG2 A ILE A 90  ? 0.2352 0.2404 0.0720 -0.0036 -0.0114 -0.0902 90   ILE A CG2 
730  C  CG2 B ILE A 90  ? 0.1892 0.1972 0.1637 0.0280  -0.0316 -0.0632 90   ILE A CG2 
731  C  CD1 A ILE A 90  ? 0.1833 0.1379 0.0967 -0.0093 0.0950  -0.0453 90   ILE A CD1 
732  C  CD1 B ILE A 90  ? 0.3508 0.2241 0.1422 0.0447  0.0350  0.0398  90   ILE A CD1 
733  N  N   . LEU A 91  ? 0.1364 0.1083 0.0956 0.0096  0.0168  0.0083  91   LEU A N   
734  C  CA  . LEU A 91  ? 0.1363 0.1051 0.1169 0.0095  0.0095  0.0212  91   LEU A CA  
735  C  C   . LEU A 91  ? 0.1291 0.1110 0.1037 0.0034  0.0052  0.0199  91   LEU A C   
736  O  O   . LEU A 91  ? 0.1242 0.1301 0.1490 -0.0021 0.0248  -0.0063 91   LEU A O   
737  C  CB  . LEU A 91  ? 0.1516 0.1162 0.0944 0.0195  0.0150  0.0151  91   LEU A CB  
738  C  CG  . LEU A 91  ? 0.1456 0.1106 0.1054 0.0180  0.0232  0.0208  91   LEU A CG  
739  C  CD1 . LEU A 91  ? 0.2370 0.1261 0.0966 0.0399  0.0144  0.0263  91   LEU A CD1 
740  C  CD2 . LEU A 91  ? 0.1189 0.2206 0.0926 0.0331  0.0153  0.0419  91   LEU A CD2 
741  N  N   . ILE A 92  ? 0.1197 0.0997 0.1058 -0.0071 -0.0005 0.0105  92   ILE A N   
742  C  CA  . ILE A 92  ? 0.1286 0.0930 0.1415 0.0230  -0.0305 0.0015  92   ILE A CA  
743  C  C   . ILE A 92  ? 0.0949 0.1039 0.1209 0.0322  -0.0118 -0.0044 92   ILE A C   
744  O  O   . ILE A 92  ? 0.1138 0.1357 0.1102 0.0268  -0.0224 -0.0001 92   ILE A O   
745  C  CB  . ILE A 92  ? 0.1685 0.1067 0.0896 0.0256  -0.0204 -0.0030 92   ILE A CB  
746  C  CG1 . ILE A 92  ? 0.1722 0.1210 0.1194 0.0246  -0.0288 0.0176  92   ILE A CG1 
747  C  CG2 . ILE A 92  ? 0.2182 0.1193 0.1162 0.0153  -0.0170 -0.0218 92   ILE A CG2 
748  C  CD1 . ILE A 92  ? 0.2082 0.1367 0.1454 0.0404  0.0148  0.0292  92   ILE A CD1 
749  N  N   . ASN A 93  ? 0.1146 0.1368 0.0869 0.0075  0.0002  0.0047  93   ASN A N   
750  C  CA  . ASN A 93  ? 0.1503 0.1324 0.0958 -0.0002 -0.0155 0.0119  93   ASN A CA  
751  C  C   . ASN A 93  ? 0.1510 0.1363 0.1093 0.0044  -0.0133 0.0122  93   ASN A C   
752  O  O   . ASN A 93  ? 0.1880 0.1140 0.1055 0.0260  -0.0101 0.0244  93   ASN A O   
753  C  CB  . ASN A 93  ? 0.1502 0.1267 0.1133 0.0051  -0.0121 0.0154  93   ASN A CB  
754  C  CG  . ASN A 93  ? 0.1404 0.1006 0.1118 0.0095  -0.0118 0.0143  93   ASN A CG  
755  O  OD1 . ASN A 93  ? 0.1523 0.1704 0.1026 0.0346  -0.0127 -0.0075 93   ASN A OD1 
756  N  ND2 . ASN A 93  ? 0.1338 0.1751 0.1284 0.0301  0.0150  0.0042  93   ASN A ND2 
757  N  N   . ARG A 94  ? 0.1590 0.1250 0.0768 0.0105  -0.0064 -0.0056 94   ARG A N   
758  C  CA  . ARG A 94  ? 0.1464 0.1220 0.0600 0.0036  0.0050  0.0002  94   ARG A CA  
759  C  C   . ARG A 94  ? 0.1273 0.1211 0.0832 -0.0087 0.0071  -0.0008 94   ARG A C   
760  O  O   . ARG A 94  ? 0.1584 0.1411 0.0759 -0.0084 0.0177  0.0076  94   ARG A O   
761  C  CB  . ARG A 94  ? 0.1722 0.0966 0.0869 0.0296  -0.0290 -0.0176 94   ARG A CB  
762  C  CG  . ARG A 94  ? 0.1738 0.1104 0.0925 -0.0067 -0.0126 -0.0229 94   ARG A CG  
763  C  CD  . ARG A 94  ? 0.1872 0.1717 0.0820 0.0305  -0.0060 0.0166  94   ARG A CD  
764  N  NE  . ARG A 94  ? 0.2306 0.1224 0.0907 0.0302  0.0142  0.0068  94   ARG A NE  
765  C  CZ  . ARG A 94  ? 0.2354 0.1326 0.0924 0.0309  0.0013  0.0098  94   ARG A CZ  
766  N  NH1 . ARG A 94  ? 0.3285 0.1314 0.0795 0.0060  -0.0150 0.0062  94   ARG A NH1 
767  N  NH2 . ARG A 94  ? 0.3205 0.1463 0.0853 0.0411  -0.0002 0.0160  94   ARG A NH2 
768  N  N   . PRO A 95  ? 0.1487 0.1084 0.0682 -0.0094 0.0049  -0.0053 95   PRO A N   
769  C  CA  . PRO A 95  ? 0.1271 0.1334 0.0700 0.0134  -0.0033 0.0032  95   PRO A CA  
770  C  C   . PRO A 95  ? 0.1257 0.1270 0.0663 -0.0029 -0.0015 0.0077  95   PRO A C   
771  O  O   . PRO A 95  ? 0.1443 0.2008 0.1129 -0.0612 -0.0150 0.0275  95   PRO A O   
772  C  CB  . PRO A 95  ? 0.1508 0.1329 0.0849 0.0242  -0.0199 -0.0088 95   PRO A CB  
773  C  CG  . PRO A 95  ? 0.1857 0.1308 0.0861 0.0168  -0.0343 0.0039  95   PRO A CG  
774  C  CD  . PRO A 95  ? 0.1790 0.1046 0.0849 -0.0157 -0.0243 -0.0006 95   PRO A CD  
775  N  N   . ILE A 96  ? 0.1794 0.1057 0.0674 -0.0188 0.0111  -0.0085 96   ILE A N   
776  C  CA  . ILE A 96  ? 0.1706 0.1063 0.0635 0.0044  0.0169  -0.0145 96   ILE A CA  
777  C  C   . ILE A 96  ? 0.1588 0.1024 0.0671 0.0056  -0.0145 -0.0141 96   ILE A C   
778  O  O   . ILE A 96  ? 0.1637 0.1319 0.0940 -0.0126 -0.0236 -0.0112 96   ILE A O   
779  C  CB  . ILE A 96  ? 0.1839 0.1114 0.0751 0.0211  -0.0097 -0.0157 96   ILE A CB  
780  C  CG1 . ILE A 96  ? 0.1669 0.1248 0.1012 0.0153  -0.0178 -0.0222 96   ILE A CG1 
781  C  CG2 . ILE A 96  ? 0.2212 0.1468 0.0728 0.0289  -0.0030 -0.0063 96   ILE A CG2 
782  C  CD1 . ILE A 96  ? 0.2193 0.1573 0.1630 0.0588  -0.0059 0.0318  96   ILE A CD1 
783  N  N   . VAL A 97  ? 0.1469 0.0966 0.1017 -0.0023 0.0054  -0.0159 97   VAL A N   
784  C  CA  . VAL A 97  ? 0.1667 0.1105 0.0686 0.0148  -0.0054 -0.0197 97   VAL A CA  
785  C  C   . VAL A 97  ? 0.1588 0.1358 0.0617 -0.0035 -0.0044 -0.0133 97   VAL A C   
786  O  O   . VAL A 97  ? 0.1548 0.1589 0.0811 0.0083  -0.0093 -0.0169 97   VAL A O   
787  C  CB  . VAL A 97  ? 0.1642 0.1156 0.0788 0.0117  -0.0086 -0.0084 97   VAL A CB  
788  C  CG1 . VAL A 97  ? 0.1770 0.1167 0.0944 0.0241  -0.0165 -0.0070 97   VAL A CG1 
789  C  CG2 . VAL A 97  ? 0.1804 0.1615 0.0767 0.0141  -0.0286 -0.0098 97   VAL A CG2 
790  N  N   . VAL A 98  ? 0.1570 0.1584 0.0784 0.0110  0.0006  -0.0114 98   VAL A N   
791  C  CA  . VAL A 98  ? 0.1659 0.1417 0.0804 0.0036  0.0166  -0.0108 98   VAL A CA  
792  C  C   . VAL A 98  ? 0.1678 0.1462 0.0816 0.0035  -0.0133 -0.0273 98   VAL A C   
793  O  O   . VAL A 98  ? 0.1542 0.1414 0.1034 -0.0056 -0.0024 -0.0399 98   VAL A O   
794  C  CB  . VAL A 98  ? 0.2035 0.1456 0.0807 -0.0054 0.0027  -0.0090 98   VAL A CB  
795  C  CG1 . VAL A 98  ? 0.3415 0.2051 0.0792 -0.0339 0.0320  -0.0091 98   VAL A CG1 
796  C  CG2 . VAL A 98  ? 0.2496 0.1411 0.1545 0.0058  0.0527  0.0144  98   VAL A CG2 
797  N  N   . THR A 99  ? 0.1867 0.1671 0.1154 0.0131  -0.0399 -0.0529 99   THR A N   
798  C  CA  . THR A 99  ? 0.2344 0.1509 0.1011 0.0299  -0.0095 -0.0239 99   THR A CA  
799  C  C   . THR A 99  ? 0.1944 0.1829 0.0954 0.0012  0.0194  -0.0172 99   THR A C   
800  O  O   . THR A 99  ? 0.2259 0.1821 0.0954 0.0161  -0.0143 -0.0515 99   THR A O   
801  C  CB  . THR A 99  ? 0.1823 0.1948 0.1176 0.0141  -0.0136 0.0104  99   THR A CB  
802  O  OG1 . THR A 99  ? 0.2570 0.2369 0.1073 -0.0312 -0.0502 -0.0071 99   THR A OG1 
803  C  CG2 . THR A 99  ? 0.1908 0.1985 0.1044 0.0079  -0.0261 -0.0146 99   THR A CG2 
804  N  N   . PRO A 100 ? 0.1883 0.2124 0.0953 0.0097  0.0100  -0.0278 100  PRO A N   
805  C  CA  . PRO A 100 ? 0.2398 0.1881 0.1206 0.0147  -0.0138 -0.0633 100  PRO A CA  
806  C  C   . PRO A 100 ? 0.2453 0.2086 0.1439 -0.0089 -0.0504 0.0033  100  PRO A C   
807  O  O   . PRO A 100 ? 0.2933 0.2090 0.1178 0.0456  -0.0559 -0.0518 100  PRO A O   
808  C  CB  . PRO A 100 ? 0.2668 0.2833 0.1747 0.0669  -0.0097 -0.0993 100  PRO A CB  
809  C  CG  . PRO A 100 ? 0.2305 0.2961 0.1955 0.0571  0.0102  -0.1125 100  PRO A CG  
810  C  CD  . PRO A 100 ? 0.1832 0.2672 0.1587 0.0257  -0.0093 -0.0550 100  PRO A CD  
811  N  N   . LEU A 101 ? 0.2386 0.1808 0.1432 0.0245  -0.0306 -0.0173 101  LEU A N   
812  C  CA  . LEU A 101 ? 0.2273 0.2149 0.1167 0.0478  0.0555  -0.0497 101  LEU A CA  
813  C  C   . LEU A 101 ? 0.2337 0.1773 0.1145 0.0279  -0.0110 -0.0784 101  LEU A C   
814  O  O   . LEU A 101 ? 0.2639 0.1963 0.2147 0.0468  -0.0765 -0.1005 101  LEU A O   
815  C  CB  . LEU A 101 ? 0.2264 0.2055 0.1276 0.0157  -0.0194 -0.0438 101  LEU A CB  
816  C  CG  . LEU A 101 ? 0.2294 0.2331 0.1372 0.0458  -0.0295 -0.0311 101  LEU A CG  
817  C  CD1 . LEU A 101 ? 0.1934 0.2306 0.1810 -0.0057 -0.0726 -0.0089 101  LEU A CD1 
818  C  CD2 . LEU A 101 ? 0.3484 0.1409 0.1745 -0.0137 -0.0417 -0.0395 101  LEU A CD2 
819  N  N   . GLY A 102 ? 0.2433 0.1688 0.0864 0.0318  -0.0273 -0.0545 102  GLY A N   
820  C  CA  . GLY A 102 ? 0.2576 0.1316 0.1020 0.0311  -0.0445 -0.0366 102  GLY A CA  
821  C  C   . GLY A 102 ? 0.1928 0.1440 0.0975 0.0261  -0.0302 -0.0394 102  GLY A C   
822  O  O   . GLY A 102 ? 0.1895 0.1741 0.1220 0.0288  -0.0338 -0.0543 102  GLY A O   
823  N  N   . THR A 103 ? 0.1857 0.1338 0.0972 0.0155  -0.0156 -0.0294 103  THR A N   
824  C  CA  . THR A 103 ? 0.1750 0.1451 0.0804 0.0158  -0.0119 -0.0284 103  THR A CA  
825  C  C   . THR A 103 ? 0.1631 0.1538 0.0911 0.0099  -0.0189 -0.0225 103  THR A C   
826  O  O   . THR A 103 ? 0.1779 0.1744 0.0964 -0.0265 -0.0244 -0.0223 103  THR A O   
827  C  CB  . THR A 103 ? 0.1536 0.1351 0.1018 -0.0087 -0.0293 -0.0323 103  THR A CB  
828  O  OG1 . THR A 103 ? 0.2243 0.1714 0.1164 -0.0034 0.0224  -0.0212 103  THR A OG1 
829  C  CG2 . THR A 103 ? 0.2205 0.1508 0.1159 -0.0155 -0.0047 -0.0469 103  THR A CG2 
830  N  N   . ARG A 104 ? 0.1527 0.1410 0.0836 -0.0002 -0.0108 -0.0071 104  ARG A N   
831  C  CA  . ARG A 104 ? 0.1389 0.1205 0.1030 0.0018  -0.0085 -0.0114 104  ARG A CA  
832  C  C   . ARG A 104 ? 0.1205 0.1209 0.0830 -0.0010 -0.0183 0.0011  104  ARG A C   
833  O  O   . ARG A 104 ? 0.1180 0.1542 0.1256 0.0045  -0.0194 -0.0217 104  ARG A O   
834  C  CB  . ARG A 104 ? 0.1924 0.1175 0.1246 0.0083  0.0483  -0.0241 104  ARG A CB  
835  C  CG  . ARG A 104 ? 0.2257 0.1305 0.1427 -0.0193 0.0480  -0.0345 104  ARG A CG  
836  C  CD  . ARG A 104 ? 0.2192 0.2775 0.2253 -0.0478 0.0382  -0.0855 104  ARG A CD  
837  N  NE  . ARG A 104 ? 0.2202 0.3096 0.3187 -0.0101 -0.0288 -0.1292 104  ARG A NE  
838  C  CZ  . ARG A 104 ? 0.2106 0.3247 0.3090 -0.0391 -0.0651 -0.1735 104  ARG A CZ  
839  N  NH1 . ARG A 104 ? 0.3659 0.5031 0.2838 -0.2073 -0.0267 -0.1911 104  ARG A NH1 
840  N  NH2 . ARG A 104 ? 0.3740 0.3313 0.3760 -0.0146 -0.1831 -0.1910 104  ARG A NH2 
841  N  N   . LEU A 105 ? 0.1226 0.1459 0.0990 0.0098  -0.0248 -0.0189 105  LEU A N   
842  C  CA  . LEU A 105 ? 0.1305 0.1332 0.1016 0.0005  -0.0073 -0.0082 105  LEU A CA  
843  C  C   . LEU A 105 ? 0.1298 0.1211 0.1026 0.0108  -0.0216 -0.0194 105  LEU A C   
844  O  O   . LEU A 105 ? 0.1448 0.1184 0.1301 -0.0022 -0.0392 0.0023  105  LEU A O   
845  C  CB  . LEU A 105 ? 0.1435 0.1341 0.0915 0.0109  0.0050  0.0108  105  LEU A CB  
846  C  CG  . LEU A 105 ? 0.1675 0.1199 0.1047 0.0049  -0.0053 -0.0164 105  LEU A CG  
847  C  CD1 . LEU A 105 ? 0.2050 0.1138 0.1578 -0.0255 -0.0159 -0.0020 105  LEU A CD1 
848  C  CD2 . LEU A 105 ? 0.1802 0.1562 0.1564 0.0270  0.0486  0.0071  105  LEU A CD2 
849  N  N   . CYS A 106 ? 0.1434 0.1338 0.1035 0.0088  -0.0359 -0.0186 106  CYS A N   
850  C  CA  . CYS A 106 ? 0.1452 0.1265 0.1139 0.0167  -0.0223 -0.0157 106  CYS A CA  
851  C  C   . CYS A 106 ? 0.1297 0.1480 0.1125 0.0026  -0.0214 -0.0147 106  CYS A C   
852  O  O   . CYS A 106 ? 0.1267 0.1417 0.1148 0.0006  -0.0315 -0.0248 106  CYS A O   
853  C  CB  . CYS A 106 ? 0.1491 0.1658 0.1066 0.0278  -0.0185 -0.0025 106  CYS A CB  
854  S  SG  . CYS A 106 ? 0.1782 0.1823 0.1207 0.0455  0.0000  0.0035  106  CYS A SG  
855  N  N   . ARG A 107 ? 0.1341 0.1759 0.1048 0.0083  -0.0288 -0.0018 107  ARG A N   
856  C  CA  . ARG A 107 ? 0.1391 0.1615 0.1185 0.0103  -0.0075 0.0030  107  ARG A CA  
857  C  C   . ARG A 107 ? 0.1333 0.1526 0.1472 0.0200  -0.0175 0.0047  107  ARG A C   
858  O  O   . ARG A 107 ? 0.1568 0.1856 0.1345 0.0000  -0.0237 0.0019  107  ARG A O   
859  C  CB  . ARG A 107 ? 0.1889 0.1577 0.1260 0.0091  -0.0053 -0.0049 107  ARG A CB  
860  C  CG  . ARG A 107 ? 0.1655 0.1580 0.0938 0.0192  -0.0107 0.0056  107  ARG A CG  
861  C  CD  . ARG A 107 ? 0.2166 0.1527 0.0921 0.0190  -0.0079 0.0060  107  ARG A CD  
862  N  NE  . ARG A 107 ? 0.1530 0.1901 0.1066 0.0393  -0.0069 -0.0100 107  ARG A NE  
863  C  CZ  . ARG A 107 ? 0.1465 0.1402 0.0903 0.0170  0.0273  -0.0339 107  ARG A CZ  
864  N  NH1 . ARG A 107 ? 0.1405 0.1467 0.0912 0.0356  0.0042  0.0195  107  ARG A NH1 
865  N  NH2 . ARG A 107 ? 0.1925 0.2919 0.0970 0.0150  0.0461  -0.0354 107  ARG A NH2 
866  N  N   . PRO A 108 ? 0.1359 0.1581 0.1256 0.0068  -0.0067 -0.0033 108  PRO A N   
867  C  CA  . PRO A 108 ? 0.1626 0.1434 0.1143 0.0248  -0.0170 -0.0180 108  PRO A CA  
868  C  C   . PRO A 108 ? 0.1688 0.1371 0.0989 0.0497  -0.0298 -0.0148 108  PRO A C   
869  O  O   . PRO A 108 ? 0.1525 0.1435 0.1003 -0.0037 -0.0240 -0.0252 108  PRO A O   
870  C  CB  . PRO A 108 ? 0.2041 0.1717 0.1560 0.0144  -0.0150 0.0158  108  PRO A CB  
871  C  CG  . PRO A 108 ? 0.2638 0.1946 0.2262 -0.0502 -0.0708 0.0599  108  PRO A CG  
872  C  CD  . PRO A 108 ? 0.1722 0.1548 0.2004 -0.0058 -0.0361 0.0028  108  PRO A CD  
873  N  N   . SER A 109 ? 0.1560 0.1616 0.0886 0.0020  -0.0141 0.0009  109  SER A N   
874  C  CA  . SER A 109 ? 0.1517 0.1442 0.1013 -0.0049 -0.0110 -0.0025 109  SER A CA  
875  C  C   . SER A 109 ? 0.1411 0.1378 0.0901 0.0032  -0.0252 0.0058  109  SER A C   
876  O  O   . SER A 109 ? 0.1456 0.1546 0.1079 0.0038  -0.0055 0.0037  109  SER A O   
877  C  CB  . SER A 109 ? 0.1380 0.1706 0.0813 -0.0377 0.0084  -0.0009 109  SER A CB  
878  O  OG  . SER A 109 ? 0.2169 0.1603 0.0847 -0.0388 0.0013  0.0057  109  SER A OG  
879  N  N   . GLU A 110 ? 0.1264 0.1484 0.1015 0.0012  -0.0108 -0.0123 110  GLU A N   
880  C  CA  . GLU A 110 ? 0.1926 0.1340 0.1218 0.0135  -0.0430 -0.0120 110  GLU A CA  
881  C  C   . GLU A 110 ? 0.1117 0.1271 0.1222 0.0067  -0.0270 -0.0193 110  GLU A C   
882  O  O   . GLU A 110 ? 0.1858 0.1230 0.1243 -0.0006 -0.0121 -0.0183 110  GLU A O   
883  C  CB  . GLU A 110 ? 0.2401 0.1478 0.1694 -0.0029 -0.0740 0.0286  110  GLU A CB  
884  C  CG  . GLU A 110 ? 0.2520 0.1498 0.1847 -0.0407 -0.0357 0.0153  110  GLU A CG  
885  C  CD  . GLU A 110 ? 0.3163 0.2981 0.1199 -0.1469 0.0377  0.0274  110  GLU A CD  
886  O  OE1 . GLU A 110 ? 0.2546 0.1900 0.2851 -0.0448 0.0242  0.0598  110  GLU A OE1 
887  O  OE2 . GLU A 110 ? 0.2101 0.1903 0.1669 0.0092  -0.0240 0.0035  110  GLU A OE2 
888  N  N   . VAL A 111 ? 0.1346 0.1583 0.1035 0.0318  -0.0036 -0.0057 111  VAL A N   
889  C  CA  . VAL A 111 ? 0.1305 0.1648 0.1121 0.0232  -0.0192 -0.0065 111  VAL A CA  
890  C  C   . VAL A 111 ? 0.1175 0.1792 0.0830 0.0293  -0.0379 -0.0135 111  VAL A C   
891  O  O   . VAL A 111 ? 0.1459 0.1582 0.0920 0.0168  -0.0362 -0.0251 111  VAL A O   
892  C  CB  . VAL A 111 ? 0.1339 0.1833 0.1052 0.0383  -0.0112 0.0011  111  VAL A CB  
893  C  CG1 . VAL A 111 ? 0.2455 0.1575 0.1182 0.0293  -0.0158 0.0056  111  VAL A CG1 
894  C  CG2 . VAL A 111 ? 0.1355 0.1638 0.1758 0.0209  -0.0003 -0.0294 111  VAL A CG2 
895  N  N   . VAL A 112 ? 0.1309 0.1183 0.0842 0.0126  -0.0323 -0.0050 112  VAL A N   
896  C  CA  . VAL A 112 ? 0.1324 0.1198 0.1035 0.0058  -0.0225 -0.0135 112  VAL A CA  
897  C  C   . VAL A 112 ? 0.1562 0.1243 0.0643 0.0015  -0.0200 -0.0155 112  VAL A C   
898  O  O   . VAL A 112 ? 0.1653 0.1466 0.0754 -0.0038 -0.0097 -0.0240 112  VAL A O   
899  C  CB  . VAL A 112 ? 0.1273 0.1081 0.1043 0.0170  -0.0215 -0.0172 112  VAL A CB  
900  C  CG1 . VAL A 112 ? 0.1040 0.1073 0.1142 0.0136  -0.0118 -0.0142 112  VAL A CG1 
901  C  CG2 . VAL A 112 ? 0.1450 0.1515 0.0985 -0.0078 -0.0120 -0.0127 112  VAL A CG2 
902  N  N   . LEU A 113 ? 0.1641 0.1231 0.0946 -0.0042 -0.0156 -0.0135 113  LEU A N   
903  C  CA  . LEU A 113 ? 0.1791 0.1229 0.1096 0.0025  -0.0374 -0.0128 113  LEU A CA  
904  C  C   . LEU A 113 ? 0.1598 0.1463 0.1151 0.0127  -0.0361 -0.0360 113  LEU A C   
905  O  O   . LEU A 113 ? 0.1652 0.1735 0.1340 0.0228  -0.0362 -0.0500 113  LEU A O   
906  C  CB  . LEU A 113 ? 0.1508 0.1157 0.1219 0.0125  -0.0211 -0.0190 113  LEU A CB  
907  C  CG  . LEU A 113 ? 0.1428 0.1743 0.1198 0.0353  -0.0281 0.0095  113  LEU A CG  
908  C  CD1 . LEU A 113 ? 0.2371 0.2246 0.1118 -0.0199 0.0063  -0.0150 113  LEU A CD1 
909  C  CD2 . LEU A 113 ? 0.1533 0.1944 0.1551 0.0786  -0.0248 0.0041  113  LEU A CD2 
910  N  N   . ASP A 114 ? 0.1610 0.1833 0.1088 0.0268  -0.0318 -0.0263 114  ASP A N   
911  C  CA  . ASP A 114 ? 0.1725 0.2041 0.1183 0.0016  -0.0487 -0.0366 114  ASP A CA  
912  C  C   . ASP A 114 ? 0.1685 0.2045 0.0928 -0.0025 -0.0649 -0.0272 114  ASP A C   
913  O  O   . ASP A 114 ? 0.2028 0.2155 0.1159 -0.0526 -0.0441 -0.0568 114  ASP A O   
914  C  CB  . ASP A 114 ? 0.1623 0.3115 0.1556 0.0300  -0.0846 -0.0768 114  ASP A CB  
915  C  CG  . ASP A 114 ? 0.1837 0.4863 0.3246 -0.0057 0.0065  -0.2146 114  ASP A CG  
916  O  OD1 . ASP A 114 ? 0.1970 0.7909 0.8240 0.1267  -0.0038 -0.1659 114  ASP A OD1 
917  O  OD2 . ASP A 114 ? 0.2527 0.6484 0.4922 -0.1752 0.1025  -0.0723 114  ASP A OD2 
918  N  N   . ILE A 115 ? 0.1673 0.1755 0.0675 0.0228  -0.0351 -0.0581 115  ILE A N   
919  C  CA  . ILE A 115 ? 0.1718 0.1392 0.0727 0.0165  -0.0426 -0.0632 115  ILE A CA  
920  C  C   . ILE A 115 ? 0.1707 0.1519 0.0780 0.0094  -0.0300 -0.0214 115  ILE A C   
921  O  O   . ILE A 115 ? 0.1896 0.1828 0.0906 0.0367  -0.0058 -0.0136 115  ILE A O   
922  C  CB  . ILE A 115 ? 0.2058 0.1491 0.1078 0.0284  -0.0441 -0.0571 115  ILE A CB  
923  C  CG1 . ILE A 115 ? 0.1894 0.1340 0.1181 0.0430  -0.0290 -0.0689 115  ILE A CG1 
924  C  CG2 . ILE A 115 ? 0.2249 0.1151 0.1349 -0.0126 -0.0664 0.0079  115  ILE A CG2 
925  C  CD1 . ILE A 115 ? 0.2768 0.1362 0.1520 0.0403  -0.0523 -0.0510 115  ILE A CD1 
926  N  N   . LEU A 116 ? 0.1693 0.1268 0.0934 0.0217  -0.0158 -0.0183 116  LEU A N   
927  C  CA  . LEU A 116 ? 0.1537 0.1264 0.0866 0.0013  -0.0076 -0.0119 116  LEU A CA  
928  C  C   . LEU A 116 ? 0.1587 0.1321 0.0856 0.0260  -0.0307 -0.0176 116  LEU A C   
929  O  O   . LEU A 116 ? 0.1917 0.1395 0.1154 0.0060  -0.0272 -0.0416 116  LEU A O   
930  C  CB  . LEU A 116 ? 0.1426 0.1384 0.0877 -0.0038 -0.0155 -0.0196 116  LEU A CB  
931  C  CG  . LEU A 116 ? 0.1355 0.1372 0.0947 0.0015  -0.0282 -0.0236 116  LEU A CG  
932  C  CD1 . LEU A 116 ? 0.1515 0.1232 0.0928 -0.0149 -0.0081 -0.0202 116  LEU A CD1 
933  C  CD2 . LEU A 116 ? 0.1883 0.1552 0.0745 -0.0293 -0.0111 -0.0187 116  LEU A CD2 
934  N  N   . GLN A 117 ? 0.1785 0.1869 0.0753 0.0325  -0.0224 -0.0252 117  GLN A N   
935  C  CA  . GLN A 117 ? 0.2088 0.2035 0.0753 0.0469  -0.0217 -0.0409 117  GLN A CA  
936  C  C   . GLN A 117 ? 0.1570 0.1760 0.1243 0.0026  -0.0349 -0.0389 117  GLN A C   
937  O  O   . GLN A 117 ? 0.1677 0.1948 0.1416 -0.0105 -0.0087 -0.0609 117  GLN A O   
938  C  CB  . GLN A 117 ? 0.2546 0.1924 0.0901 0.0407  0.0015  -0.0414 117  GLN A CB  
939  C  CG  . GLN A 117 ? 0.2747 0.2483 0.1531 -0.0089 -0.0314 0.0204  117  GLN A CG  
940  C  CD  . GLN A 117 ? 0.2692 0.2703 0.1775 -0.0214 -0.0376 0.0322  117  GLN A CD  
941  O  OE1 . GLN A 117 ? 0.2986 0.3726 0.3476 -0.0746 -0.0954 0.0250  117  GLN A OE1 
942  N  NE2 . GLN A 117 ? 0.4487 0.3085 0.1868 -0.0180 0.0584  -0.0029 117  GLN A NE2 
943  N  N   . ASP A 118 ? 0.2094 0.1688 0.1257 0.0142  -0.0571 -0.0322 118  ASP A N   
944  C  CA  . ASP A 118 ? 0.1389 0.1867 0.1378 0.0377  0.0052  -0.0058 118  ASP A CA  
945  C  C   . ASP A 118 ? 0.1455 0.1755 0.1377 0.0096  -0.0018 -0.0283 118  ASP A C   
946  O  O   . ASP A 118 ? 0.1386 0.1863 0.1284 0.0154  -0.0038 -0.0223 118  ASP A O   
947  C  CB  . ASP A 118 ? 0.1523 0.1931 0.1685 0.0089  0.0045  -0.0027 118  ASP A CB  
948  C  CG  . ASP A 118 ? 0.2800 0.3677 0.2056 -0.1174 0.1087  -0.0875 118  ASP A CG  
949  O  OD1 . ASP A 118 ? 0.2513 0.3891 0.2155 -0.0088 0.0565  -0.1080 118  ASP A OD1 
950  O  OD2 . ASP A 118 ? 0.4379 0.7193 0.2194 -0.4209 0.0233  -0.0222 118  ASP A OD2 
951  N  N   . ALA A 119 ? 0.1966 0.1836 0.1138 0.0265  -0.0181 -0.0019 119  ALA A N   
952  C  CA  . ALA A 119 ? 0.1937 0.1651 0.1087 0.0313  -0.0211 -0.0158 119  ALA A CA  
953  C  C   . ALA A 119 ? 0.1745 0.1738 0.1064 0.0211  -0.0158 -0.0072 119  ALA A C   
954  O  O   . ALA A 119 ? 0.1712 0.1663 0.1249 0.0192  -0.0043 0.0019  119  ALA A O   
955  C  CB  . ALA A 119 ? 0.2389 0.1743 0.1597 -0.0102 -0.0440 0.0004  119  ALA A CB  
956  N  N   . GLN A 120 ? 0.1629 0.1592 0.1043 0.0203  -0.0245 -0.0123 120  GLN A N   
957  C  CA  . GLN A 120 ? 0.1437 0.1300 0.0919 0.0034  -0.0193 0.0112  120  GLN A CA  
958  C  C   . GLN A 120 ? 0.1570 0.1255 0.0995 0.0148  -0.0162 -0.0110 120  GLN A C   
959  O  O   . GLN A 120 ? 0.1572 0.1282 0.1481 0.0076  -0.0108 0.0035  120  GLN A O   
960  C  CB  . GLN A 120 ? 0.1690 0.1283 0.1198 0.0176  0.0051  0.0071  120  GLN A CB  
961  C  CG  . GLN A 120 ? 0.1457 0.1338 0.1624 0.0087  -0.0094 0.0012  120  GLN A CG  
962  C  CD  . GLN A 120 ? 0.1778 0.1269 0.1201 0.0180  -0.0281 -0.0030 120  GLN A CD  
963  O  OE1 . GLN A 120 ? 0.1598 0.1641 0.1128 0.0257  -0.0036 -0.0120 120  GLN A OE1 
964  N  NE2 . GLN A 120 ? 0.1448 0.1170 0.1035 0.0128  -0.0190 -0.0263 120  GLN A NE2 
965  N  N   . LYS A 121 ? 0.1764 0.1346 0.1207 0.0362  -0.0452 -0.0281 121  LYS A N   
966  C  CA  . LYS A 121 ? 0.1628 0.1474 0.1292 0.0389  -0.0136 -0.0126 121  LYS A CA  
967  C  C   . LYS A 121 ? 0.1672 0.2068 0.1457 0.0582  -0.0187 0.0210  121  LYS A C   
968  O  O   . LYS A 121 ? 0.3884 0.2178 0.2172 0.1518  0.0626  0.0584  121  LYS A O   
969  C  CB  . LYS A 121 ? 0.1724 0.1855 0.2139 0.0224  -0.0250 -0.0034 121  LYS A CB  
970  C  CG  . LYS A 121 ? 0.2667 0.2242 0.2898 -0.0047 0.0374  0.0843  121  LYS A CG  
971  C  CD  . LYS A 121 ? 0.2847 0.4053 0.4864 -0.0866 0.0805  0.0730  121  LYS A CD  
972  C  CE  . LYS A 121 ? 0.3506 0.6418 0.6721 -0.1197 -0.1384 0.0797  121  LYS A CE  
973  N  NZ  . LYS A 121 ? 0.3588 1.0395 0.8012 -0.2930 0.1138  -0.4549 121  LYS A NZ  
974  N  N   . GLY A 122 ? 0.1925 0.2163 0.1447 0.0488  -0.0001 0.0260  122  GLY A N   
975  C  CA  . GLY A 122 ? 0.2336 0.1682 0.1378 0.0645  0.0029  0.0069  122  GLY A CA  
976  C  C   . GLY A 122 ? 0.2083 0.1703 0.1223 0.0592  -0.0073 0.0235  122  GLY A C   
977  O  O   . GLY A 122 ? 0.2182 0.1521 0.1159 0.0505  -0.0208 0.0082  122  GLY A O   
978  N  N   . ALA A 123 ? 0.1858 0.1571 0.1260 0.0300  -0.0144 0.0215  123  ALA A N   
979  C  CA  . ALA A 123 ? 0.1885 0.1304 0.1443 0.0244  -0.0051 0.0092  123  ALA A CA  
980  C  C   . ALA A 123 ? 0.1776 0.1308 0.1529 0.0162  -0.0524 0.0186  123  ALA A C   
981  O  O   . ALA A 123 ? 0.1674 0.1633 0.1517 0.0116  -0.0263 -0.0060 123  ALA A O   
982  C  CB  . ALA A 123 ? 0.1812 0.1332 0.1532 0.0249  -0.0001 0.0156  123  ALA A CB  
983  N  N   . PHE A 124 ? 0.1602 0.1107 0.1078 -0.0064 -0.0256 -0.0042 124  PHE A N   
984  C  CA  . PHE A 124 ? 0.1515 0.1104 0.1061 -0.0121 -0.0223 0.0046  124  PHE A CA  
985  C  C   . PHE A 124 ? 0.1454 0.1237 0.1098 0.0144  -0.0335 0.0040  124  PHE A C   
986  O  O   . PHE A 124 ? 0.1406 0.1513 0.0975 0.0171  -0.0214 -0.0094 124  PHE A O   
987  C  CB  . PHE A 124 ? 0.1495 0.1204 0.1041 -0.0052 -0.0436 0.0035  124  PHE A CB  
988  C  CG  . PHE A 124 ? 0.1701 0.1153 0.0883 0.0074  -0.0317 0.0039  124  PHE A CG  
989  C  CD1 . PHE A 124 ? 0.1944 0.1441 0.0894 0.0196  -0.0169 -0.0095 124  PHE A CD1 
990  C  CD2 . PHE A 124 ? 0.1895 0.1260 0.1314 -0.0237 -0.0073 -0.0139 124  PHE A CD2 
991  C  CE1 . PHE A 124 ? 0.2119 0.1379 0.0668 0.0203  0.0213  -0.0039 124  PHE A CE1 
992  C  CE2 . PHE A 124 ? 0.1847 0.1204 0.1033 -0.0022 -0.0324 0.0088  124  PHE A CE2 
993  C  CZ  . PHE A 124 ? 0.2104 0.1458 0.0975 0.0089  -0.0093 -0.0022 124  PHE A CZ  
994  N  N   . THR A 125 ? 0.1306 0.1292 0.0940 0.0075  -0.0183 0.0167  125  THR A N   
995  C  CA  . THR A 125 ? 0.1159 0.1343 0.1019 0.0137  -0.0249 0.0049  125  THR A CA  
996  C  C   . THR A 125 ? 0.1276 0.1345 0.1027 -0.0008 -0.0089 0.0096  125  THR A C   
997  O  O   . THR A 125 ? 0.1290 0.1390 0.0816 0.0066  -0.0134 0.0010  125  THR A O   
998  C  CB  . THR A 125 ? 0.1298 0.1392 0.1032 -0.0263 -0.0207 0.0166  125  THR A CB  
999  O  OG1 . THR A 125 ? 0.2141 0.1409 0.1249 -0.0466 -0.0094 0.0307  125  THR A OG1 
1000 C  CG2 . THR A 125 ? 0.1465 0.1831 0.1211 -0.0176 0.0106  0.0344  125  THR A CG2 
1001 N  N   . LYS A 126 ? 0.1298 0.1230 0.0866 -0.0009 -0.0217 -0.0116 126  LYS A N   
1002 C  CA  . LYS A 126 ? 0.1035 0.1362 0.0816 -0.0051 -0.0047 -0.0303 126  LYS A CA  
1003 C  C   . LYS A 126 ? 0.1314 0.1305 0.0832 -0.0030 -0.0261 -0.0126 126  LYS A C   
1004 O  O   . LYS A 126 ? 0.1391 0.1244 0.0935 0.0180  -0.0237 -0.0080 126  LYS A O   
1005 C  CB  . LYS A 126 ? 0.1364 0.1477 0.1172 0.0116  -0.0449 0.0173  126  LYS A CB  
1006 C  CG  . LYS A 126 ? 0.1581 0.1674 0.0991 0.0293  -0.0343 -0.0013 126  LYS A CG  
1007 C  CD  . LYS A 126 ? 0.1739 0.1666 0.1376 0.0447  -0.0624 0.0245  126  LYS A CD  
1008 C  CE  . LYS A 126 ? 0.1879 0.1358 0.1649 0.0201  -0.0807 0.0317  126  LYS A CE  
1009 N  NZ  . LYS A 126 ? 0.1694 0.1658 0.1614 0.0166  -0.0639 0.0516  126  LYS A NZ  
1010 N  N   . GLU A 127 ? 0.1589 0.1370 0.0761 -0.0240 -0.0359 -0.0032 127  GLU A N   
1011 C  CA  . GLU A 127 ? 0.1319 0.1585 0.0879 -0.0133 -0.0498 -0.0154 127  GLU A CA  
1012 C  C   . GLU A 127 ? 0.1481 0.1597 0.0856 0.0174  -0.0293 -0.0235 127  GLU A C   
1013 O  O   . GLU A 127 ? 0.1647 0.2471 0.0824 0.0266  -0.0311 -0.0199 127  GLU A O   
1014 C  CB  . GLU A 127 ? 0.3338 0.1609 0.1499 -0.0832 -0.0751 -0.0191 127  GLU A CB  
1015 C  CG  . GLU A 127 ? 0.4685 0.1863 0.0999 -0.1311 -0.0367 -0.0363 127  GLU A CG  
1016 C  CD  . GLU A 127 ? 0.2895 0.1850 0.1036 -0.0890 0.0007  -0.0520 127  GLU A CD  
1017 O  OE1 . GLU A 127 ? 0.2473 0.2703 0.1617 -0.0869 0.0325  -0.0203 127  GLU A OE1 
1018 O  OE2 . GLU A 127 ? 0.2336 0.1559 0.1550 -0.0215 -0.0267 0.0140  127  GLU A OE2 
1019 N  N   . ASP A 128 ? 0.1440 0.1747 0.1126 0.0161  -0.0274 0.0031  128  ASP A N   
1020 C  CA  . ASP A 128 ? 0.1624 0.1790 0.1482 0.0202  0.0042  -0.0216 128  ASP A CA  
1021 C  C   . ASP A 128 ? 0.2003 0.1813 0.0743 0.0070  -0.0080 -0.0167 128  ASP A C   
1022 O  O   . ASP A 128 ? 0.2083 0.2176 0.1346 0.0062  0.0304  -0.0169 128  ASP A O   
1023 C  CB  . ASP A 128 ? 0.1841 0.2110 0.1623 0.0509  0.0137  -0.0255 128  ASP A CB  
1024 C  CG  . ASP A 128 ? 0.1700 0.1999 0.2464 0.0520  -0.0392 -0.0092 128  ASP A CG  
1025 O  OD1 . ASP A 128 ? 0.1871 0.2162 0.1738 0.0049  -0.0153 -0.0155 128  ASP A OD1 
1026 O  OD2 . ASP A 128 ? 0.1678 0.2997 0.3266 0.0708  -0.0310 0.0530  128  ASP A OD2 
1027 N  N   . GLY A 129 ? 0.2182 0.1673 0.0866 0.0057  0.0086  -0.0110 129  GLY A N   
1028 C  CA  . GLY A 129 ? 0.2054 0.1715 0.1045 0.0019  0.0092  0.0075  129  GLY A CA  
1029 C  C   . GLY A 129 ? 0.1995 0.1865 0.1224 -0.0301 0.0176  0.0217  129  GLY A C   
1030 O  O   . GLY A 129 ? 0.1684 0.1786 0.1668 -0.0183 0.0412  0.0045  129  GLY A O   
1031 N  N   . GLU A 130 ? 0.1856 0.1822 0.1126 0.0006  0.0107  -0.0278 130  GLU A N   
1032 C  CA  . GLU A 130 ? 0.1772 0.1903 0.1198 -0.0386 0.0264  -0.0219 130  GLU A CA  
1033 C  C   . GLU A 130 ? 0.1638 0.1785 0.1067 -0.0573 0.0128  -0.0252 130  GLU A C   
1034 O  O   . GLU A 130 ? 0.1321 0.1822 0.1189 -0.0169 0.0099  0.0148  130  GLU A O   
1035 C  CB  . GLU A 130 ? 0.1617 0.2817 0.1666 0.0017  -0.0083 -0.0189 130  GLU A CB  
1036 C  CG  . GLU A 130 ? 0.3036 0.3985 0.2207 -0.0447 -0.0921 -0.0243 130  GLU A CG  
1037 C  CD  . GLU A 130 ? 0.4204 0.4603 0.3623 -0.0129 -0.2356 -0.0145 130  GLU A CD  
1038 O  OE1 . GLU A 130 ? 0.2959 0.4315 0.3652 -0.0460 -0.0580 0.0594  130  GLU A OE1 
1039 O  OE2 . GLU A 130 ? 0.8170 0.5752 0.4511 -0.0477 -0.4434 -0.0055 130  GLU A OE2 
1040 N  N   . LYS A 131 ? 0.1869 0.1748 0.1411 -0.0426 0.0278  -0.0169 131  LYS A N   
1041 C  CA  . LYS A 131 ? 0.2191 0.1835 0.1137 -0.0268 0.0263  -0.0132 131  LYS A CA  
1042 C  C   . LYS A 131 ? 0.1721 0.2222 0.1380 -0.0025 -0.0020 -0.0226 131  LYS A C   
1043 O  O   . LYS A 131 ? 0.1729 0.3282 0.2117 -0.0330 0.0061  -0.0829 131  LYS A O   
1044 C  CB  A LYS A 131 ? 0.3501 0.1829 0.1888 0.0114  0.0570  0.0099  131  LYS A CB  
1045 C  CB  B LYS A 131 ? 0.3495 0.1830 0.2027 0.0172  0.0593  0.0155  131  LYS A CB  
1046 C  CG  A LYS A 131 ? 0.3382 0.1979 0.2088 0.0586  0.0284  0.0395  131  LYS A CG  
1047 C  CG  B LYS A 131 ? 0.4557 0.2325 0.2723 0.0002  -0.0042 0.0784  131  LYS A CG  
1048 C  CD  A LYS A 131 ? 0.4319 0.2363 0.3647 0.0973  0.0463  0.1549  131  LYS A CD  
1049 C  CD  B LYS A 131 ? 0.5504 0.2428 0.3713 0.0003  0.0303  0.1394  131  LYS A CD  
1050 C  CE  A LYS A 131 ? 0.6224 0.2043 0.3400 0.0928  0.0732  0.1214  131  LYS A CE  
1051 C  CE  B LYS A 131 ? 0.5773 0.2226 0.3786 0.0469  0.1098  0.1043  131  LYS A CE  
1052 N  NZ  A LYS A 131 ? 1.6669 0.4101 0.5624 -0.0053 0.0045  -0.0986 131  LYS A NZ  
1053 N  NZ  B LYS A 131 ? 0.5702 0.1151 0.5977 0.1036  0.3583  -0.0902 131  LYS A NZ  
1054 N  N   . VAL A 132 ? 0.1662 0.1915 0.0988 -0.0178 -0.0304 -0.0136 132  VAL A N   
1055 C  CA  . VAL A 132 ? 0.1859 0.1746 0.1211 -0.0335 -0.0781 -0.0054 132  VAL A CA  
1056 C  C   . VAL A 132 ? 0.2115 0.1890 0.1016 -0.0276 -0.0520 -0.0045 132  VAL A C   
1057 O  O   . VAL A 132 ? 0.1932 0.1942 0.1308 -0.0056 -0.0413 -0.0484 132  VAL A O   
1058 C  CB  . VAL A 132 ? 0.3058 0.1999 0.1240 -0.0782 -0.0870 0.0130  132  VAL A CB  
1059 C  CG1 . VAL A 132 ? 0.4255 0.2975 0.1413 -0.1316 -0.1205 0.0518  132  VAL A CG1 
1060 C  CG2 . VAL A 132 ? 0.2647 0.1779 0.1806 -0.0587 -0.0705 0.0143  132  VAL A CG2 
1061 N  N   . VAL A 133 ? 0.2002 0.1997 0.1122 -0.0331 -0.0459 -0.0058 133  VAL A N   
1062 C  CA  . VAL A 133 ? 0.1660 0.2156 0.0798 -0.0427 -0.0407 -0.0143 133  VAL A CA  
1063 C  C   . VAL A 133 ? 0.1704 0.1928 0.1041 -0.0482 -0.0341 0.0015  133  VAL A C   
1064 O  O   . VAL A 133 ? 0.1262 0.1746 0.1308 -0.0098 -0.0426 -0.0106 133  VAL A O   
1065 C  CB  . VAL A 133 ? 0.2299 0.2480 0.1560 0.0438  0.0392  0.0723  133  VAL A CB  
1066 C  CG1 . VAL A 133 ? 0.2640 0.5441 0.1743 0.1717  0.0783  0.1657  133  VAL A CG1 
1067 C  CG2 . VAL A 133 ? 0.2216 0.5204 0.3370 -0.0284 0.0273  0.2687  133  VAL A CG2 
1068 N  N   . ASP A 134 ? 0.2734 0.2035 0.1181 -0.0878 -0.0424 0.0076  134  ASP A N   
1069 C  CA  . ASP A 134 ? 0.3572 0.2078 0.1255 -0.0626 0.0021  0.0568  134  ASP A CA  
1070 C  C   . ASP A 134 ? 0.3280 0.1762 0.1269 -0.0602 -0.0610 -0.0110 134  ASP A C   
1071 O  O   . ASP A 134 ? 0.2869 0.1693 0.1389 0.0148  -0.0230 -0.0123 134  ASP A O   
1072 C  CB  . ASP A 134 ? 0.4332 0.2658 0.1622 -0.1265 -0.0028 0.0667  134  ASP A CB  
1073 C  CG  . ASP A 134 ? 0.4266 0.2904 0.2346 -0.1155 -0.1243 0.0576  134  ASP A CG  
1074 O  OD1 . ASP A 134 ? 1.2758 0.6310 0.4527 -0.6846 0.0884  -0.0593 134  ASP A OD1 
1075 O  OD2 . ASP A 134 ? 0.6331 0.2490 0.1978 -0.1302 -0.0962 0.0020  134  ASP A OD2 
1076 N  N   . GLU A 135 ? 0.3566 0.2247 0.1744 -0.0592 -0.0878 0.0306  135  GLU A N   
1077 C  CA  . GLU A 135 ? 0.3995 0.2360 0.2114 0.0079  -0.0794 0.0161  135  GLU A CA  
1078 C  C   . GLU A 135 ? 0.4323 0.3198 0.2238 0.0221  -0.0863 -0.0120 135  GLU A C   
1079 O  O   . GLU A 135 ? 0.4005 0.4550 0.3466 0.0843  -0.0235 -0.1556 135  GLU A O   
1080 C  CB  . GLU A 135 ? 0.5848 0.3758 0.2991 0.1277  -0.2074 0.0007  135  GLU A CB  
1081 C  CG  . GLU A 135 ? 0.6829 0.5745 0.5308 -0.1235 -0.3549 0.3497  135  GLU A CG  
1082 C  CD  . GLU A 135 ? 0.9570 0.6779 0.4784 -0.1964 -0.3242 0.4175  135  GLU A CD  
1083 O  OE1 . GLU A 135 ? 2.6487 0.9350 0.5274 -0.8800 0.1295  0.0373  135  GLU A OE1 
1084 O  OE2 . GLU A 135 ? 0.3955 0.3895 0.4576 0.1346  0.1634  0.1400  135  GLU A OE2 
1085 N  N   . ALA A 136 ? 0.4109 0.2319 0.2724 0.0825  -0.1353 -0.0322 136  ALA A N   
1086 C  CA  . ALA A 136 ? 0.5435 0.2117 0.3019 0.0768  -0.1328 -0.0585 136  ALA A CA  
1087 C  C   . ALA A 136 ? 0.4157 0.2673 0.2005 0.0962  -0.0390 -0.0713 136  ALA A C   
1088 O  O   . ALA A 136 ? 0.7161 0.3857 0.2306 0.1538  -0.0721 -0.1335 136  ALA A O   
1089 C  CB  . ALA A 136 ? 0.7195 0.1286 0.4391 0.0007  -0.1697 -0.0455 136  ALA A CB  
1090 N  N   . GLY A 137 ? 0.3703 0.2396 0.1789 0.0748  -0.0144 -0.0291 137  GLY A N   
1091 C  CA  . GLY A 137 ? 0.2706 0.2963 0.1928 0.0489  0.0246  0.0215  137  GLY A CA  
1092 C  C   . GLY A 137 ? 0.2556 0.2095 0.1701 -0.0110 0.0092  -0.0118 137  GLY A C   
1093 O  O   . GLY A 137 ? 0.2520 0.2472 0.1734 -0.0169 -0.0140 0.0013  137  GLY A O   
1094 N  N   . LYS A 138 ? 0.2999 0.2167 0.1862 -0.0387 0.0233  -0.0165 138  LYS A N   
1095 C  CA  . LYS A 138 ? 0.2881 0.2691 0.1622 -0.0886 0.0191  -0.0726 138  LYS A CA  
1096 C  C   . LYS A 138 ? 0.2333 0.3255 0.1604 -0.0486 -0.0312 -0.1059 138  LYS A C   
1097 O  O   . LYS A 138 ? 0.2087 0.2954 0.1517 -0.0489 -0.0197 -0.0851 138  LYS A O   
1098 C  CB  . LYS A 138 ? 0.4169 0.3582 0.2560 -0.2282 -0.0095 -0.0470 138  LYS A CB  
1099 C  CG  . LYS A 138 ? 0.4096 0.5490 0.3083 -0.2875 0.0103  -0.0782 138  LYS A CG  
1100 C  CD  . LYS A 138 ? 0.8138 0.8825 0.7004 -0.6755 0.2574  -0.0818 138  LYS A CD  
1101 C  CE  . LYS A 138 ? 0.7787 1.0743 1.0354 -0.6997 0.3703  -0.0090 138  LYS A CE  
1102 N  NZ  . LYS A 138 ? 1.1097 1.6543 1.2972 -0.7794 0.7105  -0.0724 138  LYS A NZ  
1103 N  N   . ARG A 139 ? 0.2414 0.3436 0.1446 -0.0454 -0.0236 -0.0985 139  ARG A N   
1104 C  CA  . ARG A 139 ? 0.2756 0.3741 0.1748 -0.0036 -0.0734 -0.1304 139  ARG A CA  
1105 C  C   . ARG A 139 ? 0.3043 0.3515 0.2985 -0.0423 0.0233  -0.2094 139  ARG A C   
1106 O  O   . ARG A 139 ? 0.3156 0.6564 0.4707 -0.1804 0.0809  -0.3914 139  ARG A O   
1107 C  CB  A ARG A 139 ? 0.3416 0.3857 0.3020 -0.0130 -0.1937 -0.1189 139  ARG A CB  
1108 C  CB  B ARG A 139 ? 0.3575 0.4000 0.2924 -0.0083 -0.2024 -0.1160 139  ARG A CB  
1109 C  CG  A ARG A 139 ? 0.4440 0.4162 0.2656 -0.0539 -0.2156 -0.0695 139  ARG A CG  
1110 C  CG  B ARG A 139 ? 0.3656 0.4113 0.2660 -0.0500 -0.1508 -0.0658 139  ARG A CG  
1111 C  CD  A ARG A 139 ? 0.3983 0.3570 0.2536 -0.0712 -0.1572 -0.0308 139  ARG A CD  
1112 C  CD  B ARG A 139 ? 0.4013 0.3853 0.3354 0.0043  -0.1696 -0.0515 139  ARG A CD  
1113 N  NE  A ARG A 139 ? 0.3660 0.4421 0.2587 -0.0703 -0.1699 -0.0320 139  ARG A NE  
1114 N  NE  B ARG A 139 ? 0.5046 0.4743 0.4237 0.0404  -0.1669 0.0353  139  ARG A NE  
1115 C  CZ  A ARG A 139 ? 0.4294 0.4074 0.3411 -0.0906 -0.0867 -0.0514 139  ARG A CZ  
1116 C  CZ  B ARG A 139 ? 0.5783 0.5814 0.1332 -0.0109 -0.2211 0.0003  139  ARG A CZ  
1117 N  NH1 A ARG A 139 ? 0.1721 0.5237 0.2959 -0.0391 0.0027  -0.0998 139  ARG A NH1 
1118 N  NH1 B ARG A 139 ? 0.5997 0.5648 0.2572 0.0458  -0.0066 -0.0509 139  ARG A NH1 
1119 N  NH2 A ARG A 139 ? 0.6181 0.1685 0.2108 0.0019  -0.0515 0.0619  139  ARG A NH2 
1120 N  NH2 B ARG A 139 ? 0.7361 0.5994 0.2369 -0.0069 -0.3597 0.0216  139  ARG A NH2 
1121 N  N   . LEU A 140 ? 0.2926 0.5224 0.2708 -0.1152 0.0220  -0.2355 140  LEU A N   
1122 C  CA  . LEU A 140 ? 0.3009 0.4532 0.3358 -0.0187 0.0697  -0.1842 140  LEU A CA  
1123 C  C   . LEU A 140 ? 0.3307 0.5283 0.5220 0.0315  0.0439  -0.2099 140  LEU A C   
1124 O  O   . LEU A 140 ? 0.5169 0.5331 0.8473 0.1153  -0.0702 -0.3192 140  LEU A O   
1125 C  CB  . LEU A 140 ? 0.3392 0.4688 0.3244 -0.1283 0.0656  -0.0828 140  LEU A CB  
1126 C  CG  . LEU A 140 ? 0.4081 0.3196 0.4916 -0.0981 -0.0392 -0.0321 140  LEU A CG  
1127 C  CD1 . LEU A 140 ? 0.6754 0.2206 0.5152 -0.0358 -0.1772 0.0825  140  LEU A CD1 
1128 C  CD2 . LEU A 140 ? 0.5515 0.4212 0.7251 -0.2359 0.3073  -0.2675 140  LEU A CD2 
1129 S  S   . SO4 B .   ? 0.1919 0.1334 0.1024 0.0291  0.0083  0.0093  201  SO4 A S   
1130 O  O1  . SO4 B .   ? 0.2060 0.1413 0.0886 0.0171  0.0013  0.0046  201  SO4 A O1  
1131 O  O2  . SO4 B .   ? 0.2619 0.1366 0.1001 -0.0077 0.0216  -0.0020 201  SO4 A O2  
1132 O  O3  . SO4 B .   ? 0.1810 0.1793 0.1316 0.0403  0.0130  0.0026  201  SO4 A O3  
1133 O  O4  . SO4 B .   ? 0.2002 0.1364 0.1165 0.0423  0.0121  0.0124  201  SO4 A O4  
1134 S  S   . SO4 C .   ? 0.3103 0.2365 0.1304 0.0639  0.0072  -0.0125 202  SO4 A S   
1135 O  O1  . SO4 C .   ? 0.3282 0.2243 0.1576 0.0843  0.0023  -0.0582 202  SO4 A O1  
1136 O  O2  . SO4 C .   ? 0.3629 0.2827 0.1196 0.0340  0.0671  -0.0391 202  SO4 A O2  
1137 O  O3  . SO4 C .   ? 0.3038 0.2830 0.1866 0.0663  0.0039  0.0335  202  SO4 A O3  
1138 O  O4  . SO4 C .   ? 0.4720 0.2137 0.1780 0.0852  0.0503  0.0074  202  SO4 A O4  
1139 S  S   A SO4 D .   ? 0.1975 0.2270 0.1777 0.0160  -0.0269 0.0235  203  SO4 A S   
1140 S  S   B SO4 D .   ? 0.1880 0.2452 0.1647 0.0134  -0.0085 0.0100  203  SO4 A S   
1141 O  O1  A SO4 D .   ? 0.1975 0.4028 0.4578 0.0272  -0.0474 0.2432  203  SO4 A O1  
1142 O  O1  B SO4 D .   ? 0.3861 0.2366 0.4562 0.0024  0.1589  -0.0059 203  SO4 A O1  
1143 O  O2  A SO4 D .   ? 0.3606 0.5114 0.1805 -0.0267 0.1117  -0.0877 203  SO4 A O2  
1144 O  O2  B SO4 D .   ? 0.3763 0.5592 0.1421 -0.1610 -0.0415 0.0630  203  SO4 A O2  
1145 O  O3  A SO4 D .   ? 0.2075 0.2481 0.3696 -0.0234 -0.0931 0.0741  203  SO4 A O3  
1146 O  O3  B SO4 D .   ? 0.1606 0.2708 0.4254 -0.0399 0.0231  0.1302  203  SO4 A O3  
1147 O  O4  . SO4 D .   ? 0.0856 0.2248 0.1063 0.0702  -0.0190 -0.0040 203  SO4 A O4  
1148 CS CS  . CS  E .   ? 0.1678 0.1769 0.1152 0.0078  -0.0305 -0.0529 301  CS  A CS  
1149 CS CS  . CS  F .   ? 0.2900 0.3505 0.2505 -0.0742 0.0717  0.0662  302  CS  A CS  
1150 CS CS  . CS  G .   ? 0.2892 0.8106 0.4400 -0.1074 -0.0180 0.2715  303  CS  A CS  
1151 O  O   . HOH H .   ? 0.1504 0.1979 0.1158 0.0114  -0.0097 -0.0068 1001 HOH A O   
1152 O  O   . HOH H .   ? 0.1414 0.1290 0.0969 0.0277  -0.0184 0.0081  1002 HOH A O   
1153 O  O   . HOH H .   ? 0.1553 0.1500 0.1071 0.0189  -0.0291 -0.0090 1003 HOH A O   
1154 O  O   . HOH H .   ? 0.1515 0.1663 0.1021 0.0093  0.0017  0.0306  1004 HOH A O   
1155 O  O   . HOH H .   ? 0.2308 0.1534 0.1185 -0.0050 0.0254  0.0247  1005 HOH A O   
1156 O  O   . HOH H .   ? 0.1419 0.1899 0.1091 -0.0043 -0.0141 -0.0146 1006 HOH A O   
1157 O  O   . HOH H .   ? 0.1958 0.1513 0.1208 0.0192  -0.0294 -0.0173 1007 HOH A O   
1158 O  O   . HOH H .   ? 0.1530 0.1960 0.1208 0.0478  -0.0594 -0.0560 1008 HOH A O   
1159 O  O   . HOH H .   ? 0.1754 0.1948 0.1528 0.0038  -0.0181 0.0600  1009 HOH A O   
1160 O  O   . HOH H .   ? 0.1529 0.1890 0.1423 0.0111  -0.0492 0.0115  1010 HOH A O   
1161 O  O   . HOH H .   ? 0.2447 0.2034 0.1869 0.0342  -0.0112 -0.0388 1011 HOH A O   
1162 O  O   . HOH H .   ? 0.1718 0.1736 0.0982 0.0227  0.0126  0.0028  1012 HOH A O   
1163 O  O   . HOH H .   ? 0.2329 0.1720 0.1428 0.0066  -0.0484 0.0015  1013 HOH A O   
1164 O  O   . HOH H .   ? 0.1753 0.1551 0.1437 -0.0015 -0.0263 -0.0314 1014 HOH A O   
1165 O  O   . HOH H .   ? 0.1780 0.1248 0.1220 -0.0080 -0.0113 0.0222  1015 HOH A O   
1166 O  O   . HOH H .   ? 0.1899 0.2217 0.1793 -0.0092 -0.0308 0.0002  1016 HOH A O   
1167 O  O   . HOH H .   ? 0.2212 0.2295 0.1898 0.0317  0.0208  0.0843  1017 HOH A O   
1168 O  O   . HOH H .   ? 0.2362 0.2609 0.1006 -0.0298 -0.0004 -0.0171 1018 HOH A O   
1169 O  O   . HOH H .   ? 0.2796 0.1678 0.1909 0.0201  0.0172  0.0612  1019 HOH A O   
1170 O  O   . HOH H .   ? 0.1658 0.1543 0.1314 0.0094  -0.0025 0.0330  1020 HOH A O   
1171 O  O   . HOH H .   ? 0.1690 0.1965 0.1792 -0.0265 -0.0174 -0.0173 1021 HOH A O   
1172 O  O   . HOH H .   ? 0.1504 0.2113 0.2726 -0.0043 -0.0017 -0.0267 1022 HOH A O   
1173 O  O   . HOH H .   ? 0.2641 0.1682 0.1061 -0.0102 0.0194  0.0268  1023 HOH A O   
1174 O  O   . HOH H .   ? 0.2260 0.2386 0.1753 0.0418  0.0150  0.0293  1024 HOH A O   
1175 O  O   . HOH H .   ? 0.2118 0.2118 0.1091 0.0028  -0.0660 -0.0576 1025 HOH A O   
1176 O  O   . HOH H .   ? 0.1664 0.1802 0.1266 -0.0089 -0.0120 -0.0017 1026 HOH A O   
1177 O  O   . HOH H .   ? 0.1812 0.1417 0.1023 -0.0049 -0.0194 0.0283  1027 HOH A O   
1178 O  O   . HOH H .   ? 0.2024 0.2187 0.1669 0.0095  -0.0205 0.0075  1028 HOH A O   
1179 O  O   . HOH H .   ? 0.2286 0.1929 0.1879 0.0031  -0.0772 -0.0195 1029 HOH A O   
1180 O  O   . HOH H .   ? 0.2400 0.2104 0.2018 0.0132  -0.0328 -0.0083 1030 HOH A O   
1181 O  O   . HOH H .   ? 0.2398 0.2457 0.1377 -0.0198 0.0026  0.0085  1031 HOH A O   
1182 O  O   . HOH H .   ? 0.2079 0.1948 0.1417 -0.0020 -0.0105 0.0184  1032 HOH A O   
1183 O  O   . HOH H .   ? 0.2108 0.2727 0.2775 0.0524  -0.0744 -0.0178 1033 HOH A O   
1184 O  O   . HOH H .   ? 0.2235 0.1512 0.1465 0.0244  0.0094  0.0223  1034 HOH A O   
1185 O  O   . HOH H .   ? 0.3099 0.2055 0.1540 0.0288  -0.0480 -0.0115 1035 HOH A O   
1186 O  O   . HOH H .   ? 0.2565 0.2191 0.1261 -0.0135 0.0020  -0.0149 1036 HOH A O   
1187 O  O   . HOH H .   ? 0.2661 0.2987 0.1442 0.0376  0.0551  -0.0508 1037 HOH A O   
1188 O  O   . HOH H .   ? 0.2401 0.2266 0.1871 -0.0655 -0.0570 0.0543  1038 HOH A O   
1189 O  O   . HOH H .   ? 0.2352 0.2125 0.1859 0.0114  0.0060  0.0191  1039 HOH A O   
1190 O  O   . HOH H .   ? 0.1960 0.2598 0.1860 0.0316  0.0226  -0.0517 1040 HOH A O   
1191 O  O   . HOH H .   ? 0.2344 0.2734 0.1563 -0.0157 -0.0266 -0.0238 1041 HOH A O   
1192 O  O   . HOH H .   ? 0.3237 0.2061 0.1698 -0.0265 0.0409  0.0296  1042 HOH A O   
1193 O  O   . HOH H .   ? 0.2378 0.2077 0.1661 0.0209  0.0325  0.0201  1043 HOH A O   
1194 O  O   . HOH H .   ? 0.2010 0.2224 0.2078 0.0197  0.0286  -0.0503 1044 HOH A O   
1195 O  O   . HOH H .   ? 0.3501 0.2350 0.1711 -0.0028 -0.1261 -0.0483 1045 HOH A O   
1196 O  O   . HOH H .   ? 0.3130 0.1690 0.1615 -0.0103 -0.0177 0.0181  1046 HOH A O   
1197 O  O   . HOH H .   ? 0.3216 0.2216 0.1894 -0.0178 0.0004  0.0063  1047 HOH A O   
1198 O  O   . HOH H .   ? 0.2650 0.1616 0.1826 0.0201  -0.0206 -0.0320 1048 HOH A O   
1199 O  O   . HOH H .   ? 0.4153 0.2689 0.1943 -0.0085 0.0283  -0.0458 1049 HOH A O   
1200 O  O   . HOH H .   ? 0.2928 0.2019 0.1742 0.0651  -0.0583 -0.0030 1050 HOH A O   
1201 O  O   . HOH H .   ? 0.2482 0.3212 0.1510 0.0862  -0.0352 -0.0349 1051 HOH A O   
1202 O  O   . HOH H .   ? 0.4182 0.2968 0.2212 -0.0667 0.0859  -0.1193 1052 HOH A O   
1203 O  O   . HOH H .   ? 0.4478 0.2552 0.2035 -0.0390 -0.1330 0.0593  1053 HOH A O   
1204 O  O   . HOH H .   ? 0.4243 0.2355 0.1373 -0.0910 0.0293  -0.0246 1054 HOH A O   
1205 O  O   . HOH H .   ? 0.2398 0.2096 0.1806 -0.0306 -0.0849 0.0166  1055 HOH A O   
1206 O  O   . HOH H .   ? 0.2407 0.2415 0.1771 0.0193  -0.0666 -0.0627 1056 HOH A O   
1207 O  O   . HOH H .   ? 0.2613 0.2033 0.1595 0.0396  -0.0343 -0.0131 1057 HOH A O   
1208 O  O   . HOH H .   ? 0.3656 0.1775 0.2730 0.0513  0.1189  0.0201  1058 HOH A O   
1209 O  O   . HOH H .   ? 0.3151 0.3067 0.2069 0.0110  0.0494  0.1036  1059 HOH A O   
1210 O  O   . HOH H .   ? 0.3474 0.2025 0.1787 -0.0912 0.0670  -0.0211 1060 HOH A O   
1211 O  O   . HOH H .   ? 0.2312 0.2455 0.2347 0.0529  -0.0716 -0.0717 1061 HOH A O   
1212 O  O   . HOH H .   ? 0.3962 0.2207 0.2919 -0.1076 0.0596  -0.0062 1062 HOH A O   
1213 O  O   . HOH H .   ? 0.3703 0.2937 0.1894 -0.0073 0.0290  -0.0892 1063 HOH A O   
1214 O  O   . HOH H .   ? 0.3514 0.2744 0.2210 -0.0045 0.0763  -0.0421 1064 HOH A O   
1215 O  O   . HOH H .   ? 0.2937 0.2724 0.2577 -0.0280 -0.0114 0.0895  1065 HOH A O   
1216 O  O   . HOH H .   ? 0.3989 0.2215 0.2936 -0.0428 -0.2084 0.0647  1066 HOH A O   
1217 O  O   . HOH H .   ? 0.3218 0.2226 0.1909 0.0391  -0.0770 -0.0438 1067 HOH A O   
1218 O  O   . HOH H .   ? 0.2518 0.3081 0.1811 0.0453  0.0260  0.0517  1068 HOH A O   
1219 O  O   . HOH H .   ? 0.5224 0.2129 0.2612 0.0826  -0.0732 -0.0888 1069 HOH A O   
1220 O  O   . HOH H .   ? 0.2231 0.3273 0.1381 -0.0037 0.0121  0.0051  1070 HOH A O   
1221 O  O   . HOH H .   ? 0.5163 0.2773 0.2634 -0.0549 -0.0994 0.0361  1071 HOH A O   
1222 O  O   . HOH H .   ? 0.4184 0.3051 0.2391 -0.0397 -0.0954 0.0182  1072 HOH A O   
1223 O  O   . HOH H .   ? 0.3646 0.4900 0.2350 -0.0499 -0.0512 0.1072  1073 HOH A O   
1224 O  O   . HOH H .   ? 0.4409 0.3609 0.2544 -0.1253 0.0846  -0.0214 1074 HOH A O   
1225 O  O   . HOH H .   ? 0.3514 0.4482 0.2486 -0.1059 -0.0062 0.0010  1075 HOH A O   
1226 O  O   . HOH H .   ? 0.2313 0.3182 0.2340 0.0238  -0.0526 0.0061  1076 HOH A O   
1227 O  O   . HOH H .   ? 0.4552 0.2071 0.1677 -0.0337 -0.1002 -0.0145 1077 HOH A O   
1228 O  O   . HOH H .   ? 0.2236 0.4241 0.2678 0.0412  -0.0262 0.0081  1078 HOH A O   
1229 O  O   . HOH H .   ? 0.2435 0.3564 0.3475 -0.0031 -0.0164 -0.0490 1079 HOH A O   
1230 O  O   . HOH H .   ? 0.1507 0.3319 0.3142 -0.0253 -0.0337 -0.0837 1080 HOH A O   
1231 O  O   . HOH H .   ? 0.4516 0.3052 0.2884 -0.0122 -0.1781 0.0988  1081 HOH A O   
1232 O  O   . HOH H .   ? 0.6780 0.4208 0.2027 0.0370  -0.0897 -0.1082 1082 HOH A O   
1233 O  O   . HOH H .   ? 0.2732 0.5310 0.2882 -0.0860 0.0051  -0.1486 1083 HOH A O   
1234 O  O   . HOH H .   ? 0.2657 0.2483 0.4310 0.0108  -0.0667 -0.0010 1084 HOH A O   
1235 O  O   . HOH H .   ? 0.3068 0.3470 0.2591 -0.0290 0.0551  0.0319  1085 HOH A O   
1236 O  O   . HOH H .   ? 0.4045 0.3312 0.3083 0.0795  -0.0606 0.0410  1086 HOH A O   
1237 O  O   . HOH H .   ? 0.4661 0.3051 0.3614 -0.0139 -0.0460 -0.0801 1087 HOH A O   
1238 O  O   . HOH H .   ? 0.3009 0.5579 0.2030 -0.0259 -0.1358 -0.0259 1088 HOH A O   
1239 O  O   . HOH H .   ? 0.1876 0.5026 0.3766 -0.0563 -0.1078 0.0875  1089 HOH A O   
1240 O  O   . HOH H .   ? 0.3699 0.4829 0.3744 -0.1965 0.0097  -0.0493 1090 HOH A O   
1241 O  O   . HOH H .   ? 0.4255 0.4351 0.4630 0.1182  -0.1390 -0.1073 1091 HOH A O   
1242 O  O   . HOH H .   ? 0.3797 0.3455 0.4626 -0.0079 -0.1347 -0.0453 1092 HOH A O   
1243 O  O   . HOH H .   ? 0.4110 0.5492 0.5633 -0.0895 0.2440  -0.1710 1093 HOH A O   
1244 O  O   . HOH H .   ? 0.2750 0.5183 0.3158 0.0264  -0.1107 -0.0073 1094 HOH A O   
1245 O  O   . HOH H .   ? 0.4052 0.4691 0.2461 -0.0423 -0.0037 -0.0859 1095 HOH A O   
1246 O  O   . HOH H .   ? 0.3794 0.6068 0.2565 -0.0954 0.0357  0.0121  1096 HOH A O   
1247 O  O   . HOH H .   ? 0.3400 0.2014 0.4685 -0.0033 -0.1638 0.0401  1097 HOH A O   
1248 O  O   . HOH H .   ? 0.4382 0.4320 0.2427 -0.1782 0.0547  0.0186  1098 HOH A O   
1249 O  O   . HOH H .   ? 0.3340 0.4986 0.2716 0.0300  -0.0281 0.0749  1099 HOH A O   
1250 O  O   . HOH H .   ? 0.3640 0.4448 0.3668 -0.0785 0.0209  -0.0122 1100 HOH A O   
1251 O  O   . HOH H .   ? 1.0649 0.2734 0.2204 0.0300  0.0689  0.0020  1101 HOH A O   
1252 O  O   . HOH H .   ? 0.3139 0.5328 0.5317 -0.0527 -0.1505 0.0615  1102 HOH A O   
1253 O  O   . HOH H .   ? 0.2703 0.3013 0.3800 -0.0160 -0.0050 -0.0816 1103 HOH A O   
1254 O  O   . HOH H .   ? 0.3490 0.3828 0.5099 -0.0904 -0.0280 -0.0231 1104 HOH A O   
1255 O  O   . HOH H .   ? 0.2631 0.4811 0.6033 -0.0162 0.0091  -0.0256 1105 HOH A O   
1256 O  O   . HOH H .   ? 0.4489 0.3174 0.3061 0.1155  -0.0784 -0.0652 1106 HOH A O   
1257 O  O   . HOH H .   ? 0.3707 0.3224 0.3404 -0.0802 0.1020  -0.0079 1107 HOH A O   
1258 O  O   . HOH H .   ? 0.5095 0.3124 0.3717 -0.0887 -0.0616 0.1467  1108 HOH A O   
1259 O  O   . HOH H .   ? 0.5497 0.4353 0.2051 -0.2420 -0.0379 -0.0121 1109 HOH A O   
1260 O  O   . HOH H .   ? 0.3438 0.4727 0.3818 0.0969  -0.0533 -0.0806 1110 HOH A O   
1261 O  O   . HOH H .   ? 0.4252 0.6608 0.4945 0.0218  0.2126  -0.2431 1111 HOH A O   
1262 O  O   . HOH H .   ? 0.6182 0.4338 0.3674 0.0348  -0.0026 0.0215  1112 HOH A O   
1263 O  O   . HOH H .   ? 0.5508 0.2912 0.3187 -0.1601 -0.1695 0.1487  1113 HOH A O   
1264 O  O   . HOH H .   ? 0.8524 0.1737 0.2421 -0.0526 -0.2320 0.0447  1114 HOH A O   
1265 O  O   . HOH H .   ? 0.3604 0.3095 0.3640 0.0915  0.0621  -0.0900 1115 HOH A O   
1266 O  O   . HOH H .   ? 0.6095 0.6017 0.1515 -0.0558 -0.0114 -0.0979 1116 HOH A O   
1267 O  O   . HOH H .   ? 0.4210 0.4163 0.3881 -0.0790 -0.2058 0.0900  1117 HOH A O   
1268 O  O   . HOH H .   ? 0.3231 0.3897 0.4901 0.0320  -0.0443 0.1001  1118 HOH A O   
1269 O  O   . HOH H .   ? 0.7145 0.5300 0.2229 -0.0867 0.0233  -0.0173 1119 HOH A O   
1270 O  O   . HOH H .   ? 0.3220 0.3740 0.2743 0.0193  -0.0296 0.0278  1120 HOH A O   
1271 O  O   . HOH H .   ? 0.6176 0.4898 0.1912 -0.0154 0.0072  -0.0259 1121 HOH A O   
1272 O  O   . HOH H .   ? 0.2615 0.4286 0.4418 0.0239  -0.0091 -0.0750 1122 HOH A O   
1273 O  O   . HOH H .   ? 0.4262 0.1901 0.5063 0.1146  0.1140  0.0690  1123 HOH A O   
1274 O  O   . HOH H .   ? 0.3915 0.4418 0.3334 -0.0286 0.0697  0.1194  1124 HOH A O   
1275 O  O   . HOH H .   ? 0.3799 0.3594 0.5486 0.0248  0.1433  -0.1644 1125 HOH A O   
1276 O  O   . HOH H .   ? 0.3183 0.5905 0.3929 0.0154  -0.0772 0.1567  1126 HOH A O   
1277 O  O   . HOH H .   ? 0.3549 0.2756 0.5018 -0.0089 -0.0365 -0.0796 1127 HOH A O   
1278 O  O   . HOH H .   ? 0.3451 0.5209 0.3805 -0.0426 -0.0255 -0.0122 1128 HOH A O   
1279 O  O   . HOH H .   ? 0.4783 0.5774 0.4475 0.1461  0.1389  -0.0896 1129 HOH A O   
1280 O  O   . HOH H .   ? 0.9941 0.4014 0.3699 -0.0364 -0.3338 -0.0209 1130 HOH A O   
1281 O  O   . HOH H .   ? 0.2616 0.7511 0.2767 0.0828  0.0168  -0.2396 1131 HOH A O   
1282 O  O   . HOH H .   ? 0.5535 0.2825 0.4224 0.0140  0.1908  -0.0223 1132 HOH A O   
1283 O  O   . HOH H .   ? 0.6382 0.2957 0.2638 -0.1541 0.1866  -0.0435 1133 HOH A O   
1284 O  O   . HOH H .   ? 0.4669 0.6109 0.3694 -0.0251 -0.1325 0.0199  1134 HOH A O   
1285 O  O   . HOH H .   ? 0.8788 0.4611 0.5101 0.0340  -0.2779 -0.0932 1135 HOH A O   
1286 O  O   . HOH H .   ? 0.4222 0.4224 0.4715 -0.0292 -0.1040 -0.1380 1136 HOH A O   
1287 O  O   . HOH H .   ? 0.6350 0.7001 0.3077 -0.1409 0.0801  0.0059  1137 HOH A O   
1288 O  O   . HOH H .   ? 0.6764 0.4084 0.7955 -0.1044 0.1354  0.1786  1138 HOH A O   
1289 O  O   . HOH H .   ? 0.3633 0.4418 0.5684 0.0825  0.1817  0.0620  1139 HOH A O   
1290 O  O   . HOH H .   ? 0.6100 0.4274 0.7357 0.1372  -0.1930 -0.1619 1140 HOH A O   
1291 O  O   . HOH H .   ? 0.5183 0.3146 0.2305 0.0067  0.0899  -0.0691 1141 HOH A O   
1292 O  O   . HOH H .   ? 0.4620 0.4999 0.4665 -0.0777 0.0639  -0.1679 1142 HOH A O   
1293 O  O   . HOH H .   ? 0.5770 0.5578 0.7211 0.0622  0.2556  -0.0959 1143 HOH A O   
1294 O  O   . HOH H .   ? 0.5020 0.3950 0.7470 0.0678  0.0779  -0.0110 1144 HOH A O   
1295 O  O   . HOH H .   ? 0.3652 0.4644 0.4178 0.1440  0.1449  0.0273  1145 HOH A O   
1296 O  O   . HOH H .   ? 0.2603 0.4554 0.4508 0.0078  -0.0549 0.0321  1146 HOH A O   
1297 O  O   . HOH H .   ? 0.2951 0.4423 0.3900 -0.0637 -0.0766 -0.0481 1147 HOH A O   
1298 O  O   . HOH H .   ? 0.4538 0.3505 0.5512 -0.0224 -0.1062 -0.0955 1148 HOH A O   
1299 O  O   . HOH H .   ? 0.9472 0.4562 0.8645 0.1709  0.1646  -0.1670 1149 HOH A O   
1300 O  O   . HOH H .   ? 0.5113 0.4724 0.4435 0.1306  0.0153  -0.0161 1150 HOH A O   
1301 O  O   . HOH H .   ? 0.5465 0.5338 0.4887 -0.0654 0.0128  -0.0773 1151 HOH A O   
1302 O  O   . HOH H .   ? 0.4250 0.1771 0.3069 -0.0811 -0.1422 0.0215  1152 HOH A O   
1303 O  O   . HOH H .   ? 0.4853 0.6066 0.6183 0.0125  -0.2461 0.2065  1153 HOH A O   
1304 O  O   . HOH H .   ? 0.6251 0.3858 0.4640 0.0250  0.0614  -0.0497 1154 HOH A O   
1305 O  O   . HOH H .   ? 0.3929 0.4534 0.9242 0.1002  -0.3820 -0.0558 1155 HOH A O   
1306 O  O   . HOH H .   ? 0.4342 0.3495 0.6460 0.0326  -0.0674 0.1134  1156 HOH A O   
1307 O  O   . HOH H .   ? 0.6418 0.4933 0.5176 -0.2553 -0.0683 0.0844  1157 HOH A O   
1308 O  O   . HOH H .   ? 0.5388 0.4709 0.5477 0.1845  0.1015  -0.0547 1158 HOH A O   
1309 O  O   . HOH H .   ? 0.8885 0.3402 0.5109 -0.0394 -0.3165 0.1453  1159 HOH A O   
1310 O  O   . HOH H .   ? 0.8335 0.6835 0.4956 -0.0128 0.1110  0.0092  1160 HOH A O   
1311 O  O   . HOH H .   ? 0.4816 0.6790 0.4297 -0.0704 0.1412  -0.1905 1161 HOH A O   
1312 O  O   . HOH H .   ? 0.7080 0.4823 0.5020 0.0067  0.0425  -0.2139 1162 HOH A O   
1313 O  O   . HOH H .   ? 0.5572 0.6544 0.4345 -0.1174 0.2313  -0.1261 1163 HOH A O   
1314 O  O   . HOH H .   ? 0.7975 0.6471 0.3664 -0.1970 0.2388  -0.1642 1164 HOH A O   
1315 O  O   . HOH H .   ? 0.4107 0.4780 0.5778 -0.0058 0.1513  0.0510  1165 HOH A O   
1316 O  O   . HOH H .   ? 0.1913 0.5959 0.6434 -0.0295 0.1148  -0.0171 1166 HOH A O   
1317 O  O   . HOH H .   ? 0.8981 0.6423 0.9513 0.1951  0.1916  -0.0399 1167 HOH A O   
1318 O  O   . HOH H .   ? 0.5315 0.7378 0.7649 -0.2466 -0.4597 0.2124  1168 HOH A O   
1319 O  O   . HOH H .   ? 0.4237 0.4668 0.4167 -0.1208 0.1462  -0.1553 1169 HOH A O   
1320 O  O   . HOH H .   ? 0.5020 0.5979 0.3952 -0.0719 0.0392  -0.0258 1170 HOH A O   
1321 O  O   . HOH H .   ? 0.6073 0.3499 0.3010 0.1012  -0.1143 -0.0144 1171 HOH A O   
1322 O  O   . HOH H .   ? 0.6363 0.6722 0.3627 0.1569  0.0004  -0.0710 1172 HOH A O   
1323 O  O   . HOH H .   ? 0.3654 0.5368 0.5531 -0.0062 0.0489  -0.0235 1173 HOH A O   
1324 O  O   . HOH H .   ? 0.2549 0.3621 0.5993 0.1497  -0.1216 -0.0024 1174 HOH A O   
1325 O  O   . HOH H .   ? 0.3372 0.4031 0.7041 -0.0263 0.1203  -0.0706 1175 HOH A O   
1326 O  O   . HOH H .   ? 0.5104 0.3531 0.5109 0.0581  -0.0087 0.0488  1176 HOH A O   
1327 O  O   . HOH H .   ? 0.6827 0.3453 0.6875 0.1918  0.1609  0.0174  1177 HOH A O   
1328 O  O   . HOH H .   ? 0.6078 0.5928 0.7209 0.0000  0.0000  -0.0675 1178 HOH A O   
1329 O  O   . HOH H .   ? 0.4458 0.7700 0.6199 -0.0549 0.1477  -0.2724 1179 HOH A O   
1330 O  O   . HOH H .   ? 0.3972 0.8032 0.5526 -0.0493 -0.1285 0.1503  1180 HOH A O   
1331 O  O   . HOH H .   ? 0.8347 0.3553 0.4984 -0.1677 0.2810  -0.0661 1181 HOH A O   
1332 O  O   . HOH H .   ? 0.6856 0.4004 0.4465 -0.1633 -0.2954 0.1105  1182 HOH A O   
1333 O  O   . HOH H .   ? 0.4181 0.5950 0.5479 -0.0462 -0.2207 0.0761  1183 HOH A O   
1334 O  O   . HOH H .   ? 0.3591 0.4933 0.4421 0.0516  0.0261  0.1594  1184 HOH A O   
1335 O  O   . HOH H .   ? 0.5505 0.4519 0.3351 -0.1004 -0.1677 0.0458  1185 HOH A O   
1336 O  O   . HOH H .   ? 0.6428 0.5849 0.5152 -0.2845 -0.1540 0.0418  1186 HOH A O   
1337 O  O   . HOH H .   ? 0.8738 0.5696 0.4174 -0.2979 -0.1727 0.1071  1187 HOH A O   
1338 O  O   . HOH H .   ? 0.4685 0.4821 0.7555 0.0107  -0.1819 -0.0146 1188 HOH A O   
1339 O  O   . HOH H .   ? 0.4671 0.5751 0.6708 0.0604  0.2140  -0.2099 1189 HOH A O   
1340 O  O   . HOH H .   ? 0.6339 0.7958 0.3766 -0.0936 -0.0997 -0.0149 1190 HOH A O   
1341 O  O   . HOH H .   ? 0.3187 0.8551 0.6300 0.1594  0.1066  -0.1675 1191 HOH A O   
1342 O  O   . HOH H .   ? 0.5460 0.9179 0.3641 -0.0350 0.0484  0.1932  1192 HOH A O   
1343 O  O   . HOH H .   ? 0.4446 0.4614 0.5081 -0.0259 0.0293  -0.1514 1193 HOH A O   
1344 O  O   . HOH H .   ? 0.3647 0.7222 0.8013 -0.0328 -0.0507 -0.0098 1194 HOH A O   
1345 O  O   . HOH H .   ? 0.5137 0.5537 0.5250 -0.0509 0.1430  -0.1760 1195 HOH A O   
1346 O  O   . HOH H .   ? 0.1834 0.3826 0.4200 -0.0890 0.0688  -0.2164 1196 HOH A O   
1347 O  O   . HOH H .   ? 1.1062 0.7305 0.2184 0.0501  0.0779  0.1247  1197 HOH A O   
1348 O  O   . HOH H .   ? 0.4665 0.5170 0.5406 0.0523  -0.0934 0.2565  1198 HOH A O   
1349 O  O   . HOH H .   ? 0.3164 0.3702 0.5740 0.0685  -0.0750 -0.1866 1199 HOH A O   
1350 O  O   . HOH H .   ? 0.7107 0.8705 0.3193 -0.1784 -0.1164 0.1795  1200 HOH A O   
1351 O  O   . HOH H .   ? 0.6815 0.5038 0.6851 0.0093  0.0934  0.2243  1201 HOH A O   
1352 O  O   . HOH H .   ? 0.6266 0.3157 0.4073 -0.2526 -0.2953 0.1183  1202 HOH A O   
1353 O  O   . HOH H .   ? 0.2879 0.4435 0.2418 -0.1084 0.0105  -0.0706 1203 HOH A O   
1354 O  O   . HOH H .   ? 0.6523 1.0688 0.3762 -0.2218 0.2255  -0.0094 1204 HOH A O   
1355 O  O   . HOH H .   ? 1.1189 0.6430 0.6481 -0.1533 -0.1983 0.0186  1205 HOH A O   
1356 O  O   . HOH H .   ? 0.7471 0.5593 0.6573 0.0701  -0.0368 0.2371  1206 HOH A O   
1357 O  O   . HOH H .   ? 0.3326 0.3909 0.4536 0.1395  -0.0006 0.0191  1207 HOH A O   
1358 O  O   . HOH H .   ? 0.7581 0.7939 0.1982 -0.2075 0.0193  -0.0877 1208 HOH A O   
1359 O  O   . HOH H .   ? 0.5297 0.2414 0.4535 -0.0713 -0.2324 0.0893  1209 HOH A O   
1360 O  O   . HOH H .   ? 0.5646 0.6932 0.7306 -0.0824 -0.0857 0.3716  1210 HOH A O   
1361 O  O   . HOH H .   ? 0.5161 0.8511 0.7158 -0.0720 -0.1214 -0.0110 1211 HOH A O   
1362 O  O   . HOH H .   ? 0.7132 0.4694 0.5003 -0.1456 0.1230  -0.1731 1212 HOH A O   
1363 O  O   . HOH H .   ? 0.4284 0.6741 0.6366 0.1226  0.0776  0.0907  1213 HOH A O   
1364 O  O   . HOH H .   ? 0.3279 0.7033 0.5291 0.0555  -0.1092 -0.2035 1214 HOH A O   
1365 O  O   . HOH H .   ? 0.7651 0.9148 0.4795 -0.2573 0.3251  -0.0363 1215 HOH A O   
1366 O  O   . HOH H .   ? 0.5227 0.5005 0.6205 0.0649  -0.3817 0.0722  1216 HOH A O   
1367 O  O   . HOH H .   ? 0.7537 0.6386 0.3368 0.2927  0.0473  -0.1237 1217 HOH A O   
1368 O  O   . HOH H .   ? 0.5499 0.6706 0.7035 -0.1430 0.1496  -0.2377 1218 HOH A O   
1369 O  O   . HOH H .   ? 0.7693 0.3496 0.3919 -0.0349 0.0129  0.0209  1219 HOH A O   
1370 O  O   . HOH H .   ? 0.7377 0.2361 0.2667 -0.0382 -0.1497 -0.1027 1220 HOH A O   
1371 O  O   . HOH H .   ? 0.5397 0.2799 0.4414 -0.0103 0.1278  0.0292  1221 HOH A O   
1372 O  O   . HOH H .   ? 0.8169 0.8190 0.7281 -0.0891 -0.1755 0.0660  1222 HOH A O   
1373 O  O   . HOH H .   ? 0.6173 0.3137 0.3214 -0.1605 0.0271  0.0690  1223 HOH A O   
1374 O  O   . HOH H .   ? 0.7809 0.6473 0.6739 -0.1487 -0.0148 0.2061  1224 HOH A O   
1375 O  O   . HOH H .   ? 0.4554 0.6618 0.5939 0.1952  -0.2153 0.0710  1225 HOH A O   
1376 O  O   . HOH H .   ? 0.4892 0.7602 0.5631 0.1155  0.0693  0.1286  1226 HOH A O   
1377 O  O   . HOH H .   ? 0.5833 0.6978 0.2933 -0.1974 -0.0866 -0.0478 1227 HOH A O   
1378 O  O   . HOH H .   ? 0.5751 0.6912 0.6096 -0.0334 -0.0270 -0.2622 1228 HOH A O   
1379 O  O   . HOH H .   ? 0.9712 0.5984 0.4833 -0.1860 -0.1386 0.0312  1229 HOH A O   
1380 O  O   . HOH H .   ? 0.2773 0.4309 0.4417 -0.1421 -0.0183 0.0541  1230 HOH A O   
1381 O  O   . HOH H .   ? 0.5706 0.6378 0.5741 0.2312  -0.2710 -0.0796 1231 HOH A O   
1382 O  O   . HOH H .   ? 0.5934 0.9642 0.6222 -0.0014 0.0722  -0.0090 1232 HOH A O   
1383 O  O   . HOH H .   ? 0.6238 0.6104 0.6935 -0.0112 -0.2682 0.1765  1233 HOH A O   
1384 O  O   . HOH H .   ? 0.5788 0.4564 0.5442 -0.0822 -0.0811 -0.0222 1234 HOH A O   
1385 O  O   . HOH H .   ? 0.5444 0.6377 0.4792 -0.0544 -0.1011 0.0261  1235 HOH A O   
1386 O  O   . HOH H .   ? 0.6358 0.8178 0.8037 0.1789  -0.0877 -0.2203 1236 HOH A O   
1387 O  O   . HOH H .   ? 0.5092 0.4271 0.3064 -0.1740 0.2033  0.0150  1237 HOH A O   
1388 O  O   . HOH H .   ? 0.6320 0.4378 0.5451 -0.0695 0.1569  0.1382  1238 HOH A O   
1389 O  O   . HOH H .   ? 0.4272 0.4521 0.3100 -0.2594 -0.0403 -0.0948 1239 HOH A O   
1390 O  O   . HOH H .   ? 0.8656 0.6535 0.4403 -0.0343 0.2073  0.0891  1240 HOH A O   
1391 O  O   . HOH H .   ? 0.5200 0.2846 0.4611 -0.0322 -0.1244 -0.0949 1241 HOH A O   
1392 O  O   . HOH H .   ? 0.8855 0.5562 0.6289 0.0139  -0.2626 0.1074  1242 HOH A O   
1393 O  O   . HOH H .   ? 0.6046 0.6515 0.4603 -0.0657 -0.0648 -0.2669 1243 HOH A O   
1394 O  O   . HOH H .   ? 0.3518 0.3369 0.3968 0.1756  -0.1180 -0.0680 1244 HOH A O   
1395 O  O   . HOH H .   ? 0.3012 0.4049 0.4874 -0.0444 -0.0849 -0.0691 1245 HOH A O   
1396 O  O   . HOH H .   ? 0.2043 0.8030 0.8284 -0.0314 -0.1300 0.0310  1246 HOH A O   
1397 O  O   . HOH H .   ? 0.6243 0.8380 0.3866 0.0755  -0.0763 -0.0983 1247 HOH A O   
1398 O  O   . HOH H .   ? 0.5285 0.6643 0.8355 -0.1688 0.2261  -0.0096 1248 HOH A O   
1399 O  O   . HOH H .   ? 0.4995 0.5340 0.3663 -0.0896 0.0053  0.0158  1249 HOH A O   
1400 O  O   . HOH H .   ? 0.4813 0.8298 0.6284 -0.1447 0.1445  0.2795  1250 HOH A O   
1402 O  O   . HOH H .   ? 0.5281 0.4954 0.7097 0.0283  -0.1135 0.1966  1252 HOH A O   
1403 O  O   . HOH H .   ? 0.3764 0.6081 0.4983 -0.0074 -0.0126 -0.1062 1253 HOH A O   
1404 O  O   . HOH H .   ? 0.5190 0.3489 0.3942 -0.0634 0.1122  -0.1380 1254 HOH A O   
1405 O  O   . HOH H .   ? 0.4304 0.5116 0.5382 0.1039  -0.1347 0.2359  1255 HOH A O   
1406 O  O   . HOH H .   ? 0.7567 0.6613 0.4994 -0.1173 0.2405  0.1103  1256 HOH A O   
1407 O  O   . HOH H .   ? 0.4407 0.4621 0.5327 0.0152  -0.1683 -0.0576 1257 HOH A O   
1408 O  O   . HOH H .   ? 0.6436 0.7176 0.6840 -0.2478 0.0191  0.0109  1258 HOH A O   
1409 O  O   . HOH H .   ? 0.5892 0.4487 0.4204 0.1375  -0.0103 0.0615  1259 HOH A O   
1410 O  O   . HOH H .   ? 0.7191 0.6562 0.4834 0.0723  0.3013  -0.1952 1260 HOH A O   
1411 O  O   . HOH H .   ? 0.6251 0.4115 0.3904 -0.2702 0.0714  0.0060  1261 HOH A O   
1412 O  O   . HOH H .   ? 0.3588 0.4296 0.6572 0.1019  -0.1558 0.0908  1262 HOH A O   
1413 O  O   . HOH H .   ? 0.4551 0.5477 0.2866 -0.0731 -0.0386 0.0288  1263 HOH A O   
1414 O  O   . HOH H .   ? 0.9086 0.6694 0.6861 0.0132  -0.1921 0.0223  1264 HOH A O   
1415 O  O   . HOH H .   ? 0.7064 0.6862 0.4552 -0.2334 -0.0700 -0.0698 1265 HOH A O   
1416 O  O   . HOH H .   ? 0.6149 0.5002 0.3114 0.0532  0.0613  -0.0037 1266 HOH A O   
1417 O  O   . HOH H .   ? 0.7296 0.3118 0.4057 -0.1562 -0.0273 -0.0371 1267 HOH A O   
1418 O  O   . HOH H .   ? 0.6090 0.5020 0.3106 0.0355  -0.0511 -0.0389 1268 HOH A O   
1419 O  O   . HOH H .   ? 0.4341 0.6398 0.2616 -0.0467 0.0303  0.0116  1269 HOH A O   
1420 O  O   . HOH H .   ? 0.5111 0.5205 0.6417 0.0508  -0.0836 0.0688  1270 HOH A O   
1421 O  O   . HOH H .   ? 0.3881 0.4566 0.4989 -0.0487 -0.2195 -0.1665 1271 HOH A O   
1422 O  O   . HOH H .   ? 0.5036 0.5602 0.5756 -0.3008 0.1953  -0.1804 1272 HOH A O   
1423 O  O   . HOH H .   ? 0.4993 0.7476 0.6453 -0.0672 -0.2700 0.0089  1273 HOH A O   
1424 O  O   . HOH H .   ? 0.4531 0.4822 0.4700 0.1459  0.0748  0.1336  1274 HOH A O   
1425 O  O   . HOH H .   ? 0.7656 0.2112 0.4581 0.0944  -0.2791 0.0002  1275 HOH A O   
1426 O  O   . HOH H .   ? 0.4992 0.5988 0.5647 -0.0525 -0.1424 -0.0792 1276 HOH A O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   SER 2   2   ?   ?   ?   A . n 
A 1 3   ASN 3   3   3   ASN ASN A . n 
A 1 4   ILE 4   4   4   ILE ILE A . n 
A 1 5   THR 5   5   5   THR THR A . n 
A 1 6   ILE 6   6   6   ILE ILE A . n 
A 1 7   TYR 7   7   7   TYR TYR A . n 
A 1 8   HIS 8   8   8   HIS HIS A . n 
A 1 9   ASN 9   9   9   ASN ASN A . n 
A 1 10  PRO 10  10  10  PRO PRO A . n 
A 1 11  ALA 11  11  11  ALA ALA A . n 
A 1 12  SER 12  12  12  SER SER A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  THR 14  14  14  THR THR A . n 
A 1 15  SER 15  15  15  SER SER A . n 
A 1 16  ARG 16  16  16  ARG ARG A . n 
A 1 17  ASN 17  17  17  ASN ASN A . n 
A 1 18  THR 18  18  18  THR THR A . n 
A 1 19  LEU 19  19  19  LEU LEU A . n 
A 1 20  GLU 20  20  20  GLU GLU A . n 
A 1 21  MET 21  21  21  MET MET A . n 
A 1 22  ILE 22  22  22  ILE ILE A . n 
A 1 23  ARG 23  23  23  ARG ARG A . n 
A 1 24  ASN 24  24  24  ASN ASN A . n 
A 1 25  SER 25  25  25  SER SER A . n 
A 1 26  GLY 26  26  26  GLY GLY A . n 
A 1 27  THR 27  27  27  THR THR A . n 
A 1 28  GLU 28  28  28  GLU GLU A . n 
A 1 29  PRO 29  29  29  PRO PRO A . n 
A 1 30  THR 30  30  30  THR THR A . n 
A 1 31  ILE 31  31  31  ILE ILE A . n 
A 1 32  ILE 32  32  32  ILE ILE A . n 
A 1 33  LEU 33  33  33  LEU LEU A . n 
A 1 34  TYR 34  34  34  TYR TYR A . n 
A 1 35  LEU 35  35  35  LEU LEU A . n 
A 1 36  GLU 36  36  36  GLU GLU A . n 
A 1 37  ASN 37  37  37  ASN ASN A . n 
A 1 38  PRO 38  38  38  PRO PRO A . n 
A 1 39  PRO 39  39  39  PRO PRO A . n 
A 1 40  SER 40  40  40  SER SER A . n 
A 1 41  ARG 41  41  41  ARG ARG A . n 
A 1 42  ASP 42  42  42  ASP ASP A . n 
A 1 43  GLU 43  43  43  GLU GLU A . n 
A 1 44  LEU 44  44  44  LEU LEU A . n 
A 1 45  VAL 45  45  45  VAL VAL A . n 
A 1 46  LYS 46  46  46  LYS LYS A . n 
A 1 47  LEU 47  47  47  LEU LEU A . n 
A 1 48  ILE 48  48  48  ILE ILE A . n 
A 1 49  ALA 49  49  49  ALA ALA A . n 
A 1 50  ASP 50  50  50  ASP ASP A . n 
A 1 51  MET 51  51  51  MET MET A . n 
A 1 52  GLY 52  52  52  GLY GLY A . n 
A 1 53  ILE 53  53  53  ILE ILE A . n 
A 1 54  SER 54  54  54  SER SER A . n 
A 1 55  VAL 55  55  55  VAL VAL A . n 
A 1 56  ARG 56  56  56  ARG ARG A . n 
A 1 57  ALA 57  57  57  ALA ALA A . n 
A 1 58  LEU 58  58  58  LEU LEU A . n 
A 1 59  LEU 59  59  59  LEU LEU A . n 
A 1 60  ARG 60  60  60  ARG ARG A . n 
A 1 61  LYS 61  61  61  LYS LYS A . n 
A 1 62  ASN 62  62  62  ASN ASN A . n 
A 1 63  VAL 63  63  63  VAL VAL A . n 
A 1 64  GLU 64  64  64  GLU GLU A . n 
A 1 65  PRO 65  65  65  PRO PRO A . n 
A 1 66  TYR 66  66  66  TYR TYR A . n 
A 1 67  GLU 67  67  67  GLU GLU A . n 
A 1 68  GLN 68  68  68  GLN GLN A . n 
A 1 69  LEU 69  69  69  LEU LEU A . n 
A 1 70  GLY 70  70  70  GLY GLY A . n 
A 1 71  LEU 71  71  71  LEU LEU A . n 
A 1 72  ALA 72  72  72  ALA ALA A . n 
A 1 73  GLU 73  73  73  GLU GLU A . n 
A 1 74  ASP 74  74  74  ASP ASP A . n 
A 1 75  LYS 75  75  75  LYS LYS A . n 
A 1 76  PHE 76  76  76  PHE PHE A . n 
A 1 77  THR 77  77  77  THR THR A . n 
A 1 78  ASP 78  78  78  ASP ASP A . n 
A 1 79  ASP 79  79  79  ASP ASP A . n 
A 1 80  GLN 80  80  80  GLN GLN A . n 
A 1 81  LEU 81  81  81  LEU LEU A . n 
A 1 82  ILE 82  82  82  ILE ILE A . n 
A 1 83  ASP 83  83  83  ASP ASP A . n 
A 1 84  PHE 84  84  84  PHE PHE A . n 
A 1 85  MET 85  85  85  MET MET A . n 
A 1 86  LEU 86  86  86  LEU LEU A . n 
A 1 87  GLN 87  87  87  GLN GLN A . n 
A 1 88  HIS 88  88  88  HIS HIS A . n 
A 1 89  PRO 89  89  89  PRO PRO A . n 
A 1 90  ILE 90  90  90  ILE ILE A . n 
A 1 91  LEU 91  91  91  LEU LEU A . n 
A 1 92  ILE 92  92  92  ILE ILE A . n 
A 1 93  ASN 93  93  93  ASN ASN A . n 
A 1 94  ARG 94  94  94  ARG ARG A . n 
A 1 95  PRO 95  95  95  PRO PRO A . n 
A 1 96  ILE 96  96  96  ILE ILE A . n 
A 1 97  VAL 97  97  97  VAL VAL A . n 
A 1 98  VAL 98  98  98  VAL VAL A . n 
A 1 99  THR 99  99  99  THR THR A . n 
A 1 100 PRO 100 100 100 PRO PRO A . n 
A 1 101 LEU 101 101 101 LEU LEU A . n 
A 1 102 GLY 102 102 102 GLY GLY A . n 
A 1 103 THR 103 103 103 THR THR A . n 
A 1 104 ARG 104 104 104 ARG ARG A . n 
A 1 105 LEU 105 105 105 LEU LEU A . n 
A 1 106 CYS 106 106 106 CYS CYS A . n 
A 1 107 ARG 107 107 107 ARG ARG A . n 
A 1 108 PRO 108 108 108 PRO PRO A . n 
A 1 109 SER 109 109 109 SER SER A . n 
A 1 110 GLU 110 110 110 GLU GLU A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 VAL 112 112 112 VAL VAL A . n 
A 1 113 LEU 113 113 113 LEU LEU A . n 
A 1 114 ASP 114 114 114 ASP ASP A . n 
A 1 115 ILE 115 115 115 ILE ILE A . n 
A 1 116 LEU 116 116 116 LEU LEU A . n 
A 1 117 GLN 117 117 117 GLN GLN A . n 
A 1 118 ASP 118 118 118 ASP ASP A . n 
A 1 119 ALA 119 119 119 ALA ALA A . n 
A 1 120 GLN 120 120 120 GLN GLN A . n 
A 1 121 LYS 121 121 121 LYS LYS A . n 
A 1 122 GLY 122 122 122 GLY GLY A . n 
A 1 123 ALA 123 123 123 ALA ALA A . n 
A 1 124 PHE 124 124 124 PHE PHE A . n 
A 1 125 THR 125 125 125 THR THR A . n 
A 1 126 LYS 126 126 126 LYS LYS A . n 
A 1 127 GLU 127 127 127 GLU GLU A . n 
A 1 128 ASP 128 128 128 ASP ASP A . n 
A 1 129 GLY 129 129 129 GLY GLY A . n 
A 1 130 GLU 130 130 130 GLU GLU A . n 
A 1 131 LYS 131 131 131 LYS LYS A . n 
A 1 132 VAL 132 132 132 VAL VAL A . n 
A 1 133 VAL 133 133 133 VAL VAL A . n 
A 1 134 ASP 134 134 134 ASP ASP A . n 
A 1 135 GLU 135 135 135 GLU GLU A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 GLY 137 137 137 GLY GLY A . n 
A 1 138 LYS 138 138 138 LYS LYS A . n 
A 1 139 ARG 139 139 139 ARG ARG A . n 
A 1 140 LEU 140 140 140 LEU LEU A . n 
A 1 141 LYS 141 141 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 SO4 1   201  201  SO4 SO4 A . 
C 2 SO4 1   202  202  SO4 SO4 A . 
D 2 SO4 1   203  203  SO4 SO4 A . 
E 3 CS  1   301  301  CS  CS  A . 
F 3 CS  1   302  302  CS  CS  A . 
G 3 CS  1   303  303  CS  CS  A . 
H 4 HOH 1   1001 1001 HOH HOH A . 
H 4 HOH 2   1002 1002 HOH HOH A . 
H 4 HOH 3   1003 1003 HOH HOH A . 
H 4 HOH 4   1004 14   HOH HOH A . 
H 4 HOH 5   1005 1005 HOH HOH A . 
H 4 HOH 6   1006 1006 HOH HOH A . 
H 4 HOH 7   1007 22   HOH HOH A . 
H 4 HOH 8   1008 1008 HOH HOH A . 
H 4 HOH 9   1009 1009 HOH HOH A . 
H 4 HOH 10  1010 1010 HOH HOH A . 
H 4 HOH 11  1011 1011 HOH HOH A . 
H 4 HOH 12  1012 1012 HOH HOH A . 
H 4 HOH 13  1013 1013 HOH HOH A . 
H 4 HOH 14  1014 1014 HOH HOH A . 
H 4 HOH 15  1015 1015 HOH HOH A . 
H 4 HOH 16  1016 1016 HOH HOH A . 
H 4 HOH 17  1017 1017 HOH HOH A . 
H 4 HOH 18  1018 45   HOH HOH A . 
H 4 HOH 19  1019 1019 HOH HOH A . 
H 4 HOH 20  1020 1020 HOH HOH A . 
H 4 HOH 21  1021 1021 HOH HOH A . 
H 4 HOH 22  1022 1022 HOH HOH A . 
H 4 HOH 23  1023 1023 HOH HOH A . 
H 4 HOH 24  1024 1024 HOH HOH A . 
H 4 HOH 25  1025 1025 HOH HOH A . 
H 4 HOH 26  1026 1026 HOH HOH A . 
H 4 HOH 27  1027 1027 HOH HOH A . 
H 4 HOH 28  1028 1028 HOH HOH A . 
H 4 HOH 29  1029 78   HOH HOH A . 
H 4 HOH 30  1030 1030 HOH HOH A . 
H 4 HOH 31  1031 1031 HOH HOH A . 
H 4 HOH 32  1032 1032 HOH HOH A . 
H 4 HOH 33  1033 1033 HOH HOH A . 
H 4 HOH 34  1034 1034 HOH HOH A . 
H 4 HOH 35  1035 17   HOH HOH A . 
H 4 HOH 36  1036 1036 HOH HOH A . 
H 4 HOH 37  1037 1037 HOH HOH A . 
H 4 HOH 38  1038 1038 HOH HOH A . 
H 4 HOH 39  1039 1039 HOH HOH A . 
H 4 HOH 40  1040 1040 HOH HOH A . 
H 4 HOH 41  1041 1041 HOH HOH A . 
H 4 HOH 42  1042 1042 HOH HOH A . 
H 4 HOH 43  1043 1043 HOH HOH A . 
H 4 HOH 44  1044 1044 HOH HOH A . 
H 4 HOH 45  1045 1045 HOH HOH A . 
H 4 HOH 46  1046 1046 HOH HOH A . 
H 4 HOH 47  1047 1047 HOH HOH A . 
H 4 HOH 48  1048 1048 HOH HOH A . 
H 4 HOH 49  1049 1049 HOH HOH A . 
H 4 HOH 50  1050 1050 HOH HOH A . 
H 4 HOH 51  1051 65   HOH HOH A . 
H 4 HOH 52  1052 1052 HOH HOH A . 
H 4 HOH 53  1053 1053 HOH HOH A . 
H 4 HOH 54  1054 1054 HOH HOH A . 
H 4 HOH 55  1055 1055 HOH HOH A . 
H 4 HOH 56  1056 1056 HOH HOH A . 
H 4 HOH 57  1057 1057 HOH HOH A . 
H 4 HOH 58  1058 58   HOH HOH A . 
H 4 HOH 59  1059 1059 HOH HOH A . 
H 4 HOH 60  1060 1060 HOH HOH A . 
H 4 HOH 61  1061 1061 HOH HOH A . 
H 4 HOH 62  1062 1062 HOH HOH A . 
H 4 HOH 63  1063 1063 HOH HOH A . 
H 4 HOH 64  1064 1064 HOH HOH A . 
H 4 HOH 65  1065 1065 HOH HOH A . 
H 4 HOH 66  1066 1066 HOH HOH A . 
H 4 HOH 67  1067 1067 HOH HOH A . 
H 4 HOH 68  1068 101  HOH HOH A . 
H 4 HOH 69  1069 55   HOH HOH A . 
H 4 HOH 70  1070 1070 HOH HOH A . 
H 4 HOH 71  1071 1071 HOH HOH A . 
H 4 HOH 72  1072 1072 HOH HOH A . 
H 4 HOH 73  1073 1073 HOH HOH A . 
H 4 HOH 74  1074 1074 HOH HOH A . 
H 4 HOH 75  1075 1075 HOH HOH A . 
H 4 HOH 76  1076 1076 HOH HOH A . 
H 4 HOH 77  1077 62   HOH HOH A . 
H 4 HOH 78  1078 1078 HOH HOH A . 
H 4 HOH 79  1079 1079 HOH HOH A . 
H 4 HOH 80  1080 1080 HOH HOH A . 
H 4 HOH 81  1081 1081 HOH HOH A . 
H 4 HOH 82  1082 1082 HOH HOH A . 
H 4 HOH 83  1083 1083 HOH HOH A . 
H 4 HOH 84  1084 1084 HOH HOH A . 
H 4 HOH 85  1085 1085 HOH HOH A . 
H 4 HOH 86  1086 1086 HOH HOH A . 
H 4 HOH 87  1087 1087 HOH HOH A . 
H 4 HOH 88  1088 1088 HOH HOH A . 
H 4 HOH 89  1089 1089 HOH HOH A . 
H 4 HOH 90  1090 1090 HOH HOH A . 
H 4 HOH 91  1091 1091 HOH HOH A . 
H 4 HOH 92  1092 1092 HOH HOH A . 
H 4 HOH 93  1093 1093 HOH HOH A . 
H 4 HOH 94  1094 1094 HOH HOH A . 
H 4 HOH 95  1095 1095 HOH HOH A . 
H 4 HOH 96  1096 1096 HOH HOH A . 
H 4 HOH 97  1097 1097 HOH HOH A . 
H 4 HOH 98  1098 1098 HOH HOH A . 
H 4 HOH 99  1099 1099 HOH HOH A . 
H 4 HOH 100 1100 1100 HOH HOH A . 
H 4 HOH 101 1101 1101 HOH HOH A . 
H 4 HOH 102 1102 1102 HOH HOH A . 
H 4 HOH 103 1103 1103 HOH HOH A . 
H 4 HOH 104 1104 1104 HOH HOH A . 
H 4 HOH 105 1105 1105 HOH HOH A . 
H 4 HOH 106 1106 156  HOH HOH A . 
H 4 HOH 107 1107 1107 HOH HOH A . 
H 4 HOH 108 1108 1108 HOH HOH A . 
H 4 HOH 109 1109 1109 HOH HOH A . 
H 4 HOH 110 1110 1110 HOH HOH A . 
H 4 HOH 111 1111 1111 HOH HOH A . 
H 4 HOH 112 1112 1112 HOH HOH A . 
H 4 HOH 113 1113 1113 HOH HOH A . 
H 4 HOH 114 1114 1114 HOH HOH A . 
H 4 HOH 115 1115 1115 HOH HOH A . 
H 4 HOH 116 1116 1116 HOH HOH A . 
H 4 HOH 117 1117 1117 HOH HOH A . 
H 4 HOH 118 1118 1118 HOH HOH A . 
H 4 HOH 119 1119 1119 HOH HOH A . 
H 4 HOH 120 1120 1120 HOH HOH A . 
H 4 HOH 121 1121 1121 HOH HOH A . 
H 4 HOH 122 1122 1122 HOH HOH A . 
H 4 HOH 123 1123 1123 HOH HOH A . 
H 4 HOH 124 1124 1124 HOH HOH A . 
H 4 HOH 125 1125 1125 HOH HOH A . 
H 4 HOH 126 1126 1126 HOH HOH A . 
H 4 HOH 127 1127 1127 HOH HOH A . 
H 4 HOH 128 1128 1128 HOH HOH A . 
H 4 HOH 129 1129 1129 HOH HOH A . 
H 4 HOH 130 1130 1130 HOH HOH A . 
H 4 HOH 131 1131 1131 HOH HOH A . 
H 4 HOH 132 1132 1132 HOH HOH A . 
H 4 HOH 133 1133 1133 HOH HOH A . 
H 4 HOH 134 1134 1134 HOH HOH A . 
H 4 HOH 135 1135 1135 HOH HOH A . 
H 4 HOH 136 1136 1136 HOH HOH A . 
H 4 HOH 137 1137 1137 HOH HOH A . 
H 4 HOH 138 1138 1138 HOH HOH A . 
H 4 HOH 139 1139 1139 HOH HOH A . 
H 4 HOH 140 1140 1140 HOH HOH A . 
H 4 HOH 141 1141 1141 HOH HOH A . 
H 4 HOH 142 1142 1142 HOH HOH A . 
H 4 HOH 143 1143 1143 HOH HOH A . 
H 4 HOH 144 1144 1144 HOH HOH A . 
H 4 HOH 145 1145 1145 HOH HOH A . 
H 4 HOH 146 1146 1146 HOH HOH A . 
H 4 HOH 147 1147 1147 HOH HOH A . 
H 4 HOH 148 1148 1148 HOH HOH A . 
H 4 HOH 149 1149 1149 HOH HOH A . 
H 4 HOH 150 1150 1150 HOH HOH A . 
H 4 HOH 151 1151 1151 HOH HOH A . 
H 4 HOH 152 1152 1152 HOH HOH A . 
H 4 HOH 153 1153 1153 HOH HOH A . 
H 4 HOH 154 1154 1154 HOH HOH A . 
H 4 HOH 155 1155 1155 HOH HOH A . 
H 4 HOH 156 1156 1156 HOH HOH A . 
H 4 HOH 157 1157 1157 HOH HOH A . 
H 4 HOH 158 1158 1158 HOH HOH A . 
H 4 HOH 159 1159 1159 HOH HOH A . 
H 4 HOH 160 1160 1160 HOH HOH A . 
H 4 HOH 161 1161 1161 HOH HOH A . 
H 4 HOH 162 1162 1162 HOH HOH A . 
H 4 HOH 163 1163 175  HOH HOH A . 
H 4 HOH 164 1164 1164 HOH HOH A . 
H 4 HOH 165 1165 1165 HOH HOH A . 
H 4 HOH 166 1166 1166 HOH HOH A . 
H 4 HOH 167 1167 1167 HOH HOH A . 
H 4 HOH 168 1168 1168 HOH HOH A . 
H 4 HOH 169 1169 1169 HOH HOH A . 
H 4 HOH 170 1170 1170 HOH HOH A . 
H 4 HOH 171 1171 1171 HOH HOH A . 
H 4 HOH 172 1172 1172 HOH HOH A . 
H 4 HOH 173 1173 1173 HOH HOH A . 
H 4 HOH 174 1174 1174 HOH HOH A . 
H 4 HOH 175 1175 1175 HOH HOH A . 
H 4 HOH 176 1176 1176 HOH HOH A . 
H 4 HOH 177 1177 1177 HOH HOH A . 
H 4 HOH 178 1178 1178 HOH HOH A . 
H 4 HOH 179 1179 1179 HOH HOH A . 
H 4 HOH 180 1180 182  HOH HOH A . 
H 4 HOH 181 1181 1181 HOH HOH A . 
H 4 HOH 182 1182 1182 HOH HOH A . 
H 4 HOH 183 1183 1183 HOH HOH A . 
H 4 HOH 184 1184 1184 HOH HOH A . 
H 4 HOH 185 1185 1185 HOH HOH A . 
H 4 HOH 186 1186 1186 HOH HOH A . 
H 4 HOH 187 1187 1187 HOH HOH A . 
H 4 HOH 188 1188 1188 HOH HOH A . 
H 4 HOH 189 1189 1189 HOH HOH A . 
H 4 HOH 190 1190 1190 HOH HOH A . 
H 4 HOH 191 1191 1191 HOH HOH A . 
H 4 HOH 192 1192 1192 HOH HOH A . 
H 4 HOH 193 1193 1193 HOH HOH A . 
H 4 HOH 194 1194 1194 HOH HOH A . 
H 4 HOH 195 1195 1195 HOH HOH A . 
H 4 HOH 196 1196 1196 HOH HOH A . 
H 4 HOH 197 1197 1197 HOH HOH A . 
H 4 HOH 198 1198 1198 HOH HOH A . 
H 4 HOH 199 1199 1199 HOH HOH A . 
H 4 HOH 200 1200 1200 HOH HOH A . 
H 4 HOH 201 1201 1201 HOH HOH A . 
H 4 HOH 202 1202 1202 HOH HOH A . 
H 4 HOH 203 1203 1203 HOH HOH A . 
H 4 HOH 204 1204 1204 HOH HOH A . 
H 4 HOH 205 1205 1205 HOH HOH A . 
H 4 HOH 206 1206 1206 HOH HOH A . 
H 4 HOH 207 1207 1207 HOH HOH A . 
H 4 HOH 208 1208 1208 HOH HOH A . 
H 4 HOH 209 1209 1209 HOH HOH A . 
H 4 HOH 210 1210 1210 HOH HOH A . 
H 4 HOH 211 1211 1211 HOH HOH A . 
H 4 HOH 212 1212 1212 HOH HOH A . 
H 4 HOH 213 1213 1213 HOH HOH A . 
H 4 HOH 214 1214 1214 HOH HOH A . 
H 4 HOH 215 1215 1215 HOH HOH A . 
H 4 HOH 216 1216 1216 HOH HOH A . 
H 4 HOH 217 1217 1217 HOH HOH A . 
H 4 HOH 218 1218 1218 HOH HOH A . 
H 4 HOH 219 1219 1219 HOH HOH A . 
H 4 HOH 220 1220 1220 HOH HOH A . 
H 4 HOH 221 1221 1221 HOH HOH A . 
H 4 HOH 222 1222 1222 HOH HOH A . 
H 4 HOH 223 1223 1223 HOH HOH A . 
H 4 HOH 224 1224 1224 HOH HOH A . 
H 4 HOH 225 1225 1225 HOH HOH A . 
H 4 HOH 226 1226 1226 HOH HOH A . 
H 4 HOH 227 1227 1227 HOH HOH A . 
H 4 HOH 228 1228 1228 HOH HOH A . 
H 4 HOH 229 1229 1229 HOH HOH A . 
H 4 HOH 230 1230 1230 HOH HOH A . 
H 4 HOH 231 1231 1231 HOH HOH A . 
H 4 HOH 232 1232 1232 HOH HOH A . 
H 4 HOH 233 1233 1233 HOH HOH A . 
H 4 HOH 234 1234 1234 HOH HOH A . 
H 4 HOH 235 1235 1235 HOH HOH A . 
H 4 HOH 236 1236 1236 HOH HOH A . 
H 4 HOH 237 1237 1237 HOH HOH A . 
H 4 HOH 238 1238 1238 HOH HOH A . 
H 4 HOH 239 1239 1239 HOH HOH A . 
H 4 HOH 240 1240 1240 HOH HOH A . 
H 4 HOH 241 1241 1241 HOH HOH A . 
H 4 HOH 242 1242 1242 HOH HOH A . 
H 4 HOH 243 1243 1243 HOH HOH A . 
H 4 HOH 244 1244 1244 HOH HOH A . 
H 4 HOH 245 1245 1245 HOH HOH A . 
H 4 HOH 246 1246 1246 HOH HOH A . 
H 4 HOH 247 1247 1247 HOH HOH A . 
H 4 HOH 248 1248 1248 HOH HOH A . 
H 4 HOH 249 1249 1249 HOH HOH A . 
H 4 HOH 250 1250 1250 HOH HOH A . 
H 4 HOH 251 1251 1251 HOH HOH A . 
H 4 HOH 252 1252 1252 HOH HOH A . 
H 4 HOH 253 1253 1253 HOH HOH A . 
H 4 HOH 254 1254 1254 HOH HOH A . 
H 4 HOH 255 1255 1255 HOH HOH A . 
H 4 HOH 256 1256 233  HOH HOH A . 
H 4 HOH 257 1257 1257 HOH HOH A . 
H 4 HOH 258 1258 1258 HOH HOH A . 
H 4 HOH 259 1259 1259 HOH HOH A . 
H 4 HOH 260 1260 1260 HOH HOH A . 
H 4 HOH 261 1261 1261 HOH HOH A . 
H 4 HOH 262 1262 1262 HOH HOH A . 
H 4 HOH 263 1263 1263 HOH HOH A . 
H 4 HOH 264 1264 1264 HOH HOH A . 
H 4 HOH 265 1265 1265 HOH HOH A . 
H 4 HOH 266 1266 1266 HOH HOH A . 
H 4 HOH 267 1267 1267 HOH HOH A . 
H 4 HOH 268 1268 1268 HOH HOH A . 
H 4 HOH 269 1269 1269 HOH HOH A . 
H 4 HOH 270 1270 1270 HOH HOH A . 
H 4 HOH 271 1271 1271 HOH HOH A . 
H 4 HOH 272 1272 1272 HOH HOH A . 
H 4 HOH 273 1273 1273 HOH HOH A . 
H 4 HOH 274 1274 1274 HOH HOH A . 
H 4 HOH 275 1275 1275 HOH HOH A . 
H 4 HOH 276 1276 1276 HOH HOH A . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PQS  monomeric 1 
2 software_defined_assembly            PISA dimeric   2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1   A,B,C,D,E,F,G,H 
2 1,2 A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
2 'ABSA (A^2)' 3000  ? 
2 MORE         -184  ? 
2 'SSA (A^2)'  13600 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555  x,y,z          1.0000000000 0.0000000000 0.0000000000 0.0000000000   0.0000000000 
1.0000000000  0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 12_566 x,x-y+1,-z+7/6 0.5000000000 0.8660254038 0.0000000000 -43.2375000000 0.8660254038 
-0.5000000000 0.0000000000 74.8895467923 0.0000000000 0.0000000000 -1.0000000000 135.4955000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A SO4 202  ? C SO4 . 
2 1 A CS  301  ? E CS  . 
3 1 A HOH 1178 ? H HOH . 
4 1 A HOH 1252 ? H HOH . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? A PRO 38  ? A PRO 38   ? 1_555  CS ? F CS . ? A CS 302 ? 1_555 N   ? A SER 40  ? A SER 40   ? 1_555  62.8  ? 
2  O   ? A PRO 38  ? A PRO 38   ? 1_555  CS ? F CS . ? A CS 302 ? 1_555 O   ? H HOH .   ? A HOH 1024 ? 1_555  62.5  ? 
3  N   ? A SER 40  ? A SER 40   ? 1_555  CS ? F CS . ? A CS 302 ? 1_555 O   ? H HOH .   ? A HOH 1024 ? 1_555  96.0  ? 
4  O   ? A PRO 38  ? A PRO 38   ? 1_555  CS ? F CS . ? A CS 302 ? 1_555 O   ? H HOH .   ? A HOH 1098 ? 1_555  49.6  ? 
5  N   ? A SER 40  ? A SER 40   ? 1_555  CS ? F CS . ? A CS 302 ? 1_555 O   ? H HOH .   ? A HOH 1098 ? 1_555  102.2 ? 
6  O   ? H HOH .   ? A HOH 1024 ? 1_555  CS ? F CS . ? A CS 302 ? 1_555 O   ? H HOH .   ? A HOH 1098 ? 1_555  84.5  ? 
7  O   ? A PRO 38  ? A PRO 38   ? 1_555  CS ? F CS . ? A CS 302 ? 1_555 O   ? H HOH .   ? A HOH 1157 ? 1_555  71.3  ? 
8  N   ? A SER 40  ? A SER 40   ? 1_555  CS ? F CS . ? A CS 302 ? 1_555 O   ? H HOH .   ? A HOH 1157 ? 1_555  69.1  ? 
9  O   ? H HOH .   ? A HOH 1024 ? 1_555  CS ? F CS . ? A CS 302 ? 1_555 O   ? H HOH .   ? A HOH 1157 ? 1_555  132.9 ? 
10 O   ? H HOH .   ? A HOH 1098 ? 1_555  CS ? F CS . ? A CS 302 ? 1_555 O   ? H HOH .   ? A HOH 1157 ? 1_555  57.8  ? 
11 OE2 ? A GLU 64  ? A GLU 64   ? 1_555  CS ? G CS . ? A CS 303 ? 1_555 NE2 ? A GLN 87  ? A GLN 87   ? 8_676  123.2 ? 
12 OE2 ? A GLU 64  ? A GLU 64   ? 1_555  CS ? G CS . ? A CS 303 ? 1_555 O   ? H HOH .   ? A HOH 1071 ? 1_555  57.5  ? 
13 NE2 ? A GLN 87  ? A GLN 87   ? 8_676  CS ? G CS . ? A CS 303 ? 1_555 O   ? H HOH .   ? A HOH 1071 ? 1_555  68.7  ? 
14 OE2 ? A GLU 64  ? A GLU 64   ? 1_555  CS ? G CS . ? A CS 303 ? 1_555 O   ? H HOH .   ? A HOH 1104 ? 1_555  77.2  ? 
15 NE2 ? A GLN 87  ? A GLN 87   ? 8_676  CS ? G CS . ? A CS 303 ? 1_555 O   ? H HOH .   ? A HOH 1104 ? 1_555  67.2  ? 
16 O   ? H HOH .   ? A HOH 1071 ? 1_555  CS ? G CS . ? A CS 303 ? 1_555 O   ? H HOH .   ? A HOH 1104 ? 1_555  68.8  ? 
17 OE2 ? A GLU 64  ? A GLU 64   ? 1_555  CS ? G CS . ? A CS 303 ? 1_555 O   ? H HOH .   ? A HOH 1210 ? 12_566 62.4  ? 
18 NE2 ? A GLN 87  ? A GLN 87   ? 8_676  CS ? G CS . ? A CS 303 ? 1_555 O   ? H HOH .   ? A HOH 1210 ? 12_566 86.3  ? 
19 O   ? H HOH .   ? A HOH 1071 ? 1_555  CS ? G CS . ? A CS 303 ? 1_555 O   ? H HOH .   ? A HOH 1210 ? 12_566 37.5  ? 
20 O   ? H HOH .   ? A HOH 1104 ? 1_555  CS ? G CS . ? A CS 303 ? 1_555 O   ? H HOH .   ? A HOH 1210 ? 12_566 106.1 ? 
21 OE2 ? A GLU 64  ? A GLU 64   ? 1_555  CS ? G CS . ? A CS 303 ? 1_555 O   ? H HOH .   ? A HOH 1233 ? 12_566 78.4  ? 
22 NE2 ? A GLN 87  ? A GLN 87   ? 8_676  CS ? G CS . ? A CS 303 ? 1_555 O   ? H HOH .   ? A HOH 1233 ? 12_566 141.5 ? 
23 O   ? H HOH .   ? A HOH 1071 ? 1_555  CS ? G CS . ? A CS 303 ? 1_555 O   ? H HOH .   ? A HOH 1233 ? 12_566 110.6 ? 
24 O   ? H HOH .   ? A HOH 1104 ? 1_555  CS ? G CS . ? A CS 303 ? 1_555 O   ? H HOH .   ? A HOH 1233 ? 12_566 150.6 ? 
25 O   ? H HOH .   ? A HOH 1210 ? 12_566 CS ? G CS . ? A CS 303 ? 1_555 O   ? H HOH .   ? A HOH 1233 ? 12_566 76.3  ? 
26 O   ? A LEU 113 ? A LEU 113  ? 1_555  CS ? E CS . ? A CS 301 ? 1_555 O   ? A LEU 113 ? A LEU 113  ? 10_665 133.5 ? 
27 O   ? A LEU 113 ? A LEU 113  ? 1_555  CS ? E CS . ? A CS 301 ? 1_555 O   ? A ASP 114 ? A ASP 114  ? 1_555  68.8  ? 
28 O   ? A LEU 113 ? A LEU 113  ? 10_665 CS ? E CS . ? A CS 301 ? 1_555 O   ? A ASP 114 ? A ASP 114  ? 1_555  72.7  ? 
29 O   ? A LEU 113 ? A LEU 113  ? 1_555  CS ? E CS . ? A CS 301 ? 1_555 O   ? A ASP 114 ? A ASP 114  ? 10_665 72.7  ? 
30 O   ? A LEU 113 ? A LEU 113  ? 10_665 CS ? E CS . ? A CS 301 ? 1_555 O   ? A ASP 114 ? A ASP 114  ? 10_665 68.8  ? 
31 O   ? A ASP 114 ? A ASP 114  ? 1_555  CS ? E CS . ? A CS 301 ? 1_555 O   ? A ASP 114 ? A ASP 114  ? 10_665 66.7  ? 
32 O   ? A LEU 113 ? A LEU 113  ? 1_555  CS ? E CS . ? A CS 301 ? 1_555 O   ? A LEU 116 ? A LEU 116  ? 1_555  79.4  ? 
33 O   ? A LEU 113 ? A LEU 113  ? 10_665 CS ? E CS . ? A CS 301 ? 1_555 O   ? A LEU 116 ? A LEU 116  ? 1_555  129.4 ? 
34 O   ? A ASP 114 ? A ASP 114  ? 1_555  CS ? E CS . ? A CS 301 ? 1_555 O   ? A LEU 116 ? A LEU 116  ? 1_555  94.8  ? 
35 O   ? A ASP 114 ? A ASP 114  ? 10_665 CS ? E CS . ? A CS 301 ? 1_555 O   ? A LEU 116 ? A LEU 116  ? 1_555  150.6 ? 
36 O   ? A LEU 113 ? A LEU 113  ? 1_555  CS ? E CS . ? A CS 301 ? 1_555 O   ? A LEU 116 ? A LEU 116  ? 10_665 129.4 ? 
37 O   ? A LEU 113 ? A LEU 113  ? 10_665 CS ? E CS . ? A CS 301 ? 1_555 O   ? A LEU 116 ? A LEU 116  ? 10_665 79.5  ? 
38 O   ? A ASP 114 ? A ASP 114  ? 1_555  CS ? E CS . ? A CS 301 ? 1_555 O   ? A LEU 116 ? A LEU 116  ? 10_665 150.6 ? 
39 O   ? A ASP 114 ? A ASP 114  ? 10_665 CS ? E CS . ? A CS 301 ? 1_555 O   ? A LEU 116 ? A LEU 116  ? 10_665 94.8  ? 
40 O   ? A LEU 116 ? A LEU 116  ? 1_555  CS ? E CS . ? A CS 301 ? 1_555 O   ? A LEU 116 ? A LEU 116  ? 10_665 110.3 ? 
41 O   ? A LEU 113 ? A LEU 113  ? 1_555  CS ? E CS . ? A CS 301 ? 1_555 O   ? H HOH .   ? A HOH 1025 ? 1_555  142.1 ? 
42 O   ? A LEU 113 ? A LEU 113  ? 10_665 CS ? E CS . ? A CS 301 ? 1_555 O   ? H HOH .   ? A HOH 1025 ? 1_555  83.7  ? 
43 O   ? A ASP 114 ? A ASP 114  ? 1_555  CS ? E CS . ? A CS 301 ? 1_555 O   ? H HOH .   ? A HOH 1025 ? 1_555  131.4 ? 
44 O   ? A ASP 114 ? A ASP 114  ? 10_665 CS ? E CS . ? A CS 301 ? 1_555 O   ? H HOH .   ? A HOH 1025 ? 1_555  141.1 ? 
45 O   ? A LEU 116 ? A LEU 116  ? 1_555  CS ? E CS . ? A CS 301 ? 1_555 O   ? H HOH .   ? A HOH 1025 ? 1_555  68.3  ? 
46 O   ? A LEU 116 ? A LEU 116  ? 10_665 CS ? E CS . ? A CS 301 ? 1_555 O   ? H HOH .   ? A HOH 1025 ? 1_555  52.1  ? 
47 O   ? A LEU 113 ? A LEU 113  ? 1_555  CS ? E CS . ? A CS 301 ? 1_555 O   ? H HOH .   ? A HOH 1025 ? 10_665 83.7  ? 
48 O   ? A LEU 113 ? A LEU 113  ? 10_665 CS ? E CS . ? A CS 301 ? 1_555 O   ? H HOH .   ? A HOH 1025 ? 10_665 142.1 ? 
49 O   ? A ASP 114 ? A ASP 114  ? 1_555  CS ? E CS . ? A CS 301 ? 1_555 O   ? H HOH .   ? A HOH 1025 ? 10_665 141.1 ? 
50 O   ? A ASP 114 ? A ASP 114  ? 10_665 CS ? E CS . ? A CS 301 ? 1_555 O   ? H HOH .   ? A HOH 1025 ? 10_665 131.4 ? 
51 O   ? A LEU 116 ? A LEU 116  ? 1_555  CS ? E CS . ? A CS 301 ? 1_555 O   ? H HOH .   ? A HOH 1025 ? 10_665 52.1  ? 
52 O   ? A LEU 116 ? A LEU 116  ? 10_665 CS ? E CS . ? A CS 301 ? 1_555 O   ? H HOH .   ? A HOH 1025 ? 10_665 68.3  ? 
53 O   ? H HOH .   ? A HOH 1025 ? 1_555  CS ? E CS . ? A CS 301 ? 1_555 O   ? H HOH .   ? A HOH 1025 ? 10_665 61.1  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-02-15 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-11 
5 'Structure model' 1 4 2018-08-29 
6 'Structure model' 1 5 2019-07-24 
7 'Structure model' 1 6 2021-10-27 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' 'Version format compliance' 
2  3 'Structure model' 'Derived calculations'      
3  3 'Structure model' 'Version format compliance' 
4  4 'Structure model' 'Refinement description'    
5  5 'Structure model' 'Data collection'           
6  5 'Structure model' 'Source and taxonomy'       
7  5 'Structure model' 'Structure summary'         
8  6 'Structure model' 'Data collection'           
9  6 'Structure model' 'Refinement description'    
10 7 'Structure model' 'Database references'       
11 7 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' software               
2  5 'Structure model' entity                 
3  5 'Structure model' entity_src_gen         
4  5 'Structure model' entity_src_nat         
5  6 'Structure model' software               
6  7 'Structure model' database_2             
7  7 'Structure model' pdbx_struct_conn_angle 
8  7 'Structure model' struct_conn            
9  7 'Structure model' struct_ref_seq_dif     
10 7 'Structure model' struct_site            
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_software.classification'                    
2  4 'Structure model' '_software.name'                              
3  5 'Structure model' '_entity.src_method'                          
4  6 'Structure model' '_software.classification'                    
5  6 'Structure model' '_software.name'                              
6  7 'Structure model' '_database_2.pdbx_DOI'                        
7  7 'Structure model' '_database_2.pdbx_database_accession'         
8  7 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
9  7 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
10 7 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 
11 7 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
12 7 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
13 7 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id'  
14 7 'Structure model' '_pdbx_struct_conn_angle.ptnr1_symmetry'      
15 7 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id'   
16 7 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 
17 7 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
18 7 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
19 7 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 
20 7 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
21 7 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
22 7 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id'  
23 7 'Structure model' '_pdbx_struct_conn_angle.ptnr3_symmetry'      
24 7 'Structure model' '_pdbx_struct_conn_angle.value'               
25 7 'Structure model' '_struct_conn.pdbx_dist_value'                
26 7 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
27 7 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
28 7 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
29 7 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
30 7 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
31 7 'Structure model' '_struct_conn.ptnr1_label_seq_id'             
32 7 'Structure model' '_struct_conn.ptnr1_symmetry'                 
33 7 'Structure model' '_struct_conn.ptnr2_auth_comp_id'             
34 7 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
35 7 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
36 7 'Structure model' '_struct_conn.ptnr2_label_atom_id'            
37 7 'Structure model' '_struct_conn.ptnr2_label_comp_id'            
38 7 'Structure model' '_struct_conn.ptnr2_label_seq_id'             
39 7 'Structure model' '_struct_conn.ptnr2_symmetry'                 
40 7 'Structure model' '_struct_ref_seq_dif.details'                 
41 7 'Structure model' '_struct_site.pdbx_auth_asym_id'              
42 7 'Structure model' '_struct_site.pdbx_auth_comp_id'              
43 7 'Structure model' '_struct_site.pdbx_auth_seq_id'               
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
SHELXL-97 refinement       .     ? 1 
X-GEN     'data reduction' .     ? 2 
XTALVIEW  refinement       SHELX ? 3 
XDS       'data scaling'   .     ? 4 
XDS       'data reduction' .     ? 5 
X-GEN     'data scaling'   .     ? 6 
SHELX     phasing          .     ? 7 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 NE  A ARG 23  ? ? CZ A ARG 23  ? ? NH2 A ARG 23  ? ? 115.64 120.30 -4.66  0.50 N 
2  1 CA  A GLU 36  ? ? CB A GLU 36  ? ? CG  A GLU 36  ? ? 131.47 113.40 18.07  2.20 N 
3  1 NE  A ARG 41  ? ? CZ A ARG 41  ? ? NH2 A ARG 41  ? ? 125.31 120.30 5.01   0.50 N 
4  1 CA  A GLU 43  ? ? CB A GLU 43  ? A CG  A GLU 43  ? A 129.21 113.40 15.81  2.20 N 
5  1 OE1 A GLU 43  ? A CD A GLU 43  ? A OE2 A GLU 43  ? A 112.09 123.30 -11.21 1.20 N 
6  1 OE1 A GLU 67  ? A CD A GLU 67  ? A OE2 A GLU 67  ? A 114.57 123.30 -8.73  1.20 N 
7  1 O   A ASP 79  ? ? C  A ASP 79  ? ? N   A GLN 80  ? ? 112.12 122.70 -10.58 1.60 Y 
8  1 NE  A ARG 94  ? ? CZ A ARG 94  ? ? NH1 A ARG 94  ? ? 123.61 120.30 3.31   0.50 N 
9  1 NE  A ARG 94  ? ? CZ A ARG 94  ? ? NH2 A ARG 94  ? ? 115.61 120.30 -4.69  0.50 N 
10 1 NE  A ARG 104 ? ? CZ A ARG 104 ? ? NH2 A ARG 104 ? ? 115.71 120.30 -4.59  0.50 N 
11 1 NE  A ARG 107 ? ? CZ A ARG 107 ? ? NH2 A ARG 107 ? ? 123.90 120.30 3.60   0.50 N 
12 1 CD  A ARG 139 ? B NE A ARG 139 ? B CZ  A ARG 139 ? B 134.85 123.60 11.25  1.40 N 
13 1 NE  A ARG 139 ? B CZ A ARG 139 ? B NH1 A ARG 139 ? B 116.80 120.30 -3.50  0.50 N 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MET 1   ? A MET 1   
2 1 Y 1 A SER 2   ? A SER 2   
3 1 Y 1 A LYS 141 ? A LYS 141 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SULFATE ION' SO4 
3 'CESIUM ION'  CS  
4 water         HOH 
#