data_1S3D
# 
_entry.id   1S3D 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.351 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1S3D         pdb_00001s3d 10.2210/pdb1s3d/pdb 
RCSB  RCSB021315   ?            ?                   
WWPDB D_1000021315 ?            ?                   
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1S3C 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1S3D 
_pdbx_database_status.recvd_initial_deposition_date   2004-01-13 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Demel, S.'     1 
'Edwards, B.F.' 2 
# 
_citation.id                        primary 
_citation.title                     
'Arginine 60 in the ArsC arsenate reductase of E. coli plasmid R773 determines the chemical nature of the bound As(III) product.' 
_citation.journal_abbrev            'Protein Sci.' 
_citation.journal_volume            13 
_citation.page_first                2330 
_citation.page_last                 2340 
_citation.year                      2004 
_citation.journal_id_ASTM           PRCIEI 
_citation.country                   US 
_citation.journal_id_ISSN           0961-8368 
_citation.journal_id_CSD            0795 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15295115 
_citation.pdbx_database_id_DOI      10.1110/ps.04787204 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'DeMel, S.'     1 ? 
primary 'Shi, J.'       2 ? 
primary 'Martin, P.'    3 ? 
primary 'Rosen, B.P.'   4 ? 
primary 'Edwards, B.F.' 5 ? 
# 
_cell.entry_id           1S3D 
_cell.length_a           86.600 
_cell.length_b           86.600 
_cell.length_c           115.650 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1S3D 
_symmetry.space_group_name_H-M             'P 61 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                178 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Arsenate reductase' 15415.670 1   1.20.4.1 R60A ? ? 
2 non-polymer syn 'SULFATE ION'        96.063    4   ?        ?    ? ? 
3 non-polymer syn 'CESIUM ION'         132.905   5   ?        ?    ? ? 
4 water       nat water                18.015    335 ?        ?    ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Arsenical pump modifier' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;NITIYHNPACGTSRNTLEMIRNSGTEPTIILYLENPPSRDELVKLIADMGISVRALLAKNVEPYEQLGLAEDKFTDDQLI
DFMLQHPILINRPIVVTPLGTRLCRPSEVVLDILQDAQKGAFTKEDGEKVVDEAGKRL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;NITIYHNPACGTSRNTLEMIRNSGTEPTIILYLENPPSRDELVKLIADMGISVRALLAKNVEPYEQLGLAEDKFTDDQLI
DFMLQHPILINRPIVVTPLGTRLCRPSEVVLDILQDAQKGAFTKEDGEKVVDEAGKRL
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASN n 
1 2   ILE n 
1 3   THR n 
1 4   ILE n 
1 5   TYR n 
1 6   HIS n 
1 7   ASN n 
1 8   PRO n 
1 9   ALA n 
1 10  CYS n 
1 11  GLY n 
1 12  THR n 
1 13  SER n 
1 14  ARG n 
1 15  ASN n 
1 16  THR n 
1 17  LEU n 
1 18  GLU n 
1 19  MET n 
1 20  ILE n 
1 21  ARG n 
1 22  ASN n 
1 23  SER n 
1 24  GLY n 
1 25  THR n 
1 26  GLU n 
1 27  PRO n 
1 28  THR n 
1 29  ILE n 
1 30  ILE n 
1 31  LEU n 
1 32  TYR n 
1 33  LEU n 
1 34  GLU n 
1 35  ASN n 
1 36  PRO n 
1 37  PRO n 
1 38  SER n 
1 39  ARG n 
1 40  ASP n 
1 41  GLU n 
1 42  LEU n 
1 43  VAL n 
1 44  LYS n 
1 45  LEU n 
1 46  ILE n 
1 47  ALA n 
1 48  ASP n 
1 49  MET n 
1 50  GLY n 
1 51  ILE n 
1 52  SER n 
1 53  VAL n 
1 54  ARG n 
1 55  ALA n 
1 56  LEU n 
1 57  LEU n 
1 58  ALA n 
1 59  LYS n 
1 60  ASN n 
1 61  VAL n 
1 62  GLU n 
1 63  PRO n 
1 64  TYR n 
1 65  GLU n 
1 66  GLN n 
1 67  LEU n 
1 68  GLY n 
1 69  LEU n 
1 70  ALA n 
1 71  GLU n 
1 72  ASP n 
1 73  LYS n 
1 74  PHE n 
1 75  THR n 
1 76  ASP n 
1 77  ASP n 
1 78  GLN n 
1 79  LEU n 
1 80  ILE n 
1 81  ASP n 
1 82  PHE n 
1 83  MET n 
1 84  LEU n 
1 85  GLN n 
1 86  HIS n 
1 87  PRO n 
1 88  ILE n 
1 89  LEU n 
1 90  ILE n 
1 91  ASN n 
1 92  ARG n 
1 93  PRO n 
1 94  ILE n 
1 95  VAL n 
1 96  VAL n 
1 97  THR n 
1 98  PRO n 
1 99  LEU n 
1 100 GLY n 
1 101 THR n 
1 102 ARG n 
1 103 LEU n 
1 104 CYS n 
1 105 ARG n 
1 106 PRO n 
1 107 SER n 
1 108 GLU n 
1 109 VAL n 
1 110 VAL n 
1 111 LEU n 
1 112 ASP n 
1 113 ILE n 
1 114 LEU n 
1 115 GLN n 
1 116 ASP n 
1 117 ALA n 
1 118 GLN n 
1 119 LYS n 
1 120 GLY n 
1 121 ALA n 
1 122 PHE n 
1 123 THR n 
1 124 LYS n 
1 125 GLU n 
1 126 ASP n 
1 127 GLY n 
1 128 GLU n 
1 129 LYS n 
1 130 VAL n 
1 131 VAL n 
1 132 ASP n 
1 133 GLU n 
1 134 ALA n 
1 135 GLY n 
1 136 LYS n 
1 137 ARG n 
1 138 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     562 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ARSC1_ECOLI 
_struct_ref.pdbx_db_accession          P08692 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSNITIYHNPACGTSRNTLEMIRNSGTEPTIILYLENPPSRDELVKLIADMGISVRALLRKNVEPYEQLGLAEDKFTDDQ
LIDFMLQHPILINRPIVVTPLGTRLCRPSEVVLDILQDAQKGAFTKEDGEKVVDEAGKRLK
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1S3D 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 138 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P08692 
_struct_ref_seq.db_align_beg                  3 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  140 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       3 
_struct_ref_seq.pdbx_auth_seq_align_end       140 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1S3D 
_struct_ref_seq_dif.mon_id                       ALA 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      58 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P08692 
_struct_ref_seq_dif.db_mon_id                    ARG 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          60 
_struct_ref_seq_dif.details                      'engineered mutation' 
_struct_ref_seq_dif.pdbx_auth_seq_num            60 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CS  non-polymer         . 'CESIUM ION'    ? 'Cs 1'           132.905 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1S3D 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   57.1 
_exptl_crystal.description           ? 
_exptl_crystal.density_Matthews      2.87 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.80 
_exptl_crystal_grow.pdbx_details    
'50% Saturated Cesium sulfate, 100 mM sodium acetate, 5 mM DTT, pH 4.80, VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           93.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2001-07-24 
_diffrn_detector.details                'OSMIC MIRRORS' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'OSMIC MIRRORS' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1S3D 
_reflns.observed_criterion_sigma_I   -3.00 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.000 
_reflns.d_resolution_high            1.5287 
_reflns.number_obs                   34567 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         92.6 
_reflns.pdbx_Rmerge_I_obs            0.093 
_reflns.pdbx_Rsym_value              0.093 
_reflns.pdbx_netI_over_sigmaI        25.10 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              16.38 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.5287 
_reflns_shell.d_res_low              1.5880 
_reflns_shell.percent_possible_all   56.6 
_reflns_shell.Rmerge_I_obs           0.2972 
_reflns_shell.pdbx_Rsym_value        0.2972 
_reflns_shell.meanI_over_sigI_obs    3.13 
_reflns_shell.pdbx_redundancy        3.92 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1S3D 
_refine.ls_number_reflns_obs                     34567 
_refine.ls_number_reflns_all                     34567 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            1.54 
_refine.ls_percent_reflns_obs                    89.2 
_refine.ls_R_factor_obs                          0.1466 
_refine.ls_R_factor_all                          0.1376 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       0.1985 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.2 
_refine.ls_number_reflns_R_free                  1806 
_refine.ls_number_parameters                     13495 
_refine.ls_number_restraints                     15505 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'MOEWS & KRETSINGER, J.MOL.BIOL.91(1973)201-228' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'NATIVE STRUCTURE' 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1S3D 
_refine_analyze.Luzzati_coordinate_error_obs    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      9 
_refine_analyze.occupancy_sum_hydrogen          1103.00 
_refine_analyze.occupancy_sum_non_hydrogen      1448.74 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1080 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         25 
_refine_hist.number_atoms_solvent             335 
_refine_hist.number_atoms_total               1440 
_refine_hist.d_res_high                       1.54 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
s_bond_d               0.011  ? ? ? 'X-RAY DIFFRACTION' ? 
s_angle_d              0.030  ? ? ? 'X-RAY DIFFRACTION' ? 
s_similar_dist         0.000  ? ? ? 'X-RAY DIFFRACTION' ? 
s_from_restr_planes    0.0300 ? ? ? 'X-RAY DIFFRACTION' ? 
s_zero_chiral_vol      0.056  ? ? ? 'X-RAY DIFFRACTION' ? 
s_non_zero_chiral_vol  0.076  ? ? ? 'X-RAY DIFFRACTION' ? 
s_anti_bump_dis_restr  0.054  ? ? ? 'X-RAY DIFFRACTION' ? 
s_rigid_bond_adp_cmpnt 0.004  ? ? ? 'X-RAY DIFFRACTION' ? 
s_similar_adp_cmpnt    0.045  ? ? ? 'X-RAY DIFFRACTION' ? 
s_approx_iso_adps      0.073  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_pdbx_refine.entry_id                                    1S3D 
_pdbx_refine.R_factor_all_no_cutoff                      0.1376 
_pdbx_refine.R_factor_obs_no_cutoff                      0.1466 
_pdbx_refine.free_R_factor_no_cutoff                     0.1985 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     5.2 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            1806 
_pdbx_refine.R_factor_all_4sig_cutoff                    0.1352 
_pdbx_refine.R_factor_obs_4sig_cutoff                    0.1442 
_pdbx_refine.free_R_factor_4sig_cutoff                   0.1946 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   5.2 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          1745 
_pdbx_refine.number_reflns_obs_4sig_cutoff               33399 
_pdbx_refine.number_reflns_obs_no_cutoff                 34567 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.free_R_error_no_cutoff                      ? 
# 
_struct.entry_id                  1S3D 
_struct.title                     'ARSENATE REDUCTASE R60A MUTANT FROM E. COLI' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1S3D 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            'ARSC, REDUCTASE, ARSENITE, ARSENATE, OXIDOREDUCTASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
I N N 3 ? 
J N N 3 ? 
K N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 CYS A 10  ? SER A 23  ? CYS A 12  SER A 25  1 ? 14 
HELX_P HELX_P2 2 SER A 38  ? GLY A 50  ? SER A 40  GLY A 52  1 ? 13 
HELX_P HELX_P3 3 VAL A 53  ? LEU A 57  ? VAL A 55  LEU A 59  5 ? 5  
HELX_P HELX_P4 4 VAL A 61  ? LEU A 67  ? VAL A 63  LEU A 69  1 ? 7  
HELX_P HELX_P5 5 THR A 75  ? HIS A 86  ? THR A 77  HIS A 88  1 ? 12 
HELX_P HELX_P6 6 PRO A 87  ? ILE A 90  ? PRO A 89  ILE A 92  5 ? 4  
HELX_P HELX_P7 7 PRO A 106 ? ILE A 113 ? PRO A 108 ILE A 115 5 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1  metalc ? ? A PRO 36  O   ? ? ? 1_555  G CS  . CS ? ? A PRO 38  A CS  402  1_555  ? ? ? ? ? ? ? 3.147 ? ? 
metalc2  metalc ? ? A SER 38  N   ? ? ? 1_555  G CS  . CS ? ? A SER 40  A CS  402  1_555  ? ? ? ? ? ? ? 3.747 ? ? 
metalc3  metalc ? ? A GLU 62  OE2 ? ? ? 1_555  H CS  . CS ? ? A GLU 64  A CS  403  1_555  ? ? ? ? ? ? ? 3.184 ? ? 
metalc4  metalc ? ? A GLN 85  NE2 ? ? ? 8_676  H CS  . CS ? ? A GLN 87  A CS  403  1_555  ? ? ? ? ? ? ? 3.712 ? ? 
metalc5  metalc ? ? A LEU 111 O   ? ? ? 1_555  F CS  . CS ? ? A LEU 113 A CS  401  1_555  ? ? ? ? ? ? ? 3.225 ? ? 
metalc6  metalc ? ? A LEU 111 O   ? ? ? 10_665 F CS  . CS ? ? A LEU 113 A CS  401  1_555  ? ? ? ? ? ? ? 3.157 ? ? 
metalc7  metalc ? ? A ASP 112 O   ? ? ? 1_555  F CS  . CS ? ? A ASP 114 A CS  401  1_555  ? ? ? ? ? ? ? 3.254 ? ? 
metalc8  metalc ? ? A ASP 112 O   ? ? ? 10_665 F CS  . CS ? ? A ASP 114 A CS  401  1_555  ? ? ? ? ? ? ? 3.487 ? ? 
metalc9  metalc ? ? A LEU 114 O   ? ? ? 1_555  F CS  . CS ? ? A LEU 116 A CS  401  1_555  ? ? ? ? ? ? ? 2.994 ? ? 
metalc10 metalc ? ? A LEU 114 O   ? ? ? 10_665 F CS  . CS ? ? A LEU 116 A CS  401  1_555  ? ? ? ? ? ? ? 3.246 ? ? 
metalc11 metalc ? ? A GLN 118 O   ? ? ? 1_555  I CS  . CS ? ? A GLN 120 A CS  404  1_555  ? ? ? ? ? ? ? 3.424 ? ? 
metalc12 metalc ? ? A ASP 126 OD2 ? ? ? 1_555  J CS  . CS ? ? A ASP 128 A CS  405  1_555  ? ? ? ? ? ? ? 3.484 ? ? 
metalc13 metalc ? ? A GLU 133 O   ? ? ? 1_555  I CS  . CS ? ? A GLU 135 A CS  404  1_555  ? ? ? ? ? ? ? 3.102 ? ? 
metalc14 metalc ? ? F CS  .   CS  ? ? ? 1_555  K HOH . O  ? ? A CS  401 A HOH 1039 1_555  ? ? ? ? ? ? ? 3.316 ? ? 
metalc15 metalc ? ? F CS  .   CS  ? ? ? 1_555  K HOH . O  ? ? A CS  401 A HOH 1039 10_665 ? ? ? ? ? ? ? 3.214 ? ? 
metalc16 metalc ? ? G CS  .   CS  ? ? ? 1_555  K HOH . O  ? ? A CS  402 A HOH 1020 1_555  ? ? ? ? ? ? ? 3.136 ? ? 
metalc17 metalc ? ? G CS  .   CS  ? ? ? 1_555  K HOH . O  ? ? A CS  402 A HOH 1127 1_555  ? ? ? ? ? ? ? 3.344 ? ? 
metalc18 metalc ? ? H CS  .   CS  ? ? ? 1_555  K HOH . O  ? ? A CS  403 A HOH 1071 1_555  ? ? ? ? ? ? ? 3.533 ? ? 
metalc19 metalc ? ? H CS  .   CS  ? ? ? 1_555  K HOH . O  ? ? A CS  403 A HOH 1135 1_555  ? ? ? ? ? ? ? 3.175 ? ? 
metalc20 metalc ? ? H CS  .   CS  ? ? ? 1_555  K HOH . O  ? ? A CS  403 A HOH 1277 1_555  ? ? ? ? ? ? ? 3.860 ? ? 
metalc21 metalc ? ? I CS  .   CS  ? ? ? 1_555  K HOH . O  ? ? A CS  404 A HOH 1093 1_555  ? ? ? ? ? ? ? 3.163 ? ? 
metalc22 metalc ? ? I CS  .   CS  ? ? ? 1_555  K HOH . O  ? ? A CS  404 A HOH 1119 1_555  ? ? ? ? ? ? ? 2.661 ? ? 
metalc23 metalc ? ? I CS  .   CS  ? ? ? 1_555  K HOH . O  ? ? A CS  404 A HOH 1151 1_555  ? ? ? ? ? ? ? 3.420 ? ? 
metalc24 metalc ? ? I CS  .   CS  ? ? ? 1_555  K HOH . O  ? ? A CS  404 A HOH 1183 1_555  ? ? ? ? ? ? ? 2.977 ? ? 
metalc25 metalc ? ? I CS  .   CS  ? ? ? 1_555  K HOH . O  ? ? A CS  404 A HOH 1301 1_555  ? ? ? ? ? ? ? 2.687 ? ? 
metalc26 metalc ? ? J CS  .   CS  ? ? ? 1_555  K HOH . O  ? ? A CS  405 A HOH 1033 1_555  ? ? ? ? ? ? ? 3.435 ? ? 
metalc27 metalc ? ? J CS  .   CS  ? ? ? 1_555  K HOH . O  ? ? A CS  405 A HOH 1065 12_566 ? ? ? ? ? ? ? 3.852 ? ? 
metalc28 metalc ? ? J CS  .   CS  ? ? ? 1_555  K HOH . O  ? ? A CS  405 A HOH 1077 1_555  ? ? ? ? ? ? ? 2.874 ? ? 
metalc29 metalc ? ? J CS  .   CS  ? ? ? 1_555  K HOH . O  ? ? A CS  405 A HOH 1195 1_555  ? ? ? ? ? ? ? 3.423 ? ? 
metalc30 metalc ? ? J CS  .   CS  ? ? ? 1_555  K HOH . O  ? ? A CS  405 A HOH 1209 1_555  ? ? ? ? ? ? ? 3.058 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ARG 92  A . ? ARG 94  A PRO 93  A ? PRO 95  A 1 -12.95 
2 ARG 105 A . ? ARG 107 A PRO 106 A ? PRO 108 A 1 0.98   
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 28  ? LEU A 31  ? THR A 30  LEU A 33  
A 2 THR A 3   ? HIS A 6   ? THR A 5   HIS A 8   
A 3 ILE A 94  ? THR A 97  ? ILE A 96  THR A 99  
A 4 GLY A 100 ? LEU A 103 ? GLY A 102 LEU A 105 
B 1 PHE A 122 ? THR A 123 ? PHE A 124 THR A 125 
B 2 LYS A 129 ? VAL A 131 ? LYS A 131 VAL A 133 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ILE A 30  ? O ILE A 32  N ILE A 4   ? N ILE A 6   
A 2 3 N TYR A 5   ? N TYR A 7   O ILE A 94  ? O ILE A 96  
A 3 4 N THR A 97  ? N THR A 99  O GLY A 100 ? O GLY A 102 
B 1 2 N PHE A 122 ? N PHE A 124 O VAL A 130 ? O VAL A 132 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A SO4 201 ? 10 'BINDING SITE FOR RESIDUE SO4 A 201' 
AC2 Software A SO4 202 ? 6  'BINDING SITE FOR RESIDUE SO4 A 202' 
AC3 Software A SO4 203 ? 9  'BINDING SITE FOR RESIDUE SO4 A 203' 
AC4 Software A SO4 204 ? 7  'BINDING SITE FOR RESIDUE SO4 A 204' 
AC5 Software A CS  401 ? 6  'BINDING SITE FOR RESIDUE CS A 401'  
AC6 Software A CS  402 ? 2  'BINDING SITE FOR RESIDUE CS A 402'  
AC7 Software A CS  403 ? 1  'BINDING SITE FOR RESIDUE CS A 403'  
AC8 Software A CS  404 ? 5  'BINDING SITE FOR RESIDUE CS A 404'  
AC9 Software A CS  405 ? 4  'BINDING SITE FOR RESIDUE CS A 405'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 10 CYS A 10  ? CYS A 12   . ? 1_555  ? 
2  AC1 10 GLY A 11  ? GLY A 13   . ? 1_555  ? 
3  AC1 10 THR A 12  ? THR A 14   . ? 1_555  ? 
4  AC1 10 ASN A 60  ? ASN A 62   . ? 12_566 ? 
5  AC1 10 ARG A 92  ? ARG A 94   . ? 1_555  ? 
6  AC1 10 ARG A 105 ? ARG A 107  . ? 1_555  ? 
7  AC1 10 HOH K .   ? HOH A 1064 . ? 1_555  ? 
8  AC1 10 HOH K .   ? HOH A 1088 . ? 1_555  ? 
9  AC1 10 HOH K .   ? HOH A 1100 . ? 1_555  ? 
10 AC1 10 HOH K .   ? HOH A 1188 . ? 1_555  ? 
11 AC2 6  ASN A 91  ? ASN A 93   . ? 1_555  ? 
12 AC2 6  ARG A 105 ? ARG A 107  . ? 1_555  ? 
13 AC2 6  HOH K .   ? HOH A 1125 . ? 1_555  ? 
14 AC2 6  HOH K .   ? HOH A 1234 . ? 1_555  ? 
15 AC2 6  HOH K .   ? HOH A 1235 . ? 1_555  ? 
16 AC2 6  HOH K .   ? HOH A 1240 . ? 1_555  ? 
17 AC3 9  THR A 12  ? THR A 14   . ? 1_555  ? 
18 AC3 9  ASN A 15  ? ASN A 17   . ? 1_555  ? 
19 AC3 9  PRO A 106 ? PRO A 108  . ? 1_555  ? 
20 AC3 9  SER A 107 ? SER A 109  . ? 1_555  ? 
21 AC3 9  LYS A 124 ? LYS A 126  . ? 1_555  ? 
22 AC3 9  HOH K .   ? HOH A 1033 . ? 1_555  ? 
23 AC3 9  HOH K .   ? HOH A 1077 . ? 1_555  ? 
24 AC3 9  HOH K .   ? HOH A 1195 . ? 1_555  ? 
25 AC3 9  HOH K .   ? HOH A 1229 . ? 1_555  ? 
26 AC4 7  HIS A 86  ? HIS A 88   . ? 1_555  ? 
27 AC4 7  HOH K .   ? HOH A 1087 . ? 1_555  ? 
28 AC4 7  HOH K .   ? HOH A 1165 . ? 1_555  ? 
29 AC4 7  HOH K .   ? HOH A 1171 . ? 1_555  ? 
30 AC4 7  HOH K .   ? HOH A 1173 . ? 1_555  ? 
31 AC4 7  HOH K .   ? HOH A 1194 . ? 1_555  ? 
32 AC4 7  HOH K .   ? HOH A 1273 . ? 1_555  ? 
33 AC5 6  LEU A 111 ? LEU A 113  . ? 10_665 ? 
34 AC5 6  LEU A 111 ? LEU A 113  . ? 1_555  ? 
35 AC5 6  ASP A 112 ? ASP A 114  . ? 10_665 ? 
36 AC5 6  ASP A 112 ? ASP A 114  . ? 1_555  ? 
37 AC5 6  LEU A 114 ? LEU A 116  . ? 1_555  ? 
38 AC5 6  LEU A 114 ? LEU A 116  . ? 10_665 ? 
39 AC6 2  PRO A 36  ? PRO A 38   . ? 1_555  ? 
40 AC6 2  GLU A 41  ? GLU A 43   . ? 1_555  ? 
41 AC7 1  GLU A 62  ? GLU A 64   . ? 1_555  ? 
42 AC8 5  GLN A 118 ? GLN A 120  . ? 1_555  ? 
43 AC8 5  GLU A 133 ? GLU A 135  . ? 1_555  ? 
44 AC8 5  HOH K .   ? HOH A 1119 . ? 1_555  ? 
45 AC8 5  HOH K .   ? HOH A 1183 . ? 1_555  ? 
46 AC8 5  HOH K .   ? HOH A 1301 . ? 1_555  ? 
47 AC9 4  GLU A 65  ? GLU A 67   . ? 12_566 ? 
48 AC9 4  ASP A 126 ? ASP A 128  . ? 1_555  ? 
49 AC9 4  HOH K .   ? HOH A 1077 . ? 1_555  ? 
50 AC9 4  HOH K .   ? HOH A 1209 . ? 1_555  ? 
# 
_database_PDB_matrix.entry_id          1S3D 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.000000 
_database_PDB_matrix.origx_vector[2]   0.000000 
_database_PDB_matrix.origx_vector[3]   0.000000 
# 
_atom_sites.entry_id                    1S3D 
_atom_sites.fract_transf_matrix[1][1]   0.011547 
_atom_sites.fract_transf_matrix[1][2]   0.006667 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013334 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008647 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
CS 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ASN A 1 1   ? 31.828 45.674 45.193 1.00 32.75  ? 3    ASN A N   1 
ATOM   2    C  CA  . ASN A 1 1   ? 31.851 47.133 45.378 1.00 29.52  ? 3    ASN A CA  1 
ATOM   3    C  C   . ASN A 1 1   ? 30.535 47.600 46.010 1.00 21.49  ? 3    ASN A C   1 
ATOM   4    O  O   . ASN A 1 1   ? 29.437 47.625 45.419 1.00 22.90  ? 3    ASN A O   1 
ATOM   5    C  CB  . ASN A 1 1   ? 32.024 47.908 44.102 1.00 45.29  ? 3    ASN A CB  1 
ATOM   6    C  CG  . ASN A 1 1   ? 32.509 49.335 44.186 1.00 60.41  ? 3    ASN A CG  1 
ATOM   7    O  OD1 . ASN A 1 1   ? 32.727 49.977 43.131 1.00 85.28  ? 3    ASN A OD1 1 
ATOM   8    N  ND2 . ASN A 1 1   ? 32.693 49.882 45.382 1.00 69.08  ? 3    ASN A ND2 1 
ATOM   9    N  N   . ILE A 1 2   ? 30.663 47.956 47.280 1.00 17.46  ? 4    ILE A N   1 
ATOM   10   C  CA  . ILE A 1 2   ? 29.522 48.241 48.118 1.00 15.94  ? 4    ILE A CA  1 
ATOM   11   C  C   . ILE A 1 2   ? 29.674 49.649 48.731 1.00 14.82  ? 4    ILE A C   1 
ATOM   12   O  O   . ILE A 1 2   ? 30.781 49.972 49.191 1.00 17.01  ? 4    ILE A O   1 
ATOM   13   C  CB  . ILE A 1 2   ? 29.341 47.209 49.247 1.00 17.22  ? 4    ILE A CB  1 
ATOM   14   C  CG1 . ILE A 1 2   ? 29.215 45.758 48.762 1.00 17.02  ? 4    ILE A CG1 1 
ATOM   15   C  CG2 . ILE A 1 2   ? 28.159 47.550 50.141 1.00 16.94  ? 4    ILE A CG2 1 
ATOM   16   C  CD1 . ILE A 1 2   ? 29.067 44.703 49.820 1.00 22.19  ? 4    ILE A CD1 1 
ATOM   17   N  N   . THR A 1 3   ? 28.566 50.368 48.733 1.00 15.25  ? 5    THR A N   1 
ATOM   18   C  CA  . THR A 1 3   ? 28.529 51.687 49.377 1.00 14.73  ? 5    THR A CA  1 
ATOM   19   C  C   . THR A 1 3   ? 27.432 51.711 50.420 1.00 13.75  ? 5    THR A C   1 
ATOM   20   O  O   . THR A 1 3   ? 26.323 51.253 50.118 1.00 16.42  ? 5    THR A O   1 
ATOM   21   C  CB  . THR A 1 3   ? 28.313 52.787 48.337 1.00 17.86  ? 5    THR A CB  1 
ATOM   22   O  OG1 . THR A 1 3   ? 29.439 52.771 47.452 1.00 21.73  ? 5    THR A OG1 1 
ATOM   23   C  CG2 . THR A 1 3   ? 28.238 54.156 48.995 1.00 18.76  ? 5    THR A CG2 1 
ATOM   24   N  N   . ILE A 1 4   ? 27.749 52.220 51.619 1.00 14.59  ? 6    ILE A N   1 
ATOM   25   C  CA  . ILE A 1 4   ? 26.694 52.464 52.622 1.00 14.71  ? 6    ILE A CA  1 
ATOM   26   C  C   . ILE A 1 4   ? 26.646 53.943 52.955 1.00 13.83  ? 6    ILE A C   1 
ATOM   27   O  O   . ILE A 1 4   ? 27.680 54.533 53.253 1.00 14.60  ? 6    ILE A O   1 
ATOM   28   C  CB  . ILE A 1 4   ? 26.867 51.580 53.868 1.00 15.11  ? 6    ILE A CB  1 
ATOM   29   C  CG1 . ILE A 1 4   ? 25.779 51.850 54.924 1.00 14.35  ? 6    ILE A CG1 1 
ATOM   30   C  CG2 . ILE A 1 4   ? 28.217 51.686 54.550 1.00 17.55  ? 6    ILE A CG2 1 
ATOM   31   C  CD1 . ILE A 1 4   ? 25.667 50.881 56.051 1.00 14.92  ? 6    ILE A CD1 1 
ATOM   32   N  N   . TYR A 1 5   ? 25.491 54.546 52.943 1.00 14.14  ? 7    TYR A N   1 
ATOM   33   C  CA  . TYR A 1 5   ? 25.203 55.880 53.464 1.00 14.06  ? 7    TYR A CA  1 
ATOM   34   C  C   . TYR A 1 5   ? 24.848 55.680 54.944 1.00 14.22  ? 7    TYR A C   1 
ATOM   35   O  O   . TYR A 1 5   ? 23.717 55.228 55.241 1.00 14.46  ? 7    TYR A O   1 
ATOM   36   C  CB  . TYR A 1 5   ? 24.144 56.597 52.668 1.00 14.59  ? 7    TYR A CB  1 
ATOM   37   C  CG  . TYR A 1 5   ? 24.551 56.925 51.261 1.00 15.29  ? 7    TYR A CG  1 
ATOM   38   C  CD1 . TYR A 1 5   ? 24.435 55.957 50.258 1.00 14.16  ? 7    TYR A CD1 1 
ATOM   39   C  CD2 . TYR A 1 5   ? 25.054 58.159 50.883 1.00 17.02  ? 7    TYR A CD2 1 
ATOM   40   C  CE1 . TYR A 1 5   ? 24.819 56.275 48.965 1.00 17.74  ? 7    TYR A CE1 1 
ATOM   41   C  CE2 . TYR A 1 5   ? 25.428 58.486 49.576 1.00 18.26  ? 7    TYR A CE2 1 
ATOM   42   C  CZ  . TYR A 1 5   ? 25.307 57.505 48.611 1.00 15.30  ? 7    TYR A CZ  1 
ATOM   43   O  OH  . TYR A 1 5   ? 25.651 57.736 47.288 1.00 18.79  ? 7    TYR A OH  1 
ATOM   44   N  N   . HIS A 1 6   ? 25.882 55.973 55.751 1.00 14.54  ? 8    HIS A N   1 
ATOM   45   C  CA  . HIS A 1 6   ? 25.881 55.535 57.141 1.00 14.52  ? 8    HIS A CA  1 
ATOM   46   C  C   . HIS A 1 6   ? 25.730 56.677 58.112 1.00 14.31  ? 8    HIS A C   1 
ATOM   47   O  O   . HIS A 1 6   ? 26.319 57.724 57.894 1.00 15.66  ? 8    HIS A O   1 
ATOM   48   C  CB  . HIS A 1 6   ? 27.170 54.787 57.406 1.00 14.59  ? 8    HIS A CB  1 
ATOM   49   C  CG  . HIS A 1 6   ? 27.431 54.249 58.770 1.00 14.39  ? 8    HIS A CG  1 
ATOM   50   N  ND1 . HIS A 1 6   ? 26.560 53.448 59.437 1.00 15.24  ? 8    HIS A ND1 1 
ATOM   51   C  CD2 . HIS A 1 6   ? 28.526 54.343 59.587 1.00 15.18  ? 8    HIS A CD2 1 
ATOM   52   C  CE1 . HIS A 1 6   ? 27.068 53.105 60.615 1.00 17.56  ? 8    HIS A CE1 1 
ATOM   53   N  NE2 . HIS A 1 6   ? 28.263 53.643 60.728 1.00 15.66  ? 8    HIS A NE2 1 
ATOM   54   N  N   . ASN A 1 7   ? 25.030 56.645 59.221 1.00 16.36  ? 9    ASN A N   1 
ATOM   55   C  CA  . ASN A 1 7   ? 24.907 57.363 60.429 1.00 13.19  ? 9    ASN A CA  1 
ATOM   56   C  C   . ASN A 1 7   ? 25.304 56.475 61.611 1.00 14.76  ? 9    ASN A C   1 
ATOM   57   O  O   . ASN A 1 7   ? 24.572 55.600 62.079 1.00 14.71  ? 9    ASN A O   1 
ATOM   58   C  CB  . ASN A 1 7   ? 23.475 57.832 60.560 1.00 15.03  ? 9    ASN A CB  1 
ATOM   59   C  CG  . ASN A 1 7   ? 23.360 58.884 61.645 1.00 15.36  ? 9    ASN A CG  1 
ATOM   60   O  OD1 . ASN A 1 7   ? 24.206 58.890 62.564 1.00 16.45  ? 9    ASN A OD1 1 
ATOM   61   N  ND2 . ASN A 1 7   ? 22.341 59.707 61.471 1.00 16.34  ? 9    ASN A ND2 1 
ATOM   62   N  N   . PRO A 1 8   ? 26.530 56.717 62.089 1.00 15.14  ? 10   PRO A N   1 
ATOM   63   C  CA  . PRO A 1 8   ? 27.027 55.961 63.228 1.00 14.58  ? 10   PRO A CA  1 
ATOM   64   C  C   . PRO A 1 8   ? 26.218 56.087 64.514 1.00 14.84  ? 10   PRO A C   1 
ATOM   65   O  O   . PRO A 1 8   ? 26.413 55.220 65.406 1.00 15.81  ? 10   PRO A O   1 
ATOM   66   C  CB  . PRO A 1 8   ? 28.412 56.567 63.503 1.00 18.33  ? 10   PRO A CB  1 
ATOM   67   C  CG  . PRO A 1 8   ? 28.791 57.243 62.238 1.00 23.43  ? 10   PRO A CG  1 
ATOM   68   C  CD  . PRO A 1 8   ? 27.503 57.689 61.567 1.00 17.40  ? 10   PRO A CD  1 
ATOM   69   N  N   . ALA A 1 9   ? 25.358 57.096 64.569 1.00 14.13  ? 11   ALA A N   1 
ATOM   70   C  CA  . ALA A 1 9   ? 24.549 57.283 65.777 1.00 17.08  ? 11   ALA A CA  1 
ATOM   71   C  C   . ALA A 1 9   ? 23.169 56.615 65.647 1.00 16.79  ? 11   ALA A C   1 
ATOM   72   O  O   . ALA A 1 9   ? 22.250 56.973 66.392 1.00 19.96  ? 11   ALA A O   1 
ATOM   73   C  CB  . ALA A 1 9   ? 24.432 58.756 66.086 1.00 17.24  ? 11   ALA A CB  1 
ATOM   74   N  N   . CYS A 1 10  ? 23.024 55.656 64.712 1.00 15.85  ? 12   CYS A N   1 
ATOM   75   C  CA  . CYS A 1 10  ? 21.766 54.975 64.452 1.00 13.53  ? 12   CYS A CA  1 
ATOM   76   C  C   . CYS A 1 10  ? 21.967 53.481 64.499 1.00 14.99  ? 12   CYS A C   1 
ATOM   77   O  O   . CYS A 1 10  ? 22.764 52.969 63.721 1.00 13.29  ? 12   CYS A O   1 
ATOM   78   C  CB  A CYS A 1 10  ? 21.274 55.488 63.093 0.37 15.24  ? 12   CYS A CB  1 
ATOM   79   C  CB  B CYS A 1 10  ? 21.219 55.385 63.068 0.63 15.66  ? 12   CYS A CB  1 
ATOM   80   S  SG  A CYS A 1 10  ? 20.285 54.309 62.176 0.37 31.64  ? 12   CYS A SG  1 
ATOM   81   S  SG  B CYS A 1 10  ? 20.917 57.172 63.106 0.63 15.27  ? 12   CYS A SG  1 
ATOM   82   N  N   . GLY A 1 11  ? 21.322 52.756 65.396 1.00 15.12  ? 13   GLY A N   1 
ATOM   83   C  CA  . GLY A 1 11  ? 21.486 51.312 65.532 1.00 14.28  ? 13   GLY A CA  1 
ATOM   84   C  C   . GLY A 1 11  ? 21.189 50.564 64.262 1.00 14.70  ? 13   GLY A C   1 
ATOM   85   O  O   . GLY A 1 11  ? 21.882 49.611 63.917 1.00 15.11  ? 13   GLY A O   1 
ATOM   86   N  N   . THR A 1 12  ? 20.138 50.964 63.522 1.00 12.79  ? 14   THR A N   1 
ATOM   87   C  CA  . THR A 1 12  ? 19.833 50.256 62.268 1.00 13.67  ? 14   THR A CA  1 
ATOM   88   C  C   . THR A 1 12  ? 20.999 50.367 61.318 1.00 12.45  ? 14   THR A C   1 
ATOM   89   O  O   . THR A 1 12  ? 21.330 49.394 60.606 1.00 12.84  ? 14   THR A O   1 
ATOM   90   C  CB  . THR A 1 12  ? 18.543 50.854 61.654 1.00 15.70  ? 14   THR A CB  1 
ATOM   91   O  OG1 . THR A 1 12  ? 17.494 50.795 62.620 1.00 16.71  ? 14   THR A OG1 1 
ATOM   92   C  CG2 . THR A 1 12  ? 18.115 50.111 60.408 1.00 15.60  ? 14   THR A CG2 1 
ATOM   93   N  N   . SER A 1 13  ? 21.640 51.526 61.242 1.00 13.59  ? 15   SER A N   1 
ATOM   94   C  CA  . SER A 1 13  ? 22.788 51.721 60.372 1.00 13.55  ? 15   SER A CA  1 
ATOM   95   C  C   . SER A 1 13  ? 23.981 50.910 60.842 1.00 13.06  ? 15   SER A C   1 
ATOM   96   O  O   . SER A 1 13  ? 24.657 50.281 60.021 1.00 14.76  ? 15   SER A O   1 
ATOM   97   C  CB  . SER A 1 13  ? 23.117 53.205 60.318 1.00 13.91  ? 15   SER A CB  1 
ATOM   98   O  OG  . SER A 1 13  ? 23.818 53.405 59.108 1.00 14.64  ? 15   SER A OG  1 
ATOM   99   N  N   . ARG A 1 14  ? 24.240 50.891 62.153 1.00 13.57  ? 16   ARG A N   1 
ATOM   100  C  CA  . ARG A 1 14  ? 25.321 50.054 62.684 1.00 13.17  ? 16   ARG A CA  1 
ATOM   101  C  C   . ARG A 1 14  ? 25.089 48.577 62.409 1.00 12.23  ? 16   ARG A C   1 
ATOM   102  O  O   . ARG A 1 14  ? 26.016 47.903 61.966 1.00 13.33  ? 16   ARG A O   1 
ATOM   103  C  CB  . ARG A 1 14  ? 25.506 50.300 64.188 1.00 11.71  ? 16   ARG A CB  1 
ATOM   104  C  CG  . ARG A 1 14  ? 26.054 51.687 64.498 1.00 13.51  ? 16   ARG A CG  1 
ATOM   105  C  CD  . ARG A 1 14  ? 26.470 51.823 65.954 1.00 14.89  ? 16   ARG A CD  1 
ATOM   106  N  NE  . ARG A 1 14  ? 25.360 51.514 66.868 1.00 14.58  ? 16   ARG A NE  1 
ATOM   107  C  CZ  . ARG A 1 14  ? 24.452 52.361 67.312 1.00 14.93  ? 16   ARG A CZ  1 
ATOM   108  N  NH1 . ARG A 1 14  ? 24.480 53.635 66.994 1.00 13.91  ? 16   ARG A NH1 1 
ATOM   109  N  NH2 . ARG A 1 14  ? 23.506 51.932 68.107 1.00 14.07  ? 16   ARG A NH2 1 
ATOM   110  N  N   . ASN A 1 15  ? 23.869 48.087 62.644 1.00 13.68  ? 17   ASN A N   1 
ATOM   111  C  CA  . ASN A 1 15  ? 23.615 46.680 62.374 1.00 13.67  ? 17   ASN A CA  1 
ATOM   112  C  C   . ASN A 1 15  ? 23.854 46.350 60.892 1.00 12.43  ? 17   ASN A C   1 
ATOM   113  O  O   . ASN A 1 15  ? 24.430 45.307 60.553 1.00 13.30  ? 17   ASN A O   1 
ATOM   114  C  CB  . ASN A 1 15  ? 22.214 46.242 62.797 1.00 15.68  ? 17   ASN A CB  1 
ATOM   115  C  CG  . ASN A 1 15  ? 22.068 46.067 64.292 1.00 13.49  ? 17   ASN A CG  1 
ATOM   116  O  OD1 . ASN A 1 15  ? 22.945 45.570 65.001 1.00 13.78  ? 17   ASN A OD1 1 
ATOM   117  N  ND2 . ASN A 1 15  ? 20.880 46.436 64.770 1.00 15.48  ? 17   ASN A ND2 1 
ATOM   118  N  N   . THR A 1 16  ? 23.398 47.259 60.021 1.00 12.10  ? 18   THR A N   1 
ATOM   119  C  CA  . THR A 1 16  ? 23.527 47.017 58.582 1.00 13.16  ? 18   THR A CA  1 
ATOM   120  C  C   . THR A 1 16  ? 24.999 46.933 58.179 1.00 13.20  ? 18   THR A C   1 
ATOM   121  O  O   . THR A 1 16  ? 25.407 46.046 57.437 1.00 14.28  ? 18   THR A O   1 
ATOM   122  C  CB  . THR A 1 16  ? 22.859 48.129 57.758 1.00 13.55  ? 18   THR A CB  1 
ATOM   123  O  OG1 . THR A 1 16  ? 21.436 48.154 58.029 1.00 14.76  ? 18   THR A OG1 1 
ATOM   124  C  CG2 . THR A 1 16  ? 23.000 47.848 56.292 1.00 14.29  ? 18   THR A CG2 1 
ATOM   125  N  N   . LEU A 1 17  ? 25.763 47.905 58.680 1.00 13.63  ? 19   LEU A N   1 
ATOM   126  C  CA  . LEU A 1 17  ? 27.185 47.935 58.370 1.00 14.22  ? 19   LEU A CA  1 
ATOM   127  C  C   . LEU A 1 17  ? 27.860 46.662 58.822 1.00 13.23  ? 19   LEU A C   1 
ATOM   128  O  O   . LEU A 1 17  ? 28.681 46.075 58.088 1.00 14.44  ? 19   LEU A O   1 
ATOM   129  C  CB  . LEU A 1 17  ? 27.842 49.162 59.005 1.00 12.50  ? 19   LEU A CB  1 
ATOM   130  C  CG  . LEU A 1 17  ? 29.357 49.321 58.936 1.00 12.87  ? 19   LEU A CG  1 
ATOM   131  C  CD1 . LEU A 1 17  ? 29.847 49.209 57.488 1.00 13.96  ? 19   LEU A CD1 1 
ATOM   132  C  CD2 . LEU A 1 17  ? 29.763 50.635 59.556 1.00 13.51  ? 19   LEU A CD2 1 
ATOM   133  N  N   . GLU A 1 18  ? 27.601 46.212 60.047 1.00 13.64  ? 20   GLU A N   1 
ATOM   134  C  CA  . GLU A 1 18  ? 28.207 44.952 60.457 1.00 13.19  ? 20   GLU A CA  1 
ATOM   135  C  C   . GLU A 1 18  ? 27.727 43.751 59.658 1.00 13.19  ? 20   GLU A C   1 
ATOM   136  O  O   . GLU A 1 18  ? 28.480 42.794 59.435 1.00 14.33  ? 20   GLU A O   1 
ATOM   137  C  CB  . GLU A 1 18  ? 27.987 44.709 61.972 1.00 14.07  ? 20   GLU A CB  1 
ATOM   138  C  CG  . GLU A 1 18  ? 28.517 45.831 62.843 1.00 14.53  ? 20   GLU A CG  1 
ATOM   139  C  CD  . GLU A 1 18  ? 29.981 46.130 62.879 1.00 15.56  ? 20   GLU A CD  1 
ATOM   140  O  OE1 . GLU A 1 18  ? 30.668 46.091 61.839 1.00 17.38  ? 20   GLU A OE1 1 
ATOM   141  O  OE2 . GLU A 1 18  ? 30.543 46.493 63.958 1.00 14.91  ? 20   GLU A OE2 1 
ATOM   142  N  N   . MET A 1 19  ? 26.470 43.743 59.207 1.00 13.51  ? 21   MET A N   1 
ATOM   143  C  CA  . MET A 1 19  ? 26.061 42.631 58.335 1.00 14.12  ? 21   MET A CA  1 
ATOM   144  C  C   . MET A 1 19  ? 26.811 42.688 57.007 1.00 14.28  ? 21   MET A C   1 
ATOM   145  O  O   . MET A 1 19  ? 27.187 41.625 56.455 1.00 14.66  ? 21   MET A O   1 
ATOM   146  C  CB  . MET A 1 19  ? 24.554 42.605 58.076 1.00 16.05  ? 21   MET A CB  1 
ATOM   147  C  CG  . MET A 1 19  ? 23.804 41.695 58.994 1.00 16.73  ? 21   MET A CG  1 
ATOM   148  S  SD  . MET A 1 19  ? 22.007 41.631 58.823 1.00 18.68  ? 21   MET A SD  1 
ATOM   149  C  CE  . MET A 1 19  ? 21.586 43.213 59.545 1.00 19.74  ? 21   MET A CE  1 
ATOM   150  N  N   . ILE A 1 20  ? 27.021 43.867 56.452 1.00 14.82  ? 22   ILE A N   1 
ATOM   151  C  CA  . ILE A 1 20  ? 27.856 43.932 55.233 1.00 13.01  ? 22   ILE A CA  1 
ATOM   152  C  C   . ILE A 1 20  ? 29.212 43.265 55.465 1.00 12.57  ? 22   ILE A C   1 
ATOM   153  O  O   . ILE A 1 20  ? 29.723 42.433 54.722 1.00 14.88  ? 22   ILE A O   1 
ATOM   154  C  CB  . ILE A 1 20  ? 28.033 45.400 54.765 1.00 13.58  ? 22   ILE A CB  1 
ATOM   155  C  CG1 . ILE A 1 20  ? 26.685 46.046 54.378 1.00 13.47  ? 22   ILE A CG1 1 
ATOM   156  C  CG2 . ILE A 1 20  ? 28.984 45.530 53.593 1.00 14.88  ? 22   ILE A CG2 1 
ATOM   157  C  CD1 . ILE A 1 20  ? 26.736 47.520 54.123 1.00 15.04  ? 22   ILE A CD1 1 
ATOM   158  N  N   . ARG A 1 21  ? 29.837 43.679 56.578 1.00 14.72  ? 23   ARG A N   1 
ATOM   159  C  CA  . ARG A 1 21  ? 31.170 43.178 56.868 1.00 13.20  ? 23   ARG A CA  1 
ATOM   160  C  C   . ARG A 1 21  ? 31.186 41.681 57.080 1.00 13.22  ? 23   ARG A C   1 
ATOM   161  O  O   . ARG A 1 21  ? 32.163 40.970 56.726 1.00 15.76  ? 23   ARG A O   1 
ATOM   162  C  CB  . ARG A 1 21  ? 31.726 43.904 58.101 1.00 13.74  ? 23   ARG A CB  1 
ATOM   163  C  CG  . ARG A 1 21  ? 32.114 45.332 57.772 1.00 16.59  ? 23   ARG A CG  1 
ATOM   164  C  CD  . ARG A 1 21  ? 32.544 46.068 59.016 1.00 15.29  ? 23   ARG A CD  1 
ATOM   165  N  NE  . ARG A 1 21  ? 33.147 47.377 58.757 1.00 15.58  ? 23   ARG A NE  1 
ATOM   166  C  CZ  . ARG A 1 21  ? 33.094 48.462 59.512 1.00 14.36  ? 23   ARG A CZ  1 
ATOM   167  N  NH1 . ARG A 1 21  ? 32.408 48.469 60.664 1.00 14.93  ? 23   ARG A NH1 1 
ATOM   168  N  NH2 . ARG A 1 21  ? 33.728 49.569 59.118 1.00 16.47  ? 23   ARG A NH2 1 
ATOM   169  N  N   . ASN A 1 22  ? 30.091 41.171 57.645 1.00 14.27  ? 24   ASN A N   1 
ATOM   170  C  CA  . ASN A 1 22  ? 29.972 39.746 57.943 1.00 14.68  ? 24   ASN A CA  1 
ATOM   171  C  C   . ASN A 1 22  ? 29.803 38.964 56.638 1.00 15.30  ? 24   ASN A C   1 
ATOM   172  O  O   . ASN A 1 22  ? 29.873 37.731 56.695 1.00 16.03  ? 24   ASN A O   1 
ATOM   173  C  CB  . ASN A 1 22  ? 28.835 39.416 58.916 1.00 17.45  ? 24   ASN A CB  1 
ATOM   174  C  CG  . ASN A 1 22  ? 28.804 38.001 59.471 1.00 13.41  ? 24   ASN A CG  1 
ATOM   175  O  OD1 . ASN A 1 22  ? 27.750 37.360 59.625 1.00 19.24  ? 24   ASN A OD1 1 
ATOM   176  N  ND2 . ASN A 1 22  ? 29.944 37.469 59.840 1.00 15.18  ? 24   ASN A ND2 1 
ATOM   177  N  N   . SER A 1 23  ? 29.563 39.642 55.533 1.00 14.66  ? 25   SER A N   1 
ATOM   178  C  CA  . SER A 1 23  ? 29.545 38.957 54.226 1.00 14.01  ? 25   SER A CA  1 
ATOM   179  C  C   . SER A 1 23  ? 30.926 38.888 53.575 1.00 15.66  ? 25   SER A C   1 
ATOM   180  O  O   . SER A 1 23  ? 31.103 38.276 52.500 1.00 15.67  ? 25   SER A O   1 
ATOM   181  C  CB  . SER A 1 23  ? 28.575 39.592 53.216 1.00 14.73  ? 25   SER A CB  1 
ATOM   182  O  OG  . SER A 1 23  ? 29.097 40.808 52.679 1.00 16.37  ? 25   SER A OG  1 
ATOM   183  N  N   . GLY A 1 24  ? 31.938 39.519 54.176 1.00 17.25  ? 26   GLY A N   1 
ATOM   184  C  CA  . GLY A 1 24  ? 33.311 39.471 53.736 1.00 18.01  ? 26   GLY A CA  1 
ATOM   185  C  C   . GLY A 1 24  ? 33.772 40.678 52.958 1.00 17.83  ? 26   GLY A C   1 
ATOM   186  O  O   . GLY A 1 24  ? 34.858 40.590 52.414 1.00 21.43  ? 26   GLY A O   1 
ATOM   187  N  N   . THR A 1 25  ? 32.968 41.735 52.911 1.00 17.78  ? 27   THR A N   1 
ATOM   188  C  CA  . THR A 1 25  ? 33.513 42.918 52.280 1.00 18.24  ? 27   THR A CA  1 
ATOM   189  C  C   . THR A 1 25  ? 33.332 44.185 53.123 1.00 17.55  ? 27   THR A C   1 
ATOM   190  O  O   . THR A 1 25  ? 32.345 44.384 53.812 1.00 18.43  ? 27   THR A O   1 
ATOM   191  C  CB  . THR A 1 25  ? 33.142 43.297 50.819 1.00 25.57  ? 27   THR A CB  1 
ATOM   192  O  OG1 . THR A 1 25  ? 32.477 44.551 50.676 1.00 32.49  ? 27   THR A OG1 1 
ATOM   193  C  CG2 . THR A 1 25  ? 32.394 42.177 50.181 1.00 20.88  ? 27   THR A CG2 1 
ATOM   194  N  N   . GLU A 1 26  ? 34.395 44.987 53.018 1.00 17.73  ? 28   GLU A N   1 
ATOM   195  C  CA  . GLU A 1 26  ? 34.417 46.303 53.644 1.00 17.20  ? 28   GLU A CA  1 
ATOM   196  C  C   . GLU A 1 26  ? 33.828 47.303 52.655 1.00 16.87  ? 28   GLU A C   1 
ATOM   197  O  O   . GLU A 1 26  ? 34.410 47.483 51.570 1.00 19.53  ? 28   GLU A O   1 
ATOM   198  C  CB  . GLU A 1 26  ? 35.820 46.744 54.074 1.00 18.06  ? 28   GLU A CB  1 
ATOM   199  C  CG  . GLU A 1 26  ? 35.863 48.124 54.704 1.00 19.47  ? 28   GLU A CG  1 
ATOM   200  C  CD  . GLU A 1 26  ? 35.282 48.168 56.103 1.00 17.10  ? 28   GLU A CD  1 
ATOM   201  O  OE1 . GLU A 1 26  ? 35.162 49.315 56.566 1.00 18.93  ? 28   GLU A OE1 1 
ATOM   202  O  OE2 . GLU A 1 26  ? 35.001 47.082 56.612 1.00 19.43  ? 28   GLU A OE2 1 
ATOM   203  N  N   . PRO A 1 27  ? 32.711 47.933 53.000 1.00 17.41  ? 29   PRO A N   1 
ATOM   204  C  CA  . PRO A 1 27  ? 32.108 48.863 52.051 1.00 15.72  ? 29   PRO A CA  1 
ATOM   205  C  C   . PRO A 1 27  ? 32.823 50.199 52.108 1.00 16.19  ? 29   PRO A C   1 
ATOM   206  O  O   . PRO A 1 27  ? 33.514 50.548 53.059 1.00 18.16  ? 29   PRO A O   1 
ATOM   207  C  CB  . PRO A 1 27  ? 30.668 48.982 52.588 1.00 14.96  ? 29   PRO A CB  1 
ATOM   208  C  CG  . PRO A 1 27  ? 30.865 48.862 54.081 1.00 14.20  ? 29   PRO A CG  1 
ATOM   209  C  CD  . PRO A 1 27  ? 31.943 47.821 54.251 1.00 14.78  ? 29   PRO A CD  1 
ATOM   210  N  N   . THR A 1 28  ? 32.608 50.981 51.066 1.00 17.14  ? 30   THR A N   1 
ATOM   211  C  CA  . THR A 1 28  ? 32.852 52.408 51.101 1.00 17.00  ? 30   THR A CA  1 
ATOM   212  C  C   . THR A 1 28  ? 31.801 53.029 52.026 1.00 17.74  ? 30   THR A C   1 
ATOM   213  O  O   . THR A 1 28  ? 30.619 52.688 51.839 1.00 17.66  ? 30   THR A O   1 
ATOM   214  C  CB  . THR A 1 28  ? 32.670 53.019 49.710 1.00 19.84  ? 30   THR A CB  1 
ATOM   215  O  OG1 . THR A 1 28  ? 33.700 52.541 48.835 1.00 21.41  ? 30   THR A OG1 1 
ATOM   216  C  CG2 . THR A 1 28  ? 32.790 54.544 49.723 1.00 19.11  ? 30   THR A CG2 1 
ATOM   217  N  N   . ILE A 1 29  ? 32.220 53.859 52.969 1.00 16.77  ? 31   ILE A N   1 
ATOM   218  C  CA  . ILE A 1 29  ? 31.296 54.449 53.951 1.00 15.30  ? 31   ILE A CA  1 
ATOM   219  C  C   . ILE A 1 29  ? 31.180 55.938 53.680 1.00 15.23  ? 31   ILE A C   1 
ATOM   220  O  O   . ILE A 1 29  ? 32.177 56.674 53.695 1.00 17.77  ? 31   ILE A O   1 
ATOM   221  C  CB  . ILE A 1 29  ? 31.759 54.158 55.372 1.00 15.16  ? 31   ILE A CB  1 
ATOM   222  C  CG1 . ILE A 1 29  ? 31.899 52.660 55.694 1.00 16.97  ? 31   ILE A CG1 1 
ATOM   223  C  CG2 . ILE A 1 29  ? 30.874 54.826 56.417 1.00 17.32  ? 31   ILE A CG2 1 
ATOM   224  C  CD1 . ILE A 1 29  ? 32.573 52.306 57.022 1.00 20.09  ? 31   ILE A CD1 1 
ATOM   225  N  N   . ILE A 1 30  ? 29.933 56.343 53.395 1.00 15.81  ? 32   ILE A N   1 
ATOM   226  C  CA  . ILE A 1 30  ? 29.608 57.761 53.161 1.00 14.85  ? 32   ILE A CA  1 
ATOM   227  C  C   . ILE A 1 30  ? 28.798 58.258 54.351 1.00 14.66  ? 32   ILE A C   1 
ATOM   228  O  O   . ILE A 1 30  ? 27.707 57.736 54.616 1.00 15.37  ? 32   ILE A O   1 
ATOM   229  C  CB  . ILE A 1 30  ? 28.862 58.014 51.838 1.00 15.59  ? 32   ILE A CB  1 
ATOM   230  C  CG1 . ILE A 1 30  ? 29.662 57.542 50.594 1.00 17.02  ? 32   ILE A CG1 1 
ATOM   231  C  CG2 . ILE A 1 30  ? 28.440 59.447 51.705 1.00 19.45  ? 32   ILE A CG2 1 
ATOM   232  C  CD1 . ILE A 1 30  ? 28.968 57.762 49.256 1.00 21.01  ? 32   ILE A CD1 1 
ATOM   233  N  N   . LEU A 1 31  ? 29.380 59.217 55.040 1.00 14.81  ? 33   LEU A N   1 
ATOM   234  C  CA  . LEU A 1 31  ? 28.736 59.870 56.183 1.00 15.19  ? 33   LEU A CA  1 
ATOM   235  C  C   . LEU A 1 31  ? 27.831 60.931 55.583 1.00 14.27  ? 33   LEU A C   1 
ATOM   236  O  O   . LEU A 1 31  ? 28.283 62.056 55.395 1.00 16.55  ? 33   LEU A O   1 
ATOM   237  C  CB  . LEU A 1 31  ? 29.718 60.461 57.180 1.00 16.03  ? 33   LEU A CB  1 
ATOM   238  C  CG  . LEU A 1 31  ? 30.697 59.437 57.769 1.00 18.08  ? 33   LEU A CG  1 
ATOM   239  C  CD1 . LEU A 1 31  ? 31.719 60.106 58.654 1.00 20.38  ? 33   LEU A CD1 1 
ATOM   240  C  CD2 . LEU A 1 31  ? 29.991 58.332 58.558 1.00 20.57  ? 33   LEU A CD2 1 
ATOM   241  N  N   . TYR A 1 32  ? 26.623 60.493 55.266 1.00 15.75  ? 34   TYR A N   1 
ATOM   242  C  CA  . TYR A 1 32  ? 25.703 61.287 54.445 1.00 15.73  ? 34   TYR A CA  1 
ATOM   243  C  C   . TYR A 1 32  ? 25.390 62.607 55.136 1.00 14.50  ? 34   TYR A C   1 
ATOM   244  O  O   . TYR A 1 32  ? 24.979 63.550 54.432 1.00 15.83  ? 34   TYR A O   1 
ATOM   245  C  CB  . TYR A 1 32  ? 24.421 60.512 53.996 1.00 14.93  ? 34   TYR A CB  1 
ATOM   246  C  CG  . TYR A 1 32  ? 23.519 60.258 55.178 1.00 13.93  ? 34   TYR A CG  1 
ATOM   247  C  CD1 . TYR A 1 32  ? 22.521 61.126 55.562 1.00 15.75  ? 34   TYR A CD1 1 
ATOM   248  C  CD2 . TYR A 1 32  ? 23.690 59.093 55.915 1.00 16.38  ? 34   TYR A CD2 1 
ATOM   249  C  CE1 . TYR A 1 32  ? 21.695 60.883 56.640 1.00 16.14  ? 34   TYR A CE1 1 
ATOM   250  C  CE2 . TYR A 1 32  ? 22.895 58.854 57.020 1.00 14.82  ? 34   TYR A CE2 1 
ATOM   251  C  CZ  . TYR A 1 32  ? 21.897 59.731 57.387 1.00 15.85  ? 34   TYR A CZ  1 
ATOM   252  O  OH  . TYR A 1 32  ? 21.143 59.448 58.496 1.00 16.11  ? 34   TYR A OH  1 
ATOM   253  N  N   . LEU A 1 33  ? 25.464 62.697 56.454 1.00 14.69  ? 35   LEU A N   1 
ATOM   254  C  CA  . LEU A 1 33  ? 25.120 63.968 57.103 1.00 14.71  ? 35   LEU A CA  1 
ATOM   255  C  C   . LEU A 1 33  ? 26.076 65.085 56.718 1.00 15.86  ? 35   LEU A C   1 
ATOM   256  O  O   . LEU A 1 33  ? 25.669 66.262 56.679 1.00 22.61  ? 35   LEU A O   1 
ATOM   257  C  CB  . LEU A 1 33  ? 25.097 63.810 58.635 1.00 16.20  ? 35   LEU A CB  1 
ATOM   258  C  CG  . LEU A 1 33  ? 23.985 62.933 59.212 1.00 16.02  ? 35   LEU A CG  1 
ATOM   259  C  CD1 . LEU A 1 33  ? 24.222 62.689 60.709 1.00 22.33  ? 35   LEU A CD1 1 
ATOM   260  C  CD2 . LEU A 1 33  ? 22.580 63.500 58.993 1.00 18.03  ? 35   LEU A CD2 1 
ATOM   261  N  N   . GLU A 1 34  ? 27.314 64.720 56.478 1.00 17.93  ? 36   GLU A N   1 
ATOM   262  C  CA  . GLU A 1 34  ? 28.396 65.614 56.076 1.00 23.47  ? 36   GLU A CA  1 
ATOM   263  C  C   . GLU A 1 34  ? 28.642 65.612 54.574 1.00 21.73  ? 36   GLU A C   1 
ATOM   264  O  O   . GLU A 1 34  ? 29.024 66.652 54.014 1.00 25.11  ? 36   GLU A O   1 
ATOM   265  C  CB  A GLU A 1 34  ? 29.696 65.160 56.751 0.66 26.19  ? 36   GLU A CB  1 
ATOM   266  C  CB  B GLU A 1 34  ? 29.692 65.296 56.817 0.34 26.83  ? 36   GLU A CB  1 
ATOM   267  C  CG  A GLU A 1 34  ? 29.643 65.092 58.263 0.66 30.57  ? 36   GLU A CG  1 
ATOM   268  C  CG  B GLU A 1 34  ? 30.224 63.888 56.715 0.34 29.27  ? 36   GLU A CG  1 
ATOM   269  C  CD  A GLU A 1 34  ? 30.873 64.530 58.941 0.66 35.52  ? 36   GLU A CD  1 
ATOM   270  C  CD  B GLU A 1 34  ? 31.336 63.603 57.710 0.34 34.71  ? 36   GLU A CD  1 
ATOM   271  O  OE1 A GLU A 1 34  ? 30.877 64.329 60.182 0.66 42.52  ? 36   GLU A OE1 1 
ATOM   272  O  OE1 B GLU A 1 34  ? 31.044 63.669 58.930 0.34 41.67  ? 36   GLU A OE1 1 
ATOM   273  O  OE2 A GLU A 1 34  ? 31.891 64.276 58.238 0.66 39.88  ? 36   GLU A OE2 1 
ATOM   274  O  OE2 B GLU A 1 34  ? 32.490 63.314 57.309 0.34 36.05  ? 36   GLU A OE2 1 
ATOM   275  N  N   . ASN A 1 35  ? 28.444 64.491 53.908 1.00 22.80  ? 37   ASN A N   1 
ATOM   276  C  CA  . ASN A 1 35  ? 28.724 64.347 52.466 1.00 19.50  ? 37   ASN A CA  1 
ATOM   277  C  C   . ASN A 1 35  ? 27.515 63.754 51.789 1.00 19.65  ? 37   ASN A C   1 
ATOM   278  O  O   . ASN A 1 35  ? 27.579 62.583 51.368 1.00 18.85  ? 37   ASN A O   1 
ATOM   279  C  CB  . ASN A 1 35  ? 29.909 63.420 52.255 1.00 24.32  ? 37   ASN A CB  1 
ATOM   280  C  CG  . ASN A 1 35  ? 31.158 64.054 52.819 1.00 23.89  ? 37   ASN A CG  1 
ATOM   281  O  OD1 . ASN A 1 35  ? 31.593 65.092 52.288 1.00 35.18  ? 37   ASN A OD1 1 
ATOM   282  N  ND2 . ASN A 1 35  ? 31.703 63.436 53.854 1.00 31.52  ? 37   ASN A ND2 1 
ATOM   283  N  N   . PRO A 1 36  ? 26.409 64.468 51.728 1.00 18.56  ? 38   PRO A N   1 
ATOM   284  C  CA  . PRO A 1 36  ? 25.211 63.882 51.104 1.00 17.79  ? 38   PRO A CA  1 
ATOM   285  C  C   . PRO A 1 36  ? 25.433 63.623 49.623 1.00 16.83  ? 38   PRO A C   1 
ATOM   286  O  O   . PRO A 1 36  ? 26.328 64.215 49.014 1.00 18.02  ? 38   PRO A O   1 
ATOM   287  C  CB  . PRO A 1 36  ? 24.125 64.925 51.279 1.00 20.73  ? 38   PRO A CB  1 
ATOM   288  C  CG  . PRO A 1 36  ? 24.846 66.200 51.520 1.00 23.61  ? 38   PRO A CG  1 
ATOM   289  C  CD  . PRO A 1 36  ? 26.110 65.815 52.255 1.00 21.64  ? 38   PRO A CD  1 
ATOM   290  N  N   . PRO A 1 37  ? 24.580 62.762 49.068 1.00 19.07  ? 39   PRO A N   1 
ATOM   291  C  CA  . PRO A 1 37  ? 24.611 62.534 47.600 1.00 20.20  ? 39   PRO A CA  1 
ATOM   292  C  C   . PRO A 1 37  ? 24.263 63.844 46.869 1.00 18.75  ? 39   PRO A C   1 
ATOM   293  O  O   . PRO A 1 37  ? 23.532 64.704 47.393 1.00 18.96  ? 39   PRO A O   1 
ATOM   294  C  CB  . PRO A 1 37  ? 23.494 61.507 47.377 1.00 18.59  ? 39   PRO A CB  1 
ATOM   295  C  CG  . PRO A 1 37  ? 22.594 61.735 48.568 1.00 20.85  ? 39   PRO A CG  1 
ATOM   296  C  CD  . PRO A 1 37  ? 23.499 62.001 49.714 1.00 18.36  ? 39   PRO A CD  1 
ATOM   297  N  N   . SER A 1 38  ? 24.789 64.016 45.656 1.00 17.93  ? 40   SER A N   1 
ATOM   298  C  CA  . SER A 1 38  ? 24.295 65.077 44.772 1.00 18.25  ? 40   SER A CA  1 
ATOM   299  C  C   . SER A 1 38  ? 22.838 64.834 44.394 1.00 17.11  ? 40   SER A C   1 
ATOM   300  O  O   . SER A 1 38  ? 22.287 63.765 44.624 1.00 16.52  ? 40   SER A O   1 
ATOM   301  C  CB  . SER A 1 38  ? 25.099 65.118 43.472 1.00 19.58  ? 40   SER A CB  1 
ATOM   302  O  OG  . SER A 1 38  ? 24.783 63.936 42.768 1.00 19.92  ? 40   SER A OG  1 
ATOM   303  N  N   . ARG A 1 39  ? 22.196 65.840 43.792 1.00 17.36  ? 41   ARG A N   1 
ATOM   304  C  CA  . ARG A 1 39  ? 20.792 65.666 43.402 1.00 17.02  ? 41   ARG A CA  1 
ATOM   305  C  C   . ARG A 1 39  ? 20.617 64.512 42.436 1.00 17.76  ? 41   ARG A C   1 
ATOM   306  O  O   . ARG A 1 39  ? 19.732 63.663 42.593 1.00 17.41  ? 41   ARG A O   1 
ATOM   307  C  CB  . ARG A 1 39  ? 20.237 66.964 42.807 1.00 17.16  ? 41   ARG A CB  1 
ATOM   308  C  CG  . ARG A 1 39  ? 18.763 67.032 42.611 1.00 19.94  ? 41   ARG A CG  1 
ATOM   309  C  CD  . ARG A 1 39  ? 18.172 68.359 42.165 1.00 21.01  ? 41   ARG A CD  1 
ATOM   310  N  NE  . ARG A 1 39  ? 16.801 68.466 42.639 1.00 18.19  ? 41   ARG A NE  1 
ATOM   311  C  CZ  . ARG A 1 39  ? 15.746 67.800 42.195 1.00 15.81  ? 41   ARG A CZ  1 
ATOM   312  N  NH1 . ARG A 1 39  ? 15.939 66.956 41.183 1.00 19.48  ? 41   ARG A NH1 1 
ATOM   313  N  NH2 . ARG A 1 39  ? 14.528 67.958 42.710 1.00 16.98  ? 41   ARG A NH2 1 
ATOM   314  N  N   . ASP A 1 40  ? 21.500 64.481 41.432 1.00 18.50  ? 42   ASP A N   1 
ATOM   315  C  CA  . ASP A 1 40  ? 21.420 63.389 40.474 1.00 21.33  ? 42   ASP A CA  1 
ATOM   316  C  C   . ASP A 1 40  ? 21.536 62.028 41.161 1.00 20.97  ? 42   ASP A C   1 
ATOM   317  O  O   . ASP A 1 40  ? 20.830 61.058 40.884 1.00 21.59  ? 42   ASP A O   1 
ATOM   318  C  CB  . ASP A 1 40  ? 22.501 63.581 39.391 1.00 24.80  ? 42   ASP A CB  1 
ATOM   319  C  CG  . ASP A 1 40  ? 22.152 64.654 38.379 1.00 30.55  ? 42   ASP A CG  1 
ATOM   320  O  OD1 . ASP A 1 40  ? 20.988 65.110 38.331 1.00 34.03  ? 42   ASP A OD1 1 
ATOM   321  O  OD2 . ASP A 1 40  ? 23.031 65.063 37.587 1.00 39.13  ? 42   ASP A OD2 1 
ATOM   322  N  N   . GLU A 1 41  ? 22.464 61.955 42.097 1.00 19.89  ? 43   GLU A N   1 
ATOM   323  C  CA  . GLU A 1 41  ? 22.714 60.686 42.755 1.00 18.71  ? 43   GLU A CA  1 
ATOM   324  C  C   . GLU A 1 41  ? 21.539 60.293 43.629 1.00 17.56  ? 43   GLU A C   1 
ATOM   325  O  O   . GLU A 1 41  ? 21.145 59.128 43.678 1.00 18.92  ? 43   GLU A O   1 
ATOM   326  C  CB  A GLU A 1 41  ? 24.027 60.639 43.529 0.39 18.02  ? 43   GLU A CB  1 
ATOM   327  C  CB  B GLU A 1 41  ? 23.974 60.909 43.609 0.61 21.83  ? 43   GLU A CB  1 
ATOM   328  C  CG  A GLU A 1 41  ? 24.309 59.212 43.988 0.39 18.02  ? 43   GLU A CG  1 
ATOM   329  C  CG  B GLU A 1 41  ? 25.323 61.118 43.004 0.61 23.93  ? 43   GLU A CG  1 
ATOM   330  C  CD  A GLU A 1 41  ? 24.289 58.130 42.934 0.39 17.89  ? 43   GLU A CD  1 
ATOM   331  C  CD  B GLU A 1 41  ? 26.580 61.409 43.785 0.61 20.05  ? 43   GLU A CD  1 
ATOM   332  O  OE1 A GLU A 1 41  ? 24.645 58.267 41.740 0.39 22.19  ? 43   GLU A OE1 1 
ATOM   333  O  OE1 B GLU A 1 41  ? 26.584 61.792 44.948 0.61 15.67  ? 43   GLU A OE1 1 
ATOM   334  O  OE2 A GLU A 1 41  ? 23.901 57.018 43.314 0.39 24.03  ? 43   GLU A OE2 1 
ATOM   335  O  OE2 B GLU A 1 41  ? 27.679 61.296 43.177 0.61 30.73  ? 43   GLU A OE2 1 
ATOM   336  N  N   . LEU A 1 42  ? 20.960 61.268 44.317 1.00 17.38  ? 44   LEU A N   1 
ATOM   337  C  CA  . LEU A 1 42  ? 19.819 60.976 45.198 1.00 15.93  ? 44   LEU A CA  1 
ATOM   338  C  C   . LEU A 1 42  ? 18.618 60.509 44.363 1.00 16.76  ? 44   LEU A C   1 
ATOM   339  O  O   . LEU A 1 42  ? 17.956 59.529 44.738 1.00 15.34  ? 44   LEU A O   1 
ATOM   340  C  CB  . LEU A 1 42  ? 19.498 62.199 46.043 1.00 16.23  ? 44   LEU A CB  1 
ATOM   341  C  CG  . LEU A 1 42  ? 18.337 62.019 47.019 1.00 16.46  ? 44   LEU A CG  1 
ATOM   342  C  CD1 . LEU A 1 42  ? 18.509 60.863 47.976 1.00 17.23  ? 44   LEU A CD1 1 
ATOM   343  C  CD2 . LEU A 1 42  ? 18.214 63.299 47.822 1.00 17.65  ? 44   LEU A CD2 1 
ATOM   344  N  N   . VAL A 1 43  ? 18.372 61.173 43.235 1.00 18.47  ? 45   VAL A N   1 
ATOM   345  C  CA  . VAL A 1 43  ? 17.293 60.743 42.362 1.00 18.54  ? 45   VAL A CA  1 
ATOM   346  C  C   . VAL A 1 43  ? 17.494 59.306 41.903 1.00 18.75  ? 45   VAL A C   1 
ATOM   347  O  O   . VAL A 1 43  ? 16.565 58.484 41.833 1.00 20.38  ? 45   VAL A O   1 
ATOM   348  C  CB  . VAL A 1 43  ? 17.195 61.694 41.136 1.00 20.17  ? 45   VAL A CB  1 
ATOM   349  C  CG1 . VAL A 1 43  ? 16.281 61.084 40.083 1.00 19.92  ? 45   VAL A CG1 1 
ATOM   350  C  CG2 . VAL A 1 43  ? 16.722 63.072 41.573 1.00 23.40  ? 45   VAL A CG2 1 
ATOM   351  N  N   . LYS A 1 44  ? 18.752 58.958 41.603 1.00 21.41  ? 46   LYS A N   1 
ATOM   352  C  CA  . LYS A 1 44  ? 19.060 57.603 41.152 1.00 20.10  ? 46   LYS A CA  1 
ATOM   353  C  C   . LYS A 1 44  ? 18.842 56.568 42.254 1.00 19.36  ? 46   LYS A C   1 
ATOM   354  O  O   . LYS A 1 44  ? 18.290 55.469 42.086 1.00 19.53  ? 46   LYS A O   1 
ATOM   355  C  CB  . LYS A 1 44  ? 20.483 57.566 40.604 1.00 21.84  ? 46   LYS A CB  1 
ATOM   356  C  CG  . LYS A 1 44  ? 20.927 56.170 40.174 1.00 26.54  ? 46   LYS A CG  1 
ATOM   357  C  CD  . LYS A 1 44  ? 22.220 56.122 39.387 1.00 41.21  ? 46   LYS A CD  1 
ATOM   358  C  CE  . LYS A 1 44  ? 22.905 54.762 39.527 1.00 46.35  ? 46   LYS A CE  1 
ATOM   359  N  NZ  . LYS A 1 44  ? 24.403 54.881 39.374 1.00 66.33  ? 46   LYS A NZ  1 
ATOM   360  N  N   . LEU A 1 45  ? 19.266 56.936 43.467 1.00 18.08  ? 47   LEU A N   1 
ATOM   361  C  CA  . LEU A 1 45  ? 19.149 56.034 44.596 1.00 16.81  ? 47   LEU A CA  1 
ATOM   362  C  C   . LEU A 1 45  ? 17.690 55.709 44.871 1.00 15.91  ? 47   LEU A C   1 
ATOM   363  O  O   . LEU A 1 45  ? 17.313 54.577 45.069 1.00 18.58  ? 47   LEU A O   1 
ATOM   364  C  CB  . LEU A 1 45  ? 19.800 56.632 45.835 1.00 16.06  ? 47   LEU A CB  1 
ATOM   365  C  CG  . LEU A 1 45  ? 21.326 56.778 45.878 1.00 14.98  ? 47   LEU A CG  1 
ATOM   366  C  CD1 . LEU A 1 45  ? 21.783 57.685 47.023 1.00 19.15  ? 47   LEU A CD1 1 
ATOM   367  C  CD2 . LEU A 1 45  ? 22.012 55.421 46.025 1.00 19.02  ? 47   LEU A CD2 1 
ATOM   368  N  N   . ILE A 1 46  ? 16.843 56.730 44.813 1.00 17.73  ? 48   ILE A N   1 
ATOM   369  C  CA  . ILE A 1 46  ? 15.408 56.529 45.091 1.00 17.94  ? 48   ILE A CA  1 
ATOM   370  C  C   . ILE A 1 46  ? 14.813 55.612 44.046 1.00 19.50  ? 48   ILE A C   1 
ATOM   371  O  O   . ILE A 1 46  ? 14.032 54.723 44.339 1.00 20.62  ? 48   ILE A O   1 
ATOM   372  C  CB  . ILE A 1 46  ? 14.707 57.899 45.187 1.00 17.33  ? 48   ILE A CB  1 
ATOM   373  C  CG1 . ILE A 1 46  ? 15.186 58.677 46.406 1.00 17.22  ? 48   ILE A CG1 1 
ATOM   374  C  CG2 . ILE A 1 46  ? 13.182 57.774 45.147 1.00 19.15  ? 48   ILE A CG2 1 
ATOM   375  C  CD1 . ILE A 1 46  ? 14.789 60.123 46.428 1.00 18.35  ? 48   ILE A CD1 1 
ATOM   376  N  N   . ALA A 1 47  ? 15.192 55.862 42.788 1.00 21.12  ? 49   ALA A N   1 
ATOM   377  C  CA  . ALA A 1 47  ? 14.682 55.068 41.697 1.00 21.72  ? 49   ALA A CA  1 
ATOM   378  C  C   . ALA A 1 47  ? 15.057 53.602 41.914 1.00 18.99  ? 49   ALA A C   1 
ATOM   379  O  O   . ALA A 1 47  ? 14.250 52.676 41.806 1.00 24.40  ? 49   ALA A O   1 
ATOM   380  C  CB  . ALA A 1 47  ? 15.189 55.581 40.361 1.00 24.43  ? 49   ALA A CB  1 
ATOM   381  N  N   . ASP A 1 48  ? 16.318 53.374 42.268 1.00 20.84  ? 50   ASP A N   1 
ATOM   382  C  CA  . ASP A 1 48  ? 16.769 51.993 42.385 1.00 19.73  ? 50   ASP A CA  1 
ATOM   383  C  C   . ASP A 1 48  ? 16.213 51.342 43.643 1.00 19.94  ? 50   ASP A C   1 
ATOM   384  O  O   . ASP A 1 48  ? 16.080 50.124 43.662 1.00 22.55  ? 50   ASP A O   1 
ATOM   385  C  CB  . ASP A 1 48  ? 18.291 51.944 42.417 1.00 18.48  ? 50   ASP A CB  1 
ATOM   386  C  CG  . ASP A 1 48  ? 18.919 52.324 41.108 1.00 20.66  ? 50   ASP A CG  1 
ATOM   387  O  OD1 . ASP A 1 48  ? 20.156 52.462 41.067 1.00 23.75  ? 50   ASP A OD1 1 
ATOM   388  O  OD2 . ASP A 1 48  ? 18.204 52.461 40.101 1.00 26.43  ? 50   ASP A OD2 1 
ATOM   389  N  N   . MET A 1 49  ? 15.914 52.129 44.675 1.00 20.47  ? 51   MET A N   1 
ATOM   390  C  CA  . MET A 1 49  ? 15.382 51.505 45.882 1.00 20.44  ? 51   MET A CA  1 
ATOM   391  C  C   . MET A 1 49  ? 13.916 51.083 45.785 1.00 24.05  ? 51   MET A C   1 
ATOM   392  O  O   . MET A 1 49  ? 13.436 50.355 46.664 1.00 26.11  ? 51   MET A O   1 
ATOM   393  C  CB  . MET A 1 49  ? 15.429 52.445 47.091 1.00 21.40  ? 51   MET A CB  1 
ATOM   394  C  CG  . MET A 1 49  ? 16.792 52.753 47.593 1.00 21.19  ? 51   MET A CG  1 
ATOM   395  S  SD  . MET A 1 49  ? 16.875 53.667 49.132 1.00 21.79  ? 51   MET A SD  1 
ATOM   396  C  CE  . MET A 1 49  ? 16.668 55.343 48.596 1.00 23.77  ? 51   MET A CE  1 
ATOM   397  N  N   . GLY A 1 50  ? 13.265 51.602 44.746 1.00 25.26  ? 52   GLY A N   1 
ATOM   398  C  CA  . GLY A 1 50  ? 11.886 51.313 44.447 1.00 27.60  ? 52   GLY A CA  1 
ATOM   399  C  C   . GLY A 1 50  ? 10.907 51.749 45.510 1.00 30.84  ? 52   GLY A C   1 
ATOM   400  O  O   . GLY A 1 50  ? 9.847  51.156 45.712 1.00 34.45  ? 52   GLY A O   1 
ATOM   401  N  N   . ILE A 1 51  ? 11.212 52.795 46.234 1.00 23.55  ? 53   ILE A N   1 
ATOM   402  C  CA  . ILE A 1 51  ? 10.300 53.365 47.224 1.00 20.81  ? 53   ILE A CA  1 
ATOM   403  C  C   . ILE A 1 51  ? 9.925  54.774 46.784 1.00 20.62  ? 53   ILE A C   1 
ATOM   404  O  O   . ILE A 1 51  ? 10.563 55.354 45.912 1.00 21.77  ? 53   ILE A O   1 
ATOM   405  C  CB  . ILE A 1 51  ? 10.942 53.388 48.629 1.00 22.60  ? 53   ILE A CB  1 
ATOM   406  C  CG1 . ILE A 1 51  ? 12.161 54.317 48.701 1.00 21.66  ? 53   ILE A CG1 1 
ATOM   407  C  CG2 . ILE A 1 51  ? 11.229 51.962 49.108 1.00 24.89  ? 53   ILE A CG2 1 
ATOM   408  C  CD1 . ILE A 1 51  ? 12.724 54.468 50.109 1.00 21.94  ? 53   ILE A CD1 1 
ATOM   409  N  N   . SER A 1 52  ? 8.887  55.341 47.369 1.00 19.42  ? 54   SER A N   1 
ATOM   410  C  CA  . SER A 1 52  ? 8.578  56.719 47.060 1.00 20.11  ? 54   SER A CA  1 
ATOM   411  C  C   . SER A 1 52  ? 9.559  57.698 47.699 1.00 18.93  ? 54   SER A C   1 
ATOM   412  O  O   . SER A 1 52  ? 10.252 57.372 48.667 1.00 17.46  ? 54   SER A O   1 
ATOM   413  C  CB  . SER A 1 52  ? 7.178  57.011 47.571 1.00 18.46  ? 54   SER A CB  1 
ATOM   414  O  OG  . SER A 1 52  ? 7.195  57.094 48.974 1.00 19.75  ? 54   SER A OG  1 
ATOM   415  N  N   . VAL A 1 53  ? 9.624  58.907 47.160 1.00 17.60  ? 55   VAL A N   1 
ATOM   416  C  CA  . VAL A 1 53  ? 10.463 59.957 47.758 1.00 16.32  ? 55   VAL A CA  1 
ATOM   417  C  C   . VAL A 1 53  ? 10.046 60.165 49.219 1.00 14.55  ? 55   VAL A C   1 
ATOM   418  O  O   . VAL A 1 53  ? 10.877 60.188 50.124 1.00 15.58  ? 55   VAL A O   1 
ATOM   419  C  CB  . VAL A 1 53  ? 10.359 61.266 46.960 1.00 17.75  ? 55   VAL A CB  1 
ATOM   420  C  CG1 . VAL A 1 53  ? 11.076 62.375 47.741 1.00 17.43  ? 55   VAL A CG1 1 
ATOM   421  C  CG2 . VAL A 1 53  ? 10.877 61.096 45.539 1.00 16.80  ? 55   VAL A CG2 1 
ATOM   422  N  N   . ARG A 1 54  ? 8.741  60.281 49.493 1.00 15.79  ? 56   ARG A N   1 
ATOM   423  C  CA  . ARG A 1 54  ? 8.303  60.434 50.868 1.00 16.16  ? 56   ARG A CA  1 
ATOM   424  C  C   . ARG A 1 54  ? 8.722  59.273 51.766 1.00 16.56  ? 56   ARG A C   1 
ATOM   425  O  O   . ARG A 1 54  ? 9.019  59.525 52.948 1.00 17.38  ? 56   ARG A O   1 
ATOM   426  C  CB  . ARG A 1 54  ? 6.788  60.614 50.911 1.00 17.41  ? 56   ARG A CB  1 
ATOM   427  C  CG  . ARG A 1 54  ? 6.251  60.660 52.326 1.00 15.77  ? 56   ARG A CG  1 
ATOM   428  C  CD  . ARG A 1 54  ? 4.812  61.156 52.341 1.00 17.51  ? 56   ARG A CD  1 
ATOM   429  N  NE  . ARG A 1 54  ? 4.666  62.565 52.044 1.00 17.32  ? 56   ARG A NE  1 
ATOM   430  C  CZ  . ARG A 1 54  ? 4.855  63.544 52.920 1.00 16.89  ? 56   ARG A CZ  1 
ATOM   431  N  NH1 . ARG A 1 54  ? 4.685  64.801 52.524 1.00 17.95  ? 56   ARG A NH1 1 
ATOM   432  N  NH2 . ARG A 1 54  ? 5.203  63.272 54.171 1.00 19.53  ? 56   ARG A NH2 1 
ATOM   433  N  N   . ALA A 1 55  ? 8.732  58.040 51.288 1.00 17.99  ? 57   ALA A N   1 
ATOM   434  C  CA  . ALA A 1 55  ? 9.139  56.925 52.124 1.00 18.47  ? 57   ALA A CA  1 
ATOM   435  C  C   . ALA A 1 55  ? 10.592 57.027 52.589 1.00 18.10  ? 57   ALA A C   1 
ATOM   436  O  O   . ALA A 1 55  ? 10.980 56.337 53.532 1.00 19.36  ? 57   ALA A O   1 
ATOM   437  C  CB  . ALA A 1 55  ? 8.864  55.581 51.413 1.00 18.99  ? 57   ALA A CB  1 
ATOM   438  N  N   . LEU A 1 56  ? 11.394 57.859 51.934 1.00 16.89  ? 58   LEU A N   1 
ATOM   439  C  CA  . LEU A 1 56  ? 12.790 58.067 52.321 1.00 15.21  ? 58   LEU A CA  1 
ATOM   440  C  C   . LEU A 1 56  ? 12.934 59.073 53.462 1.00 16.53  ? 58   LEU A C   1 
ATOM   441  O  O   . LEU A 1 56  ? 13.997 59.150 54.093 1.00 16.76  ? 58   LEU A O   1 
ATOM   442  C  CB  . LEU A 1 56  ? 13.678 58.435 51.130 1.00 16.84  ? 58   LEU A CB  1 
ATOM   443  C  CG  . LEU A 1 56  ? 15.192 58.480 51.363 1.00 15.73  ? 58   LEU A CG  1 
ATOM   444  C  CD1 . LEU A 1 56  ? 15.709 57.171 51.949 1.00 16.25  ? 58   LEU A CD1 1 
ATOM   445  C  CD2 . LEU A 1 56  ? 15.900 58.788 50.064 1.00 18.00  ? 58   LEU A CD2 1 
ATOM   446  N  N   . LEU A 1 57  ? 11.895 59.871 53.778 1.00 15.64  ? 59   LEU A N   1 
ATOM   447  C  CA  . LEU A 1 57  ? 12.052 60.916 54.775 1.00 15.72  ? 59   LEU A CA  1 
ATOM   448  C  C   . LEU A 1 57  ? 12.160 60.341 56.192 1.00 14.76  ? 59   LEU A C   1 
ATOM   449  O  O   . LEU A 1 57  ? 11.304 59.539 56.569 1.00 16.84  ? 59   LEU A O   1 
ATOM   450  C  CB  . LEU A 1 57  ? 10.843 61.885 54.786 1.00 15.77  ? 59   LEU A CB  1 
ATOM   451  C  CG  . LEU A 1 57  ? 10.659 62.753 53.549 1.00 17.86  ? 59   LEU A CG  1 
ATOM   452  C  CD1 . LEU A 1 57  ? 9.307  63.440 53.611 1.00 16.10  ? 59   LEU A CD1 1 
ATOM   453  C  CD2 . LEU A 1 57  ? 11.747 63.792 53.405 1.00 17.64  ? 59   LEU A CD2 1 
ATOM   454  N  N   . ALA A 1 58  ? 13.175 60.763 56.927 1.00 14.80  ? 60   ALA A N   1 
ATOM   455  C  CA  . ALA A 1 58  ? 13.311 60.479 58.339 1.00 14.98  ? 60   ALA A CA  1 
ATOM   456  C  C   . ALA A 1 58  ? 12.351 61.348 59.153 1.00 15.25  ? 60   ALA A C   1 
ATOM   457  O  O   . ALA A 1 58  ? 12.421 62.584 59.025 1.00 15.31  ? 60   ALA A O   1 
ATOM   458  C  CB  . ALA A 1 58  ? 14.754 60.679 58.830 1.00 17.12  ? 60   ALA A CB  1 
ATOM   459  N  N   . LYS A 1 59  ? 11.515 60.711 59.952 1.00 16.82  ? 61   LYS A N   1 
ATOM   460  C  CA  . LYS A 1 59  ? 10.584 61.445 60.778 1.00 18.11  ? 61   LYS A CA  1 
ATOM   461  C  C   . LYS A 1 59  ? 11.288 61.787 62.089 1.00 21.77  ? 61   LYS A C   1 
ATOM   462  O  O   . LYS A 1 59  ? 12.370 61.297 62.453 1.00 27.48  ? 61   LYS A O   1 
ATOM   463  C  CB  . LYS A 1 59  ? 9.313  60.631 61.057 1.00 19.91  ? 61   LYS A CB  1 
ATOM   464  C  CG  . LYS A 1 59  ? 8.615  60.144 59.791 1.00 19.83  ? 61   LYS A CG  1 
ATOM   465  C  CD  . LYS A 1 59  ? 7.349  59.382 60.101 1.00 27.73  ? 61   LYS A CD  1 
ATOM   466  C  CE  . LYS A 1 59  ? 6.453  59.150 58.904 1.00 37.70  ? 61   LYS A CE  1 
ATOM   467  N  NZ  . LYS A 1 59  ? 5.058  58.710 59.217 1.00 64.42  ? 61   LYS A NZ  1 
ATOM   468  N  N   . ASN A 1 60  ? 10.747 62.660 62.879 1.00 23.10  ? 62   ASN A N   1 
ATOM   469  C  CA  . ASN A 1 60  ? 11.268 62.864 64.239 1.00 19.15  ? 62   ASN A CA  1 
ATOM   470  C  C   . ASN A 1 60  ? 12.672 63.506 64.257 1.00 17.15  ? 62   ASN A C   1 
ATOM   471  O  O   . ASN A 1 60  ? 13.408 63.393 65.231 1.00 19.27  ? 62   ASN A O   1 
ATOM   472  C  CB  A ASN A 1 60  ? 11.289 61.546 65.017 0.24 24.50  ? 62   ASN A CB  1 
ATOM   473  C  CB  B ASN A 1 60  ? 11.339 61.577 65.081 0.76 20.01  ? 62   ASN A CB  1 
ATOM   474  C  CG  A ASN A 1 60  ? 9.876  61.122 65.364 0.24 26.40  ? 62   ASN A CG  1 
ATOM   475  C  CG  B ASN A 1 60  ? 11.311 61.964 66.562 0.76 17.08  ? 62   ASN A CG  1 
ATOM   476  O  OD1 A ASN A 1 60  ? 8.996  61.125 64.499 0.24 29.05  ? 62   ASN A OD1 1 
ATOM   477  O  OD1 B ASN A 1 60  ? 10.765 62.975 66.945 0.76 19.26  ? 62   ASN A OD1 1 
ATOM   478  N  ND2 A ASN A 1 60  ? 9.640  60.760 66.620 0.24 41.15  ? 62   ASN A ND2 1 
ATOM   479  N  ND2 B ASN A 1 60  ? 11.893 61.185 67.450 0.76 18.30  ? 62   ASN A ND2 1 
ATOM   480  N  N   . VAL A 1 61  ? 12.993 64.187 63.178 1.00 17.68  ? 63   VAL A N   1 
ATOM   481  C  CA  . VAL A 1 61  ? 14.178 65.039 63.079 1.00 15.81  ? 63   VAL A CA  1 
ATOM   482  C  C   . VAL A 1 61  ? 13.726 66.492 62.884 1.00 15.44  ? 63   VAL A C   1 
ATOM   483  O  O   . VAL A 1 61  ? 12.624 66.764 62.368 1.00 15.71  ? 63   VAL A O   1 
ATOM   484  C  CB  . VAL A 1 61  ? 15.156 64.543 61.998 1.00 14.81  ? 63   VAL A CB  1 
ATOM   485  C  CG1 . VAL A 1 61  ? 15.578 63.088 62.257 1.00 16.08  ? 63   VAL A CG1 1 
ATOM   486  C  CG2 . VAL A 1 61  ? 14.553 64.661 60.626 1.00 13.34  ? 63   VAL A CG2 1 
ATOM   487  N  N   . GLU A 1 62  ? 14.558 67.418 63.341 1.00 13.70  ? 64   GLU A N   1 
ATOM   488  C  CA  . GLU A 1 62  ? 14.152 68.820 63.427 1.00 13.12  ? 64   GLU A CA  1 
ATOM   489  C  C   . GLU A 1 62  ? 13.579 69.418 62.156 1.00 13.68  ? 64   GLU A C   1 
ATOM   490  O  O   . GLU A 1 62  ? 12.510 70.026 62.193 1.00 14.65  ? 64   GLU A O   1 
ATOM   491  C  CB  . GLU A 1 62  ? 15.319 69.658 63.943 1.00 14.06  ? 64   GLU A CB  1 
ATOM   492  C  CG  . GLU A 1 62  ? 14.989 71.089 64.218 1.00 17.50  ? 64   GLU A CG  1 
ATOM   493  C  CD  . GLU A 1 62  ? 16.014 71.846 65.044 1.00 18.75  ? 64   GLU A CD  1 
ATOM   494  O  OE1 . GLU A 1 62  ? 15.865 73.081 65.285 1.00 18.79  ? 64   GLU A OE1 1 
ATOM   495  O  OE2 . GLU A 1 62  ? 17.023 71.252 65.478 1.00 21.13  ? 64   GLU A OE2 1 
ATOM   496  N  N   . PRO A 1 63  ? 14.222 69.321 61.006 1.00 14.38  ? 65   PRO A N   1 
ATOM   497  C  CA  . PRO A 1 63  ? 13.611 69.891 59.807 1.00 14.95  ? 65   PRO A CA  1 
ATOM   498  C  C   . PRO A 1 63  ? 12.293 69.243 59.380 1.00 15.20  ? 65   PRO A C   1 
ATOM   499  O  O   . PRO A 1 63  ? 11.418 69.899 58.790 1.00 14.85  ? 65   PRO A O   1 
ATOM   500  C  CB  . PRO A 1 63  ? 14.689 69.693 58.714 1.00 15.74  ? 65   PRO A CB  1 
ATOM   501  C  CG  . PRO A 1 63  ? 15.692 68.793 59.286 1.00 20.61  ? 65   PRO A CG  1 
ATOM   502  C  CD  . PRO A 1 63  ? 15.572 68.758 60.761 1.00 15.86  ? 65   PRO A CD  1 
ATOM   503  N  N   . TYR A 1 64  ? 12.137 67.939 59.658 1.00 14.61  ? 66   TYR A N   1 
ATOM   504  C  CA  . TYR A 1 64  ? 10.867 67.297 59.329 1.00 14.46  ? 66   TYR A CA  1 
ATOM   505  C  C   . TYR A 1 64  ? 9.734  67.972 60.099 1.00 12.90  ? 66   TYR A C   1 
ATOM   506  O  O   . TYR A 1 64  ? 8.641  68.204 59.554 1.00 13.12  ? 66   TYR A O   1 
ATOM   507  C  CB  . TYR A 1 64  ? 10.903 65.790 59.604 1.00 14.58  ? 66   TYR A CB  1 
ATOM   508  C  CG  . TYR A 1 64  ? 9.727  64.976 59.155 1.00 14.38  ? 66   TYR A CG  1 
ATOM   509  C  CD1 . TYR A 1 64  ? 8.596  64.852 59.948 1.00 17.89  ? 66   TYR A CD1 1 
ATOM   510  C  CD2 . TYR A 1 64  ? 9.684  64.303 57.956 1.00 15.15  ? 66   TYR A CD2 1 
ATOM   511  C  CE1 . TYR A 1 64  ? 7.496  64.097 59.550 1.00 18.42  ? 66   TYR A CE1 1 
ATOM   512  C  CE2 . TYR A 1 64  ? 8.614  63.540 57.514 1.00 16.03  ? 66   TYR A CE2 1 
ATOM   513  C  CZ  . TYR A 1 64  ? 7.496  63.437 58.324 1.00 17.54  ? 66   TYR A CZ  1 
ATOM   514  O  OH  . TYR A 1 64  ? 6.379  62.730 58.036 1.00 19.90  ? 66   TYR A OH  1 
ATOM   515  N  N   . GLU A 1 65  ? 10.018 68.237 61.377 1.00 14.89  ? 67   GLU A N   1 
ATOM   516  C  CA  . GLU A 1 65  ? 9.050  68.838 62.284 1.00 15.81  ? 67   GLU A CA  1 
ATOM   517  C  C   . GLU A 1 65  ? 8.796  70.270 61.840 1.00 15.11  ? 67   GLU A C   1 
ATOM   518  O  O   . GLU A 1 65  ? 7.651  70.674 61.573 1.00 16.74  ? 67   GLU A O   1 
ATOM   519  C  CB  A GLU A 1 65  ? 9.486  68.834 63.753 0.45 14.06  ? 67   GLU A CB  1 
ATOM   520  C  CB  B GLU A 1 65  ? 9.605  68.679 63.722 0.55 17.99  ? 67   GLU A CB  1 
ATOM   521  C  CG  A GLU A 1 65  ? 9.836  67.437 64.204 0.45 16.81  ? 67   GLU A CG  1 
ATOM   522  C  CG  B GLU A 1 65  ? 9.730  67.268 64.243 0.55 17.71  ? 67   GLU A CG  1 
ATOM   523  C  CD  A GLU A 1 65  ? 8.687  66.464 64.312 0.45 16.84  ? 67   GLU A CD  1 
ATOM   524  C  CD  B GLU A 1 65  ? 10.707 66.827 65.311 0.55 19.88  ? 67   GLU A CD  1 
ATOM   525  O  OE1 A GLU A 1 65  ? 8.913  65.433 65.001 0.45 17.90  ? 67   GLU A OE1 1 
ATOM   526  O  OE1 B GLU A 1 65  ? 10.520 65.786 66.080 0.55 19.20  ? 67   GLU A OE1 1 
ATOM   527  O  OE2 A GLU A 1 65  ? 7.523  66.769 64.011 0.45 15.95  ? 67   GLU A OE2 1 
ATOM   528  O  OE2 B GLU A 1 65  ? 11.792 67.463 65.462 0.55 23.75  ? 67   GLU A OE2 1 
ATOM   529  N  N   . GLN A 1 66  ? 9.830  71.078 61.731 1.00 14.37  ? 68   GLN A N   1 
ATOM   530  C  CA  . GLN A 1 66  ? 9.752  72.523 61.511 1.00 15.71  ? 68   GLN A CA  1 
ATOM   531  C  C   . GLN A 1 66  ? 9.326  72.885 60.098 1.00 15.39  ? 68   GLN A C   1 
ATOM   532  O  O   . GLN A 1 66  ? 8.687  73.933 59.930 1.00 16.34  ? 68   GLN A O   1 
ATOM   533  C  CB  . GLN A 1 66  ? 11.067 73.207 61.865 1.00 13.77  ? 68   GLN A CB  1 
ATOM   534  C  CG  . GLN A 1 66  ? 11.404 73.073 63.351 1.00 15.69  ? 68   GLN A CG  1 
ATOM   535  C  CD  . GLN A 1 66  ? 12.705 73.732 63.720 1.00 14.30  ? 68   GLN A CD  1 
ATOM   536  O  OE1 . GLN A 1 66  ? 13.481 74.085 62.833 1.00 16.73  ? 68   GLN A OE1 1 
ATOM   537  N  NE2 . GLN A 1 66  ? 12.950 73.935 65.016 1.00 19.81  ? 68   GLN A NE2 1 
ATOM   538  N  N   . LEU A 1 67  ? 9.641  72.059 59.130 1.00 15.59  ? 69   LEU A N   1 
ATOM   539  C  CA  . LEU A 1 67  ? 9.183  72.337 57.771 1.00 15.39  ? 69   LEU A CA  1 
ATOM   540  C  C   . LEU A 1 67  ? 7.806  71.744 57.477 1.00 16.83  ? 69   LEU A C   1 
ATOM   541  O  O   . LEU A 1 67  ? 7.256  71.883 56.402 1.00 17.83  ? 69   LEU A O   1 
ATOM   542  C  CB  . LEU A 1 67  ? 10.186 71.786 56.763 1.00 16.07  ? 69   LEU A CB  1 
ATOM   543  C  CG  . LEU A 1 67  ? 11.554 72.432 56.756 1.00 16.25  ? 69   LEU A CG  1 
ATOM   544  C  CD1 . LEU A 1 67  ? 12.549 71.562 55.987 1.00 17.14  ? 69   LEU A CD1 1 
ATOM   545  C  CD2 . LEU A 1 67  ? 11.467 73.853 56.216 1.00 18.11  ? 69   LEU A CD2 1 
ATOM   546  N  N   . GLY A 1 68  ? 7.241  71.036 58.439 1.00 15.29  ? 70   GLY A N   1 
ATOM   547  C  CA  . GLY A 1 68  ? 5.887  70.533 58.339 1.00 17.16  ? 70   GLY A CA  1 
ATOM   548  C  C   . GLY A 1 68  ? 5.655  69.433 57.323 1.00 15.03  ? 70   GLY A C   1 
ATOM   549  O  O   . GLY A 1 68  ? 4.612  69.288 56.720 1.00 16.35  ? 70   GLY A O   1 
ATOM   550  N  N   . LEU A 1 69  ? 6.705  68.623 57.160 1.00 14.92  ? 71   LEU A N   1 
ATOM   551  C  CA  . LEU A 1 69  ? 6.751  67.654 56.091 1.00 15.94  ? 71   LEU A CA  1 
ATOM   552  C  C   . LEU A 1 69  ? 5.765  66.493 56.273 1.00 16.04  ? 71   LEU A C   1 
ATOM   553  O  O   . LEU A 1 69  ? 5.497  65.745 55.320 1.00 16.58  ? 71   LEU A O   1 
ATOM   554  C  CB  . LEU A 1 69  ? 8.164  67.133 55.890 1.00 16.02  ? 71   LEU A CB  1 
ATOM   555  C  CG  . LEU A 1 69  ? 9.244  68.172 55.534 1.00 16.05  ? 71   LEU A CG  1 
ATOM   556  C  CD1 . LEU A 1 69  ? 10.559 67.491 55.174 1.00 17.79  ? 71   LEU A CD1 1 
ATOM   557  C  CD2 . LEU A 1 69  ? 8.821  69.074 54.379 1.00 15.31  ? 71   LEU A CD2 1 
ATOM   558  N  N   . ALA A 1 70  ? 5.224  66.330 57.491 1.00 14.63  ? 72   ALA A N   1 
ATOM   559  C  CA  . ALA A 1 70  ? 4.191  65.311 57.672 1.00 15.60  ? 72   ALA A CA  1 
ATOM   560  C  C   . ALA A 1 70  ? 2.965  65.585 56.815 1.00 14.94  ? 72   ALA A C   1 
ATOM   561  O  O   . ALA A 1 70  ? 2.260  64.646 56.447 1.00 18.97  ? 72   ALA A O   1 
ATOM   562  C  CB  . ALA A 1 70  ? 3.710  65.189 59.119 1.00 18.09  ? 72   ALA A CB  1 
ATOM   563  N  N   . GLU A 1 71  ? 2.715  66.861 56.521 1.00 17.30  ? 73   GLU A N   1 
ATOM   564  C  CA  . GLU A 1 71  ? 1.550  67.251 55.759 1.00 15.74  ? 73   GLU A CA  1 
ATOM   565  C  C   . GLU A 1 71  ? 1.757  66.990 54.261 1.00 15.40  ? 73   GLU A C   1 
ATOM   566  O  O   . GLU A 1 71  ? 2.839  67.165 53.723 1.00 16.48  ? 73   GLU A O   1 
ATOM   567  C  CB  . GLU A 1 71  ? 1.297  68.739 55.956 1.00 19.36  ? 73   GLU A CB  1 
ATOM   568  C  CG  . GLU A 1 71  ? 0.931  69.185 57.366 1.00 29.35  ? 73   GLU A CG  1 
ATOM   569  C  CD  . GLU A 1 71  ? 0.326  70.594 57.189 1.00 40.25  ? 73   GLU A CD  1 
ATOM   570  O  OE1 . GLU A 1 71  ? 0.998  71.614 57.213 1.00 45.11  ? 73   GLU A OE1 1 
ATOM   571  O  OE2 . GLU A 1 71  ? -0.887 70.587 56.941 1.00 63.01  ? 73   GLU A OE2 1 
ATOM   572  N  N   . ASP A 1 72  ? 0.692  66.552 53.614 1.00 18.59  ? 74   ASP A N   1 
ATOM   573  C  CA  . ASP A 1 72  ? 0.738  66.222 52.207 1.00 18.35  ? 74   ASP A CA  1 
ATOM   574  C  C   . ASP A 1 72  ? 0.578  67.464 51.328 1.00 18.11  ? 74   ASP A C   1 
ATOM   575  O  O   . ASP A 1 72  ? -0.482 67.577 50.716 1.00 21.40  ? 74   ASP A O   1 
ATOM   576  C  CB  . ASP A 1 72  ? -0.358 65.240 51.817 1.00 19.16  ? 74   ASP A CB  1 
ATOM   577  C  CG  . ASP A 1 72  ? -0.227 64.702 50.423 1.00 21.27  ? 74   ASP A CG  1 
ATOM   578  O  OD1 . ASP A 1 72  ? -1.227 64.091 49.988 1.00 29.56  ? 74   ASP A OD1 1 
ATOM   579  O  OD2 . ASP A 1 72  ? 0.826  64.837 49.768 1.00 24.50  ? 74   ASP A OD2 1 
ATOM   580  N  N   . LYS A 1 73  ? 1.618  68.273 51.343 1.00 16.85  ? 75   LYS A N   1 
ATOM   581  C  CA  . LYS A 1 73  ? 1.619  69.583 50.702 1.00 17.55  ? 75   LYS A CA  1 
ATOM   582  C  C   . LYS A 1 73  ? 2.890  69.793 49.853 1.00 17.11  ? 75   LYS A C   1 
ATOM   583  O  O   . LYS A 1 73  ? 3.216  70.941 49.494 1.00 16.33  ? 75   LYS A O   1 
ATOM   584  C  CB  A LYS A 1 73  ? 1.466  70.702 51.749 0.45 23.35  ? 75   LYS A CB  1 
ATOM   585  C  CB  B LYS A 1 73  ? 1.553  70.718 51.731 0.55 23.11  ? 75   LYS A CB  1 
ATOM   586  C  CG  A LYS A 1 73  ? 0.135  70.799 52.463 0.45 26.32  ? 75   LYS A CG  1 
ATOM   587  C  CG  B LYS A 1 73  ? 0.299  70.889 52.546 0.55 26.24  ? 75   LYS A CG  1 
ATOM   588  C  CD  A LYS A 1 73  ? 0.040  71.810 53.594 0.45 28.03  ? 75   LYS A CD  1 
ATOM   589  C  CD  B LYS A 1 73  ? 0.494  71.782 53.762 0.55 30.65  ? 75   LYS A CD  1 
ATOM   590  C  CE  A LYS A 1 73  ? -1.243 71.676 54.391 0.45 25.15  ? 75   LYS A CE  1 
ATOM   591  C  CE  B LYS A 1 73  ? 1.133  73.104 53.376 0.55 35.30  ? 75   LYS A CE  1 
ATOM   592  N  NZ  A LYS A 1 73  ? -1.547 72.776 55.360 0.45 24.98  ? 75   LYS A NZ  1 
ATOM   593  N  NZ  B LYS A 1 73  ? 0.624  74.234 54.241 0.55 28.63  ? 75   LYS A NZ  1 
ATOM   594  N  N   . PHE A 1 74  ? 3.604  68.705 49.552 1.00 15.17  ? 76   PHE A N   1 
ATOM   595  C  CA  . PHE A 1 74  ? 4.913  68.755 48.941 1.00 15.31  ? 76   PHE A CA  1 
ATOM   596  C  C   . PHE A 1 74  ? 5.020  67.831 47.749 1.00 14.41  ? 76   PHE A C   1 
ATOM   597  O  O   . PHE A 1 74  ? 4.686  66.660 47.850 1.00 16.39  ? 76   PHE A O   1 
ATOM   598  C  CB  . PHE A 1 74  ? 6.013  68.390 49.962 1.00 14.97  ? 76   PHE A CB  1 
ATOM   599  C  CG  . PHE A 1 74  ? 5.910  69.287 51.184 1.00 13.65  ? 76   PHE A CG  1 
ATOM   600  C  CD1 . PHE A 1 74  ? 5.226  68.798 52.291 1.00 13.27  ? 76   PHE A CD1 1 
ATOM   601  C  CD2 . PHE A 1 74  ? 6.453  70.553 51.179 1.00 15.15  ? 76   PHE A CD2 1 
ATOM   602  C  CE1 . PHE A 1 74  ? 5.079  69.594 53.409 1.00 15.46  ? 76   PHE A CE1 1 
ATOM   603  C  CE2 . PHE A 1 74  ? 6.352  71.359 52.288 1.00 15.38  ? 76   PHE A CE2 1 
ATOM   604  C  CZ  . PHE A 1 74  ? 5.653  70.846 53.376 1.00 14.92  ? 76   PHE A CZ  1 
ATOM   605  N  N   . THR A 1 75  ? 5.518  68.339 46.620 1.00 14.93  ? 77   THR A N   1 
ATOM   606  C  CA  . THR A 1 75  ? 5.776  67.462 45.505 1.00 15.09  ? 77   THR A CA  1 
ATOM   607  C  C   . THR A 1 75  ? 7.041  66.661 45.805 1.00 15.57  ? 77   THR A C   1 
ATOM   608  O  O   . THR A 1 75  ? 7.850  66.953 46.698 1.00 14.89  ? 77   THR A O   1 
ATOM   609  C  CB  . THR A 1 75  ? 5.989  68.191 44.193 1.00 14.77  ? 77   THR A CB  1 
ATOM   610  O  OG1 . THR A 1 75  ? 7.116  69.039 44.354 1.00 15.65  ? 77   THR A OG1 1 
ATOM   611  C  CG2 . THR A 1 75  ? 4.935  69.225 43.871 1.00 16.67  ? 77   THR A CG2 1 
ATOM   612  N  N   . ASP A 1 76  ? 7.205  65.613 45.002 1.00 16.46  ? 78   ASP A N   1 
ATOM   613  C  CA  . ASP A 1 76  ? 8.416  64.806 45.163 1.00 14.87  ? 78   ASP A CA  1 
ATOM   614  C  C   . ASP A 1 76  ? 9.689  65.644 45.041 1.00 14.82  ? 78   ASP A C   1 
ATOM   615  O  O   . ASP A 1 76  ? 10.657 65.460 45.781 1.00 15.22  ? 78   ASP A O   1 
ATOM   616  C  CB  . ASP A 1 76  ? 8.433  63.644 44.144 1.00 15.46  ? 78   ASP A CB  1 
ATOM   617  C  CG  . ASP A 1 76  ? 7.528  62.491 44.514 1.00 16.88  ? 78   ASP A CG  1 
ATOM   618  O  OD1 . ASP A 1 76  ? 7.413  61.550 43.680 1.00 21.35  ? 78   ASP A OD1 1 
ATOM   619  O  OD2 . ASP A 1 76  ? 6.934  62.520 45.611 1.00 18.96  ? 78   ASP A OD2 1 
ATOM   620  N  N   . ASP A 1 77  ? 9.725  66.538 44.034 1.00 15.23  ? 79   ASP A N   1 
ATOM   621  C  CA  . ASP A 1 77  ? 10.972 67.305 43.861 1.00 14.65  ? 79   ASP A CA  1 
ATOM   622  C  C   . ASP A 1 77  ? 11.192 68.250 45.001 1.00 14.33  ? 79   ASP A C   1 
ATOM   623  O  O   . ASP A 1 77  ? 12.313 68.566 45.368 1.00 16.47  ? 79   ASP A O   1 
ATOM   624  C  CB  . ASP A 1 77  ? 10.990 67.980 42.487 1.00 15.09  ? 79   ASP A CB  1 
ATOM   625  C  CG  . ASP A 1 77  ? 11.386 66.940 41.455 1.00 17.16  ? 79   ASP A CG  1 
ATOM   626  O  OD1 . ASP A 1 77  ? 10.476 66.444 40.742 1.00 18.16  ? 79   ASP A OD1 1 
ATOM   627  O  OD2 . ASP A 1 77  ? 12.590 66.608 41.397 1.00 18.97  ? 79   ASP A OD2 1 
ATOM   628  N  N   . GLN A 1 78  ? 10.259 68.854 45.682 1.00 15.40  ? 80   GLN A N   1 
ATOM   629  C  CA  . GLN A 1 78  ? 10.269 69.696 46.854 1.00 13.62  ? 80   GLN A CA  1 
ATOM   630  C  C   . GLN A 1 78  ? 10.929 68.839 47.935 1.00 12.92  ? 80   GLN A C   1 
ATOM   631  O  O   . GLN A 1 78  ? 11.874 69.334 48.558 1.00 15.69  ? 80   GLN A O   1 
ATOM   632  C  CB  . GLN A 1 78  ? 8.921  70.258 47.266 1.00 13.96  ? 80   GLN A CB  1 
ATOM   633  C  CG  . GLN A 1 78  ? 8.455  71.361 46.353 1.00 13.80  ? 80   GLN A CG  1 
ATOM   634  C  CD  . GLN A 1 78  ? 7.071  71.881 46.610 1.00 12.20  ? 80   GLN A CD  1 
ATOM   635  O  OE1 . GLN A 1 78  ? 6.188  71.126 47.036 1.00 14.19  ? 80   GLN A OE1 1 
ATOM   636  N  NE2 . GLN A 1 78  ? 6.826  73.167 46.341 1.00 12.91  ? 80   GLN A NE2 1 
ATOM   637  N  N   . LEU A 1 79  ? 10.478 67.618 48.070 1.00 14.36  ? 81   LEU A N   1 
ATOM   638  C  CA  . LEU A 1 79  ? 11.045 66.716 49.102 1.00 13.30  ? 81   LEU A CA  1 
ATOM   639  C  C   . LEU A 1 79  ? 12.469 66.352 48.791 1.00 12.87  ? 81   LEU A C   1 
ATOM   640  O  O   . LEU A 1 79  ? 13.306 66.374 49.697 1.00 14.71  ? 81   LEU A O   1 
ATOM   641  C  CB  . LEU A 1 79  ? 10.152 65.500 49.276 1.00 14.79  ? 81   LEU A CB  1 
ATOM   642  C  CG  . LEU A 1 79  ? 8.733  65.753 49.797 1.00 13.85  ? 81   LEU A CG  1 
ATOM   643  C  CD1 . LEU A 1 79  ? 7.986  64.419 49.872 1.00 16.61  ? 81   LEU A CD1 1 
ATOM   644  C  CD2 . LEU A 1 79  ? 8.792  66.458 51.134 1.00 15.60  ? 81   LEU A CD2 1 
ATOM   645  N  N   . ILE A 1 80  ? 12.767 66.064 47.546 1.00 14.66  ? 82   ILE A N   1 
ATOM   646  C  CA  . ILE A 1 80  ? 14.181 65.819 47.203 1.00 14.62  ? 82   ILE A CA  1 
ATOM   647  C  C   . ILE A 1 80  ? 15.057 66.980 47.575 1.00 13.97  ? 82   ILE A C   1 
ATOM   648  O  O   . ILE A 1 80  ? 16.123 66.858 48.178 1.00 14.81  ? 82   ILE A O   1 
ATOM   649  C  CB  . ILE A 1 80  ? 14.311 65.480 45.691 1.00 15.23  ? 82   ILE A CB  1 
ATOM   650  C  CG1 . ILE A 1 80  ? 13.664 64.128 45.412 1.00 17.05  ? 82   ILE A CG1 1 
ATOM   651  C  CG2 . ILE A 1 80  ? 15.761 65.573 45.216 1.00 15.48  ? 82   ILE A CG2 1 
ATOM   652  C  CD1 . ILE A 1 80  ? 13.421 63.777 43.986 1.00 21.07  ? 82   ILE A CD1 1 
ATOM   653  N  N   . ASP A 1 81  ? 14.655 68.204 47.228 1.00 14.59  ? 83   ASP A N   1 
ATOM   654  C  CA  . ASP A 1 81  ? 15.473 69.360 47.528 1.00 13.60  ? 83   ASP A CA  1 
ATOM   655  C  C   . ASP A 1 81  ? 15.545 69.580 49.041 1.00 13.67  ? 83   ASP A C   1 
ATOM   656  O  O   . ASP A 1 81  ? 16.602 70.020 49.534 1.00 14.27  ? 83   ASP A O   1 
ATOM   657  C  CB  . ASP A 1 81  ? 14.932 70.580 46.744 1.00 15.11  ? 83   ASP A CB  1 
ATOM   658  C  CG  . ASP A 1 81  ? 15.332 70.408 45.260 1.00 16.70  ? 83   ASP A CG  1 
ATOM   659  O  OD1 . ASP A 1 81  ? 14.478 70.472 44.378 1.00 17.05  ? 83   ASP A OD1 1 
ATOM   660  O  OD2 . ASP A 1 81  ? 16.548 70.168 45.032 1.00 18.39  ? 83   ASP A OD2 1 
ATOM   661  N  N   . PHE A 1 82  ? 14.507 69.300 49.830 1.00 13.81  ? 84   PHE A N   1 
ATOM   662  C  CA  . PHE A 1 82  ? 14.690 69.409 51.273 1.00 14.19  ? 84   PHE A CA  1 
ATOM   663  C  C   . PHE A 1 82  ? 15.722 68.408 51.779 1.00 13.67  ? 84   PHE A C   1 
ATOM   664  O  O   . PHE A 1 82  ? 16.512 68.768 52.650 1.00 14.67  ? 84   PHE A O   1 
ATOM   665  C  CB  . PHE A 1 82  ? 13.348 69.189 51.953 1.00 13.60  ? 84   PHE A CB  1 
ATOM   666  C  CG  . PHE A 1 82  ? 12.418 70.389 51.940 1.00 13.70  ? 84   PHE A CG  1 
ATOM   667  C  CD1 . PHE A 1 82  ? 12.849 71.641 52.341 1.00 14.90  ? 84   PHE A CD1 1 
ATOM   668  C  CD2 . PHE A 1 82  ? 11.104 70.271 51.550 1.00 15.16  ? 84   PHE A CD2 1 
ATOM   669  C  CE1 . PHE A 1 82  ? 11.986 72.728 52.339 1.00 15.63  ? 84   PHE A CE1 1 
ATOM   670  C  CE2 . PHE A 1 82  ? 10.228 71.363 51.533 1.00 15.38  ? 84   PHE A CE2 1 
ATOM   671  C  CZ  . PHE A 1 82  ? 10.658 72.601 51.937 1.00 15.04  ? 84   PHE A CZ  1 
ATOM   672  N  N   . MET A 1 83  ? 15.698 67.177 51.245 1.00 14.41  ? 85   MET A N   1 
ATOM   673  C  CA  . MET A 1 83  ? 16.694 66.202 51.671 1.00 14.22  ? 85   MET A CA  1 
ATOM   674  C  C   . MET A 1 83  ? 18.098 66.679 51.354 1.00 15.69  ? 85   MET A C   1 
ATOM   675  O  O   . MET A 1 83  ? 19.013 66.514 52.162 1.00 16.89  ? 85   MET A O   1 
ATOM   676  C  CB  A MET A 1 83  ? 16.505 64.859 50.982 0.40 16.57  ? 85   MET A CB  1 
ATOM   677  C  CB  B MET A 1 83  ? 16.431 64.795 51.103 0.60 16.11  ? 85   MET A CB  1 
ATOM   678  C  CG  A MET A 1 83  ? 15.223 64.152 51.426 0.40 15.31  ? 85   MET A CG  1 
ATOM   679  C  CG  B MET A 1 83  ? 15.412 64.024 51.930 0.60 16.94  ? 85   MET A CG  1 
ATOM   680  S  SD  A MET A 1 83  ? 15.150 62.567 50.564 0.40 17.67  ? 85   MET A SD  1 
ATOM   681  S  SD  B MET A 1 83  ? 14.917 62.367 51.439 0.60 18.88  ? 85   MET A SD  1 
ATOM   682  C  CE  A MET A 1 83  ? 13.392 62.318 50.409 0.40 21.65  ? 85   MET A CE  1 
ATOM   683  C  CE  B MET A 1 83  ? 14.415 62.684 49.758 0.60 14.14  ? 85   MET A CE  1 
ATOM   684  N  N   . LEU A 1 84  ? 18.299 67.277 50.185 1.00 16.73  ? 86   LEU A N   1 
ATOM   685  C  CA  . LEU A 1 84  ? 19.644 67.766 49.843 1.00 15.31  ? 86   LEU A CA  1 
ATOM   686  C  C   . LEU A 1 84  ? 20.124 68.888 50.735 1.00 16.54  ? 86   LEU A C   1 
ATOM   687  O  O   . LEU A 1 84  ? 21.314 68.989 51.053 1.00 18.20  ? 86   LEU A O   1 
ATOM   688  C  CB  . LEU A 1 84  ? 19.662 68.258 48.397 1.00 17.21  ? 86   LEU A CB  1 
ATOM   689  C  CG  . LEU A 1 84  ? 19.521 67.148 47.371 1.00 20.13  ? 86   LEU A CG  1 
ATOM   690  C  CD1 . LEU A 1 84  ? 19.270 67.771 46.002 1.00 27.35  ? 86   LEU A CD1 1 
ATOM   691  C  CD2 . LEU A 1 84  ? 20.738 66.264 47.330 1.00 22.11  ? 86   LEU A CD2 1 
ATOM   692  N  N   . GLN A 1 85  ? 19.193 69.753 51.132 1.00 15.17  ? 87   GLN A N   1 
ATOM   693  C  CA  . GLN A 1 85  ? 19.532 70.930 51.927 1.00 14.28  ? 87   GLN A CA  1 
ATOM   694  C  C   . GLN A 1 85  ? 19.623 70.584 53.415 1.00 14.34  ? 87   GLN A C   1 
ATOM   695  O  O   . GLN A 1 85  ? 20.219 71.337 54.192 1.00 17.71  ? 87   GLN A O   1 
ATOM   696  C  CB  . GLN A 1 85  ? 18.525 72.064 51.685 1.00 16.30  ? 87   GLN A CB  1 
ATOM   697  C  CG  . GLN A 1 85  ? 18.541 72.563 50.244 1.00 17.30  ? 87   GLN A CG  1 
ATOM   698  C  CD  . GLN A 1 85  ? 19.910 72.996 49.771 1.00 25.05  ? 87   GLN A CD  1 
ATOM   699  O  OE1 . GLN A 1 85  ? 20.405 72.642 48.691 1.00 32.59  ? 87   GLN A OE1 1 
ATOM   700  N  NE2 . GLN A 1 85  ? 20.525 73.822 50.592 1.00 35.18  ? 87   GLN A NE2 1 
ATOM   701  N  N   . HIS A 1 86  ? 18.992 69.481 53.808 1.00 13.93  ? 88   HIS A N   1 
ATOM   702  C  CA  . HIS A 1 86  ? 18.905 69.042 55.202 1.00 14.47  ? 88   HIS A CA  1 
ATOM   703  C  C   . HIS A 1 86  ? 19.081 67.522 55.244 1.00 13.78  ? 88   HIS A C   1 
ATOM   704  O  O   . HIS A 1 86  ? 18.086 66.794 55.394 1.00 14.42  ? 88   HIS A O   1 
ATOM   705  C  CB  . HIS A 1 86  ? 17.580 69.431 55.850 1.00 15.28  ? 88   HIS A CB  1 
ATOM   706  C  CG  . HIS A 1 86  ? 17.183 70.852 55.577 1.00 16.36  ? 88   HIS A CG  1 
ATOM   707  N  ND1 . HIS A 1 86  ? 17.552 71.912 56.328 1.00 23.14  ? 88   HIS A ND1 1 
ATOM   708  C  CD2 . HIS A 1 86  ? 16.478 71.366 54.540 1.00 15.44  ? 88   HIS A CD2 1 
ATOM   709  C  CE1 . HIS A 1 86  ? 17.069 73.042 55.827 1.00 24.06  ? 88   HIS A CE1 1 
ATOM   710  N  NE2 . HIS A 1 86  ? 16.402 72.714 54.708 1.00 18.75  ? 88   HIS A NE2 1 
ATOM   711  N  N   . PRO A 1 87  ? 20.322 67.076 55.047 1.00 14.16  ? 89   PRO A N   1 
ATOM   712  C  CA  . PRO A 1 87  ? 20.573 65.641 54.921 1.00 15.22  ? 89   PRO A CA  1 
ATOM   713  C  C   . PRO A 1 87  ? 20.106 64.752 56.057 1.00 13.65  ? 89   PRO A C   1 
ATOM   714  O  O   . PRO A 1 87  ? 19.934 63.517 55.844 1.00 15.37  ? 89   PRO A O   1 
ATOM   715  C  CB  . PRO A 1 87  ? 22.114 65.563 54.776 1.00 18.14  ? 89   PRO A CB  1 
ATOM   716  C  CG  . PRO A 1 87  ? 22.559 66.899 54.325 1.00 18.57  ? 89   PRO A CG  1 
ATOM   717  C  CD  . PRO A 1 87  ? 21.537 67.897 54.845 1.00 15.85  ? 89   PRO A CD  1 
ATOM   718  N  N   . ILE A 1 88  ? 19.885 65.302 57.250 1.00 14.36  ? 90   ILE A N   1 
ATOM   719  C  CA  . ILE A 1 88  ? 19.334 64.498 58.340 1.00 15.02  ? 90   ILE A CA  1 
ATOM   720  C  C   . ILE A 1 88  ? 17.955 63.959 57.973 1.00 13.92  ? 90   ILE A C   1 
ATOM   721  O  O   . ILE A 1 88  ? 17.483 62.971 58.539 1.00 15.10  ? 90   ILE A O   1 
ATOM   722  C  CB  . ILE A 1 88  ? 19.312 65.315 59.648 1.00 14.25  ? 90   ILE A CB  1 
ATOM   723  C  CG1 . ILE A 1 88  ? 19.029 64.438 60.893 1.00 20.38  ? 90   ILE A CG1 1 
ATOM   724  C  CG2 . ILE A 1 88  ? 18.360 66.485 59.568 1.00 16.71  ? 90   ILE A CG2 1 
ATOM   725  C  CD1 . ILE A 1 88  ? 19.199 65.097 62.233 1.00 28.28  ? 90   ILE A CD1 1 
ATOM   726  N  N   . LEU A 1 89  ? 17.268 64.565 57.001 1.00 14.88  ? 91   LEU A N   1 
ATOM   727  C  CA  . LEU A 1 89  ? 16.012 64.058 56.478 1.00 14.67  ? 91   LEU A CA  1 
ATOM   728  C  C   . LEU A 1 89  ? 16.130 62.756 55.697 1.00 13.94  ? 91   LEU A C   1 
ATOM   729  O  O   . LEU A 1 89  ? 15.105 62.092 55.490 1.00 15.64  ? 91   LEU A O   1 
ATOM   730  C  CB  . LEU A 1 89  ? 15.338 65.071 55.533 1.00 14.66  ? 91   LEU A CB  1 
ATOM   731  C  CG  . LEU A 1 89  ? 14.756 66.312 56.160 1.00 14.45  ? 91   LEU A CG  1 
ATOM   732  C  CD1 . LEU A 1 89  ? 14.358 67.318 55.107 1.00 17.21  ? 91   LEU A CD1 1 
ATOM   733  C  CD2 . LEU A 1 89  ? 13.570 65.909 57.071 1.00 15.38  ? 91   LEU A CD2 1 
ATOM   734  N  N   . ILE A 1 90  ? 17.292 62.356 55.229 1.00 14.72  ? 92   ILE A N   1 
ATOM   735  C  CA  . ILE A 1 90  ? 17.473 61.131 54.479 1.00 14.87  ? 92   ILE A CA  1 
ATOM   736  C  C   . ILE A 1 90  ? 17.496 59.950 55.454 1.00 14.60  ? 92   ILE A C   1 
ATOM   737  O  O   . ILE A 1 90  ? 18.403 59.849 56.301 1.00 15.22  ? 92   ILE A O   1 
ATOM   738  C  CB  . ILE A 1 90  ? 18.765 61.185 53.634 1.00 14.95  ? 92   ILE A CB  1 
ATOM   739  C  CG1 . ILE A 1 90  ? 18.830 62.392 52.713 1.00 17.88  ? 92   ILE A CG1 1 
ATOM   740  C  CG2 . ILE A 1 90  ? 18.954 59.876 52.865 1.00 16.34  ? 92   ILE A CG2 1 
ATOM   741  C  CD1 . ILE A 1 90  ? 20.134 62.646 52.020 1.00 18.12  ? 92   ILE A CD1 1 
ATOM   742  N  N   . ASN A 1 91  ? 16.483 59.072 55.378 1.00 17.39  ? 93   ASN A N   1 
ATOM   743  C  CA  . ASN A 1 91  ? 16.472 57.943 56.319 1.00 14.79  ? 93   ASN A CA  1 
ATOM   744  C  C   . ASN A 1 91  ? 17.638 56.984 56.027 1.00 15.31  ? 93   ASN A C   1 
ATOM   745  O  O   . ASN A 1 91  ? 18.232 57.106 54.959 1.00 16.30  ? 93   ASN A O   1 
ATOM   746  C  CB  . ASN A 1 91  ? 15.146 57.231 56.332 1.00 15.73  ? 93   ASN A CB  1 
ATOM   747  C  CG  . ASN A 1 91  ? 14.813 56.658 57.696 1.00 16.86  ? 93   ASN A CG  1 
ATOM   748  O  OD1 . ASN A 1 91  ? 15.659 56.586 58.585 1.00 17.73  ? 93   ASN A OD1 1 
ATOM   749  N  ND2 . ASN A 1 91  ? 13.549 56.261 57.877 1.00 18.78  ? 93   ASN A ND2 1 
ATOM   750  N  N   . ARG A 1 92  ? 17.919 56.124 56.993 1.00 15.13  ? 94   ARG A N   1 
ATOM   751  C  CA  . ARG A 1 92  ? 19.207 55.438 56.988 1.00 15.42  ? 94   ARG A CA  1 
ATOM   752  C  C   . ARG A 1 92  ? 19.125 53.978 57.357 1.00 14.30  ? 94   ARG A C   1 
ATOM   753  O  O   . ARG A 1 92  ? 18.219 53.635 58.142 1.00 16.06  ? 94   ARG A O   1 
ATOM   754  C  CB  . ARG A 1 92  ? 20.145 56.161 57.983 1.00 16.51  ? 94   ARG A CB  1 
ATOM   755  C  CG  . ARG A 1 92  ? 19.627 56.155 59.401 1.00 16.40  ? 94   ARG A CG  1 
ATOM   756  C  CD  . ARG A 1 92  ? 18.830 57.404 59.753 1.00 18.61  ? 94   ARG A CD  1 
ATOM   757  N  NE  . ARG A 1 92  ? 18.244 57.342 61.095 1.00 18.40  ? 94   ARG A NE  1 
ATOM   758  C  CZ  . ARG A 1 92  ? 17.911 58.354 61.868 1.00 18.61  ? 94   ARG A CZ  1 
ATOM   759  N  NH1 . ARG A 1 92  ? 18.093 59.609 61.434 1.00 21.91  ? 94   ARG A NH1 1 
ATOM   760  N  NH2 . ARG A 1 92  ? 17.393 58.120 63.098 1.00 24.02  ? 94   ARG A NH2 1 
ATOM   761  N  N   . PRO A 1 93  ? 20.077 53.146 56.902 1.00 13.10  ? 95   PRO A N   1 
ATOM   762  C  CA  . PRO A 1 93  ? 21.047 53.426 55.881 1.00 12.82  ? 95   PRO A CA  1 
ATOM   763  C  C   . PRO A 1 93  ? 20.585 53.030 54.483 1.00 12.67  ? 95   PRO A C   1 
ATOM   764  O  O   . PRO A 1 93  ? 19.812 52.076 54.320 1.00 15.85  ? 95   PRO A O   1 
ATOM   765  C  CB  . PRO A 1 93  ? 22.180 52.460 56.255 1.00 14.59  ? 95   PRO A CB  1 
ATOM   766  C  CG  . PRO A 1 93  ? 21.463 51.250 56.792 1.00 14.77  ? 95   PRO A CG  1 
ATOM   767  C  CD  . PRO A 1 93  ? 20.229 51.768 57.453 1.00 13.80  ? 95   PRO A CD  1 
ATOM   768  N  N   . ILE A 1 94  ? 21.116 53.760 53.490 1.00 14.70  ? 96   ILE A N   1 
ATOM   769  C  CA  . ILE A 1 94  ? 20.999 53.329 52.118 1.00 13.62  ? 96   ILE A CA  1 
ATOM   770  C  C   . ILE A 1 94  ? 22.241 52.540 51.738 1.00 14.48  ? 96   ILE A C   1 
ATOM   771  O  O   . ILE A 1 94  ? 23.352 53.012 51.996 1.00 14.04  ? 96   ILE A O   1 
ATOM   772  C  CB  . ILE A 1 94  ? 20.841 54.535 51.180 1.00 13.09  ? 96   ILE A CB  1 
ATOM   773  C  CG1 . ILE A 1 94  ? 19.622 55.398 51.495 1.00 15.16  ? 96   ILE A CG1 1 
ATOM   774  C  CG2 . ILE A 1 94  ? 20.884 54.075 49.693 1.00 15.70  ? 96   ILE A CG2 1 
ATOM   775  C  CD1 . ILE A 1 94  ? 19.581 56.773 50.909 1.00 15.27  ? 96   ILE A CD1 1 
ATOM   776  N  N   . VAL A 1 95  ? 22.012 51.388 51.140 1.00 14.51  ? 97   VAL A N   1 
ATOM   777  C  CA  . VAL A 1 95  ? 23.129 50.544 50.712 1.00 13.60  ? 97   VAL A CA  1 
ATOM   778  C  C   . VAL A 1 95  ? 23.009 50.252 49.220 1.00 15.24  ? 97   VAL A C   1 
ATOM   779  O  O   . VAL A 1 95  ? 21.928 49.895 48.738 1.00 15.74  ? 97   VAL A O   1 
ATOM   780  C  CB  . VAL A 1 95  ? 23.161 49.209 51.483 1.00 13.99  ? 97   VAL A CB  1 
ATOM   781  C  CG1 . VAL A 1 95  ? 24.289 48.300 50.990 1.00 15.07  ? 97   VAL A CG1 1 
ATOM   782  C  CG2 . VAL A 1 95  ? 23.281 49.502 52.970 1.00 15.33  ? 97   VAL A CG2 1 
ATOM   783  N  N   . VAL A 1 96  ? 24.138 50.392 48.540 1.00 15.09  ? 98   VAL A N   1 
ATOM   784  C  CA  . VAL A 1 96  ? 24.300 50.058 47.133 1.00 14.54  ? 98   VAL A CA  1 
ATOM   785  C  C   . VAL A 1 96  ? 25.291 48.905 46.988 1.00 14.86  ? 98   VAL A C   1 
ATOM   786  O  O   . VAL A 1 96  ? 26.416 48.979 47.478 1.00 15.96  ? 98   VAL A O   1 
ATOM   787  C  CB  . VAL A 1 96  ? 24.800 51.266 46.312 1.00 15.06  ? 98   VAL A CB  1 
ATOM   788  C  CG1 . VAL A 1 96  ? 24.838 50.972 44.814 1.00 20.11  ? 98   VAL A CG1 1 
ATOM   789  C  CG2 . VAL A 1 96  ? 23.980 52.495 46.640 1.00 18.13  ? 98   VAL A CG2 1 
ATOM   790  N  N   . THR A 1 97  ? 24.876 47.856 46.283 1.00 15.88  ? 99   THR A N   1 
ATOM   791  C  CA  . THR A 1 97  ? 25.769 46.771 45.862 1.00 15.62  ? 99   THR A CA  1 
ATOM   792  C  C   . THR A 1 97  ? 25.606 46.490 44.373 1.00 16.22  ? 99   THR A C   1 
ATOM   793  O  O   . THR A 1 97  ? 24.704 47.068 43.729 1.00 17.11  ? 99   THR A O   1 
ATOM   794  C  CB  . THR A 1 97  ? 25.511 45.498 46.651 1.00 15.49  ? 99   THR A CB  1 
ATOM   795  O  OG1 . THR A 1 97  ? 24.312 44.892 46.166 1.00 17.77  ? 99   THR A OG1 1 
ATOM   796  C  CG2 . THR A 1 97  ? 25.242 45.694 48.127 1.00 15.35  ? 99   THR A CG2 1 
ATOM   797  N  N   . PRO A 1 98  ? 26.433 45.631 43.779 1.00 18.91  ? 100  PRO A N   1 
ATOM   798  C  CA  . PRO A 1 98  ? 26.190 45.298 42.349 1.00 18.10  ? 100  PRO A CA  1 
ATOM   799  C  C   . PRO A 1 98  ? 24.845 44.686 42.050 1.00 18.76  ? 100  PRO A C   1 
ATOM   800  O  O   . PRO A 1 98  ? 24.373 44.695 40.922 1.00 21.17  ? 100  PRO A O   1 
ATOM   801  C  CB  . PRO A 1 98  ? 27.292 44.282 42.015 1.00 20.10  ? 100  PRO A CB  1 
ATOM   802  C  CG  . PRO A 1 98  ? 28.384 44.616 43.000 1.00 21.07  ? 100  PRO A CG  1 
ATOM   803  C  CD  . PRO A 1 98  ? 27.655 44.976 44.248 1.00 18.53  ? 100  PRO A CD  1 
ATOM   804  N  N   . LEU A 1 99  ? 24.109 44.055 42.899 1.00 17.81  ? 101  LEU A N   1 
ATOM   805  C  CA  . LEU A 1 99  ? 22.772 43.494 42.865 1.00 18.26  ? 101  LEU A CA  1 
ATOM   806  C  C   . LEU A 1 99  ? 21.659 44.519 43.028 1.00 16.94  ? 101  LEU A C   1 
ATOM   807  O  O   . LEU A 1 99  ? 20.565 44.248 42.560 1.00 20.04  ? 101  LEU A O   1 
ATOM   808  C  CB  . LEU A 1 99  ? 22.579 42.400 43.924 1.00 17.29  ? 101  LEU A CB  1 
ATOM   809  C  CG  . LEU A 1 99  ? 23.338 41.077 43.689 1.00 17.81  ? 101  LEU A CG  1 
ATOM   810  C  CD1 . LEU A 1 99  ? 23.041 40.033 44.755 1.00 21.43  ? 101  LEU A CD1 1 
ATOM   811  C  CD2 . LEU A 1 99  ? 23.072 40.463 42.319 1.00 21.37  ? 101  LEU A CD2 1 
ATOM   812  N  N   . GLY A 1 100 ? 21.854 45.652 43.703 1.00 17.76  ? 102  GLY A N   1 
ATOM   813  C  CA  . GLY A 1 100 ? 20.735 46.574 43.820 1.00 18.13  ? 102  GLY A CA  1 
ATOM   814  C  C   . GLY A 1 100 ? 21.005 47.566 44.939 1.00 15.70  ? 102  GLY A C   1 
ATOM   815  O  O   . GLY A 1 100 ? 22.081 47.611 45.546 1.00 16.13  ? 102  GLY A O   1 
ATOM   816  N  N   . THR A 1 101 ? 20.015 48.402 45.208 1.00 15.95  ? 103  THR A N   1 
ATOM   817  C  CA  . THR A 1 101 ? 20.081 49.438 46.241 1.00 15.77  ? 103  THR A CA  1 
ATOM   818  C  C   . THR A 1 101 ? 18.880 49.293 47.165 1.00 15.32  ? 103  THR A C   1 
ATOM   819  O  O   . THR A 1 101 ? 17.770 49.085 46.648 1.00 16.66  ? 103  THR A O   1 
ATOM   820  C  CB  . THR A 1 101 ? 20.090 50.830 45.582 1.00 15.70  ? 103  THR A CB  1 
ATOM   821  O  OG1 . THR A 1 101 ? 21.225 50.924 44.712 1.00 19.41  ? 103  THR A OG1 1 
ATOM   822  C  CG2 . THR A 1 101 ? 20.184 51.927 46.654 1.00 16.24  ? 103  THR A CG2 1 
ATOM   823  N  N   . ARG A 1 102 ? 19.002 49.380 48.483 1.00 13.94  ? 104  ARG A N   1 
ATOM   824  C  CA  . ARG A 1 102 ? 17.889 49.292 49.382 1.00 14.28  ? 104  ARG A CA  1 
ATOM   825  C  C   . ARG A 1 102 ? 18.045 50.306 50.528 1.00 13.41  ? 104  ARG A C   1 
ATOM   826  O  O   . ARG A 1 102 ? 19.153 50.556 50.978 1.00 14.31  ? 104  ARG A O   1 
ATOM   827  C  CB  A ARG A 1 102 ? 17.769 47.924 50.059 0.53 15.97  ? 104  ARG A CB  1 
ATOM   828  C  CB  B ARG A 1 102 ? 17.717 47.916 50.028 0.47 16.21  ? 104  ARG A CB  1 
ATOM   829  C  CG  A ARG A 1 102 ? 17.493 46.765 49.151 0.53 18.23  ? 104  ARG A CG  1 
ATOM   830  C  CG  B ARG A 1 102 ? 17.480 46.772 49.095 0.47 18.55  ? 104  ARG A CG  1 
ATOM   831  C  CD  A ARG A 1 102 ? 16.079 46.828 48.572 0.53 21.79  ? 104  ARG A CD  1 
ATOM   832  C  CD  B ARG A 1 102 ? 16.136 46.837 48.363 0.47 21.84  ? 104  ARG A CD  1 
ATOM   833  N  NE  A ARG A 1 102 ? 15.837 45.551 47.869 0.53 24.40  ? 104  ARG A NE  1 
ATOM   834  N  NE  B ARG A 1 102 ? 16.081 45.644 47.494 0.47 24.09  ? 104  ARG A NE  1 
ATOM   835  C  CZ  A ARG A 1 102 ? 16.309 45.312 46.650 0.53 21.62  ? 104  ARG A CZ  1 
ATOM   836  C  CZ  B ARG A 1 102 ? 15.685 44.444 47.891 0.47 16.56  ? 104  ARG A CZ  1 
ATOM   837  N  NH1 A ARG A 1 102 ? 17.022 46.207 45.976 0.53 21.70  ? 104  ARG A NH1 1 
ATOM   838  N  NH1 B ARG A 1 102 ? 15.287 44.215 49.134 0.47 22.41  ? 104  ARG A NH1 1 
ATOM   839  N  NH2 A ARG A 1 102 ? 16.043 44.134 46.114 0.53 25.90  ? 104  ARG A NH2 1 
ATOM   840  N  NH2 B ARG A 1 102 ? 15.689 43.440 47.036 0.47 19.63  ? 104  ARG A NH2 1 
ATOM   841  N  N   . LEU A 1 103 ? 16.907 50.858 50.981 1.00 15.02  ? 105  LEU A N   1 
ATOM   842  C  CA  . LEU A 1 103 ? 16.836 51.437 52.298 1.00 13.38  ? 105  LEU A CA  1 
ATOM   843  C  C   . LEU A 1 103 ? 16.706 50.248 53.253 1.00 12.98  ? 105  LEU A C   1 
ATOM   844  O  O   . LEU A 1 103 ? 15.693 49.546 53.257 1.00 14.55  ? 105  LEU A O   1 
ATOM   845  C  CB  . LEU A 1 103 ? 15.673 52.402 52.401 1.00 15.32  ? 105  LEU A CB  1 
ATOM   846  C  CG  . LEU A 1 103 ? 15.430 52.955 53.788 1.00 14.28  ? 105  LEU A CG  1 
ATOM   847  C  CD1 . LEU A 1 103 ? 16.549 53.871 54.247 1.00 18.29  ? 105  LEU A CD1 1 
ATOM   848  C  CD2 . LEU A 1 103 ? 14.119 53.743 53.801 1.00 17.02  ? 105  LEU A CD2 1 
ATOM   849  N  N   . CYS A 1 104 ? 17.775 50.064 54.052 1.00 14.22  ? 106  CYS A N   1 
ATOM   850  C  CA  . CYS A 1 104 ? 17.873 48.859 54.883 1.00 14.07  ? 106  CYS A CA  1 
ATOM   851  C  C   . CYS A 1 104 ? 17.247 49.067 56.268 1.00 14.12  ? 106  CYS A C   1 
ATOM   852  O  O   . CYS A 1 104 ? 17.923 49.078 57.271 1.00 15.09  ? 106  CYS A O   1 
ATOM   853  C  CB  . CYS A 1 104 ? 19.313 48.383 54.979 1.00 14.62  ? 106  CYS A CB  1 
ATOM   854  S  SG  . CYS A 1 104 ? 20.047 47.961 53.367 1.00 15.89  ? 106  CYS A SG  1 
ATOM   855  N  N   . ARG A 1 105 ? 15.908 49.193 56.162 1.00 14.46  ? 107  ARG A N   1 
ATOM   856  C  CA  . ARG A 1 105 ? 15.088 49.274 57.392 1.00 15.25  ? 107  ARG A CA  1 
ATOM   857  C  C   . ARG A 1 105 ? 13.988 48.223 57.307 1.00 15.73  ? 107  ARG A C   1 
ATOM   858  O  O   . ARG A 1 105 ? 13.061 48.381 56.463 1.00 16.95  ? 107  ARG A O   1 
ATOM   859  C  CB  . ARG A 1 105 ? 14.523 50.682 57.588 1.00 16.50  ? 107  ARG A CB  1 
ATOM   860  C  CG  . ARG A 1 105 ? 15.601 51.769 57.627 1.00 14.98  ? 107  ARG A CG  1 
ATOM   861  C  CD  . ARG A 1 105 ? 14.979 53.139 57.905 1.00 16.52  ? 107  ARG A CD  1 
ATOM   862  N  NE  . ARG A 1 105 ? 14.447 53.246 59.252 1.00 15.76  ? 107  ARG A NE  1 
ATOM   863  C  CZ  . ARG A 1 105 ? 15.131 53.446 60.353 1.00 16.14  ? 107  ARG A CZ  1 
ATOM   864  N  NH1 . ARG A 1 105 ? 16.452 53.592 60.333 1.00 16.67  ? 107  ARG A NH1 1 
ATOM   865  N  NH2 . ARG A 1 105 ? 14.564 53.529 61.557 1.00 21.03  ? 107  ARG A NH2 1 
ATOM   866  N  N   . PRO A 1 106 ? 14.025 47.144 58.096 1.00 16.20  ? 108  PRO A N   1 
ATOM   867  C  CA  . PRO A 1 106 ? 15.033 46.835 59.100 1.00 16.30  ? 108  PRO A CA  1 
ATOM   868  C  C   . PRO A 1 106 ? 16.353 46.435 58.449 1.00 16.32  ? 108  PRO A C   1 
ATOM   869  O  O   . PRO A 1 106 ? 16.421 46.217 57.218 1.00 16.00  ? 108  PRO A O   1 
ATOM   870  C  CB  . PRO A 1 106 ? 14.451 45.651 59.879 1.00 17.13  ? 108  PRO A CB  1 
ATOM   871  C  CG  . PRO A 1 106 ? 13.501 45.006 58.913 1.00 19.81  ? 108  PRO A CG  1 
ATOM   872  C  CD  . PRO A 1 106 ? 13.005 46.087 58.012 1.00 15.63  ? 108  PRO A CD  1 
ATOM   873  N  N   . SER A 1 107 ? 17.383 46.393 59.270 1.00 15.41  ? 109  SER A N   1 
ATOM   874  C  CA  . SER A 1 107 ? 18.743 46.211 58.768 1.00 14.29  ? 109  SER A CA  1 
ATOM   875  C  C   . SER A 1 107 ? 18.856 44.945 57.905 1.00 14.41  ? 109  SER A C   1 
ATOM   876  O  O   . SER A 1 107 ? 19.587 44.951 56.906 1.00 14.99  ? 109  SER A O   1 
ATOM   877  C  CB  . SER A 1 107 ? 19.710 46.180 59.928 1.00 15.20  ? 109  SER A CB  1 
ATOM   878  O  OG  . SER A 1 107 ? 19.418 45.178 60.880 1.00 14.82  ? 109  SER A OG  1 
ATOM   879  N  N   . GLU A 1 108 ? 18.157 43.881 58.263 1.00 15.44  ? 110  GLU A N   1 
ATOM   880  C  CA  . GLU A 1 108 ? 18.337 42.608 57.561 1.00 15.04  ? 110  GLU A CA  1 
ATOM   881  C  C   . GLU A 1 108 ? 17.878 42.649 56.120 1.00 14.05  ? 110  GLU A C   1 
ATOM   882  O  O   . GLU A 1 108 ? 18.125 41.713 55.377 1.00 15.43  ? 110  GLU A O   1 
ATOM   883  C  CB  . GLU A 1 108 ? 17.653 41.472 58.300 1.00 17.41  ? 110  GLU A CB  1 
ATOM   884  C  CG  . GLU A 1 108 ? 16.160 41.579 58.434 1.00 20.17  ? 110  GLU A CG  1 
ATOM   885  C  CD  . GLU A 1 108 ? 15.682 42.237 59.718 1.00 19.05  ? 110  GLU A CD  1 
ATOM   886  O  OE1 . GLU A 1 108 ? 14.479 42.024 60.068 1.00 20.02  ? 110  GLU A OE1 1 
ATOM   887  O  OE2 . GLU A 1 108 ? 16.487 42.948 60.354 1.00 16.89  ? 110  GLU A OE2 1 
ATOM   888  N  N   . VAL A 1 109 ? 17.218 43.731 55.683 1.00 14.38  ? 111  VAL A N   1 
ATOM   889  C  CA  . VAL A 1 109 ? 16.927 43.913 54.246 1.00 14.04  ? 111  VAL A CA  1 
ATOM   890  C  C   . VAL A 1 109 ? 18.187 43.829 53.424 1.00 14.36  ? 111  VAL A C   1 
ATOM   891  O  O   . VAL A 1 109 ? 18.178 43.408 52.274 1.00 15.31  ? 111  VAL A O   1 
ATOM   892  C  CB  . VAL A 1 109 ? 16.235 45.290 54.064 1.00 15.45  ? 111  VAL A CB  1 
ATOM   893  C  CG1 . VAL A 1 109 ? 16.176 45.731 52.618 1.00 16.24  ? 111  VAL A CG1 1 
ATOM   894  C  CG2 . VAL A 1 109 ? 14.827 45.217 54.634 1.00 15.17  ? 111  VAL A CG2 1 
ATOM   895  N  N   . VAL A 1 110 ? 19.319 44.260 54.033 1.00 14.12  ? 112  VAL A N   1 
ATOM   896  C  CA  . VAL A 1 110 ? 20.568 44.245 53.264 1.00 14.72  ? 112  VAL A CA  1 
ATOM   897  C  C   . VAL A 1 110 ? 20.912 42.847 52.788 1.00 14.20  ? 112  VAL A C   1 
ATOM   898  O  O   . VAL A 1 110 ? 21.631 42.708 51.797 1.00 14.81  ? 112  VAL A O   1 
ATOM   899  C  CB  . VAL A 1 110 ? 21.715 44.858 54.087 1.00 14.26  ? 112  VAL A CB  1 
ATOM   900  C  CG1 . VAL A 1 110 ? 22.219 43.882 55.137 1.00 14.60  ? 112  VAL A CG1 1 
ATOM   901  C  CG2 . VAL A 1 110 ? 22.863 45.326 53.223 1.00 15.54  ? 112  VAL A CG2 1 
ATOM   902  N  N   . LEU A 1 111 ? 20.437 41.804 53.436 1.00 14.96  ? 113  LEU A N   1 
ATOM   903  C  CA  . LEU A 1 111 ? 20.747 40.438 52.996 1.00 16.37  ? 113  LEU A CA  1 
ATOM   904  C  C   . LEU A 1 111 ? 20.238 40.192 51.571 1.00 13.80  ? 113  LEU A C   1 
ATOM   905  O  O   . LEU A 1 111 ? 20.770 39.327 50.876 1.00 17.26  ? 113  LEU A O   1 
ATOM   906  C  CB  . LEU A 1 111 ? 20.169 39.370 53.924 1.00 14.60  ? 113  LEU A CB  1 
ATOM   907  C  CG  . LEU A 1 111 ? 20.665 39.438 55.377 1.00 14.63  ? 113  LEU A CG  1 
ATOM   908  C  CD1 . LEU A 1 111 ? 19.907 38.451 56.226 1.00 16.73  ? 113  LEU A CD1 1 
ATOM   909  C  CD2 . LEU A 1 111 ? 22.178 39.208 55.418 1.00 18.04  ? 113  LEU A CD2 1 
ATOM   910  N  N   . ASP A 1 112 ? 19.239 40.959 51.156 1.00 14.62  ? 114  ASP A N   1 
ATOM   911  C  CA  . ASP A 1 112 ? 18.728 40.753 49.804 1.00 15.44  ? 114  ASP A CA  1 
ATOM   912  C  C   . ASP A 1 112 ? 19.804 41.100 48.775 1.00 17.18  ? 114  ASP A C   1 
ATOM   913  O  O   . ASP A 1 112 ? 19.762 40.646 47.616 1.00 18.77  ? 114  ASP A O   1 
ATOM   914  C  CB  . ASP A 1 112 ? 17.474 41.611 49.593 1.00 17.01  ? 114  ASP A CB  1 
ATOM   915  C  CG  . ASP A 1 112 ? 16.228 41.128 50.312 1.00 22.41  ? 114  ASP A CG  1 
ATOM   916  O  OD1 . ASP A 1 112 ? 15.130 41.618 49.973 1.00 31.42  ? 114  ASP A OD1 1 
ATOM   917  O  OD2 . ASP A 1 112 ? 16.224 40.280 51.229 1.00 24.67  ? 114  ASP A OD2 1 
ATOM   918  N  N   . ILE A 1 113 ? 20.578 42.193 49.012 1.00 16.06  ? 115  ILE A N   1 
ATOM   919  C  CA  . ILE A 1 113 ? 21.471 42.706 47.987 1.00 16.13  ? 115  ILE A CA  1 
ATOM   920  C  C   . ILE A 1 113 ? 22.921 42.353 48.209 1.00 16.28  ? 115  ILE A C   1 
ATOM   921  O  O   . ILE A 1 113 ? 23.788 42.627 47.369 1.00 17.77  ? 115  ILE A O   1 
ATOM   922  C  CB  . ILE A 1 113 ? 21.295 44.232 47.866 1.00 15.35  ? 115  ILE A CB  1 
ATOM   923  C  CG1 . ILE A 1 113 ? 21.435 45.007 49.160 1.00 16.12  ? 115  ILE A CG1 1 
ATOM   924  C  CG2 . ILE A 1 113 ? 19.916 44.512 47.235 1.00 18.65  ? 115  ILE A CG2 1 
ATOM   925  C  CD1 . ILE A 1 113 ? 21.436 46.517 48.945 1.00 19.81  ? 115  ILE A CD1 1 
ATOM   926  N  N   . LEU A 1 114 ? 23.275 41.738 49.327 1.00 17.14  ? 116  LEU A N   1 
ATOM   927  C  CA  . LEU A 1 114 ? 24.635 41.200 49.470 1.00 14.83  ? 116  LEU A CA  1 
ATOM   928  C  C   . LEU A 1 114 ? 24.850 39.938 48.640 1.00 16.31  ? 116  LEU A C   1 
ATOM   929  O  O   . LEU A 1 114 ? 24.086 38.981 48.716 1.00 16.20  ? 116  LEU A O   1 
ATOM   930  C  CB  . LEU A 1 114 ? 24.922 40.972 50.940 1.00 15.15  ? 116  LEU A CB  1 
ATOM   931  C  CG  . LEU A 1 114 ? 25.022 42.212 51.814 1.00 13.48  ? 116  LEU A CG  1 
ATOM   932  C  CD1 . LEU A 1 114 ? 25.079 41.819 53.289 1.00 14.98  ? 116  LEU A CD1 1 
ATOM   933  C  CD2 . LEU A 1 114 ? 26.215 43.046 51.441 1.00 17.72  ? 116  LEU A CD2 1 
ATOM   934  N  N   . GLN A 1 115 ? 25.886 39.992 47.785 1.00 17.11  ? 117  GLN A N   1 
ATOM   935  C  CA  . GLN A 1 115 ? 26.186 38.893 46.894 1.00 17.11  ? 117  GLN A CA  1 
ATOM   936  C  C   . GLN A 1 115 ? 26.658 37.649 47.610 1.00 16.51  ? 117  GLN A C   1 
ATOM   937  O  O   . GLN A 1 115 ? 26.290 36.522 47.223 1.00 17.78  ? 117  GLN A O   1 
ATOM   938  C  CB  . GLN A 1 115 ? 27.302 39.275 45.898 1.00 20.68  ? 117  GLN A CB  1 
ATOM   939  C  CG  . GLN A 1 115 ? 26.857 40.313 44.905 1.00 21.19  ? 117  GLN A CG  1 
ATOM   940  C  CD  . GLN A 1 115 ? 27.993 40.980 44.192 1.00 20.89  ? 117  GLN A CD  1 
ATOM   941  O  OE1 . GLN A 1 115 ? 28.880 41.613 44.740 1.00 26.56  ? 117  GLN A OE1 1 
ATOM   942  N  NE2 . GLN A 1 115 ? 27.999 40.873 42.873 1.00 27.01  ? 117  GLN A NE2 1 
ATOM   943  N  N   . ASP A 1 116 ? 27.502 37.867 48.641 1.00 16.57  ? 118  ASP A N   1 
ATOM   944  C  CA  . ASP A 1 116 ? 28.085 36.731 49.354 1.00 16.19  ? 118  ASP A CA  1 
ATOM   945  C  C   . ASP A 1 116 ? 27.321 36.464 50.651 1.00 15.45  ? 118  ASP A C   1 
ATOM   946  O  O   . ASP A 1 116 ? 26.918 37.436 51.275 1.00 15.67  ? 118  ASP A O   1 
ATOM   947  C  CB  . ASP A 1 116 ? 29.579 36.956 49.594 1.00 16.89  ? 118  ASP A CB  1 
ATOM   948  C  CG  . ASP A 1 116 ? 30.292 37.191 48.261 1.00 22.34  ? 118  ASP A CG  1 
ATOM   949  O  OD1 . ASP A 1 116 ? 29.982 36.480 47.267 1.00 21.77  ? 118  ASP A OD1 1 
ATOM   950  O  OD2 . ASP A 1 116 ? 31.164 38.089 48.193 1.00 28.65  ? 118  ASP A OD2 1 
ATOM   951  N  N   . ALA A 1 117 ? 27.139 35.208 51.002 1.00 17.75  ? 119  ALA A N   1 
ATOM   952  C  CA  . ALA A 1 117 ? 26.380 34.880 52.206 1.00 16.48  ? 119  ALA A CA  1 
ATOM   953  C  C   . ALA A 1 117 ? 27.094 35.275 53.492 1.00 15.87  ? 119  ALA A C   1 
ATOM   954  O  O   . ALA A 1 117 ? 28.343 35.318 53.541 1.00 16.82  ? 119  ALA A O   1 
ATOM   955  C  CB  . ALA A 1 117 ? 26.132 33.377 52.289 1.00 21.14  ? 119  ALA A CB  1 
ATOM   956  N  N   . GLN A 1 118 ? 26.298 35.470 54.528 1.00 14.40  ? 120  GLN A N   1 
ATOM   957  C  CA  . GLN A 1 118 ? 26.921 35.698 55.837 1.00 15.62  ? 120  GLN A CA  1 
ATOM   958  C  C   . GLN A 1 118 ? 27.922 34.601 56.176 1.00 16.29  ? 120  GLN A C   1 
ATOM   959  O  O   . GLN A 1 118 ? 27.647 33.432 55.904 1.00 18.00  ? 120  GLN A O   1 
ATOM   960  C  CB  . GLN A 1 118 ? 25.856 35.759 56.934 1.00 17.52  ? 120  GLN A CB  1 
ATOM   961  C  CG  . GLN A 1 118 ? 24.863 36.906 56.705 1.00 17.00  ? 120  GLN A CG  1 
ATOM   962  C  CD  . GLN A 1 118 ? 25.479 38.260 57.004 1.00 16.66  ? 120  GLN A CD  1 
ATOM   963  O  OE1 . GLN A 1 118 ? 25.713 38.641 58.157 1.00 16.76  ? 120  GLN A OE1 1 
ATOM   964  N  NE2 . GLN A 1 118 ? 25.762 39.029 55.964 1.00 15.68  ? 120  GLN A NE2 1 
ATOM   965  N  N   . LYS A 1 119 ? 29.069 35.005 56.700 1.00 16.12  ? 121  LYS A N   1 
ATOM   966  C  CA  . LYS A 1 119 ? 30.140 34.033 56.933 1.00 15.68  ? 121  LYS A CA  1 
ATOM   967  C  C   . LYS A 1 119 ? 29.947 33.203 58.176 1.00 18.19  ? 121  LYS A C   1 
ATOM   968  O  O   . LYS A 1 119 ? 30.695 32.224 58.354 1.00 22.58  ? 121  LYS A O   1 
ATOM   969  C  CB  . LYS A 1 119 ? 31.503 34.759 56.941 1.00 19.06  ? 121  LYS A CB  1 
ATOM   970  C  CG  . LYS A 1 119 ? 31.877 35.187 55.510 1.00 22.05  ? 121  LYS A CG  1 
ATOM   971  C  CD  . LYS A 1 119 ? 33.058 36.116 55.463 1.00 30.80  ? 121  LYS A CD  1 
ATOM   972  C  CE  . LYS A 1 119 ? 34.311 35.595 56.139 1.00 39.14  ? 121  LYS A CE  1 
ATOM   973  N  NZ  . LYS A 1 119 ? 35.295 36.710 56.324 1.00 53.55  ? 121  LYS A NZ  1 
ATOM   974  N  N   . GLY A 1 120 ? 28.973 33.584 58.980 1.00 18.78  ? 122  GLY A N   1 
ATOM   975  C  CA  . GLY A 1 120 ? 28.643 32.886 60.222 1.00 17.64  ? 122  GLY A CA  1 
ATOM   976  C  C   . GLY A 1 120 ? 27.450 33.587 60.847 1.00 15.68  ? 122  GLY A C   1 
ATOM   977  O  O   . GLY A 1 120 ? 26.869 34.506 60.285 1.00 17.82  ? 122  GLY A O   1 
ATOM   978  N  N   . ALA A 1 121 ? 27.063 33.152 62.015 1.00 17.44  ? 123  ALA A N   1 
ATOM   979  C  CA  . ALA A 1 121 ? 25.834 33.675 62.633 1.00 17.09  ? 123  ALA A CA  1 
ATOM   980  C  C   . ALA A 1 121 ? 25.920 35.180 62.823 1.00 16.60  ? 123  ALA A C   1 
ATOM   981  O  O   . ALA A 1 121 ? 27.035 35.700 63.059 1.00 15.60  ? 123  ALA A O   1 
ATOM   982  C  CB  . ALA A 1 121 ? 25.617 33.028 63.987 1.00 16.89  ? 123  ALA A CB  1 
ATOM   983  N  N   . PHE A 1 122 ? 24.773 35.831 62.734 1.00 14.40  ? 124  PHE A N   1 
ATOM   984  C  CA  . PHE A 1 122 ? 24.714 37.262 62.951 1.00 15.78  ? 124  PHE A CA  1 
ATOM   985  C  C   . PHE A 1 122 ? 23.596 37.556 63.950 1.00 15.76  ? 124  PHE A C   1 
ATOM   986  O  O   . PHE A 1 122 ? 22.469 37.133 63.723 1.00 16.17  ? 124  PHE A O   1 
ATOM   987  C  CB  . PHE A 1 122 ? 24.470 38.057 61.660 1.00 13.97  ? 124  PHE A CB  1 
ATOM   988  C  CG  . PHE A 1 122 ? 24.629 39.569 61.928 1.00 13.11  ? 124  PHE A CG  1 
ATOM   989  C  CD1 . PHE A 1 122 ? 23.572 40.366 62.280 1.00 15.37  ? 124  PHE A CD1 1 
ATOM   990  C  CD2 . PHE A 1 122 ? 25.874 40.179 61.878 1.00 15.67  ? 124  PHE A CD2 1 
ATOM   991  C  CE1 . PHE A 1 122 ? 23.683 41.701 62.601 1.00 15.69  ? 124  PHE A CE1 1 
ATOM   992  C  CE2 . PHE A 1 122 ? 26.033 41.511 62.169 1.00 16.11  ? 124  PHE A CE2 1 
ATOM   993  C  CZ  . PHE A 1 122 ? 24.944 42.284 62.555 1.00 18.14  ? 124  PHE A CZ  1 
ATOM   994  N  N   . THR A 1 123 ? 23.961 38.283 64.984 1.00 14.82  ? 125  THR A N   1 
ATOM   995  C  CA  . THR A 1 123 ? 23.048 38.728 66.047 1.00 15.05  ? 125  THR A CA  1 
ATOM   996  C  C   . THR A 1 123 ? 23.171 40.229 66.150 1.00 13.04  ? 125  THR A C   1 
ATOM   997  O  O   . THR A 1 123 ? 24.272 40.749 66.227 1.00 14.70  ? 125  THR A O   1 
ATOM   998  C  CB  . THR A 1 123 ? 23.372 38.081 67.411 1.00 15.34  ? 125  THR A CB  1 
ATOM   999  O  OG1 . THR A 1 123 ? 23.180 36.673 67.245 1.00 16.68  ? 125  THR A OG1 1 
ATOM   1000 C  CG2 . THR A 1 123 ? 22.448 38.587 68.525 1.00 14.86  ? 125  THR A CG2 1 
ATOM   1001 N  N   . LYS A 1 124 ? 22.058 40.937 66.098 1.00 14.88  ? 126  LYS A N   1 
ATOM   1002 C  CA  . LYS A 1 124 ? 22.060 42.390 66.168 1.00 12.75  ? 126  LYS A CA  1 
ATOM   1003 C  C   . LYS A 1 124 ? 22.573 42.871 67.536 1.00 12.15  ? 126  LYS A C   1 
ATOM   1004 O  O   . LYS A 1 124 ? 22.639 42.070 68.485 1.00 14.90  ? 126  LYS A O   1 
ATOM   1005 C  CB  . LYS A 1 124 ? 20.641 42.923 66.001 1.00 12.40  ? 126  LYS A CB  1 
ATOM   1006 C  CG  . LYS A 1 124 ? 20.039 42.644 64.638 1.00 12.87  ? 126  LYS A CG  1 
ATOM   1007 C  CD  . LYS A 1 124 ? 18.664 43.272 64.497 1.00 14.72  ? 126  LYS A CD  1 
ATOM   1008 C  CE  . LYS A 1 124 ? 17.993 42.994 63.154 1.00 15.27  ? 126  LYS A CE  1 
ATOM   1009 N  NZ  . LYS A 1 124 ? 16.619 43.518 63.006 1.00 13.68  ? 126  LYS A NZ  1 
ATOM   1010 N  N   . GLU A 1 125 ? 22.872 44.151 67.626 1.00 13.16  ? 127  GLU A N   1 
ATOM   1011 C  CA  . GLU A 1 125 ? 23.351 44.712 68.880 1.00 13.81  ? 127  GLU A CA  1 
ATOM   1012 C  C   . GLU A 1 125 ? 22.522 44.330 70.106 1.00 12.85  ? 127  GLU A C   1 
ATOM   1013 O  O   . GLU A 1 125 ? 23.096 44.064 71.169 1.00 18.03  ? 127  GLU A O   1 
ATOM   1014 C  CB  . GLU A 1 125 ? 23.317 46.251 68.854 1.00 22.84  ? 127  GLU A CB  1 
ATOM   1015 C  CG  . GLU A 1 125 ? 24.364 46.879 68.011 1.00 24.33  ? 127  GLU A CG  1 
ATOM   1016 C  CD  . GLU A 1 125 ? 24.304 48.394 67.950 1.00 18.59  ? 127  GLU A CD  1 
ATOM   1017 O  OE1 . GLU A 1 125 ? 23.257 49.031 68.223 1.00 21.67  ? 127  GLU A OE1 1 
ATOM   1018 O  OE2 . GLU A 1 125 ? 25.383 48.919 67.655 1.00 20.10  ? 127  GLU A OE2 1 
ATOM   1019 N  N   . ASP A 1 126 ? 21.202 44.373 69.902 1.00 14.79  ? 128  ASP A N   1 
ATOM   1020 C  CA  . ASP A 1 126 ? 20.304 44.188 71.039 1.00 17.34  ? 128  ASP A CA  1 
ATOM   1021 C  C   . ASP A 1 126 ? 20.043 42.727 71.385 1.00 16.55  ? 128  ASP A C   1 
ATOM   1022 O  O   . ASP A 1 126 ? 19.200 42.412 72.245 1.00 18.19  ? 128  ASP A O   1 
ATOM   1023 C  CB  . ASP A 1 126 ? 18.957 44.913 70.817 1.00 17.69  ? 128  ASP A CB  1 
ATOM   1024 C  CG  . ASP A 1 126 ? 18.059 44.305 69.775 1.00 17.25  ? 128  ASP A CG  1 
ATOM   1025 O  OD1 . ASP A 1 126 ? 18.509 43.362 69.083 1.00 17.45  ? 128  ASP A OD1 1 
ATOM   1026 O  OD2 . ASP A 1 126 ? 16.906 44.806 69.658 1.00 20.77  ? 128  ASP A OD2 1 
ATOM   1027 N  N   . GLY A 1 127 ? 20.744 41.837 70.686 1.00 14.85  ? 129  GLY A N   1 
ATOM   1028 C  CA  . GLY A 1 127 ? 20.552 40.427 70.883 1.00 15.04  ? 129  GLY A CA  1 
ATOM   1029 C  C   . GLY A 1 127 ? 19.598 39.699 69.983 1.00 17.69  ? 129  GLY A C   1 
ATOM   1030 O  O   . GLY A 1 127 ? 19.461 38.472 70.091 1.00 18.55  ? 129  GLY A O   1 
ATOM   1031 N  N   . GLU A 1 128 ? 18.937 40.372 69.051 1.00 16.58  ? 130  GLU A N   1 
ATOM   1032 C  CA  . GLU A 1 128 ? 18.033 39.761 68.096 1.00 15.68  ? 130  GLU A CA  1 
ATOM   1033 C  C   . GLU A 1 128 ? 18.822 38.931 67.090 1.00 16.76  ? 130  GLU A C   1 
ATOM   1034 O  O   . GLU A 1 128 ? 19.650 39.464 66.359 1.00 18.38  ? 130  GLU A O   1 
ATOM   1035 C  CB  A GLU A 1 128 ? 17.189 40.799 67.356 0.41 18.22  ? 130  GLU A CB  1 
ATOM   1036 C  CB  B GLU A 1 128 ? 17.168 40.801 67.378 0.59 16.37  ? 130  GLU A CB  1 
ATOM   1037 C  CG  A GLU A 1 128 ? 16.376 41.792 68.155 0.41 18.91  ? 130  GLU A CG  1 
ATOM   1038 C  CG  B GLU A 1 128 ? 16.286 40.249 66.273 0.59 16.07  ? 130  GLU A CG  1 
ATOM   1039 C  CD  A GLU A 1 128 ? 15.508 42.711 67.305 0.41 21.33  ? 130  GLU A CD  1 
ATOM   1040 C  CD  B GLU A 1 128 ? 15.677 41.267 65.336 0.59 17.90  ? 130  GLU A CD  1 
ATOM   1041 O  OE1 A GLU A 1 128 ? 14.868 42.163 66.365 0.41 26.38  ? 130  GLU A OE1 1 
ATOM   1042 O  OE1 B GLU A 1 128 ? 15.727 42.475 65.574 0.59 21.01  ? 130  GLU A OE1 1 
ATOM   1043 O  OE2 A GLU A 1 128 ? 15.465 43.936 67.560 0.41 15.74  ? 130  GLU A OE2 1 
ATOM   1044 O  OE2 B GLU A 1 128 ? 15.127 40.864 64.288 0.59 25.15  ? 130  GLU A OE2 1 
ATOM   1045 N  N   . LYS A 1 129 ? 18.555 37.626 67.077 1.00 18.01  ? 131  LYS A N   1 
ATOM   1046 C  CA  . LYS A 1 129 ? 19.262 36.732 66.183 1.00 16.21  ? 131  LYS A CA  1 
ATOM   1047 C  C   . LYS A 1 129 ? 18.722 36.929 64.780 1.00 18.87  ? 131  LYS A C   1 
ATOM   1048 O  O   . LYS A 1 129 ? 17.494 36.945 64.600 1.00 23.80  ? 131  LYS A O   1 
ATOM   1049 C  CB  . LYS A 1 129 ? 19.113 35.263 66.610 1.00 18.82  ? 131  LYS A CB  1 
ATOM   1050 C  CG  . LYS A 1 129 ? 19.562 34.967 68.032 1.00 21.64  ? 131  LYS A CG  1 
ATOM   1051 C  CD  . LYS A 1 129 ? 19.259 33.560 68.469 1.00 25.54  ? 131  LYS A CD  1 
ATOM   1052 C  CE  . LYS A 1 129 ? 19.758 33.226 69.873 1.00 31.12  ? 131  LYS A CE  1 
ATOM   1053 N  NZ  . LYS A 1 129 ? 19.449 31.788 70.173 1.00 54.76  ? 131  LYS A NZ  1 
ATOM   1054 N  N   . VAL A 1 130 ? 19.555 37.110 63.778 1.00 16.87  ? 132  VAL A N   1 
ATOM   1055 C  CA  . VAL A 1 130 ? 19.201 37.277 62.399 1.00 17.18  ? 132  VAL A CA  1 
ATOM   1056 C  C   . VAL A 1 130 ? 19.422 36.036 61.537 1.00 18.21  ? 132  VAL A C   1 
ATOM   1057 O  O   . VAL A 1 130 ? 18.491 35.598 60.867 1.00 16.91  ? 132  VAL A O   1 
ATOM   1058 C  CB  . VAL A 1 130 ? 19.972 38.474 61.779 1.00 17.90  ? 132  VAL A CB  1 
ATOM   1059 C  CG1 . VAL A 1 130 ? 19.537 38.682 60.318 1.00 18.93  ? 132  VAL A CG1 1 
ATOM   1060 C  CG2 . VAL A 1 130 ? 19.751 39.718 62.604 1.00 16.27  ? 132  VAL A CG2 1 
ATOM   1061 N  N   . VAL A 1 131 ? 20.659 35.553 61.534 1.00 17.56  ? 133  VAL A N   1 
ATOM   1062 C  CA  . VAL A 1 131 ? 20.981 34.290 60.850 1.00 18.25  ? 133  VAL A CA  1 
ATOM   1063 C  C   . VAL A 1 131 ? 21.774 33.423 61.823 1.00 17.44  ? 133  VAL A C   1 
ATOM   1064 O  O   . VAL A 1 131 ? 22.561 33.965 62.593 1.00 16.28  ? 133  VAL A O   1 
ATOM   1065 C  CB  . VAL A 1 131 ? 21.760 34.411 59.535 1.00 22.18  ? 133  VAL A CB  1 
ATOM   1066 C  CG1 . VAL A 1 131 ? 20.949 35.317 58.600 1.00 27.22  ? 133  VAL A CG1 1 
ATOM   1067 C  CG2 . VAL A 1 131 ? 23.131 34.959 59.704 1.00 28.99  ? 133  VAL A CG2 1 
ATOM   1068 N  N   . ASP A 1 132 ? 21.535 32.120 61.768 1.00 18.28  ? 134  ASP A N   1 
ATOM   1069 C  CA  . ASP A 1 132 ? 22.253 31.191 62.620 1.00 19.14  ? 134  ASP A CA  1 
ATOM   1070 C  C   . ASP A 1 132 ? 23.543 30.776 61.932 1.00 19.45  ? 134  ASP A C   1 
ATOM   1071 O  O   . ASP A 1 132 ? 23.839 31.238 60.828 1.00 21.32  ? 134  ASP A O   1 
ATOM   1072 C  CB  . ASP A 1 132 ? 21.338 30.033 63.012 1.00 20.03  ? 134  ASP A CB  1 
ATOM   1073 C  CG  . ASP A 1 132 ? 20.938 29.105 61.878 1.00 24.74  ? 134  ASP A CG  1 
ATOM   1074 O  OD1 . ASP A 1 132 ? 20.028 28.246 61.997 1.00 32.95  ? 134  ASP A OD1 1 
ATOM   1075 O  OD2 . ASP A 1 132 ? 21.535 29.195 60.790 1.00 22.36  ? 134  ASP A OD2 1 
ATOM   1076 N  N   . GLU A 1 133 ? 24.321 29.910 62.572 1.00 21.72  ? 135  GLU A N   1 
ATOM   1077 C  CA  . GLU A 1 133 ? 25.616 29.562 62.025 1.00 22.90  ? 135  GLU A CA  1 
ATOM   1078 C  C   . GLU A 1 133 ? 25.464 28.820 60.703 1.00 25.91  ? 135  GLU A C   1 
ATOM   1079 O  O   . GLU A 1 133 ? 26.343 28.931 59.857 1.00 30.77  ? 135  GLU A O   1 
ATOM   1080 C  CB  . GLU A 1 133 ? 26.363 28.728 63.053 1.00 27.22  ? 135  GLU A CB  1 
ATOM   1081 C  CG  . GLU A 1 133 ? 27.821 28.568 62.715 1.00 30.59  ? 135  GLU A CG  1 
ATOM   1082 C  CD  . GLU A 1 133 ? 28.703 29.770 62.504 1.00 30.69  ? 135  GLU A CD  1 
ATOM   1083 O  OE1 . GLU A 1 133 ? 29.672 29.537 61.716 1.00 38.85  ? 135  GLU A OE1 1 
ATOM   1084 O  OE2 . GLU A 1 133 ? 28.515 30.878 63.058 1.00 27.84  ? 135  GLU A OE2 1 
ATOM   1085 N  N   . ALA A 1 134 ? 24.356 28.092 60.567 1.00 26.78  ? 136  ALA A N   1 
ATOM   1086 C  CA  . ALA A 1 134 ? 24.115 27.395 59.314 1.00 31.65  ? 136  ALA A CA  1 
ATOM   1087 C  C   . ALA A 1 134 ? 23.726 28.345 58.178 1.00 28.95  ? 136  ALA A C   1 
ATOM   1088 O  O   . ALA A 1 134 ? 23.758 27.916 57.010 1.00 35.35  ? 136  ALA A O   1 
ATOM   1089 C  CB  . ALA A 1 134 ? 23.024 26.347 59.515 1.00 38.24  ? 136  ALA A CB  1 
ATOM   1090 N  N   . GLY A 1 135 ? 23.367 29.584 58.485 1.00 23.28  ? 137  GLY A N   1 
ATOM   1091 C  CA  . GLY A 1 135 ? 22.968 30.574 57.499 1.00 22.53  ? 137  GLY A CA  1 
ATOM   1092 C  C   . GLY A 1 135 ? 21.485 30.789 57.321 1.00 21.63  ? 137  GLY A C   1 
ATOM   1093 O  O   . GLY A 1 135 ? 21.048 31.578 56.467 1.00 21.84  ? 137  GLY A O   1 
ATOM   1094 N  N   . LYS A 1 136 ? 20.702 30.093 58.118 1.00 21.34  ? 138  LYS A N   1 
ATOM   1095 C  CA  . LYS A 1 136 ? 19.270 30.218 58.034 1.00 21.23  ? 138  LYS A CA  1 
ATOM   1096 C  C   . LYS A 1 136 ? 18.813 31.480 58.731 1.00 22.67  ? 138  LYS A C   1 
ATOM   1097 O  O   . LYS A 1 136 ? 19.268 31.767 59.855 1.00 20.42  ? 138  LYS A O   1 
ATOM   1098 C  CB  . LYS A 1 136 ? 18.645 29.001 58.724 1.00 27.17  ? 138  LYS A CB  1 
ATOM   1099 C  CG  . LYS A 1 136 ? 17.146 28.944 58.488 1.00 35.65  ? 138  LYS A CG  1 
ATOM   1100 C  CD  . LYS A 1 136 ? 16.490 27.799 59.242 1.00 45.74  ? 138  LYS A CD  1 
ATOM   1101 C  CE  . LYS A 1 136 ? 16.510 27.983 60.754 1.00 56.87  ? 138  LYS A CE  1 
ATOM   1102 N  NZ  . LYS A 1 136 ? 16.203 26.730 61.514 1.00 66.57  ? 138  LYS A NZ  1 
ATOM   1103 N  N   . ARG A 1 137 ? 17.921 32.199 58.072 1.00 22.85  ? 139  ARG A N   1 
ATOM   1104 C  CA  . ARG A 1 137 ? 17.229 33.321 58.668 1.00 24.60  ? 139  ARG A CA  1 
ATOM   1105 C  C   . ARG A 1 137 ? 16.263 32.921 59.781 1.00 24.91  ? 139  ARG A C   1 
ATOM   1106 O  O   . ARG A 1 137 ? 15.423 32.047 59.523 1.00 34.01  ? 139  ARG A O   1 
ATOM   1107 C  CB  . ARG A 1 137 ? 16.345 34.039 57.648 1.00 31.13  ? 139  ARG A CB  1 
ATOM   1108 C  CG  . ARG A 1 137 ? 16.944 35.236 56.996 1.00 40.51  ? 139  ARG A CG  1 
ATOM   1109 C  CD  . ARG A 1 137 ? 17.260 36.364 57.955 1.00 38.46  ? 139  ARG A CD  1 
ATOM   1110 N  NE  . ARG A 1 137 ? 16.120 37.203 58.201 1.00 39.23  ? 139  ARG A NE  1 
ATOM   1111 C  CZ  . ARG A 1 137 ? 15.575 37.560 59.349 1.00 35.95  ? 139  ARG A CZ  1 
ATOM   1112 N  NH1 . ARG A 1 137 ? 16.036 37.150 60.540 1.00 31.84  ? 139  ARG A NH1 1 
ATOM   1113 N  NH2 . ARG A 1 137 ? 14.496 38.378 59.315 1.00 36.21  ? 139  ARG A NH2 1 
ATOM   1114 N  N   . LEU A 1 138 ? 16.375 33.536 60.936 1.00 25.65  ? 140  LEU A N   1 
ATOM   1115 C  CA  . LEU A 1 138 ? 15.517 33.145 62.045 1.00 28.89  ? 140  LEU A CA  1 
ATOM   1116 C  C   . LEU A 1 138 ? 14.205 33.905 62.046 1.00 37.47  ? 140  LEU A C   1 
ATOM   1117 O  O   . LEU A 1 138 ? 14.112 35.091 61.733 1.00 47.65  ? 140  LEU A O   1 
ATOM   1118 C  CB  . LEU A 1 138 ? 16.311 33.358 63.344 1.00 31.73  ? 140  LEU A CB  1 
ATOM   1119 C  CG  . LEU A 1 138 ? 17.520 32.395 63.422 1.00 34.95  ? 140  LEU A CG  1 
ATOM   1120 C  CD1 . LEU A 1 138 ? 18.562 32.874 64.402 1.00 38.03  ? 140  LEU A CD1 1 
ATOM   1121 C  CD2 . LEU A 1 138 ? 17.032 30.985 63.742 1.00 43.57  ? 140  LEU A CD2 1 
ATOM   1122 O  OXT . LEU A 1 138 ? 11.879 33.361 63.497 1.00 104.90 ? 140  LEU A OXT 1 
HETATM 1123 S  S   . SO4 B 2 .   ? 17.582 54.477 64.011 0.83 20.56  ? 201  SO4 A S   1 
HETATM 1124 O  O1  . SO4 B 2 .   ? 17.437 54.948 62.630 0.83 32.95  ? 201  SO4 A O1  1 
HETATM 1125 O  O2  . SO4 B 2 .   ? 18.076 55.615 64.810 0.83 16.68  ? 201  SO4 A O2  1 
HETATM 1126 O  O3  . SO4 B 2 .   ? 16.167 54.184 64.095 0.83 23.48  ? 201  SO4 A O3  1 
HETATM 1127 O  O4  . SO4 B 2 .   ? 18.414 53.271 64.251 0.83 22.55  ? 201  SO4 A O4  1 
HETATM 1128 S  S   . SO4 C 2 .   ? 10.966 53.465 60.380 1.00 51.21  ? 202  SO4 A S   1 
HETATM 1129 O  O1  . SO4 C 2 .   ? 11.452 52.119 59.938 1.00 57.55  ? 202  SO4 A O1  1 
HETATM 1130 O  O2  . SO4 C 2 .   ? 11.188 54.390 59.242 1.00 61.05  ? 202  SO4 A O2  1 
HETATM 1131 O  O3  . SO4 C 2 .   ? 9.564  53.037 60.376 1.00 67.45  ? 202  SO4 A O3  1 
HETATM 1132 O  O4  . SO4 C 2 .   ? 11.387 53.576 61.806 1.00 56.21  ? 202  SO4 A O4  1 
HETATM 1133 S  S   . SO4 D 2 .   ? 17.236 47.137 63.201 1.00 17.77  ? 203  SO4 A S   1 
HETATM 1134 O  O1  . SO4 D 2 .   ? 17.168 48.509 63.680 1.00 33.89  ? 203  SO4 A O1  1 
HETATM 1135 O  O2  . SO4 D 2 .   ? 16.661 47.125 61.861 1.00 32.11  ? 203  SO4 A O2  1 
HETATM 1136 O  O3  . SO4 D 2 .   ? 18.663 47.055 63.143 1.00 28.19  ? 203  SO4 A O3  1 
HETATM 1137 O  O4  . SO4 D 2 .   ? 16.568 46.216 64.121 1.00 19.09  ? 203  SO4 A O4  1 
HETATM 1138 S  S   . SO4 E 2 .   ? 19.488 70.935 59.149 0.51 28.89  ? 204  SO4 A S   1 
HETATM 1139 O  O1  . SO4 E 2 .   ? 20.087 70.119 58.087 0.51 32.31  ? 204  SO4 A O1  1 
HETATM 1140 O  O2  . SO4 E 2 .   ? 20.573 71.691 59.823 0.51 28.84  ? 204  SO4 A O2  1 
HETATM 1141 O  O3  . SO4 E 2 .   ? 18.290 71.810 59.119 0.51 25.15  ? 204  SO4 A O3  1 
HETATM 1142 O  O4  . SO4 E 2 .   ? 19.498 70.179 60.422 0.51 29.59  ? 204  SO4 A O4  1 
HETATM 1143 CS CS  . CS  F 3 .   ? 21.385 37.862 48.070 0.53 16.76  ? 401  CS  A CS  1 
HETATM 1144 CS CS  . CS  G 3 .   ? 28.400 63.991 46.656 0.21 28.15  ? 402  CS  A CS  1 
HETATM 1145 CS CS  . CS  H 3 .   ? 19.843 72.538 64.750 0.21 26.10  ? 403  CS  A CS  1 
HETATM 1146 CS CS  . CS  I 3 .   ? 27.403 30.310 57.288 0.21 39.20  ? 404  CS  A CS  1 
HETATM 1147 CS CS  . CS  J 3 .   ? 16.354 48.017 68.423 0.17 24.64  ? 405  CS  A CS  1 
HETATM 1148 O  O   . HOH K 4 .   ? 25.726 45.156 64.741 1.00 12.92  ? 1001 HOH A O   1 
HETATM 1149 O  O   . HOH K 4 .   ? 28.893 34.006 46.909 1.00 18.35  ? 1002 HOH A O   1 
HETATM 1150 O  O   . HOH K 4 .   ? 5.945  67.548 60.156 1.00 18.00  ? 1003 HOH A O   1 
HETATM 1151 O  O   . HOH K 4 .   ? 22.686 37.504 52.045 1.00 15.46  ? 1004 HOH A O   1 
HETATM 1152 O  O   . HOH K 4 .   ? 26.435 60.570 58.379 1.00 15.84  ? 1005 HOH A O   1 
HETATM 1153 O  O   . HOH K 4 .   ? 26.878 47.465 66.009 1.00 17.07  ? 1006 HOH A O   1 
HETATM 1154 O  O   . HOH K 4 .   ? 4.938  73.074 49.395 1.00 20.01  ? 1007 HOH A O   1 
HETATM 1155 O  O   . HOH K 4 .   ? 7.758  73.409 49.773 1.00 15.22  ? 1008 HOH A O   1 
HETATM 1156 O  O   . HOH K 4 .   ? 25.779 44.463 71.374 1.00 16.85  ? 1009 HOH A O   1 
HETATM 1157 O  O   . HOH K 4 .   ? 6.482  61.033 55.867 1.00 20.21  ? 1010 HOH A O   1 
HETATM 1158 O  O   . HOH K 4 .   ? 24.048 40.946 70.997 1.00 19.43  ? 1011 HOH A O   1 
HETATM 1159 O  O   . HOH K 4 .   ? 18.195 43.642 74.508 1.00 19.76  ? 1012 HOH A O   1 
HETATM 1160 O  O   . HOH K 4 .   ? 25.388 35.324 66.687 1.00 20.57  ? 1013 HOH A O   1 
HETATM 1161 O  O   . HOH K 4 .   ? 15.599 74.212 52.593 1.00 17.51  ? 1014 HOH A O   1 
HETATM 1162 O  O   . HOH K 4 .   ? 20.576 48.461 67.813 1.00 21.64  ? 1015 HOH A O   1 
HETATM 1163 O  O   . HOH K 4 .   ? 17.086 66.478 64.555 1.00 17.50  ? 1016 HOH A O   1 
HETATM 1164 O  O   . HOH K 4 .   ? 10.106 73.482 48.385 1.00 15.98  ? 1017 HOH A O   1 
HETATM 1165 O  O   . HOH K 4 .   ? 19.954 45.867 67.652 1.00 17.14  ? 1018 HOH A O   1 
HETATM 1166 O  O   . HOH K 4 .   ? 25.135 38.277 53.313 1.00 16.58  ? 1019 HOH A O   1 
HETATM 1167 O  O   . HOH K 4 .   ? 28.324 61.743 48.841 1.00 21.11  ? 1020 HOH A O   1 
HETATM 1168 O  O   . HOH K 4 .   ? 18.823 60.688 58.798 1.00 16.55  ? 1021 HOH A O   1 
HETATM 1169 O  O   . HOH K 4 .   ? 23.405 35.404 53.910 1.00 17.98  ? 1022 HOH A O   1 
HETATM 1170 O  O   . HOH K 4 .   ? 33.359 47.645 48.877 1.00 21.15  ? 1023 HOH A O   1 
HETATM 1171 O  O   . HOH K 4 .   ? 11.336 56.853 56.101 1.00 20.08  ? 1024 HOH A O   1 
HETATM 1172 O  O   . HOH K 4 .   ? 5.094  63.987 47.172 1.00 20.29  ? 1025 HOH A O   1 
HETATM 1173 O  O   . HOH K 4 .   ? 7.578  76.151 61.097 1.00 18.22  ? 1026 HOH A O   1 
HETATM 1174 O  O   . HOH K 4 .   ? 27.916 36.113 65.774 1.00 20.64  ? 1027 HOH A O   1 
HETATM 1175 O  O   . HOH K 4 .   ? 27.598 42.301 47.688 1.00 20.61  ? 1028 HOH A O   1 
HETATM 1176 O  O   . HOH K 4 .   ? 35.003 54.478 53.032 1.00 24.43  ? 1029 HOH A O   1 
HETATM 1177 O  O   . HOH K 4 .   ? 7.993  66.937 41.563 1.00 17.18  ? 1030 HOH A O   1 
HETATM 1178 O  O   . HOH K 4 .   ? 15.716 62.293 65.895 1.00 21.29  ? 1031 HOH A O   1 
HETATM 1179 O  O   . HOH K 4 .   ? 32.682 37.900 59.605 1.00 22.69  ? 1032 HOH A O   1 
HETATM 1180 O  O   . HOH K 4 .   ? 18.537 49.312 66.108 1.00 18.83  ? 1033 HOH A O   1 
HETATM 1181 O  O   . HOH K 4 .   ? 16.950 72.229 43.076 1.00 20.07  ? 1034 HOH A O   1 
HETATM 1182 O  O   . HOH K 4 .   ? 7.942  69.701 42.010 1.00 17.45  ? 1035 HOH A O   1 
HETATM 1183 O  O   . HOH K 4 .   ? 31.833 60.666 54.169 1.00 20.09  ? 1036 HOH A O   1 
HETATM 1184 O  O   . HOH K 4 .   ? 14.608 49.994 49.443 1.00 19.29  ? 1037 HOH A O   1 
HETATM 1185 O  O   . HOH K 4 .   ? 3.433  65.627 50.108 1.00 17.13  ? 1038 HOH A O   1 
HETATM 1186 O  O   . HOH K 4 .   ? 23.788 36.466 49.879 1.00 18.97  ? 1039 HOH A O   1 
HETATM 1187 O  O   . HOH K 4 .   ? 28.686 40.518 49.839 1.00 18.11  ? 1040 HOH A O   1 
HETATM 1188 O  O   . HOH K 4 .   ? 27.147 59.923 46.900 1.00 20.95  ? 1041 HOH A O   1 
HETATM 1189 O  O   . HOH K 4 .   ? 21.086 56.782 54.379 1.00 18.61  ? 1042 HOH A O   1 
HETATM 1190 O  O   . HOH K 4 .   ? 15.012 73.039 50.061 1.00 23.88  ? 1043 HOH A O   1 
HETATM 1191 O  O   . HOH K 4 .   ? 6.582  60.537 47.528 1.00 19.51  ? 1044 HOH A O   1 
HETATM 1192 O  O   . HOH K 4 .   ? 8.689  59.161 55.618 1.00 19.52  ? 1045 HOH A O   1 
HETATM 1193 O  O   . HOH K 4 .   ? 21.971 34.565 65.428 1.00 20.42  ? 1046 HOH A O   1 
HETATM 1194 O  O   . HOH K 4 .   ? 5.804  65.912 62.349 1.00 23.29  ? 1047 HOH A O   1 
HETATM 1195 O  O   . HOH K 4 .   ? 14.499 57.240 61.140 1.00 24.92  ? 1048 HOH A O   1 
HETATM 1196 O  O   . HOH K 4 .   ? 22.346 43.228 74.014 1.00 20.98  ? 1049 HOH A O   1 
HETATM 1197 O  O   . HOH K 4 .   ? 12.504 72.106 48.718 1.00 16.88  ? 1050 HOH A O   1 
HETATM 1198 O  O   . HOH K 4 .   ? 26.618 38.633 65.600 1.00 16.25  ? 1051 HOH A O   1 
HETATM 1199 O  O   . HOH K 4 .   ? 24.441 67.354 47.680 1.00 26.88  ? 1052 HOH A O   1 
HETATM 1200 O  O   . HOH K 4 .   ? 22.692 32.880 54.746 1.00 19.76  ? 1053 HOH A O   1 
HETATM 1201 O  O   . HOH K 4 .   ? 26.058 60.854 63.122 1.00 18.70  ? 1054 HOH A O   1 
HETATM 1202 O  O   . HOH K 4 .   ? 23.403 66.557 40.618 1.00 25.37  ? 1055 HOH A O   1 
HETATM 1203 O  O   . HOH K 4 .   ? 7.994  59.037 44.626 1.00 22.40  ? 1056 HOH A O   1 
HETATM 1204 O  O   . HOH K 4 .   ? 21.197 49.889 42.206 1.00 28.37  ? 1057 HOH A O   1 
HETATM 1205 O  O   . HOH K 4 .   ? -1.895 66.074 55.016 1.00 31.94  ? 1058 HOH A O   1 
HETATM 1206 O  O   . HOH K 4 .   ? 29.682 52.885 63.107 1.00 23.30  ? 1059 HOH A O   1 
HETATM 1207 O  O   . HOH K 4 .   ? 12.645 58.408 66.857 1.00 41.98  ? 1060 HOH A O   1 
HETATM 1208 O  O   . HOH K 4 .   ? 25.090 63.153 64.353 1.00 23.13  ? 1061 HOH A O   1 
HETATM 1209 O  O   . HOH K 4 .   ? 27.717 61.280 60.886 1.00 18.17  ? 1062 HOH A O   1 
HETATM 1210 O  O   . HOH K 4 .   ? 20.895 36.670 71.382 1.00 22.32  ? 1063 HOH A O   1 
HETATM 1211 O  O   . HOH K 4 .   ? 14.555 56.130 63.938 1.00 29.80  ? 1064 HOH A O   1 
HETATM 1212 O  O   . HOH K 4 .   ? 7.744  63.471 63.282 1.00 24.35  ? 1065 HOH A O   1 
HETATM 1213 O  O   . HOH K 4 .   ? 33.697 57.508 55.812 1.00 27.10  ? 1066 HOH A O   1 
HETATM 1214 O  O   . HOH K 4 .   ? 18.524 71.606 46.346 1.00 27.72  ? 1067 HOH A O   1 
HETATM 1215 O  O   . HOH K 4 .   ? 29.246 48.753 65.747 1.00 21.70  ? 1068 HOH A O   1 
HETATM 1216 O  O   . HOH K 4 .   ? 5.186  64.664 43.234 1.00 20.37  ? 1069 HOH A O   1 
HETATM 1217 O  O   . HOH K 4 .   ? 21.526 61.437 63.647 1.00 23.15  ? 1070 HOH A O   1 
HETATM 1218 O  O   . HOH K 4 .   ? 17.521 74.199 66.832 1.00 25.32  ? 1071 HOH A O   1 
HETATM 1219 O  O   . HOH K 4 .   ? 13.581 49.267 51.959 1.00 32.63  ? 1072 HOH A O   1 
HETATM 1220 O  O   . HOH K 4 .   ? 22.707 35.311 69.692 1.00 19.49  ? 1073 HOH A O   1 
HETATM 1221 O  O   . HOH K 4 .   ? 16.278 36.630 68.720 1.00 28.47  ? 1074 HOH A O   1 
HETATM 1222 O  O   . HOH K 4 .   ? 22.085 31.976 66.367 1.00 26.36  ? 1075 HOH A O   1 
HETATM 1223 O  O   . HOH K 4 .   ? 11.518 57.840 60.551 1.00 25.18  ? 1076 HOH A O   1 
HETATM 1224 O  O   . HOH K 4 .   ? 17.310 45.858 66.784 1.00 21.86  ? 1077 HOH A O   1 
HETATM 1225 O  O   . HOH K 4 .   ? 17.788 48.030 43.328 1.00 23.54  ? 1078 HOH A O   1 
HETATM 1226 O  O   . HOH K 4 .   ? 13.800 58.909 41.395 1.00 26.24  ? 1079 HOH A O   1 
HETATM 1227 O  O   . HOH K 4 .   ? 17.795 63.713 65.061 1.00 20.84  ? 1080 HOH A O   1 
HETATM 1228 O  O   . HOH K 4 .   ? 18.665 61.366 63.725 1.00 21.26  ? 1081 HOH A O   1 
HETATM 1229 O  O   . HOH K 4 .   ? 23.937 30.006 65.486 1.00 27.38  ? 1082 HOH A O   1 
HETATM 1230 O  O   . HOH K 4 .   ? 12.244 61.187 42.058 1.00 30.78  ? 1083 HOH A O   1 
HETATM 1231 O  O   . HOH K 4 .   ? 7.237  53.554 48.953 1.00 23.18  ? 1084 HOH A O   1 
HETATM 1232 O  O   . HOH K 4 .   ? 14.566 72.923 60.570 1.00 27.14  ? 1085 HOH A O   1 
HETATM 1233 O  O   . HOH K 4 .   ? 30.120 60.766 62.116 1.00 28.12  ? 1086 HOH A O   1 
HETATM 1234 O  O   . HOH K 4 .   ? 21.036 67.956 58.221 1.00 22.01  ? 1087 HOH A O   1 
HETATM 1235 O  O   . HOH K 4 .   ? 17.453 57.673 66.350 1.00 22.03  ? 1088 HOH A O   1 
HETATM 1236 O  O   . HOH K 4 .   ? 20.464 41.324 74.946 1.00 28.37  ? 1089 HOH A O   1 
HETATM 1237 O  O   . HOH K 4 .   ? 4.648  61.684 59.879 1.00 27.53  ? 1090 HOH A O   1 
HETATM 1238 O  O   . HOH K 4 .   ? 33.584 56.318 58.537 1.00 31.63  ? 1091 HOH A O   1 
HETATM 1239 O  O   . HOH K 4 .   ? 32.542 60.492 51.513 1.00 24.41  ? 1092 HOH A O   1 
HETATM 1240 O  O   . HOH K 4 .   ? 25.286 32.081 55.744 1.00 25.70  ? 1093 HOH A O   1 
HETATM 1241 O  O   . HOH K 4 .   ? 3.857  59.421 48.443 1.00 37.75  ? 1094 HOH A O   1 
HETATM 1242 O  O   . HOH K 4 .   ? 21.611 53.201 43.211 1.00 21.47  ? 1095 HOH A O   1 
HETATM 1243 O  O   . HOH K 4 .   ? -1.894 69.130 48.778 1.00 24.71  ? 1096 HOH A O   1 
HETATM 1244 O  O   . HOH K 4 .   ? 13.332 43.190 62.180 1.00 28.93  ? 1097 HOH A O   1 
HETATM 1245 O  O   . HOH K 4 .   ? 32.138 39.393 50.262 1.00 35.42  ? 1098 HOH A O   1 
HETATM 1246 O  O   . HOH K 4 .   ? 33.526 52.208 60.398 1.00 23.22  ? 1099 HOH A O   1 
HETATM 1247 O  O   . HOH K 4 .   ? 19.322 54.349 66.941 1.00 24.65  ? 1100 HOH A O   1 
HETATM 1248 O  O   . HOH K 4 .   ? 28.637 51.093 45.412 1.00 32.46  ? 1101 HOH A O   1 
HETATM 1249 O  O   . HOH K 4 .   ? 11.853 57.848 63.811 1.00 38.50  ? 1102 HOH A O   1 
HETATM 1250 O  O   . HOH K 4 .   ? 31.875 54.712 60.051 1.00 24.68  ? 1103 HOH A O   1 
HETATM 1251 O  O   . HOH K 4 .   ? 26.301 30.827 66.868 1.00 30.09  ? 1104 HOH A O   1 
HETATM 1252 O  O   . HOH K 4 .   ? 22.020 54.840 68.280 1.00 21.10  ? 1105 HOH A O   1 
HETATM 1253 O  O   . HOH K 4 .   ? 13.967 59.601 62.292 1.00 26.80  ? 1106 HOH A O   1 
HETATM 1254 O  O   . HOH K 4 .   ? 11.683 57.158 41.604 1.00 27.70  ? 1107 HOH A O   1 
HETATM 1255 O  O   . HOH K 4 .   ? 35.517 51.419 54.975 1.00 27.51  ? 1108 HOH A O   1 
HETATM 1256 O  O   . HOH K 4 .   ? 15.619 59.882 64.547 1.00 21.88  ? 1109 HOH A O   1 
HETATM 1257 O  O   . HOH K 4 .   ? 17.258 37.875 51.511 1.00 27.90  ? 1110 HOH A O   1 
HETATM 1258 O  O   . HOH K 4 .   ? 13.846 65.018 40.005 1.00 38.31  ? 1111 HOH A O   1 
HETATM 1259 O  O   . HOH K 4 .   ? 36.652 44.118 51.063 1.00 38.57  ? 1112 HOH A O   1 
HETATM 1260 O  O   . HOH K 4 .   ? 21.902 27.813 55.119 1.00 26.79  ? 1113 HOH A O   1 
HETATM 1261 O  O   . HOH K 4 .   ? 10.254 53.917 54.538 1.00 28.17  ? 1114 HOH A O   1 
HETATM 1262 O  O   . HOH K 4 .   ? 3.126  71.461 56.425 1.00 34.19  ? 1115 HOH A O   1 
HETATM 1263 O  O   . HOH K 4 .   ? 33.451 57.946 51.547 1.00 28.48  ? 1116 HOH A O   1 
HETATM 1264 O  O   . HOH K 4 .   ? 24.008 54.592 42.727 1.00 32.87  ? 1117 HOH A O   1 
HETATM 1265 O  O   . HOH K 4 .   ? 30.838 35.548 61.419 1.00 37.72  ? 1118 HOH A O   1 
HETATM 1266 O  O   . HOH K 4 .   ? 25.792 31.912 58.673 1.00 27.46  ? 1119 HOH A O   1 
HETATM 1267 O  O   . HOH K 4 .   ? 28.035 60.372 64.920 1.00 33.16  ? 1120 HOH A O   1 
HETATM 1268 O  O   . HOH K 4 .   ? 6.042  74.054 58.481 1.00 41.50  ? 1121 HOH A O   1 
HETATM 1269 O  O   . HOH K 4 .   ? 23.318 32.786 69.554 1.00 35.25  ? 1122 HOH A O   1 
HETATM 1270 O  O   . HOH K 4 .   ? 20.631 70.368 40.335 1.00 34.50  ? 1123 HOH A O   1 
HETATM 1271 O  O   . HOH K 4 .   ? 22.641 64.189 63.615 1.00 28.51  ? 1124 HOH A O   1 
HETATM 1272 O  O   . HOH K 4 .   ? 11.699 52.930 56.613 1.00 27.21  ? 1125 HOH A O   1 
HETATM 1273 O  O   . HOH K 4 .   ? 16.126 40.033 54.192 1.00 29.48  ? 1126 HOH A O   1 
HETATM 1274 O  O   . HOH K 4 .   ? 28.325 65.883 49.412 1.00 31.81  ? 1127 HOH A O   1 
HETATM 1275 O  O   . HOH K 4 .   ? 34.700 42.109 55.976 1.00 34.63  ? 1128 HOH A O   1 
HETATM 1276 O  O   . HOH K 4 .   ? 11.212 54.945 43.343 1.00 37.04  ? 1129 HOH A O   1 
HETATM 1277 O  O   . HOH K 4 .   ? 21.703 70.478 42.713 1.00 33.15  ? 1130 HOH A O   1 
HETATM 1278 O  O   . HOH K 4 .   ? 19.533 60.741 38.350 1.00 31.06  ? 1131 HOH A O   1 
HETATM 1279 O  O   . HOH K 4 .   ? 31.036 61.263 49.234 1.00 31.83  ? 1132 HOH A O   1 
HETATM 1280 O  O   . HOH K 4 .   ? 23.466 68.448 43.631 1.00 28.25  ? 1133 HOH A O   1 
HETATM 1281 O  O   . HOH K 4 .   ? 23.183 26.701 62.955 1.00 38.62  ? 1134 HOH A O   1 
HETATM 1282 O  O   . HOH K 4 .   ? 17.933 74.337 62.962 1.00 27.19  ? 1135 HOH A O   1 
HETATM 1283 O  O   . HOH K 4 .   ? 34.628 38.997 57.364 1.00 36.32  ? 1136 HOH A O   1 
HETATM 1284 O  O   . HOH K 4 .   ? 24.516 41.443 73.526 1.00 35.48  ? 1137 HOH A O   1 
HETATM 1285 O  O   . HOH K 4 .   ? 15.490 73.922 58.555 1.00 42.41  ? 1138 HOH A O   1 
HETATM 1286 O  O   . HOH K 4 .   ? 18.670 59.950 66.214 1.00 24.72  ? 1139 HOH A O   1 
HETATM 1287 O  O   . HOH K 4 .   ? 33.344 57.995 48.834 1.00 42.90  ? 1140 HOH A O   1 
HETATM 1288 O  O   . HOH K 4 .   ? 28.205 58.411 66.984 1.00 35.13  ? 1141 HOH A O   1 
HETATM 1289 O  O   . HOH K 4 .   ? 3.952  59.865 56.013 1.00 34.42  ? 1142 HOH A O   1 
HETATM 1290 O  O   . HOH K 4 .   ? 15.218 35.942 65.941 1.00 39.21  ? 1143 HOH A O   1 
HETATM 1291 O  O   . HOH K 4 .   ? 1.189  63.109 47.762 1.00 50.26  ? 1144 HOH A O   1 
HETATM 1292 O  O   . HOH K 4 .   ? 2.476  64.238 46.134 1.00 32.42  ? 1145 HOH A O   1 
HETATM 1293 O  O   . HOH K 4 .   ? 0.802  66.570 47.411 1.00 34.52  ? 1146 HOH A O   1 
HETATM 1294 O  O   . HOH K 4 .   ? 30.128 34.050 52.032 1.00 39.25  ? 1147 HOH A O   1 
HETATM 1295 O  O   . HOH K 4 .   ? 18.241 69.007 66.018 1.00 35.27  ? 1148 HOH A O   1 
HETATM 1296 O  O   . HOH K 4 .   ? 11.234 50.441 56.257 1.00 38.39  ? 1149 HOH A O   1 
HETATM 1297 O  O   . HOH K 4 .   ? 10.162 63.970 39.817 1.00 40.75  ? 1150 HOH A O   1 
HETATM 1298 O  O   . HOH K 4 .   ? 25.650 29.714 54.413 1.00 35.87  ? 1151 HOH A O   1 
HETATM 1299 O  O   . HOH K 4 .   ? 33.735 50.041 47.776 1.00 32.03  ? 1152 HOH A O   1 
HETATM 1300 O  O   . HOH K 4 .   ? 23.255 70.352 52.343 1.00 32.47  ? 1153 HOH A O   1 
HETATM 1301 O  O   . HOH K 4 .   ? 11.314 47.022 54.790 1.00 26.95  ? 1154 HOH A O   1 
HETATM 1302 O  O   . HOH K 4 .   ? 19.710 26.056 60.709 1.00 43.51  ? 1155 HOH A O   1 
HETATM 1303 O  O   . HOH K 4 .   ? 21.069 59.435 66.516 1.00 37.76  ? 1156 HOH A O   1 
HETATM 1304 O  O   . HOH K 4 .   ? 12.541 41.431 58.438 1.00 38.03  ? 1157 HOH A O   1 
HETATM 1305 O  O   . HOH K 4 .   ? 20.460 72.184 44.711 1.00 39.46  ? 1158 HOH A O   1 
HETATM 1306 O  O   . HOH K 4 .   ? 23.458 47.095 39.780 1.00 41.44  ? 1159 HOH A O   1 
HETATM 1307 O  O   . HOH K 4 .   ? 23.332 27.628 65.978 1.00 41.94  ? 1160 HOH A O   1 
HETATM 1308 O  O   . HOH K 4 .   ? 23.625 67.546 58.558 1.00 47.62  ? 1161 HOH A O   1 
HETATM 1309 O  O   . HOH K 4 .   ? 32.139 59.010 62.230 1.00 31.20  ? 1162 HOH A O   1 
HETATM 1310 O  O   . HOH K 4 .   ? 23.134 66.733 62.058 1.00 36.30  ? 1163 HOH A O   1 
HETATM 1311 O  O   . HOH K 4 .   ? 3.651  62.277 44.943 1.00 40.35  ? 1164 HOH A O   1 
HETATM 1312 O  O   . HOH K 4 .   ? 21.014 68.338 60.981 1.00 51.13  ? 1165 HOH A O   1 
HETATM 1313 O  O   . HOH K 4 .   ? 26.055 68.598 55.252 1.00 33.99  ? 1166 HOH A O   1 
HETATM 1314 O  O   . HOH K 4 .   ? 19.618 41.896 42.156 1.00 38.37  ? 1167 HOH A O   1 
HETATM 1315 O  O   . HOH K 4 .   ? 25.781 55.714 45.484 1.00 31.70  ? 1168 HOH A O   1 
HETATM 1316 O  O   . HOH K 4 .   ? 19.942 26.289 56.291 1.00 39.37  ? 1169 HOH A O   1 
HETATM 1317 O  O   . HOH K 4 .   ? 28.028 48.619 43.627 1.00 41.00  ? 1170 HOH A O   1 
HETATM 1318 O  O   . HOH K 4 .   ? 18.815 69.225 62.388 1.00 39.45  ? 1171 HOH A O   1 
HETATM 1319 O  O   . HOH K 4 .   ? 23.835 70.487 54.990 1.00 39.72  ? 1172 HOH A O   1 
HETATM 1320 O  O   . HOH K 4 .   ? 17.187 72.162 61.752 1.00 38.77  ? 1173 HOH A O   1 
HETATM 1321 O  O   . HOH K 4 .   ? 16.282 74.125 47.853 1.00 41.73  ? 1174 HOH A O   1 
HETATM 1322 O  O   . HOH K 4 .   ? 34.635 62.060 51.283 1.00 42.60  ? 1175 HOH A O   1 
HETATM 1323 O  O   . HOH K 4 .   ? 13.865 58.619 38.504 1.00 38.83  ? 1176 HOH A O   1 
HETATM 1324 O  O   . HOH K 4 .   ? 23.678 48.796 41.954 1.00 41.04  ? 1177 HOH A O   1 
HETATM 1325 O  O   . HOH K 4 .   ? 24.567 60.647 69.431 1.00 40.22  ? 1178 HOH A O   1 
HETATM 1326 O  O   . HOH K 4 .   ? 34.013 60.165 55.531 1.00 30.25  ? 1179 HOH A O   1 
HETATM 1327 O  O   . HOH K 4 .   ? 29.798 50.285 63.674 1.00 37.47  ? 1180 HOH A O   1 
HETATM 1328 O  O   . HOH K 4 .   ? 17.485 64.550 37.416 1.00 60.66  ? 1181 HOH A O   1 
HETATM 1329 O  O   . HOH K 4 .   ? 36.953 42.192 54.148 1.00 48.17  ? 1182 HOH A O   1 
HETATM 1330 O  O   . HOH K 4 .   ? 29.177 30.985 54.994 1.00 47.75  ? 1183 HOH A O   1 
HETATM 1331 O  O   . HOH K 4 .   ? 23.340 69.095 49.285 1.00 33.63  ? 1184 HOH A O   1 
HETATM 1332 O  O   . HOH K 4 .   ? 30.956 36.992 44.784 1.00 42.56  ? 1185 HOH A O   1 
HETATM 1333 O  O   . HOH K 4 .   ? 21.601 60.770 68.291 1.00 33.87  ? 1186 HOH A O   1 
HETATM 1334 O  O   . HOH K 4 .   ? 1.223  63.048 54.346 1.00 38.33  ? 1187 HOH A O   1 
HETATM 1335 O  O   . HOH K 4 .   ? 17.325 51.747 65.563 1.00 33.15  ? 1188 HOH A O   1 
HETATM 1336 O  O   . HOH K 4 .   ? 26.537 64.367 40.472 1.00 48.47  ? 1189 HOH A O   1 
HETATM 1337 O  O   . HOH K 4 .   ? 15.738 42.500 74.059 1.00 34.47  ? 1190 HOH A O   1 
HETATM 1338 O  O   . HOH K 4 .   ? 2.564  62.020 57.122 1.00 37.49  ? 1191 HOH A O   1 
HETATM 1339 O  O   . HOH K 4 .   ? 29.532 34.825 63.156 1.00 39.26  ? 1192 HOH A O   1 
HETATM 1340 O  O   . HOH K 4 .   ? 35.735 55.094 58.106 1.00 42.04  ? 1193 HOH A O   1 
HETATM 1341 O  O   . HOH K 4 .   ? 21.231 71.507 56.483 1.00 50.25  ? 1194 HOH A O   1 
HETATM 1342 O  O   . HOH K 4 .   ? 14.840 48.775 65.448 1.00 32.11  ? 1195 HOH A O   1 
HETATM 1343 O  O   . HOH K 4 .   ? 30.909 57.030 66.339 1.00 45.47  ? 1196 HOH A O   1 
HETATM 1344 O  O   . HOH K 4 .   ? 31.866 57.082 46.663 1.00 44.12  ? 1197 HOH A O   1 
HETATM 1345 O  O   . HOH K 4 .   ? 24.518 59.611 39.767 1.00 47.30  ? 1198 HOH A O   1 
HETATM 1346 O  O   . HOH K 4 .   ? 13.759 49.776 41.311 1.00 39.43  ? 1199 HOH A O   1 
HETATM 1347 O  O   . HOH K 4 .   ? 4.514  57.714 49.818 1.00 39.55  ? 1200 HOH A O   1 
HETATM 1348 O  O   . HOH K 4 .   ? 29.931 43.164 46.380 1.00 36.27  ? 1201 HOH A O   1 
HETATM 1349 O  O   . HOH K 4 .   ? 12.790 62.734 40.156 1.00 36.60  ? 1202 HOH A O   1 
HETATM 1350 O  O   . HOH K 4 .   ? 26.553 61.145 68.405 1.00 56.04  ? 1203 HOH A O   1 
HETATM 1351 O  O   . HOH K 4 .   ? 15.571 38.890 63.198 1.00 46.27  ? 1204 HOH A O   1 
HETATM 1352 O  O   . HOH K 4 .   ? 7.813  54.370 55.060 1.00 44.28  ? 1205 HOH A O   1 
HETATM 1353 O  O   . HOH K 4 .   ? 35.729 44.430 56.763 1.00 28.02  ? 1206 HOH A O   1 
HETATM 1354 O  O   . HOH K 4 .   ? 29.536 58.939 45.560 1.00 34.01  ? 1207 HOH A O   1 
HETATM 1355 O  O   . HOH K 4 .   ? 35.196 39.822 49.360 1.00 41.08  ? 1208 HOH A O   1 
HETATM 1356 O  O   . HOH K 4 .   ? 13.847 46.835 69.715 1.00 54.27  ? 1209 HOH A O   1 
HETATM 1357 O  O   . HOH K 4 .   ? 11.743 52.709 40.141 1.00 64.71  ? 1210 HOH A O   1 
HETATM 1358 O  O   . HOH K 4 .   ? 32.924 33.426 60.841 1.00 45.56  ? 1211 HOH A O   1 
HETATM 1359 O  O   . HOH K 4 .   ? 7.468  52.232 50.997 1.00 38.54  ? 1212 HOH A O   1 
HETATM 1360 O  O   . HOH K 4 .   ? 14.257 47.757 43.810 1.00 45.19  ? 1213 HOH A O   1 
HETATM 1361 O  O   . HOH K 4 .   ? 24.813 62.888 66.878 1.00 38.98  ? 1214 HOH A O   1 
HETATM 1362 O  O   . HOH K 4 .   ? -1.793 63.275 47.396 1.00 47.96  ? 1215 HOH A O   1 
HETATM 1363 O  O   . HOH K 4 .   ? 32.135 57.089 64.199 1.00 47.97  ? 1216 HOH A O   1 
HETATM 1364 O  O   . HOH K 4 .   ? 13.235 46.018 50.555 1.00 33.38  ? 1217 HOH A O   1 
HETATM 1365 O  O   . HOH K 4 .   ? 23.962 72.455 42.718 1.00 42.71  ? 1218 HOH A O   1 
HETATM 1366 O  O   . HOH K 4 .   ? 18.154 66.735 39.152 1.00 38.47  ? 1219 HOH A O   1 
HETATM 1367 O  O   . HOH K 4 .   ? 4.836  54.774 49.058 1.00 54.14  ? 1220 HOH A O   1 
HETATM 1368 O  O   . HOH K 4 .   ? 28.969 54.804 66.346 1.00 45.22  ? 1221 HOH A O   1 
HETATM 1369 O  O   . HOH K 4 .   ? 19.835 30.076 66.709 1.00 46.06  ? 1222 HOH A O   1 
HETATM 1370 O  O   . HOH K 4 .   ? 28.135 64.007 61.023 1.00 36.93  ? 1223 HOH A O   1 
HETATM 1371 O  O   . HOH K 4 .   ? 14.569 49.427 61.642 1.00 38.46  ? 1224 HOH A O   1 
HETATM 1372 O  O   . HOH K 4 .   ? 32.508 35.831 51.999 1.00 46.34  ? 1225 HOH A O   1 
HETATM 1373 O  O   . HOH K 4 .   ? 36.729 49.189 51.040 1.00 39.12  ? 1226 HOH A O   1 
HETATM 1374 O  O   . HOH K 4 .   ? 28.365 31.247 65.651 1.00 43.30  ? 1227 HOH A O   1 
HETATM 1375 O  O   . HOH K 4 .   ? 32.096 54.925 63.007 1.00 35.04  ? 1228 HOH A O   1 
HETATM 1376 O  O   . HOH K 4 .   ? 13.938 45.839 64.339 1.00 57.90  ? 1229 HOH A O   1 
HETATM 1377 O  O   . HOH K 4 .   ? 5.153  56.903 53.311 1.00 55.75  ? 1230 HOH A O   1 
HETATM 1378 O  O   . HOH K 4 .   ? 15.262 38.354 56.129 1.00 54.84  ? 1231 HOH A O   1 
HETATM 1379 O  O   . HOH K 4 .   ? 11.079 44.159 55.110 1.00 44.18  ? 1232 HOH A O   1 
HETATM 1380 O  O   . HOH K 4 .   ? 19.159 48.448 40.461 1.00 64.22  ? 1233 HOH A O   1 
HETATM 1381 O  O   . HOH K 4 .   ? 11.693 55.112 64.040 1.00 46.63  ? 1234 HOH A O   1 
HETATM 1382 O  O   . HOH K 4 .   ? 9.593  56.175 58.211 1.00 36.97  ? 1235 HOH A O   1 
HETATM 1383 O  O   . HOH K 4 .   ? 36.467 56.458 56.124 1.00 72.47  ? 1236 HOH A O   1 
HETATM 1384 O  O   . HOH K 4 .   ? 31.802 59.427 47.388 1.00 51.53  ? 1237 HOH A O   1 
HETATM 1385 O  O   . HOH K 4 .   ? 8.207  62.432 40.376 1.00 41.50  ? 1238 HOH A O   1 
HETATM 1386 O  O   . HOH K 4 .   ? 11.567 48.522 47.251 1.00 48.15  ? 1239 HOH A O   1 
HETATM 1387 O  O   . HOH K 4 .   ? 12.585 49.356 60.454 1.00 50.64  ? 1240 HOH A O   1 
HETATM 1388 O  O   . HOH K 4 .   ? 6.139  57.121 44.212 1.00 46.28  ? 1241 HOH A O   1 
HETATM 1389 O  O   . HOH K 4 .   ? 12.196 35.497 59.329 1.00 50.80  ? 1242 HOH A O   1 
HETATM 1390 O  O   . HOH K 4 .   ? 14.150 37.906 73.752 1.00 77.57  ? 1243 HOH A O   1 
HETATM 1391 O  O   . HOH K 4 .   ? 11.490 49.835 52.697 1.00 43.53  ? 1244 HOH A O   1 
HETATM 1392 O  O   . HOH K 4 .   ? 25.020 67.701 60.522 1.00 69.05  ? 1245 HOH A O   1 
HETATM 1393 O  O   . HOH K 4 .   ? 12.588 42.557 56.317 1.00 46.98  ? 1246 HOH A O   1 
HETATM 1394 O  O   . HOH K 4 .   ? 31.439 40.028 46.353 1.00 60.10  ? 1247 HOH A O   1 
HETATM 1395 O  O   . HOH K 4 .   ? 25.726 53.075 41.644 1.00 60.35  ? 1248 HOH A O   1 
HETATM 1396 O  O   . HOH K 4 .   ? 13.448 42.036 52.053 1.00 44.18  ? 1249 HOH A O   1 
HETATM 1397 O  O   . HOH K 4 .   ? 21.985 61.530 66.132 1.00 39.73  ? 1250 HOH A O   1 
HETATM 1398 O  O   . HOH K 4 .   ? 28.477 47.559 40.661 1.00 53.02  ? 1251 HOH A O   1 
HETATM 1399 O  O   . HOH K 4 .   ? 33.912 45.267 46.839 1.00 43.74  ? 1252 HOH A O   1 
HETATM 1400 O  O   . HOH K 4 .   ? 18.969 28.012 64.724 1.00 40.58  ? 1253 HOH A O   1 
HETATM 1401 O  O   . HOH K 4 .   ? 25.872 52.204 37.599 1.00 86.10  ? 1254 HOH A O   1 
HETATM 1402 O  O   . HOH K 4 .   ? 30.741 54.892 46.437 1.00 37.89  ? 1255 HOH A O   1 
HETATM 1403 O  O   . HOH K 4 .   ? 24.242 50.887 41.147 1.00 44.20  ? 1256 HOH A O   1 
HETATM 1404 O  O   . HOH K 4 .   ? 18.250 54.333 38.129 1.00 67.77  ? 1257 HOH A O   1 
HETATM 1405 O  O   . HOH K 4 .   ? 12.796 61.567 37.750 1.00 47.76  ? 1258 HOH A O   1 
HETATM 1406 O  O   . HOH K 4 .   ? 23.220 68.949 46.119 1.00 59.51  ? 1259 HOH A O   1 
HETATM 1407 O  O   . HOH K 4 .   ? 5.856  62.424 62.440 1.00 40.93  ? 1260 HOH A O   1 
HETATM 1408 O  O   . HOH K 4 .   ? 27.159 64.872 63.746 1.00 43.03  ? 1261 HOH A O   1 
HETATM 1409 O  O   . HOH K 4 .   ? 17.033 30.837 67.570 1.00 46.83  ? 1262 HOH A O   1 
HETATM 1410 O  O   . HOH K 4 .   ? 9.738  51.859 52.711 1.00 40.02  ? 1263 HOH A O   1 
HETATM 1411 O  O   . HOH K 4 .   ? 12.269 46.424 48.510 1.00 44.62  ? 1264 HOH A O   1 
HETATM 1412 O  O   . HOH K 4 .   ? 27.754 66.207 60.490 1.00 40.82  ? 1265 HOH A O   1 
HETATM 1413 O  O   . HOH K 4 .   ? 31.020 53.742 43.576 1.00 64.71  ? 1266 HOH A O   1 
HETATM 1414 O  O   . HOH K 4 .   ? 9.867  61.412 41.741 1.00 45.77  ? 1267 HOH A O   1 
HETATM 1415 O  O   . HOH K 4 .   ? 18.624 45.419 40.923 1.00 52.74  ? 1268 HOH A O   1 
HETATM 1416 O  O   . HOH K 4 .   ? 17.692 44.308 43.820 1.00 48.50  ? 1269 HOH A O   1 
HETATM 1417 O  O   . HOH K 4 .   ? 36.356 51.951 49.957 1.00 56.46  ? 1270 HOH A O   1 
HETATM 1418 O  O   . HOH K 4 .   ? 34.822 57.000 65.909 1.00 66.83  ? 1271 HOH A O   1 
HETATM 1419 O  O   . HOH K 4 .   ? 14.715 45.242 72.058 1.00 39.99  ? 1272 HOH A O   1 
HETATM 1420 O  O   . HOH K 4 .   ? 18.483 74.099 59.040 1.00 52.27  ? 1273 HOH A O   1 
HETATM 1421 O  O   . HOH K 4 .   ? 3.012  62.350 61.350 1.00 63.56  ? 1274 HOH A O   1 
HETATM 1422 O  O   . HOH K 4 .   ? 7.783  52.846 57.845 1.00 40.69  ? 1275 HOH A O   1 
HETATM 1423 O  O   . HOH K 4 .   ? 30.132 68.220 51.624 1.00 47.27  ? 1276 HOH A O   1 
HETATM 1424 O  O   . HOH K 4 .   ? 21.040 68.963 65.580 1.00 47.24  ? 1277 HOH A O   1 
HETATM 1425 O  O   . HOH K 4 .   ? 11.107 55.612 39.450 1.00 49.72  ? 1278 HOH A O   1 
HETATM 1426 O  O   . HOH K 4 .   ? 10.811 59.271 42.323 1.00 62.41  ? 1279 HOH A O   1 
HETATM 1427 O  O   . HOH K 4 .   ? 16.604 23.365 57.757 1.00 67.79  ? 1280 HOH A O   1 
HETATM 1428 O  O   . HOH K 4 .   ? 26.078 68.157 41.583 1.00 59.17  ? 1281 HOH A O   1 
HETATM 1429 O  O   . HOH K 4 .   ? 5.660  53.966 52.781 1.00 56.53  ? 1282 HOH A O   1 
HETATM 1430 O  O   . HOH K 4 .   ? 25.635 69.851 51.497 1.00 43.72  ? 1283 HOH A O   1 
HETATM 1431 O  O   . HOH K 4 .   ? 30.737 41.393 48.062 1.00 39.74  ? 1284 HOH A O   1 
HETATM 1432 O  O   . HOH K 4 .   ? 31.913 51.881 46.646 1.00 45.57  ? 1285 HOH A O   1 
HETATM 1433 O  O   . HOH K 4 .   ? 19.861 74.332 54.326 1.00 37.98  ? 1286 HOH A O   1 
HETATM 1434 O  O   . HOH K 4 .   ? 19.474 65.665 35.548 1.00 44.11  ? 1287 HOH A O   1 
HETATM 1435 O  O   . HOH K 4 .   ? 34.820 36.196 59.880 1.00 53.44  ? 1288 HOH A O   1 
HETATM 1436 O  O   . HOH K 4 .   ? 19.399 67.806 64.464 1.00 40.32  ? 1289 HOH A O   1 
HETATM 1437 O  O   . HOH K 4 .   ? 25.322 66.924 62.755 1.00 50.81  ? 1290 HOH A O   1 
HETATM 1438 O  O   . HOH K 4 .   ? 27.182 53.923 44.227 1.00 61.55  ? 1291 HOH A O   1 
HETATM 1439 O  O   . HOH K 4 .   ? 21.027 32.553 72.800 1.00 50.57  ? 1292 HOH A O   1 
HETATM 1440 O  O   . HOH K 4 .   ? 9.242  60.426 69.480 1.00 42.78  ? 1293 HOH A O   1 
HETATM 1441 O  O   . HOH K 4 .   ? 16.576 48.674 39.456 1.00 65.63  ? 1294 HOH A O   1 
HETATM 1442 O  O   . HOH K 4 .   ? 8.835  49.886 54.782 1.00 52.18  ? 1295 HOH A O   1 
HETATM 1443 O  O   . HOH K 4 .   ? 31.814 63.026 61.830 1.00 66.03  ? 1296 HOH A O   1 
HETATM 1444 O  O   . HOH K 4 .   ? 30.461 68.717 55.592 1.00 58.45  ? 1297 HOH A O   1 
HETATM 1445 O  O   . HOH K 4 .   ? 28.823 67.784 58.178 1.00 54.32  ? 1298 HOH A O   1 
HETATM 1446 O  O   . HOH K 4 .   ? 7.303  56.867 55.837 1.00 38.11  ? 1299 HOH A O   1 
HETATM 1447 O  O   . HOH K 4 .   ? 11.383 46.350 61.854 1.00 103.71 ? 1300 HOH A O   1 
HETATM 1448 O  O   . HOH K 4 .   ? 29.580 29.228 58.432 1.00 56.34  ? 1301 HOH A O   1 
HETATM 1449 O  O   . HOH K 4 .   ? 26.761 27.441 67.117 1.00 85.05  ? 1302 HOH A O   1 
HETATM 1450 O  O   . HOH K 4 .   ? 9.975  57.778 67.837 1.00 43.04  ? 1303 HOH A O   1 
HETATM 1451 O  O   . HOH K 4 .   ? 31.448 31.024 60.655 1.00 59.31  ? 1304 HOH A O   1 
HETATM 1452 O  O   . HOH K 4 .   ? -6.426 68.527 50.903 1.00 73.60  ? 1305 HOH A O   1 
HETATM 1453 O  O   . HOH K 4 .   ? 20.869 24.691 63.162 1.00 78.21  ? 1306 HOH A O   1 
HETATM 1454 O  O   . HOH K 4 .   ? 24.763 32.142 72.483 1.00 44.73  ? 1307 HOH A O   1 
HETATM 1455 O  O   . HOH K 4 .   ? 1.221  60.938 52.502 1.00 60.39  ? 1308 HOH A O   1 
HETATM 1456 O  O   . HOH K 4 .   ? 37.868 51.522 54.278 1.00 60.81  ? 1309 HOH A O   1 
HETATM 1457 O  O   . HOH K 4 .   ? 36.273 56.786 51.168 1.00 82.05  ? 1310 HOH A O   1 
HETATM 1458 O  O   . HOH K 4 .   ? 4.197  62.477 49.203 1.00 21.39  ? 1311 HOH A O   1 
HETATM 1459 O  O   . HOH K 4 .   ? 8.543  58.880 64.368 1.00 53.68  ? 1312 HOH A O   1 
HETATM 1460 O  O   . HOH K 4 .   ? 20.202 67.875 39.280 1.00 49.70  ? 1313 HOH A O   1 
HETATM 1461 O  O   . HOH K 4 .   ? 32.240 30.954 56.501 1.00 48.36  ? 1314 HOH A O   1 
HETATM 1462 O  O   . HOH K 4 .   ? 16.703 40.504 72.462 1.00 55.18  ? 1315 HOH A O   1 
HETATM 1463 O  O   . HOH K 4 .   ? 35.427 58.565 52.544 1.00 115.37 ? 1316 HOH A O   1 
HETATM 1464 O  O   . HOH K 4 .   ? 17.353 37.257 72.499 1.00 95.86  ? 1317 HOH A O   1 
HETATM 1465 O  O   . HOH K 4 .   ? 32.273 43.744 43.686 1.00 60.11  ? 1318 HOH A O   1 
HETATM 1466 O  O   . HOH K 4 .   ? 35.160 60.419 48.538 1.00 74.10  ? 1319 HOH A O   1 
HETATM 1467 O  O   . HOH K 4 .   ? 35.874 49.892 45.789 1.00 59.55  ? 1320 HOH A O   1 
HETATM 1468 O  O   . HOH K 4 .   ? 8.996  48.804 44.230 1.00 53.60  ? 1321 HOH A O   1 
HETATM 1469 O  O   . HOH K 4 .   ? 9.992  57.091 43.832 1.00 45.41  ? 1322 HOH A O   1 
HETATM 1470 O  O   . HOH K 4 .   ? 15.664 51.859 38.695 1.00 41.58  ? 1323 HOH A O   1 
HETATM 1471 O  O   . HOH K 4 .   ? 9.362  49.020 48.678 1.00 68.20  ? 1324 HOH A O   1 
HETATM 1472 O  O   . HOH K 4 .   ? 9.597  59.636 39.169 1.00 74.51  ? 1325 HOH A O   1 
HETATM 1473 O  O   . HOH K 4 .   ? 19.902 24.660 58.681 1.00 51.24  ? 1326 HOH A O   1 
HETATM 1474 O  O   . HOH K 4 .   ? 6.292  51.804 46.543 1.00 112.36 ? 1327 HOH A O   1 
HETATM 1475 O  O   . HOH K 4 .   ? 34.288 37.039 47.188 1.00 64.40  ? 1328 HOH A O   1 
HETATM 1476 O  O   . HOH K 4 .   ? -3.530 66.936 50.910 1.00 65.07  ? 1329 HOH A O   1 
HETATM 1477 O  O   . HOH K 4 .   ? 14.599 57.821 65.849 1.00 51.55  ? 1330 HOH A O   1 
HETATM 1478 O  O   . HOH K 4 .   ? 10.714 47.101 51.792 1.00 89.28  ? 1331 HOH A O   1 
HETATM 1479 O  O   . HOH K 4 .   ? -2.443 59.876 51.309 1.00 81.24  ? 1332 HOH A O   1 
HETATM 1480 O  O   . HOH K 4 .   ? 26.532 72.119 49.743 1.00 113.31 ? 1333 HOH A O   1 
HETATM 1481 O  O   . HOH K 4 .   ? 16.151 34.255 70.740 1.00 65.43  ? 1334 HOH A O   1 
HETATM 1482 O  O   . HOH K 4 .   ? 11.297 48.593 69.142 1.00 70.39  ? 1335 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N   . ASN A 1   ? 0.4620 0.3589 0.4235 0.1241  0.1116  -0.2268 3    ASN A N   
2    C  CA  . ASN A 1   ? 0.3897 0.3391 0.3928 0.1392  0.1093  -0.1260 3    ASN A CA  
3    C  C   . ASN A 1   ? 0.3048 0.2503 0.2614 0.0849  0.0153  -0.1071 3    ASN A C   
4    O  O   . ASN A 1   ? 0.3160 0.3691 0.1849 -0.0149 0.0277  -0.0044 3    ASN A O   
5    C  CB  . ASN A 1   ? 0.6034 0.5928 0.5246 0.0022  0.2650  0.0079  3    ASN A CB  
6    C  CG  . ASN A 1   ? 1.1390 0.7155 0.4408 -0.2713 0.2108  0.0335  3    ASN A CG  
7    O  OD1 . ASN A 1   ? 1.6039 1.0118 0.6245 -0.5131 0.1648  0.2572  3    ASN A OD1 
8    N  ND2 . ASN A 1   ? 0.9951 1.0310 0.5986 -0.3034 0.5837  -0.3291 3    ASN A ND2 
9    N  N   . ILE A 2   ? 0.2489 0.2002 0.2144 0.0106  0.0277  -0.0202 4    ILE A N   
10   C  CA  . ILE A 2   ? 0.2379 0.1730 0.1947 0.0119  0.0111  -0.0011 4    ILE A CA  
11   C  C   . ILE A 2   ? 0.2124 0.1714 0.1794 0.0056  0.0137  0.0078  4    ILE A C   
12   O  O   . ILE A 2   ? 0.2181 0.2391 0.1891 0.0054  -0.0002 -0.0252 4    ILE A O   
13   C  CB  . ILE A 2   ? 0.2516 0.1812 0.2214 -0.0079 0.0076  0.0133  4    ILE A CB  
14   C  CG1 . ILE A 2   ? 0.2143 0.1794 0.2530 -0.0087 0.0474  0.0173  4    ILE A CG1 
15   C  CG2 . ILE A 2   ? 0.2788 0.1879 0.1769 -0.0044 0.0039  0.0051  4    ILE A CG2 
16   C  CD1 . ILE A 2   ? 0.3244 0.2050 0.3139 0.0025  -0.0266 0.0781  4    ILE A CD1 
17   N  N   . THR A 3   ? 0.2233 0.1936 0.1625 0.0248  -0.0065 -0.0176 5    THR A N   
18   C  CA  . THR A 3   ? 0.2042 0.1888 0.1665 0.0209  -0.0063 -0.0111 5    THR A CA  
19   C  C   . THR A 3   ? 0.2117 0.1692 0.1415 0.0098  -0.0109 -0.0030 5    THR A C   
20   O  O   . THR A 3   ? 0.2208 0.2350 0.1680 -0.0150 -0.0017 -0.0469 5    THR A O   
21   C  CB  . THR A 3   ? 0.3014 0.1943 0.1831 -0.0020 0.0448  0.0100  5    THR A CB  
22   O  OG1 . THR A 3   ? 0.3604 0.2745 0.1909 0.0021  0.0879  -0.0197 5    THR A OG1 
23   C  CG2 . THR A 3   ? 0.2732 0.1906 0.2489 0.0421  0.0412  0.0048  5    THR A CG2 
24   N  N   . ILE A 4   ? 0.2006 0.1959 0.1577 -0.0076 -0.0083 -0.0133 6    ILE A N   
25   C  CA  . ILE A 4   ? 0.2307 0.1822 0.1459 -0.0016 0.0007  -0.0201 6    ILE A CA  
26   C  C   . ILE A 4   ? 0.2129 0.1732 0.1395 -0.0084 -0.0169 0.0062  6    ILE A C   
27   O  O   . ILE A 4   ? 0.2180 0.1961 0.1405 -0.0211 -0.0103 0.0081  6    ILE A O   
28   C  CB  . ILE A 4   ? 0.2146 0.1659 0.1935 -0.0026 0.0197  0.0105  6    ILE A CB  
29   C  CG1 . ILE A 4   ? 0.2205 0.1868 0.1379 0.0295  -0.0148 0.0095  6    ILE A CG1 
30   C  CG2 . ILE A 4   ? 0.2196 0.1933 0.2539 0.0272  -0.0117 0.0571  6    ILE A CG2 
31   C  CD1 . ILE A 4   ? 0.2372 0.1946 0.1351 -0.0116 -0.0292 0.0131  6    ILE A CD1 
32   N  N   . TYR A 5   ? 0.2188 0.1758 0.1425 0.0009  -0.0234 -0.0174 7    TYR A N   
33   C  CA  . TYR A 5   ? 0.2265 0.1645 0.1431 -0.0192 -0.0038 -0.0060 7    TYR A CA  
34   C  C   . TYR A 5   ? 0.1778 0.2113 0.1512 0.0028  0.0048  -0.0218 7    TYR A C   
35   O  O   . TYR A 5   ? 0.1869 0.2124 0.1503 -0.0151 -0.0079 0.0007  7    TYR A O   
36   C  CB  . TYR A 5   ? 0.2192 0.1779 0.1574 0.0078  0.0243  -0.0014 7    TYR A CB  
37   C  CG  . TYR A 5   ? 0.2449 0.1849 0.1512 0.0093  0.0047  0.0078  7    TYR A CG  
38   C  CD1 . TYR A 5   ? 0.1879 0.2101 0.1399 0.0126  -0.0185 0.0083  7    TYR A CD1 
39   C  CD2 . TYR A 5   ? 0.3234 0.1778 0.1456 0.0183  -0.0186 0.0363  7    TYR A CD2 
40   C  CE1 . TYR A 5   ? 0.2840 0.2441 0.1461 -0.0023 0.0069  0.0073  7    TYR A CE1 
41   C  CE2 . TYR A 5   ? 0.3306 0.2139 0.1492 0.0143  -0.0096 0.0422  7    TYR A CE2 
42   C  CZ  . TYR A 5   ? 0.1854 0.2444 0.1515 0.0255  0.0129  0.0227  7    TYR A CZ  
43   O  OH  . TYR A 5   ? 0.2335 0.3293 0.1510 0.0001  0.0190  0.0313  7    TYR A OH  
44   N  N   . HIS A 6   ? 0.1883 0.2292 0.1349 -0.0284 0.0111  -0.0027 8    HIS A N   
45   C  CA  . HIS A 6   ? 0.2012 0.2219 0.1285 -0.0074 0.0208  -0.0206 8    HIS A CA  
46   C  C   . HIS A 6   ? 0.2176 0.1968 0.1293 0.0124  0.0128  -0.0082 8    HIS A C   
47   O  O   . HIS A 6   ? 0.2331 0.2006 0.1611 -0.0056 -0.0095 0.0114  8    HIS A O   
48   C  CB  . HIS A 6   ? 0.2221 0.2116 0.1207 0.0069  0.0151  -0.0246 8    HIS A CB  
49   C  CG  . HIS A 6   ? 0.2247 0.1969 0.1253 -0.0159 0.0103  -0.0273 8    HIS A CG  
50   N  ND1 . HIS A 6   ? 0.2306 0.2076 0.1407 -0.0111 0.0081  -0.0082 8    HIS A ND1 
51   C  CD2 . HIS A 6   ? 0.2347 0.1859 0.1560 -0.0063 -0.0114 0.0002  8    HIS A CD2 
52   C  CE1 . HIS A 6   ? 0.2576 0.2664 0.1433 -0.0539 -0.0128 0.0057  8    HIS A CE1 
53   N  NE2 . HIS A 6   ? 0.1991 0.2145 0.1816 0.0154  0.0009  0.0265  8    HIS A NE2 
54   N  N   . ASN A 7   ? 0.2342 0.2542 0.1331 -0.0243 0.0153  -0.0324 9    ASN A N   
55   C  CA  . ASN A 7   ? 0.2136 0.1839 0.1036 0.0046  -0.0010 -0.0049 9    ASN A CA  
56   C  C   . ASN A 7   ? 0.2332 0.1695 0.1583 0.0131  -0.0437 0.0078  9    ASN A C   
57   O  O   . ASN A 7   ? 0.2459 0.1479 0.1652 0.0076  -0.0579 0.0114  9    ASN A O   
58   C  CB  . ASN A 7   ? 0.2254 0.1691 0.1767 0.0272  -0.0436 -0.0117 9    ASN A CB  
59   C  CG  . ASN A 7   ? 0.2056 0.2064 0.1714 0.0204  -0.0031 -0.0280 9    ASN A CG  
60   O  OD1 . ASN A 7   ? 0.2618 0.1905 0.1726 0.0208  -0.0319 -0.0160 9    ASN A OD1 
61   N  ND2 . ASN A 7   ? 0.2148 0.2039 0.2020 0.0253  0.0042  -0.0158 9    ASN A ND2 
62   N  N   . PRO A 8   ? 0.2481 0.1851 0.1420 -0.0055 -0.0454 -0.0156 10   PRO A N   
63   C  CA  . PRO A 8   ? 0.2227 0.1816 0.1496 0.0235  -0.0390 -0.0197 10   PRO A CA  
64   C  C   . PRO A 8   ? 0.2370 0.1789 0.1478 0.0144  -0.0366 -0.0073 10   PRO A C   
65   O  O   . PRO A 8   ? 0.2151 0.2115 0.1740 0.0221  -0.0260 0.0194  10   PRO A O   
66   C  CB  . PRO A 8   ? 0.2313 0.3081 0.1572 -0.0148 -0.0443 -0.0194 10   PRO A CB  
67   C  CG  . PRO A 8   ? 0.2739 0.3709 0.2453 -0.0691 -0.0512 0.0583  10   PRO A CG  
68   C  CD  . PRO A 8   ? 0.2805 0.2432 0.1372 -0.0531 -0.0391 -0.0200 10   PRO A CD  
69   N  N   . ALA A 9   ? 0.2374 0.1512 0.1484 -0.0019 -0.0056 0.0036  11   ALA A N   
70   C  CA  . ALA A 9   ? 0.2823 0.1821 0.1846 -0.0186 0.0277  -0.0210 11   ALA A CA  
71   C  C   . ALA A 9   ? 0.2571 0.2113 0.1693 -0.0079 0.0196  -0.0071 11   ALA A C   
72   O  O   . ALA A 9   ? 0.2970 0.2343 0.2271 -0.0165 0.0562  -0.0578 11   ALA A O   
73   C  CB  . ALA A 9   ? 0.3223 0.1854 0.1474 -0.0028 0.0056  -0.0206 11   ALA A CB  
74   N  N   . CYS A 10  ? 0.1934 0.2273 0.1816 0.0040  0.0227  -0.0231 12   CYS A N   
75   C  CA  . CYS A 10  ? 0.1885 0.1997 0.1259 0.0183  0.0395  0.0060  12   CYS A CA  
76   C  C   . CYS A 10  ? 0.2050 0.1986 0.1659 0.0208  0.0182  0.0179  12   CYS A C   
77   O  O   . CYS A 10  ? 0.1775 0.1803 0.1472 0.0172  -0.0083 0.0122  12   CYS A O   
78   C  CB  A CYS A 10  ? 0.2203 0.2077 0.1509 0.0162  0.0165  0.0228  12   CYS A CB  
79   C  CB  B CYS A 10  ? 0.2818 0.1638 0.1494 -0.0197 -0.0148 0.0045  12   CYS A CB  
80   S  SG  A CYS A 10  ? 0.7960 0.2035 0.2024 -0.0507 -0.1771 -0.0201 12   CYS A SG  
81   S  SG  B CYS A 10  ? 0.2496 0.1724 0.1584 0.0053  -0.0017 0.0029  12   CYS A SG  
82   N  N   . GLY A 11  ? 0.2182 0.1895 0.1670 -0.0145 0.0229  -0.0122 13   GLY A N   
83   C  CA  . GLY A 11  ? 0.1921 0.1914 0.1590 -0.0308 -0.0073 -0.0122 13   GLY A CA  
84   C  C   . GLY A 11  ? 0.2155 0.1932 0.1499 0.0055  -0.0188 -0.0110 13   GLY A C   
85   O  O   . GLY A 11  ? 0.2253 0.2007 0.1481 0.0181  -0.0225 -0.0047 13   GLY A O   
86   N  N   . THR A 12  ? 0.1747 0.1918 0.1196 -0.0139 0.0156  -0.0040 14   THR A N   
87   C  CA  . THR A 12  ? 0.2029 0.2015 0.1149 0.0145  0.0091  -0.0069 14   THR A CA  
88   C  C   . THR A 12  ? 0.1968 0.1489 0.1274 0.0183  0.0051  -0.0184 14   THR A C   
89   O  O   . THR A 12  ? 0.1815 0.1600 0.1466 0.0262  0.0048  -0.0212 14   THR A O   
90   C  CB  . THR A 12  ? 0.1801 0.2469 0.1697 -0.0004 -0.0169 -0.0258 14   THR A CB  
91   O  OG1 . THR A 12  ? 0.1793 0.2573 0.1984 -0.0181 -0.0076 -0.0019 14   THR A OG1 
92   C  CG2 . THR A 12  ? 0.2478 0.1800 0.1649 -0.0206 -0.0403 0.0134  14   THR A CG2 
93   N  N   . SER A 13  ? 0.2194 0.1431 0.1537 0.0105  -0.0035 0.0133  15   SER A N   
94   C  CA  . SER A 13  ? 0.2054 0.1748 0.1346 -0.0137 -0.0262 -0.0154 15   SER A CA  
95   C  C   . SER A 13  ? 0.1940 0.1738 0.1285 -0.0210 -0.0292 -0.0109 15   SER A C   
96   O  O   . SER A 13  ? 0.2760 0.1672 0.1175 0.0287  -0.0376 0.0003  15   SER A O   
97   C  CB  . SER A 13  ? 0.1633 0.1650 0.2001 0.0065  0.0448  -0.0501 15   SER A CB  
98   O  OG  . SER A 13  ? 0.1946 0.1980 0.1636 0.0141  0.0009  0.0131  15   SER A OG  
99   N  N   . ARG A 14  ? 0.2096 0.1781 0.1279 -0.0008 -0.0196 -0.0089 16   ARG A N   
100  C  CA  . ARG A 14  ? 0.2120 0.1762 0.1121 -0.0121 -0.0243 -0.0094 16   ARG A CA  
101  C  C   . ARG A 14  ? 0.1716 0.1769 0.1161 -0.0091 -0.0546 -0.0113 16   ARG A C   
102  O  O   . ARG A 14  ? 0.1860 0.1764 0.1441 -0.0167 -0.0197 -0.0084 16   ARG A O   
103  C  CB  . ARG A 14  ? 0.1489 0.1813 0.1147 -0.0009 -0.0014 -0.0260 16   ARG A CB  
104  C  CG  . ARG A 14  ? 0.1854 0.1993 0.1286 -0.0158 -0.0235 -0.0314 16   ARG A CG  
105  C  CD  . ARG A 14  ? 0.2352 0.2103 0.1201 0.0017  -0.0170 -0.0486 16   ARG A CD  
106  N  NE  . ARG A 14  ? 0.2564 0.1730 0.1247 0.0170  -0.0051 -0.0186 16   ARG A NE  
107  C  CZ  . ARG A 14  ? 0.2671 0.1749 0.1251 0.0167  0.0176  0.0037  16   ARG A CZ  
108  N  NH1 . ARG A 14  ? 0.2111 0.1819 0.1355 0.0195  0.0128  0.0165  16   ARG A NH1 
109  N  NH2 . ARG A 14  ? 0.2067 0.1703 0.1575 -0.0011 -0.0140 0.0088  16   ARG A NH2 
110  N  N   . ASN A 15  ? 0.1780 0.1872 0.1547 -0.0031 -0.0263 -0.0137 17   ASN A N   
111  C  CA  . ASN A 15  ? 0.2157 0.1951 0.1085 -0.0402 -0.0144 0.0102  17   ASN A CA  
112  C  C   . ASN A 15  ? 0.1878 0.1741 0.1102 0.0291  -0.0423 0.0089  17   ASN A C   
113  O  O   . ASN A 15  ? 0.1594 0.1717 0.1743 0.0198  -0.0090 0.0079  17   ASN A O   
114  C  CB  . ASN A 15  ? 0.2124 0.2582 0.1253 -0.0497 -0.0325 0.0567  17   ASN A CB  
115  C  CG  . ASN A 15  ? 0.1750 0.2211 0.1166 -0.0134 -0.0219 0.0209  17   ASN A CG  
116  O  OD1 . ASN A 15  ? 0.2056 0.2100 0.1081 0.0134  -0.0307 -0.0014 17   ASN A OD1 
117  N  ND2 . ASN A 15  ? 0.1929 0.2212 0.1742 0.0053  -0.0207 -0.0204 17   ASN A ND2 
118  N  N   . THR A 16  ? 0.1738 0.1754 0.1107 0.0129  -0.0301 0.0151  18   THR A N   
119  C  CA  . THR A 16  ? 0.2039 0.1888 0.1072 -0.0147 -0.0201 0.0209  18   THR A CA  
120  C  C   . THR A 16  ? 0.2054 0.1489 0.1473 -0.0110 -0.0021 -0.0012 18   THR A C   
121  O  O   . THR A 16  ? 0.2538 0.1650 0.1237 0.0039  -0.0173 -0.0088 18   THR A O   
122  C  CB  . THR A 16  ? 0.2146 0.2055 0.0949 0.0064  0.0012  0.0265  18   THR A CB  
123  O  OG1 . THR A 16  ? 0.2097 0.2117 0.1392 0.0036  -0.0131 0.0023  18   THR A OG1 
124  C  CG2 . THR A 16  ? 0.2392 0.2047 0.0991 -0.0050 -0.0174 0.0070  18   THR A CG2 
125  N  N   . LEU A 17  ? 0.2054 0.1580 0.1544 -0.0123 0.0028  -0.0123 19   LEU A N   
126  C  CA  . LEU A 17  ? 0.2048 0.1586 0.1770 -0.0228 -0.0074 0.0234  19   LEU A CA  
127  C  C   . LEU A 17  ? 0.2145 0.1549 0.1332 -0.0116 -0.0158 -0.0017 19   LEU A C   
128  O  O   . LEU A 17  ? 0.2098 0.2012 0.1374 0.0035  -0.0190 0.0020  19   LEU A O   
129  C  CB  . LEU A 17  ? 0.1798 0.1600 0.1354 0.0112  -0.0183 0.0064  19   LEU A CB  
130  C  CG  . LEU A 17  ? 0.1820 0.1821 0.1247 0.0008  -0.0243 -0.0196 19   LEU A CG  
131  C  CD1 . LEU A 17  ? 0.2161 0.1648 0.1495 0.0072  0.0114  -0.0248 19   LEU A CD1 
132  C  CD2 . LEU A 17  ? 0.1990 0.1740 0.1405 -0.0095 -0.0007 -0.0202 19   LEU A CD2 
133  N  N   . GLU A 18  ? 0.2161 0.1514 0.1508 0.0165  0.0036  0.0030  20   GLU A N   
134  C  CA  . GLU A 18  ? 0.2124 0.1641 0.1245 0.0237  -0.0138 -0.0058 20   GLU A CA  
135  C  C   . GLU A 18  ? 0.2054 0.1531 0.1426 0.0224  -0.0092 -0.0084 20   GLU A C   
136  O  O   . GLU A 18  ? 0.2209 0.1544 0.1690 0.0339  -0.0229 -0.0032 20   GLU A O   
137  C  CB  . GLU A 18  ? 0.2222 0.1827 0.1298 -0.0159 -0.0095 0.0022  20   GLU A CB  
138  C  CG  . GLU A 18  ? 0.2179 0.2102 0.1241 -0.0403 -0.0344 0.0068  20   GLU A CG  
139  C  CD  . GLU A 18  ? 0.1929 0.2365 0.1619 0.0158  -0.0140 -0.0666 20   GLU A CD  
140  O  OE1 . GLU A 18  ? 0.2381 0.2533 0.1690 -0.0102 0.0089  -0.0432 20   GLU A OE1 
141  O  OE2 . GLU A 18  ? 0.1700 0.2467 0.1499 0.0061  -0.0240 -0.0168 20   GLU A OE2 
142  N  N   . MET A 19  ? 0.2024 0.1517 0.1593 0.0198  -0.0105 -0.0040 21   MET A N   
143  C  CA  . MET A 19  ? 0.2006 0.1748 0.1610 0.0027  -0.0092 -0.0037 21   MET A CA  
144  C  C   . MET A 19  ? 0.2274 0.1889 0.1265 -0.0181 -0.0325 0.0066  21   MET A C   
145  O  O   . MET A 19  ? 0.1943 0.2047 0.1578 -0.0055 0.0002  0.0047  21   MET A O   
146  C  CB  . MET A 19  ? 0.2078 0.2101 0.1918 -0.0004 -0.0349 0.0308  21   MET A CB  
147  C  CG  . MET A 19  ? 0.2002 0.2018 0.2337 0.0205  0.0039  0.0368  21   MET A CG  
148  S  SD  . MET A 19  ? 0.2075 0.2514 0.2509 0.0021  -0.0118 -0.0013 21   MET A SD  
149  C  CE  . MET A 19  ? 0.2444 0.2933 0.2122 0.0644  0.0040  -0.0068 21   MET A CE  
150  N  N   . ILE A 20  ? 0.1654 0.1980 0.1995 -0.0108 -0.0010 0.0252  22   ILE A N   
151  C  CA  . ILE A 20  ? 0.1791 0.1625 0.1528 0.0020  -0.0339 0.0172  22   ILE A CA  
152  C  C   . ILE A 20  ? 0.1770 0.1513 0.1494 0.0012  -0.0192 -0.0048 22   ILE A C   
153  O  O   . ILE A 20  ? 0.2140 0.1991 0.1522 0.0177  0.0058  -0.0183 22   ILE A O   
154  C  CB  . ILE A 20  ? 0.1928 0.1787 0.1444 0.0027  -0.0247 0.0281  22   ILE A CB  
155  C  CG1 . ILE A 20  ? 0.2195 0.1682 0.1241 0.0219  -0.0339 0.0220  22   ILE A CG1 
156  C  CG2 . ILE A 20  ? 0.2143 0.1920 0.1588 -0.0294 0.0000  -0.0057 22   ILE A CG2 
157  C  CD1 . ILE A 20  ? 0.2403 0.1624 0.1686 0.0185  0.0021  0.0133  22   ILE A CD1 
158  N  N   . ARG A 21  ? 0.1674 0.2131 0.1786 0.0106  -0.0392 -0.0340 23   ARG A N   
159  C  CA  . ARG A 21  ? 0.1615 0.1847 0.1555 -0.0025 -0.0147 -0.0179 23   ARG A CA  
160  C  C   . ARG A 21  ? 0.1919 0.1817 0.1289 -0.0089 -0.0159 -0.0165 23   ARG A C   
161  O  O   . ARG A 21  ? 0.2094 0.1890 0.2005 0.0060  0.0041  -0.0116 23   ARG A O   
162  C  CB  . ARG A 21  ? 0.1512 0.1774 0.1935 0.0049  -0.0316 -0.0330 23   ARG A CB  
163  C  CG  . ARG A 21  ? 0.2896 0.2038 0.1368 -0.0539 0.0453  -0.0460 23   ARG A CG  
164  C  CD  . ARG A 21  ? 0.2136 0.1785 0.1889 0.0079  -0.0325 -0.0464 23   ARG A CD  
165  N  NE  . ARG A 21  ? 0.2391 0.1845 0.1683 -0.0010 -0.0109 -0.0431 23   ARG A NE  
166  C  CZ  . ARG A 21  ? 0.1909 0.1747 0.1800 -0.0027 -0.0047 -0.0370 23   ARG A CZ  
167  N  NH1 . ARG A 21  ? 0.2139 0.1842 0.1693 0.0141  -0.0080 -0.0296 23   ARG A NH1 
168  N  NH2 . ARG A 21  ? 0.2358 0.1858 0.2041 -0.0128 -0.0105 -0.0083 23   ARG A NH2 
169  N  N   . ASN A 22  ? 0.2135 0.1865 0.1420 0.0022  0.0062  -0.0020 24   ASN A N   
170  C  CA  . ASN A 22  ? 0.2167 0.1882 0.1531 -0.0122 -0.0131 -0.0008 24   ASN A CA  
171  C  C   . ASN A 22  ? 0.2298 0.1913 0.1600 0.0061  -0.0292 -0.0098 24   ASN A C   
172  O  O   . ASN A 22  ? 0.2482 0.1884 0.1726 -0.0125 -0.0221 -0.0057 24   ASN A O   
173  C  CB  . ASN A 22  ? 0.2774 0.2140 0.1717 0.0139  0.0216  0.0504  24   ASN A CB  
174  C  CG  . ASN A 22  ? 0.1994 0.1695 0.1408 -0.0164 -0.0170 -0.0152 24   ASN A CG  
175  O  OD1 . ASN A 22  ? 0.2192 0.2778 0.2339 -0.0695 -0.0179 0.0103  24   ASN A OD1 
176  N  ND2 . ASN A 22  ? 0.2069 0.2025 0.1673 0.0072  -0.0059 0.0087  24   ASN A ND2 
177  N  N   . SER A 23  ? 0.2114 0.2044 0.1412 0.0150  0.0061  -0.0082 25   SER A N   
178  C  CA  . SER A 23  ? 0.1901 0.1847 0.1577 0.0349  -0.0092 -0.0242 25   SER A CA  
179  C  C   . SER A 23  ? 0.1901 0.2207 0.1844 0.0060  -0.0026 -0.0698 25   SER A C   
180  O  O   . SER A 23  ? 0.1916 0.2599 0.1439 0.0261  -0.0038 -0.0354 25   SER A O   
181  C  CB  . SER A 23  ? 0.2085 0.1845 0.1666 0.0095  -0.0338 -0.0134 25   SER A CB  
182  O  OG  . SER A 23  ? 0.2610 0.1856 0.1754 0.0076  -0.0198 -0.0143 25   SER A OG  
183  N  N   . GLY A 24  ? 0.2084 0.2285 0.2186 -0.0122 -0.0368 -0.0338 26   GLY A N   
184  C  CA  . GLY A 24  ? 0.2025 0.2277 0.2542 -0.0062 -0.0399 -0.0363 26   GLY A CA  
185  C  C   . GLY A 24  ? 0.2046 0.2537 0.2190 -0.0058 -0.0153 -0.0386 26   GLY A C   
186  O  O   . GLY A 24  ? 0.2367 0.2978 0.2795 0.0277  0.0249  -0.0224 26   GLY A O   
187  N  N   . THR A 25  ? 0.2064 0.2423 0.2268 -0.0081 0.0092  -0.0218 27   THR A N   
188  C  CA  . THR A 25  ? 0.2076 0.2672 0.2180 -0.0045 0.0527  -0.0125 27   THR A CA  
189  C  C   . THR A 25  ? 0.1462 0.2227 0.2980 0.0430  -0.0090 -0.0024 27   THR A C   
190  O  O   . THR A 25  ? 0.1860 0.2230 0.2913 0.0202  0.0253  -0.0236 27   THR A O   
191  C  CB  . THR A 25  ? 0.3958 0.2967 0.2791 0.0059  -0.0562 0.0280  27   THR A CB  
192  O  OG1 . THR A 25  ? 0.3141 0.3688 0.5516 0.0370  -0.1856 0.0418  27   THR A OG1 
193  C  CG2 . THR A 25  ? 0.1681 0.3508 0.2743 -0.0288 -0.0785 0.1205  27   THR A CG2 
194  N  N   . GLU A 26  ? 0.2026 0.2463 0.2248 0.0081  0.0172  0.0127  28   GLU A N   
195  C  CA  . GLU A 26  ? 0.1937 0.2379 0.2221 -0.0010 0.0362  0.0109  28   GLU A CA  
196  C  C   . GLU A 26  ? 0.2070 0.2347 0.1995 -0.0050 0.0360  0.0021  28   GLU A C   
197  O  O   . GLU A 26  ? 0.2422 0.2962 0.2038 0.0120  0.0439  0.0114  28   GLU A O   
198  C  CB  . GLU A 26  ? 0.2017 0.2423 0.2422 0.0049  0.0301  0.0016  28   GLU A CB  
199  C  CG  . GLU A 26  ? 0.2353 0.2813 0.2232 0.0044  0.0022  -0.0346 28   GLU A CG  
200  C  CD  . GLU A 26  ? 0.1936 0.2330 0.2231 0.0305  -0.0065 0.0069  28   GLU A CD  
201  O  OE1 . GLU A 26  ? 0.2694 0.2329 0.2168 0.0006  0.0254  -0.0104 28   GLU A OE1 
202  O  OE2 . GLU A 26  ? 0.2344 0.2315 0.2724 -0.0032 0.0018  0.0006  28   GLU A OE2 
203  N  N   . PRO A 27  ? 0.2348 0.2261 0.2008 0.0159  0.0415  0.0194  29   PRO A N   
204  C  CA  . PRO A 27  ? 0.2397 0.2000 0.1575 -0.0041 0.0243  -0.0120 29   PRO A CA  
205  C  C   . PRO A 27  ? 0.2076 0.2216 0.1859 -0.0168 -0.0032 0.0070  29   PRO A C   
206  O  O   . PRO A 27  ? 0.2383 0.2623 0.1894 -0.0134 -0.0035 -0.0277 29   PRO A O   
207  C  CB  . PRO A 27  ? 0.2235 0.1966 0.1483 -0.0152 0.0041  0.0127  29   PRO A CB  
208  C  CG  . PRO A 27  ? 0.1875 0.1975 0.1546 -0.0089 0.0036  0.0170  29   PRO A CG  
209  C  CD  . PRO A 27  ? 0.1821 0.2121 0.1673 0.0016  0.0021  -0.0011 29   PRO A CD  
210  N  N   . THR A 28  ? 0.2647 0.2209 0.1655 -0.0269 0.0318  -0.0001 30   THR A N   
211  C  CA  . THR A 28  ? 0.2310 0.2127 0.2020 -0.0085 0.0250  0.0031  30   THR A CA  
212  C  C   . THR A 28  ? 0.2282 0.2652 0.1805 0.0022  0.0050  -0.0263 30   THR A C   
213  O  O   . THR A 28  ? 0.2245 0.2875 0.1591 -0.0090 0.0109  -0.0201 30   THR A O   
214  C  CB  . THR A 28  ? 0.3073 0.2459 0.2006 -0.0193 0.0557  0.0240  30   THR A CB  
215  O  OG1 . THR A 28  ? 0.3173 0.2652 0.2311 -0.0026 0.0643  -0.0020 30   THR A OG1 
216  C  CG2 . THR A 28  ? 0.3246 0.2447 0.1567 0.0187  -0.0097 0.0157  30   THR A CG2 
217  N  N   . ILE A 29  ? 0.2300 0.2217 0.1854 0.0156  -0.0129 -0.0043 31   ILE A N   
218  C  CA  . ILE A 29  ? 0.2283 0.1911 0.1619 0.0001  -0.0180 0.0051  31   ILE A CA  
219  C  C   . ILE A 29  ? 0.2090 0.2006 0.1690 0.0003  -0.0130 0.0042  31   ILE A C   
220  O  O   . ILE A 29  ? 0.2260 0.1944 0.2548 -0.0130 -0.0271 -0.0160 31   ILE A O   
221  C  CB  . ILE A 29  ? 0.2277 0.1736 0.1746 0.0081  -0.0485 -0.0254 31   ILE A CB  
222  C  CG1 . ILE A 29  ? 0.2335 0.1965 0.2146 0.0040  -0.0539 0.0266  31   ILE A CG1 
223  C  CG2 . ILE A 29  ? 0.2570 0.2258 0.1754 -0.0137 0.0047  -0.0131 31   ILE A CG2 
224  C  CD1 . ILE A 29  ? 0.3179 0.2806 0.1647 -0.0028 -0.0160 0.0561  31   ILE A CD1 
225  N  N   . ILE A 30  ? 0.2140 0.1985 0.1881 0.0128  -0.0148 -0.0157 32   ILE A N   
226  C  CA  . ILE A 30  ? 0.2010 0.1953 0.1679 0.0006  0.0089  -0.0027 32   ILE A CA  
227  C  C   . ILE A 30  ? 0.1887 0.2003 0.1681 0.0044  0.0021  -0.0079 32   ILE A C   
228  O  O   . ILE A 30  ? 0.1966 0.2127 0.1749 -0.0115 0.0078  0.0037  32   ILE A O   
229  C  CB  . ILE A 30  ? 0.2435 0.1831 0.1658 0.0098  -0.0014 -0.0120 32   ILE A CB  
230  C  CG1 . ILE A 30  ? 0.2280 0.2514 0.1674 -0.0262 0.0285  0.0019  32   ILE A CG1 
231  C  CG2 . ILE A 30  ? 0.3597 0.1782 0.2013 0.0099  -0.0337 0.0077  32   ILE A CG2 
232  C  CD1 . ILE A 30  ? 0.3394 0.2944 0.1646 -0.0118 0.0038  -0.0140 32   ILE A CD1 
233  N  N   . LEU A 31  ? 0.1779 0.2066 0.1782 -0.0069 0.0292  -0.0125 33   LEU A N   
234  C  CA  . LEU A 31  ? 0.1960 0.2166 0.1644 0.0224  0.0138  -0.0156 33   LEU A CA  
235  C  C   . LEU A 31  ? 0.1943 0.1866 0.1614 -0.0013 0.0219  -0.0074 33   LEU A C   
236  O  O   . LEU A 31  ? 0.2742 0.1831 0.1714 -0.0266 0.0033  -0.0255 33   LEU A O   
237  C  CB  . LEU A 31  ? 0.1934 0.2297 0.1859 0.0130  0.0123  -0.0254 33   LEU A CB  
238  C  CG  . LEU A 31  ? 0.1822 0.2547 0.2501 -0.0070 -0.0187 0.0002  33   LEU A CG  
239  C  CD1 . LEU A 31  ? 0.2577 0.3031 0.2134 -0.0263 -0.0482 0.0049  33   LEU A CD1 
240  C  CD2 . LEU A 31  ? 0.2224 0.3005 0.2586 -0.0129 -0.0290 0.0529  33   LEU A CD2 
241  N  N   . TYR A 32  ? 0.1964 0.2181 0.1839 -0.0067 -0.0001 0.0074  34   TYR A N   
242  C  CA  . TYR A 32  ? 0.2224 0.2101 0.1651 -0.0027 -0.0082 -0.0080 34   TYR A CA  
243  C  C   . TYR A 32  ? 0.1992 0.1930 0.1585 -0.0203 0.0121  0.0096  34   TYR A C   
244  O  O   . TYR A 32  ? 0.2188 0.2042 0.1785 -0.0229 0.0048  0.0313  34   TYR A O   
245  C  CB  . TYR A 32  ? 0.2286 0.1934 0.1454 -0.0026 -0.0138 0.0050  34   TYR A CB  
246  C  CG  . TYR A 32  ? 0.2214 0.1803 0.1276 -0.0004 -0.0256 -0.0052 34   TYR A CG  
247  C  CD1 . TYR A 32  ? 0.1965 0.2096 0.1923 0.0148  -0.0108 0.0322  34   TYR A CD1 
248  C  CD2 . TYR A 32  ? 0.2645 0.1831 0.1749 0.0180  0.0114  0.0189  34   TYR A CD2 
249  C  CE1 . TYR A 32  ? 0.2159 0.2023 0.1950 0.0061  0.0037  0.0225  34   TYR A CE1 
250  C  CE2 . TYR A 32  ? 0.1720 0.1925 0.1987 -0.0166 -0.0146 0.0272  34   TYR A CE2 
251  C  CZ  . TYR A 32  ? 0.1371 0.2130 0.2519 -0.0124 -0.0095 0.0541  34   TYR A CZ  
252  O  OH  . TYR A 32  ? 0.2408 0.1832 0.1879 0.0210  0.0005  0.0172  34   TYR A OH  
253  N  N   . LEU A 33  ? 0.2129 0.1813 0.1640 0.0309  0.0090  0.0068  35   LEU A N   
254  C  CA  . LEU A 33  ? 0.2051 0.1932 0.1605 0.0369  0.0096  0.0108  35   LEU A CA  
255  C  C   . LEU A 33  ? 0.2625 0.1899 0.1504 0.0108  0.0188  -0.0083 35   LEU A C   
256  O  O   . LEU A 33  ? 0.3659 0.1796 0.3137 0.0197  0.0251  -0.0224 35   LEU A O   
257  C  CB  . LEU A 33  ? 0.2364 0.2214 0.1577 0.0026  0.0126  -0.0014 35   LEU A CB  
258  C  CG  . LEU A 33  ? 0.2563 0.1955 0.1570 0.0170  0.0125  0.0190  35   LEU A CG  
259  C  CD1 . LEU A 33  ? 0.3763 0.3002 0.1721 -0.0082 -0.0118 0.0695  35   LEU A CD1 
260  C  CD2 . LEU A 33  ? 0.2332 0.2612 0.1906 0.0087  0.0300  0.0126  35   LEU A CD2 
261  N  N   . GLU A 34  ? 0.2493 0.2347 0.1974 -0.0145 0.0381  -0.0144 36   GLU A N   
262  C  CA  . GLU A 34  ? 0.3059 0.3525 0.2333 -0.1120 0.0347  -0.0301 36   GLU A CA  
263  C  C   . GLU A 34  ? 0.2895 0.2868 0.2495 -0.0497 0.0792  -0.0094 36   GLU A C   
264  O  O   . GLU A 34  ? 0.4018 0.2853 0.2669 -0.0642 0.0166  0.0207  36   GLU A O   
265  C  CB  A GLU A 34  ? 0.2859 0.4323 0.2769 -0.1243 0.0320  -0.0107 36   GLU A CB  
266  C  CB  B GLU A 34  ? 0.3001 0.4284 0.2908 -0.1310 0.0162  -0.0156 36   GLU A CB  
267  C  CG  A GLU A 34  ? 0.3980 0.4889 0.2745 -0.2175 -0.0341 0.0236  36   GLU A CG  
268  C  CG  B GLU A 34  ? 0.2603 0.4660 0.3859 -0.0866 0.0268  -0.0037 36   GLU A CG  
269  C  CD  A GLU A 34  ? 0.4623 0.5344 0.3530 -0.1794 -0.1057 -0.0083 36   GLU A CD  
270  C  CD  B GLU A 34  ? 0.3935 0.4812 0.4443 -0.0896 -0.0736 -0.0066 36   GLU A CD  
271  O  OE1 A GLU A 34  ? 0.6365 0.6135 0.3656 -0.2395 -0.1959 0.0378  36   GLU A OE1 
272  O  OE1 B GLU A 34  ? 0.6622 0.5108 0.4103 -0.2729 -0.1100 -0.0614 36   GLU A OE1 
273  O  OE2 A GLU A 34  ? 0.4592 0.5249 0.5310 -0.1303 -0.0996 -0.1407 36   GLU A OE2 
274  O  OE2 B GLU A 34  ? 0.4154 0.2590 0.6954 0.0660  -0.1100 0.1087  36   GLU A OE2 
275  N  N   . ASN A 35  ? 0.3947 0.2738 0.1977 -0.0537 0.0441  0.0260  37   ASN A N   
276  C  CA  . ASN A 35  ? 0.2583 0.2723 0.2105 -0.0253 0.0617  0.0248  37   ASN A CA  
277  C  C   . ASN A 35  ? 0.2835 0.2359 0.2271 -0.0015 0.0022  0.0478  37   ASN A C   
278  O  O   . ASN A 35  ? 0.2520 0.2434 0.2208 0.0022  0.0372  0.0399  37   ASN A O   
279  C  CB  . ASN A 35  ? 0.2852 0.3443 0.2947 0.0335  0.0040  0.0179  37   ASN A CB  
280  C  CG  . ASN A 35  ? 0.2757 0.3174 0.3146 0.0159  0.0360  0.0216  37   ASN A CG  
281  O  OD1 . ASN A 35  ? 0.5063 0.4052 0.4251 -0.1050 -0.0137 0.0949  37   ASN A OD1 
282  N  ND2 . ASN A 35  ? 0.4150 0.4338 0.3488 -0.1071 -0.0902 0.0690  37   ASN A ND2 
283  N  N   . PRO A 36  ? 0.2764 0.2130 0.2158 -0.0151 0.0314  0.0206  38   PRO A N   
284  C  CA  . PRO A 36  ? 0.2900 0.1825 0.2034 0.0004  -0.0117 0.0718  38   PRO A CA  
285  C  C   . PRO A 36  ? 0.2154 0.2057 0.2184 0.0328  -0.0153 0.0555  38   PRO A C   
286  O  O   . PRO A 36  ? 0.2640 0.1942 0.2264 0.0232  0.0150  0.0528  38   PRO A O   
287  C  CB  . PRO A 36  ? 0.2707 0.2460 0.2709 0.0050  0.0543  0.0346  38   PRO A CB  
288  C  CG  . PRO A 36  ? 0.3252 0.2259 0.3460 0.0229  0.0485  -0.0163 38   PRO A CG  
289  C  CD  . PRO A 36  ? 0.3246 0.1902 0.3073 -0.0347 0.0447  0.0282  38   PRO A CD  
290  N  N   . PRO A 37  ? 0.2445 0.2577 0.2226 0.0044  -0.0202 0.0423  39   PRO A N   
291  C  CA  . PRO A 37  ? 0.3054 0.2420 0.2202 -0.0294 -0.0013 0.0458  39   PRO A CA  
292  C  C   . PRO A 37  ? 0.2651 0.2481 0.1993 0.0106  0.0335  0.0299  39   PRO A C   
293  O  O   . PRO A 37  ? 0.2204 0.2904 0.2096 0.0100  0.0201  -0.0042 39   PRO A O   
294  C  CB  . PRO A 37  ? 0.2572 0.2430 0.2063 0.0042  0.0040  0.0295  39   PRO A CB  
295  C  CG  . PRO A 37  ? 0.2459 0.3230 0.2234 -0.0093 0.0007  -0.0068 39   PRO A CG  
296  C  CD  . PRO A 37  ? 0.2681 0.2159 0.2135 -0.0047 0.0035  0.0008  39   PRO A CD  
297  N  N   . SER A 38  ? 0.2421 0.2629 0.1764 0.0119  0.0142  0.0275  40   SER A N   
298  C  CA  . SER A 38  ? 0.2280 0.2359 0.2295 0.0103  0.0354  0.0461  40   SER A CA  
299  C  C   . SER A 38  ? 0.2301 0.2142 0.2059 0.0257  0.0253  0.0116  40   SER A C   
300  O  O   . SER A 38  ? 0.2139 0.2218 0.1918 0.0315  -0.0002 0.0313  40   SER A O   
301  C  CB  . SER A 38  ? 0.2554 0.2496 0.2390 -0.0178 0.0460  0.0716  40   SER A CB  
302  O  OG  . SER A 38  ? 0.2482 0.2845 0.2244 0.0332  0.0377  0.0379  40   SER A OG  
303  N  N   . ARG A 39  ? 0.2512 0.2424 0.1661 -0.0041 0.0149  0.0533  41   ARG A N   
304  C  CA  . ARG A 39  ? 0.2508 0.2064 0.1895 0.0040  0.0052  0.0322  41   ARG A CA  
305  C  C   . ARG A 39  ? 0.2637 0.2244 0.1866 0.0021  0.0222  0.0230  41   ARG A C   
306  O  O   . ARG A 39  ? 0.2690 0.2316 0.1608 -0.0094 -0.0136 0.0258  41   ARG A O   
307  C  CB  . ARG A 39  ? 0.2470 0.2192 0.1859 0.0072  0.0385  0.0526  41   ARG A CB  
308  C  CG  . ARG A 39  ? 0.2563 0.2604 0.2409 0.0255  0.0164  0.0604  41   ARG A CG  
309  C  CD  . ARG A 39  ? 0.2446 0.2363 0.3173 -0.0031 -0.0020 0.0659  41   ARG A CD  
310  N  NE  . ARG A 39  ? 0.2458 0.2244 0.2211 0.0033  -0.0158 0.0565  41   ARG A NE  
311  C  CZ  . ARG A 39  ? 0.2324 0.1668 0.2016 0.0353  -0.0110 0.0304  41   ARG A CZ  
312  N  NH1 . ARG A 39  ? 0.3114 0.2414 0.1872 0.0070  0.0427  0.0178  41   ARG A NH1 
313  N  NH2 . ARG A 39  ? 0.2456 0.2320 0.1674 0.0139  0.0052  0.0342  41   ARG A NH2 
314  N  N   . ASP A 40  ? 0.2520 0.2356 0.2152 0.0446  0.0290  0.0305  42   ASP A N   
315  C  CA  . ASP A 40  ? 0.3282 0.2312 0.2510 0.0845  0.0599  0.0141  42   ASP A CA  
316  C  C   . ASP A 40  ? 0.3313 0.2399 0.2255 0.0235  0.0244  0.0222  42   ASP A C   
317  O  O   . ASP A 40  ? 0.3751 0.2538 0.1916 0.0114  0.0387  -0.0118 42   ASP A O   
318  C  CB  . ASP A 40  ? 0.4410 0.2373 0.2638 0.0397  0.1146  0.0149  42   ASP A CB  
319  C  CG  . ASP A 40  ? 0.5657 0.2488 0.3462 -0.0107 0.0821  0.0726  42   ASP A CG  
320  O  OD1 . ASP A 40  ? 0.6280 0.3535 0.3114 0.0785  -0.0257 0.0458  42   ASP A OD1 
321  O  OD2 . ASP A 40  ? 0.7832 0.3909 0.3127 -0.0175 0.1982  0.0789  42   ASP A OD2 
322  N  N   . GLU A 41  ? 0.2735 0.2604 0.2220 0.0402  0.0520  0.0195  43   GLU A N   
323  C  CA  . GLU A 41  ? 0.2641 0.2525 0.1945 0.0126  0.0239  -0.0019 43   GLU A CA  
324  C  C   . GLU A 41  ? 0.2193 0.2250 0.2231 0.0290  0.0032  0.0123  43   GLU A C   
325  O  O   . GLU A 41  ? 0.2746 0.2308 0.2134 0.0054  0.0224  -0.0156 43   GLU A O   
326  C  CB  A GLU A 41  ? 0.2191 0.2533 0.2122 0.0339  0.0627  0.0024  43   GLU A CB  
327  C  CB  B GLU A 41  ? 0.2452 0.3466 0.2376 -0.0274 0.0169  0.0555  43   GLU A CB  
328  C  CG  A GLU A 41  ? 0.2260 0.2389 0.2197 -0.0281 0.0249  0.0242  43   GLU A CG  
329  C  CG  B GLU A 41  ? 0.2840 0.4053 0.2199 -0.0854 0.0401  -0.0100 43   GLU A CG  
330  C  CD  A GLU A 41  ? 0.2131 0.2416 0.2252 0.0465  -0.0493 0.0201  43   GLU A CD  
331  C  CD  B GLU A 41  ? 0.2175 0.3022 0.2422 0.0369  0.0437  0.0114  43   GLU A CD  
332  O  OE1 A GLU A 41  ? 0.3747 0.2195 0.2491 0.0778  0.0189  0.0060  43   GLU A OE1 
333  O  OE1 B GLU A 41  ? 0.1945 0.1762 0.2245 -0.0071 0.0151  0.0561  43   GLU A OE1 
334  O  OE2 A GLU A 41  ? 0.2765 0.2889 0.3476 -0.0721 0.1926  -0.0938 43   GLU A OE2 
335  O  OE2 B GLU A 41  ? 0.2638 0.5280 0.3756 -0.0848 0.1438  -0.0652 43   GLU A OE2 
336  N  N   . LEU A 42  ? 0.2668 0.2125 0.1811 0.0023  0.0261  0.0147  44   LEU A N   
337  C  CA  . LEU A 42  ? 0.2263 0.2038 0.1750 0.0168  -0.0025 0.0239  44   LEU A CA  
338  C  C   . LEU A 42  ? 0.2635 0.1951 0.1783 0.0056  -0.0273 0.0295  44   LEU A C   
339  O  O   . LEU A 42  ? 0.2499 0.1924 0.1407 0.0114  -0.0003 0.0013  44   LEU A O   
340  C  CB  . LEU A 42  ? 0.2324 0.2200 0.1643 0.0035  -0.0007 0.0151  44   LEU A CB  
341  C  CG  . LEU A 42  ? 0.2438 0.1830 0.1987 0.0257  0.0195  0.0230  44   LEU A CG  
342  C  CD1 . LEU A 42  ? 0.2392 0.2190 0.1966 -0.0188 -0.0125 0.0417  44   LEU A CD1 
343  C  CD2 . LEU A 42  ? 0.2459 0.2182 0.2064 0.0212  -0.0118 -0.0128 44   LEU A CD2 
344  N  N   . VAL A 43  ? 0.3180 0.2302 0.1535 -0.0118 -0.0274 0.0284  45   VAL A N   
345  C  CA  . VAL A 43  ? 0.2985 0.2314 0.1746 0.0137  -0.0356 0.0308  45   VAL A CA  
346  C  C   . VAL A 43  ? 0.3225 0.2194 0.1704 0.0151  -0.0537 0.0336  45   VAL A C   
347  O  O   . VAL A 43  ? 0.3503 0.2446 0.1795 -0.0045 -0.0290 0.0140  45   VAL A O   
348  C  CB  . VAL A 43  ? 0.3580 0.2178 0.1907 0.0483  -0.0593 0.0280  45   VAL A CB  
349  C  CG1 . VAL A 43  ? 0.3855 0.2019 0.1694 0.0281  -0.0469 0.0354  45   VAL A CG1 
350  C  CG2 . VAL A 43  ? 0.4163 0.2152 0.2576 0.0412  -0.0744 -0.0037 45   VAL A CG2 
351  N  N   . LYS A 44  ? 0.3364 0.2270 0.2502 0.0297  -0.0342 0.0243  46   LYS A N   
352  C  CA  . LYS A 44  ? 0.3353 0.2235 0.2048 0.0085  -0.0135 0.0305  46   LYS A CA  
353  C  C   . LYS A 44  ? 0.3273 0.2231 0.1851 0.0026  -0.0064 0.0142  46   LYS A C   
354  O  O   . LYS A 44  ? 0.3245 0.2219 0.1956 -0.0012 0.0057  0.0057  46   LYS A O   
355  C  CB  . LYS A 44  ? 0.3661 0.2671 0.1966 0.0186  0.0243  0.0381  46   LYS A CB  
356  C  CG  . LYS A 44  ? 0.4268 0.3188 0.2628 0.0792  0.0111  -0.0032 46   LYS A CG  
357  C  CD  . LYS A 44  ? 0.5460 0.4920 0.5276 0.1003  0.1877  -0.0751 46   LYS A CD  
358  C  CE  . LYS A 44  ? 0.5868 0.5796 0.5946 0.1917  0.2432  -0.0392 46   LYS A CE  
359  N  NZ  . LYS A 44  ? 0.5578 0.9838 0.9785 0.2411  0.1752  -0.0418 46   LYS A NZ  
360  N  N   . LEU A 45  ? 0.2756 0.2179 0.1936 0.0220  -0.0144 0.0161  47   LEU A N   
361  C  CA  . LEU A 45  ? 0.2387 0.2078 0.1923 0.0238  -0.0403 0.0121  47   LEU A CA  
362  C  C   . LEU A 45  ? 0.2448 0.2240 0.1359 0.0144  -0.0255 -0.0263 47   LEU A C   
363  O  O   . LEU A 45  ? 0.2671 0.2342 0.2046 0.0010  -0.0025 -0.0141 47   LEU A O   
364  C  CB  . LEU A 45  ? 0.2355 0.1871 0.1876 -0.0120 -0.0052 -0.0021 47   LEU A CB  
365  C  CG  . LEU A 45  ? 0.2238 0.1770 0.1683 -0.0087 0.0059  0.0154  47   LEU A CG  
366  C  CD1 . LEU A 45  ? 0.2677 0.2375 0.2225 0.0130  -0.0591 -0.0214 47   LEU A CD1 
367  C  CD2 . LEU A 45  ? 0.2917 0.2062 0.2249 0.0309  -0.0467 0.0180  47   LEU A CD2 
368  N  N   . ILE A 46  ? 0.2383 0.2400 0.1952 0.0174  0.0007  -0.0347 48   ILE A N   
369  C  CA  . ILE A 46  ? 0.2378 0.2218 0.2222 0.0052  -0.0118 -0.0289 48   ILE A CA  
370  C  C   . ILE A 46  ? 0.2427 0.2425 0.2558 0.0167  -0.0107 -0.0595 48   ILE A C   
371  O  O   . ILE A 46  ? 0.2608 0.2375 0.2852 0.0014  -0.0560 -0.0384 48   ILE A O   
372  C  CB  . ILE A 46  ? 0.2161 0.2381 0.2045 0.0163  -0.0533 -0.0381 48   ILE A CB  
373  C  CG1 . ILE A 46  ? 0.2437 0.1879 0.2227 -0.0396 -0.0433 -0.0205 48   ILE A CG1 
374  C  CG2 . ILE A 46  ? 0.2204 0.2803 0.2269 0.0088  -0.0714 -0.0359 48   ILE A CG2 
375  C  CD1 . ILE A 46  ? 0.3004 0.2105 0.1862 0.0037  0.0093  -0.0080 48   ILE A CD1 
376  N  N   . ALA A 47  ? 0.2957 0.2702 0.2366 -0.0029 -0.0563 -0.0453 49   ALA A N   
377  C  CA  . ALA A 47  ? 0.2874 0.2823 0.2556 0.0328  -0.1235 -0.0399 49   ALA A CA  
378  C  C   . ALA A 47  ? 0.2862 0.2715 0.1637 0.0216  -0.0517 -0.0353 49   ALA A C   
379  O  O   . ALA A 47  ? 0.3112 0.2884 0.3274 0.0110  -0.0679 -0.0638 49   ALA A O   
380  C  CB  . ALA A 47  ? 0.4619 0.2388 0.2277 0.0818  -0.1465 -0.0164 49   ALA A CB  
381  N  N   . ASP A 48  ? 0.3101 0.2822 0.1997 0.0314  -0.0942 0.0010  50   ASP A N   
382  C  CA  . ASP A 48  ? 0.2874 0.2616 0.2008 0.0194  -0.0578 -0.0475 50   ASP A CA  
383  C  C   . ASP A 48  ? 0.2591 0.2387 0.2597 0.0284  -0.0265 -0.0200 50   ASP A C   
384  O  O   . ASP A 48  ? 0.3222 0.2440 0.2907 0.0115  -0.0580 -0.0308 50   ASP A O   
385  C  CB  . ASP A 48  ? 0.2832 0.2290 0.1898 -0.0002 -0.0286 -0.0567 50   ASP A CB  
386  C  CG  . ASP A 48  ? 0.3161 0.2737 0.1953 0.0235  -0.0458 0.0091  50   ASP A CG  
387  O  OD1 . ASP A 48  ? 0.3334 0.3507 0.2183 -0.0337 -0.0021 -0.0088 50   ASP A OD1 
388  O  OD2 . ASP A 48  ? 0.4202 0.3720 0.2119 0.0882  -0.0896 -0.0121 50   ASP A OD2 
389  N  N   . MET A 49  ? 0.3171 0.2473 0.2136 0.0308  -0.0350 -0.0085 51   MET A N   
390  C  CA  . MET A 49  ? 0.3109 0.2244 0.2411 0.0517  -0.0358 0.0220  51   MET A CA  
391  C  C   . MET A 49  ? 0.3326 0.3305 0.2508 0.0061  -0.0057 -0.0296 51   MET A C   
392  O  O   . MET A 49  ? 0.3606 0.2561 0.3754 0.0028  0.0083  0.0043  51   MET A O   
393  C  CB  . MET A 49  ? 0.2627 0.3061 0.2443 -0.0016 0.0368  -0.0089 51   MET A CB  
394  C  CG  . MET A 49  ? 0.2677 0.2489 0.2886 0.0386  0.0001  -0.0261 51   MET A CG  
395  S  SD  . MET A 49  ? 0.3220 0.2780 0.2280 0.0164  0.0007  0.0192  51   MET A SD  
396  C  CE  . MET A 49  ? 0.4326 0.2683 0.2024 0.1162  0.0248  -0.0327 51   MET A CE  
397  N  N   . GLY A 50  ? 0.3464 0.3304 0.2830 -0.0309 -0.0937 -0.0625 52   GLY A N   
398  C  CA  . GLY A 50  ? 0.3125 0.3235 0.4128 0.0105  -0.0491 -0.1587 52   GLY A CA  
399  C  C   . GLY A 50  ? 0.4100 0.3985 0.3631 -0.0972 0.0222  -0.1678 52   GLY A C   
400  O  O   . GLY A 50  ? 0.3930 0.3504 0.5657 -0.0764 0.0568  -0.2464 52   GLY A O   
401  N  N   . ILE A 51  ? 0.2606 0.2994 0.3349 -0.0017 -0.0428 -0.0980 53   ILE A N   
402  C  CA  . ILE A 51  ? 0.2496 0.2430 0.2980 -0.0065 -0.0500 -0.0473 53   ILE A CA  
403  C  C   . ILE A 51  ? 0.2356 0.2655 0.2823 0.0036  -0.0624 -0.0213 53   ILE A C   
404  O  O   . ILE A 51  ? 0.2886 0.2478 0.2907 0.0132  -0.0153 -0.0461 53   ILE A O   
405  C  CB  . ILE A 51  ? 0.3512 0.2348 0.2727 -0.0349 -0.0423 0.0246  53   ILE A CB  
406  C  CG1 . ILE A 51  ? 0.3013 0.1982 0.3234 0.0244  -0.1055 -0.0580 53   ILE A CG1 
407  C  CG2 . ILE A 51  ? 0.3684 0.2275 0.3497 0.0179  -0.0282 0.0030  53   ILE A CG2 
408  C  CD1 . ILE A 51  ? 0.3067 0.2495 0.2775 0.0678  -0.0552 -0.0452 53   ILE A CD1 
409  N  N   . SER A 52  ? 0.2441 0.2279 0.2660 -0.0179 -0.0497 -0.0236 54   SER A N   
410  C  CA  . SER A 52  ? 0.2299 0.2246 0.3098 -0.0288 -0.0101 -0.0180 54   SER A CA  
411  C  C   . SER A 52  ? 0.1843 0.2064 0.3286 -0.0028 -0.0575 0.0308  54   SER A C   
412  O  O   . SER A 52  ? 0.2497 0.1843 0.2293 0.0262  -0.0109 0.0109  54   SER A O   
413  C  CB  . SER A 52  ? 0.1923 0.2435 0.2657 -0.0259 -0.0593 0.0504  54   SER A CB  
414  O  OG  . SER A 52  ? 0.2409 0.2376 0.2718 -0.0185 -0.0302 -0.0022 54   SER A OG  
415  N  N   . VAL A 53  ? 0.2813 0.2028 0.1845 -0.0179 -0.0525 -0.0003 55   VAL A N   
416  C  CA  . VAL A 53  ? 0.2164 0.2101 0.1937 -0.0122 -0.0042 -0.0123 55   VAL A CA  
417  C  C   . VAL A 53  ? 0.2139 0.1433 0.1957 0.0229  -0.0133 -0.0120 55   VAL A C   
418  O  O   . VAL A 53  ? 0.2131 0.1812 0.1975 -0.0051 -0.0155 -0.0076 55   VAL A O   
419  C  CB  . VAL A 53  ? 0.2608 0.2082 0.2053 -0.0295 0.0296  -0.0088 55   VAL A CB  
420  C  CG1 . VAL A 53  ? 0.2288 0.2214 0.2121 -0.0303 0.0468  -0.0255 55   VAL A CG1 
421  C  CG2 . VAL A 53  ? 0.2263 0.2249 0.1872 -0.0202 -0.0155 -0.0063 55   VAL A CG2 
422  N  N   . ARG A 54  ? 0.2098 0.2182 0.1719 -0.0053 -0.0150 -0.0033 56   ARG A N   
423  C  CA  . ARG A 54  ? 0.2274 0.1970 0.1895 -0.0179 0.0016  -0.0145 56   ARG A CA  
424  C  C   . ARG A 54  ? 0.2495 0.1993 0.1805 -0.0252 0.0231  -0.0025 56   ARG A C   
425  O  O   . ARG A 54  ? 0.2477 0.2190 0.1937 0.0292  0.0070  -0.0182 56   ARG A O   
426  C  CB  . ARG A 54  ? 0.2248 0.2263 0.2104 -0.0303 0.0199  -0.0037 56   ARG A CB  
427  C  CG  . ARG A 54  ? 0.2257 0.1708 0.2027 0.0029  0.0022  0.0130  56   ARG A CG  
428  C  CD  . ARG A 54  ? 0.2126 0.1912 0.2615 -0.0190 0.0202  -0.0330 56   ARG A CD  
429  N  NE  . ARG A 54  ? 0.2333 0.2127 0.2122 0.0402  -0.0079 -0.0103 56   ARG A NE  
430  C  CZ  . ARG A 54  ? 0.2723 0.1747 0.1946 -0.0146 -0.0102 0.0240  56   ARG A CZ  
431  N  NH1 . ARG A 54  ? 0.2751 0.1890 0.2178 -0.0037 0.0063  0.0349  56   ARG A NH1 
432  N  NH2 . ARG A 54  ? 0.3272 0.2103 0.2044 -0.0077 -0.0300 0.0303  56   ARG A NH2 
433  N  N   . ALA A 55  ? 0.2497 0.2025 0.2313 -0.0014 -0.0175 -0.0164 57   ALA A N   
434  C  CA  . ALA A 55  ? 0.2567 0.2002 0.2449 -0.0142 -0.0291 -0.0052 57   ALA A CA  
435  C  C   . ALA A 55  ? 0.2740 0.1990 0.2148 -0.0313 -0.0425 -0.0057 57   ALA A C   
436  O  O   . ALA A 55  ? 0.2451 0.2383 0.2522 -0.0055 -0.0117 0.0410  57   ALA A O   
437  C  CB  . ALA A 55  ? 0.2027 0.2044 0.3145 -0.0310 -0.0082 -0.0218 57   ALA A CB  
438  N  N   . LEU A 56  ? 0.2464 0.1675 0.2277 0.0136  -0.0243 0.0032  58   LEU A N   
439  C  CA  . LEU A 56  ? 0.2265 0.1506 0.2009 0.0422  -0.0106 0.0149  58   LEU A CA  
440  C  C   . LEU A 56  ? 0.2088 0.2041 0.2151 0.0171  0.0069  -0.0181 58   LEU A C   
441  O  O   . LEU A 56  ? 0.2060 0.2434 0.1873 0.0280  0.0177  -0.0167 58   LEU A O   
442  C  CB  . LEU A 56  ? 0.2557 0.2277 0.1566 -0.0216 -0.0443 0.0088  58   LEU A CB  
443  C  CG  . LEU A 56  ? 0.2426 0.1719 0.1831 0.0002  -0.0064 0.0146  58   LEU A CG  
444  C  CD1 . LEU A 56  ? 0.2863 0.1689 0.1622 0.0271  0.0064  -0.0090 58   LEU A CD1 
445  C  CD2 . LEU A 56  ? 0.2939 0.2205 0.1697 -0.0408 -0.0074 0.0107  58   LEU A CD2 
446  N  N   . LEU A 57  ? 0.2253 0.1910 0.1781 0.0348  -0.0085 -0.0008 59   LEU A N   
447  C  CA  . LEU A 57  ? 0.2295 0.1856 0.1821 0.0325  -0.0114 0.0019  59   LEU A CA  
448  C  C   . LEU A 57  ? 0.1963 0.1778 0.1865 0.0336  -0.0204 0.0003  59   LEU A C   
449  O  O   . LEU A 57  ? 0.2238 0.2457 0.1702 -0.0174 -0.0293 0.0039  59   LEU A O   
450  C  CB  . LEU A 57  ? 0.2394 0.1550 0.2049 0.0231  -0.0382 0.0046  59   LEU A CB  
451  C  CG  . LEU A 57  ? 0.2348 0.2009 0.2431 0.0122  -0.0413 0.0461  59   LEU A CG  
452  C  CD1 . LEU A 57  ? 0.2328 0.2037 0.1751 0.0158  -0.0535 0.0048  59   LEU A CD1 
453  C  CD2 . LEU A 57  ? 0.2443 0.1952 0.2307 0.0132  0.0251  0.0084  59   LEU A CD2 
454  N  N   . ALA A 58  ? 0.1906 0.1928 0.1788 0.0179  -0.0042 -0.0014 60   ALA A N   
455  C  CA  . ALA A 58  ? 0.2319 0.1607 0.1765 0.0002  -0.0125 -0.0086 60   ALA A CA  
456  C  C   . ALA A 58  ? 0.2207 0.1826 0.1759 -0.0086 -0.0147 -0.0264 60   ALA A C   
457  O  O   . ALA A 58  ? 0.2322 0.1875 0.1621 0.0108  0.0041  -0.0213 60   ALA A O   
458  C  CB  . ALA A 58  ? 0.2304 0.2217 0.1982 0.0290  -0.0320 0.0405  60   ALA A CB  
459  N  N   . LYS A 59  ? 0.2883 0.2010 0.1498 0.0164  0.0084  0.0096  61   LYS A N   
460  C  CA  . LYS A 59  ? 0.3462 0.1798 0.1619 -0.0219 0.0492  -0.0103 61   LYS A CA  
461  C  C   . LYS A 59  ? 0.3789 0.3060 0.1423 -0.1145 0.0639  -0.0104 61   LYS A C   
462  O  O   . LYS A 59  ? 0.5037 0.3412 0.1991 -0.0310 -0.0472 -0.0232 61   LYS A O   
463  C  CB  . LYS A 59  ? 0.2706 0.2402 0.2457 0.0096  0.0132  0.0109  61   LYS A CB  
464  C  CG  . LYS A 59  ? 0.2536 0.2321 0.2675 0.0521  -0.0301 0.0264  61   LYS A CG  
465  C  CD  . LYS A 59  ? 0.3357 0.3816 0.3362 -0.0658 -0.0393 0.0261  61   LYS A CD  
466  C  CE  . LYS A 59  ? 0.5044 0.4958 0.4323 -0.2151 -0.1484 0.0530  61   LYS A CE  
467  N  NZ  . LYS A 59  ? 0.6695 1.1895 0.5889 -0.6165 -0.2235 0.1719  61   LYS A NZ  
468  N  N   . ASN A 60  ? 0.3639 0.3612 0.1525 -0.1469 0.0775  -0.0450 62   ASN A N   
469  C  CA  . ASN A 60  ? 0.2829 0.2736 0.1711 -0.0587 0.0499  -0.0360 62   ASN A CA  
470  C  C   . ASN A 60  ? 0.2230 0.2592 0.1696 0.0155  0.0285  0.0593  62   ASN A C   
471  O  O   . ASN A 60  ? 0.3043 0.2314 0.1966 -0.0189 -0.0219 0.0601  62   ASN A O   
472  C  CB  A ASN A 60  ? 0.4752 0.2606 0.1950 -0.1232 0.0490  -0.0404 62   ASN A CB  
473  C  CB  B ASN A 60  ? 0.3228 0.2562 0.1813 -0.0738 0.0622  -0.0542 62   ASN A CB  
474  C  CG  A ASN A 60  ? 0.5033 0.3257 0.1739 -0.1493 0.0742  -0.0141 62   ASN A CG  
475  C  CG  B ASN A 60  ? 0.2591 0.2130 0.1769 -0.0201 0.0116  -0.0438 62   ASN A CG  
476  O  OD1 A ASN A 60  ? 0.4521 0.3141 0.3376 -0.0310 0.0200  -0.1184 62   ASN A OD1 
477  O  OD1 B ASN A 60  ? 0.2744 0.2660 0.1911 0.0319  0.0167  -0.0465 62   ASN A OD1 
478  N  ND2 A ASN A 60  ? 0.8074 0.5911 0.1652 -0.1751 0.2365  -0.0814 62   ASN A ND2 
479  N  ND2 B ASN A 60  ? 0.2720 0.2116 0.2118 -0.0322 0.0397  0.0067  62   ASN A ND2 
480  N  N   . VAL A 61  ? 0.3060 0.2172 0.1485 -0.0260 0.0304  0.0237  63   VAL A N   
481  C  CA  . VAL A 61  ? 0.2956 0.1778 0.1272 -0.0052 0.0175  0.0166  63   VAL A CA  
482  C  C   . VAL A 61  ? 0.2311 0.1916 0.1638 0.0072  0.0054  0.0033  63   VAL A C   
483  O  O   . VAL A 61  ? 0.2058 0.2276 0.1635 -0.0087 0.0211  0.0152  63   VAL A O   
484  C  CB  . VAL A 61  ? 0.2425 0.1774 0.1427 0.0233  -0.0139 0.0247  63   VAL A CB  
485  C  CG1 . VAL A 61  ? 0.2433 0.1561 0.2116 -0.0018 -0.0607 0.0120  63   VAL A CG1 
486  C  CG2 . VAL A 61  ? 0.1873 0.1853 0.1341 0.0289  0.0077  0.0055  63   VAL A CG2 
487  N  N   . GLU A 62  ? 0.1795 0.1806 0.1605 0.0223  0.0256  0.0086  64   GLU A N   
488  C  CA  . GLU A 62  ? 0.1837 0.1819 0.1328 0.0063  0.0186  0.0126  64   GLU A CA  
489  C  C   . GLU A 62  ? 0.1967 0.1839 0.1390 0.0024  0.0050  0.0181  64   GLU A C   
490  O  O   . GLU A 62  ? 0.1791 0.2076 0.1699 -0.0058 -0.0098 0.0150  64   GLU A O   
491  C  CB  . GLU A 62  ? 0.1935 0.2118 0.1290 -0.0236 0.0143  0.0244  64   GLU A CB  
492  C  CG  . GLU A 62  ? 0.2153 0.1998 0.2500 -0.0373 -0.0190 0.0249  64   GLU A CG  
493  C  CD  . GLU A 62  ? 0.2510 0.2034 0.2579 -0.0108 -0.0550 0.0041  64   GLU A CD  
494  O  OE1 . GLU A 62  ? 0.2799 0.2076 0.2263 -0.0116 -0.0249 -0.0003 64   GLU A OE1 
495  O  OE2 . GLU A 62  ? 0.2761 0.2300 0.2967 -0.0033 -0.0877 0.0037  64   GLU A OE2 
496  N  N   . PRO A 63  ? 0.2140 0.1905 0.1420 -0.0004 0.0146  0.0360  65   PRO A N   
497  C  CA  . PRO A 63  ? 0.2136 0.2134 0.1411 -0.0187 0.0073  0.0366  65   PRO A CA  
498  C  C   . PRO A 63  ? 0.2090 0.1883 0.1802 0.0030  -0.0003 0.0084  65   PRO A C   
499  O  O   . PRO A 63  ? 0.2067 0.1938 0.1639 0.0275  0.0197  0.0012  65   PRO A O   
500  C  CB  . PRO A 63  ? 0.2317 0.2213 0.1450 -0.0051 0.0153  0.0426  65   PRO A CB  
501  C  CG  . PRO A 63  ? 0.2880 0.3431 0.1520 0.0812  0.0486  0.0695  65   PRO A CG  
502  C  CD  . PRO A 63  ? 0.2419 0.2189 0.1416 0.0315  0.0349  0.0480  65   PRO A CD  
503  N  N   . TYR A 64  ? 0.1727 0.1896 0.1927 0.0115  0.0153  0.0113  66   TYR A N   
504  C  CA  . TYR A 64  ? 0.1853 0.1926 0.1715 0.0024  0.0258  0.0245  66   TYR A CA  
505  C  C   . TYR A 64  ? 0.1635 0.2019 0.1247 0.0129  -0.0210 0.0088  66   TYR A C   
506  O  O   . TYR A 64  ? 0.1871 0.1613 0.1503 0.0121  -0.0468 0.0151  66   TYR A O   
507  C  CB  . TYR A 64  ? 0.2428 0.1787 0.1327 0.0016  0.0027  -0.0119 66   TYR A CB  
508  C  CG  . TYR A 64  ? 0.2092 0.1729 0.1645 0.0250  -0.0026 -0.0141 66   TYR A CG  
509  C  CD1 . TYR A 64  ? 0.2479 0.2289 0.2030 -0.0094 0.0284  -0.0191 66   TYR A CD1 
510  C  CD2 . TYR A 64  ? 0.2367 0.1946 0.1444 -0.0087 -0.0177 0.0047  66   TYR A CD2 
511  C  CE1 . TYR A 64  ? 0.2502 0.2100 0.2395 -0.0132 0.0319  -0.0100 66   TYR A CE1 
512  C  CE2 . TYR A 64  ? 0.2566 0.1741 0.1784 -0.0109 -0.0198 -0.0001 66   TYR A CE2 
513  C  CZ  . TYR A 64  ? 0.2400 0.2070 0.2196 -0.0060 -0.0109 0.0097  66   TYR A CZ  
514  O  OH  . TYR A 64  ? 0.2764 0.2151 0.2647 -0.0400 -0.0057 0.0134  66   TYR A OH  
515  N  N   . GLU A 65  ? 0.2028 0.2282 0.1347 0.0150  -0.0437 -0.0023 67   GLU A N   
516  C  CA  . GLU A 65  ? 0.2660 0.1755 0.1590 -0.0361 -0.0011 -0.0400 67   GLU A CA  
517  C  C   . GLU A 65  ? 0.2366 0.1809 0.1565 -0.0335 0.0018  -0.0309 67   GLU A C   
518  O  O   . GLU A 65  ? 0.2237 0.2017 0.2107 -0.0278 0.0323  -0.0212 67   GLU A O   
519  C  CB  A GLU A 65  ? 0.1846 0.1824 0.1672 -0.0220 0.0010  -0.0289 67   GLU A CB  
520  C  CB  B GLU A 65  ? 0.3195 0.2193 0.1446 -0.0788 0.0097  0.0005  67   GLU A CB  
521  C  CG  A GLU A 65  ? 0.2709 0.1861 0.1816 -0.0243 0.0427  0.0012  67   GLU A CG  
522  C  CG  B GLU A 65  ? 0.2916 0.2183 0.1630 -0.0452 0.0590  0.0072  67   GLU A CG  
523  C  CD  A GLU A 65  ? 0.3006 0.1895 0.1496 -0.0448 0.0210  -0.0182 67   GLU A CD  
524  C  CD  B GLU A 65  ? 0.2449 0.2285 0.2820 -0.0821 0.0032  0.0367  67   GLU A CD  
525  O  OE1 A GLU A 65  ? 0.3127 0.1912 0.1761 -0.0389 0.0411  -0.0022 67   GLU A OE1 
526  O  OE1 B GLU A 65  ? 0.2078 0.2142 0.3076 0.0098  0.0397  0.0446  67   GLU A OE1 
527  O  OE2 A GLU A 65  ? 0.2745 0.1278 0.2039 -0.0350 0.0878  -0.0135 67   GLU A OE2 
528  O  OE2 B GLU A 65  ? 0.3770 0.3040 0.2215 -0.1986 0.0156  -0.1290 67   GLU A OE2 
529  N  N   . GLN A 66  ? 0.2157 0.1742 0.1561 -0.0056 -0.0100 0.0019  68   GLN A N   
530  C  CA  . GLN A 66  ? 0.2416 0.1813 0.1740 -0.0206 -0.0137 0.0319  68   GLN A CA  
531  C  C   . GLN A 66  ? 0.2316 0.1809 0.1721 0.0051  -0.0107 0.0133  68   GLN A C   
532  O  O   . GLN A 66  ? 0.2595 0.1797 0.1816 0.0158  -0.0053 0.0229  68   GLN A O   
533  C  CB  . GLN A 66  ? 0.2269 0.1647 0.1317 -0.0070 0.0203  -0.0042 68   GLN A CB  
534  C  CG  . GLN A 66  ? 0.2253 0.2258 0.1448 -0.0135 0.0090  0.0271  68   GLN A CG  
535  C  CD  . GLN A 66  ? 0.1886 0.1946 0.1601 0.0348  -0.0012 0.0135  68   GLN A CD  
536  O  OE1 . GLN A 66  ? 0.2451 0.2048 0.1859 -0.0334 0.0177  0.0004  68   GLN A OE1 
537  N  NE2 . GLN A 66  ? 0.3001 0.2813 0.1713 -0.0472 -0.0084 -0.0125 68   GLN A NE2 
538  N  N   . LEU A 67  ? 0.2059 0.2094 0.1770 0.0250  -0.0029 0.0078  69   LEU A N   
539  C  CA  . LEU A 67  ? 0.2479 0.1642 0.1727 -0.0137 -0.0057 0.0080  69   LEU A CA  
540  C  C   . LEU A 67  ? 0.2290 0.2131 0.1975 -0.0048 -0.0207 0.0470  69   LEU A C   
541  O  O   . LEU A 67  ? 0.2468 0.2205 0.2104 -0.0310 -0.0340 0.0656  69   LEU A O   
542  C  CB  . LEU A 67  ? 0.2438 0.1975 0.1694 0.0282  -0.0045 0.0356  69   LEU A CB  
543  C  CG  . LEU A 67  ? 0.2919 0.1841 0.1414 -0.0154 0.0397  0.0006  69   LEU A CG  
544  C  CD1 . LEU A 67  ? 0.2716 0.1967 0.1832 0.0257  0.0466  0.0508  69   LEU A CD1 
545  C  CD2 . LEU A 67  ? 0.2848 0.1875 0.2157 0.0166  0.0090  0.0071  69   LEU A CD2 
546  N  N   . GLY A 68  ? 0.2359 0.1692 0.1758 -0.0055 -0.0045 0.0143  70   GLY A N   
547  C  CA  . GLY A 68  ? 0.2362 0.2104 0.2055 -0.0136 0.0130  -0.0179 70   GLY A CA  
548  C  C   . GLY A 68  ? 0.2089 0.1925 0.1697 0.0042  -0.0232 0.0172  70   GLY A C   
549  O  O   . GLY A 68  ? 0.2081 0.2382 0.1748 0.0152  -0.0255 0.0193  70   GLY A O   
550  N  N   . LEU A 69  ? 0.2163 0.2054 0.1453 0.0220  -0.0341 0.0109  71   LEU A N   
551  C  CA  . LEU A 69  ? 0.2221 0.2433 0.1402 -0.0256 0.0212  -0.0056 71   LEU A CA  
552  C  C   . LEU A 69  ? 0.2349 0.2494 0.1253 -0.0411 -0.0281 0.0242  71   LEU A C   
553  O  O   . LEU A 69  ? 0.2567 0.2232 0.1502 -0.0090 -0.0150 0.0038  71   LEU A O   
554  C  CB  . LEU A 69  ? 0.2299 0.2233 0.1554 -0.0174 0.0156  -0.0083 71   LEU A CB  
555  C  CG  . LEU A 69  ? 0.1825 0.1872 0.2401 0.0203  -0.0303 0.0494  71   LEU A CG  
556  C  CD1 . LEU A 69  ? 0.1639 0.2887 0.2235 0.0285  -0.0495 0.0087  71   LEU A CD1 
557  C  CD2 . LEU A 69  ? 0.1785 0.2253 0.1779 -0.0045 -0.0471 0.0253  71   LEU A CD2 
558  N  N   . ALA A 70  ? 0.2131 0.2085 0.1344 -0.0142 -0.0244 0.0341  72   ALA A N   
559  C  CA  . ALA A 70  ? 0.2007 0.2265 0.1657 -0.0160 -0.0115 0.0143  72   ALA A CA  
560  C  C   . ALA A 70  ? 0.2099 0.2078 0.1500 -0.0058 -0.0182 0.0070  72   ALA A C   
561  O  O   . ALA A 70  ? 0.2919 0.2383 0.1907 -0.0304 -0.0783 0.0014  72   ALA A O   
562  C  CB  . ALA A 70  ? 0.2451 0.2883 0.1540 -0.0947 -0.0330 0.0310  72   ALA A CB  
563  N  N   . GLU A 71  ? 0.2405 0.2296 0.1874 -0.0209 -0.0127 0.0546  73   GLU A N   
564  C  CA  . GLU A 71  ? 0.2374 0.2014 0.1591 0.0048  0.0111  0.0332  73   GLU A CA  
565  C  C   . GLU A 71  ? 0.2352 0.1826 0.1673 -0.0064 0.0068  0.0037  73   GLU A C   
566  O  O   . GLU A 71  ? 0.2392 0.2326 0.1545 -0.0071 0.0036  0.0141  73   GLU A O   
567  C  CB  . GLU A 71  ? 0.3023 0.2252 0.2081 0.0412  0.0082  -0.0281 73   GLU A CB  
568  C  CG  . GLU A 71  ? 0.5026 0.3316 0.2811 0.0800  0.1520  -0.0403 73   GLU A CG  
569  C  CD  . GLU A 71  ? 0.6464 0.3027 0.5804 0.1190  0.1206  -0.1599 73   GLU A CD  
570  O  OE1 . GLU A 71  ? 0.9096 0.3360 0.4684 0.0029  0.1489  -0.0178 73   GLU A OE1 
571  O  OE2 . GLU A 71  ? 0.6123 0.4621 1.3198 0.2326  0.1293  -0.0389 73   GLU A OE2 
572  N  N   . ASP A 72  ? 0.2478 0.2603 0.1982 -0.0244 -0.0235 0.0206  74   ASP A N   
573  C  CA  . ASP A 72  ? 0.2544 0.2442 0.1987 -0.0559 -0.0294 0.0258  74   ASP A CA  
574  C  C   . ASP A 72  ? 0.2243 0.2564 0.2074 -0.0182 -0.0106 0.0317  74   ASP A C   
575  O  O   . ASP A 72  ? 0.2306 0.3161 0.2664 -0.0304 -0.0325 0.0680  74   ASP A O   
576  C  CB  . ASP A 72  ? 0.2181 0.2588 0.2511 -0.0378 -0.0434 0.0161  74   ASP A CB  
577  C  CG  . ASP A 72  ? 0.2798 0.3206 0.2076 -0.0568 -0.1106 0.0381  74   ASP A CG  
578  O  OD1 . ASP A 72  ? 0.3630 0.4032 0.3571 -0.1247 -0.1308 -0.0297 74   ASP A OD1 
579  O  OD2 . ASP A 72  ? 0.3921 0.3333 0.2057 -0.1145 -0.0268 -0.0141 74   ASP A OD2 
580  N  N   . LYS A 73  ? 0.2309 0.2380 0.1715 -0.0208 -0.0149 0.0372  75   LYS A N   
581  C  CA  . LYS A 73  ? 0.2147 0.2425 0.2096 0.0112  -0.0095 0.0518  75   LYS A CA  
582  C  C   . LYS A 73  ? 0.2443 0.2156 0.1904 0.0104  0.0041  0.0471  75   LYS A C   
583  O  O   . LYS A 73  ? 0.2274 0.1975 0.1957 0.0133  0.0015  0.0208  75   LYS A O   
584  C  CB  A LYS A 73  ? 0.4222 0.2406 0.2245 0.0363  0.0914  0.0594  75   LYS A CB  
585  C  CB  B LYS A 73  ? 0.4154 0.2366 0.2262 0.0299  0.0873  0.0548  75   LYS A CB  
586  C  CG  A LYS A 73  ? 0.4156 0.3165 0.2681 0.0565  0.0895  0.0375  75   LYS A CG  
587  C  CG  B LYS A 73  ? 0.4042 0.3182 0.2745 0.0687  0.0833  0.0470  75   LYS A CG  
588  C  CD  A LYS A 73  ? 0.4037 0.3247 0.3365 0.1166  0.0777  -0.0025 75   LYS A CD  
589  C  CD  B LYS A 73  ? 0.4506 0.4090 0.3051 0.0722  0.1178  -0.0156 75   LYS A CD  
590  C  CE  A LYS A 73  ? 0.2927 0.3235 0.3393 0.1699  -0.0007 -0.0348 75   LYS A CE  
591  C  CE  B LYS A 73  ? 0.5847 0.3823 0.3744 0.0320  0.1714  -0.0883 75   LYS A CE  
592  N  NZ  A LYS A 73  ? 0.4244 0.2393 0.2855 0.0897  0.0821  0.0311  75   LYS A NZ  
593  N  NZ  B LYS A 73  ? 0.4059 0.4492 0.2327 0.0107  0.1549  -0.0762 75   LYS A NZ  
594  N  N   . PHE A 74  ? 0.2168 0.1871 0.1724 -0.0256 -0.0108 0.0199  76   PHE A N   
595  C  CA  . PHE A 74  ? 0.2196 0.2114 0.1506 -0.0199 -0.0205 0.0014  76   PHE A CA  
596  C  C   . PHE A 74  ? 0.2330 0.1749 0.1396 0.0105  -0.0342 0.0283  76   PHE A C   
597  O  O   . PHE A 74  ? 0.2507 0.1746 0.1974 0.0028  0.0102  0.0089  76   PHE A O   
598  C  CB  . PHE A 74  ? 0.2157 0.2146 0.1385 -0.0015 -0.0050 -0.0006 76   PHE A CB  
599  C  CG  . PHE A 74  ? 0.1721 0.2066 0.1399 -0.0206 -0.0043 0.0033  76   PHE A CG  
600  C  CD1 . PHE A 74  ? 0.1759 0.1953 0.1328 0.0063  -0.0125 0.0144  76   PHE A CD1 
601  C  CD2 . PHE A 74  ? 0.1905 0.2400 0.1451 -0.0581 -0.0259 -0.0012 76   PHE A CD2 
602  C  CE1 . PHE A 74  ? 0.1939 0.2418 0.1516 -0.0352 0.0067  -0.0198 76   PHE A CE1 
603  C  CE2 . PHE A 74  ? 0.2138 0.1934 0.1772 0.0014  -0.0012 -0.0003 76   PHE A CE2 
604  C  CZ  . PHE A 74  ? 0.1997 0.1878 0.1796 0.0209  0.0050  -0.0011 76   PHE A CZ  
605  N  N   . THR A 75  ? 0.2265 0.1972 0.1436 -0.0136 -0.0288 0.0150  77   THR A N   
606  C  CA  . THR A 75  ? 0.2338 0.1903 0.1492 -0.0116 -0.0072 0.0240  77   THR A CA  
607  C  C   . THR A 75  ? 0.2526 0.1655 0.1735 -0.0118 -0.0317 0.0169  77   THR A C   
608  O  O   . THR A 75  ? 0.2262 0.2057 0.1339 -0.0126 0.0028  0.0018  77   THR A O   
609  C  CB  . THR A 75  ? 0.2336 0.1748 0.1528 -0.0182 -0.0042 0.0263  77   THR A CB  
610  O  OG1 . THR A 75  ? 0.2378 0.1648 0.1919 -0.0015 -0.0059 0.0342  77   THR A OG1 
611  C  CG2 . THR A 75  ? 0.2341 0.2199 0.1794 -0.0027 -0.0053 0.0526  77   THR A CG2 
612  N  N   . ASP A 76  ? 0.2517 0.1828 0.1909 -0.0032 -0.0625 -0.0017 78   ASP A N   
613  C  CA  . ASP A 76  ? 0.2477 0.1848 0.1323 0.0018  -0.0149 0.0329  78   ASP A CA  
614  C  C   . ASP A 76  ? 0.2501 0.1658 0.1474 0.0082  0.0024  0.0184  78   ASP A C   
615  O  O   . ASP A 76  ? 0.2656 0.1520 0.1606 -0.0144 -0.0205 0.0233  78   ASP A O   
616  C  CB  . ASP A 76  ? 0.2142 0.2349 0.1384 0.0022  -0.0374 0.0001  78   ASP A CB  
617  C  CG  . ASP A 76  ? 0.2685 0.2403 0.1327 -0.0369 -0.0771 0.0086  78   ASP A CG  
618  O  OD1 . ASP A 76  ? 0.3475 0.2709 0.1927 -0.0481 -0.0542 -0.0299 78   ASP A OD1 
619  O  OD2 . ASP A 76  ? 0.2980 0.2069 0.2156 -0.0255 0.0107  0.0045  78   ASP A OD2 
620  N  N   . ASP A 77  ? 0.2557 0.1667 0.1562 -0.0068 -0.0082 0.0240  79   ASP A N   
621  C  CA  . ASP A 77  ? 0.2550 0.1553 0.1463 0.0009  0.0163  -0.0052 79   ASP A CA  
622  C  C   . ASP A 77  ? 0.2359 0.1422 0.1664 0.0228  0.0127  -0.0132 79   ASP A C   
623  O  O   . ASP A 77  ? 0.2420 0.2308 0.1528 -0.0121 -0.0024 0.0001  79   ASP A O   
624  C  CB  . ASP A 77  ? 0.2266 0.1758 0.1709 -0.0256 -0.0082 0.0203  79   ASP A CB  
625  C  CG  . ASP A 77  ? 0.2335 0.2734 0.1450 -0.0240 0.0262  -0.0042 79   ASP A CG  
626  O  OD1 . ASP A 77  ? 0.2765 0.2273 0.1861 0.0020  -0.0141 -0.0179 79   ASP A OD1 
627  O  OD2 . ASP A 77  ? 0.2569 0.2611 0.2026 0.0207  0.0020  0.0031  79   ASP A OD2 
628  N  N   . GLN A 78  ? 0.2579 0.1837 0.1434 -0.0129 0.0549  -0.0018 80   GLN A N   
629  C  CA  . GLN A 78  ? 0.2024 0.1649 0.1503 0.0401  0.0239  0.0016  80   GLN A CA  
630  C  C   . GLN A 78  ? 0.1490 0.1743 0.1677 0.0100  0.0232  0.0299  80   GLN A C   
631  O  O   . GLN A 78  ? 0.2190 0.2186 0.1587 -0.0162 -0.0059 0.0056  80   GLN A O   
632  C  CB  . GLN A 78  ? 0.1684 0.1897 0.1722 0.0294  -0.0093 -0.0089 80   GLN A CB  
633  C  CG  . GLN A 78  ? 0.1759 0.1436 0.2049 0.0036  -0.0063 -0.0020 80   GLN A CG  
634  C  CD  . GLN A 78  ? 0.1797 0.1442 0.1395 0.0050  -0.0005 0.0224  80   GLN A CD  
635  O  OE1 . GLN A 78  ? 0.2113 0.1689 0.1588 -0.0011 0.0317  0.0355  80   GLN A OE1 
636  N  NE2 . GLN A 78  ? 0.1913 0.1425 0.1567 0.0133  0.0184  -0.0037 80   GLN A NE2 
637  N  N   . LEU A 79  ? 0.1904 0.1666 0.1886 0.0166  -0.0007 0.0150  81   LEU A N   
638  C  CA  . LEU A 79  ? 0.1971 0.1602 0.1481 -0.0014 0.0160  0.0119  81   LEU A CA  
639  C  C   . LEU A 79  ? 0.1998 0.1539 0.1352 0.0141  -0.0010 0.0111  81   LEU A C   
640  O  O   . LEU A 79  ? 0.2119 0.2008 0.1462 -0.0009 -0.0086 0.0291  81   LEU A O   
641  C  CB  . LEU A 79  ? 0.2331 0.1913 0.1376 -0.0392 0.0009  0.0080  81   LEU A CB  
642  C  CG  . LEU A 79  ? 0.2087 0.2041 0.1132 -0.0491 -0.0307 0.0326  81   LEU A CG  
643  C  CD1 . LEU A 79  ? 0.2603 0.1931 0.1776 -0.0557 0.0397  0.0008  81   LEU A CD1 
644  C  CD2 . LEU A 79  ? 0.1917 0.2537 0.1471 -0.0542 -0.0002 -0.0106 81   LEU A CD2 
645  N  N   . ILE A 80  ? 0.2059 0.1987 0.1524 0.0035  0.0143  -0.0266 82   ILE A N   
646  C  CA  . ILE A 80  ? 0.2059 0.1956 0.1539 0.0004  0.0107  -0.0019 82   ILE A CA  
647  C  C   . ILE A 80  ? 0.2065 0.1924 0.1317 0.0036  -0.0119 0.0145  82   ILE A C   
648  O  O   . ILE A 80  ? 0.2140 0.2030 0.1456 0.0078  -0.0132 0.0049  82   ILE A O   
649  C  CB  . ILE A 80  ? 0.2068 0.2110 0.1609 -0.0371 0.0355  -0.0197 82   ILE A CB  
650  C  CG1 . ILE A 80  ? 0.2575 0.2176 0.1726 -0.0575 -0.0409 0.0097  82   ILE A CG1 
651  C  CG2 . ILE A 80  ? 0.1988 0.2249 0.1646 -0.0165 0.0169  0.0045  82   ILE A CG2 
652  C  CD1 . ILE A 80  ? 0.3092 0.2915 0.1998 -0.0714 -0.1152 0.0052  82   ILE A CD1 
653  N  N   . ASP A 81  ? 0.2451 0.1866 0.1226 0.0100  -0.0232 -0.0098 83   ASP A N   
654  C  CA  . ASP A 81  ? 0.1811 0.1946 0.1412 0.0164  -0.0209 -0.0050 83   ASP A CA  
655  C  C   . ASP A 81  ? 0.2123 0.1699 0.1372 -0.0229 -0.0140 0.0042  83   ASP A C   
656  O  O   . ASP A 81  ? 0.1961 0.2166 0.1295 -0.0034 -0.0193 0.0088  83   ASP A O   
657  C  CB  . ASP A 81  ? 0.2212 0.2047 0.1481 0.0024  0.0126  0.0311  83   ASP A CB  
658  C  CG  . ASP A 81  ? 0.1871 0.2977 0.1499 0.0074  0.0111  0.0364  83   ASP A CG  
659  O  OD1 . ASP A 81  ? 0.2200 0.2619 0.1660 -0.0163 -0.0208 0.0112  83   ASP A OD1 
660  O  OD2 . ASP A 81  ? 0.2104 0.2863 0.2019 0.0583  0.0302  0.0464  83   ASP A OD2 
661  N  N   . PHE A 82  ? 0.1889 0.1897 0.1462 0.0045  -0.0186 0.0108  84   PHE A N   
662  C  CA  . PHE A 82  ? 0.1964 0.1996 0.1433 0.0198  -0.0087 0.0375  84   PHE A CA  
663  C  C   . PHE A 82  ? 0.1809 0.1735 0.1651 -0.0009 -0.0196 0.0250  84   PHE A C   
664  O  O   . PHE A 82  ? 0.2064 0.1831 0.1681 0.0184  -0.0325 0.0171  84   PHE A O   
665  C  CB  . PHE A 82  ? 0.1842 0.1817 0.1508 0.0041  -0.0221 0.0267  84   PHE A CB  
666  C  CG  . PHE A 82  ? 0.1834 0.1807 0.1564 0.0012  -0.0200 0.0104  84   PHE A CG  
667  C  CD1 . PHE A 82  ? 0.2136 0.1850 0.1677 -0.0013 0.0160  -0.0136 84   PHE A CD1 
668  C  CD2 . PHE A 82  ? 0.1741 0.2117 0.1902 0.0120  -0.0107 0.0175  84   PHE A CD2 
669  C  CE1 . PHE A 82  ? 0.2260 0.1925 0.1754 0.0124  -0.0018 -0.0125 84   PHE A CE1 
670  C  CE2 . PHE A 82  ? 0.1808 0.2195 0.1841 0.0206  0.0106  -0.0116 84   PHE A CE2 
671  C  CZ  . PHE A 82  ? 0.2262 0.2064 0.1386 0.0037  0.0013  0.0175  84   PHE A CZ  
672  N  N   . MET A 83  ? 0.2082 0.1671 0.1721 -0.0095 -0.0249 0.0296  85   MET A N   
673  C  CA  . MET A 83  ? 0.2255 0.1943 0.1205 0.0248  -0.0014 -0.0029 85   MET A CA  
674  C  C   . MET A 83  ? 0.2173 0.2288 0.1500 0.0203  0.0149  0.0012  85   MET A C   
675  O  O   . MET A 83  ? 0.2240 0.2630 0.1549 0.0097  0.0162  0.0382  85   MET A O   
676  C  CB  A MET A 83  ? 0.2622 0.1943 0.1732 0.0251  -0.0075 -0.0138 85   MET A CB  
677  C  CB  B MET A 83  ? 0.2637 0.1899 0.1585 0.0276  -0.0108 -0.0061 85   MET A CB  
678  C  CG  A MET A 83  ? 0.2697 0.2030 0.1089 0.0044  -0.0433 0.0053  85   MET A CG  
679  C  CG  B MET A 83  ? 0.2401 0.1945 0.2089 0.0278  -0.0209 0.0255  85   MET A CG  
680  S  SD  A MET A 83  ? 0.2242 0.2520 0.1953 0.0109  -0.0498 -0.0650 85   MET A SD  
681  S  SD  B MET A 83  ? 0.3068 0.2272 0.1832 -0.0050 0.0297  -0.0070 85   MET A SD  
682  C  CE  A MET A 83  ? 0.2169 0.3720 0.2338 -0.1026 0.1108  -0.0995 85   MET A CE  
683  C  CE  B MET A 83  ? 0.2445 0.0968 0.1960 0.0691  0.0406  0.0068  85   MET A CE  
684  N  N   . LEU A 84  ? 0.2069 0.2764 0.1523 -0.0147 -0.0169 0.0097  86   LEU A N   
685  C  CA  . LEU A 84  ? 0.2065 0.1973 0.1780 0.0217  0.0036  0.0300  86   LEU A CA  
686  C  C   . LEU A 84  ? 0.1807 0.2623 0.1856 -0.0040 0.0164  -0.0015 86   LEU A C   
687  O  O   . LEU A 84  ? 0.1854 0.2856 0.2207 -0.0080 0.0036  0.0235  86   LEU A O   
688  C  CB  . LEU A 84  ? 0.2632 0.2183 0.1725 0.0215  -0.0015 0.0377  86   LEU A CB  
689  C  CG  . LEU A 84  ? 0.2880 0.2907 0.1862 0.0366  -0.0167 0.0019  86   LEU A CG  
690  C  CD1 . LEU A 84  ? 0.4768 0.3938 0.1685 0.0874  -0.0167 0.0090  86   LEU A CD1 
691  C  CD2 . LEU A 84  ? 0.2967 0.2953 0.2483 0.0502  0.0210  -0.0266 86   LEU A CD2 
692  N  N   . GLN A 85  ? 0.1954 0.2169 0.1642 0.0039  -0.0370 0.0019  87   GLN A N   
693  C  CA  . GLN A 85  ? 0.1872 0.1902 0.1651 -0.0220 -0.0526 0.0369  87   GLN A CA  
694  C  C   . GLN A 85  ? 0.2148 0.1716 0.1587 -0.0117 -0.0486 0.0269  87   GLN A C   
695  O  O   . GLN A 85  ? 0.2722 0.2287 0.1719 -0.0525 -0.0643 0.0232  87   GLN A O   
696  C  CB  . GLN A 85  ? 0.2471 0.1868 0.1854 -0.0002 -0.0646 0.0357  87   GLN A CB  
697  C  CG  . GLN A 85  ? 0.2669 0.1871 0.2035 -0.0264 -0.0512 0.0651  87   GLN A CG  
698  C  CD  . GLN A 85  ? 0.3020 0.3929 0.2569 -0.1091 -0.0331 0.0584  87   GLN A CD  
699  O  OE1 . GLN A 85  ? 0.3327 0.5665 0.3391 -0.0699 0.0446  0.0242  87   GLN A OE1 
700  N  NE2 . GLN A 85  ? 0.4693 0.5895 0.2778 -0.3066 -0.0899 0.0963  87   GLN A NE2 
701  N  N   . HIS A 86  ? 0.1970 0.1661 0.1662 0.0078  0.0080  0.0170  88   HIS A N   
702  C  CA  . HIS A 86  ? 0.2033 0.1772 0.1691 -0.0014 0.0252  0.0067  88   HIS A CA  
703  C  C   . HIS A 86  ? 0.2236 0.1768 0.1230 0.0024  0.0437  0.0111  88   HIS A C   
704  O  O   . HIS A 86  ? 0.2201 0.1734 0.1543 -0.0030 -0.0246 0.0109  88   HIS A O   
705  C  CB  . HIS A 86  ? 0.1943 0.2211 0.1653 0.0361  0.0092  0.0353  88   HIS A CB  
706  C  CG  . HIS A 86  ? 0.2388 0.2146 0.1683 0.0420  -0.0128 0.0040  88   HIS A CG  
707  N  ND1 . HIS A 86  ? 0.4658 0.2305 0.1829 -0.0087 -0.0692 0.0153  88   HIS A ND1 
708  C  CD2 . HIS A 86  ? 0.2245 0.1928 0.1693 0.0295  0.0002  0.0232  88   HIS A CD2 
709  C  CE1 . HIS A 86  ? 0.4247 0.2049 0.2844 -0.0260 -0.0849 0.0113  88   HIS A CE1 
710  N  NE2 . HIS A 86  ? 0.2891 0.2016 0.2219 0.0412  -0.0094 0.0104  88   HIS A NE2 
711  N  N   . PRO A 87  ? 0.2155 0.1800 0.1423 0.0074  -0.0194 -0.0046 89   PRO A N   
712  C  CA  . PRO A 87  ? 0.2299 0.1810 0.1674 0.0152  0.0244  0.0035  89   PRO A CA  
713  C  C   . PRO A 87  ? 0.1985 0.1847 0.1354 0.0143  -0.0275 0.0045  89   PRO A C   
714  O  O   . PRO A 87  ? 0.2435 0.1843 0.1561 0.0017  0.0146  0.0006  89   PRO A O   
715  C  CB  . PRO A 87  ? 0.2337 0.2166 0.2391 0.0339  0.0466  0.0185  89   PRO A CB  
716  C  CG  . PRO A 87  ? 0.2025 0.2116 0.2915 -0.0082 -0.0178 -0.0141 89   PRO A CG  
717  C  CD  . PRO A 87  ? 0.1796 0.2023 0.2205 0.0060  -0.0755 0.0059  89   PRO A CD  
718  N  N   . ILE A 88  ? 0.2192 0.1816 0.1448 0.0104  -0.0123 0.0063  90   ILE A N   
719  C  CA  . ILE A 88  ? 0.2083 0.2015 0.1608 0.0010  0.0075  0.0103  90   ILE A CA  
720  C  C   . ILE A 88  ? 0.2162 0.1802 0.1324 0.0136  0.0006  -0.0002 90   ILE A C   
721  O  O   . ILE A 88  ? 0.2234 0.1921 0.1584 -0.0068 -0.0016 0.0077  90   ILE A O   
722  C  CB  . ILE A 88  ? 0.1482 0.2320 0.1611 -0.0118 0.0088  0.0021  90   ILE A CB  
723  C  CG1 . ILE A 88  ? 0.2943 0.3135 0.1664 -0.0613 0.0342  0.0262  90   ILE A CG1 
724  C  CG2 . ILE A 88  ? 0.1707 0.2837 0.1806 0.0262  -0.0120 -0.0489 90   ILE A CG2 
725  C  CD1 . ILE A 88  ? 0.3912 0.5190 0.1642 -0.0793 -0.0331 0.0009  90   ILE A CD1 
726  N  N   . LEU A 89  ? 0.2250 0.1765 0.1638 0.0186  -0.0115 0.0037  91   LEU A N   
727  C  CA  . LEU A 89  ? 0.2166 0.1809 0.1597 0.0083  -0.0074 0.0221  91   LEU A CA  
728  C  C   . LEU A 89  ? 0.2177 0.1745 0.1375 -0.0119 0.0100  0.0305  91   LEU A C   
729  O  O   . LEU A 89  ? 0.1937 0.1855 0.2151 0.0111  0.0211  -0.0091 91   LEU A O   
730  C  CB  . LEU A 89  ? 0.2193 0.1859 0.1519 0.0001  -0.0065 0.0216  91   LEU A CB  
731  C  CG  . LEU A 89  ? 0.1962 0.1764 0.1766 -0.0006 -0.0251 0.0236  91   LEU A CG  
732  C  CD1 . LEU A 89  ? 0.2783 0.2069 0.1686 0.0316  -0.0142 0.0329  91   LEU A CD1 
733  C  CD2 . LEU A 89  ? 0.2029 0.2014 0.1801 0.0256  -0.0109 0.0259  91   LEU A CD2 
734  N  N   . ILE A 90  ? 0.1931 0.1663 0.1999 -0.0132 -0.0248 -0.0024 92   ILE A N   
735  C  CA  . ILE A 90  ? 0.2096 0.1869 0.1685 0.0179  -0.0333 0.0005  92   ILE A CA  
736  C  C   . ILE A 90  ? 0.2042 0.1678 0.1826 0.0264  -0.0055 -0.0101 92   ILE A C   
737  O  O   . ILE A 90  ? 0.1961 0.1943 0.1878 0.0149  -0.0082 0.0364  92   ILE A O   
738  C  CB  . ILE A 90  ? 0.2091 0.1768 0.1820 -0.0060 -0.0310 -0.0021 92   ILE A CB  
739  C  CG1 . ILE A 90  ? 0.2446 0.2107 0.2241 0.0487  0.0201  0.0319  92   ILE A CG1 
740  C  CG2 . ILE A 90  ? 0.2553 0.1996 0.1659 -0.0169 -0.0018 -0.0183 92   ILE A CG2 
741  C  CD1 . ILE A 90  ? 0.2610 0.2751 0.1525 -0.0429 0.0030  -0.0221 92   ILE A CD1 
742  N  N   . ASN A 91  ? 0.2686 0.1557 0.2364 -0.0009 -0.0569 -0.0082 93   ASN A N   
743  C  CA  . ASN A 91  ? 0.1846 0.1704 0.2068 0.0052  -0.0557 -0.0104 93   ASN A CA  
744  C  C   . ASN A 91  ? 0.1961 0.2010 0.1846 0.0202  -0.0236 0.0077  93   ASN A C   
745  O  O   . ASN A 91  ? 0.2612 0.1914 0.1666 0.0108  -0.0207 -0.0041 93   ASN A O   
746  C  CB  . ASN A 91  ? 0.1892 0.1863 0.2223 0.0000  -0.0427 -0.0237 93   ASN A CB  
747  C  CG  . ASN A 91  ? 0.2034 0.2099 0.2275 -0.0208 -0.0333 -0.0231 93   ASN A CG  
748  O  OD1 . ASN A 91  ? 0.2123 0.2255 0.2357 0.0161  -0.0311 0.0196  93   ASN A OD1 
749  N  ND2 . ASN A 91  ? 0.1933 0.2282 0.2920 0.0112  -0.0126 0.0101  93   ASN A ND2 
750  N  N   . ARG A 92  ? 0.2101 0.1927 0.1721 0.0337  -0.0091 -0.0023 94   ARG A N   
751  C  CA  . ARG A 92  ? 0.2134 0.1854 0.1872 0.0325  -0.0255 0.0026  94   ARG A CA  
752  C  C   . ARG A 92  ? 0.1564 0.1871 0.2000 0.0022  -0.0299 -0.0030 94   ARG A C   
753  O  O   . ARG A 92  ? 0.1972 0.2183 0.1946 0.0040  0.0103  -0.0156 94   ARG A O   
754  C  CB  . ARG A 92  ? 0.1795 0.1921 0.2558 -0.0020 0.0102  -0.0389 94   ARG A CB  
755  C  CG  . ARG A 92  ? 0.1999 0.2244 0.1988 0.0347  -0.0525 0.0002  94   ARG A CG  
756  C  CD  . ARG A 92  ? 0.2413 0.2137 0.2523 0.0117  0.0580  0.0059  94   ARG A CD  
757  N  NE  . ARG A 92  ? 0.2953 0.2262 0.1777 0.0339  -0.0190 -0.0001 94   ARG A NE  
758  C  CZ  . ARG A 92  ? 0.3183 0.2125 0.1764 0.0162  -0.0144 0.0061  94   ARG A CZ  
759  N  NH1 . ARG A 92  ? 0.3925 0.2132 0.2270 0.0013  -0.0538 0.0231  94   ARG A NH1 
760  N  NH2 . ARG A 92  ? 0.4649 0.2715 0.1762 0.0070  0.0216  -0.0051 94   ARG A NH2 
761  N  N   . PRO A 93  ? 0.2071 0.1568 0.1338 -0.0024 0.0007  0.0075  95   PRO A N   
762  C  CA  . PRO A 93  ? 0.1989 0.1575 0.1308 -0.0102 -0.0172 0.0090  95   PRO A CA  
763  C  C   . PRO A 93  ? 0.1941 0.1576 0.1296 0.0125  -0.0064 -0.0090 95   PRO A C   
764  O  O   . PRO A 93  ? 0.2308 0.2002 0.1710 -0.0290 -0.0337 -0.0088 95   PRO A O   
765  C  CB  . PRO A 93  ? 0.2032 0.2030 0.1481 0.0122  -0.0204 0.0082  95   PRO A CB  
766  C  CG  . PRO A 93  ? 0.2365 0.1688 0.1560 0.0190  -0.0410 0.0102  95   PRO A CG  
767  C  CD  . PRO A 93  ? 0.2049 0.1846 0.1346 0.0067  -0.0431 0.0444  95   PRO A CD  
768  N  N   . ILE A 94  ? 0.2274 0.2055 0.1256 -0.0080 0.0004  -0.0129 96   ILE A N   
769  C  CA  . ILE A 94  ? 0.2089 0.1850 0.1236 -0.0085 0.0010  -0.0161 96   ILE A CA  
770  C  C   . ILE A 94  ? 0.2077 0.1731 0.1693 -0.0133 0.0104  -0.0170 96   ILE A C   
771  O  O   . ILE A 94  ? 0.2121 0.1901 0.1312 -0.0087 0.0018  -0.0204 96   ILE A O   
772  C  CB  . ILE A 94  ? 0.1661 0.1921 0.1391 -0.0352 -0.0171 -0.0029 96   ILE A CB  
773  C  CG1 . ILE A 94  ? 0.2233 0.2046 0.1480 0.0019  0.0078  0.0062  96   ILE A CG1 
774  C  CG2 . ILE A 94  ? 0.2519 0.2164 0.1283 -0.0314 0.0320  0.0072  96   ILE A CG2 
775  C  CD1 . ILE A 94  ? 0.2226 0.2028 0.1546 -0.0114 -0.0007 0.0089  96   ILE A CD1 
776  N  N   . VAL A 95  ? 0.2067 0.1673 0.1773 0.0064  -0.0221 -0.0140 97   VAL A N   
777  C  CA  . VAL A 95  ? 0.2089 0.1709 0.1368 0.0014  -0.0027 0.0025  97   VAL A CA  
778  C  C   . VAL A 95  ? 0.2131 0.2347 0.1313 0.0039  -0.0115 0.0097  97   VAL A C   
779  O  O   . VAL A 95  ? 0.2207 0.2308 0.1467 0.0007  -0.0158 -0.0091 97   VAL A O   
780  C  CB  . VAL A 95  ? 0.2418 0.1635 0.1263 0.0134  0.0017  -0.0108 97   VAL A CB  
781  C  CG1 . VAL A 95  ? 0.1998 0.1817 0.1911 0.0127  -0.0118 -0.0039 97   VAL A CG1 
782  C  CG2 . VAL A 95  ? 0.2195 0.2379 0.1251 0.0110  -0.0291 0.0057  97   VAL A CG2 
783  N  N   . VAL A 96  ? 0.2249 0.2153 0.1331 -0.0067 -0.0065 -0.0040 98   VAL A N   
784  C  CA  . VAL A 96  ? 0.2078 0.2049 0.1397 -0.0113 -0.0044 -0.0152 98   VAL A CA  
785  C  C   . VAL A 96  ? 0.2425 0.1923 0.1296 0.0012  -0.0081 0.0084  98   VAL A C   
786  O  O   . VAL A 96  ? 0.2392 0.1946 0.1726 0.0140  -0.0151 -0.0255 98   VAL A O   
787  C  CB  . VAL A 96  ? 0.2441 0.1848 0.1432 0.0245  0.0142  -0.0099 98   VAL A CB  
788  C  CG1 . VAL A 96  ? 0.3777 0.2377 0.1488 -0.0017 0.0350  -0.0079 98   VAL A CG1 
789  C  CG2 . VAL A 96  ? 0.2358 0.2167 0.2363 0.0497  0.0206  -0.0134 98   VAL A CG2 
790  N  N   . THR A 97  ? 0.2313 0.2086 0.1634 0.0134  -0.0220 -0.0126 99   THR A N   
791  C  CA  . THR A 97  ? 0.2467 0.1988 0.1481 0.0096  0.0030  0.0029  99   THR A CA  
792  C  C   . THR A 97  ? 0.2509 0.2145 0.1507 0.0035  0.0075  -0.0019 99   THR A C   
793  O  O   . THR A 97  ? 0.3053 0.2000 0.1448 0.0341  -0.0161 -0.0418 99   THR A O   
794  C  CB  . THR A 97  ? 0.2104 0.2125 0.1658 0.0012  0.0081  0.0126  99   THR A CB  
795  O  OG1 . THR A 97  ? 0.2518 0.2143 0.2090 -0.0082 -0.0272 -0.0289 99   THR A OG1 
796  C  CG2 . THR A 97  ? 0.2466 0.1895 0.1470 0.0354  -0.0110 0.0202  99   THR A CG2 
797  N  N   . PRO A 98  ? 0.2611 0.2656 0.1919 0.0230  -0.0136 -0.0545 100  PRO A N   
798  C  CA  . PRO A 98  ? 0.2841 0.2118 0.1919 -0.0056 -0.0037 -0.0479 100  PRO A CA  
799  C  C   . PRO A 98  ? 0.2856 0.2293 0.1978 -0.0210 -0.0438 0.0212  100  PRO A C   
800  O  O   . PRO A 98  ? 0.3213 0.2957 0.1875 0.0292  -0.0537 -0.0166 100  PRO A O   
801  C  CB  . PRO A 98  ? 0.3033 0.2512 0.2090 0.0271  -0.0169 -0.0613 100  PRO A CB  
802  C  CG  . PRO A 98  ? 0.2693 0.3096 0.2217 0.0102  0.0066  -0.0901 100  PRO A CG  
803  C  CD  . PRO A 98  ? 0.2680 0.2305 0.2056 0.0258  -0.0040 -0.0576 100  PRO A CD  
804  N  N   . LEU A 99  ? 0.2689 0.1866 0.2213 0.0258  -0.0050 -0.0019 101  LEU A N   
805  C  CA  . LEU A 99  ? 0.2720 0.2011 0.2206 0.0240  0.0341  -0.0036 101  LEU A CA  
806  C  C   . LEU A 99  ? 0.2604 0.2140 0.1693 0.0218  -0.0377 -0.0380 101  LEU A C   
807  O  O   . LEU A 99  ? 0.2870 0.2740 0.2003 0.0130  -0.0766 -0.0330 101  LEU A O   
808  C  CB  . LEU A 99  ? 0.3202 0.1584 0.1782 0.0102  0.0203  -0.0542 101  LEU A CB  
809  C  CG  . LEU A 99  ? 0.3385 0.1797 0.1584 0.0378  -0.0096 -0.0515 101  LEU A CG  
810  C  CD1 . LEU A 99  ? 0.3873 0.2081 0.2190 0.0090  -0.0538 0.0054  101  LEU A CD1 
811  C  CD2 . LEU A 99  ? 0.4092 0.2219 0.1807 -0.0029 0.0166  -0.1016 101  LEU A CD2 
812  N  N   . GLY A 100 ? 0.3013 0.2070 0.1664 0.0171  -0.0143 -0.0390 102  GLY A N   
813  C  CA  . GLY A 100 ? 0.3163 0.2247 0.1479 0.0312  -0.0392 -0.0458 102  GLY A CA  
814  C  C   . GLY A 100 ? 0.2360 0.2184 0.1421 0.0238  -0.0357 -0.0340 102  GLY A C   
815  O  O   . GLY A 100 ? 0.2191 0.2457 0.1482 0.0091  -0.0248 -0.0111 102  GLY A O   
816  N  N   . THR A 101 ? 0.2217 0.2039 0.1803 0.0114  -0.0192 -0.0359 103  THR A N   
817  C  CA  . THR A 101 ? 0.2606 0.1977 0.1407 0.0144  -0.0177 -0.0151 103  THR A CA  
818  C  C   . THR A 101 ? 0.2422 0.2005 0.1393 0.0154  -0.0337 -0.0108 103  THR A C   
819  O  O   . THR A 101 ? 0.2557 0.2368 0.1405 -0.0069 -0.0403 -0.0174 103  THR A O   
820  C  CB  . THR A 101 ? 0.2268 0.1940 0.1758 0.0170  -0.0058 -0.0176 103  THR A CB  
821  O  OG1 . THR A 101 ? 0.3200 0.2383 0.1791 -0.0160 0.0540  -0.0346 103  THR A OG1 
822  C  CG2 . THR A 101 ? 0.2396 0.1986 0.1787 -0.0021 0.0333  -0.0252 103  THR A CG2 
823  N  N   . ARG A 102 ? 0.2081 0.1840 0.1378 0.0099  -0.0310 -0.0061 104  ARG A N   
824  C  CA  . ARG A 102 ? 0.1870 0.2043 0.1513 -0.0055 -0.0387 -0.0259 104  ARG A CA  
825  C  C   . ARG A 102 ? 0.1924 0.1860 0.1310 0.0117  -0.0438 -0.0107 104  ARG A C   
826  O  O   . ARG A 102 ? 0.2015 0.2007 0.1413 -0.0126 -0.0349 -0.0221 104  ARG A O   
827  C  CB  A ARG A 102 ? 0.2083 0.1973 0.2012 -0.0301 0.0074  -0.0278 104  ARG A CB  
828  C  CB  B ARG A 102 ? 0.2114 0.1985 0.2060 -0.0299 0.0127  -0.0315 104  ARG A CB  
829  C  CG  A ARG A 102 ? 0.1918 0.2303 0.2705 -0.0718 0.0572  -0.0758 104  ARG A CG  
830  C  CG  B ARG A 102 ? 0.1898 0.2373 0.2776 -0.0845 0.0509  -0.0796 104  ARG A CG  
831  C  CD  A ARG A 102 ? 0.1949 0.3154 0.3177 -0.0978 0.0418  -0.1116 104  ARG A CD  
832  C  CD  B ARG A 102 ? 0.1967 0.3232 0.3099 -0.0946 0.0353  -0.1105 104  ARG A CD  
833  N  NE  A ARG A 102 ? 0.2770 0.3346 0.3155 -0.1031 0.0178  -0.1252 104  ARG A NE  
834  N  NE  B ARG A 102 ? 0.3095 0.3202 0.2856 -0.1123 0.0064  -0.0980 104  ARG A NE  
835  C  CZ  A ARG A 102 ? 0.3003 0.3016 0.2196 -0.0977 -0.0706 -0.0621 104  ARG A CZ  
836  C  CZ  B ARG A 102 ? 0.1353 0.2945 0.1992 -0.0243 -0.0572 -0.0679 104  ARG A CZ  
837  N  NH1 A ARG A 102 ? 0.2570 0.2644 0.3031 -0.0644 -0.0246 -0.0711 104  ARG A NH1 
838  N  NH1 B ARG A 102 ? 0.2791 0.3797 0.1928 -0.0713 -0.0299 -0.0894 104  ARG A NH1 
839  N  NH2 A ARG A 102 ? 0.4123 0.2816 0.2900 -0.1145 0.0515  -0.0829 104  ARG A NH2 
840  N  NH2 B ARG A 102 ? 0.2730 0.2700 0.2031 -0.0075 0.0018  -0.0544 104  ARG A NH2 
841  N  N   . LEU A 103 ? 0.2083 0.2020 0.1603 0.0201  -0.0392 -0.0149 105  LEU A N   
842  C  CA  . LEU A 103 ? 0.1822 0.1833 0.1429 0.0189  -0.0165 0.0135  105  LEU A CA  
843  C  C   . LEU A 103 ? 0.1579 0.1553 0.1799 0.0229  -0.0244 0.0097  105  LEU A C   
844  O  O   . LEU A 103 ? 0.1756 0.1988 0.1783 -0.0063 -0.0090 0.0077  105  LEU A O   
845  C  CB  . LEU A 103 ? 0.2319 0.1879 0.1622 0.0551  -0.0293 0.0164  105  LEU A CB  
846  C  CG  . LEU A 103 ? 0.2045 0.1766 0.1616 0.0257  -0.0091 0.0175  105  LEU A CG  
847  C  CD1 . LEU A 103 ? 0.2423 0.2502 0.2025 -0.0239 -0.0114 -0.0063 105  LEU A CD1 
848  C  CD2 . LEU A 103 ? 0.2221 0.1957 0.2290 0.0446  0.0113  0.0154  105  LEU A CD2 
849  N  N   . CYS A 104 ? 0.1936 0.1639 0.1830 0.0184  -0.0479 0.0132  106  CYS A N   
850  C  CA  . CYS A 104 ? 0.1728 0.1837 0.1782 0.0305  -0.0215 0.0242  106  CYS A CA  
851  C  C   . CYS A 104 ? 0.1804 0.1773 0.1787 0.0259  -0.0268 0.0111  106  CYS A C   
852  O  O   . CYS A 104 ? 0.2008 0.1944 0.1783 0.0252  -0.0334 -0.0031 106  CYS A O   
853  C  CB  . CYS A 104 ? 0.1909 0.1889 0.1756 0.0514  -0.0408 -0.0107 106  CYS A CB  
854  S  SG  . CYS A 104 ? 0.2030 0.2197 0.1809 0.0191  -0.0005 0.0172  106  CYS A SG  
855  N  N   . ARG A 105 ? 0.1756 0.2041 0.1698 0.0020  -0.0143 -0.0122 107  ARG A N   
856  C  CA  . ARG A 105 ? 0.2044 0.1910 0.1841 -0.0300 0.0029  -0.0624 107  ARG A CA  
857  C  C   . ARG A 105 ? 0.2091 0.2214 0.1673 -0.0492 -0.0319 -0.0175 107  ARG A C   
858  O  O   . ARG A 105 ? 0.1964 0.2410 0.2065 -0.0096 -0.0454 -0.0245 107  ARG A O   
859  C  CB  . ARG A 105 ? 0.2175 0.2044 0.2049 0.0020  -0.0275 -0.0502 107  ARG A CB  
860  C  CG  . ARG A 105 ? 0.2349 0.1630 0.1713 0.0093  -0.0311 -0.0078 107  ARG A CG  
861  C  CD  . ARG A 105 ? 0.2644 0.1795 0.1837 0.0312  -0.0224 0.0014  107  ARG A CD  
862  N  NE  . ARG A 105 ? 0.1663 0.2280 0.2045 0.0137  -0.0114 -0.0242 107  ARG A NE  
863  C  CZ  . ARG A 105 ? 0.1980 0.2328 0.1823 -0.0118 -0.0048 0.0066  107  ARG A CZ  
864  N  NH1 . ARG A 105 ? 0.2015 0.2294 0.2026 -0.0106 -0.0449 -0.0064 107  ARG A NH1 
865  N  NH2 . ARG A 105 ? 0.2897 0.3195 0.1899 -0.0061 0.0153  -0.0245 107  ARG A NH2 
866  N  N   . PRO A 106 ? 0.1809 0.2283 0.2062 -0.0243 -0.0074 0.0017  108  PRO A N   
867  C  CA  . PRO A 106 ? 0.2088 0.2175 0.1932 -0.0037 -0.0144 -0.0166 108  PRO A CA  
868  C  C   . PRO A 106 ? 0.2030 0.2300 0.1870 0.0006  -0.0187 -0.0180 108  PRO A C   
869  O  O   . PRO A 106 ? 0.2140 0.2008 0.1931 0.0178  -0.0294 -0.0333 108  PRO A O   
870  C  CB  . PRO A 106 ? 0.2045 0.2140 0.2322 0.0123  -0.0036 -0.0020 108  PRO A CB  
871  C  CG  . PRO A 106 ? 0.2551 0.2434 0.2543 -0.0417 -0.0369 0.0318  108  PRO A CG  
872  C  CD  . PRO A 106 ? 0.2175 0.1859 0.1903 -0.0164 0.0035  -0.0329 108  PRO A CD  
873  N  N   . SER A 107 ? 0.2038 0.2062 0.1754 0.0001  -0.0074 -0.0254 109  SER A N   
874  C  CA  . SER A 107 ? 0.2000 0.2057 0.1373 -0.0088 -0.0094 -0.0053 109  SER A CA  
875  C  C   . SER A 107 ? 0.1755 0.2159 0.1560 -0.0038 -0.0141 -0.0163 109  SER A C   
876  O  O   . SER A 107 ? 0.1807 0.2370 0.1517 -0.0076 -0.0121 -0.0191 109  SER A O   
877  C  CB  . SER A 107 ? 0.2104 0.2077 0.1596 -0.0246 -0.0214 -0.0069 109  SER A CB  
878  O  OG  . SER A 107 ? 0.2257 0.1943 0.1431 -0.0024 -0.0180 -0.0083 109  SER A OG  
879  N  N   . GLU A 108 ? 0.2087 0.2176 0.1606 -0.0233 -0.0143 -0.0155 110  GLU A N   
880  C  CA  . GLU A 108 ? 0.2080 0.2058 0.1576 0.0059  -0.0219 0.0009  110  GLU A CA  
881  C  C   . GLU A 108 ? 0.2197 0.1632 0.1510 -0.0082 -0.0145 0.0080  110  GLU A C   
882  O  O   . GLU A 108 ? 0.2188 0.2013 0.1664 0.0238  -0.0184 -0.0096 110  GLU A O   
883  C  CB  . GLU A 108 ? 0.3038 0.2173 0.1406 -0.0266 -0.0510 0.0131  110  GLU A CB  
884  C  CG  . GLU A 108 ? 0.2923 0.2524 0.2216 -0.0955 -0.0170 0.0037  110  GLU A CG  
885  C  CD  . GLU A 108 ? 0.2711 0.2314 0.2213 -0.0437 -0.0290 0.0244  110  GLU A CD  
886  O  OE1 . GLU A 108 ? 0.2668 0.2872 0.2068 -0.0617 -0.0406 0.0131  110  GLU A OE1 
887  O  OE2 . GLU A 108 ? 0.2184 0.2352 0.1884 -0.0007 -0.0221 0.0177  110  GLU A OE2 
888  N  N   . VAL A 109 ? 0.2207 0.1816 0.1439 0.0065  -0.0204 -0.0112 111  VAL A N   
889  C  CA  . VAL A 109 ? 0.2038 0.1772 0.1523 -0.0028 -0.0100 0.0173  111  VAL A CA  
890  C  C   . VAL A 109 ? 0.2043 0.1905 0.1508 -0.0109 -0.0162 -0.0137 111  VAL A C   
891  O  O   . VAL A 109 ? 0.2120 0.2310 0.1385 0.0005  -0.0231 -0.0040 111  VAL A O   
892  C  CB  . VAL A 109 ? 0.2215 0.1800 0.1854 0.0042  -0.0075 0.0189  111  VAL A CB  
893  C  CG1 . VAL A 109 ? 0.2299 0.1929 0.1944 0.0159  -0.0037 0.0356  111  VAL A CG1 
894  C  CG2 . VAL A 109 ? 0.1977 0.2343 0.1446 0.0158  -0.0407 -0.0020 111  VAL A CG2 
895  N  N   . VAL A 110 ? 0.1986 0.1727 0.1652 -0.0032 -0.0310 0.0169  112  VAL A N   
896  C  CA  . VAL A 110 ? 0.2004 0.1787 0.1803 0.0073  -0.0157 0.0129  112  VAL A CA  
897  C  C   . VAL A 110 ? 0.1837 0.1762 0.1796 0.0075  -0.0496 0.0136  112  VAL A C   
898  O  O   . VAL A 110 ? 0.2261 0.1529 0.1838 -0.0019 -0.0364 -0.0055 112  VAL A O   
899  C  CB  . VAL A 110 ? 0.1957 0.1814 0.1646 0.0052  0.0049  -0.0061 112  VAL A CB  
900  C  CG1 . VAL A 110 ? 0.2449 0.1680 0.1417 -0.0008 -0.0232 -0.0276 112  VAL A CG1 
901  C  CG2 . VAL A 110 ? 0.2132 0.2053 0.1718 -0.0124 0.0124  -0.0112 112  VAL A CG2 
902  N  N   . LEU A 111 ? 0.2259 0.1820 0.1605 -0.0245 -0.0611 -0.0007 113  LEU A N   
903  C  CA  . LEU A 111 ? 0.2913 0.1751 0.1555 -0.0069 -0.0760 0.0291  113  LEU A CA  
904  C  C   . LEU A 111 ? 0.1969 0.1809 0.1464 0.0141  -0.0355 -0.0024 113  LEU A C   
905  O  O   . LEU A 111 ? 0.2271 0.1984 0.2305 0.0113  -0.0095 -0.0380 113  LEU A O   
906  C  CB  . LEU A 111 ? 0.2000 0.1922 0.1624 0.0087  -0.0579 0.0246  113  LEU A CB  
907  C  CG  . LEU A 111 ? 0.2010 0.2184 0.1364 0.0333  -0.0424 0.0171  113  LEU A CG  
908  C  CD1 . LEU A 111 ? 0.2431 0.2258 0.1666 0.0013  -0.0483 0.0227  113  LEU A CD1 
909  C  CD2 . LEU A 111 ? 0.2030 0.2712 0.2111 0.0054  -0.0782 0.0071  113  LEU A CD2 
910  N  N   . ASP A 112 ? 0.1706 0.2093 0.1757 0.0023  -0.0566 -0.0053 114  ASP A N   
911  C  CA  . ASP A 112 ? 0.2454 0.1558 0.1857 0.0130  -0.0816 -0.0152 114  ASP A CA  
912  C  C   . ASP A 112 ? 0.2500 0.2418 0.1609 -0.0032 -0.0823 -0.0305 114  ASP A C   
913  O  O   . ASP A 112 ? 0.2872 0.2628 0.1630 0.0090  -0.0922 -0.0309 114  ASP A O   
914  C  CB  . ASP A 112 ? 0.2715 0.2227 0.1522 0.0522  -0.0891 -0.0334 114  ASP A CB  
915  C  CG  . ASP A 112 ? 0.2843 0.2747 0.2924 0.0394  -0.0075 -0.0893 114  ASP A CG  
916  O  OD1 . ASP A 112 ? 0.2991 0.4450 0.4496 0.0896  0.0095  -0.0248 114  ASP A OD1 
917  O  OD2 . ASP A 112 ? 0.2601 0.3192 0.3580 -0.0303 0.0206  -0.0349 114  ASP A OD2 
918  N  N   . ILE A 113 ? 0.2604 0.1872 0.1624 0.0195  -0.0199 -0.0342 115  ILE A N   
919  C  CA  . ILE A 113 ? 0.2618 0.2118 0.1392 0.0327  -0.0280 -0.0339 115  ILE A CA  
920  C  C   . ILE A 113 ? 0.2501 0.2086 0.1599 -0.0066 -0.0362 -0.0071 115  ILE A C   
921  O  O   . ILE A 113 ? 0.2653 0.2399 0.1702 0.0039  -0.0157 -0.0203 115  ILE A O   
922  C  CB  . ILE A 113 ? 0.2044 0.2068 0.1720 -0.0164 -0.0249 -0.0374 115  ILE A CB  
923  C  CG1 . ILE A 113 ? 0.2542 0.1938 0.1644 -0.0200 -0.0188 -0.0282 115  ILE A CG1 
924  C  CG2 . ILE A 113 ? 0.2558 0.2139 0.2388 0.0106  -0.0818 -0.0171 115  ILE A CG2 
925  C  CD1 . ILE A 113 ? 0.3660 0.1906 0.1959 0.0129  -0.0375 -0.0325 115  ILE A CD1 
926  N  N   . LEU A 114 ? 0.2510 0.2343 0.1661 0.0362  -0.0294 -0.0069 116  LEU A N   
927  C  CA  . LEU A 114 ? 0.2106 0.1904 0.1624 -0.0202 -0.0231 -0.0181 116  LEU A CA  
928  C  C   . LEU A 114 ? 0.2340 0.2031 0.1825 0.0044  -0.0220 -0.0269 116  LEU A C   
929  O  O   . LEU A 114 ? 0.2414 0.1982 0.1761 0.0042  -0.0163 -0.0627 116  LEU A O   
930  C  CB  . LEU A 114 ? 0.2189 0.1920 0.1648 0.0382  -0.0100 -0.0081 116  LEU A CB  
931  C  CG  . LEU A 114 ? 0.2107 0.1624 0.1392 0.0156  -0.0195 0.0207  116  LEU A CG  
932  C  CD1 . LEU A 114 ? 0.2387 0.1849 0.1454 -0.0081 -0.0285 0.0242  116  LEU A CD1 
933  C  CD2 . LEU A 114 ? 0.2437 0.2662 0.1635 -0.0438 -0.0149 0.0265  116  LEU A CD2 
934  N  N   . GLN A 115 ? 0.2383 0.2289 0.1831 0.0164  -0.0178 -0.0280 117  GLN A N   
935  C  CA  . GLN A 115 ? 0.2444 0.2294 0.1763 0.0118  -0.0284 -0.0366 117  GLN A CA  
936  C  C   . GLN A 115 ? 0.2226 0.2245 0.1803 0.0070  -0.0284 -0.0408 117  GLN A C   
937  O  O   . GLN A 115 ? 0.2510 0.2291 0.1954 -0.0145 -0.0419 -0.0356 117  GLN A O   
938  C  CB  . GLN A 115 ? 0.3359 0.2476 0.2021 0.0210  0.0334  -0.0259 117  GLN A CB  
939  C  CG  . GLN A 115 ? 0.2774 0.2774 0.2505 0.0272  0.0331  0.0051  117  GLN A CG  
940  C  CD  . GLN A 115 ? 0.3102 0.2550 0.2283 -0.0169 0.0229  -0.0220 117  GLN A CD  
941  O  OE1 . GLN A 115 ? 0.4021 0.3310 0.2760 -0.0920 -0.0539 0.0363  117  GLN A OE1 
942  N  NE2 . GLN A 115 ? 0.3939 0.3987 0.2338 -0.0774 0.0579  -0.0557 117  GLN A NE2 
943  N  N   . ASP A 116 ? 0.2439 0.2028 0.1828 0.0104  -0.0332 -0.0434 118  ASP A N   
944  C  CA  . ASP A 116 ? 0.2074 0.2335 0.1740 0.0244  -0.0029 -0.0256 118  ASP A CA  
945  C  C   . ASP A 116 ? 0.1861 0.2266 0.1744 0.0190  -0.0055 -0.0361 118  ASP A C   
946  O  O   . ASP A 116 ? 0.1995 0.2297 0.1661 0.0244  -0.0134 -0.0326 118  ASP A O   
947  C  CB  . ASP A 116 ? 0.1990 0.2360 0.2066 0.0247  0.0182  -0.0464 118  ASP A CB  
948  C  CG  . ASP A 116 ? 0.2995 0.3122 0.2372 -0.0690 0.0772  -0.0845 118  ASP A CG  
949  O  OD1 . ASP A 116 ? 0.2745 0.3414 0.2113 -0.0531 0.0316  -0.0650 118  ASP A OD1 
950  O  OD2 . ASP A 116 ? 0.3930 0.4798 0.2156 -0.2025 0.0249  -0.0558 118  ASP A OD2 
951  N  N   . ALA A 117 ? 0.2781 0.2258 0.1706 0.0020  -0.0018 -0.0351 119  ALA A N   
952  C  CA  . ALA A 117 ? 0.2258 0.2109 0.1895 0.0147  -0.0105 -0.0254 119  ALA A CA  
953  C  C   . ALA A 117 ? 0.2189 0.2084 0.1756 -0.0394 0.0069  -0.0069 119  ALA A C   
954  O  O   . ALA A 117 ? 0.2063 0.2307 0.2023 0.0159  0.0004  -0.0245 119  ALA A O   
955  C  CB  . ALA A 117 ? 0.3678 0.2254 0.2099 -0.0508 -0.0270 -0.0333 119  ALA A CB  
956  N  N   . GLN A 118 ? 0.1871 0.1688 0.1914 -0.0014 -0.0139 -0.0271 120  GLN A N   
957  C  CA  . GLN A 118 ? 0.2313 0.2093 0.1528 0.0168  -0.0152 0.0397  120  GLN A CA  
958  C  C   . GLN A 118 ? 0.2379 0.1828 0.1981 0.0278  -0.0211 -0.0153 120  GLN A C   
959  O  O   . GLN A 118 ? 0.2761 0.1968 0.2110 0.0042  0.0047  -0.0191 120  GLN A O   
960  C  CB  . GLN A 118 ? 0.2331 0.2349 0.1978 0.0206  0.0135  0.0053  120  GLN A CB  
961  C  CG  . GLN A 118 ? 0.2326 0.2168 0.1964 0.0053  0.0027  0.0056  120  GLN A CG  
962  C  CD  . GLN A 118 ? 0.2034 0.2323 0.1973 -0.0029 -0.0024 -0.0033 120  GLN A CD  
963  O  OE1 . GLN A 118 ? 0.2215 0.2307 0.1844 0.0071  0.0009  0.0012  120  GLN A OE1 
964  N  NE2 . GLN A 118 ? 0.2229 0.1978 0.1752 0.0003  -0.0168 -0.0244 120  GLN A NE2 
965  N  N   . LYS A 119 ? 0.2021 0.1837 0.2267 0.0314  0.0134  -0.0182 121  LYS A N   
966  C  CA  . LYS A 119 ? 0.2178 0.1916 0.1866 0.0487  0.0134  -0.0602 121  LYS A CA  
967  C  C   . LYS A 119 ? 0.2484 0.2332 0.2095 0.0612  -0.0071 -0.0176 121  LYS A C   
968  O  O   . LYS A 119 ? 0.2943 0.2580 0.3056 0.0912  -0.0091 0.0102  121  LYS A O   
969  C  CB  . LYS A 119 ? 0.2071 0.2478 0.2693 0.0440  0.0170  -0.0598 121  LYS A CB  
970  C  CG  . LYS A 119 ? 0.2408 0.2619 0.3352 0.0342  0.0020  0.0801  121  LYS A CG  
971  C  CD  . LYS A 119 ? 0.2800 0.4893 0.4009 -0.0751 -0.0512 0.1094  121  LYS A CD  
972  C  CE  . LYS A 119 ? 0.3668 0.6100 0.5105 -0.1059 -0.1976 0.1496  121  LYS A CE  
973  N  NZ  . LYS A 119 ? 0.4367 0.7517 0.8462 -0.2135 -0.2957 0.2108  121  LYS A NZ  
974  N  N   . GLY A 120 ? 0.2448 0.2478 0.2210 0.0570  0.0139  0.0334  122  GLY A N   
975  C  CA  . GLY A 120 ? 0.2311 0.2365 0.2025 0.0313  -0.0177 0.0099  122  GLY A CA  
976  C  C   . GLY A 120 ? 0.1884 0.2298 0.1776 0.0103  -0.0382 0.0203  122  GLY A C   
977  O  O   . GLY A 120 ? 0.2587 0.2242 0.1942 0.0372  -0.0384 0.0159  122  GLY A O   
978  N  N   . ALA A 121 ? 0.2294 0.2463 0.1871 0.0067  -0.0168 0.0255  123  ALA A N   
979  C  CA  . ALA A 121 ? 0.2340 0.1966 0.2187 0.0004  0.0022  0.0365  123  ALA A CA  
980  C  C   . ALA A 121 ? 0.2297 0.2031 0.1981 -0.0044 -0.0630 0.0350  123  ALA A C   
981  O  O   . ALA A 121 ? 0.1997 0.2009 0.1920 0.0078  -0.0126 0.0239  123  ALA A O   
982  C  CB  . ALA A 121 ? 0.2429 0.1934 0.2055 -0.0226 -0.0016 0.0162  123  ALA A CB  
983  N  N   . PHE A 122 ? 0.2034 0.1781 0.1656 -0.0247 -0.0359 0.0213  124  PHE A N   
984  C  CA  . PHE A 122 ? 0.2682 0.1759 0.1554 -0.0224 0.0153  0.0303  124  PHE A CA  
985  C  C   . PHE A 122 ? 0.2295 0.2350 0.1345 -0.0192 -0.0206 0.0032  124  PHE A C   
986  O  O   . PHE A 122 ? 0.2190 0.2093 0.1861 0.0072  -0.0434 -0.0184 124  PHE A O   
987  C  CB  . PHE A 122 ? 0.2401 0.1607 0.1302 -0.0090 -0.0258 -0.0087 124  PHE A CB  
988  C  CG  . PHE A 122 ? 0.2243 0.1539 0.1201 0.0078  -0.0755 -0.0014 124  PHE A CG  
989  C  CD1 . PHE A 122 ? 0.2487 0.1600 0.1753 0.0251  -0.0574 0.0191  124  PHE A CD1 
990  C  CD2 . PHE A 122 ? 0.2593 0.1847 0.1514 -0.0313 -0.0096 -0.0063 124  PHE A CD2 
991  C  CE1 . PHE A 122 ? 0.2832 0.1541 0.1590 0.0147  -0.0290 0.0187  124  PHE A CE1 
992  C  CE2 . PHE A 122 ? 0.2577 0.1668 0.1875 -0.0143 -0.0782 0.0370  124  PHE A CE2 
993  C  CZ  . PHE A 122 ? 0.2930 0.1737 0.2225 0.0014  -0.0506 0.0275  124  PHE A CZ  
994  N  N   . THR A 123 ? 0.2044 0.1882 0.1704 0.0000  -0.0233 -0.0062 125  THR A N   
995  C  CA  . THR A 123 ? 0.2442 0.1644 0.1631 -0.0144 0.0000  0.0070  125  THR A CA  
996  C  C   . THR A 123 ? 0.1958 0.1618 0.1379 -0.0179 -0.0068 0.0195  125  THR A C   
997  O  O   . THR A 123 ? 0.2030 0.1916 0.1640 -0.0362 0.0095  0.0050  125  THR A O   
998  C  CB  . THR A 123 ? 0.2509 0.1512 0.1808 0.0161  0.0044  0.0203  125  THR A CB  
999  O  OG1 . THR A 123 ? 0.2955 0.1627 0.1758 0.0041  0.0007  0.0056  125  THR A OG1 
1000 C  CG2 . THR A 123 ? 0.2367 0.1810 0.1470 -0.0141 -0.0312 -0.0174 125  THR A CG2 
1001 N  N   . LYS A 124 ? 0.2069 0.1806 0.1779 -0.0065 -0.0153 -0.0229 126  LYS A N   
1002 C  CA  . LYS A 124 ? 0.1749 0.1812 0.1282 -0.0014 -0.0265 -0.0042 126  LYS A CA  
1003 C  C   . LYS A 124 ? 0.1567 0.1692 0.1358 -0.0017 -0.0388 0.0062  126  LYS A C   
1004 O  O   . LYS A 124 ? 0.2312 0.1913 0.1434 0.0167  -0.0514 0.0227  126  LYS A O   
1005 C  CB  . LYS A 124 ? 0.1490 0.1863 0.1359 -0.0258 -0.0302 0.0002  126  LYS A CB  
1006 C  CG  . LYS A 124 ? 0.1723 0.1974 0.1194 0.0098  -0.0210 0.0234  126  LYS A CG  
1007 C  CD  . LYS A 124 ? 0.1494 0.2237 0.1863 -0.0008 -0.0371 0.0206  126  LYS A CD  
1008 C  CE  . LYS A 124 ? 0.1512 0.2062 0.2228 -0.0092 -0.0547 -0.0248 126  LYS A CE  
1009 N  NZ  . LYS A 124 ? 0.1662 0.2031 0.1503 0.0092  -0.0309 0.0118  126  LYS A NZ  
1010 N  N   . GLU A 125 ? 0.1814 0.1821 0.1365 -0.0282 -0.0014 -0.0053 127  GLU A N   
1011 C  CA  . GLU A 125 ? 0.2073 0.1609 0.1563 0.0290  -0.0096 -0.0393 127  GLU A CA  
1012 C  C   . GLU A 125 ? 0.1931 0.1597 0.1356 0.0310  -0.0293 -0.0307 127  GLU A C   
1013 O  O   . GLU A 125 ? 0.2423 0.2920 0.1508 -0.0023 -0.0678 -0.0109 127  GLU A O   
1014 C  CB  . GLU A 125 ? 0.4812 0.1586 0.2282 -0.0478 -0.0311 -0.0088 127  GLU A CB  
1015 C  CG  . GLU A 125 ? 0.5591 0.2103 0.1551 -0.0697 -0.0213 0.0049  127  GLU A CG  
1016 C  CD  . GLU A 125 ? 0.3945 0.2039 0.1078 -0.0590 -0.0145 -0.0217 127  GLU A CD  
1017 O  OE1 . GLU A 125 ? 0.3645 0.2595 0.1995 -0.0871 0.0259  -0.0429 127  GLU A OE1 
1018 O  OE2 . GLU A 125 ? 0.3190 0.2062 0.2387 -0.0147 -0.0646 0.0045  127  GLU A OE2 
1019 N  N   . ASP A 126 ? 0.1900 0.1956 0.1763 0.0205  -0.0320 -0.0208 128  ASP A N   
1020 C  CA  . ASP A 126 ? 0.2067 0.2346 0.2174 -0.0100 0.0015  -0.0318 128  ASP A CA  
1021 C  C   . ASP A 126 ? 0.1765 0.2387 0.2135 -0.0163 -0.0024 -0.0319 128  ASP A C   
1022 O  O   . ASP A 126 ? 0.2130 0.2656 0.2125 0.0151  0.0173  0.0071  128  ASP A O   
1023 C  CB  . ASP A 126 ? 0.2331 0.2685 0.1706 0.0240  0.0171  -0.0291 128  ASP A CB  
1024 C  CG  . ASP A 126 ? 0.2158 0.2419 0.1977 0.0198  0.0012  0.0008  128  ASP A CG  
1025 O  OD1 . ASP A 126 ? 0.2472 0.2438 0.1720 0.0028  -0.0133 -0.0131 128  ASP A OD1 
1026 O  OD2 . ASP A 126 ? 0.2189 0.2754 0.2948 0.0265  -0.0093 0.0257  128  ASP A OD2 
1027 N  N   . GLY A 127 ? 0.2019 0.2281 0.1343 0.0116  -0.0240 0.0136  129  GLY A N   
1028 C  CA  . GLY A 127 ? 0.1892 0.2337 0.1487 0.0155  0.0185  0.0105  129  GLY A CA  
1029 C  C   . GLY A 127 ? 0.2339 0.2098 0.2284 0.0064  -0.0290 0.0183  129  GLY A C   
1030 O  O   . GLY A 127 ? 0.2514 0.2111 0.2422 -0.0009 0.0189  0.0157  129  GLY A O   
1031 N  N   . GLU A 128 ? 0.2439 0.2233 0.1626 -0.0098 -0.0193 0.0030  130  GLU A N   
1032 C  CA  . GLU A 128 ? 0.1933 0.1917 0.2108 0.0147  -0.0061 -0.0259 130  GLU A CA  
1033 C  C   . GLU A 128 ? 0.2682 0.1805 0.1882 0.0105  0.0333  -0.0056 130  GLU A C   
1034 O  O   . GLU A 128 ? 0.2361 0.2741 0.1881 -0.0474 0.0140  -0.0328 130  GLU A O   
1035 C  CB  A GLU A 128 ? 0.1654 0.2209 0.3060 -0.0029 -0.0418 0.0119  130  GLU A CB  
1036 C  CB  B GLU A 128 ? 0.1677 0.2093 0.2452 -0.0030 -0.0188 -0.0058 130  GLU A CB  
1037 C  CG  A GLU A 128 ? 0.2434 0.1815 0.2935 0.0391  -0.1298 -0.0119 130  GLU A CG  
1038 C  CG  B GLU A 128 ? 0.1240 0.2825 0.2042 -0.0456 0.0178  0.0161  130  GLU A CG  
1039 C  CD  A GLU A 128 ? 0.2804 0.2305 0.2997 0.0462  -0.1545 0.0048  130  GLU A CD  
1040 C  CD  B GLU A 128 ? 0.0971 0.3544 0.2287 -0.0140 0.0231  0.0412  130  GLU A CD  
1041 O  OE1 A GLU A 128 ? 0.3379 0.3371 0.3275 -0.0637 -0.2027 0.0543  130  GLU A OE1 
1042 O  OE1 B GLU A 128 ? 0.2856 0.3460 0.1666 0.0226  0.0401  0.0747  130  GLU A OE1 
1043 O  OE2 A GLU A 128 ? 0.1321 0.1872 0.2786 -0.0072 -0.0115 0.1015  130  GLU A OE2 
1044 O  OE2 B GLU A 128 ? 0.3064 0.4364 0.2129 0.0235  -0.0312 0.0265  130  GLU A OE2 
1045 N  N   . LYS A 129 ? 0.2725 0.1866 0.2252 0.0054  0.0112  -0.0307 131  LYS A N   
1046 C  CA  . LYS A 129 ? 0.2423 0.1861 0.1877 -0.0013 -0.0107 -0.0280 131  LYS A CA  
1047 C  C   . LYS A 129 ? 0.2111 0.3041 0.2019 -0.0238 -0.0291 -0.0180 131  LYS A C   
1048 O  O   . LYS A 129 ? 0.2168 0.4604 0.2271 -0.0135 -0.0240 -0.0553 131  LYS A O   
1049 C  CB  . LYS A 129 ? 0.2967 0.1769 0.2417 -0.0154 -0.0083 -0.0433 131  LYS A CB  
1050 C  CG  . LYS A 129 ? 0.3422 0.2155 0.2646 -0.0086 -0.0170 0.0269  131  LYS A CG  
1051 C  CD  . LYS A 129 ? 0.4225 0.2331 0.3149 -0.0339 0.0465  0.0292  131  LYS A CD  
1052 C  CE  . LYS A 129 ? 0.4880 0.3053 0.3892 -0.0056 0.0084  0.1390  131  LYS A CE  
1053 N  NZ  . LYS A 129 ? 1.0314 0.3144 0.7348 -0.0078 -0.0764 0.2598  131  LYS A NZ  
1054 N  N   . VAL A 130 ? 0.2094 0.2324 0.1991 -0.0422 -0.0482 0.0191  132  VAL A N   
1055 C  CA  . VAL A 130 ? 0.2338 0.2152 0.2038 -0.0117 -0.0626 0.0245  132  VAL A CA  
1056 C  C   . VAL A 130 ? 0.2335 0.2496 0.2086 -0.0271 -0.0314 0.0052  132  VAL A C   
1057 O  O   . VAL A 130 ? 0.1923 0.2606 0.1897 -0.0107 0.0021  -0.0187 132  VAL A O   
1058 C  CB  . VAL A 130 ? 0.2515 0.2465 0.1821 -0.0198 -0.0013 0.0036  132  VAL A CB  
1059 C  CG1 . VAL A 130 ? 0.2847 0.2212 0.2134 0.0170  -0.0397 0.0272  132  VAL A CG1 
1060 C  CG2 . VAL A 130 ? 0.2294 0.1925 0.1962 0.0156  -0.0325 0.0474  132  VAL A CG2 
1061 N  N   . VAL A 131 ? 0.2251 0.2222 0.2199 -0.0320 -0.0469 0.0077  133  VAL A N   
1062 C  CA  . VAL A 131 ? 0.2830 0.2382 0.1723 -0.0170 -0.0415 0.0057  133  VAL A CA  
1063 C  C   . VAL A 131 ? 0.2625 0.2185 0.1816 -0.0289 -0.0424 0.0005  133  VAL A C   
1064 O  O   . VAL A 131 ? 0.2166 0.2324 0.1694 -0.0209 -0.0182 -0.0127 133  VAL A O   
1065 C  CB  . VAL A 131 ? 0.3352 0.2987 0.2086 0.0189  0.0013  0.0543  133  VAL A CB  
1066 C  CG1 . VAL A 131 ? 0.3169 0.4842 0.2332 0.1009  0.0477  0.1261  133  VAL A CG1 
1067 C  CG2 . VAL A 131 ? 0.3021 0.3962 0.4031 0.0191  0.0107  0.1967  133  VAL A CG2 
1068 N  N   . ASP A 132 ? 0.2673 0.2238 0.2035 -0.0525 -0.0350 0.0178  134  ASP A N   
1069 C  CA  . ASP A 132 ? 0.2969 0.2289 0.2014 -0.0228 -0.0317 0.0126  134  ASP A CA  
1070 C  C   . ASP A 132 ? 0.3140 0.2299 0.1950 -0.0152 -0.0241 0.0098  134  ASP A C   
1071 O  O   . ASP A 132 ? 0.3520 0.2727 0.1855 -0.0352 -0.0186 -0.0005 134  ASP A O   
1072 C  CB  . ASP A 132 ? 0.3324 0.2196 0.2091 -0.0234 -0.0138 0.0180  134  ASP A CB  
1073 C  CG  . ASP A 132 ? 0.3908 0.3061 0.2433 -0.1117 -0.0202 -0.0077 134  ASP A CG  
1074 O  OD1 . ASP A 132 ? 0.5546 0.3588 0.3385 -0.2213 0.0057  0.0057  134  ASP A OD1 
1075 O  OD2 . ASP A 132 ? 0.3517 0.2710 0.2269 -0.0535 -0.0366 -0.0251 134  ASP A OD2 
1076 N  N   . GLU A 133 ? 0.2995 0.2401 0.2857 -0.0150 -0.0156 0.0440  135  GLU A N   
1077 C  CA  . GLU A 133 ? 0.3246 0.2693 0.2762 0.0088  -0.0181 0.0167  135  GLU A CA  
1078 C  C   . GLU A 133 ? 0.4151 0.2766 0.2927 0.0645  -0.0505 0.0026  135  GLU A C   
1079 O  O   . GLU A 133 ? 0.4757 0.3699 0.3235 0.0771  0.0031  -0.0604 135  GLU A O   
1080 C  CB  . GLU A 133 ? 0.3795 0.3269 0.3277 0.0676  -0.0888 -0.0149 135  GLU A CB  
1081 C  CG  . GLU A 133 ? 0.3823 0.3493 0.4305 0.0665  -0.0552 0.0594  135  GLU A CG  
1082 C  CD  . GLU A 133 ? 0.4546 0.3148 0.3965 0.0726  0.0671  0.0121  135  GLU A CD  
1083 O  OE1 . GLU A 133 ? 0.5885 0.3057 0.5819 0.0757  0.2159  -0.0148 135  GLU A OE1 
1084 O  OE2 . GLU A 133 ? 0.4196 0.3093 0.3291 0.1353  0.0010  0.0396  135  GLU A OE2 
1085 N  N   . ALA A 134 ? 0.5013 0.2032 0.3131 0.0283  -0.1022 0.0146  136  ALA A N   
1086 C  CA  . ALA A 134 ? 0.6017 0.2843 0.3164 0.0100  -0.0721 -0.0200 136  ALA A CA  
1087 C  C   . ALA A 134 ? 0.4967 0.3473 0.2560 0.0597  -0.0010 -0.0221 136  ALA A C   
1088 O  O   . ALA A 134 ? 0.6351 0.4066 0.3016 0.0814  -0.1387 -0.0993 136  ALA A O   
1089 C  CB  . ALA A 134 ? 0.7913 0.3703 0.2914 -0.1417 -0.1286 -0.0260 136  ALA A CB  
1090 N  N   . GLY A 135 ? 0.3179 0.3285 0.2382 0.0169  -0.0007 -0.0028 137  GLY A N   
1091 C  CA  . GLY A 135 ? 0.2900 0.3395 0.2266 -0.0117 -0.0245 -0.0074 137  GLY A CA  
1092 C  C   . GLY A 135 ? 0.2784 0.2874 0.2561 -0.0022 0.0089  -0.0205 137  GLY A C   
1093 O  O   . GLY A 135 ? 0.2621 0.2948 0.2730 -0.0088 0.0080  -0.0104 137  GLY A O   
1094 N  N   . LYS A 136 ? 0.3124 0.2517 0.2468 -0.0463 -0.0156 -0.0414 138  LYS A N   
1095 C  CA  . LYS A 136 ? 0.3118 0.3156 0.1792 -0.0571 0.0155  -0.0127 138  LYS A CA  
1096 C  C   . LYS A 136 ? 0.2792 0.3280 0.2540 -0.0369 -0.0341 -0.0442 138  LYS A C   
1097 O  O   . LYS A 136 ? 0.2490 0.2643 0.2624 -0.0006 -0.0456 -0.0408 138  LYS A O   
1098 C  CB  . LYS A 136 ? 0.4191 0.3348 0.2784 -0.0975 0.1003  -0.0222 138  LYS A CB  
1099 C  CG  . LYS A 136 ? 0.4131 0.4951 0.4465 -0.1738 0.1292  -0.0525 138  LYS A CG  
1100 C  CD  . LYS A 136 ? 0.6486 0.6353 0.4539 -0.3872 0.1422  -0.0756 138  LYS A CD  
1101 C  CE  . LYS A 136 ? 0.9545 0.7519 0.4544 -0.4781 0.2026  -0.0801 138  LYS A CE  
1102 N  NZ  . LYS A 136 ? 1.1442 0.8210 0.5643 -0.2277 0.0662  0.1325  138  LYS A NZ  
1103 N  N   . ARG A 137 ? 0.3169 0.3629 0.1886 -0.0209 -0.0334 -0.0486 139  ARG A N   
1104 C  CA  . ARG A 137 ? 0.2854 0.3913 0.2579 0.0023  -0.0450 -0.0603 139  ARG A CA  
1105 C  C   . ARG A 137 ? 0.2522 0.3770 0.3171 -0.0741 -0.0161 -0.1476 139  ARG A C   
1106 O  O   . ARG A 137 ? 0.4038 0.4269 0.4613 -0.1639 0.0198  -0.2359 139  ARG A O   
1107 C  CB  . ARG A 137 ? 0.3580 0.4282 0.3967 0.0102  -0.1460 -0.0417 139  ARG A CB  
1108 C  CG  . ARG A 137 ? 0.6455 0.4634 0.4305 -0.0890 -0.2731 0.0430  139  ARG A CG  
1109 C  CD  . ARG A 137 ? 0.6678 0.4306 0.3629 -0.0945 0.0465  0.0032  139  ARG A CD  
1110 N  NE  . ARG A 137 ? 0.5321 0.5233 0.4353 -0.1275 0.0470  0.1168  139  ARG A NE  
1111 C  CZ  . ARG A 137 ? 0.4240 0.5303 0.4116 0.0079  -0.0380 0.1407  139  ARG A CZ  
1112 N  NH1 . ARG A 137 ? 0.3028 0.4817 0.4251 0.0097  -0.0936 0.0641  139  ARG A NH1 
1113 N  NH2 . ARG A 137 ? 0.3706 0.5195 0.4858 -0.0308 -0.0718 0.2421  139  ARG A NH2 
1114 N  N   . LEU A 138 ? 0.2782 0.3712 0.3251 -0.0899 0.0218  -0.1664 140  LEU A N   
1115 C  CA  . LEU A 138 ? 0.2587 0.4498 0.3890 -0.0154 0.0840  -0.1627 140  LEU A CA  
1116 C  C   . LEU A 138 ? 0.3396 0.5276 0.5567 0.0783  0.0921  -0.1103 140  LEU A C   
1117 O  O   . LEU A 138 ? 0.4818 0.6136 0.7150 0.1185  -0.0180 0.0640  140  LEU A O   
1118 C  CB  . LEU A 138 ? 0.4100 0.4488 0.3469 -0.0789 0.0512  -0.0515 140  LEU A CB  
1119 C  CG  . LEU A 138 ? 0.4433 0.3879 0.4969 -0.0936 -0.0623 -0.0041 140  LEU A CG  
1120 C  CD1 . LEU A 138 ? 0.4067 0.4020 0.6362 -0.1639 -0.0507 -0.0597 140  LEU A CD1 
1121 C  CD2 . LEU A 138 ? 0.5271 0.3823 0.7460 -0.1769 -0.1296 -0.0659 140  LEU A CD2 
1122 O  OXT . LEU A 138 ? 0.8950 1.0906 2.0000 -0.1900 0.2413  0.6888  140  LEU A OXT 
1123 S  S   . SO4 B .   ? 0.3142 0.2700 0.1970 -0.0383 -0.0417 0.0256  201  SO4 A S   
1124 O  O1  . SO4 B .   ? 0.5904 0.4662 0.1954 -0.2113 -0.1323 0.0572  201  SO4 A O1  
1125 O  O2  . SO4 B .   ? 0.2077 0.2632 0.1628 -0.0167 0.0122  0.0145  201  SO4 A O2  
1126 O  O3  . SO4 B .   ? 0.2716 0.3867 0.2340 -0.0277 -0.1211 -0.0061 201  SO4 A O3  
1127 O  O4  . SO4 B .   ? 0.2891 0.3105 0.2574 0.0242  0.0906  -0.0541 201  SO4 A O4  
1128 S  S   . SO4 C .   ? 0.5011 0.7294 0.7152 0.0450  0.0330  -0.1028 202  SO4 A S   
1129 O  O1  . SO4 C .   ? 0.7532 0.6379 0.7955 -0.0392 -0.1512 -0.1803 202  SO4 A O1  
1130 O  O2  . SO4 C .   ? 0.7652 0.7216 0.8328 -0.0334 -0.0181 -0.0262 202  SO4 A O2  
1131 O  O3  . SO4 C .   ? 0.6135 1.0526 0.8969 -0.2051 0.0799  -0.3143 202  SO4 A O3  
1132 O  O4  . SO4 C .   ? 0.5356 0.9217 0.6786 -0.0174 0.1248  -0.2110 202  SO4 A O4  
1133 S  S   . SO4 D .   ? 0.2229 0.2485 0.2038 -0.0385 -0.0018 0.0408  203  SO4 A S   
1134 O  O1  . SO4 D .   ? 0.6324 0.2551 0.4004 -0.0361 0.1687  0.0130  203  SO4 A O1  
1135 O  O2  . SO4 D .   ? 0.3639 0.6312 0.2249 -0.2014 -0.0512 0.1191  203  SO4 A O2  
1136 O  O3  . SO4 D .   ? 0.2290 0.4376 0.4044 -0.0361 0.0060  0.1768  203  SO4 A O3  
1137 O  O4  . SO4 D .   ? 0.2538 0.2680 0.2036 -0.0128 0.0322  0.0325  203  SO4 A O4  
1138 S  S   . SO4 E .   ? 0.4351 0.3407 0.3220 0.0170  -0.0537 0.0021  204  SO4 A S   
1139 O  O1  . SO4 E .   ? 0.4845 0.3864 0.3565 0.0394  -0.0289 -0.0217 204  SO4 A O1  
1140 O  O2  . SO4 E .   ? 0.3630 0.3224 0.4103 0.0643  -0.0524 -0.0170 204  SO4 A O2  
1141 O  O3  . SO4 E .   ? 0.3654 0.4531 0.1370 0.0095  -0.0235 0.0467  204  SO4 A O3  
1142 O  O4  . SO4 E .   ? 0.5170 0.2707 0.3364 0.0511  -0.0663 -0.0083 204  SO4 A O4  
1143 CS CS  . CS  F .   ? 0.2182 0.2311 0.1875 -0.0080 -0.0136 -0.0309 401  CS  A CS  
1144 CS CS  . CS  G .   ? 0.3298 0.4454 0.2942 -0.0344 0.0425  0.0946  402  CS  A CS  
1145 CS CS  . CS  H .   ? 0.2669 0.4689 0.2559 -0.0465 -0.0137 0.0739  403  CS  A CS  
1146 CS CS  . CS  I .   ? 0.4511 0.5450 0.4934 0.0108  0.0267  -0.0868 404  CS  A CS  
1147 CS CS  . CS  J .   ? 0.3521 0.3194 0.2647 0.0177  0.0436  -0.0329 405  CS  A CS  
1148 O  O   . HOH K .   ? 0.2041 0.1546 0.1322 0.0260  -0.0157 0.0044  1001 HOH A O   
1149 O  O   . HOH K .   ? 0.2107 0.2465 0.2401 0.0200  -0.0100 -0.0456 1002 HOH A O   
1150 O  O   . HOH K .   ? 0.2718 0.2506 0.1617 -0.0182 0.0009  -0.0076 1003 HOH A O   
1151 O  O   . HOH K .   ? 0.1980 0.2345 0.1549 -0.0260 -0.0478 0.0007  1004 HOH A O   
1152 O  O   . HOH K .   ? 0.2079 0.2144 0.1795 0.0266  -0.0183 -0.0127 1005 HOH A O   
1153 O  O   . HOH K .   ? 0.2715 0.1996 0.1775 -0.0065 -0.0526 0.0110  1006 HOH A O   
1154 O  O   . HOH K .   ? 0.2495 0.2783 0.2323 0.0053  0.0205  0.0533  1007 HOH A O   
1155 O  O   . HOH K .   ? 0.2043 0.1971 0.1767 -0.0105 -0.0064 0.0084  1008 HOH A O   
1156 O  O   . HOH K .   ? 0.2173 0.2601 0.1630 -0.0214 0.0151  -0.0127 1009 HOH A O   
1157 O  O   . HOH K .   ? 0.2975 0.2501 0.2204 0.0292  -0.0123 0.0301  1010 HOH A O   
1158 O  O   . HOH K .   ? 0.2536 0.2750 0.2097 -0.0219 -0.0201 0.0408  1011 HOH A O   
1159 O  O   . HOH K .   ? 0.2631 0.2448 0.2430 0.0044  -0.0460 0.0053  1012 HOH A O   
1160 O  O   . HOH K .   ? 0.2782 0.2696 0.2340 0.0209  0.0024  0.0143  1013 HOH A O   
1161 O  O   . HOH K .   ? 0.2404 0.2199 0.2049 0.0473  -0.0183 0.0025  1014 HOH A O   
1162 O  O   . HOH K .   ? 0.3893 0.2576 0.1754 0.0016  -0.0813 0.0401  1015 HOH A O   
1163 O  O   . HOH K .   ? 0.2722 0.2232 0.1696 0.0123  -0.0519 0.0081  1016 HOH A O   
1164 O  O   . HOH K .   ? 0.2258 0.1958 0.1854 -0.0222 0.0165  0.0266  1017 HOH A O   
1165 O  O   . HOH K .   ? 0.2296 0.2392 0.1825 0.0147  -0.0417 -0.0184 1018 HOH A O   
1166 O  O   . HOH K .   ? 0.2209 0.2348 0.1742 -0.0061 -0.0483 -0.0178 1019 HOH A O   
1167 O  O   . HOH K .   ? 0.3435 0.2463 0.2123 -0.0014 0.0234  0.0351  1020 HOH A O   
1168 O  O   . HOH K .   ? 0.2372 0.2222 0.1693 0.0136  0.0329  0.0192  1021 HOH A O   
1169 O  O   . HOH K .   ? 0.2384 0.2156 0.2293 -0.0013 0.0129  -0.0126 1022 HOH A O   
1170 O  O   . HOH K .   ? 0.2812 0.2966 0.2259 0.0204  0.0093  -0.0402 1023 HOH A O   
1171 O  O   . HOH K .   ? 0.2594 0.2510 0.2526 0.0118  -0.0471 0.0560  1024 HOH A O   
1172 O  O   . HOH K .   ? 0.3008 0.2335 0.2367 -0.0372 -0.0050 -0.0060 1025 HOH A O   
1173 O  O   . HOH K .   ? 0.2654 0.2146 0.2124 -0.0035 0.0354  0.0096  1026 HOH A O   
1174 O  O   . HOH K .   ? 0.3300 0.1998 0.2544 0.0080  -0.0020 -0.0170 1027 HOH A O   
1175 O  O   . HOH K .   ? 0.2172 0.2533 0.3127 0.0337  0.0024  0.0018  1028 HOH A O   
1176 O  O   . HOH K .   ? 0.2336 0.3850 0.3098 -0.0344 -0.0278 -0.0786 1029 HOH A O   
1177 O  O   . HOH K .   ? 0.2258 0.2295 0.1977 0.0024  -0.0417 -0.0113 1030 HOH A O   
1178 O  O   . HOH K .   ? 0.2695 0.3346 0.2047 0.0033  -0.0363 -0.0498 1031 HOH A O   
1179 O  O   . HOH K .   ? 0.2094 0.2881 0.3645 0.0180  -0.0366 -0.0638 1032 HOH A O   
1180 O  O   . HOH K .   ? 0.3003 0.2499 0.1651 0.0191  -0.0286 0.0239  1033 HOH A O   
1181 O  O   . HOH K .   ? 0.2635 0.2734 0.2257 -0.0623 -0.0471 0.0138  1034 HOH A O   
1182 O  O   . HOH K .   ? 0.2685 0.1983 0.1963 0.0393  -0.0327 0.0138  1035 HOH A O   
1183 O  O   . HOH K .   ? 0.2236 0.2880 0.2516 -0.0310 0.0155  0.0051  1036 HOH A O   
1184 O  O   . HOH K .   ? 0.2210 0.2795 0.2324 -0.0266 -0.0355 -0.0076 1037 HOH A O   
1185 O  O   . HOH K .   ? 0.2202 0.2279 0.2029 0.0090  -0.0055 -0.0495 1038 HOH A O   
1186 O  O   . HOH K .   ? 0.2666 0.2659 0.1881 0.0003  0.0116  -0.0566 1039 HOH A O   
1187 O  O   . HOH K .   ? 0.2392 0.2527 0.1961 0.0483  0.0134  0.0136  1040 HOH A O   
1188 O  O   . HOH K .   ? 0.3371 0.2490 0.2097 0.0251  -0.0263 -0.0035 1041 HOH A O   
1189 O  O   . HOH K .   ? 0.3057 0.2072 0.1943 -0.0057 -0.0496 0.0021  1042 HOH A O   
1190 O  O   . HOH K .   ? 0.3325 0.3150 0.2600 -0.0253 0.0492  -0.0747 1043 HOH A O   
1191 O  O   . HOH K .   ? 0.2859 0.2203 0.2352 -0.0079 -0.0306 -0.0128 1044 HOH A O   
1192 O  O   . HOH K .   ? 0.2459 0.2542 0.2416 -0.0063 -0.0250 0.0406  1045 HOH A O   
1193 O  O   . HOH K .   ? 0.3190 0.2594 0.1974 -0.0420 -0.0267 -0.0072 1046 HOH A O   
1194 O  O   . HOH K .   ? 0.4429 0.2642 0.1778 -0.0164 0.0051  0.0519  1047 HOH A O   
1195 O  O   . HOH K .   ? 0.3551 0.3579 0.2339 0.0064  -0.0229 0.0034  1048 HOH A O   
1196 O  O   . HOH K .   ? 0.2892 0.2952 0.2127 -0.0176 -0.0172 0.0482  1049 HOH A O   
1197 O  O   . HOH K .   ? 0.2267 0.2255 0.1890 0.0026  -0.0184 0.0229  1050 HOH A O   
1198 O  O   . HOH K .   ? 0.2282 0.2283 0.1609 -0.0157 -0.0166 0.0240  1051 HOH A O   
1199 O  O   . HOH K .   ? 0.4513 0.3251 0.2450 -0.0092 0.0746  0.0291  1052 HOH A O   
1200 O  O   . HOH K .   ? 0.2776 0.2853 0.1878 -0.0253 -0.0269 -0.0204 1053 HOH A O   
1201 O  O   . HOH K .   ? 0.2887 0.2301 0.1919 -0.0187 -0.0180 -0.0257 1054 HOH A O   
1202 O  O   . HOH K .   ? 0.4377 0.2926 0.2337 -0.0012 0.0477  0.0530  1055 HOH A O   
1203 O  O   . HOH K .   ? 0.3227 0.2707 0.2578 0.0324  -0.0689 0.0236  1056 HOH A O   
1204 O  O   . HOH K .   ? 0.4494 0.3618 0.2668 -0.0037 -0.0313 -0.0571 1057 HOH A O   
1205 O  O   . HOH K .   ? 0.3587 0.5447 0.3100 -0.1098 -0.0187 -0.0154 1058 HOH A O   
1206 O  O   . HOH K .   ? 0.2893 0.4080 0.1882 0.0259  -0.0518 0.0034  1059 HOH A O   
1207 O  O   . HOH K .   ? 0.8469 0.3585 0.3894 -0.1797 0.2896  -0.1426 1060 HOH A O   
1208 O  O   . HOH K .   ? 0.3323 0.2940 0.2526 0.0386  -0.0048 -0.0732 1061 HOH A O   
1209 O  O   . HOH K .   ? 0.2300 0.2656 0.1949 -0.0115 0.0023  0.0106  1062 HOH A O   
1210 O  O   . HOH K .   ? 0.3146 0.3148 0.2187 0.0212  -0.0113 0.0193  1063 HOH A O   
1211 O  O   . HOH K .   ? 0.4781 0.4138 0.2403 -0.0438 0.0229  -0.0425 1064 HOH A O   
1212 O  O   . HOH K .   ? 0.3434 0.3583 0.2234 -0.0762 0.0838  -0.0847 1065 HOH A O   
1213 O  O   . HOH K .   ? 0.2968 0.3208 0.4122 -0.0438 -0.0595 -0.0125 1066 HOH A O   
1214 O  O   . HOH K .   ? 0.2944 0.4581 0.3009 -0.0545 -0.0869 0.0431  1067 HOH A O   
1215 O  O   . HOH K .   ? 0.2620 0.2661 0.2964 -0.0101 0.0363  -0.0199 1068 HOH A O   
1216 O  O   . HOH K .   ? 0.2619 0.2648 0.2473 -0.0269 -0.0735 0.0295  1069 HOH A O   
1217 O  O   . HOH K .   ? 0.3193 0.3335 0.2269 0.0546  -0.0201 -0.0825 1070 HOH A O   
1218 O  O   . HOH K .   ? 0.3932 0.3019 0.2671 -0.0450 -0.0518 0.0384  1071 HOH A O   
1219 O  O   . HOH K .   ? 0.3298 0.5275 0.3825 -0.0217 -0.0977 0.0347  1072 HOH A O   
1220 O  O   . HOH K .   ? 0.2600 0.2667 0.2140 0.0166  0.0173  0.0497  1073 HOH A O   
1221 O  O   . HOH K .   ? 0.3916 0.3431 0.3471 -0.0784 0.0853  -0.0172 1074 HOH A O   
1222 O  O   . HOH K .   ? 0.3856 0.3167 0.2991 0.0091  0.0072  0.0721  1075 HOH A O   
1223 O  O   . HOH K .   ? 0.4499 0.2646 0.2421 -0.0229 0.0880  0.0173  1076 HOH A O   
1224 O  O   . HOH K .   ? 0.1787 0.4199 0.2321 -0.0073 -0.0077 -0.0382 1077 HOH A O   
1225 O  O   . HOH K .   ? 0.2779 0.3318 0.2848 0.0226  -0.1019 -0.0998 1078 HOH A O   
1226 O  O   . HOH K .   ? 0.3531 0.3406 0.3033 -0.0500 -0.0908 0.0283  1079 HOH A O   
1227 O  O   . HOH K .   ? 0.3235 0.2359 0.2325 0.0656  -0.0283 0.0152  1080 HOH A O   
1228 O  O   . HOH K .   ? 0.2982 0.2714 0.2380 0.0329  -0.0299 0.0141  1081 HOH A O   
1229 O  O   . HOH K .   ? 0.3865 0.3735 0.2805 0.0001  -0.0163 0.0084  1082 HOH A O   
1230 O  O   . HOH K .   ? 0.4819 0.3939 0.2935 -0.0026 -0.0966 0.0162  1083 HOH A O   
1231 O  O   . HOH K .   ? 0.2936 0.2524 0.3346 -0.0644 0.0076  -0.0337 1084 HOH A O   
1232 O  O   . HOH K .   ? 0.3754 0.3523 0.3036 -0.0885 0.0502  -0.1083 1085 HOH A O   
1233 O  O   . HOH K .   ? 0.3997 0.3854 0.2835 -0.0479 -0.0456 -0.0253 1086 HOH A O   
1234 O  O   . HOH K .   ? 0.3214 0.2813 0.2337 -0.0491 -0.0125 -0.0060 1087 HOH A O   
1235 O  O   . HOH K .   ? 0.3203 0.2618 0.2549 0.0400  0.0160  -0.0320 1088 HOH A O   
1236 O  O   . HOH K .   ? 0.3849 0.3686 0.3244 -0.0449 0.0087  0.0629  1089 HOH A O   
1237 O  O   . HOH K .   ? 0.3225 0.3143 0.4091 0.0037  0.0403  0.0135  1090 HOH A O   
1238 O  O   . HOH K .   ? 0.3674 0.3515 0.4828 0.0427  -0.0946 0.0200  1091 HOH A O   
1239 O  O   . HOH K .   ? 0.3004 0.3345 0.2927 -0.0258 0.1082  0.0398  1092 HOH A O   
1240 O  O   . HOH K .   ? 0.2963 0.2801 0.4001 0.0191  -0.0454 -0.0055 1093 HOH A O   
1241 O  O   . HOH K .   ? 0.2933 0.5821 0.5589 0.0972  -0.1560 -0.0664 1094 HOH A O   
1242 O  O   . HOH K .   ? 0.3696 0.2156 0.2306 -0.0182 -0.0138 0.0164  1095 HOH A O   
1243 O  O   . HOH K .   ? 0.2994 0.3471 0.2923 -0.0202 0.0381  0.0808  1096 HOH A O   
1244 O  O   . HOH K .   ? 0.3336 0.4396 0.3259 -0.0728 0.0148  -0.0296 1097 HOH A O   
1245 O  O   . HOH K .   ? 0.5451 0.5188 0.2821 -0.2122 -0.0683 0.0119  1098 HOH A O   
1246 O  O   . HOH K .   ? 0.3560 0.2659 0.2606 0.0285  -0.0961 -0.0176 1099 HOH A O   
1247 O  O   . HOH K .   ? 0.2850 0.3361 0.3156 0.0046  0.1056  -0.0624 1100 HOH A O   
1248 O  O   . HOH K .   ? 0.4693 0.4425 0.3216 -0.0163 -0.0159 -0.0996 1101 HOH A O   
1249 O  O   . HOH K .   ? 0.5062 0.4301 0.5263 -0.0430 0.1428  0.0203  1102 HOH A O   
1250 O  O   . HOH K .   ? 0.2735 0.3347 0.3296 0.0017  -0.0678 0.0132  1103 HOH A O   
1251 O  O   . HOH K .   ? 0.4396 0.3620 0.3418 0.0302  0.0162  0.0484  1104 HOH A O   
1252 O  O   . HOH K .   ? 0.2846 0.2872 0.2301 0.0167  -0.0005 -0.0546 1105 HOH A O   
1253 O  O   . HOH K .   ? 0.4830 0.2358 0.2995 0.0102  -0.0951 0.0009  1106 HOH A O   
1254 O  O   . HOH K .   ? 0.3710 0.3339 0.3475 -0.0208 -0.0391 -0.0372 1107 HOH A O   
1255 O  O   . HOH K .   ? 0.4052 0.3008 0.3395 -0.0472 0.0859  -0.0003 1108 HOH A O   
1256 O  O   . HOH K .   ? 0.3175 0.2786 0.2352 0.0365  0.0117  -0.0104 1109 HOH A O   
1257 O  O   . HOH K .   ? 0.4043 0.4375 0.2182 -0.0363 0.0616  -0.1190 1110 HOH A O   
1258 O  O   . HOH K .   ? 0.4942 0.4763 0.4850 0.0719  -0.0860 -0.1192 1111 HOH A O   
1259 O  O   . HOH K .   ? 0.4070 0.4838 0.5749 -0.0205 0.2262  -0.0444 1112 HOH A O   
1260 O  O   . HOH K .   ? 0.3614 0.2958 0.3606 -0.0288 -0.1012 0.0744  1113 HOH A O   
1261 O  O   . HOH K .   ? 0.3163 0.3384 0.4157 -0.0237 -0.0671 0.1362  1114 HOH A O   
1262 O  O   . HOH K .   ? 0.3436 0.2669 0.6884 0.0838  -0.1253 -0.0709 1115 HOH A O   
1263 O  O   . HOH K .   ? 0.3665 0.3434 0.3720 -0.1117 0.0700  -0.0194 1116 HOH A O   
1264 O  O   . HOH K .   ? 0.5158 0.3152 0.4179 0.0429  0.0725  0.0105  1117 HOH A O   
1265 O  O   . HOH K .   ? 0.6982 0.3678 0.3673 0.0732  -0.1347 0.0953  1118 HOH A O   
1266 O  O   . HOH K .   ? 0.3880 0.4005 0.2550 -0.0886 -0.0263 -0.0151 1119 HOH A O   
1267 O  O   . HOH K .   ? 0.4314 0.4369 0.3916 -0.0457 -0.2517 0.0732  1120 HOH A O   
1268 O  O   . HOH K .   ? 0.6183 0.4828 0.4755 0.0550  0.0394  -0.0686 1121 HOH A O   
1269 O  O   . HOH K .   ? 0.4851 0.3609 0.4933 0.0249  0.1340  0.0419  1122 HOH A O   
1270 O  O   . HOH K .   ? 0.3984 0.4017 0.5107 0.0002  -0.0747 0.0501  1123 HOH A O   
1271 O  O   . HOH K .   ? 0.3701 0.4228 0.2905 -0.0267 -0.0538 -0.0655 1124 HOH A O   
1272 O  O   . HOH K .   ? 0.3462 0.3511 0.3368 -0.0207 -0.0364 0.0626  1125 HOH A O   
1273 O  O   . HOH K .   ? 0.3030 0.3444 0.4726 -0.0354 -0.0406 -0.0596 1126 HOH A O   
1274 O  O   . HOH K .   ? 0.4165 0.4716 0.3205 -0.1794 0.0199  0.0903  1127 HOH A O   
1275 O  O   . HOH K .   ? 0.2881 0.4253 0.6022 0.0315  -0.0425 0.0190  1128 HOH A O   
1276 O  O   . HOH K .   ? 0.5576 0.4942 0.3557 -0.0144 -0.0821 -0.0804 1129 HOH A O   
1277 O  O   . HOH K .   ? 0.4873 0.3798 0.3923 -0.0978 -0.0536 0.0686  1130 HOH A O   
1278 O  O   . HOH K .   ? 0.4553 0.4297 0.2953 -0.0437 -0.0091 0.0117  1131 HOH A O   
1279 O  O   . HOH K .   ? 0.4504 0.4044 0.3547 -0.0666 0.0800  -0.0448 1132 HOH A O   
1280 O  O   . HOH K .   ? 0.3611 0.3064 0.4059 -0.0329 0.0042  0.0362  1133 HOH A O   
1281 O  O   . HOH K .   ? 0.5498 0.4199 0.4975 -0.0510 -0.1005 0.1236  1134 HOH A O   
1282 O  O   . HOH K .   ? 0.3619 0.3490 0.3220 -0.1106 -0.0322 0.0898  1135 HOH A O   
1283 O  O   . HOH K .   ? 0.5432 0.4182 0.4185 0.0866  0.0314  -0.0670 1136 HOH A O   
1284 O  O   . HOH K .   ? 0.4320 0.6257 0.2905 -0.0904 0.0156  -0.0737 1137 HOH A O   
1285 O  O   . HOH K .   ? 0.5929 0.5685 0.4501 -0.0389 0.2033  -0.1470 1138 HOH A O   
1286 O  O   . HOH K .   ? 0.3090 0.3246 0.3057 -0.0371 0.0450  -0.0055 1139 HOH A O   
1287 O  O   . HOH K .   ? 0.6823 0.4465 0.5010 -0.0374 0.0258  0.0815  1140 HOH A O   
1288 O  O   . HOH K .   ? 0.4992 0.4789 0.3566 0.0657  0.0051  0.0186  1141 HOH A O   
1289 O  O   . HOH K .   ? 0.3657 0.5305 0.4116 0.0104  -0.1373 0.0039  1142 HOH A O   
1290 O  O   . HOH K .   ? 0.3448 0.5335 0.6114 -0.0118 0.0928  -0.1446 1143 HOH A O   
1291 O  O   . HOH K .   ? 0.6189 0.6173 0.6737 -0.0971 0.0798  -0.2802 1144 HOH A O   
1292 O  O   . HOH K .   ? 0.3237 0.4994 0.4087 -0.0054 -0.0297 0.0215  1145 HOH A O   
1293 O  O   . HOH K .   ? 0.6079 0.3780 0.3258 -0.2073 -0.1748 0.1121  1146 HOH A O   
1294 O  O   . HOH K .   ? 0.5346 0.5240 0.4326 0.1456  0.1153  0.0011  1147 HOH A O   
1295 O  O   . HOH K .   ? 0.4922 0.4560 0.3917 0.0034  -0.0174 0.0306  1148 HOH A O   
1296 O  O   . HOH K .   ? 0.3996 0.3395 0.7197 0.0160  -0.2834 0.0760  1149 HOH A O   
1297 O  O   . HOH K .   ? 0.5339 0.4121 0.6022 0.0012  0.1104  -0.1858 1150 HOH A O   
1298 O  O   . HOH K .   ? 0.4385 0.3939 0.5303 0.0381  -0.0024 -0.0038 1151 HOH A O   
1299 O  O   . HOH K .   ? 0.3835 0.4498 0.3835 -0.1022 0.0810  0.0014  1152 HOH A O   
1300 O  O   . HOH K .   ? 0.3573 0.4484 0.4280 -0.1417 -0.1173 0.0877  1153 HOH A O   
1301 O  O   . HOH K .   ? 0.3118 0.3385 0.3736 0.0330  -0.1136 -0.0675 1154 HOH A O   
1302 O  O   . HOH K .   ? 0.5173 0.5483 0.5878 -0.1336 -0.1726 -0.0542 1155 HOH A O   
1303 O  O   . HOH K .   ? 0.3969 0.3730 0.6650 0.0918  0.0252  -0.1358 1156 HOH A O   
1304 O  O   . HOH K .   ? 0.4268 0.5432 0.4752 -0.1151 -0.1445 0.0145  1157 HOH A O   
1305 O  O   . HOH K .   ? 0.5074 0.4086 0.5831 0.1042  -0.0410 0.0739  1158 HOH A O   
1306 O  O   . HOH K .   ? 0.8229 0.3413 0.4101 0.0504  -0.0627 0.0177  1159 HOH A O   
1307 O  O   . HOH K .   ? 0.7193 0.4306 0.4435 -0.0444 -0.1157 0.1292  1160 HOH A O   
1308 O  O   . HOH K .   ? 0.4830 0.5391 0.7871 -0.0393 -0.1578 0.0230  1161 HOH A O   
1309 O  O   . HOH K .   ? 0.2956 0.4898 0.3999 -0.0157 -0.0235 0.0805  1162 HOH A O   
1310 O  O   . HOH K .   ? 0.2766 0.5445 0.5582 -0.0429 -0.0526 0.0135  1163 HOH A O   
1311 O  O   . HOH K .   ? 0.4269 0.5536 0.5526 -0.1670 -0.2344 0.1247  1164 HOH A O   
1312 O  O   . HOH K .   ? 0.7714 0.5544 0.6169 -0.0444 0.2286  -0.1705 1165 HOH A O   
1313 O  O   . HOH K .   ? 0.5003 0.2931 0.4980 -0.0707 -0.1450 0.0958  1166 HOH A O   
1314 O  O   . HOH K .   ? 0.6189 0.3845 0.4545 -0.0888 -0.0997 0.0392  1167 HOH A O   
1315 O  O   . HOH K .   ? 0.5279 0.3994 0.2773 -0.0564 0.0024  0.0141  1168 HOH A O   
1316 O  O   . HOH K .   ? 0.5448 0.5019 0.4491 -0.0277 0.1229  0.0596  1169 HOH A O   
1317 O  O   . HOH K .   ? 0.5670 0.4092 0.5817 -0.0137 -0.1931 0.0364  1170 HOH A O   
1318 O  O   . HOH K .   ? 0.3868 0.6965 0.4157 -0.0895 0.0102  -0.0375 1171 HOH A O   
1319 O  O   . HOH K .   ? 0.5867 0.5014 0.4211 -0.1366 -0.0742 0.0553  1172 HOH A O   
1320 O  O   . HOH K .   ? 0.5403 0.4635 0.4692 -0.1127 0.2135  -0.0947 1173 HOH A O   
1321 O  O   . HOH K .   ? 0.7203 0.4652 0.4001 -0.1320 -0.1303 0.0758  1174 HOH A O   
1322 O  O   . HOH K .   ? 0.5265 0.6120 0.4801 -0.0122 0.0180  -0.0631 1175 HOH A O   
1323 O  O   . HOH K .   ? 0.6715 0.3796 0.4244 0.0011  -0.1975 0.0543  1176 HOH A O   
1324 O  O   . HOH K .   ? 0.5968 0.4591 0.5032 0.0049  -0.2274 0.1677  1177 HOH A O   
1325 O  O   . HOH K .   ? 0.5846 0.4839 0.4597 -0.1046 -0.0211 0.0012  1178 HOH A O   
1326 O  O   . HOH K .   ? 0.3713 0.4194 0.3588 -0.0926 0.0330  0.0500  1179 HOH A O   
1327 O  O   . HOH K .   ? 0.4254 0.5342 0.4640 0.1460  0.0940  0.1729  1180 HOH A O   
1328 O  O   . HOH K .   ? 0.9070 0.7009 0.6969 -0.0020 -0.0209 0.1190  1181 HOH A O   
1329 O  O   . HOH K .   ? 0.5590 0.5463 0.7249 0.0504  -0.1094 0.0186  1182 HOH A O   
1330 O  O   . HOH K .   ? 0.5861 0.5609 0.6673 0.0534  -0.0963 -0.1163 1183 HOH A O   
1331 O  O   . HOH K .   ? 0.3955 0.3680 0.5144 0.0035  -0.0003 -0.0727 1184 HOH A O   
1332 O  O   . HOH K .   ? 0.5583 0.6224 0.4363 -0.1531 -0.0689 -0.0468 1185 HOH A O   
1333 O  O   . HOH K .   ? 0.4724 0.4200 0.3945 0.0140  0.1271  -0.0101 1186 HOH A O   
1334 O  O   . HOH K .   ? 0.5822 0.4537 0.4206 -0.0433 -0.0786 0.0506  1187 HOH A O   
1335 O  O   . HOH K .   ? 0.4352 0.3391 0.4854 0.1578  0.0216  0.0130  1188 HOH A O   
1336 O  O   . HOH K .   ? 0.5573 0.8264 0.4581 -0.0606 0.1566  -0.1164 1189 HOH A O   
1337 O  O   . HOH K .   ? 0.2896 0.4951 0.5248 -0.0454 0.0437  -0.1617 1190 HOH A O   
1338 O  O   . HOH K .   ? 0.5197 0.4003 0.5045 -0.0235 -0.0449 0.0855  1191 HOH A O   
1339 O  O   . HOH K .   ? 0.1925 0.5684 0.7306 0.0791  0.0040  -0.0946 1192 HOH A O   
1340 O  O   . HOH K .   ? 0.5070 0.5600 0.5304 -0.0002 -0.0635 0.0875  1193 HOH A O   
1341 O  O   . HOH K .   ? 0.7411 0.5121 0.6560 -0.1291 -0.1145 -0.0975 1194 HOH A O   
1342 O  O   . HOH K .   ? 0.2871 0.5941 0.3387 -0.0092 0.0832  -0.1500 1195 HOH A O   
1343 O  O   . HOH K .   ? 0.6658 0.6301 0.4317 -0.0335 -0.0801 0.0415  1196 HOH A O   
1344 O  O   . HOH K .   ? 0.7026 0.4974 0.4764 -0.1238 0.1113  0.0595  1197 HOH A O   
1345 O  O   . HOH K .   ? 0.6955 0.6429 0.4586 -0.0819 0.1622  -0.1553 1198 HOH A O   
1346 O  O   . HOH K .   ? 0.4144 0.5005 0.5832 0.0268  -0.1115 -0.1115 1199 HOH A O   
1347 O  O   . HOH K .   ? 0.4441 0.4317 0.6269 -0.1010 0.1817  -0.1247 1200 HOH A O   
1348 O  O   . HOH K .   ? 0.6663 0.4604 0.2515 -0.0642 0.0234  -0.0917 1201 HOH A O   
1349 O  O   . HOH K .   ? 0.4373 0.4912 0.4619 -0.0368 0.0067  0.0154  1202 HOH A O   
1350 O  O   . HOH K .   ? 0.8498 0.6838 0.5956 0.0032  0.1028  -0.0859 1203 HOH A O   
1351 O  O   . HOH K .   ? 0.5473 0.7365 0.4743 0.0216  -0.1226 -0.0642 1204 HOH A O   
1352 O  O   . HOH K .   ? 0.6063 0.5294 0.5466 -0.1215 -0.0657 -0.0130 1205 HOH A O   
1353 O  O   . HOH K .   ? 0.3403 0.3126 0.4117 0.0310  -0.0344 0.0447  1206 HOH A O   
1354 O  O   . HOH K .   ? 0.4070 0.4722 0.4132 0.0047  0.0812  -0.0418 1207 HOH A O   
1355 O  O   . HOH K .   ? 0.4222 0.7952 0.3436 -0.0698 0.0491  -0.2421 1208 HOH A O   
1356 O  O   . HOH K .   ? 0.6164 0.8239 0.6219 -0.1226 -0.0958 0.0518  1209 HOH A O   
1357 O  O   . HOH K .   ? 0.6802 0.8533 0.9252 0.0330  -0.3564 0.0835  1210 HOH A O   
1358 O  O   . HOH K .   ? 0.5901 0.5134 0.6275 0.0413  -0.0506 -0.1335 1211 HOH A O   
1359 O  O   . HOH K .   ? 0.5162 0.4748 0.4735 -0.0979 -0.0730 0.0713  1212 HOH A O   
1360 O  O   . HOH K .   ? 0.6099 0.5027 0.6044 -0.0456 0.1437  -0.0604 1213 HOH A O   
1361 O  O   . HOH K .   ? 0.5292 0.5928 0.3591 0.0653  0.0555  0.0113  1214 HOH A O   
1362 O  O   . HOH K .   ? 0.5633 0.5807 0.6783 -0.0186 0.1449  0.0332  1215 HOH A O   
1363 O  O   . HOH K .   ? 0.5906 0.6577 0.5743 -0.1592 0.0921  -0.1189 1216 HOH A O   
1364 O  O   . HOH K .   ? 0.3935 0.4666 0.4080 0.0037  -0.0451 -0.1200 1217 HOH A O   
1365 O  O   . HOH K .   ? 0.4902 0.5172 0.6153 0.1422  -0.1372 0.0675  1218 HOH A O   
1366 O  O   . HOH K .   ? 0.3583 0.6593 0.4440 -0.0330 0.0700  -0.1363 1219 HOH A O   
1367 O  O   . HOH K .   ? 0.7015 0.5648 0.7909 -0.0543 0.1357  -0.0463 1220 HOH A O   
1368 O  O   . HOH K .   ? 0.5446 0.5751 0.5983 -0.1629 -0.1901 0.3245  1221 HOH A O   
1369 O  O   . HOH K .   ? 0.6995 0.4813 0.5694 -0.0456 0.0176  0.2369  1222 HOH A O   
1370 O  O   . HOH K .   ? 0.4681 0.4882 0.4468 -0.1414 0.0042  -0.0131 1223 HOH A O   
1371 O  O   . HOH K .   ? 0.4564 0.5043 0.5004 0.1205  -0.1179 -0.0745 1224 HOH A O   
1372 O  O   . HOH K .   ? 0.6401 0.4822 0.6385 0.0982  0.0207  -0.0701 1225 HOH A O   
1373 O  O   . HOH K .   ? 0.4494 0.6715 0.3654 -0.1076 0.0432  0.1789  1226 HOH A O   
1374 O  O   . HOH K .   ? 0.5571 0.5454 0.5427 0.0792  -0.2053 0.0604  1227 HOH A O   
1375 O  O   . HOH K .   ? 0.3096 0.5062 0.5154 0.0117  0.0157  0.0058  1228 HOH A O   
1376 O  O   . HOH K .   ? 0.4278 0.7750 0.9970 0.0782  0.0681  0.0564  1229 HOH A O   
1377 O  O   . HOH K .   ? 0.6974 0.7023 0.7186 -0.2076 0.1430  -0.0370 1230 HOH A O   
1378 O  O   . HOH K .   ? 0.7164 0.7521 0.6152 -0.0231 -0.0942 -0.0400 1231 HOH A O   
1379 O  O   . HOH K .   ? 0.4130 0.5585 0.7070 -0.0628 -0.0783 0.0092  1232 HOH A O   
1380 O  O   . HOH K .   ? 0.8513 0.8557 0.7331 -0.0059 -0.0007 -0.1274 1233 HOH A O   
1381 O  O   . HOH K .   ? 0.7122 0.5536 0.5059 0.0323  0.0901  -0.1244 1234 HOH A O   
1382 O  O   . HOH K .   ? 0.5542 0.4227 0.4277 -0.0164 0.1083  0.0355  1235 HOH A O   
1383 O  O   . HOH K .   ? 0.8709 0.9194 0.9631 0.0737  -0.1794 0.1436  1236 HOH A O   
1384 O  O   . HOH K .   ? 0.6911 0.6906 0.5764 -0.1319 0.1233  -0.1417 1237 HOH A O   
1385 O  O   . HOH K .   ? 0.4485 0.4552 0.6732 -0.0128 -0.2160 -0.0934 1238 HOH A O   
1386 O  O   . HOH K .   ? 0.7878 0.4325 0.6093 0.0000  -0.0066 0.0081  1239 HOH A O   
1387 O  O   . HOH K .   ? 0.4681 0.6977 0.7581 -0.0017 -0.0555 0.1715  1240 HOH A O   
1388 O  O   . HOH K .   ? 0.7015 0.5667 0.4901 -0.0662 -0.2855 -0.0343 1241 HOH A O   
1389 O  O   . HOH K .   ? 0.4875 0.6750 0.7675 0.0404  -0.1990 -0.0407 1242 HOH A O   
1390 O  O   . HOH K .   ? 1.0191 1.0203 0.9081 -0.0646 0.0643  -0.0275 1243 HOH A O   
1391 O  O   . HOH K .   ? 0.5968 0.5289 0.5281 0.0189  -0.0564 -0.0543 1244 HOH A O   
1392 O  O   . HOH K .   ? 0.9316 0.9111 0.7809 0.0291  0.0121  0.0396  1245 HOH A O   
1393 O  O   . HOH K .   ? 0.6575 0.5599 0.5675 -0.1703 -0.1855 0.0813  1246 HOH A O   
1394 O  O   . HOH K .   ? 0.8943 0.8372 0.5521 -0.1941 0.1187  -0.0841 1247 HOH A O   
1395 O  O   . HOH K .   ? 0.8721 0.7486 0.6723 -0.0587 0.2188  -0.0921 1248 HOH A O   
1396 O  O   . HOH K .   ? 0.5384 0.6689 0.4715 -0.1193 0.2507  -0.1742 1249 HOH A O   
1397 O  O   . HOH K .   ? 0.5274 0.4946 0.4876 0.0520  -0.1417 0.0709  1250 HOH A O   
1398 O  O   . HOH K .   ? 0.9633 0.6455 0.4056 -0.2516 -0.0801 0.1559  1251 HOH A O   
1399 O  O   . HOH K .   ? 0.7223 0.3679 0.5719 0.0879  0.1594  -0.0134 1252 HOH A O   
1400 O  O   . HOH K .   ? 0.5214 0.5502 0.4702 -0.0948 0.1534  0.0836  1253 HOH A O   
1401 O  O   . HOH K .   ? 1.0381 1.1595 1.0736 -0.0559 -0.1536 0.0395  1254 HOH A O   
1402 O  O   . HOH K .   ? 0.6108 0.3952 0.4335 -0.0390 0.0390  0.0997  1255 HOH A O   
1403 O  O   . HOH K .   ? 0.9072 0.5305 0.2416 -0.0895 -0.0129 0.0119  1256 HOH A O   
1404 O  O   . HOH K .   ? 0.9919 0.9606 0.6225 -0.1911 0.2329  -0.1280 1257 HOH A O   
1405 O  O   . HOH K .   ? 0.6280 0.6307 0.5560 -0.0600 -0.2031 0.1661  1258 HOH A O   
1406 O  O   . HOH K .   ? 0.8989 0.6874 0.6748 -0.0366 -0.1466 0.1387  1259 HOH A O   
1407 O  O   . HOH K .   ? 0.5525 0.5775 0.4250 -0.1285 0.0563  -0.0519 1260 HOH A O   
1408 O  O   . HOH K .   ? 0.5023 0.5937 0.5388 -0.0585 0.0805  0.0255  1261 HOH A O   
1409 O  O   . HOH K .   ? 0.6764 0.5867 0.5164 -0.2012 0.2080  -0.1375 1262 HOH A O   
1410 O  O   . HOH K .   ? 0.6238 0.3794 0.5174 -0.0520 -0.0869 -0.0345 1263 HOH A O   
1411 O  O   . HOH K .   ? 0.5130 0.5779 0.6044 -0.1064 -0.1661 -0.0627 1264 HOH A O   
1412 O  O   . HOH K .   ? 0.4316 0.5285 0.5909 0.0314  -0.0349 -0.0439 1265 HOH A O   
1413 O  O   . HOH K .   ? 1.0064 0.8402 0.6119 -0.1388 0.1746  0.0645  1266 HOH A O   
1414 O  O   . HOH K .   ? 0.7927 0.4994 0.4472 -0.0656 0.1185  -0.1977 1267 HOH A O   
1415 O  O   . HOH K .   ? 0.5745 0.6504 0.7791 0.0422  -0.0961 -0.0259 1268 HOH A O   
1416 O  O   . HOH K .   ? 0.6224 0.6403 0.5803 -0.1152 0.0656  -0.2073 1269 HOH A O   
1417 O  O   . HOH K .   ? 0.6370 0.7297 0.7783 0.0813  0.0842  -0.0290 1270 HOH A O   
1418 O  O   . HOH K .   ? 0.8672 0.8816 0.7906 0.0061  -0.0504 0.0182  1271 HOH A O   
1419 O  O   . HOH K .   ? 0.5570 0.6253 0.3371 -0.1042 -0.0946 -0.0155 1272 HOH A O   
1420 O  O   . HOH K .   ? 0.8277 0.6156 0.5426 0.0657  0.1180  -0.0728 1273 HOH A O   
1421 O  O   . HOH K .   ? 0.9401 0.7668 0.7081 -0.1189 0.0416  0.2555  1274 HOH A O   
1422 O  O   . HOH K .   ? 0.4419 0.5809 0.5235 0.0503  0.0353  0.0475  1275 HOH A O   
1423 O  O   . HOH K .   ? 0.7187 0.6212 0.4562 -0.1385 0.2077  0.0197  1276 HOH A O   
1424 O  O   . HOH K .   ? 0.4266 0.7228 0.6453 -0.1197 -0.1831 0.1383  1277 HOH A O   
1425 O  O   . HOH K .   ? 0.6552 0.7000 0.5338 -0.0230 -0.0467 -0.1137 1278 HOH A O   
1426 O  O   . HOH K .   ? 0.7891 0.7213 0.8608 0.0551  0.0791  -0.0548 1279 HOH A O   
1427 O  O   . HOH K .   ? 0.9464 0.8397 0.7897 -0.0488 -0.1309 0.1389  1280 HOH A O   
1428 O  O   . HOH K .   ? 0.9096 0.6984 0.6402 -0.1630 -0.0660 0.2501  1281 HOH A O   
1429 O  O   . HOH K .   ? 0.5532 0.8418 0.7530 -0.0549 0.0980  0.0094  1282 HOH A O   
1430 O  O   . HOH K .   ? 0.5059 0.4547 0.7004 0.0052  0.0028  -0.0601 1283 HOH A O   
1431 O  O   . HOH K .   ? 0.3529 0.6193 0.5377 -0.0253 0.0084  -0.1096 1284 HOH A O   
1432 O  O   . HOH K .   ? 0.5290 0.7231 0.4794 0.0174  -0.1293 0.0099  1285 HOH A O   
1433 O  O   . HOH K .   ? 0.5790 0.3774 0.4867 -0.0633 -0.1519 0.0267  1286 HOH A O   
1434 O  O   . HOH K .   ? 0.7157 0.4842 0.4762 0.1209  0.0635  0.1387  1287 HOH A O   
1435 O  O   . HOH K .   ? 0.6865 0.6807 0.6634 0.0327  -0.0050 -0.0287 1288 HOH A O   
1436 O  O   . HOH K .   ? 0.5282 0.5351 0.4688 -0.0462 0.0072  -0.1130 1289 HOH A O   
1437 O  O   . HOH K .   ? 0.7698 0.5176 0.6430 0.0670  0.1347  0.0438  1290 HOH A O   
1438 O  O   . HOH K .   ? 0.8537 0.8038 0.6813 -0.1594 0.0909  0.0922  1291 HOH A O   
1439 O  O   . HOH K .   ? 0.7355 0.6606 0.5253 -0.1251 -0.1627 0.0506  1292 HOH A O   
1440 O  O   . HOH K .   ? 0.4474 0.6363 0.5418 -0.0821 0.0123  0.0760  1293 HOH A O   
1441 O  O   . HOH K .   ? 0.9149 0.7129 0.8660 0.0310  -0.2063 0.0763  1294 HOH A O   
1442 O  O   . HOH K .   ? 0.4859 0.7340 0.7628 -0.1233 -0.1862 0.1212  1295 HOH A O   
1443 O  O   . HOH K .   ? 1.0304 0.7231 0.7551 -0.1898 -0.0707 0.0424  1296 HOH A O   
1444 O  O   . HOH K .   ? 0.9126 0.5896 0.7186 -0.2226 0.1572  -0.2040 1297 HOH A O   
1445 O  O   . HOH K .   ? 0.8496 0.4794 0.7349 -0.0761 0.0701  -0.0130 1298 HOH A O   
1446 O  O   . HOH K .   ? 0.5092 0.3433 0.5955 -0.0382 0.1412  -0.0354 1299 HOH A O   
1447 O  O   . HOH K .   ? 1.1609 1.3548 1.4248 0.1109  0.1080  0.0158  1300 HOH A O   
1448 O  O   . HOH K .   ? 0.6857 0.6588 0.7961 0.1085  0.2184  -0.0993 1301 HOH A O   
1449 O  O   . HOH K .   ? 1.0776 1.0128 1.1413 0.0060  -0.0930 0.0367  1302 HOH A O   
1450 O  O   . HOH K .   ? 0.4096 0.6337 0.5921 0.0524  0.0548  0.0467  1303 HOH A O   
1451 O  O   . HOH K .   ? 0.7052 0.7032 0.8451 0.0415  0.0973  0.1086  1304 HOH A O   
1452 O  O   . HOH K .   ? 1.0064 0.8144 0.9757 0.1218  -0.1061 0.0556  1305 HOH A O   
1453 O  O   . HOH K .   ? 1.1233 0.8419 1.0065 -0.0120 0.0442  -0.0600 1306 HOH A O   
1454 O  O   . HOH K .   ? 0.5877 0.6305 0.4813 -0.0917 0.0691  0.1164  1307 HOH A O   
1455 O  O   . HOH K .   ? 0.4964 0.8632 0.9349 0.0545  -0.0371 0.0423  1308 HOH A O   
1456 O  O   . HOH K .   ? 0.7762 0.6012 0.9331 0.1177  0.1829  0.0321  1309 HOH A O   
1457 O  O   . HOH K .   ? 1.0646 1.0097 1.0434 -0.0695 -0.0780 0.0876  1310 HOH A O   
1458 O  O   . HOH K .   ? 0.3287 0.2370 0.2469 -0.0079 -0.0316 0.0223  1311 HOH A O   
1459 O  O   . HOH K .   ? 0.7746 0.7455 0.5194 -0.1858 0.1387  0.0475  1312 HOH A O   
1460 O  O   . HOH K .   ? 0.7789 0.6793 0.4302 -0.0841 0.1884  -0.1164 1313 HOH A O   
1461 O  O   . HOH K .   ? 0.6061 0.4841 0.7472 0.1497  0.0811  0.0221  1314 HOH A O   
1462 O  O   . HOH K .   ? 0.7230 0.7264 0.6471 0.0144  0.1196  -0.0941 1315 HOH A O   
1463 O  O   . HOH K .   ? 1.5151 1.4228 1.4457 0.0203  -0.0223 0.0477  1316 HOH A O   
1464 O  O   . HOH K .   ? 1.1798 1.2580 1.2046 -0.0347 0.1126  0.0145  1317 HOH A O   
1465 O  O   . HOH K .   ? 0.7189 0.8614 0.7036 0.0269  0.0445  -0.1002 1318 HOH A O   
1466 O  O   . HOH K .   ? 0.9046 0.9787 0.9323 -0.0567 0.1387  -0.0708 1319 HOH A O   
1467 O  O   . HOH K .   ? 0.6278 0.7944 0.8403 0.1229  -0.0682 0.0424  1320 HOH A O   
1468 O  O   . HOH K .   ? 0.7083 0.6589 0.6695 -0.1677 0.0735  -0.1311 1321 HOH A O   
1469 O  O   . HOH K .   ? 0.5644 0.5804 0.5805 -0.0534 0.0820  -0.0638 1322 HOH A O   
1470 O  O   . HOH K .   ? 0.5201 0.6778 0.3819 -0.0068 -0.0213 -0.1280 1323 HOH A O   
1471 O  O   . HOH K .   ? 0.9428 0.7146 0.9338 -0.1244 0.0949  -0.0029 1324 HOH A O   
1472 O  O   . HOH K .   ? 1.0466 0.8234 0.9610 -0.0441 0.1297  -0.1299 1325 HOH A O   
1473 O  O   . HOH K .   ? 0.7498 0.7349 0.4620 -0.1333 -0.1160 -0.0412 1326 HOH A O   
1474 O  O   . HOH K .   ? 1.4712 1.3996 1.3985 0.0103  0.0442  -0.0535 1327 HOH A O   
1475 O  O   . HOH K .   ? 0.8440 0.9139 0.6889 -0.0391 0.1408  -0.0831 1328 HOH A O   
1476 O  O   . HOH K .   ? 0.7999 0.7949 0.8777 -0.0012 -0.0619 0.0123  1329 HOH A O   
1477 O  O   . HOH K .   ? 0.6105 0.3522 0.9959 -0.0207 -0.2718 0.0555  1330 HOH A O   
1478 O  O   . HOH K .   ? 1.1988 1.1317 1.0616 -0.0776 0.1602  -0.0961 1331 HOH A O   
1479 O  O   . HOH K .   ? 1.0861 1.0512 0.9496 -0.0434 0.0253  0.0204  1332 HOH A O   
1480 O  O   . HOH K .   ? 1.4625 1.4279 1.4148 -0.0220 -0.0614 0.0281  1333 HOH A O   
1481 O  O   . HOH K .   ? 0.7033 0.8956 0.8870 0.0569  0.3220  -0.0939 1334 HOH A O   
1482 O  O   . HOH K .   ? 0.8746 0.8743 0.9257 0.0332  -0.1073 0.0653  1335 HOH A O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASN 1   3   3   ASN ASN A . n 
A 1 2   ILE 2   4   4   ILE ILE A . n 
A 1 3   THR 3   5   5   THR THR A . n 
A 1 4   ILE 4   6   6   ILE ILE A . n 
A 1 5   TYR 5   7   7   TYR TYR A . n 
A 1 6   HIS 6   8   8   HIS HIS A . n 
A 1 7   ASN 7   9   9   ASN ASN A . n 
A 1 8   PRO 8   10  10  PRO PRO A . n 
A 1 9   ALA 9   11  11  ALA ALA A . n 
A 1 10  CYS 10  12  12  CYS CYS A . n 
A 1 11  GLY 11  13  13  GLY GLY A . n 
A 1 12  THR 12  14  14  THR THR A . n 
A 1 13  SER 13  15  15  SER SER A . n 
A 1 14  ARG 14  16  16  ARG ARG A . n 
A 1 15  ASN 15  17  17  ASN ASN A . n 
A 1 16  THR 16  18  18  THR THR A . n 
A 1 17  LEU 17  19  19  LEU LEU A . n 
A 1 18  GLU 18  20  20  GLU GLU A . n 
A 1 19  MET 19  21  21  MET MET A . n 
A 1 20  ILE 20  22  22  ILE ILE A . n 
A 1 21  ARG 21  23  23  ARG ARG A . n 
A 1 22  ASN 22  24  24  ASN ASN A . n 
A 1 23  SER 23  25  25  SER SER A . n 
A 1 24  GLY 24  26  26  GLY GLY A . n 
A 1 25  THR 25  27  27  THR THR A . n 
A 1 26  GLU 26  28  28  GLU GLU A . n 
A 1 27  PRO 27  29  29  PRO PRO A . n 
A 1 28  THR 28  30  30  THR THR A . n 
A 1 29  ILE 29  31  31  ILE ILE A . n 
A 1 30  ILE 30  32  32  ILE ILE A . n 
A 1 31  LEU 31  33  33  LEU LEU A . n 
A 1 32  TYR 32  34  34  TYR TYR A . n 
A 1 33  LEU 33  35  35  LEU LEU A . n 
A 1 34  GLU 34  36  36  GLU GLU A . n 
A 1 35  ASN 35  37  37  ASN ASN A . n 
A 1 36  PRO 36  38  38  PRO PRO A . n 
A 1 37  PRO 37  39  39  PRO PRO A . n 
A 1 38  SER 38  40  40  SER SER A . n 
A 1 39  ARG 39  41  41  ARG ARG A . n 
A 1 40  ASP 40  42  42  ASP ASP A . n 
A 1 41  GLU 41  43  43  GLU GLU A . n 
A 1 42  LEU 42  44  44  LEU LEU A . n 
A 1 43  VAL 43  45  45  VAL VAL A . n 
A 1 44  LYS 44  46  46  LYS LYS A . n 
A 1 45  LEU 45  47  47  LEU LEU A . n 
A 1 46  ILE 46  48  48  ILE ILE A . n 
A 1 47  ALA 47  49  49  ALA ALA A . n 
A 1 48  ASP 48  50  50  ASP ASP A . n 
A 1 49  MET 49  51  51  MET MET A . n 
A 1 50  GLY 50  52  52  GLY GLY A . n 
A 1 51  ILE 51  53  53  ILE ILE A . n 
A 1 52  SER 52  54  54  SER SER A . n 
A 1 53  VAL 53  55  55  VAL VAL A . n 
A 1 54  ARG 54  56  56  ARG ARG A . n 
A 1 55  ALA 55  57  57  ALA ALA A . n 
A 1 56  LEU 56  58  58  LEU LEU A . n 
A 1 57  LEU 57  59  59  LEU LEU A . n 
A 1 58  ALA 58  60  60  ALA ALA A . n 
A 1 59  LYS 59  61  61  LYS LYS A . n 
A 1 60  ASN 60  62  62  ASN ASN A . n 
A 1 61  VAL 61  63  63  VAL VAL A . n 
A 1 62  GLU 62  64  64  GLU GLU A . n 
A 1 63  PRO 63  65  65  PRO PRO A . n 
A 1 64  TYR 64  66  66  TYR TYR A . n 
A 1 65  GLU 65  67  67  GLU GLU A . n 
A 1 66  GLN 66  68  68  GLN GLN A . n 
A 1 67  LEU 67  69  69  LEU LEU A . n 
A 1 68  GLY 68  70  70  GLY GLY A . n 
A 1 69  LEU 69  71  71  LEU LEU A . n 
A 1 70  ALA 70  72  72  ALA ALA A . n 
A 1 71  GLU 71  73  73  GLU GLU A . n 
A 1 72  ASP 72  74  74  ASP ASP A . n 
A 1 73  LYS 73  75  75  LYS LYS A . n 
A 1 74  PHE 74  76  76  PHE PHE A . n 
A 1 75  THR 75  77  77  THR THR A . n 
A 1 76  ASP 76  78  78  ASP ASP A . n 
A 1 77  ASP 77  79  79  ASP ASP A . n 
A 1 78  GLN 78  80  80  GLN GLN A . n 
A 1 79  LEU 79  81  81  LEU LEU A . n 
A 1 80  ILE 80  82  82  ILE ILE A . n 
A 1 81  ASP 81  83  83  ASP ASP A . n 
A 1 82  PHE 82  84  84  PHE PHE A . n 
A 1 83  MET 83  85  85  MET MET A . n 
A 1 84  LEU 84  86  86  LEU LEU A . n 
A 1 85  GLN 85  87  87  GLN GLN A . n 
A 1 86  HIS 86  88  88  HIS HIS A . n 
A 1 87  PRO 87  89  89  PRO PRO A . n 
A 1 88  ILE 88  90  90  ILE ILE A . n 
A 1 89  LEU 89  91  91  LEU LEU A . n 
A 1 90  ILE 90  92  92  ILE ILE A . n 
A 1 91  ASN 91  93  93  ASN ASN A . n 
A 1 92  ARG 92  94  94  ARG ARG A . n 
A 1 93  PRO 93  95  95  PRO PRO A . n 
A 1 94  ILE 94  96  96  ILE ILE A . n 
A 1 95  VAL 95  97  97  VAL VAL A . n 
A 1 96  VAL 96  98  98  VAL VAL A . n 
A 1 97  THR 97  99  99  THR THR A . n 
A 1 98  PRO 98  100 100 PRO PRO A . n 
A 1 99  LEU 99  101 101 LEU LEU A . n 
A 1 100 GLY 100 102 102 GLY GLY A . n 
A 1 101 THR 101 103 103 THR THR A . n 
A 1 102 ARG 102 104 104 ARG ARG A . n 
A 1 103 LEU 103 105 105 LEU LEU A . n 
A 1 104 CYS 104 106 106 CYS CYS A . n 
A 1 105 ARG 105 107 107 ARG ARG A . n 
A 1 106 PRO 106 108 108 PRO PRO A . n 
A 1 107 SER 107 109 109 SER SER A . n 
A 1 108 GLU 108 110 110 GLU GLU A . n 
A 1 109 VAL 109 111 111 VAL VAL A . n 
A 1 110 VAL 110 112 112 VAL VAL A . n 
A 1 111 LEU 111 113 113 LEU LEU A . n 
A 1 112 ASP 112 114 114 ASP ASP A . n 
A 1 113 ILE 113 115 115 ILE ILE A . n 
A 1 114 LEU 114 116 116 LEU LEU A . n 
A 1 115 GLN 115 117 117 GLN GLN A . n 
A 1 116 ASP 116 118 118 ASP ASP A . n 
A 1 117 ALA 117 119 119 ALA ALA A . n 
A 1 118 GLN 118 120 120 GLN GLN A . n 
A 1 119 LYS 119 121 121 LYS LYS A . n 
A 1 120 GLY 120 122 122 GLY GLY A . n 
A 1 121 ALA 121 123 123 ALA ALA A . n 
A 1 122 PHE 122 124 124 PHE PHE A . n 
A 1 123 THR 123 125 125 THR THR A . n 
A 1 124 LYS 124 126 126 LYS LYS A . n 
A 1 125 GLU 125 127 127 GLU GLU A . n 
A 1 126 ASP 126 128 128 ASP ASP A . n 
A 1 127 GLY 127 129 129 GLY GLY A . n 
A 1 128 GLU 128 130 130 GLU GLU A . n 
A 1 129 LYS 129 131 131 LYS LYS A . n 
A 1 130 VAL 130 132 132 VAL VAL A . n 
A 1 131 VAL 131 133 133 VAL VAL A . n 
A 1 132 ASP 132 134 134 ASP ASP A . n 
A 1 133 GLU 133 135 135 GLU GLU A . n 
A 1 134 ALA 134 136 136 ALA ALA A . n 
A 1 135 GLY 135 137 137 GLY GLY A . n 
A 1 136 LYS 136 138 138 LYS LYS A . n 
A 1 137 ARG 137 139 139 ARG ARG A . n 
A 1 138 LEU 138 140 140 LEU LEU A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 SO4 1   201  201  SO4 SO4 A . 
C 2 SO4 1   202  202  SO4 SO4 A . 
D 2 SO4 1   203  203  SO4 SO4 A . 
E 2 SO4 1   204  204  SO4 SO4 A . 
F 3 CS  1   401  401  CS  CS  A . 
G 3 CS  1   402  402  CS  CS  A . 
H 3 CS  1   403  403  CS  CS  A . 
I 3 CS  1   404  404  CS  CS  A . 
J 3 CS  1   405  405  CS  CS  A . 
K 4 HOH 1   1001 1001 HOH HOH A . 
K 4 HOH 2   1002 1002 HOH HOH A . 
K 4 HOH 3   1003 1003 HOH HOH A . 
K 4 HOH 4   1004 1004 HOH HOH A . 
K 4 HOH 5   1005 22   HOH HOH A . 
K 4 HOH 6   1006 1006 HOH HOH A . 
K 4 HOH 7   1007 1007 HOH HOH A . 
K 4 HOH 8   1008 1008 HOH HOH A . 
K 4 HOH 9   1009 1009 HOH HOH A . 
K 4 HOH 10  1010 1010 HOH HOH A . 
K 4 HOH 11  1011 1011 HOH HOH A . 
K 4 HOH 12  1012 1012 HOH HOH A . 
K 4 HOH 13  1013 1013 HOH HOH A . 
K 4 HOH 14  1014 1014 HOH HOH A . 
K 4 HOH 15  1015 1015 HOH HOH A . 
K 4 HOH 16  1016 1016 HOH HOH A . 
K 4 HOH 17  1017 1017 HOH HOH A . 
K 4 HOH 18  1018 1018 HOH HOH A . 
K 4 HOH 19  1019 1019 HOH HOH A . 
K 4 HOH 20  1020 1020 HOH HOH A . 
K 4 HOH 21  1021 14   HOH HOH A . 
K 4 HOH 22  1022 1022 HOH HOH A . 
K 4 HOH 23  1023 1023 HOH HOH A . 
K 4 HOH 24  1024 1024 HOH HOH A . 
K 4 HOH 25  1025 1025 HOH HOH A . 
K 4 HOH 26  1026 1026 HOH HOH A . 
K 4 HOH 27  1027 1027 HOH HOH A . 
K 4 HOH 28  1028 1028 HOH HOH A . 
K 4 HOH 29  1029 1029 HOH HOH A . 
K 4 HOH 30  1030 1030 HOH HOH A . 
K 4 HOH 31  1031 1031 HOH HOH A . 
K 4 HOH 32  1032 1032 HOH HOH A . 
K 4 HOH 33  1033 17   HOH HOH A . 
K 4 HOH 34  1034 1034 HOH HOH A . 
K 4 HOH 35  1035 1035 HOH HOH A . 
K 4 HOH 36  1036 1036 HOH HOH A . 
K 4 HOH 37  1037 1037 HOH HOH A . 
K 4 HOH 38  1038 1038 HOH HOH A . 
K 4 HOH 39  1039 1039 HOH HOH A . 
K 4 HOH 40  1040 1040 HOH HOH A . 
K 4 HOH 41  1041 1041 HOH HOH A . 
K 4 HOH 42  1042 1042 HOH HOH A . 
K 4 HOH 43  1043 45   HOH HOH A . 
K 4 HOH 44  1044 1044 HOH HOH A . 
K 4 HOH 45  1045 1045 HOH HOH A . 
K 4 HOH 46  1046 1046 HOH HOH A . 
K 4 HOH 47  1047 1047 HOH HOH A . 
K 4 HOH 48  1048 1048 HOH HOH A . 
K 4 HOH 49  1049 1049 HOH HOH A . 
K 4 HOH 50  1050 1050 HOH HOH A . 
K 4 HOH 51  1051 1051 HOH HOH A . 
K 4 HOH 52  1052 1052 HOH HOH A . 
K 4 HOH 53  1053 1053 HOH HOH A . 
K 4 HOH 54  1054 62   HOH HOH A . 
K 4 HOH 55  1055 1055 HOH HOH A . 
K 4 HOH 56  1056 1056 HOH HOH A . 
K 4 HOH 57  1057 1057 HOH HOH A . 
K 4 HOH 58  1058 1058 HOH HOH A . 
K 4 HOH 59  1059 1059 HOH HOH A . 
K 4 HOH 60  1060 1060 HOH HOH A . 
K 4 HOH 61  1061 1061 HOH HOH A . 
K 4 HOH 62  1062 78   HOH HOH A . 
K 4 HOH 63  1063 1063 HOH HOH A . 
K 4 HOH 64  1064 1064 HOH HOH A . 
K 4 HOH 65  1065 1065 HOH HOH A . 
K 4 HOH 66  1066 1066 HOH HOH A . 
K 4 HOH 67  1067 1067 HOH HOH A . 
K 4 HOH 68  1068 1068 HOH HOH A . 
K 4 HOH 69  1069 1069 HOH HOH A . 
K 4 HOH 70  1070 55   HOH HOH A . 
K 4 HOH 71  1071 1071 HOH HOH A . 
K 4 HOH 72  1072 1072 HOH HOH A . 
K 4 HOH 73  1073 1073 HOH HOH A . 
K 4 HOH 74  1074 1074 HOH HOH A . 
K 4 HOH 75  1075 1075 HOH HOH A . 
K 4 HOH 76  1076 58   HOH HOH A . 
K 4 HOH 77  1077 1077 HOH HOH A . 
K 4 HOH 78  1078 1078 HOH HOH A . 
K 4 HOH 79  1079 1079 HOH HOH A . 
K 4 HOH 80  1080 1080 HOH HOH A . 
K 4 HOH 81  1081 1081 HOH HOH A . 
K 4 HOH 82  1082 1082 HOH HOH A . 
K 4 HOH 83  1083 1083 HOH HOH A . 
K 4 HOH 84  1084 1084 HOH HOH A . 
K 4 HOH 85  1085 1085 HOH HOH A . 
K 4 HOH 86  1086 1086 HOH HOH A . 
K 4 HOH 87  1087 1087 HOH HOH A . 
K 4 HOH 88  1088 1088 HOH HOH A . 
K 4 HOH 89  1089 1089 HOH HOH A . 
K 4 HOH 90  1090 1090 HOH HOH A . 
K 4 HOH 91  1091 1091 HOH HOH A . 
K 4 HOH 92  1092 1092 HOH HOH A . 
K 4 HOH 93  1093 1093 HOH HOH A . 
K 4 HOH 94  1094 1094 HOH HOH A . 
K 4 HOH 95  1095 1095 HOH HOH A . 
K 4 HOH 96  1096 1096 HOH HOH A . 
K 4 HOH 97  1097 1097 HOH HOH A . 
K 4 HOH 98  1098 1098 HOH HOH A . 
K 4 HOH 99  1099 1099 HOH HOH A . 
K 4 HOH 100 1100 1100 HOH HOH A . 
K 4 HOH 101 1101 1101 HOH HOH A . 
K 4 HOH 102 1102 1102 HOH HOH A . 
K 4 HOH 103 1103 1103 HOH HOH A . 
K 4 HOH 104 1104 1104 HOH HOH A . 
K 4 HOH 105 1105 65   HOH HOH A . 
K 4 HOH 106 1106 1106 HOH HOH A . 
K 4 HOH 107 1107 1107 HOH HOH A . 
K 4 HOH 108 1108 1108 HOH HOH A . 
K 4 HOH 109 1109 1109 HOH HOH A . 
K 4 HOH 110 1110 1110 HOH HOH A . 
K 4 HOH 111 1111 1111 HOH HOH A . 
K 4 HOH 112 1112 1112 HOH HOH A . 
K 4 HOH 113 1113 1113 HOH HOH A . 
K 4 HOH 114 1114 1114 HOH HOH A . 
K 4 HOH 115 1115 1115 HOH HOH A . 
K 4 HOH 116 1116 1116 HOH HOH A . 
K 4 HOH 117 1117 1117 HOH HOH A . 
K 4 HOH 118 1118 1118 HOH HOH A . 
K 4 HOH 119 1119 1119 HOH HOH A . 
K 4 HOH 120 1120 1120 HOH HOH A . 
K 4 HOH 121 1121 1121 HOH HOH A . 
K 4 HOH 122 1122 1122 HOH HOH A . 
K 4 HOH 123 1123 1123 HOH HOH A . 
K 4 HOH 124 1124 1124 HOH HOH A . 
K 4 HOH 125 1125 1125 HOH HOH A . 
K 4 HOH 126 1126 1126 HOH HOH A . 
K 4 HOH 127 1127 1127 HOH HOH A . 
K 4 HOH 128 1128 1128 HOH HOH A . 
K 4 HOH 129 1129 1129 HOH HOH A . 
K 4 HOH 130 1130 1130 HOH HOH A . 
K 4 HOH 131 1131 1131 HOH HOH A . 
K 4 HOH 132 1132 1132 HOH HOH A . 
K 4 HOH 133 1133 1133 HOH HOH A . 
K 4 HOH 134 1134 1134 HOH HOH A . 
K 4 HOH 135 1135 1135 HOH HOH A . 
K 4 HOH 136 1136 1136 HOH HOH A . 
K 4 HOH 137 1137 1137 HOH HOH A . 
K 4 HOH 138 1138 1138 HOH HOH A . 
K 4 HOH 139 1139 1139 HOH HOH A . 
K 4 HOH 140 1140 1140 HOH HOH A . 
K 4 HOH 141 1141 1141 HOH HOH A . 
K 4 HOH 142 1142 211  HOH HOH A . 
K 4 HOH 143 1143 1143 HOH HOH A . 
K 4 HOH 144 1144 1144 HOH HOH A . 
K 4 HOH 145 1145 1145 HOH HOH A . 
K 4 HOH 146 1146 1146 HOH HOH A . 
K 4 HOH 147 1147 1147 HOH HOH A . 
K 4 HOH 148 1148 1148 HOH HOH A . 
K 4 HOH 149 1149 1149 HOH HOH A . 
K 4 HOH 150 1150 1150 HOH HOH A . 
K 4 HOH 151 1151 1151 HOH HOH A . 
K 4 HOH 152 1152 1152 HOH HOH A . 
K 4 HOH 153 1153 1153 HOH HOH A . 
K 4 HOH 154 1154 1154 HOH HOH A . 
K 4 HOH 155 1155 1155 HOH HOH A . 
K 4 HOH 156 1156 1156 HOH HOH A . 
K 4 HOH 157 1157 1157 HOH HOH A . 
K 4 HOH 158 1158 1158 HOH HOH A . 
K 4 HOH 159 1159 1159 HOH HOH A . 
K 4 HOH 160 1160 1160 HOH HOH A . 
K 4 HOH 161 1161 1161 HOH HOH A . 
K 4 HOH 162 1162 1162 HOH HOH A . 
K 4 HOH 163 1163 1163 HOH HOH A . 
K 4 HOH 164 1164 1164 HOH HOH A . 
K 4 HOH 165 1165 1165 HOH HOH A . 
K 4 HOH 166 1166 1166 HOH HOH A . 
K 4 HOH 167 1167 1167 HOH HOH A . 
K 4 HOH 168 1168 1168 HOH HOH A . 
K 4 HOH 169 1169 1169 HOH HOH A . 
K 4 HOH 170 1170 1170 HOH HOH A . 
K 4 HOH 171 1171 1171 HOH HOH A . 
K 4 HOH 172 1172 1172 HOH HOH A . 
K 4 HOH 173 1173 1173 HOH HOH A . 
K 4 HOH 174 1174 1174 HOH HOH A . 
K 4 HOH 175 1175 1175 HOH HOH A . 
K 4 HOH 176 1176 1176 HOH HOH A . 
K 4 HOH 177 1177 1177 HOH HOH A . 
K 4 HOH 178 1178 1178 HOH HOH A . 
K 4 HOH 179 1179 1179 HOH HOH A . 
K 4 HOH 180 1180 1180 HOH HOH A . 
K 4 HOH 181 1181 1181 HOH HOH A . 
K 4 HOH 182 1182 1182 HOH HOH A . 
K 4 HOH 183 1183 1183 HOH HOH A . 
K 4 HOH 184 1184 1184 HOH HOH A . 
K 4 HOH 185 1185 1185 HOH HOH A . 
K 4 HOH 186 1186 1186 HOH HOH A . 
K 4 HOH 187 1187 1187 HOH HOH A . 
K 4 HOH 188 1188 1188 HOH HOH A . 
K 4 HOH 189 1189 1189 HOH HOH A . 
K 4 HOH 190 1190 1190 HOH HOH A . 
K 4 HOH 191 1191 1191 HOH HOH A . 
K 4 HOH 192 1192 1192 HOH HOH A . 
K 4 HOH 193 1193 1193 HOH HOH A . 
K 4 HOH 194 1194 1194 HOH HOH A . 
K 4 HOH 195 1195 1195 HOH HOH A . 
K 4 HOH 196 1196 1196 HOH HOH A . 
K 4 HOH 197 1197 1197 HOH HOH A . 
K 4 HOH 198 1198 1198 HOH HOH A . 
K 4 HOH 199 1199 1199 HOH HOH A . 
K 4 HOH 200 1200 1200 HOH HOH A . 
K 4 HOH 201 1201 1201 HOH HOH A . 
K 4 HOH 202 1202 1202 HOH HOH A . 
K 4 HOH 203 1203 1203 HOH HOH A . 
K 4 HOH 204 1204 1204 HOH HOH A . 
K 4 HOH 205 1205 1205 HOH HOH A . 
K 4 HOH 206 1206 1206 HOH HOH A . 
K 4 HOH 207 1207 1207 HOH HOH A . 
K 4 HOH 208 1208 1208 HOH HOH A . 
K 4 HOH 209 1209 1209 HOH HOH A . 
K 4 HOH 210 1210 1210 HOH HOH A . 
K 4 HOH 211 1211 1211 HOH HOH A . 
K 4 HOH 212 1212 1212 HOH HOH A . 
K 4 HOH 213 1213 1213 HOH HOH A . 
K 4 HOH 214 1214 1214 HOH HOH A . 
K 4 HOH 215 1215 1215 HOH HOH A . 
K 4 HOH 216 1216 1216 HOH HOH A . 
K 4 HOH 217 1217 1217 HOH HOH A . 
K 4 HOH 218 1218 1218 HOH HOH A . 
K 4 HOH 219 1219 1219 HOH HOH A . 
K 4 HOH 220 1220 1220 HOH HOH A . 
K 4 HOH 221 1221 1221 HOH HOH A . 
K 4 HOH 222 1222 1222 HOH HOH A . 
K 4 HOH 223 1223 1223 HOH HOH A . 
K 4 HOH 224 1224 156  HOH HOH A . 
K 4 HOH 225 1225 1225 HOH HOH A . 
K 4 HOH 226 1226 1226 HOH HOH A . 
K 4 HOH 227 1227 1227 HOH HOH A . 
K 4 HOH 228 1228 1228 HOH HOH A . 
K 4 HOH 229 1229 1229 HOH HOH A . 
K 4 HOH 230 1230 1230 HOH HOH A . 
K 4 HOH 231 1231 1231 HOH HOH A . 
K 4 HOH 232 1232 1232 HOH HOH A . 
K 4 HOH 233 1233 1233 HOH HOH A . 
K 4 HOH 234 1234 1234 HOH HOH A . 
K 4 HOH 235 1235 182  HOH HOH A . 
K 4 HOH 236 1236 1236 HOH HOH A . 
K 4 HOH 237 1237 1237 HOH HOH A . 
K 4 HOH 238 1238 1238 HOH HOH A . 
K 4 HOH 239 1239 1239 HOH HOH A . 
K 4 HOH 240 1240 1240 HOH HOH A . 
K 4 HOH 241 1241 175  HOH HOH A . 
K 4 HOH 242 1242 1242 HOH HOH A . 
K 4 HOH 243 1243 1243 HOH HOH A . 
K 4 HOH 244 1244 1244 HOH HOH A . 
K 4 HOH 245 1245 1245 HOH HOH A . 
K 4 HOH 246 1246 1246 HOH HOH A . 
K 4 HOH 247 1247 1247 HOH HOH A . 
K 4 HOH 248 1248 1248 HOH HOH A . 
K 4 HOH 249 1249 1249 HOH HOH A . 
K 4 HOH 250 1250 1250 HOH HOH A . 
K 4 HOH 251 1251 1251 HOH HOH A . 
K 4 HOH 252 1252 1252 HOH HOH A . 
K 4 HOH 253 1253 1253 HOH HOH A . 
K 4 HOH 254 1254 1254 HOH HOH A . 
K 4 HOH 255 1255 1255 HOH HOH A . 
K 4 HOH 256 1256 1256 HOH HOH A . 
K 4 HOH 257 1257 1257 HOH HOH A . 
K 4 HOH 258 1258 1258 HOH HOH A . 
K 4 HOH 259 1259 1259 HOH HOH A . 
K 4 HOH 260 1260 1260 HOH HOH A . 
K 4 HOH 261 1261 1261 HOH HOH A . 
K 4 HOH 262 1262 1262 HOH HOH A . 
K 4 HOH 263 1263 1263 HOH HOH A . 
K 4 HOH 264 1264 1264 HOH HOH A . 
K 4 HOH 265 1265 1265 HOH HOH A . 
K 4 HOH 266 1266 1266 HOH HOH A . 
K 4 HOH 267 1267 1267 HOH HOH A . 
K 4 HOH 268 1268 1268 HOH HOH A . 
K 4 HOH 269 1269 1269 HOH HOH A . 
K 4 HOH 270 1270 1270 HOH HOH A . 
K 4 HOH 271 1271 1271 HOH HOH A . 
K 4 HOH 272 1272 1272 HOH HOH A . 
K 4 HOH 273 1273 1273 HOH HOH A . 
K 4 HOH 274 1274 1274 HOH HOH A . 
K 4 HOH 275 1275 1275 HOH HOH A . 
K 4 HOH 276 1276 1276 HOH HOH A . 
K 4 HOH 277 1277 1277 HOH HOH A . 
K 4 HOH 278 1278 1278 HOH HOH A . 
K 4 HOH 279 1279 1279 HOH HOH A . 
K 4 HOH 280 1280 1280 HOH HOH A . 
K 4 HOH 281 1281 1281 HOH HOH A . 
K 4 HOH 282 1282 1282 HOH HOH A . 
K 4 HOH 283 1283 1283 HOH HOH A . 
K 4 HOH 284 1284 1284 HOH HOH A . 
K 4 HOH 285 1285 1285 HOH HOH A . 
K 4 HOH 286 1286 1286 HOH HOH A . 
K 4 HOH 287 1287 1287 HOH HOH A . 
K 4 HOH 288 1288 1288 HOH HOH A . 
K 4 HOH 289 1289 1289 HOH HOH A . 
K 4 HOH 290 1290 1290 HOH HOH A . 
K 4 HOH 291 1291 1291 HOH HOH A . 
K 4 HOH 292 1292 1292 HOH HOH A . 
K 4 HOH 293 1293 1293 HOH HOH A . 
K 4 HOH 294 1294 1294 HOH HOH A . 
K 4 HOH 295 1295 1295 HOH HOH A . 
K 4 HOH 296 1296 1296 HOH HOH A . 
K 4 HOH 297 1297 1297 HOH HOH A . 
K 4 HOH 298 1298 1298 HOH HOH A . 
K 4 HOH 299 1299 1299 HOH HOH A . 
K 4 HOH 300 1300 1300 HOH HOH A . 
K 4 HOH 301 1301 1301 HOH HOH A . 
K 4 HOH 302 1302 1302 HOH HOH A . 
K 4 HOH 303 1303 1303 HOH HOH A . 
K 4 HOH 304 1304 1304 HOH HOH A . 
K 4 HOH 305 1305 1305 HOH HOH A . 
K 4 HOH 306 1306 1306 HOH HOH A . 
K 4 HOH 307 1307 1307 HOH HOH A . 
K 4 HOH 308 1308 1308 HOH HOH A . 
K 4 HOH 309 1309 1309 HOH HOH A . 
K 4 HOH 310 1310 1310 HOH HOH A . 
K 4 HOH 311 1311 1311 HOH HOH A . 
K 4 HOH 312 1312 1312 HOH HOH A . 
K 4 HOH 313 1313 1313 HOH HOH A . 
K 4 HOH 314 1314 1314 HOH HOH A . 
K 4 HOH 315 1315 1315 HOH HOH A . 
K 4 HOH 316 1316 1316 HOH HOH A . 
K 4 HOH 317 1317 1317 HOH HOH A . 
K 4 HOH 318 1318 1318 HOH HOH A . 
K 4 HOH 319 1319 1319 HOH HOH A . 
K 4 HOH 320 1320 1320 HOH HOH A . 
K 4 HOH 321 1321 1321 HOH HOH A . 
K 4 HOH 322 1322 1322 HOH HOH A . 
K 4 HOH 323 1323 1323 HOH HOH A . 
K 4 HOH 324 1324 1324 HOH HOH A . 
K 4 HOH 325 1325 1325 HOH HOH A . 
K 4 HOH 326 1326 1326 HOH HOH A . 
K 4 HOH 327 1327 1327 HOH HOH A . 
K 4 HOH 328 1328 1328 HOH HOH A . 
K 4 HOH 329 1329 1329 HOH HOH A . 
K 4 HOH 330 1330 1330 HOH HOH A . 
K 4 HOH 331 1331 1331 HOH HOH A . 
K 4 HOH 332 1332 1332 HOH HOH A . 
K 4 HOH 333 1333 1333 HOH HOH A . 
K 4 HOH 334 1334 1334 HOH HOH A . 
K 4 HOH 335 1335 1335 HOH HOH A . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PQS  monomeric 1 
2 software_defined_assembly            PISA dimeric   2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1   A,B,C,D,E,F,G,H,I,J,K 
2 1,2 A,B,C,D,E,F,G,H,I,J,K 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
2 'ABSA (A^2)' 4110  ? 
2 MORE         -335  ? 
2 'SSA (A^2)'  13840 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555  x,y,z          1.0000000000 0.0000000000 0.0000000000 0.0000000000   0.0000000000 
1.0000000000  0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 12_566 x,x-y+1,-z+7/6 0.5000000000 0.8660254038 0.0000000000 -43.3000000000 0.8660254038 
-0.5000000000 0.0000000000 74.9977999677 0.0000000000 0.0000000000 -1.0000000000 134.9250000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    CS 
_pdbx_struct_special_symmetry.auth_seq_id     401 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   F 
_pdbx_struct_special_symmetry.label_comp_id   CS 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? A PRO 36  ? A PRO 38   ? 1_555  CS ? G CS . ? A CS 402 ? 1_555 N   ? A SER 38  ? A SER 40   ? 1_555  64.2  ? 
2  O   ? A PRO 36  ? A PRO 38   ? 1_555  CS ? G CS . ? A CS 402 ? 1_555 O   ? K HOH .   ? A HOH 1020 ? 1_555  60.9  ? 
3  N   ? A SER 38  ? A SER 40   ? 1_555  CS ? G CS . ? A CS 402 ? 1_555 O   ? K HOH .   ? A HOH 1020 ? 1_555  99.6  ? 
4  O   ? A PRO 36  ? A PRO 38   ? 1_555  CS ? G CS . ? A CS 402 ? 1_555 O   ? K HOH .   ? A HOH 1127 ? 1_555  47.7  ? 
5  N   ? A SER 38  ? A SER 40   ? 1_555  CS ? G CS . ? A CS 402 ? 1_555 O   ? K HOH .   ? A HOH 1127 ? 1_555  101.2 ? 
6  O   ? K HOH .   ? A HOH 1020 ? 1_555  CS ? G CS . ? A CS 402 ? 1_555 O   ? K HOH .   ? A HOH 1127 ? 1_555  80.3  ? 
7  OE2 ? A GLU 62  ? A GLU 64   ? 1_555  CS ? H CS . ? A CS 403 ? 1_555 NE2 ? A GLN 85  ? A GLN 87   ? 8_676  122.6 ? 
8  OE2 ? A GLU 62  ? A GLU 64   ? 1_555  CS ? H CS . ? A CS 403 ? 1_555 O   ? K HOH .   ? A HOH 1071 ? 1_555  58.2  ? 
9  NE2 ? A GLN 85  ? A GLN 87   ? 8_676  CS ? H CS . ? A CS 403 ? 1_555 O   ? K HOH .   ? A HOH 1071 ? 1_555  67.1  ? 
10 OE2 ? A GLU 62  ? A GLU 64   ? 1_555  CS ? H CS . ? A CS 403 ? 1_555 O   ? K HOH .   ? A HOH 1135 ? 1_555  79.9  ? 
11 NE2 ? A GLN 85  ? A GLN 87   ? 8_676  CS ? H CS . ? A CS 403 ? 1_555 O   ? K HOH .   ? A HOH 1135 ? 1_555  66.6  ? 
12 O   ? K HOH .   ? A HOH 1071 ? 1_555  CS ? H CS . ? A CS 403 ? 1_555 O   ? K HOH .   ? A HOH 1135 ? 1_555  70.7  ? 
13 OE2 ? A GLU 62  ? A GLU 64   ? 1_555  CS ? H CS . ? A CS 403 ? 1_555 O   ? K HOH .   ? A HOH 1277 ? 1_555  81.5  ? 
14 NE2 ? A GLN 85  ? A GLN 87   ? 8_676  CS ? H CS . ? A CS 403 ? 1_555 O   ? K HOH .   ? A HOH 1277 ? 1_555  146.3 ? 
15 O   ? K HOH .   ? A HOH 1071 ? 1_555  CS ? H CS . ? A CS 403 ? 1_555 O   ? K HOH .   ? A HOH 1277 ? 1_555  120.8 ? 
16 O   ? K HOH .   ? A HOH 1135 ? 1_555  CS ? H CS . ? A CS 403 ? 1_555 O   ? K HOH .   ? A HOH 1277 ? 1_555  146.3 ? 
17 O   ? A LEU 111 ? A LEU 113  ? 1_555  CS ? F CS . ? A CS 401 ? 1_555 O   ? A LEU 111 ? A LEU 113  ? 10_665 132.6 ? 
18 O   ? A LEU 111 ? A LEU 113  ? 1_555  CS ? F CS . ? A CS 401 ? 1_555 O   ? A ASP 112 ? A ASP 114  ? 1_555  68.8  ? 
19 O   ? A LEU 111 ? A LEU 113  ? 10_665 CS ? F CS . ? A CS 401 ? 1_555 O   ? A ASP 112 ? A ASP 114  ? 1_555  75.4  ? 
20 O   ? A LEU 111 ? A LEU 113  ? 1_555  CS ? F CS . ? A CS 401 ? 1_555 O   ? A ASP 112 ? A ASP 114  ? 10_665 71.4  ? 
21 O   ? A LEU 111 ? A LEU 113  ? 10_665 CS ? F CS . ? A CS 401 ? 1_555 O   ? A ASP 112 ? A ASP 114  ? 10_665 66.6  ? 
22 O   ? A ASP 112 ? A ASP 114  ? 1_555  CS ? F CS . ? A CS 401 ? 1_555 O   ? A ASP 112 ? A ASP 114  ? 10_665 67.3  ? 
23 O   ? A LEU 111 ? A LEU 113  ? 1_555  CS ? F CS . ? A CS 401 ? 1_555 O   ? A LEU 114 ? A LEU 116  ? 1_555  79.3  ? 
24 O   ? A LEU 111 ? A LEU 113  ? 10_665 CS ? F CS . ? A CS 401 ? 1_555 O   ? A LEU 114 ? A LEU 116  ? 1_555  137.7 ? 
25 O   ? A ASP 112 ? A ASP 114  ? 1_555  CS ? F CS . ? A CS 401 ? 1_555 O   ? A LEU 114 ? A LEU 116  ? 1_555  99.2  ? 
26 O   ? A ASP 112 ? A ASP 114  ? 10_665 CS ? F CS . ? A CS 401 ? 1_555 O   ? A LEU 114 ? A LEU 116  ? 1_555  150.5 ? 
27 O   ? A LEU 111 ? A LEU 113  ? 1_555  CS ? F CS . ? A CS 401 ? 1_555 O   ? A LEU 114 ? A LEU 116  ? 10_665 124.9 ? 
28 O   ? A LEU 111 ? A LEU 113  ? 10_665 CS ? F CS . ? A CS 401 ? 1_555 O   ? A LEU 114 ? A LEU 116  ? 10_665 76.7  ? 
29 O   ? A ASP 112 ? A ASP 114  ? 1_555  CS ? F CS . ? A CS 401 ? 1_555 O   ? A LEU 114 ? A LEU 116  ? 10_665 149.3 ? 
30 O   ? A ASP 112 ? A ASP 114  ? 10_665 CS ? F CS . ? A CS 401 ? 1_555 O   ? A LEU 114 ? A LEU 116  ? 10_665 90.0  ? 
31 O   ? A LEU 114 ? A LEU 116  ? 1_555  CS ? F CS . ? A CS 401 ? 1_555 O   ? A LEU 114 ? A LEU 116  ? 10_665 110.0 ? 
32 O   ? A LEU 111 ? A LEU 113  ? 1_555  CS ? F CS . ? A CS 401 ? 1_555 O   ? K HOH .   ? A HOH 1039 ? 1_555  81.6  ? 
33 O   ? A LEU 111 ? A LEU 113  ? 10_665 CS ? F CS . ? A CS 401 ? 1_555 O   ? K HOH .   ? A HOH 1039 ? 1_555  141.2 ? 
34 O   ? A ASP 112 ? A ASP 114  ? 1_555  CS ? F CS . ? A CS 401 ? 1_555 O   ? K HOH .   ? A HOH 1039 ? 1_555  142.9 ? 
35 O   ? A ASP 112 ? A ASP 114  ? 10_665 CS ? F CS . ? A CS 401 ? 1_555 O   ? K HOH .   ? A HOH 1039 ? 1_555  124.3 ? 
36 O   ? A LEU 114 ? A LEU 116  ? 1_555  CS ? F CS . ? A CS 401 ? 1_555 O   ? K HOH .   ? A HOH 1039 ? 1_555  52.1  ? 
37 O   ? A LEU 114 ? A LEU 116  ? 10_665 CS ? F CS . ? A CS 401 ? 1_555 O   ? K HOH .   ? A HOH 1039 ? 1_555  66.9  ? 
38 O   ? A LEU 111 ? A LEU 113  ? 1_555  CS ? F CS . ? A CS 401 ? 1_555 O   ? K HOH .   ? A HOH 1039 ? 10_665 143.0 ? 
39 O   ? A LEU 111 ? A LEU 113  ? 10_665 CS ? F CS . ? A CS 401 ? 1_555 O   ? K HOH .   ? A HOH 1039 ? 10_665 84.3  ? 
40 O   ? A ASP 112 ? A ASP 114  ? 1_555  CS ? F CS . ? A CS 401 ? 1_555 O   ? K HOH .   ? A HOH 1039 ? 10_665 136.8 ? 
41 O   ? A ASP 112 ? A ASP 114  ? 10_665 CS ? F CS . ? A CS 401 ? 1_555 O   ? K HOH .   ? A HOH 1039 ? 10_665 136.7 ? 
42 O   ? A LEU 114 ? A LEU 116  ? 1_555  CS ? F CS . ? A CS 401 ? 1_555 O   ? K HOH .   ? A HOH 1039 ? 10_665 71.2  ? 
43 O   ? A LEU 114 ? A LEU 116  ? 10_665 CS ? F CS . ? A CS 401 ? 1_555 O   ? K HOH .   ? A HOH 1039 ? 10_665 51.1  ? 
44 O   ? K HOH .   ? A HOH 1039 ? 1_555  CS ? F CS . ? A CS 401 ? 1_555 O   ? K HOH .   ? A HOH 1039 ? 10_665 62.8  ? 
45 O   ? A GLN 118 ? A GLN 120  ? 1_555  CS ? I CS . ? A CS 404 ? 1_555 O   ? A GLU 133 ? A GLU 135  ? 1_555  139.9 ? 
46 O   ? A GLN 118 ? A GLN 120  ? 1_555  CS ? I CS . ? A CS 404 ? 1_555 O   ? K HOH .   ? A HOH 1093 ? 1_555  48.7  ? 
47 O   ? A GLU 133 ? A GLU 135  ? 1_555  CS ? I CS . ? A CS 404 ? 1_555 O   ? K HOH .   ? A HOH 1093 ? 1_555  115.1 ? 
48 O   ? A GLN 118 ? A GLN 120  ? 1_555  CS ? I CS . ? A CS 404 ? 1_555 O   ? K HOH .   ? A HOH 1119 ? 1_555  72.8  ? 
49 O   ? A GLU 133 ? A GLU 135  ? 1_555  CS ? I CS . ? A CS 404 ? 1_555 O   ? K HOH .   ? A HOH 1119 ? 1_555  68.3  ? 
50 O   ? K HOH .   ? A HOH 1093 ? 1_555  CS ? I CS . ? A CS 404 ? 1_555 O   ? K HOH .   ? A HOH 1119 ? 1_555  60.8  ? 
51 O   ? A GLN 118 ? A GLN 120  ? 1_555  CS ? I CS . ? A CS 404 ? 1_555 O   ? K HOH .   ? A HOH 1151 ? 1_555  81.7  ? 
52 O   ? A GLU 133 ? A GLU 135  ? 1_555  CS ? I CS . ? A CS 404 ? 1_555 O   ? K HOH .   ? A HOH 1151 ? 1_555  116.3 ? 
53 O   ? K HOH .   ? A HOH 1093 ? 1_555  CS ? I CS . ? A CS 404 ? 1_555 O   ? K HOH .   ? A HOH 1151 ? 1_555  49.0  ? 
54 O   ? K HOH .   ? A HOH 1119 ? 1_555  CS ? I CS . ? A CS 404 ? 1_555 O   ? K HOH .   ? A HOH 1151 ? 1_555  103.4 ? 
55 O   ? A GLN 118 ? A GLN 120  ? 1_555  CS ? I CS . ? A CS 404 ? 1_555 O   ? K HOH .   ? A HOH 1183 ? 1_555  55.9  ? 
56 O   ? A GLU 133 ? A GLU 135  ? 1_555  CS ? I CS . ? A CS 404 ? 1_555 O   ? K HOH .   ? A HOH 1183 ? 1_555  160.4 ? 
57 O   ? K HOH .   ? A HOH 1093 ? 1_555  CS ? I CS . ? A CS 404 ? 1_555 O   ? K HOH .   ? A HOH 1183 ? 1_555  84.0  ? 
58 O   ? K HOH .   ? A HOH 1119 ? 1_555  CS ? I CS . ? A CS 404 ? 1_555 O   ? K HOH .   ? A HOH 1183 ? 1_555  128.7 ? 
59 O   ? K HOH .   ? A HOH 1151 ? 1_555  CS ? I CS . ? A CS 404 ? 1_555 O   ? K HOH .   ? A HOH 1183 ? 1_555  72.4  ? 
60 O   ? A GLN 118 ? A GLN 120  ? 1_555  CS ? I CS . ? A CS 404 ? 1_555 O   ? K HOH .   ? A HOH 1301 ? 1_555  118.8 ? 
61 O   ? A GLU 133 ? A GLU 135  ? 1_555  CS ? I CS . ? A CS 404 ? 1_555 O   ? K HOH .   ? A HOH 1301 ? 1_555  75.2  ? 
62 O   ? K HOH .   ? A HOH 1093 ? 1_555  CS ? I CS . ? A CS 404 ? 1_555 O   ? K HOH .   ? A HOH 1301 ? 1_555  167.4 ? 
63 O   ? K HOH .   ? A HOH 1119 ? 1_555  CS ? I CS . ? A CS 404 ? 1_555 O   ? K HOH .   ? A HOH 1301 ? 1_555  120.8 ? 
64 O   ? K HOH .   ? A HOH 1151 ? 1_555  CS ? I CS . ? A CS 404 ? 1_555 O   ? K HOH .   ? A HOH 1301 ? 1_555  134.7 ? 
65 O   ? K HOH .   ? A HOH 1183 ? 1_555  CS ? I CS . ? A CS 404 ? 1_555 O   ? K HOH .   ? A HOH 1301 ? 1_555  86.4  ? 
66 OD2 ? A ASP 126 ? A ASP 128  ? 1_555  CS ? J CS . ? A CS 405 ? 1_555 O   ? K HOH .   ? A HOH 1033 ? 1_555  119.0 ? 
67 OD2 ? A ASP 126 ? A ASP 128  ? 1_555  CS ? J CS . ? A CS 405 ? 1_555 O   ? K HOH .   ? A HOH 1065 ? 12_566 101.8 ? 
68 O   ? K HOH .   ? A HOH 1033 ? 1_555  CS ? J CS . ? A CS 405 ? 1_555 O   ? K HOH .   ? A HOH 1065 ? 12_566 120.4 ? 
69 OD2 ? A ASP 126 ? A ASP 128  ? 1_555  CS ? J CS . ? A CS 405 ? 1_555 O   ? K HOH .   ? A HOH 1077 ? 1_555  57.1  ? 
70 O   ? K HOH .   ? A HOH 1033 ? 1_555  CS ? J CS . ? A CS 405 ? 1_555 O   ? K HOH .   ? A HOH 1077 ? 1_555  71.8  ? 
71 O   ? K HOH .   ? A HOH 1065 ? 12_566 CS ? J CS . ? A CS 405 ? 1_555 O   ? K HOH .   ? A HOH 1077 ? 1_555  158.0 ? 
72 OD2 ? A ASP 126 ? A ASP 128  ? 1_555  CS ? J CS . ? A CS 405 ? 1_555 O   ? K HOH .   ? A HOH 1195 ? 1_555  125.6 ? 
73 O   ? K HOH .   ? A HOH 1033 ? 1_555  CS ? J CS . ? A CS 405 ? 1_555 O   ? K HOH .   ? A HOH 1195 ? 1_555  67.2  ? 
74 O   ? K HOH .   ? A HOH 1065 ? 12_566 CS ? J CS . ? A CS 405 ? 1_555 O   ? K HOH .   ? A HOH 1195 ? 1_555  121.4 ? 
75 O   ? K HOH .   ? A HOH 1077 ? 1_555  CS ? J CS . ? A CS 405 ? 1_555 O   ? K HOH .   ? A HOH 1195 ? 1_555  79.5  ? 
76 OD2 ? A ASP 126 ? A ASP 128  ? 1_555  CS ? J CS . ? A CS 405 ? 1_555 O   ? K HOH .   ? A HOH 1209 ? 1_555  67.9  ? 
77 O   ? K HOH .   ? A HOH 1033 ? 1_555  CS ? J CS . ? A CS 405 ? 1_555 O   ? K HOH .   ? A HOH 1209 ? 1_555  162.1 ? 
78 O   ? K HOH .   ? A HOH 1065 ? 12_566 CS ? J CS . ? A CS 405 ? 1_555 O   ? K HOH .   ? A HOH 1209 ? 1_555  70.7  ? 
79 O   ? K HOH .   ? A HOH 1077 ? 1_555  CS ? J CS . ? A CS 405 ? 1_555 O   ? K HOH .   ? A HOH 1209 ? 1_555  102.9 ? 
80 O   ? K HOH .   ? A HOH 1195 ? 1_555  CS ? J CS . ? A CS 405 ? 1_555 O   ? K HOH .   ? A HOH 1209 ? 1_555  95.2  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-02-15 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-11 
5 'Structure model' 1 4 2018-04-04 
6 'Structure model' 2 0 2018-08-29 
7 'Structure model' 2 1 2019-07-24 
8 'Structure model' 2 2 2021-10-27 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' 'Version format compliance' 
2  3 'Structure model' 'Derived calculations'      
3  3 'Structure model' 'Version format compliance' 
4  4 'Structure model' 'Refinement description'    
5  5 'Structure model' 'Data collection'           
6  6 'Structure model' Advisory                    
7  6 'Structure model' 'Atomic model'              
8  6 'Structure model' 'Data collection'           
9  6 'Structure model' 'Derived calculations'      
10 6 'Structure model' 'Source and taxonomy'       
11 6 'Structure model' 'Structure summary'         
12 7 'Structure model' 'Data collection'           
13 7 'Structure model' 'Refinement description'    
14 8 'Structure model' 'Database references'       
15 8 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' software                     
2  5 'Structure model' diffrn_source                
3  6 'Structure model' atom_site                    
4  6 'Structure model' entity                       
5  6 'Structure model' entity_src_gen               
6  6 'Structure model' entity_src_nat               
7  6 'Structure model' pdbx_distant_solvent_atoms   
8  6 'Structure model' pdbx_struct_special_symmetry 
9  7 'Structure model' software                     
10 8 'Structure model' database_2                   
11 8 'Structure model' pdbx_struct_conn_angle       
12 8 'Structure model' struct_conn                  
13 8 'Structure model' struct_ref_seq_dif           
14 8 'Structure model' struct_site                  
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  5 'Structure model' '_diffrn_source.type'                         
2  6 'Structure model' '_atom_site.occupancy'                        
3  6 'Structure model' '_entity.pdbx_fragment'                       
4  6 'Structure model' '_entity.pdbx_mutation'                       
5  6 'Structure model' '_entity.src_method'                          
6  7 'Structure model' '_software.classification'                    
7  7 'Structure model' '_software.name'                              
8  8 'Structure model' '_database_2.pdbx_DOI'                        
9  8 'Structure model' '_database_2.pdbx_database_accession'         
10 8 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
11 8 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
12 8 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 
13 8 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
14 8 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
15 8 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id'  
16 8 'Structure model' '_pdbx_struct_conn_angle.ptnr1_symmetry'      
17 8 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id'   
18 8 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 
19 8 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
20 8 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
21 8 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 
22 8 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
23 8 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
24 8 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id'  
25 8 'Structure model' '_pdbx_struct_conn_angle.ptnr3_symmetry'      
26 8 'Structure model' '_pdbx_struct_conn_angle.value'               
27 8 'Structure model' '_struct_conn.pdbx_dist_value'                
28 8 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
29 8 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
30 8 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
31 8 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
32 8 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
33 8 'Structure model' '_struct_conn.ptnr1_label_seq_id'             
34 8 'Structure model' '_struct_conn.ptnr1_symmetry'                 
35 8 'Structure model' '_struct_conn.ptnr2_auth_comp_id'             
36 8 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
37 8 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
38 8 'Structure model' '_struct_conn.ptnr2_label_atom_id'            
39 8 'Structure model' '_struct_conn.ptnr2_label_comp_id'            
40 8 'Structure model' '_struct_conn.ptnr2_label_seq_id'             
41 8 'Structure model' '_struct_conn.ptnr2_symmetry'                 
42 8 'Structure model' '_struct_ref_seq_dif.details'                 
43 8 'Structure model' '_struct_site.pdbx_auth_asym_id'              
44 8 'Structure model' '_struct_site.pdbx_auth_comp_id'              
45 8 'Structure model' '_struct_site.pdbx_auth_seq_id'               
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
SHELXL-97 refinement       .            ? 1 
XTALVIEW  refinement       'SHELX XGEN' ? 2 
X-GEN     'data reduction' .            ? 3 
X-GEN     'data scaling'   .            ? 4 
SHELX     phasing          .            ? 5 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            C 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            LEU 
_pdbx_validate_rmsd_bond.auth_seq_id_1             140 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            OXT 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            LEU 
_pdbx_validate_rmsd_bond.auth_seq_id_2             140 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                2.795 
_pdbx_validate_rmsd_bond.bond_target_value         1.229 
_pdbx_validate_rmsd_bond.bond_deviation            1.566 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.019 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 C  A HIS 8   ? ? N  A ASN 9   ? ? CA  A ASN 9   ? ? 139.29 121.70 17.59  2.50 Y 
2 1 NE A ARG 41  ? ? CZ A ARG 41  ? ? NH1 A ARG 41  ? ? 117.26 120.30 -3.04  0.50 N 
3 1 O  A ASP 79  ? ? C  A ASP 79  ? ? N   A GLN 80  ? ? 112.34 122.70 -10.36 1.60 Y 
4 1 O  A PRO 100 ? ? C  A PRO 100 ? ? N   A LEU 101 ? ? 113.01 122.70 -9.69  1.60 Y 
5 1 CB A ASP 114 ? ? CG A ASP 114 ? ? OD2 A ASP 114 ? ? 124.51 118.30 6.21   0.90 N 
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1  1 O ? A HOH 1162 ? 5.81 . 
2  1 O ? A HOH 1193 ? 5.88 . 
3  1 O ? A HOH 1214 ? 5.91 . 
4  1 O ? A HOH 1216 ? 6.00 . 
5  1 O ? A HOH 1218 ? 6.93 . 
6  1 O ? A HOH 1237 ? 6.18 . 
7  1 O ? A HOH 1243 ? 6.48 . 
8  1 O ? A HOH 1258 ? 6.17 . 
9  1 O ? A HOH 1271 ? 8.61 . 
10 1 O ? A HOH 1290 ? 6.12 . 
11 1 O ? A HOH 1305 ? 6.02 . 
12 1 O ? A HOH 1307 ? 5.81 . 
13 1 O ? A HOH 1319 ? 6.97 . 
14 1 O ? A HOH 1333 ? 6.22 . 
15 1 O ? A HOH 1335 ? 6.45 . 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SULFATE ION' SO4 
3 'CESIUM ION'  CS  
4 water         HOH 
#