data_1S5H
# 
_entry.id   1S5H 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.351 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1S5H         pdb_00001s5h 10.2210/pdb1s5h/pdb 
RCSB  RCSB021391   ?            ?                   
WWPDB D_1000021391 ?            ?                   
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1S5H 
_pdbx_database_status.recvd_initial_deposition_date   2004-01-20 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Mackinnon, R.' 1 
'Zhou, M.'      2 
# 
_citation.id                        primary 
_citation.title                     
'A mutant KcsA K(+) channel with altered conduction properties and selectivity filter ion distribution.' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            338 
_citation.page_first                839 
_citation.page_last                 846 
_citation.year                      2004 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15099749 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2004.03.020 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Zhou, M.'      1 ? 
primary 'MacKinnon, R.' 2 ? 
# 
_cell.entry_id           1S5H 
_cell.length_a           154.705 
_cell.length_b           154.705 
_cell.length_c           75.927 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1S5H 
_symmetry.space_group_name_H-M             'I 4' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                79 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'ANTIBODY FAB FRAGMENT LIGHT CHAIN' 23435.738 1   ? ?           ? ? 
2 polymer     nat 'ANTIBODY FAB FRAGMENT HEAVY CHAIN' 23411.242 1   ? ?           ? ? 
3 polymer     man 'Voltage-gated potassium channel'   13223.636 1   ? 'P2A, T75C' ? ? 
4 non-polymer syn NONAN-1-OL                          144.254   1   ? ?           ? ? 
5 non-polymer syn 'POTASSIUM ION'                     39.098    7   ? ?           ? ? 
6 non-polymer syn 'DIACYL GLYCEROL'                   625.018   1   ? ?           ? ? 
7 water       nat water                               18.015    228 ? ?           ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVES
EDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVL
NSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
;
;DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVES
EDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVL
NSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
;
A ? 
2 'polypeptide(L)' no no 
;QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAF
MQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWN
SGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD
;
;QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAF
MQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWN
SGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD
;
B ? 
3 'polypeptide(L)' no no 
;MAPMLSGLLARLVKLLLGRHGSALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATCVGYGD
LYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
;
;MAPMLSGLLARLVKLLLGRHGSALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATCVGYGD
LYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
;
C ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   ILE n 
1 3   LEU n 
1 4   LEU n 
1 5   THR n 
1 6   GLN n 
1 7   SER n 
1 8   PRO n 
1 9   ALA n 
1 10  ILE n 
1 11  LEU n 
1 12  SER n 
1 13  VAL n 
1 14  SER n 
1 15  PRO n 
1 16  GLY n 
1 17  GLU n 
1 18  ARG n 
1 19  VAL n 
1 20  SER n 
1 21  PHE n 
1 22  SER n 
1 23  CYS n 
1 24  ARG n 
1 25  ALA n 
1 26  SER n 
1 27  GLN n 
1 28  SER n 
1 29  ILE n 
1 30  GLY n 
1 31  THR n 
1 32  ASP n 
1 33  ILE n 
1 34  HIS n 
1 35  TRP n 
1 36  TYR n 
1 37  GLN n 
1 38  GLN n 
1 39  ARG n 
1 40  THR n 
1 41  ASN n 
1 42  GLY n 
1 43  SER n 
1 44  PRO n 
1 45  ARG n 
1 46  LEU n 
1 47  LEU n 
1 48  ILE n 
1 49  LYS n 
1 50  TYR n 
1 51  ALA n 
1 52  SER n 
1 53  GLU n 
1 54  SER n 
1 55  ILE n 
1 56  SER n 
1 57  GLY n 
1 58  ILE n 
1 59  PRO n 
1 60  SER n 
1 61  ARG n 
1 62  PHE n 
1 63  SER n 
1 64  GLY n 
1 65  SER n 
1 66  GLY n 
1 67  SER n 
1 68  GLY n 
1 69  THR n 
1 70  ASP n 
1 71  PHE n 
1 72  THR n 
1 73  LEU n 
1 74  SER n 
1 75  ILE n 
1 76  ASN n 
1 77  SER n 
1 78  VAL n 
1 79  GLU n 
1 80  SER n 
1 81  GLU n 
1 82  ASP n 
1 83  ILE n 
1 84  ALA n 
1 85  ASN n 
1 86  TYR n 
1 87  TYR n 
1 88  CYS n 
1 89  GLN n 
1 90  GLN n 
1 91  SER n 
1 92  ASN n 
1 93  ARG n 
1 94  TRP n 
1 95  PRO n 
1 96  PHE n 
1 97  THR n 
1 98  PHE n 
1 99  GLY n 
1 100 SER n 
1 101 GLY n 
1 102 THR n 
1 103 LYS n 
1 104 LEU n 
1 105 GLU n 
1 106 ILE n 
1 107 LYS n 
1 108 ARG n 
1 109 ALA n 
1 110 ASP n 
1 111 ALA n 
1 112 ALA n 
1 113 PRO n 
1 114 THR n 
1 115 VAL n 
1 116 SER n 
1 117 ILE n 
1 118 PHE n 
1 119 PRO n 
1 120 PRO n 
1 121 SER n 
1 122 SER n 
1 123 GLU n 
1 124 GLN n 
1 125 LEU n 
1 126 THR n 
1 127 SER n 
1 128 GLY n 
1 129 GLY n 
1 130 ALA n 
1 131 SER n 
1 132 VAL n 
1 133 VAL n 
1 134 CYS n 
1 135 PHE n 
1 136 LEU n 
1 137 ASN n 
1 138 ASN n 
1 139 PHE n 
1 140 TYR n 
1 141 PRO n 
1 142 LYS n 
1 143 ASP n 
1 144 ILE n 
1 145 ASN n 
1 146 VAL n 
1 147 LYS n 
1 148 TRP n 
1 149 LYS n 
1 150 ILE n 
1 151 ASP n 
1 152 GLY n 
1 153 SER n 
1 154 GLU n 
1 155 ARG n 
1 156 GLN n 
1 157 ASN n 
1 158 GLY n 
1 159 VAL n 
1 160 LEU n 
1 161 ASN n 
1 162 SER n 
1 163 TRP n 
1 164 THR n 
1 165 ASP n 
1 166 GLN n 
1 167 ASP n 
1 168 SER n 
1 169 LYS n 
1 170 ASP n 
1 171 SER n 
1 172 THR n 
1 173 TYR n 
1 174 SER n 
1 175 MET n 
1 176 SER n 
1 177 SER n 
1 178 THR n 
1 179 LEU n 
1 180 THR n 
1 181 LEU n 
1 182 THR n 
1 183 LYS n 
1 184 ASP n 
1 185 GLU n 
1 186 TYR n 
1 187 GLU n 
1 188 ARG n 
1 189 HIS n 
1 190 ASN n 
1 191 SER n 
1 192 TYR n 
1 193 THR n 
1 194 CYS n 
1 195 GLU n 
1 196 ALA n 
1 197 THR n 
1 198 HIS n 
1 199 LYS n 
1 200 THR n 
1 201 SER n 
1 202 THR n 
1 203 SER n 
1 204 PRO n 
1 205 ILE n 
1 206 VAL n 
1 207 LYS n 
1 208 SER n 
1 209 PHE n 
1 210 ASN n 
1 211 ARG n 
1 212 ASN n 
2 1   GLN n 
2 2   VAL n 
2 3   GLN n 
2 4   LEU n 
2 5   GLN n 
2 6   GLN n 
2 7   PRO n 
2 8   GLY n 
2 9   ALA n 
2 10  GLU n 
2 11  LEU n 
2 12  VAL n 
2 13  LYS n 
2 14  PRO n 
2 15  GLY n 
2 16  ALA n 
2 17  SER n 
2 18  VAL n 
2 19  LYS n 
2 20  LEU n 
2 21  SER n 
2 22  CYS n 
2 23  LYS n 
2 24  ALA n 
2 25  SER n 
2 26  GLY n 
2 27  TYR n 
2 28  THR n 
2 29  PHE n 
2 30  THR n 
2 31  SER n 
2 32  ASP n 
2 33  TRP n 
2 34  ILE n 
2 35  HIS n 
2 36  TRP n 
2 37  VAL n 
2 38  LYS n 
2 39  GLN n 
2 40  ARG n 
2 41  PRO n 
2 42  GLY n 
2 43  HIS n 
2 44  GLY n 
2 45  LEU n 
2 46  GLU n 
2 47  TRP n 
2 48  ILE n 
2 49  GLY n 
2 50  GLU n 
2 51  ILE n 
2 52  ILE n 
2 53  PRO n 
2 54  SER n 
2 55  TYR n 
2 56  GLY n 
2 57  ARG n 
2 58  ALA n 
2 59  ASN n 
2 60  TYR n 
2 61  ASN n 
2 62  GLU n 
2 63  LYS n 
2 64  ILE n 
2 65  GLN n 
2 66  LYS n 
2 67  LYS n 
2 68  ALA n 
2 69  THR n 
2 70  LEU n 
2 71  THR n 
2 72  ALA n 
2 73  ASP n 
2 74  LYS n 
2 75  SER n 
2 76  SER n 
2 77  SER n 
2 78  THR n 
2 79  ALA n 
2 80  PHE n 
2 81  MET n 
2 82  GLN n 
2 83  LEU n 
2 84  SER n 
2 85  SER n 
2 86  LEU n 
2 87  THR n 
2 88  SER n 
2 89  GLU n 
2 90  ASP n 
2 91  SER n 
2 92  ALA n 
2 93  VAL n 
2 94  TYR n 
2 95  TYR n 
2 96  CYS n 
2 97  ALA n 
2 98  ARG n 
2 99  GLU n 
2 100 ARG n 
2 101 GLY n 
2 102 ASP n 
2 103 GLY n 
2 104 TYR n 
2 105 PHE n 
2 106 ALA n 
2 107 VAL n 
2 108 TRP n 
2 109 GLY n 
2 110 ALA n 
2 111 GLY n 
2 112 THR n 
2 113 THR n 
2 114 VAL n 
2 115 THR n 
2 116 VAL n 
2 117 SER n 
2 118 SER n 
2 119 ALA n 
2 120 LYS n 
2 121 THR n 
2 122 THR n 
2 123 PRO n 
2 124 PRO n 
2 125 SER n 
2 126 VAL n 
2 127 TYR n 
2 128 PRO n 
2 129 LEU n 
2 130 ALA n 
2 131 PRO n 
2 132 GLY n 
2 133 SER n 
2 134 ALA n 
2 135 ALA n 
2 136 GLN n 
2 137 THR n 
2 138 ASN n 
2 139 SER n 
2 140 MET n 
2 141 VAL n 
2 142 THR n 
2 143 LEU n 
2 144 GLY n 
2 145 CYS n 
2 146 LEU n 
2 147 VAL n 
2 148 LYS n 
2 149 GLY n 
2 150 TYR n 
2 151 PHE n 
2 152 PRO n 
2 153 GLU n 
2 154 PRO n 
2 155 VAL n 
2 156 THR n 
2 157 VAL n 
2 158 THR n 
2 159 TRP n 
2 160 ASN n 
2 161 SER n 
2 162 GLY n 
2 163 SER n 
2 164 LEU n 
2 165 SER n 
2 166 SER n 
2 167 GLY n 
2 168 VAL n 
2 169 HIS n 
2 170 THR n 
2 171 PHE n 
2 172 PRO n 
2 173 ALA n 
2 174 VAL n 
2 175 LEU n 
2 176 GLN n 
2 177 SER n 
2 178 ASP n 
2 179 LEU n 
2 180 TYR n 
2 181 THR n 
2 182 LEU n 
2 183 SER n 
2 184 SER n 
2 185 SER n 
2 186 VAL n 
2 187 THR n 
2 188 VAL n 
2 189 PRO n 
2 190 SER n 
2 191 SER n 
2 192 SER n 
2 193 TRP n 
2 194 PRO n 
2 195 SER n 
2 196 GLU n 
2 197 THR n 
2 198 VAL n 
2 199 THR n 
2 200 CYS n 
2 201 ASN n 
2 202 VAL n 
2 203 ALA n 
2 204 HIS n 
2 205 PRO n 
2 206 ALA n 
2 207 SER n 
2 208 SER n 
2 209 THR n 
2 210 LYS n 
2 211 VAL n 
2 212 ASP n 
2 213 LYS n 
2 214 LYS n 
2 215 ILE n 
2 216 VAL n 
2 217 PRO n 
2 218 ARG n 
2 219 ASP n 
3 1   MET n 
3 2   ALA n 
3 3   PRO n 
3 4   MET n 
3 5   LEU n 
3 6   SER n 
3 7   GLY n 
3 8   LEU n 
3 9   LEU n 
3 10  ALA n 
3 11  ARG n 
3 12  LEU n 
3 13  VAL n 
3 14  LYS n 
3 15  LEU n 
3 16  LEU n 
3 17  LEU n 
3 18  GLY n 
3 19  ARG n 
3 20  HIS n 
3 21  GLY n 
3 22  SER n 
3 23  ALA n 
3 24  LEU n 
3 25  HIS n 
3 26  TRP n 
3 27  ARG n 
3 28  ALA n 
3 29  ALA n 
3 30  GLY n 
3 31  ALA n 
3 32  ALA n 
3 33  THR n 
3 34  VAL n 
3 35  LEU n 
3 36  LEU n 
3 37  VAL n 
3 38  ILE n 
3 39  VAL n 
3 40  LEU n 
3 41  LEU n 
3 42  ALA n 
3 43  GLY n 
3 44  SER n 
3 45  TYR n 
3 46  LEU n 
3 47  ALA n 
3 48  VAL n 
3 49  LEU n 
3 50  ALA n 
3 51  GLU n 
3 52  ARG n 
3 53  GLY n 
3 54  ALA n 
3 55  PRO n 
3 56  GLY n 
3 57  ALA n 
3 58  GLN n 
3 59  LEU n 
3 60  ILE n 
3 61  THR n 
3 62  TYR n 
3 63  PRO n 
3 64  ARG n 
3 65  ALA n 
3 66  LEU n 
3 67  TRP n 
3 68  TRP n 
3 69  SER n 
3 70  VAL n 
3 71  GLU n 
3 72  THR n 
3 73  ALA n 
3 74  THR n 
3 75  CYS n 
3 76  VAL n 
3 77  GLY n 
3 78  TYR n 
3 79  GLY n 
3 80  ASP n 
3 81  LEU n 
3 82  TYR n 
3 83  PRO n 
3 84  VAL n 
3 85  THR n 
3 86  LEU n 
3 87  TRP n 
3 88  GLY n 
3 89  ARG n 
3 90  LEU n 
3 91  VAL n 
3 92  ALA n 
3 93  VAL n 
3 94  VAL n 
3 95  VAL n 
3 96  MET n 
3 97  VAL n 
3 98  ALA n 
3 99  GLY n 
3 100 ILE n 
3 101 THR n 
3 102 SER n 
3 103 PHE n 
3 104 GLY n 
3 105 LEU n 
3 106 VAL n 
3 107 THR n 
3 108 ALA n 
3 109 ALA n 
3 110 LEU n 
3 111 ALA n 
3 112 THR n 
3 113 TRP n 
3 114 PHE n 
3 115 VAL n 
3 116 GLY n 
3 117 ARG n 
3 118 GLU n 
3 119 GLN n 
3 120 GLU n 
3 121 ARG n 
3 122 ARG n 
3 123 GLY n 
3 124 HIS n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               , 
_entity_src_gen.gene_src_genus                     'Streptomyces, Streptomyces' 
_entity_src_gen.pdbx_gene_src_gene                 'KCSA, SKC1, SCO7660, SC10F4.33' 
_entity_src_gen.gene_src_species                   , 
_entity_src_gen.gene_src_strain                    , 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Streptomyces coelicolor, Streptomyces lividans' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1902,1916 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'XL1 blue' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PQE60 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1 1 sample ? ? 'house mouse' 'Mus musculus' 10090 Mus ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? 'house mouse' 'Mus musculus' 10090 Mus ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP KCSA_STRCO Q54397 3 
;MPPMLSGLLARLVKLLLGRHGSALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGD
LYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
;
1 ? 
2 PDB 1S5H       1S5H   1 ? ? ? 
3 PDB 1S5H       1S5H   2 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1S5H C 1 ? 124 ? Q54397 1 ? 124 ? 1 124 
2 2 1S5H A 1 ? 212 ? 1S5H   1 ? 212 ? 1 212 
3 3 1S5H B 1 ? 219 ? 1S5H   1 ? 219 ? 1 219 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1S5H ALA C 2  ? UNP Q54397 PRO 2  'engineered mutation' 2  1 
1 1S5H CYS C 75 ? UNP Q54397 THR 75 'engineered mutation' 75 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE           ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE          ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE        ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'   ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE          ? 'C3 H7 N O2 S'   121.158 
DGA non-polymer         . 'DIACYL GLYCEROL' ? 'C39 H76 O5'     625.018 
F09 non-polymer         . NONAN-1-OL        ? 'C9 H20 O'       144.254 
GLN 'L-peptide linking' y GLUTAMINE         ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'   ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE           ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE         ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER             ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE        ? 'C6 H13 N O2'    131.173 
K   non-polymer         . 'POTASSIUM ION'   ? 'K 1'            39.098  
LEU 'L-peptide linking' y LEUCINE           ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE            ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE        ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE     ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE           ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE            ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE         ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN        ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE          ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE            ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1S5H 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   67.46 
_exptl_crystal.description           ? 
_exptl_crystal.density_Matthews      3.78 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.4 
_exptl_crystal_grow.pdbx_details    
'PEG 400, magnesium acetate, sodium acetate, pH 5.4, VAPOR DIFFUSION, SITTING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2002-06-17 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'platinum-coated silicon mirror' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X25' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X25 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.1 
# 
_reflns.entry_id                     1S5H 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             27.35 
_reflns.d_resolution_high            2.2 
_reflns.number_obs                   45718 
_reflns.number_all                   45872 
_reflns.percent_possible_obs         99.7 
_reflns.pdbx_Rmerge_I_obs            0.057 
_reflns.pdbx_Rsym_value              0.054 
_reflns.pdbx_netI_over_sigmaI        27 
_reflns.B_iso_Wilson_estimate        27.7 
_reflns.pdbx_redundancy              8.8 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.2 
_reflns_shell.d_res_low              2.28 
_reflns_shell.percent_possible_all   98.1 
_reflns_shell.Rmerge_I_obs           0.288 
_reflns_shell.pdbx_Rsym_value        0.288 
_reflns_shell.meanI_over_sigI_obs    3.7 
_reflns_shell.pdbx_redundancy        2.4 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      4487 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1S5H 
_refine.ls_number_reflns_obs                     45524 
_refine.ls_number_reflns_all                     45524 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               2527612.12 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             27.35 
_refine.ls_d_res_high                            2.20 
_refine.ls_percent_reflns_obs                    99.5 
_refine.ls_R_factor_obs                          0.222 
_refine.ls_R_factor_all                          0.234 
_refine.ls_R_factor_R_work                       0.222 
_refine.ls_R_factor_R_free                       0.24 
_refine.ls_R_factor_R_free_error                 0.005 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  2259 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               38.8 
_refine.aniso_B[1][1]                            3.64 
_refine.aniso_B[2][2]                            3.64 
_refine.aniso_B[3][3]                            -7.28 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.314808 
_refine.solvent_model_param_bsol                 37.7682 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1K4C' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1S5H 
_refine_analyze.Luzzati_coordinate_error_obs    0.28 
_refine_analyze.Luzzati_sigma_a_obs             0.21 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.31 
_refine_analyze.Luzzati_sigma_a_free            0.24 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3940 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         39 
_refine_hist.number_atoms_solvent             228 
_refine_hist.number_atoms_total               4207 
_refine_hist.d_res_high                       2.20 
_refine_hist.d_res_low                        27.35 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.006 ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.3   ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      25.7  ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.82  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.20 
_refine_ls_shell.d_res_low                        2.34 
_refine_ls_shell.number_reflns_R_work             7062 
_refine_ls_shell.R_factor_R_work                  0.262 
_refine_ls_shell.percent_reflns_obs               98.8 
_refine_ls_shell.R_factor_R_free                  0.292 
_refine_ls_shell.R_factor_R_free_error            0.015 
_refine_ls_shell.percent_reflns_R_free            5.1 
_refine_ls_shell.number_reflns_R_free             383 
_refine_ls_shell.number_reflns_obs                7445 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 ION.PARAM         LIPID_1.TOP 'X-RAY DIFFRACTION' 
3 WATER_REP.PARAM   ?           'X-RAY DIFFRACTION' 
4 LIPID_1.PAR       ?           'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1S5H 
_struct.title                     'Potassium Channel Kcsa-Fab Complex T75C mutant in K+' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1S5H 
_struct_keywords.pdbx_keywords   'MEMBRANE PROTEIN' 
_struct_keywords.text            'K+ CHANNEL, PROTEIN-ANTIBODY FAB COMPLEX, selectivity filter, ion occupancy, MEMBRANE PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 5 ? 
H N N 5 ? 
I N N 5 ? 
J N N 5 ? 
K N N 5 ? 
L N N 6 ? 
M N N 7 ? 
N N N 7 ? 
O N N 7 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLU A 79  ? ILE A 83  ? GLU A 79  ILE A 83  5 ? 5  
HELX_P HELX_P2  2  SER A 121 ? THR A 126 ? SER A 121 THR A 126 1 ? 6  
HELX_P HELX_P3  3  LYS A 183 ? ARG A 188 ? LYS A 183 ARG A 188 1 ? 6  
HELX_P HELX_P4  4  THR B 87  ? SER B 91  ? THR B 87  SER B 91  5 ? 5  
HELX_P HELX_P5  5  SER B 161 ? SER B 163 ? SER B 161 SER B 163 5 ? 3  
HELX_P HELX_P6  6  SER B 191 ? TRP B 193 ? SER B 191 TRP B 193 5 ? 3  
HELX_P HELX_P7  7  PRO B 205 ? SER B 208 ? PRO B 205 SER B 208 5 ? 4  
HELX_P HELX_P8  8  ALA C 23  ? ARG C 52  ? ALA C 23  ARG C 52  1 ? 30 
HELX_P HELX_P9  9  THR C 61  ? THR C 74  ? THR C 61  THR C 74  1 ? 14 
HELX_P HELX_P10 10 THR C 85  ? ARG C 122 ? THR C 85  ARG C 122 1 ? 38 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ? ? A CYS 23  SG ? ? ? 1_555 A CYS 88  SG ? ? A CYS 23  A CYS 88  1_555 ? ? ? ? ? ? ? 2.583 ? ? 
disulf2  disulf ? ? A CYS 134 SG ? ? ? 1_555 A CYS 194 SG ? ? A CYS 134 A CYS 194 1_555 ? ? ? ? ? ? ? 2.672 ? ? 
disulf3  disulf ? ? B CYS 22  SG ? ? ? 1_555 B CYS 96  SG ? ? B CYS 22  B CYS 96  1_555 ? ? ? ? ? ? ? 2.688 ? ? 
metalc1  metalc ? ? C CYS 75  O  ? ? ? 1_555 G K   .   K  ? ? C CYS 75  C K   403 1_555 ? ? ? ? ? ? ? 2.670 ? ? 
metalc2  metalc ? ? C CYS 75  O  ? ? ? 4_575 G K   .   K  ? ? C CYS 75  C K   403 1_555 ? ? ? ? ? ? ? 2.670 ? ? 
metalc3  metalc ? ? C CYS 75  O  ? ? ? 3_755 G K   .   K  ? ? C CYS 75  C K   403 1_555 ? ? ? ? ? ? ? 2.670 ? ? 
metalc4  metalc ? ? C CYS 75  O  ? ? ? 2_775 G K   .   K  ? ? C CYS 75  C K   403 1_555 ? ? ? ? ? ? ? 2.670 ? ? 
metalc5  metalc ? ? C VAL 76  O  ? ? ? 1_555 F K   .   K  ? ? C VAL 76  C K   402 1_555 ? ? ? ? ? ? ? 2.849 ? ? 
metalc6  metalc ? ? C VAL 76  O  ? ? ? 4_575 F K   .   K  ? ? C VAL 76  C K   402 1_555 ? ? ? ? ? ? ? 2.849 ? ? 
metalc7  metalc ? ? C VAL 76  O  ? ? ? 3_755 F K   .   K  ? ? C VAL 76  C K   402 1_555 ? ? ? ? ? ? ? 2.849 ? ? 
metalc8  metalc ? ? C VAL 76  O  ? ? ? 2_775 F K   .   K  ? ? C VAL 76  C K   402 1_555 ? ? ? ? ? ? ? 2.849 ? ? 
metalc9  metalc ? ? C VAL 76  O  ? ? ? 1_555 G K   .   K  ? ? C VAL 76  C K   403 1_555 ? ? ? ? ? ? ? 3.173 ? ? 
metalc10 metalc ? ? C VAL 76  O  ? ? ? 4_575 G K   .   K  ? ? C VAL 76  C K   403 1_555 ? ? ? ? ? ? ? 3.173 ? ? 
metalc11 metalc ? ? C VAL 76  O  ? ? ? 3_755 G K   .   K  ? ? C VAL 76  C K   403 1_555 ? ? ? ? ? ? ? 3.173 ? ? 
metalc12 metalc ? ? C VAL 76  O  ? ? ? 2_775 G K   .   K  ? ? C VAL 76  C K   403 1_555 ? ? ? ? ? ? ? 3.173 ? ? 
metalc13 metalc ? ? C GLY 77  O  ? ? ? 1_555 E K   .   K  ? ? C GLY 77  C K   401 1_555 ? ? ? ? ? ? ? 3.009 ? ? 
metalc14 metalc ? ? C GLY 77  O  ? ? ? 4_575 E K   .   K  ? ? C GLY 77  C K   401 1_555 ? ? ? ? ? ? ? 3.009 ? ? 
metalc15 metalc ? ? C GLY 77  O  ? ? ? 3_755 E K   .   K  ? ? C GLY 77  C K   401 1_555 ? ? ? ? ? ? ? 3.009 ? ? 
metalc16 metalc ? ? C GLY 77  O  ? ? ? 2_775 E K   .   K  ? ? C GLY 77  C K   401 1_555 ? ? ? ? ? ? ? 3.009 ? ? 
metalc17 metalc ? ? C GLY 77  O  ? ? ? 1_555 F K   .   K  ? ? C GLY 77  C K   402 1_555 ? ? ? ? ? ? ? 2.947 ? ? 
metalc18 metalc ? ? C GLY 77  O  ? ? ? 4_575 F K   .   K  ? ? C GLY 77  C K   402 1_555 ? ? ? ? ? ? ? 2.947 ? ? 
metalc19 metalc ? ? C GLY 77  O  ? ? ? 3_755 F K   .   K  ? ? C GLY 77  C K   402 1_555 ? ? ? ? ? ? ? 2.947 ? ? 
metalc20 metalc ? ? C GLY 77  O  ? ? ? 2_775 F K   .   K  ? ? C GLY 77  C K   402 1_555 ? ? ? ? ? ? ? 2.947 ? ? 
metalc21 metalc ? ? C TYR 78  O  ? ? ? 1_555 E K   .   K  ? ? C TYR 78  C K   401 1_555 ? ? ? ? ? ? ? 2.895 ? ? 
metalc22 metalc ? ? C TYR 78  O  ? ? ? 4_575 E K   .   K  ? ? C TYR 78  C K   401 1_555 ? ? ? ? ? ? ? 2.895 ? ? 
metalc23 metalc ? ? C TYR 78  O  ? ? ? 3_755 E K   .   K  ? ? C TYR 78  C K   401 1_555 ? ? ? ? ? ? ? 2.895 ? ? 
metalc24 metalc ? ? C TYR 78  O  ? ? ? 2_775 E K   .   K  ? ? C TYR 78  C K   401 1_555 ? ? ? ? ? ? ? 2.895 ? ? 
metalc25 metalc ? ? E K   .   K  ? ? ? 1_555 F K   .   K  ? ? C K   401 C K   402 1_555 ? ? ? ? ? ? ? 3.330 ? ? 
metalc26 metalc ? ? E K   .   K  ? ? ? 1_555 F K   .   K  ? ? C K   401 C K   402 2_775 ? ? ? ? ? ? ? 3.330 ? ? 
metalc27 metalc ? ? E K   .   K  ? ? ? 1_555 F K   .   K  ? ? C K   401 C K   402 3_755 ? ? ? ? ? ? ? 3.330 ? ? 
metalc28 metalc ? ? E K   .   K  ? ? ? 1_555 F K   .   K  ? ? C K   401 C K   402 4_575 ? ? ? ? ? ? ? 3.330 ? ? 
metalc29 metalc ? ? F K   .   K  ? ? ? 1_555 G K   .   K  ? ? C K   402 C K   403 1_555 ? ? ? ? ? ? ? 3.491 ? ? 
metalc30 metalc ? ? F K   .   K  ? ? ? 1_555 G K   .   K  ? ? C K   402 C K   403 2_775 ? ? ? ? ? ? ? 3.491 ? ? 
metalc31 metalc ? ? F K   .   K  ? ? ? 1_555 G K   .   K  ? ? C K   402 C K   403 3_755 ? ? ? ? ? ? ? 3.491 ? ? 
metalc32 metalc ? ? F K   .   K  ? ? ? 1_555 G K   .   K  ? ? C K   402 C K   403 4_575 ? ? ? ? ? ? ? 3.491 ? ? 
metalc33 metalc ? ? H K   .   K  ? ? ? 1_555 O HOH .   O  ? ? C K   404 C HOH 419 1_555 ? ? ? ? ? ? ? 3.459 ? ? 
metalc34 metalc ? ? H K   .   K  ? ? ? 1_555 O HOH .   O  ? ? C K   404 C HOH 419 4_575 ? ? ? ? ? ? ? 3.459 ? ? 
metalc35 metalc ? ? H K   .   K  ? ? ? 1_555 O HOH .   O  ? ? C K   404 C HOH 419 3_755 ? ? ? ? ? ? ? 3.459 ? ? 
metalc36 metalc ? ? H K   .   K  ? ? ? 1_555 O HOH .   O  ? ? C K   404 C HOH 419 2_775 ? ? ? ? ? ? ? 3.459 ? ? 
metalc37 metalc ? ? J K   .   K  ? ? ? 1_555 K K   .   K  ? ? C K   406 C K   407 1_555 ? ? ? ? ? ? ? 3.451 ? ? 
metalc38 metalc ? ? J K   .   K  ? ? ? 1_555 K K   .   K  ? ? C K   406 C K   407 2_775 ? ? ? ? ? ? ? 3.451 ? ? 
metalc39 metalc ? ? J K   .   K  ? ? ? 1_555 K K   .   K  ? ? C K   406 C K   407 3_755 ? ? ? ? ? ? ? 3.451 ? ? 
metalc40 metalc ? ? J K   .   K  ? ? ? 1_555 K K   .   K  ? ? C K   406 C K   407 4_575 ? ? ? ? ? ? ? 3.451 ? ? 
metalc41 metalc ? ? K K   .   K  ? ? ? 1_555 O HOH .   O  ? ? C K   407 C HOH 425 1_555 ? ? ? ? ? ? ? 3.328 ? ? 
metalc42 metalc ? ? K K   .   K  ? ? ? 1_555 O HOH .   O  ? ? C K   407 C HOH 425 2_775 ? ? ? ? ? ? ? 3.328 ? ? 
metalc43 metalc ? ? K K   .   K  ? ? ? 1_555 O HOH .   O  ? ? C K   407 C HOH 425 3_755 ? ? ? ? ? ? ? 3.328 ? ? 
metalc44 metalc ? ? K K   .   K  ? ? ? 1_555 O HOH .   O  ? ? C K   407 C HOH 425 4_575 ? ? ? ? ? ? ? 3.328 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 7   A . ? SER 7   A PRO 8   A ? PRO 8   A 1 0.19  
2 TRP 94  A . ? TRP 94  A PRO 95  A ? PRO 95  A 1 -0.20 
3 TYR 140 A . ? TYR 140 A PRO 141 A ? PRO 141 A 1 0.15  
4 PHE 151 B . ? PHE 151 B PRO 152 B ? PRO 152 B 1 -0.39 
5 GLU 153 B . ? GLU 153 B PRO 154 B ? PRO 154 B 1 -0.28 
6 TRP 193 B . ? TRP 193 B PRO 194 B ? PRO 194 B 1 0.06  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 6 ? 
C ? 4 ? 
D ? 4 ? 
E ? 4 ? 
F ? 4 ? 
G ? 6 ? 
H ? 4 ? 
I ? 4 ? 
J ? 4 ? 
K ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? parallel      
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
G 4 5 ? anti-parallel 
G 5 6 ? anti-parallel 
H 1 2 ? parallel      
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
J 3 4 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 4   ? THR A 5   ? LEU A 4   THR A 5   
A 2 VAL A 19  ? ALA A 25  ? VAL A 19  ALA A 25  
A 3 ASP A 70  ? ILE A 75  ? ASP A 70  ILE A 75  
A 4 PHE A 62  ? SER A 67  ? PHE A 62  SER A 67  
B 1 ILE A 10  ? VAL A 13  ? ILE A 10  VAL A 13  
B 2 THR A 102 ? ILE A 106 ? THR A 102 ILE A 106 
B 3 ASN A 85  ? GLN A 90  ? ASN A 85  GLN A 90  
B 4 ILE A 33  ? GLN A 38  ? ILE A 33  GLN A 38  
B 5 ARG A 45  ? LYS A 49  ? ARG A 45  LYS A 49  
B 6 GLU A 53  ? SER A 54  ? GLU A 53  SER A 54  
C 1 ILE A 10  ? VAL A 13  ? ILE A 10  VAL A 13  
C 2 THR A 102 ? ILE A 106 ? THR A 102 ILE A 106 
C 3 ASN A 85  ? GLN A 90  ? ASN A 85  GLN A 90  
C 4 THR A 97  ? PHE A 98  ? THR A 97  PHE A 98  
D 1 THR A 114 ? PHE A 118 ? THR A 114 PHE A 118 
D 2 GLY A 129 ? PHE A 139 ? GLY A 129 PHE A 139 
D 3 TYR A 173 ? THR A 182 ? TYR A 173 THR A 182 
D 4 VAL A 159 ? TRP A 163 ? VAL A 159 TRP A 163 
E 1 SER A 153 ? ARG A 155 ? SER A 153 ARG A 155 
E 2 ASN A 145 ? ILE A 150 ? ASN A 145 ILE A 150 
E 3 SER A 191 ? THR A 197 ? SER A 191 THR A 197 
E 4 ILE A 205 ? ASN A 210 ? ILE A 205 ASN A 210 
F 1 LEU B 4   ? GLN B 5   ? LEU B 4   GLN B 5   
F 2 VAL B 18  ? ALA B 24  ? VAL B 18  ALA B 24  
F 3 THR B 78  ? LEU B 83  ? THR B 78  LEU B 83  
F 4 ALA B 68  ? ASP B 73  ? ALA B 68  ASP B 73  
G 1 ALA B 9   ? VAL B 12  ? ALA B 9   VAL B 12  
G 2 THR B 112 ? VAL B 116 ? THR B 112 VAL B 116 
G 3 ALA B 92  ? GLU B 99  ? ALA B 92  GLU B 99  
G 4 TRP B 33  ? GLN B 39  ? TRP B 33  GLN B 39  
G 5 GLU B 46  ? ILE B 51  ? GLU B 46  ILE B 51  
G 6 ALA B 58  ? TYR B 60  ? ALA B 58  TYR B 60  
H 1 ALA B 9   ? VAL B 12  ? ALA B 9   VAL B 12  
H 2 THR B 112 ? VAL B 116 ? THR B 112 VAL B 116 
H 3 ALA B 92  ? GLU B 99  ? ALA B 92  GLU B 99  
H 4 PHE B 105 ? TRP B 108 ? PHE B 105 TRP B 108 
I 1 SER B 125 ? LEU B 129 ? SER B 125 LEU B 129 
I 2 MET B 140 ? TYR B 150 ? MET B 140 TYR B 150 
I 3 TYR B 180 ? PRO B 189 ? TYR B 180 PRO B 189 
I 4 VAL B 168 ? THR B 170 ? VAL B 168 THR B 170 
J 1 SER B 125 ? LEU B 129 ? SER B 125 LEU B 129 
J 2 MET B 140 ? TYR B 150 ? MET B 140 TYR B 150 
J 3 TYR B 180 ? PRO B 189 ? TYR B 180 PRO B 189 
J 4 VAL B 174 ? LEU B 175 ? VAL B 174 LEU B 175 
K 1 THR B 156 ? TRP B 159 ? THR B 156 TRP B 159 
K 2 THR B 199 ? HIS B 204 ? THR B 199 HIS B 204 
K 3 THR B 209 ? LYS B 214 ? THR B 209 LYS B 214 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N THR A 5   ? N THR A 5   O ARG A 24  ? O ARG A 24  
A 2 3 N PHE A 21  ? N PHE A 21  O LEU A 73  ? O LEU A 73  
A 3 4 O SER A 74  ? O SER A 74  N SER A 63  ? N SER A 63  
B 1 2 N LEU A 11  ? N LEU A 11  O GLU A 105 ? O GLU A 105 
B 2 3 O THR A 102 ? O THR A 102 N TYR A 86  ? N TYR A 86  
B 3 4 O TYR A 87  ? O TYR A 87  N TYR A 36  ? N TYR A 36  
B 4 5 N TRP A 35  ? N TRP A 35  O LEU A 47  ? O LEU A 47  
B 5 6 N LYS A 49  ? N LYS A 49  O GLU A 53  ? O GLU A 53  
C 1 2 N LEU A 11  ? N LEU A 11  O GLU A 105 ? O GLU A 105 
C 2 3 O THR A 102 ? O THR A 102 N TYR A 86  ? N TYR A 86  
C 3 4 N GLN A 90  ? N GLN A 90  O THR A 97  ? O THR A 97  
D 1 2 N PHE A 118 ? N PHE A 118 O VAL A 133 ? O VAL A 133 
D 2 3 N VAL A 132 ? N VAL A 132 O LEU A 179 ? O LEU A 179 
D 3 4 O SER A 176 ? O SER A 176 N SER A 162 ? N SER A 162 
E 1 2 O SER A 153 ? O SER A 153 N ILE A 150 ? N ILE A 150 
E 2 3 N LYS A 147 ? N LYS A 147 O GLU A 195 ? O GLU A 195 
E 3 4 N ALA A 196 ? N ALA A 196 O ILE A 205 ? O ILE A 205 
F 1 2 N GLN B 5   ? N GLN B 5   O LYS B 23  ? O LYS B 23  
F 2 3 N VAL B 18  ? N VAL B 18  O LEU B 83  ? O LEU B 83  
F 3 4 O THR B 78  ? O THR B 78  N ASP B 73  ? N ASP B 73  
G 1 2 N VAL B 12  ? N VAL B 12  O THR B 115 ? O THR B 115 
G 2 3 O VAL B 114 ? O VAL B 114 N ALA B 92  ? N ALA B 92  
G 3 4 O GLU B 99  ? O GLU B 99  N TRP B 33  ? N TRP B 33  
G 4 5 N LYS B 38  ? N LYS B 38  O GLU B 46  ? O GLU B 46  
G 5 6 N GLU B 50  ? N GLU B 50  O ASN B 59  ? O ASN B 59  
H 1 2 N VAL B 12  ? N VAL B 12  O THR B 115 ? O THR B 115 
H 2 3 O VAL B 114 ? O VAL B 114 N ALA B 92  ? N ALA B 92  
H 3 4 N ARG B 98  ? N ARG B 98  O VAL B 107 ? O VAL B 107 
I 1 2 N TYR B 127 ? N TYR B 127 O LEU B 146 ? O LEU B 146 
I 2 3 N TYR B 150 ? N TYR B 150 O TYR B 180 ? O TYR B 180 
I 3 4 O SER B 185 ? O SER B 185 N HIS B 169 ? N HIS B 169 
J 1 2 N TYR B 127 ? N TYR B 127 O LEU B 146 ? O LEU B 146 
J 2 3 N TYR B 150 ? N TYR B 150 O TYR B 180 ? O TYR B 180 
J 3 4 O THR B 181 ? O THR B 181 N VAL B 174 ? N VAL B 174 
K 1 2 N THR B 158 ? N THR B 158 O ASN B 201 ? O ASN B 201 
K 2 3 N HIS B 204 ? N HIS B 204 O THR B 209 ? O THR B 209 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software C K   401 ? 12 'BINDING SITE FOR RESIDUE K C 401'   
AC2 Software C K   402 ? 16 'BINDING SITE FOR RESIDUE K C 402'   
AC3 Software C K   403 ? 12 'BINDING SITE FOR RESIDUE K C 403'   
AC4 Software C K   406 ? 4  'BINDING SITE FOR RESIDUE K C 406'   
AC5 Software C K   407 ? 4  'BINDING SITE FOR RESIDUE K C 407'   
AC6 Software C DGA 301 ? 3  'BINDING SITE FOR RESIDUE DGA C 301' 
AC7 Software B F09 302 ? 1  'BINDING SITE FOR RESIDUE F09 B 302' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 12 GLY C 77 ? GLY C 77  . ? 1_555 ? 
2  AC1 12 GLY C 77 ? GLY C 77  . ? 4_575 ? 
3  AC1 12 GLY C 77 ? GLY C 77  . ? 2_775 ? 
4  AC1 12 GLY C 77 ? GLY C 77  . ? 3_755 ? 
5  AC1 12 TYR C 78 ? TYR C 78  . ? 2_775 ? 
6  AC1 12 TYR C 78 ? TYR C 78  . ? 1_555 ? 
7  AC1 12 TYR C 78 ? TYR C 78  . ? 3_755 ? 
8  AC1 12 TYR C 78 ? TYR C 78  . ? 4_575 ? 
9  AC1 12 K   F .  ? K   C 402 . ? 4_575 ? 
10 AC1 12 K   F .  ? K   C 402 . ? 3_755 ? 
11 AC1 12 K   F .  ? K   C 402 . ? 2_775 ? 
12 AC1 12 K   F .  ? K   C 402 . ? 1_555 ? 
13 AC2 16 VAL C 76 ? VAL C 76  . ? 1_555 ? 
14 AC2 16 VAL C 76 ? VAL C 76  . ? 4_575 ? 
15 AC2 16 VAL C 76 ? VAL C 76  . ? 2_775 ? 
16 AC2 16 VAL C 76 ? VAL C 76  . ? 3_755 ? 
17 AC2 16 GLY C 77 ? GLY C 77  . ? 1_555 ? 
18 AC2 16 GLY C 77 ? GLY C 77  . ? 3_755 ? 
19 AC2 16 GLY C 77 ? GLY C 77  . ? 2_775 ? 
20 AC2 16 GLY C 77 ? GLY C 77  . ? 4_575 ? 
21 AC2 16 K   E .  ? K   C 401 . ? 2_775 ? 
22 AC2 16 K   E .  ? K   C 401 . ? 3_755 ? 
23 AC2 16 K   E .  ? K   C 401 . ? 4_575 ? 
24 AC2 16 K   E .  ? K   C 401 . ? 1_555 ? 
25 AC2 16 K   G .  ? K   C 403 . ? 4_575 ? 
26 AC2 16 K   G .  ? K   C 403 . ? 3_755 ? 
27 AC2 16 K   G .  ? K   C 403 . ? 2_775 ? 
28 AC2 16 K   G .  ? K   C 403 . ? 1_555 ? 
29 AC3 12 CYS C 75 ? CYS C 75  . ? 1_555 ? 
30 AC3 12 CYS C 75 ? CYS C 75  . ? 4_575 ? 
31 AC3 12 CYS C 75 ? CYS C 75  . ? 2_775 ? 
32 AC3 12 CYS C 75 ? CYS C 75  . ? 3_755 ? 
33 AC3 12 VAL C 76 ? VAL C 76  . ? 2_775 ? 
34 AC3 12 VAL C 76 ? VAL C 76  . ? 1_555 ? 
35 AC3 12 VAL C 76 ? VAL C 76  . ? 3_755 ? 
36 AC3 12 VAL C 76 ? VAL C 76  . ? 4_575 ? 
37 AC3 12 K   F .  ? K   C 402 . ? 4_575 ? 
38 AC3 12 K   F .  ? K   C 402 . ? 3_755 ? 
39 AC3 12 K   F .  ? K   C 402 . ? 2_775 ? 
40 AC3 12 K   F .  ? K   C 402 . ? 1_555 ? 
41 AC4 4  K   K .  ? K   C 407 . ? 1_555 ? 
42 AC4 4  K   K .  ? K   C 407 . ? 2_775 ? 
43 AC4 4  K   K .  ? K   C 407 . ? 3_755 ? 
44 AC4 4  K   K .  ? K   C 407 . ? 4_575 ? 
45 AC5 4  K   J .  ? K   C 406 . ? 1_555 ? 
46 AC5 4  K   J .  ? K   C 406 . ? 2_775 ? 
47 AC5 4  K   J .  ? K   C 406 . ? 3_755 ? 
48 AC5 4  K   J .  ? K   C 406 . ? 4_575 ? 
49 AC6 3  LEU C 86 ? LEU C 86  . ? 1_555 ? 
50 AC6 3  ARG C 89 ? ARG C 89  . ? 1_555 ? 
51 AC6 3  HOH O .  ? HOH C 438 . ? 1_555 ? 
52 AC7 1  ARG B 57 ? ARG B 57  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1S5H 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1S5H 
_atom_sites.fract_transf_matrix[1][1]   0.006464 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006464 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013171 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
K 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASP A 1 1   ? 154.813 139.490 -12.939 1.00 40.89 ? 1   ASP A N   1 
ATOM   2    C CA  . ASP A 1 1   ? 153.452 138.896 -12.744 1.00 40.40 ? 1   ASP A CA  1 
ATOM   3    C C   . ASP A 1 1   ? 152.583 139.852 -11.939 1.00 37.99 ? 1   ASP A C   1 
ATOM   4    O O   . ASP A 1 1   ? 153.010 140.395 -10.916 1.00 38.60 ? 1   ASP A O   1 
ATOM   5    C CB  . ASP A 1 1   ? 153.560 137.540 -12.039 1.00 43.52 ? 1   ASP A CB  1 
ATOM   6    C CG  . ASP A 1 1   ? 154.255 136.485 -12.902 1.00 46.59 ? 1   ASP A CG  1 
ATOM   7    O OD1 . ASP A 1 1   ? 155.225 136.835 -13.614 1.00 44.31 ? 1   ASP A OD1 1 
ATOM   8    O OD2 . ASP A 1 1   ? 153.837 135.306 -12.859 1.00 48.42 ? 1   ASP A OD2 1 
ATOM   9    N N   . ILE A 1 2   ? 151.360 140.049 -12.412 1.00 34.17 ? 2   ILE A N   1 
ATOM   10   C CA  . ILE A 1 2   ? 150.423 140.967 -11.787 1.00 30.20 ? 2   ILE A CA  1 
ATOM   11   C C   . ILE A 1 2   ? 149.766 140.457 -10.513 1.00 29.89 ? 2   ILE A C   1 
ATOM   12   O O   . ILE A 1 2   ? 149.065 139.448 -10.505 1.00 27.80 ? 2   ILE A O   1 
ATOM   13   C CB  . ILE A 1 2   ? 149.338 141.383 -12.798 1.00 28.72 ? 2   ILE A CB  1 
ATOM   14   C CG1 . ILE A 1 2   ? 150.018 142.004 -14.026 1.00 29.83 ? 2   ILE A CG1 1 
ATOM   15   C CG2 . ILE A 1 2   ? 148.357 142.361 -12.153 1.00 27.31 ? 2   ILE A CG2 1 
ATOM   16   C CD1 . ILE A 1 2   ? 149.081 142.542 -15.060 1.00 30.52 ? 2   ILE A CD1 1 
ATOM   17   N N   . LEU A 1 3   ? 150.007 141.184 -9.435  1.00 28.67 ? 3   LEU A N   1 
ATOM   18   C CA  . LEU A 1 3   ? 149.451 140.857 -8.138  1.00 29.85 ? 3   LEU A CA  1 
ATOM   19   C C   . LEU A 1 3   ? 148.117 141.567 -7.994  1.00 28.36 ? 3   LEU A C   1 
ATOM   20   O O   . LEU A 1 3   ? 148.016 142.768 -8.229  1.00 26.36 ? 3   LEU A O   1 
ATOM   21   C CB  . LEU A 1 3   ? 150.400 141.317 -7.028  1.00 33.99 ? 3   LEU A CB  1 
ATOM   22   C CG  . LEU A 1 3   ? 149.918 141.099 -5.591  1.00 38.39 ? 3   LEU A CG  1 
ATOM   23   C CD1 . LEU A 1 3   ? 149.542 139.632 -5.394  1.00 38.97 ? 3   LEU A CD1 1 
ATOM   24   C CD2 . LEU A 1 3   ? 151.023 141.507 -4.616  1.00 40.45 ? 3   LEU A CD2 1 
ATOM   25   N N   . LEU A 1 4   ? 147.094 140.807 -7.626  1.00 26.68 ? 4   LEU A N   1 
ATOM   26   C CA  . LEU A 1 4   ? 145.749 141.333 -7.427  1.00 27.47 ? 4   LEU A CA  1 
ATOM   27   C C   . LEU A 1 4   ? 145.453 141.282 -5.934  1.00 27.31 ? 4   LEU A C   1 
ATOM   28   O O   . LEU A 1 4   ? 145.412 140.203 -5.349  1.00 29.16 ? 4   LEU A O   1 
ATOM   29   C CB  . LEU A 1 4   ? 144.734 140.476 -8.197  1.00 25.29 ? 4   LEU A CB  1 
ATOM   30   C CG  . LEU A 1 4   ? 144.247 140.930 -9.585  1.00 27.96 ? 4   LEU A CG  1 
ATOM   31   C CD1 . LEU A 1 4   ? 145.238 141.846 -10.251 1.00 22.87 ? 4   LEU A CD1 1 
ATOM   32   C CD2 . LEU A 1 4   ? 143.956 139.706 -10.437 1.00 22.23 ? 4   LEU A CD2 1 
ATOM   33   N N   . THR A 1 5   ? 145.261 142.446 -5.322  1.00 25.80 ? 5   THR A N   1 
ATOM   34   C CA  . THR A 1 5   ? 144.983 142.529 -3.887  1.00 26.84 ? 5   THR A CA  1 
ATOM   35   C C   . THR A 1 5   ? 143.501 142.734 -3.596  1.00 26.09 ? 5   THR A C   1 
ATOM   36   O O   . THR A 1 5   ? 142.914 143.733 -3.997  1.00 26.91 ? 5   THR A O   1 
ATOM   37   C CB  . THR A 1 5   ? 145.740 143.705 -3.226  1.00 28.79 ? 5   THR A CB  1 
ATOM   38   O OG1 . THR A 1 5   ? 147.145 143.569 -3.456  1.00 28.12 ? 5   THR A OG1 1 
ATOM   39   C CG2 . THR A 1 5   ? 145.475 143.723 -1.720  1.00 26.18 ? 5   THR A CG2 1 
ATOM   40   N N   . GLN A 1 6   ? 142.898 141.781 -2.899  1.00 26.56 ? 6   GLN A N   1 
ATOM   41   C CA  . GLN A 1 6   ? 141.492 141.872 -2.526  1.00 27.10 ? 6   GLN A CA  1 
ATOM   42   C C   . GLN A 1 6   ? 141.427 142.075 -1.016  1.00 29.16 ? 6   GLN A C   1 
ATOM   43   O O   . GLN A 1 6   ? 141.660 141.140 -0.243  1.00 30.45 ? 6   GLN A O   1 
ATOM   44   C CB  . GLN A 1 6   ? 140.749 140.594 -2.911  1.00 23.64 ? 6   GLN A CB  1 
ATOM   45   C CG  . GLN A 1 6   ? 140.362 140.530 -4.384  1.00 24.24 ? 6   GLN A CG  1 
ATOM   46   C CD  . GLN A 1 6   ? 139.515 139.316 -4.711  1.00 22.94 ? 6   GLN A CD  1 
ATOM   47   O OE1 . GLN A 1 6   ? 140.025 138.272 -5.118  1.00 22.97 ? 6   GLN A OE1 1 
ATOM   48   N NE2 . GLN A 1 6   ? 138.211 139.446 -4.518  1.00 19.61 ? 6   GLN A NE2 1 
ATOM   49   N N   . SER A 1 7   ? 141.106 143.295 -0.607  1.00 29.23 ? 7   SER A N   1 
ATOM   50   C CA  . SER A 1 7   ? 141.034 143.645 0.810   1.00 33.54 ? 7   SER A CA  1 
ATOM   51   C C   . SER A 1 7   ? 139.830 144.552 1.066   1.00 33.26 ? 7   SER A C   1 
ATOM   52   O O   . SER A 1 7   ? 139.572 145.474 0.295   1.00 33.54 ? 7   SER A O   1 
ATOM   53   C CB  . SER A 1 7   ? 142.335 144.356 1.225   1.00 34.95 ? 7   SER A CB  1 
ATOM   54   O OG  . SER A 1 7   ? 142.281 144.824 2.565   1.00 40.64 ? 7   SER A OG  1 
ATOM   55   N N   . PRO A 1 8   ? 139.080 144.302 2.155   1.00 33.93 ? 8   PRO A N   1 
ATOM   56   C CA  . PRO A 1 8   ? 139.290 143.242 3.146   1.00 33.38 ? 8   PRO A CA  1 
ATOM   57   C C   . PRO A 1 8   ? 138.907 141.852 2.670   1.00 33.19 ? 8   PRO A C   1 
ATOM   58   O O   . PRO A 1 8   ? 138.144 141.689 1.710   1.00 30.10 ? 8   PRO A O   1 
ATOM   59   C CB  . PRO A 1 8   ? 138.430 143.693 4.313   1.00 34.11 ? 8   PRO A CB  1 
ATOM   60   C CG  . PRO A 1 8   ? 137.263 144.285 3.623   1.00 36.20 ? 8   PRO A CG  1 
ATOM   61   C CD  . PRO A 1 8   ? 137.916 145.126 2.530   1.00 36.74 ? 8   PRO A CD  1 
ATOM   62   N N   . ALA A 1 9   ? 139.443 140.857 3.373   1.00 31.58 ? 9   ALA A N   1 
ATOM   63   C CA  . ALA A 1 9   ? 139.208 139.453 3.071   1.00 33.66 ? 9   ALA A CA  1 
ATOM   64   C C   . ALA A 1 9   ? 137.781 139.033 3.395   1.00 33.25 ? 9   ALA A C   1 
ATOM   65   O O   . ALA A 1 9   ? 137.285 138.052 2.856   1.00 32.95 ? 9   ALA A O   1 
ATOM   66   C CB  . ALA A 1 9   ? 140.190 138.591 3.851   1.00 33.49 ? 9   ALA A CB  1 
ATOM   67   N N   . ILE A 1 10  ? 137.132 139.773 4.285   1.00 33.78 ? 10  ILE A N   1 
ATOM   68   C CA  . ILE A 1 10  ? 135.757 139.466 4.676   1.00 35.46 ? 10  ILE A CA  1 
ATOM   69   C C   . ILE A 1 10  ? 134.947 140.753 4.748   1.00 36.11 ? 10  ILE A C   1 
ATOM   70   O O   . ILE A 1 10  ? 135.430 141.768 5.247   1.00 37.69 ? 10  ILE A O   1 
ATOM   71   C CB  . ILE A 1 10  ? 135.706 138.769 6.052   1.00 36.36 ? 10  ILE A CB  1 
ATOM   72   C CG1 . ILE A 1 10  ? 136.478 137.445 5.993   1.00 37.24 ? 10  ILE A CG1 1 
ATOM   73   C CG2 . ILE A 1 10  ? 134.254 138.516 6.455   1.00 37.07 ? 10  ILE A CG2 1 
ATOM   74   C CD1 . ILE A 1 10  ? 136.656 136.769 7.337   1.00 38.92 ? 10  ILE A CD1 1 
ATOM   75   N N   . LEU A 1 11  ? 133.720 140.702 4.244   1.00 35.94 ? 11  LEU A N   1 
ATOM   76   C CA  . LEU A 1 11  ? 132.832 141.857 4.238   1.00 38.62 ? 11  LEU A CA  1 
ATOM   77   C C   . LEU A 1 11  ? 131.502 141.482 4.873   1.00 39.37 ? 11  LEU A C   1 
ATOM   78   O O   . LEU A 1 11  ? 130.853 140.534 4.435   1.00 39.27 ? 11  LEU A O   1 
ATOM   79   C CB  . LEU A 1 11  ? 132.602 142.321 2.795   1.00 39.00 ? 11  LEU A CB  1 
ATOM   80   C CG  . LEU A 1 11  ? 132.909 143.770 2.418   1.00 43.97 ? 11  LEU A CG  1 
ATOM   81   C CD1 . LEU A 1 11  ? 134.094 144.302 3.227   1.00 43.09 ? 11  LEU A CD1 1 
ATOM   82   C CD2 . LEU A 1 11  ? 133.198 143.838 0.922   1.00 42.64 ? 11  LEU A CD2 1 
ATOM   83   N N   . SER A 1 12  ? 131.105 142.223 5.905   1.00 40.56 ? 12  SER A N   1 
ATOM   84   C CA  . SER A 1 12  ? 129.842 141.977 6.593   1.00 43.54 ? 12  SER A CA  1 
ATOM   85   C C   . SER A 1 12  ? 128.880 143.110 6.282   1.00 44.57 ? 12  SER A C   1 
ATOM   86   O O   . SER A 1 12  ? 129.237 144.283 6.371   1.00 44.72 ? 12  SER A O   1 
ATOM   87   C CB  . SER A 1 12  ? 130.052 141.899 8.106   1.00 44.80 ? 12  SER A CB  1 
ATOM   88   O OG  . SER A 1 12  ? 130.968 140.868 8.439   1.00 49.08 ? 12  SER A OG  1 
ATOM   89   N N   . VAL A 1 13  ? 127.656 142.753 5.923   1.00 44.00 ? 13  VAL A N   1 
ATOM   90   C CA  . VAL A 1 13  ? 126.650 143.743 5.583   1.00 45.53 ? 13  VAL A CA  1 
ATOM   91   C C   . VAL A 1 13  ? 125.284 143.258 6.055   1.00 46.13 ? 13  VAL A C   1 
ATOM   92   O O   . VAL A 1 13  ? 125.077 142.058 6.241   1.00 45.36 ? 13  VAL A O   1 
ATOM   93   C CB  . VAL A 1 13  ? 126.621 143.973 4.046   1.00 46.07 ? 13  VAL A CB  1 
ATOM   94   C CG1 . VAL A 1 13  ? 126.373 142.658 3.323   1.00 46.14 ? 13  VAL A CG1 1 
ATOM   95   C CG2 . VAL A 1 13  ? 125.553 144.983 3.681   1.00 48.00 ? 13  VAL A CG2 1 
ATOM   96   N N   . SER A 1 14  ? 124.361 144.193 6.268   1.00 46.60 ? 14  SER A N   1 
ATOM   97   C CA  . SER A 1 14  ? 123.013 143.840 6.692   1.00 46.71 ? 14  SER A CA  1 
ATOM   98   C C   . SER A 1 14  ? 122.211 143.546 5.436   1.00 46.31 ? 14  SER A C   1 
ATOM   99   O O   . SER A 1 14  ? 122.494 144.094 4.372   1.00 45.16 ? 14  SER A O   1 
ATOM   100  C CB  . SER A 1 14  ? 122.367 144.990 7.466   1.00 46.98 ? 14  SER A CB  1 
ATOM   101  O OG  . SER A 1 14  ? 123.043 145.205 8.690   1.00 50.29 ? 14  SER A OG  1 
ATOM   102  N N   . PRO A 1 15  ? 121.197 142.675 5.542   1.00 46.75 ? 15  PRO A N   1 
ATOM   103  C CA  . PRO A 1 15  ? 120.381 142.335 4.375   1.00 47.86 ? 15  PRO A CA  1 
ATOM   104  C C   . PRO A 1 15  ? 119.757 143.538 3.673   1.00 48.57 ? 15  PRO A C   1 
ATOM   105  O O   . PRO A 1 15  ? 119.182 144.416 4.311   1.00 49.53 ? 15  PRO A O   1 
ATOM   106  C CB  . PRO A 1 15  ? 119.342 141.366 4.950   1.00 47.48 ? 15  PRO A CB  1 
ATOM   107  C CG  . PRO A 1 15  ? 119.247 141.765 6.387   1.00 47.87 ? 15  PRO A CG  1 
ATOM   108  C CD  . PRO A 1 15  ? 120.682 142.017 6.756   1.00 46.94 ? 15  PRO A CD  1 
ATOM   109  N N   . GLY A 1 16  ? 119.893 143.579 2.351   1.00 49.09 ? 16  GLY A N   1 
ATOM   110  C CA  . GLY A 1 16  ? 119.328 144.672 1.581   1.00 48.23 ? 16  GLY A CA  1 
ATOM   111  C C   . GLY A 1 16  ? 120.265 145.832 1.290   1.00 47.75 ? 16  GLY A C   1 
ATOM   112  O O   . GLY A 1 16  ? 119.985 146.646 0.410   1.00 47.53 ? 16  GLY A O   1 
ATOM   113  N N   . GLU A 1 17  ? 121.373 145.920 2.017   1.00 47.85 ? 17  GLU A N   1 
ATOM   114  C CA  . GLU A 1 17  ? 122.325 147.009 1.807   1.00 49.62 ? 17  GLU A CA  1 
ATOM   115  C C   . GLU A 1 17  ? 123.213 146.769 0.583   1.00 49.83 ? 17  GLU A C   1 
ATOM   116  O O   . GLU A 1 17  ? 123.359 145.634 0.124   1.00 50.60 ? 17  GLU A O   1 
ATOM   117  C CB  . GLU A 1 17  ? 123.187 147.200 3.059   1.00 49.14 ? 17  GLU A CB  1 
ATOM   118  N N   . ARG A 1 18  ? 123.789 147.845 0.052   1.00 49.73 ? 18  ARG A N   1 
ATOM   119  C CA  . ARG A 1 18  ? 124.670 147.768 -1.113  1.00 48.31 ? 18  ARG A CA  1 
ATOM   120  C C   . ARG A 1 18  ? 126.071 147.445 -0.598  1.00 46.75 ? 18  ARG A C   1 
ATOM   121  O O   . ARG A 1 18  ? 126.525 148.025 0.388   1.00 47.67 ? 18  ARG A O   1 
ATOM   122  C CB  . ARG A 1 18  ? 124.666 149.109 -1.861  1.00 49.74 ? 18  ARG A CB  1 
ATOM   123  C CG  . ARG A 1 18  ? 125.460 149.131 -3.169  1.00 50.32 ? 18  ARG A CG  1 
ATOM   124  C CD  . ARG A 1 18  ? 125.383 150.515 -3.814  1.00 51.49 ? 18  ARG A CD  1 
ATOM   125  N NE  . ARG A 1 18  ? 126.332 150.715 -4.915  1.00 51.23 ? 18  ARG A NE  1 
ATOM   126  C CZ  . ARG A 1 18  ? 126.182 150.241 -6.149  1.00 50.73 ? 18  ARG A CZ  1 
ATOM   127  N NH1 . ARG A 1 18  ? 125.114 149.522 -6.470  1.00 50.95 ? 18  ARG A NH1 1 
ATOM   128  N NH2 . ARG A 1 18  ? 127.098 150.502 -7.075  1.00 50.50 ? 18  ARG A NH2 1 
ATOM   129  N N   . VAL A 1 19  ? 126.750 146.510 -1.252  1.00 42.86 ? 19  VAL A N   1 
ATOM   130  C CA  . VAL A 1 19  ? 128.088 146.113 -0.825  1.00 39.43 ? 19  VAL A CA  1 
ATOM   131  C C   . VAL A 1 19  ? 129.068 146.231 -1.992  1.00 36.38 ? 19  VAL A C   1 
ATOM   132  O O   . VAL A 1 19  ? 128.682 146.054 -3.149  1.00 36.34 ? 19  VAL A O   1 
ATOM   133  C CB  . VAL A 1 19  ? 128.075 144.652 -0.271  1.00 38.73 ? 19  VAL A CB  1 
ATOM   134  C CG1 . VAL A 1 19  ? 127.849 143.658 -1.398  1.00 38.38 ? 19  VAL A CG1 1 
ATOM   135  C CG2 . VAL A 1 19  ? 129.368 144.352 0.467   1.00 39.99 ? 19  VAL A CG2 1 
ATOM   136  N N   . SER A 1 20  ? 130.326 146.539 -1.682  1.00 34.52 ? 20  SER A N   1 
ATOM   137  C CA  . SER A 1 20  ? 131.369 146.698 -2.700  1.00 33.89 ? 20  SER A CA  1 
ATOM   138  C C   . SER A 1 20  ? 132.664 145.956 -2.368  1.00 31.38 ? 20  SER A C   1 
ATOM   139  O O   . SER A 1 20  ? 133.212 146.108 -1.282  1.00 31.52 ? 20  SER A O   1 
ATOM   140  C CB  . SER A 1 20  ? 131.684 148.182 -2.899  1.00 33.43 ? 20  SER A CB  1 
ATOM   141  O OG  . SER A 1 20  ? 130.590 148.860 -3.498  1.00 39.74 ? 20  SER A OG  1 
ATOM   142  N N   . PHE A 1 21  ? 133.150 145.164 -3.319  1.00 30.42 ? 21  PHE A N   1 
ATOM   143  C CA  . PHE A 1 21  ? 134.387 144.402 -3.150  1.00 28.83 ? 21  PHE A CA  1 
ATOM   144  C C   . PHE A 1 21  ? 135.515 145.115 -3.889  1.00 28.77 ? 21  PHE A C   1 
ATOM   145  O O   . PHE A 1 21  ? 135.335 145.567 -5.028  1.00 28.39 ? 21  PHE A O   1 
ATOM   146  C CB  . PHE A 1 21  ? 134.233 142.989 -3.724  1.00 27.75 ? 21  PHE A CB  1 
ATOM   147  C CG  . PHE A 1 21  ? 133.062 142.233 -3.176  1.00 28.56 ? 21  PHE A CG  1 
ATOM   148  C CD1 . PHE A 1 21  ? 131.796 142.390 -3.722  1.00 28.63 ? 21  PHE A CD1 1 
ATOM   149  C CD2 . PHE A 1 21  ? 133.225 141.352 -2.107  1.00 31.91 ? 21  PHE A CD2 1 
ATOM   150  C CE1 . PHE A 1 21  ? 130.701 141.679 -3.215  1.00 28.68 ? 21  PHE A CE1 1 
ATOM   151  C CE2 . PHE A 1 21  ? 132.137 140.638 -1.593  1.00 28.37 ? 21  PHE A CE2 1 
ATOM   152  C CZ  . PHE A 1 21  ? 130.875 140.806 -2.152  1.00 28.55 ? 21  PHE A CZ  1 
ATOM   153  N N   . SER A 1 22  ? 136.677 145.208 -3.251  1.00 26.85 ? 22  SER A N   1 
ATOM   154  C CA  . SER A 1 22  ? 137.821 145.873 -3.864  1.00 28.32 ? 22  SER A CA  1 
ATOM   155  C C   . SER A 1 22  ? 138.836 144.924 -4.458  1.00 26.79 ? 22  SER A C   1 
ATOM   156  O O   . SER A 1 22  ? 139.126 143.870 -3.894  1.00 25.14 ? 22  SER A O   1 
ATOM   157  C CB  . SER A 1 22  ? 138.552 146.746 -2.845  1.00 29.56 ? 22  SER A CB  1 
ATOM   158  O OG  . SER A 1 22  ? 137.636 147.612 -2.205  1.00 40.31 ? 22  SER A OG  1 
ATOM   159  N N   . CYS A 1 23  ? 139.388 145.335 -5.592  1.00 25.47 ? 23  CYS A N   1 
ATOM   160  C CA  . CYS A 1 23  ? 140.421 144.586 -6.284  1.00 26.33 ? 23  CYS A CA  1 
ATOM   161  C C   . CYS A 1 23  ? 141.443 145.604 -6.799  1.00 25.87 ? 23  CYS A C   1 
ATOM   162  O O   . CYS A 1 23  ? 141.120 146.452 -7.629  1.00 26.69 ? 23  CYS A O   1 
ATOM   163  C CB  . CYS A 1 23  ? 139.844 143.800 -7.460  1.00 25.43 ? 23  CYS A CB  1 
ATOM   164  S SG  . CYS A 1 23  ? 141.142 143.012 -8.447  1.00 34.27 ? 23  CYS A SG  1 
ATOM   165  N N   . ARG A 1 24  ? 142.670 145.523 -6.300  1.00 26.20 ? 24  ARG A N   1 
ATOM   166  C CA  . ARG A 1 24  ? 143.718 146.451 -6.710  1.00 25.05 ? 24  ARG A CA  1 
ATOM   167  C C   . ARG A 1 24  ? 144.855 145.716 -7.419  1.00 24.59 ? 24  ARG A C   1 
ATOM   168  O O   . ARG A 1 24  ? 145.439 144.797 -6.858  1.00 24.48 ? 24  ARG A O   1 
ATOM   169  C CB  . ARG A 1 24  ? 144.253 147.193 -5.493  1.00 24.40 ? 24  ARG A CB  1 
ATOM   170  N N   . ALA A 1 25  ? 145.160 146.125 -8.648  1.00 22.17 ? 25  ALA A N   1 
ATOM   171  C CA  . ALA A 1 25  ? 146.237 145.505 -9.421  1.00 23.75 ? 25  ALA A CA  1 
ATOM   172  C C   . ALA A 1 25  ? 147.588 146.203 -9.161  1.00 24.10 ? 25  ALA A C   1 
ATOM   173  O O   . ALA A 1 25  ? 147.640 147.422 -9.023  1.00 21.92 ? 25  ALA A O   1 
ATOM   174  C CB  . ALA A 1 25  ? 145.897 145.560 -10.904 1.00 20.49 ? 25  ALA A CB  1 
ATOM   175  N N   . SER A 1 26  ? 148.668 145.423 -9.113  1.00 23.00 ? 26  SER A N   1 
ATOM   176  C CA  . SER A 1 26  ? 150.004 145.948 -8.861  1.00 24.87 ? 26  SER A CA  1 
ATOM   177  C C   . SER A 1 26  ? 150.508 146.894 -9.958  1.00 26.78 ? 26  SER A C   1 
ATOM   178  O O   . SER A 1 26  ? 151.506 147.584 -9.781  1.00 26.96 ? 26  SER A O   1 
ATOM   179  C CB  . SER A 1 26  ? 150.995 144.793 -8.652  1.00 24.80 ? 26  SER A CB  1 
ATOM   180  O OG  . SER A 1 26  ? 150.949 143.863 -9.721  1.00 23.21 ? 26  SER A OG  1 
ATOM   181  N N   . GLN A 1 27  ? 149.826 146.907 -11.098 1.00 29.79 ? 27  GLN A N   1 
ATOM   182  C CA  . GLN A 1 27  ? 150.164 147.810 -12.196 1.00 30.89 ? 27  GLN A CA  1 
ATOM   183  C C   . GLN A 1 27  ? 148.906 147.999 -13.023 1.00 30.95 ? 27  GLN A C   1 
ATOM   184  O O   . GLN A 1 27  ? 147.957 147.219 -12.895 1.00 30.26 ? 27  GLN A O   1 
ATOM   185  C CB  . GLN A 1 27  ? 151.308 147.259 -13.058 1.00 34.55 ? 27  GLN A CB  1 
ATOM   186  C CG  . GLN A 1 27  ? 151.098 145.881 -13.624 1.00 38.94 ? 27  GLN A CG  1 
ATOM   187  C CD  . GLN A 1 27  ? 152.331 145.372 -14.365 1.00 42.65 ? 27  GLN A CD  1 
ATOM   188  O OE1 . GLN A 1 27  ? 152.563 145.718 -15.527 1.00 43.79 ? 27  GLN A OE1 1 
ATOM   189  N NE2 . GLN A 1 27  ? 153.137 144.561 -13.684 1.00 42.91 ? 27  GLN A NE2 1 
ATOM   190  N N   . SER A 1 28  ? 148.893 149.030 -13.860 1.00 29.25 ? 28  SER A N   1 
ATOM   191  C CA  . SER A 1 28  ? 147.729 149.336 -14.686 1.00 31.26 ? 28  SER A CA  1 
ATOM   192  C C   . SER A 1 28  ? 147.379 148.230 -15.678 1.00 28.71 ? 28  SER A C   1 
ATOM   193  O O   . SER A 1 28  ? 148.227 147.762 -16.427 1.00 27.96 ? 28  SER A O   1 
ATOM   194  C CB  . SER A 1 28  ? 147.943 150.662 -15.427 1.00 32.94 ? 28  SER A CB  1 
ATOM   195  O OG  . SER A 1 28  ? 146.811 150.984 -16.222 1.00 44.28 ? 28  SER A OG  1 
ATOM   196  N N   . ILE A 1 29  ? 146.110 147.829 -15.684 1.00 27.95 ? 29  ILE A N   1 
ATOM   197  C CA  . ILE A 1 29  ? 145.640 146.759 -16.567 1.00 26.05 ? 29  ILE A CA  1 
ATOM   198  C C   . ILE A 1 29  ? 144.365 147.125 -17.337 1.00 25.44 ? 29  ILE A C   1 
ATOM   199  O O   . ILE A 1 29  ? 143.563 146.247 -17.690 1.00 24.60 ? 29  ILE A O   1 
ATOM   200  C CB  . ILE A 1 29  ? 145.368 145.475 -15.756 1.00 26.31 ? 29  ILE A CB  1 
ATOM   201  C CG1 . ILE A 1 29  ? 144.434 145.797 -14.584 1.00 24.74 ? 29  ILE A CG1 1 
ATOM   202  C CG2 . ILE A 1 29  ? 146.683 144.908 -15.216 1.00 25.27 ? 29  ILE A CG2 1 
ATOM   203  C CD1 . ILE A 1 29  ? 143.758 144.589 -13.984 1.00 22.67 ? 29  ILE A CD1 1 
ATOM   204  N N   . GLY A 1 30  ? 144.185 148.417 -17.603 1.00 25.25 ? 30  GLY A N   1 
ATOM   205  C CA  . GLY A 1 30  ? 142.999 148.875 -18.315 1.00 23.24 ? 30  GLY A CA  1 
ATOM   206  C C   . GLY A 1 30  ? 141.730 148.368 -17.649 1.00 22.71 ? 30  GLY A C   1 
ATOM   207  O O   . GLY A 1 30  ? 141.496 148.637 -16.468 1.00 23.25 ? 30  GLY A O   1 
ATOM   208  N N   . THR A 1 31  ? 140.912 147.628 -18.394 1.00 21.61 ? 31  THR A N   1 
ATOM   209  C CA  . THR A 1 31  ? 139.667 147.083 -17.854 1.00 21.28 ? 31  THR A CA  1 
ATOM   210  C C   . THR A 1 31  ? 139.641 145.563 -17.948 1.00 22.48 ? 31  THR A C   1 
ATOM   211  O O   . THR A 1 31  ? 138.572 144.952 -17.921 1.00 21.36 ? 31  THR A O   1 
ATOM   212  C CB  . THR A 1 31  ? 138.440 147.637 -18.627 1.00 26.51 ? 31  THR A CB  1 
ATOM   213  O OG1 . THR A 1 31  ? 138.732 147.640 -20.030 1.00 25.64 ? 31  THR A OG1 1 
ATOM   214  C CG2 . THR A 1 31  ? 138.091 149.058 -18.161 1.00 22.29 ? 31  THR A CG2 1 
ATOM   215  N N   . ASP A 1 32  ? 140.822 144.960 -18.045 1.00 22.88 ? 32  ASP A N   1 
ATOM   216  C CA  . ASP A 1 32  ? 140.954 143.518 -18.177 1.00 23.14 ? 32  ASP A CA  1 
ATOM   217  C C   . ASP A 1 32  ? 140.836 142.787 -16.844 1.00 24.20 ? 32  ASP A C   1 
ATOM   218  O O   . ASP A 1 32  ? 141.714 142.006 -16.457 1.00 21.72 ? 32  ASP A O   1 
ATOM   219  C CB  . ASP A 1 32  ? 142.291 143.191 -18.841 1.00 22.72 ? 32  ASP A CB  1 
ATOM   220  C CG  . ASP A 1 32  ? 142.430 143.828 -20.219 1.00 27.42 ? 32  ASP A CG  1 
ATOM   221  O OD1 . ASP A 1 32  ? 143.567 144.110 -20.642 1.00 28.26 ? 32  ASP A OD1 1 
ATOM   222  O OD2 . ASP A 1 32  ? 141.404 144.029 -20.894 1.00 28.97 ? 32  ASP A OD2 1 
ATOM   223  N N   . ILE A 1 33  ? 139.752 143.057 -16.127 1.00 24.21 ? 33  ILE A N   1 
ATOM   224  C CA  . ILE A 1 33  ? 139.537 142.391 -14.856 1.00 26.01 ? 33  ILE A CA  1 
ATOM   225  C C   . ILE A 1 33  ? 138.190 141.686 -14.973 1.00 25.12 ? 33  ILE A C   1 
ATOM   226  O O   . ILE A 1 33  ? 137.267 142.200 -15.602 1.00 21.53 ? 33  ILE A O   1 
ATOM   227  C CB  . ILE A 1 33  ? 139.535 143.396 -13.673 1.00 27.14 ? 33  ILE A CB  1 
ATOM   228  C CG1 . ILE A 1 33  ? 139.939 142.682 -12.377 1.00 31.94 ? 33  ILE A CG1 1 
ATOM   229  C CG2 . ILE A 1 33  ? 138.148 143.983 -13.471 1.00 31.62 ? 33  ILE A CG2 1 
ATOM   230  C CD1 . ILE A 1 33  ? 141.434 142.385 -12.255 1.00 26.81 ? 33  ILE A CD1 1 
ATOM   231  N N   . HIS A 1 34  ? 138.097 140.492 -14.400 1.00 25.21 ? 34  HIS A N   1 
ATOM   232  C CA  . HIS A 1 34  ? 136.869 139.708 -14.445 1.00 25.02 ? 34  HIS A CA  1 
ATOM   233  C C   . HIS A 1 34  ? 136.554 139.244 -13.022 1.00 26.66 ? 34  HIS A C   1 
ATOM   234  O O   . HIS A 1 34  ? 137.472 138.995 -12.232 1.00 24.45 ? 34  HIS A O   1 
ATOM   235  C CB  . HIS A 1 34  ? 137.078 138.506 -15.368 1.00 24.71 ? 34  HIS A CB  1 
ATOM   236  C CG  . HIS A 1 34  ? 137.720 138.863 -16.676 1.00 25.11 ? 34  HIS A CG  1 
ATOM   237  N ND1 . HIS A 1 34  ? 137.107 139.669 -17.613 1.00 22.58 ? 34  HIS A ND1 1 
ATOM   238  C CD2 . HIS A 1 34  ? 138.933 138.545 -17.190 1.00 23.11 ? 34  HIS A CD2 1 
ATOM   239  C CE1 . HIS A 1 34  ? 137.912 139.832 -18.646 1.00 22.31 ? 34  HIS A CE1 1 
ATOM   240  N NE2 . HIS A 1 34  ? 139.027 139.160 -18.416 1.00 23.44 ? 34  HIS A NE2 1 
ATOM   241  N N   . TRP A 1 35  ? 135.265 139.128 -12.701 1.00 25.24 ? 35  TRP A N   1 
ATOM   242  C CA  . TRP A 1 35  ? 134.837 138.716 -11.362 1.00 25.09 ? 35  TRP A CA  1 
ATOM   243  C C   . TRP A 1 35  ? 134.089 137.380 -11.336 1.00 26.95 ? 35  TRP A C   1 
ATOM   244  O O   . TRP A 1 35  ? 133.212 137.130 -12.179 1.00 26.31 ? 35  TRP A O   1 
ATOM   245  C CB  . TRP A 1 35  ? 133.934 139.790 -10.746 1.00 25.62 ? 35  TRP A CB  1 
ATOM   246  C CG  . TRP A 1 35  ? 134.625 141.076 -10.412 1.00 25.42 ? 35  TRP A CG  1 
ATOM   247  C CD1 . TRP A 1 35  ? 134.798 142.163 -11.229 1.00 25.90 ? 35  TRP A CD1 1 
ATOM   248  C CD2 . TRP A 1 35  ? 135.212 141.421 -9.154  1.00 24.92 ? 35  TRP A CD2 1 
ATOM   249  N NE1 . TRP A 1 35  ? 135.455 143.169 -10.548 1.00 24.85 ? 35  TRP A NE1 1 
ATOM   250  C CE2 . TRP A 1 35  ? 135.720 142.740 -9.273  1.00 27.16 ? 35  TRP A CE2 1 
ATOM   251  C CE3 . TRP A 1 35  ? 135.357 140.746 -7.933  1.00 25.43 ? 35  TRP A CE3 1 
ATOM   252  C CZ2 . TRP A 1 35  ? 136.363 143.398 -8.211  1.00 25.51 ? 35  TRP A CZ2 1 
ATOM   253  C CZ3 . TRP A 1 35  ? 135.996 141.401 -6.877  1.00 26.36 ? 35  TRP A CZ3 1 
ATOM   254  C CH2 . TRP A 1 35  ? 136.489 142.714 -7.025  1.00 27.44 ? 35  TRP A CH2 1 
ATOM   255  N N   . TYR A 1 36  ? 134.431 136.536 -10.360 1.00 25.99 ? 36  TYR A N   1 
ATOM   256  C CA  . TYR A 1 36  ? 133.794 135.233 -10.200 1.00 25.62 ? 36  TYR A CA  1 
ATOM   257  C C   . TYR A 1 36  ? 133.188 135.046 -8.817  1.00 26.55 ? 36  TYR A C   1 
ATOM   258  O O   . TYR A 1 36  ? 133.705 135.553 -7.817  1.00 25.04 ? 36  TYR A O   1 
ATOM   259  C CB  . TYR A 1 36  ? 134.797 134.096 -10.424 1.00 25.18 ? 36  TYR A CB  1 
ATOM   260  C CG  . TYR A 1 36  ? 135.490 134.148 -11.761 1.00 25.03 ? 36  TYR A CG  1 
ATOM   261  C CD1 . TYR A 1 36  ? 136.615 134.958 -11.955 1.00 24.54 ? 36  TYR A CD1 1 
ATOM   262  C CD2 . TYR A 1 36  ? 134.985 133.446 -12.854 1.00 21.13 ? 36  TYR A CD2 1 
ATOM   263  C CE1 . TYR A 1 36  ? 137.214 135.070 -13.209 1.00 21.12 ? 36  TYR A CE1 1 
ATOM   264  C CE2 . TYR A 1 36  ? 135.576 133.556 -14.114 1.00 21.45 ? 36  TYR A CE2 1 
ATOM   265  C CZ  . TYR A 1 36  ? 136.685 134.372 -14.280 1.00 21.83 ? 36  TYR A CZ  1 
ATOM   266  O OH  . TYR A 1 36  ? 137.242 134.512 -15.523 1.00 23.07 ? 36  TYR A OH  1 
ATOM   267  N N   . GLN A 1 37  ? 132.095 134.292 -8.772  1.00 27.00 ? 37  GLN A N   1 
ATOM   268  C CA  . GLN A 1 37  ? 131.425 133.985 -7.520  1.00 28.43 ? 37  GLN A CA  1 
ATOM   269  C C   . GLN A 1 37  ? 131.580 132.502 -7.227  1.00 28.60 ? 37  GLN A C   1 
ATOM   270  O O   . GLN A 1 37  ? 131.301 131.664 -8.085  1.00 27.89 ? 37  GLN A O   1 
ATOM   271  C CB  . GLN A 1 37  ? 129.936 134.301 -7.602  1.00 28.98 ? 37  GLN A CB  1 
ATOM   272  C CG  . GLN A 1 37  ? 129.175 133.898 -6.351  1.00 28.66 ? 37  GLN A CG  1 
ATOM   273  C CD  . GLN A 1 37  ? 127.671 133.875 -6.559  1.00 30.12 ? 37  GLN A CD  1 
ATOM   274  O OE1 . GLN A 1 37  ? 127.139 132.988 -7.230  1.00 31.81 ? 37  GLN A OE1 1 
ATOM   275  N NE2 . GLN A 1 37  ? 126.979 134.858 -5.988  1.00 28.39 ? 37  GLN A NE2 1 
ATOM   276  N N   . GLN A 1 38  ? 132.031 132.171 -6.022  1.00 27.30 ? 38  GLN A N   1 
ATOM   277  C CA  . GLN A 1 38  ? 132.160 130.771 -5.664  1.00 28.29 ? 38  GLN A CA  1 
ATOM   278  C C   . GLN A 1 38  ? 131.473 130.494 -4.340  1.00 30.10 ? 38  GLN A C   1 
ATOM   279  O O   . GLN A 1 38  ? 131.912 130.954 -3.283  1.00 28.94 ? 38  GLN A O   1 
ATOM   280  C CB  . GLN A 1 38  ? 133.619 130.329 -5.571  1.00 25.61 ? 38  GLN A CB  1 
ATOM   281  C CG  . GLN A 1 38  ? 133.742 128.847 -5.200  1.00 26.12 ? 38  GLN A CG  1 
ATOM   282  C CD  . GLN A 1 38  ? 135.156 128.331 -5.227  1.00 26.28 ? 38  GLN A CD  1 
ATOM   283  O OE1 . GLN A 1 38  ? 136.085 128.983 -4.731  1.00 29.37 ? 38  GLN A OE1 1 
ATOM   284  N NE2 . GLN A 1 38  ? 135.337 127.145 -5.796  1.00 24.46 ? 38  GLN A NE2 1 
ATOM   285  N N   . ARG A 1 39  ? 130.375 129.751 -4.412  1.00 31.53 ? 39  ARG A N   1 
ATOM   286  C CA  . ARG A 1 39  ? 129.631 129.389 -3.217  1.00 33.21 ? 39  ARG A CA  1 
ATOM   287  C C   . ARG A 1 39  ? 130.278 128.161 -2.596  1.00 33.45 ? 39  ARG A C   1 
ATOM   288  O O   . ARG A 1 39  ? 131.064 127.466 -3.245  1.00 31.79 ? 39  ARG A O   1 
ATOM   289  C CB  . ARG A 1 39  ? 128.176 129.083 -3.567  1.00 33.58 ? 39  ARG A CB  1 
ATOM   290  C CG  . ARG A 1 39  ? 127.375 130.297 -3.986  1.00 34.60 ? 39  ARG A CG  1 
ATOM   291  C CD  . ARG A 1 39  ? 125.904 129.948 -4.138  1.00 36.06 ? 39  ARG A CD  1 
ATOM   292  N NE  . ARG A 1 39  ? 125.081 131.128 -4.389  1.00 36.21 ? 39  ARG A NE  1 
ATOM   293  C CZ  . ARG A 1 39  ? 124.551 131.430 -5.568  1.00 36.52 ? 39  ARG A CZ  1 
ATOM   294  N NH1 . ARG A 1 39  ? 124.757 130.637 -6.608  1.00 38.60 ? 39  ARG A NH1 1 
ATOM   295  N NH2 . ARG A 1 39  ? 123.816 132.526 -5.709  1.00 37.23 ? 39  ARG A NH2 1 
ATOM   296  N N   . THR A 1 40  ? 129.953 127.903 -1.335  1.00 36.32 ? 40  THR A N   1 
ATOM   297  C CA  . THR A 1 40  ? 130.487 126.746 -0.618  1.00 38.06 ? 40  THR A CA  1 
ATOM   298  C C   . THR A 1 40  ? 130.358 125.489 -1.472  1.00 37.68 ? 40  THR A C   1 
ATOM   299  O O   . THR A 1 40  ? 129.270 125.182 -1.960  1.00 35.57 ? 40  THR A O   1 
ATOM   300  C CB  . THR A 1 40  ? 129.706 126.494 0.699   1.00 40.78 ? 40  THR A CB  1 
ATOM   301  O OG1 . THR A 1 40  ? 129.702 127.687 1.492   1.00 41.10 ? 40  THR A OG1 1 
ATOM   302  C CG2 . THR A 1 40  ? 130.348 125.356 1.491   1.00 40.58 ? 40  THR A CG2 1 
ATOM   303  N N   . ASN A 1 41  ? 131.468 124.777 -1.653  1.00 38.44 ? 41  ASN A N   1 
ATOM   304  C CA  . ASN A 1 41  ? 131.485 123.533 -2.425  1.00 41.63 ? 41  ASN A CA  1 
ATOM   305  C C   . ASN A 1 41  ? 131.020 123.645 -3.874  1.00 40.53 ? 41  ASN A C   1 
ATOM   306  O O   . ASN A 1 41  ? 130.674 122.644 -4.501  1.00 40.48 ? 41  ASN A O   1 
ATOM   307  C CB  . ASN A 1 41  ? 130.641 122.469 -1.717  1.00 44.83 ? 41  ASN A CB  1 
ATOM   308  C CG  . ASN A 1 41  ? 131.190 122.108 -0.353  1.00 48.74 ? 41  ASN A CG  1 
ATOM   309  O OD1 . ASN A 1 41  ? 132.357 121.721 -0.220  1.00 48.82 ? 41  ASN A OD1 1 
ATOM   310  N ND2 . ASN A 1 41  ? 130.353 122.232 0.674   1.00 50.20 ? 41  ASN A ND2 1 
ATOM   311  N N   . GLY A 1 42  ? 131.000 124.858 -4.404  1.00 39.36 ? 42  GLY A N   1 
ATOM   312  C CA  . GLY A 1 42  ? 130.588 125.036 -5.782  1.00 36.68 ? 42  GLY A CA  1 
ATOM   313  C C   . GLY A 1 42  ? 131.790 125.435 -6.606  1.00 34.10 ? 42  GLY A C   1 
ATOM   314  O O   . GLY A 1 42  ? 132.854 125.723 -6.061  1.00 33.30 ? 42  GLY A O   1 
ATOM   315  N N   . SER A 1 43  ? 131.646 125.441 -7.923  1.00 33.09 ? 43  SER A N   1 
ATOM   316  C CA  . SER A 1 43  ? 132.760 125.847 -8.761  1.00 32.79 ? 43  SER A CA  1 
ATOM   317  C C   . SER A 1 43  ? 132.612 127.340 -9.037  1.00 30.57 ? 43  SER A C   1 
ATOM   318  O O   . SER A 1 43  ? 131.517 127.894 -8.913  1.00 27.17 ? 43  SER A O   1 
ATOM   319  C CB  . SER A 1 43  ? 132.757 125.046 -10.060 1.00 35.14 ? 43  SER A CB  1 
ATOM   320  O OG  . SER A 1 43  ? 131.496 125.132 -10.690 1.00 41.59 ? 43  SER A OG  1 
ATOM   321  N N   . PRO A 1 44  ? 133.715 128.019 -9.399  1.00 29.63 ? 44  PRO A N   1 
ATOM   322  C CA  . PRO A 1 44  ? 133.646 129.456 -9.679  1.00 28.52 ? 44  PRO A CA  1 
ATOM   323  C C   . PRO A 1 44  ? 132.637 129.766 -10.786 1.00 28.95 ? 44  PRO A C   1 
ATOM   324  O O   . PRO A 1 44  ? 132.429 128.959 -11.697 1.00 27.06 ? 44  PRO A O   1 
ATOM   325  C CB  . PRO A 1 44  ? 135.083 129.799 -10.086 1.00 28.95 ? 44  PRO A CB  1 
ATOM   326  C CG  . PRO A 1 44  ? 135.901 128.788 -9.317  1.00 29.09 ? 44  PRO A CG  1 
ATOM   327  C CD  . PRO A 1 44  ? 135.097 127.523 -9.519  1.00 30.17 ? 44  PRO A CD  1 
ATOM   328  N N   . ARG A 1 45  ? 132.014 130.938 -10.709 1.00 28.47 ? 45  ARG A N   1 
ATOM   329  C CA  . ARG A 1 45  ? 131.024 131.334 -11.705 1.00 30.05 ? 45  ARG A CA  1 
ATOM   330  C C   . ARG A 1 45  ? 131.225 132.782 -12.137 1.00 28.22 ? 45  ARG A C   1 
ATOM   331  O O   . ARG A 1 45  ? 131.228 133.682 -11.301 1.00 26.97 ? 45  ARG A O   1 
ATOM   332  C CB  . ARG A 1 45  ? 129.615 131.163 -11.130 1.00 34.18 ? 45  ARG A CB  1 
ATOM   333  C CG  . ARG A 1 45  ? 128.503 131.526 -12.091 1.00 41.87 ? 45  ARG A CG  1 
ATOM   334  C CD  . ARG A 1 45  ? 127.139 131.496 -11.404 1.00 49.92 ? 45  ARG A CD  1 
ATOM   335  N NE  . ARG A 1 45  ? 126.060 131.830 -12.335 1.00 55.64 ? 45  ARG A NE  1 
ATOM   336  C CZ  . ARG A 1 45  ? 125.698 131.073 -13.368 1.00 56.53 ? 45  ARG A CZ  1 
ATOM   337  N NH1 . ARG A 1 45  ? 126.326 129.927 -13.607 1.00 57.89 ? 45  ARG A NH1 1 
ATOM   338  N NH2 . ARG A 1 45  ? 124.717 131.469 -14.173 1.00 56.30 ? 45  ARG A NH2 1 
ATOM   339  N N   . LEU A 1 46  ? 131.369 132.999 -13.442 1.00 26.56 ? 46  LEU A N   1 
ATOM   340  C CA  . LEU A 1 46  ? 131.570 134.336 -13.998 1.00 26.66 ? 46  LEU A CA  1 
ATOM   341  C C   . LEU A 1 46  ? 130.410 135.298 -13.724 1.00 26.80 ? 46  LEU A C   1 
ATOM   342  O O   . LEU A 1 46  ? 129.259 135.017 -14.062 1.00 26.45 ? 46  LEU A O   1 
ATOM   343  C CB  . LEU A 1 46  ? 131.802 134.242 -15.509 1.00 28.59 ? 46  LEU A CB  1 
ATOM   344  C CG  . LEU A 1 46  ? 132.085 135.568 -16.225 1.00 28.56 ? 46  LEU A CG  1 
ATOM   345  C CD1 . LEU A 1 46  ? 133.381 136.161 -15.689 1.00 27.27 ? 46  LEU A CD1 1 
ATOM   346  C CD2 . LEU A 1 46  ? 132.190 135.333 -17.741 1.00 27.62 ? 46  LEU A CD2 1 
ATOM   347  N N   . LEU A 1 47  ? 130.727 136.444 -13.134 1.00 26.32 ? 47  LEU A N   1 
ATOM   348  C CA  . LEU A 1 47  ? 129.735 137.458 -12.792 1.00 27.81 ? 47  LEU A CA  1 
ATOM   349  C C   . LEU A 1 47  ? 129.805 138.706 -13.655 1.00 29.45 ? 47  LEU A C   1 
ATOM   350  O O   . LEU A 1 47  ? 128.778 139.238 -14.086 1.00 29.59 ? 47  LEU A O   1 
ATOM   351  C CB  . LEU A 1 47  ? 129.919 137.902 -11.343 1.00 29.49 ? 47  LEU A CB  1 
ATOM   352  C CG  . LEU A 1 47  ? 129.707 136.904 -10.217 1.00 32.00 ? 47  LEU A CG  1 
ATOM   353  C CD1 . LEU A 1 47  ? 130.176 137.533 -8.909  1.00 33.55 ? 47  LEU A CD1 1 
ATOM   354  C CD2 . LEU A 1 47  ? 128.238 136.533 -10.141 1.00 32.98 ? 47  LEU A CD2 1 
ATOM   355  N N   . ILE A 1 48  ? 131.026 139.190 -13.855 1.00 29.51 ? 48  ILE A N   1 
ATOM   356  C CA  . ILE A 1 48  ? 131.283 140.398 -14.635 1.00 27.90 ? 48  ILE A CA  1 
ATOM   357  C C   . ILE A 1 48  ? 132.547 140.175 -15.456 1.00 27.32 ? 48  ILE A C   1 
ATOM   358  O O   . ILE A 1 48  ? 133.518 139.606 -14.956 1.00 26.36 ? 48  ILE A O   1 
ATOM   359  C CB  . ILE A 1 48  ? 131.558 141.619 -13.714 1.00 28.34 ? 48  ILE A CB  1 
ATOM   360  C CG1 . ILE A 1 48  ? 130.372 141.872 -12.781 1.00 27.23 ? 48  ILE A CG1 1 
ATOM   361  C CG2 . ILE A 1 48  ? 131.846 142.861 -14.563 1.00 27.82 ? 48  ILE A CG2 1 
ATOM   362  C CD1 . ILE A 1 48  ? 129.108 142.306 -13.497 1.00 31.75 ? 48  ILE A CD1 1 
ATOM   363  N N   . LYS A 1 49  ? 132.546 140.610 -16.709 1.00 25.71 ? 49  LYS A N   1 
ATOM   364  C CA  . LYS A 1 49  ? 133.749 140.461 -17.522 1.00 27.22 ? 49  LYS A CA  1 
ATOM   365  C C   . LYS A 1 49  ? 134.223 141.847 -17.938 1.00 25.62 ? 49  LYS A C   1 
ATOM   366  O O   . LYS A 1 49  ? 133.424 142.785 -18.053 1.00 23.60 ? 49  LYS A O   1 
ATOM   367  C CB  . LYS A 1 49  ? 133.492 139.579 -18.752 1.00 27.43 ? 49  LYS A CB  1 
ATOM   368  C CG  . LYS A 1 49  ? 132.515 140.157 -19.754 1.00 29.67 ? 49  LYS A CG  1 
ATOM   369  C CD  . LYS A 1 49  ? 132.241 139.160 -20.867 1.00 33.67 ? 49  LYS A CD  1 
ATOM   370  C CE  . LYS A 1 49  ? 131.267 139.730 -21.897 1.00 35.95 ? 49  LYS A CE  1 
ATOM   371  N NZ  . LYS A 1 49  ? 130.963 138.745 -22.979 1.00 37.13 ? 49  LYS A NZ  1 
ATOM   372  N N   . TYR A 1 50  ? 135.526 141.977 -18.153 1.00 25.20 ? 50  TYR A N   1 
ATOM   373  C CA  . TYR A 1 50  ? 136.100 143.263 -18.522 1.00 25.46 ? 50  TYR A CA  1 
ATOM   374  C C   . TYR A 1 50  ? 135.604 144.418 -17.647 1.00 24.59 ? 50  TYR A C   1 
ATOM   375  O O   . TYR A 1 50  ? 135.125 145.441 -18.143 1.00 24.04 ? 50  TYR A O   1 
ATOM   376  C CB  . TYR A 1 50  ? 135.846 143.552 -20.004 1.00 26.61 ? 50  TYR A CB  1 
ATOM   377  C CG  . TYR A 1 50  ? 136.719 142.696 -20.900 1.00 27.76 ? 50  TYR A CG  1 
ATOM   378  C CD1 . TYR A 1 50  ? 136.226 141.547 -21.515 1.00 29.32 ? 50  TYR A CD1 1 
ATOM   379  C CD2 . TYR A 1 50  ? 138.062 143.008 -21.073 1.00 30.89 ? 50  TYR A CD2 1 
ATOM   380  C CE1 . TYR A 1 50  ? 137.065 140.722 -22.283 1.00 30.21 ? 50  TYR A CE1 1 
ATOM   381  C CE2 . TYR A 1 50  ? 138.899 142.203 -21.826 1.00 33.15 ? 50  TYR A CE2 1 
ATOM   382  C CZ  . TYR A 1 50  ? 138.398 141.062 -22.427 1.00 31.63 ? 50  TYR A CZ  1 
ATOM   383  O OH  . TYR A 1 50  ? 139.260 140.278 -23.153 1.00 33.80 ? 50  TYR A OH  1 
ATOM   384  N N   . ALA A 1 51  ? 135.718 144.212 -16.338 1.00 21.81 ? 51  ALA A N   1 
ATOM   385  C CA  . ALA A 1 51  ? 135.375 145.190 -15.307 1.00 24.87 ? 51  ALA A CA  1 
ATOM   386  C C   . ALA A 1 51  ? 133.937 145.631 -15.119 1.00 25.59 ? 51  ALA A C   1 
ATOM   387  O O   . ALA A 1 51  ? 133.511 145.834 -13.985 1.00 29.13 ? 51  ALA A O   1 
ATOM   388  C CB  . ALA A 1 51  ? 136.264 146.441 -15.461 1.00 21.94 ? 51  ALA A CB  1 
ATOM   389  N N   . SER A 1 52  ? 133.180 145.793 -16.197 1.00 28.47 ? 52  SER A N   1 
ATOM   390  C CA  . SER A 1 52  ? 131.811 146.265 -16.027 1.00 32.13 ? 52  SER A CA  1 
ATOM   391  C C   . SER A 1 52  ? 130.767 145.633 -16.922 1.00 33.10 ? 52  SER A C   1 
ATOM   392  O O   . SER A 1 52  ? 129.588 145.949 -16.789 1.00 34.61 ? 52  SER A O   1 
ATOM   393  C CB  . SER A 1 52  ? 131.758 147.775 -16.241 1.00 31.27 ? 52  SER A CB  1 
ATOM   394  O OG  . SER A 1 52  ? 131.982 148.072 -17.605 1.00 33.38 ? 52  SER A OG  1 
ATOM   395  N N   . GLU A 1 53  ? 131.181 144.759 -17.834 1.00 33.10 ? 53  GLU A N   1 
ATOM   396  C CA  . GLU A 1 53  ? 130.223 144.147 -18.734 1.00 35.03 ? 53  GLU A CA  1 
ATOM   397  C C   . GLU A 1 53  ? 129.470 143.008 -18.071 1.00 36.07 ? 53  GLU A C   1 
ATOM   398  O O   . GLU A 1 53  ? 130.062 142.075 -17.534 1.00 34.10 ? 53  GLU A O   1 
ATOM   399  C CB  . GLU A 1 53  ? 130.922 143.666 -20.004 1.00 36.50 ? 53  GLU A CB  1 
ATOM   400  C CG  . GLU A 1 53  ? 131.829 144.727 -20.605 1.00 41.94 ? 53  GLU A CG  1 
ATOM   401  C CD  . GLU A 1 53  ? 132.276 144.400 -22.014 1.00 45.10 ? 53  GLU A CD  1 
ATOM   402  O OE1 . GLU A 1 53  ? 132.683 143.246 -22.260 1.00 47.23 ? 53  GLU A OE1 1 
ATOM   403  O OE2 . GLU A 1 53  ? 132.226 145.305 -22.876 1.00 48.38 ? 53  GLU A OE2 1 
ATOM   404  N N   . SER A 1 54  ? 128.148 143.102 -18.115 1.00 37.71 ? 54  SER A N   1 
ATOM   405  C CA  . SER A 1 54  ? 127.285 142.106 -17.511 1.00 39.13 ? 54  SER A CA  1 
ATOM   406  C C   . SER A 1 54  ? 127.244 140.818 -18.313 1.00 39.79 ? 54  SER A C   1 
ATOM   407  O O   . SER A 1 54  ? 127.507 140.809 -19.516 1.00 40.70 ? 54  SER A O   1 
ATOM   408  C CB  . SER A 1 54  ? 125.875 142.673 -17.347 1.00 40.27 ? 54  SER A CB  1 
ATOM   409  O OG  . SER A 1 54  ? 125.402 143.220 -18.565 1.00 42.25 ? 54  SER A OG  1 
ATOM   410  N N   . ILE A 1 55  ? 126.937 139.728 -17.614 1.00 39.93 ? 55  ILE A N   1 
ATOM   411  C CA  . ILE A 1 55  ? 126.846 138.398 -18.198 1.00 40.84 ? 55  ILE A CA  1 
ATOM   412  C C   . ILE A 1 55  ? 125.377 137.980 -18.115 1.00 43.22 ? 55  ILE A C   1 
ATOM   413  O O   . ILE A 1 55  ? 124.699 138.283 -17.126 1.00 43.25 ? 55  ILE A O   1 
ATOM   414  C CB  . ILE A 1 55  ? 127.700 137.390 -17.392 1.00 40.17 ? 55  ILE A CB  1 
ATOM   415  C CG1 . ILE A 1 55  ? 129.119 137.938 -17.203 1.00 41.50 ? 55  ILE A CG1 1 
ATOM   416  C CG2 . ILE A 1 55  ? 127.734 136.046 -18.093 1.00 39.00 ? 55  ILE A CG2 1 
ATOM   417  C CD1 . ILE A 1 55  ? 129.849 138.261 -18.496 1.00 39.45 ? 55  ILE A CD1 1 
ATOM   418  N N   . SER A 1 56  ? 124.882 137.289 -19.138 1.00 44.61 ? 56  SER A N   1 
ATOM   419  C CA  . SER A 1 56  ? 123.484 136.858 -19.133 1.00 47.54 ? 56  SER A CA  1 
ATOM   420  C C   . SER A 1 56  ? 123.257 135.741 -18.117 1.00 46.70 ? 56  SER A C   1 
ATOM   421  O O   . SER A 1 56  ? 124.052 134.805 -18.012 1.00 45.89 ? 56  SER A O   1 
ATOM   422  C CB  . SER A 1 56  ? 123.055 136.389 -20.529 1.00 48.32 ? 56  SER A CB  1 
ATOM   423  O OG  . SER A 1 56  ? 123.718 135.191 -20.895 1.00 53.66 ? 56  SER A OG  1 
ATOM   424  N N   . GLY A 1 57  ? 122.164 135.849 -17.370 1.00 47.99 ? 57  GLY A N   1 
ATOM   425  C CA  . GLY A 1 57  ? 121.855 134.848 -16.366 1.00 46.68 ? 57  GLY A CA  1 
ATOM   426  C C   . GLY A 1 57  ? 122.200 135.345 -14.977 1.00 47.47 ? 57  GLY A C   1 
ATOM   427  O O   . GLY A 1 57  ? 121.733 134.795 -13.975 1.00 48.46 ? 57  GLY A O   1 
ATOM   428  N N   . ILE A 1 58  ? 123.019 136.394 -14.918 1.00 45.31 ? 58  ILE A N   1 
ATOM   429  C CA  . ILE A 1 58  ? 123.436 136.986 -13.650 1.00 43.62 ? 58  ILE A CA  1 
ATOM   430  C C   . ILE A 1 58  ? 122.487 138.114 -13.242 1.00 44.35 ? 58  ILE A C   1 
ATOM   431  O O   . ILE A 1 58  ? 122.231 139.028 -14.025 1.00 46.24 ? 58  ILE A O   1 
ATOM   432  C CB  . ILE A 1 58  ? 124.877 137.554 -13.755 1.00 42.56 ? 58  ILE A CB  1 
ATOM   433  C CG1 . ILE A 1 58  ? 125.858 136.422 -14.082 1.00 40.41 ? 58  ILE A CG1 1 
ATOM   434  C CG2 . ILE A 1 58  ? 125.261 138.271 -12.471 1.00 39.35 ? 58  ILE A CG2 1 
ATOM   435  C CD1 . ILE A 1 58  ? 125.781 135.241 -13.132 1.00 40.58 ? 58  ILE A CD1 1 
ATOM   436  N N   . PRO A 1 59  ? 121.955 138.062 -12.006 1.00 43.62 ? 59  PRO A N   1 
ATOM   437  C CA  . PRO A 1 59  ? 121.033 139.091 -11.508 1.00 44.21 ? 59  PRO A CA  1 
ATOM   438  C C   . PRO A 1 59  ? 121.520 140.509 -11.803 1.00 44.56 ? 59  PRO A C   1 
ATOM   439  O O   . PRO A 1 59  ? 122.728 140.779 -11.821 1.00 43.43 ? 59  PRO A O   1 
ATOM   440  C CB  . PRO A 1 59  ? 120.970 138.802 -10.010 1.00 43.75 ? 59  PRO A CB  1 
ATOM   441  C CG  . PRO A 1 59  ? 121.111 137.308 -9.967  1.00 45.11 ? 59  PRO A CG  1 
ATOM   442  C CD  . PRO A 1 59  ? 122.219 137.048 -10.969 1.00 44.12 ? 59  PRO A CD  1 
ATOM   443  N N   . SER A 1 60  ? 120.565 141.408 -12.019 1.00 43.92 ? 60  SER A N   1 
ATOM   444  C CA  . SER A 1 60  ? 120.857 142.798 -12.332 1.00 43.09 ? 60  SER A CA  1 
ATOM   445  C C   . SER A 1 60  ? 121.472 143.583 -11.177 1.00 42.01 ? 60  SER A C   1 
ATOM   446  O O   . SER A 1 60  ? 122.061 144.645 -11.394 1.00 41.92 ? 60  SER A O   1 
ATOM   447  C CB  . SER A 1 60  ? 119.582 143.489 -12.808 1.00 45.80 ? 60  SER A CB  1 
ATOM   448  N N   . ARG A 1 61  ? 121.342 143.078 -9.953  1.00 39.72 ? 61  ARG A N   1 
ATOM   449  C CA  . ARG A 1 61  ? 121.896 143.789 -8.805  1.00 38.80 ? 61  ARG A CA  1 
ATOM   450  C C   . ARG A 1 61  ? 123.423 143.726 -8.774  1.00 37.31 ? 61  ARG A C   1 
ATOM   451  O O   . ARG A 1 61  ? 124.063 144.374 -7.946  1.00 37.78 ? 61  ARG A O   1 
ATOM   452  C CB  . ARG A 1 61  ? 121.320 143.243 -7.491  1.00 39.26 ? 61  ARG A CB  1 
ATOM   453  C CG  . ARG A 1 61  ? 121.641 141.793 -7.197  1.00 42.22 ? 61  ARG A CG  1 
ATOM   454  C CD  . ARG A 1 61  ? 121.188 141.410 -5.785  1.00 44.15 ? 61  ARG A CD  1 
ATOM   455  N NE  . ARG A 1 61  ? 121.408 139.992 -5.514  1.00 43.28 ? 61  ARG A NE  1 
ATOM   456  C CZ  . ARG A 1 61  ? 120.768 139.009 -6.139  1.00 43.77 ? 61  ARG A CZ  1 
ATOM   457  N NH1 . ARG A 1 61  ? 119.860 139.286 -7.067  1.00 45.23 ? 61  ARG A NH1 1 
ATOM   458  N NH2 . ARG A 1 61  ? 121.048 137.747 -5.850  1.00 44.66 ? 61  ARG A NH2 1 
ATOM   459  N N   . PHE A 1 62  ? 123.997 142.941 -9.681  1.00 35.38 ? 62  PHE A N   1 
ATOM   460  C CA  . PHE A 1 62  ? 125.448 142.799 -9.781  1.00 34.65 ? 62  PHE A CA  1 
ATOM   461  C C   . PHE A 1 62  ? 126.006 143.759 -10.838 1.00 33.01 ? 62  PHE A C   1 
ATOM   462  O O   . PHE A 1 62  ? 125.533 143.774 -11.977 1.00 30.88 ? 62  PHE A O   1 
ATOM   463  C CB  . PHE A 1 62  ? 125.816 141.361 -10.181 1.00 33.99 ? 62  PHE A CB  1 
ATOM   464  C CG  . PHE A 1 62  ? 125.780 140.377 -9.046  1.00 34.21 ? 62  PHE A CG  1 
ATOM   465  C CD1 . PHE A 1 62  ? 126.859 140.255 -8.181  1.00 36.11 ? 62  PHE A CD1 1 
ATOM   466  C CD2 . PHE A 1 62  ? 124.671 139.562 -8.849  1.00 36.72 ? 62  PHE A CD2 1 
ATOM   467  C CE1 . PHE A 1 62  ? 126.838 139.334 -7.137  1.00 35.25 ? 62  PHE A CE1 1 
ATOM   468  C CE2 . PHE A 1 62  ? 124.637 138.634 -7.804  1.00 35.84 ? 62  PHE A CE2 1 
ATOM   469  C CZ  . PHE A 1 62  ? 125.723 138.520 -6.948  1.00 36.38 ? 62  PHE A CZ  1 
ATOM   470  N N   . SER A 1 63  ? 127.006 144.553 -10.458 1.00 30.26 ? 63  SER A N   1 
ATOM   471  C CA  . SER A 1 63  ? 127.650 145.477 -11.396 1.00 30.92 ? 63  SER A CA  1 
ATOM   472  C C   . SER A 1 63  ? 129.111 145.660 -11.005 1.00 31.24 ? 63  SER A C   1 
ATOM   473  O O   . SER A 1 63  ? 129.488 145.414 -9.865  1.00 31.86 ? 63  SER A O   1 
ATOM   474  C CB  . SER A 1 63  ? 126.958 146.851 -11.407 1.00 30.97 ? 63  SER A CB  1 
ATOM   475  O OG  . SER A 1 63  ? 127.154 147.548 -10.187 1.00 31.42 ? 63  SER A OG  1 
ATOM   476  N N   . GLY A 1 64  ? 129.931 146.088 -11.960 1.00 30.56 ? 64  GLY A N   1 
ATOM   477  C CA  . GLY A 1 64  ? 131.337 146.301 -11.681 1.00 29.52 ? 64  GLY A CA  1 
ATOM   478  C C   . GLY A 1 64  ? 131.776 147.640 -12.231 1.00 29.04 ? 64  GLY A C   1 
ATOM   479  O O   . GLY A 1 64  ? 131.118 148.200 -13.104 1.00 27.85 ? 64  GLY A O   1 
ATOM   480  N N   . SER A 1 65  ? 132.885 148.162 -11.725 1.00 28.93 ? 65  SER A N   1 
ATOM   481  C CA  . SER A 1 65  ? 133.383 149.444 -12.199 1.00 28.82 ? 65  SER A CA  1 
ATOM   482  C C   . SER A 1 65  ? 134.882 149.565 -11.966 1.00 28.28 ? 65  SER A C   1 
ATOM   483  O O   . SER A 1 65  ? 135.496 148.717 -11.305 1.00 27.88 ? 65  SER A O   1 
ATOM   484  C CB  . SER A 1 65  ? 132.664 150.588 -11.476 1.00 29.59 ? 65  SER A CB  1 
ATOM   485  O OG  . SER A 1 65  ? 133.035 150.632 -10.106 1.00 30.96 ? 65  SER A OG  1 
ATOM   486  N N   . GLY A 1 66  ? 135.459 150.631 -12.512 1.00 26.70 ? 66  GLY A N   1 
ATOM   487  C CA  . GLY A 1 66  ? 136.874 150.884 -12.350 1.00 24.30 ? 66  GLY A CA  1 
ATOM   488  C C   . GLY A 1 66  ? 137.684 150.618 -13.596 1.00 26.70 ? 66  GLY A C   1 
ATOM   489  O O   . GLY A 1 66  ? 137.203 149.997 -14.548 1.00 24.71 ? 66  GLY A O   1 
ATOM   490  N N   . SER A 1 67  ? 138.918 151.118 -13.584 1.00 24.86 ? 67  SER A N   1 
ATOM   491  C CA  . SER A 1 67  ? 139.863 150.946 -14.673 1.00 27.57 ? 67  SER A CA  1 
ATOM   492  C C   . SER A 1 67  ? 141.234 151.325 -14.122 1.00 28.13 ? 67  SER A C   1 
ATOM   493  O O   . SER A 1 67  ? 141.333 152.040 -13.120 1.00 28.41 ? 67  SER A O   1 
ATOM   494  C CB  . SER A 1 67  ? 139.506 151.846 -15.868 1.00 28.16 ? 67  SER A CB  1 
ATOM   495  O OG  . SER A 1 67  ? 139.821 153.205 -15.620 1.00 27.86 ? 67  SER A OG  1 
ATOM   496  N N   . GLY A 1 68  ? 142.285 150.843 -14.769 1.00 27.65 ? 68  GLY A N   1 
ATOM   497  C CA  . GLY A 1 68  ? 143.625 151.153 -14.308 1.00 27.43 ? 68  GLY A CA  1 
ATOM   498  C C   . GLY A 1 68  ? 144.128 150.126 -13.312 1.00 26.18 ? 68  GLY A C   1 
ATOM   499  O O   . GLY A 1 68  ? 144.478 149.008 -13.688 1.00 22.92 ? 68  GLY A O   1 
ATOM   500  N N   . THR A 1 69  ? 144.155 150.503 -12.036 1.00 27.01 ? 69  THR A N   1 
ATOM   501  C CA  . THR A 1 69  ? 144.629 149.613 -10.982 1.00 27.69 ? 69  THR A CA  1 
ATOM   502  C C   . THR A 1 69  ? 143.537 149.297 -9.954  1.00 28.58 ? 69  THR A C   1 
ATOM   503  O O   . THR A 1 69  ? 143.660 148.337 -9.190  1.00 27.49 ? 69  THR A O   1 
ATOM   504  C CB  . THR A 1 69  ? 145.809 150.240 -10.213 1.00 27.94 ? 69  THR A CB  1 
ATOM   505  O OG1 . THR A 1 69  ? 145.380 151.477 -9.628  1.00 27.92 ? 69  THR A OG1 1 
ATOM   506  C CG2 . THR A 1 69  ? 146.992 150.507 -11.144 1.00 29.03 ? 69  THR A CG2 1 
ATOM   507  N N   . ASP A 1 70  ? 142.480 150.103 -9.928  1.00 29.33 ? 70  ASP A N   1 
ATOM   508  C CA  . ASP A 1 70  ? 141.408 149.900 -8.956  1.00 32.83 ? 70  ASP A CA  1 
ATOM   509  C C   . ASP A 1 70  ? 140.058 149.519 -9.538  1.00 30.90 ? 70  ASP A C   1 
ATOM   510  O O   . ASP A 1 70  ? 139.521 150.208 -10.403 1.00 31.38 ? 70  ASP A O   1 
ATOM   511  C CB  . ASP A 1 70  ? 141.280 151.135 -8.069  1.00 37.29 ? 70  ASP A CB  1 
ATOM   512  C CG  . ASP A 1 70  ? 142.291 151.126 -6.937  1.00 43.01 ? 70  ASP A CG  1 
ATOM   513  O OD1 . ASP A 1 70  ? 142.099 150.337 -5.985  1.00 46.09 ? 70  ASP A OD1 1 
ATOM   514  O OD2 . ASP A 1 70  ? 143.285 151.883 -7.006  1.00 44.32 ? 70  ASP A OD2 1 
ATOM   515  N N   . PHE A 1 71  ? 139.522 148.407 -9.042  1.00 29.12 ? 71  PHE A N   1 
ATOM   516  C CA  . PHE A 1 71  ? 138.252 147.876 -9.513  1.00 29.02 ? 71  PHE A CA  1 
ATOM   517  C C   . PHE A 1 71  ? 137.304 147.550 -8.381  1.00 28.85 ? 71  PHE A C   1 
ATOM   518  O O   . PHE A 1 71  ? 137.721 147.238 -7.264  1.00 27.02 ? 71  PHE A O   1 
ATOM   519  C CB  . PHE A 1 71  ? 138.494 146.621 -10.352 1.00 28.26 ? 71  PHE A CB  1 
ATOM   520  C CG  . PHE A 1 71  ? 139.471 146.834 -11.461 1.00 28.59 ? 71  PHE A CG  1 
ATOM   521  C CD1 . PHE A 1 71  ? 140.838 146.844 -11.206 1.00 28.60 ? 71  PHE A CD1 1 
ATOM   522  C CD2 . PHE A 1 71  ? 139.027 147.105 -12.748 1.00 29.35 ? 71  PHE A CD2 1 
ATOM   523  C CE1 . PHE A 1 71  ? 141.750 147.127 -12.221 1.00 29.04 ? 71  PHE A CE1 1 
ATOM   524  C CE2 . PHE A 1 71  ? 139.932 147.391 -13.767 1.00 30.34 ? 71  PHE A CE2 1 
ATOM   525  C CZ  . PHE A 1 71  ? 141.298 147.402 -13.499 1.00 27.89 ? 71  PHE A CZ  1 
ATOM   526  N N   . THR A 1 72  ? 136.019 147.596 -8.696  1.00 29.29 ? 72  THR A N   1 
ATOM   527  C CA  . THR A 1 72  ? 134.994 147.340 -7.711  1.00 30.22 ? 72  THR A CA  1 
ATOM   528  C C   . THR A 1 72  ? 133.888 146.451 -8.235  1.00 29.89 ? 72  THR A C   1 
ATOM   529  O O   . THR A 1 72  ? 133.429 146.613 -9.372  1.00 29.89 ? 72  THR A O   1 
ATOM   530  C CB  . THR A 1 72  ? 134.338 148.661 -7.249  1.00 30.39 ? 72  THR A CB  1 
ATOM   531  O OG1 . THR A 1 72  ? 135.350 149.567 -6.798  1.00 33.09 ? 72  THR A OG1 1 
ATOM   532  C CG2 . THR A 1 72  ? 133.355 148.397 -6.108  1.00 33.93 ? 72  THR A CG2 1 
ATOM   533  N N   . LEU A 1 73  ? 133.479 145.495 -7.406  1.00 29.89 ? 73  LEU A N   1 
ATOM   534  C CA  . LEU A 1 73  ? 132.357 144.625 -7.732  1.00 28.83 ? 73  LEU A CA  1 
ATOM   535  C C   . LEU A 1 73  ? 131.285 145.065 -6.736  1.00 31.44 ? 73  LEU A C   1 
ATOM   536  O O   . LEU A 1 73  ? 131.504 145.047 -5.522  1.00 31.82 ? 73  LEU A O   1 
ATOM   537  C CB  . LEU A 1 73  ? 132.686 143.147 -7.499  1.00 26.80 ? 73  LEU A CB  1 
ATOM   538  C CG  . LEU A 1 73  ? 131.464 142.235 -7.704  1.00 26.08 ? 73  LEU A CG  1 
ATOM   539  C CD1 . LEU A 1 73  ? 131.058 142.290 -9.161  1.00 25.21 ? 73  LEU A CD1 1 
ATOM   540  C CD2 . LEU A 1 73  ? 131.772 140.793 -7.293  1.00 25.17 ? 73  LEU A CD2 1 
ATOM   541  N N   . SER A 1 74  ? 130.132 145.480 -7.236  1.00 32.54 ? 74  SER A N   1 
ATOM   542  C CA  . SER A 1 74  ? 129.074 145.916 -6.343  1.00 33.23 ? 74  SER A CA  1 
ATOM   543  C C   . SER A 1 74  ? 127.825 145.063 -6.451  1.00 34.13 ? 74  SER A C   1 
ATOM   544  O O   . SER A 1 74  ? 127.491 144.553 -7.518  1.00 31.91 ? 74  SER A O   1 
ATOM   545  C CB  . SER A 1 74  ? 128.709 147.380 -6.620  1.00 32.20 ? 74  SER A CB  1 
ATOM   546  O OG  . SER A 1 74  ? 129.746 148.254 -6.211  1.00 33.10 ? 74  SER A OG  1 
ATOM   547  N N   . ILE A 1 75  ? 127.152 144.898 -5.318  1.00 35.96 ? 75  ILE A N   1 
ATOM   548  C CA  . ILE A 1 75  ? 125.903 144.155 -5.268  1.00 36.37 ? 75  ILE A CA  1 
ATOM   549  C C   . ILE A 1 75  ? 124.901 145.124 -4.673  1.00 38.67 ? 75  ILE A C   1 
ATOM   550  O O   . ILE A 1 75  ? 125.087 145.604 -3.559  1.00 36.69 ? 75  ILE A O   1 
ATOM   551  C CB  . ILE A 1 75  ? 125.968 142.934 -4.337  1.00 34.21 ? 75  ILE A CB  1 
ATOM   552  C CG1 . ILE A 1 75  ? 126.970 141.907 -4.869  1.00 33.77 ? 75  ILE A CG1 1 
ATOM   553  C CG2 . ILE A 1 75  ? 124.581 142.307 -4.232  1.00 33.73 ? 75  ILE A CG2 1 
ATOM   554  C CD1 . ILE A 1 75  ? 127.072 140.664 -4.004  1.00 29.22 ? 75  ILE A CD1 1 
ATOM   555  N N   . ASN A 1 76  ? 123.848 145.422 -5.422  1.00 42.68 ? 76  ASN A N   1 
ATOM   556  C CA  . ASN A 1 76  ? 122.823 146.334 -4.940  1.00 48.51 ? 76  ASN A CA  1 
ATOM   557  C C   . ASN A 1 76  ? 121.788 145.500 -4.187  1.00 49.37 ? 76  ASN A C   1 
ATOM   558  O O   . ASN A 1 76  ? 121.145 144.621 -4.768  1.00 51.18 ? 76  ASN A O   1 
ATOM   559  C CB  . ASN A 1 76  ? 122.171 147.055 -6.121  1.00 51.87 ? 76  ASN A CB  1 
ATOM   560  C CG  . ASN A 1 76  ? 121.862 148.505 -5.817  1.00 56.97 ? 76  ASN A CG  1 
ATOM   561  O OD1 . ASN A 1 76  ? 122.760 149.294 -5.511  1.00 59.10 ? 76  ASN A OD1 1 
ATOM   562  N ND2 . ASN A 1 76  ? 120.586 148.869 -5.899  1.00 58.38 ? 76  ASN A ND2 1 
ATOM   563  N N   . SER A 1 77  ? 121.638 145.767 -2.893  1.00 49.62 ? 77  SER A N   1 
ATOM   564  C CA  . SER A 1 77  ? 120.689 145.023 -2.064  1.00 48.57 ? 77  SER A CA  1 
ATOM   565  C C   . SER A 1 77  ? 121.085 143.546 -2.009  1.00 46.50 ? 77  SER A C   1 
ATOM   566  O O   . SER A 1 77  ? 120.566 142.718 -2.757  1.00 46.28 ? 77  SER A O   1 
ATOM   567  C CB  . SER A 1 77  ? 119.273 145.159 -2.628  1.00 49.49 ? 77  SER A CB  1 
ATOM   568  O OG  . SER A 1 77  ? 118.330 144.541 -1.771  1.00 51.80 ? 77  SER A OG  1 
ATOM   569  N N   . VAL A 1 78  ? 122.010 143.223 -1.115  1.00 44.60 ? 78  VAL A N   1 
ATOM   570  C CA  . VAL A 1 78  ? 122.484 141.857 -0.977  1.00 43.32 ? 78  VAL A CA  1 
ATOM   571  C C   . VAL A 1 78  ? 121.442 140.961 -0.316  1.00 43.21 ? 78  VAL A C   1 
ATOM   572  O O   . VAL A 1 78  ? 120.695 141.394 0.559   1.00 41.66 ? 78  VAL A O   1 
ATOM   573  C CB  . VAL A 1 78  ? 123.778 141.838 -0.167  1.00 43.71 ? 78  VAL A CB  1 
ATOM   574  N N   . GLU A 1 79  ? 121.382 139.715 -0.761  1.00 42.22 ? 79  GLU A N   1 
ATOM   575  C CA  . GLU A 1 79  ? 120.464 138.750 -0.178  1.00 41.87 ? 79  GLU A CA  1 
ATOM   576  C C   . GLU A 1 79  ? 121.242 137.479 0.119   1.00 39.86 ? 79  GLU A C   1 
ATOM   577  O O   . GLU A 1 79  ? 122.391 137.340 -0.293  1.00 37.76 ? 79  GLU A O   1 
ATOM   578  C CB  . GLU A 1 79  ? 119.282 138.467 -1.109  1.00 44.77 ? 79  GLU A CB  1 
ATOM   579  C CG  . GLU A 1 79  ? 119.637 138.136 -2.541  1.00 47.10 ? 79  GLU A CG  1 
ATOM   580  C CD  . GLU A 1 79  ? 118.399 137.936 -3.388  1.00 50.37 ? 79  GLU A CD  1 
ATOM   581  O OE1 . GLU A 1 79  ? 117.717 136.904 -3.210  1.00 52.32 ? 79  GLU A OE1 1 
ATOM   582  O OE2 . GLU A 1 79  ? 118.097 138.820 -4.220  1.00 52.92 ? 79  GLU A OE2 1 
ATOM   583  N N   . SER A 1 80  ? 120.612 136.557 0.836   1.00 38.60 ? 80  SER A N   1 
ATOM   584  C CA  . SER A 1 80  ? 121.250 135.313 1.236   1.00 36.50 ? 80  SER A CA  1 
ATOM   585  C C   . SER A 1 80  ? 121.993 134.541 0.152   1.00 35.12 ? 80  SER A C   1 
ATOM   586  O O   . SER A 1 80  ? 123.079 134.014 0.399   1.00 33.46 ? 80  SER A O   1 
ATOM   587  C CB  . SER A 1 80  ? 120.217 134.399 1.905   1.00 37.61 ? 80  SER A CB  1 
ATOM   588  O OG  . SER A 1 80  ? 119.716 134.992 3.098   1.00 39.77 ? 80  SER A OG  1 
ATOM   589  N N   . GLU A 1 81  ? 121.418 134.463 -1.042  1.00 35.17 ? 81  GLU A N   1 
ATOM   590  C CA  . GLU A 1 81  ? 122.054 133.718 -2.123  1.00 36.58 ? 81  GLU A CA  1 
ATOM   591  C C   . GLU A 1 81  ? 123.396 134.324 -2.541  1.00 35.16 ? 81  GLU A C   1 
ATOM   592  O O   . GLU A 1 81  ? 124.187 133.673 -3.227  1.00 34.69 ? 81  GLU A O   1 
ATOM   593  C CB  . GLU A 1 81  ? 121.129 133.635 -3.348  1.00 41.21 ? 81  GLU A CB  1 
ATOM   594  C CG  . GLU A 1 81  ? 120.995 134.936 -4.135  1.00 46.91 ? 81  GLU A CG  1 
ATOM   595  C CD  . GLU A 1 81  ? 120.398 134.726 -5.524  1.00 51.28 ? 81  GLU A CD  1 
ATOM   596  O OE1 . GLU A 1 81  ? 120.923 133.875 -6.275  1.00 54.08 ? 81  GLU A OE1 1 
ATOM   597  O OE2 . GLU A 1 81  ? 119.414 135.416 -5.870  1.00 53.10 ? 81  GLU A OE2 1 
ATOM   598  N N   . ASP A 1 82  ? 123.653 135.561 -2.129  1.00 31.52 ? 82  ASP A N   1 
ATOM   599  C CA  . ASP A 1 82  ? 124.909 136.211 -2.480  1.00 32.31 ? 82  ASP A CA  1 
ATOM   600  C C   . ASP A 1 82  ? 126.050 135.768 -1.571  1.00 31.24 ? 82  ASP A C   1 
ATOM   601  O O   . ASP A 1 82  ? 127.218 136.054 -1.842  1.00 29.96 ? 82  ASP A O   1 
ATOM   602  C CB  . ASP A 1 82  ? 124.753 137.732 -2.434  1.00 29.56 ? 82  ASP A CB  1 
ATOM   603  C CG  . ASP A 1 82  ? 123.697 138.229 -3.402  1.00 31.02 ? 82  ASP A CG  1 
ATOM   604  O OD1 . ASP A 1 82  ? 123.552 137.610 -4.478  1.00 29.46 ? 82  ASP A OD1 1 
ATOM   605  O OD2 . ASP A 1 82  ? 123.021 139.235 -3.098  1.00 32.43 ? 82  ASP A OD2 1 
ATOM   606  N N   . ILE A 1 83  ? 125.720 135.064 -0.492  1.00 30.14 ? 83  ILE A N   1 
ATOM   607  C CA  . ILE A 1 83  ? 126.760 134.592 0.416   1.00 29.45 ? 83  ILE A CA  1 
ATOM   608  C C   . ILE A 1 83  ? 127.676 133.631 -0.339  1.00 29.36 ? 83  ILE A C   1 
ATOM   609  O O   . ILE A 1 83  ? 127.241 132.589 -0.845  1.00 28.36 ? 83  ILE A O   1 
ATOM   610  C CB  . ILE A 1 83  ? 126.161 133.896 1.656   1.00 29.71 ? 83  ILE A CB  1 
ATOM   611  C CG1 . ILE A 1 83  ? 125.440 134.933 2.523   1.00 30.09 ? 83  ILE A CG1 1 
ATOM   612  C CG2 . ILE A 1 83  ? 127.269 133.233 2.473   1.00 28.93 ? 83  ILE A CG2 1 
ATOM   613  C CD1 . ILE A 1 83  ? 124.696 134.341 3.706   1.00 31.94 ? 83  ILE A CD1 1 
ATOM   614  N N   . ALA A 1 84  ? 128.948 134.005 -0.416  1.00 28.90 ? 84  ALA A N   1 
ATOM   615  C CA  . ALA A 1 84  ? 129.945 133.225 -1.132  1.00 30.00 ? 84  ALA A CA  1 
ATOM   616  C C   . ALA A 1 84  ? 131.287 133.959 -1.116  1.00 30.26 ? 84  ALA A C   1 
ATOM   617  O O   . ALA A 1 84  ? 131.439 134.990 -0.454  1.00 29.29 ? 84  ALA A O   1 
ATOM   618  C CB  . ALA A 1 84  ? 129.488 133.024 -2.578  1.00 30.93 ? 84  ALA A CB  1 
ATOM   619  N N   . ASN A 1 85  ? 132.259 133.408 -1.838  1.00 29.80 ? 85  ASN A N   1 
ATOM   620  C CA  . ASN A 1 85  ? 133.580 134.020 -1.960  1.00 28.78 ? 85  ASN A CA  1 
ATOM   621  C C   . ASN A 1 85  ? 133.619 134.689 -3.325  1.00 27.63 ? 85  ASN A C   1 
ATOM   622  O O   . ASN A 1 85  ? 133.063 134.169 -4.281  1.00 24.83 ? 85  ASN A O   1 
ATOM   623  C CB  . ASN A 1 85  ? 134.679 132.962 -1.865  1.00 30.95 ? 85  ASN A CB  1 
ATOM   624  C CG  . ASN A 1 85  ? 135.012 132.596 -0.430  1.00 33.27 ? 85  ASN A CG  1 
ATOM   625  O OD1 . ASN A 1 85  ? 135.629 131.566 -0.170  1.00 38.80 ? 85  ASN A OD1 1 
ATOM   626  N ND2 . ASN A 1 85  ? 134.612 133.446 0.509   1.00 34.66 ? 85  ASN A ND2 1 
ATOM   627  N N   . TYR A 1 86  ? 134.280 135.840 -3.411  1.00 27.28 ? 86  TYR A N   1 
ATOM   628  C CA  . TYR A 1 86  ? 134.355 136.578 -4.662  1.00 25.85 ? 86  TYR A CA  1 
ATOM   629  C C   . TYR A 1 86  ? 135.787 136.824 -5.080  1.00 25.67 ? 86  TYR A C   1 
ATOM   630  O O   . TYR A 1 86  ? 136.577 137.389 -4.321  1.00 24.15 ? 86  TYR A O   1 
ATOM   631  C CB  . TYR A 1 86  ? 133.607 137.905 -4.522  1.00 27.50 ? 86  TYR A CB  1 
ATOM   632  C CG  . TYR A 1 86  ? 132.118 137.720 -4.378  1.00 29.53 ? 86  TYR A CG  1 
ATOM   633  C CD1 . TYR A 1 86  ? 131.547 137.378 -3.149  1.00 31.15 ? 86  TYR A CD1 1 
ATOM   634  C CD2 . TYR A 1 86  ? 131.278 137.830 -5.490  1.00 29.15 ? 86  TYR A CD2 1 
ATOM   635  C CE1 . TYR A 1 86  ? 130.180 137.152 -3.031  1.00 29.78 ? 86  TYR A CE1 1 
ATOM   636  C CE2 . TYR A 1 86  ? 129.919 137.605 -5.386  1.00 31.04 ? 86  TYR A CE2 1 
ATOM   637  C CZ  . TYR A 1 86  ? 129.376 137.267 -4.152  1.00 32.57 ? 86  TYR A CZ  1 
ATOM   638  O OH  . TYR A 1 86  ? 128.027 137.065 -4.055  1.00 32.52 ? 86  TYR A OH  1 
ATOM   639  N N   . TYR A 1 87  ? 136.113 136.406 -6.300  1.00 25.13 ? 87  TYR A N   1 
ATOM   640  C CA  . TYR A 1 87  ? 137.464 136.545 -6.818  1.00 23.42 ? 87  TYR A CA  1 
ATOM   641  C C   . TYR A 1 87  ? 137.564 137.409 -8.059  1.00 24.49 ? 87  TYR A C   1 
ATOM   642  O O   . TYR A 1 87  ? 136.670 137.391 -8.911  1.00 23.42 ? 87  TYR A O   1 
ATOM   643  C CB  . TYR A 1 87  ? 138.047 135.175 -7.197  1.00 23.74 ? 87  TYR A CB  1 
ATOM   644  C CG  . TYR A 1 87  ? 138.178 134.160 -6.083  1.00 23.71 ? 87  TYR A CG  1 
ATOM   645  C CD1 . TYR A 1 87  ? 137.108 133.333 -5.724  1.00 22.09 ? 87  TYR A CD1 1 
ATOM   646  C CD2 . TYR A 1 87  ? 139.382 134.015 -5.397  1.00 20.66 ? 87  TYR A CD2 1 
ATOM   647  C CE1 . TYR A 1 87  ? 137.242 132.386 -4.711  1.00 22.05 ? 87  TYR A CE1 1 
ATOM   648  C CE2 . TYR A 1 87  ? 139.524 133.084 -4.387  1.00 24.13 ? 87  TYR A CE2 1 
ATOM   649  C CZ  . TYR A 1 87  ? 138.452 132.268 -4.048  1.00 22.88 ? 87  TYR A CZ  1 
ATOM   650  O OH  . TYR A 1 87  ? 138.622 131.338 -3.055  1.00 25.49 ? 87  TYR A OH  1 
ATOM   651  N N   . CYS A 1 88  ? 138.658 138.161 -8.167  1.00 21.58 ? 88  CYS A N   1 
ATOM   652  C CA  . CYS A 1 88  ? 138.891 138.948 -9.373  1.00 20.44 ? 88  CYS A CA  1 
ATOM   653  C C   . CYS A 1 88  ? 140.021 138.214 -10.083 1.00 19.91 ? 88  CYS A C   1 
ATOM   654  O O   . CYS A 1 88  ? 140.743 137.430 -9.464  1.00 19.43 ? 88  CYS A O   1 
ATOM   655  C CB  . CYS A 1 88  ? 139.283 140.386 -9.054  1.00 21.53 ? 88  CYS A CB  1 
ATOM   656  S SG  . CYS A 1 88  ? 140.651 140.529 -7.931  1.00 21.84 ? 88  CYS A SG  1 
ATOM   657  N N   . GLN A 1 89  ? 140.161 138.447 -11.380 1.00 19.97 ? 89  GLN A N   1 
ATOM   658  C CA  . GLN A 1 89  ? 141.171 137.763 -12.181 1.00 18.82 ? 89  GLN A CA  1 
ATOM   659  C C   . GLN A 1 89  ? 141.586 138.686 -13.318 1.00 19.85 ? 89  GLN A C   1 
ATOM   660  O O   . GLN A 1 89  ? 140.738 139.347 -13.926 1.00 18.98 ? 89  GLN A O   1 
ATOM   661  C CB  . GLN A 1 89  ? 140.568 136.473 -12.748 1.00 21.75 ? 89  GLN A CB  1 
ATOM   662  C CG  . GLN A 1 89  ? 141.433 135.711 -13.748 1.00 21.22 ? 89  GLN A CG  1 
ATOM   663  C CD  . GLN A 1 89  ? 140.876 135.790 -15.166 1.00 24.16 ? 89  GLN A CD  1 
ATOM   664  O OE1 . GLN A 1 89  ? 139.685 135.576 -15.386 1.00 22.02 ? 89  GLN A OE1 1 
ATOM   665  N NE2 . GLN A 1 89  ? 141.738 136.101 -16.130 1.00 22.19 ? 89  GLN A NE2 1 
ATOM   666  N N   . GLN A 1 90  ? 142.881 138.747 -13.612 1.00 20.14 ? 90  GLN A N   1 
ATOM   667  C CA  . GLN A 1 90  ? 143.323 139.624 -14.693 1.00 18.96 ? 90  GLN A CA  1 
ATOM   668  C C   . GLN A 1 90  ? 143.801 138.875 -15.915 1.00 20.76 ? 90  GLN A C   1 
ATOM   669  O O   . GLN A 1 90  ? 144.378 137.781 -15.814 1.00 19.96 ? 90  GLN A O   1 
ATOM   670  C CB  . GLN A 1 90  ? 144.418 140.591 -14.205 1.00 18.94 ? 90  GLN A CB  1 
ATOM   671  C CG  . GLN A 1 90  ? 145.785 139.985 -13.915 1.00 18.35 ? 90  GLN A CG  1 
ATOM   672  C CD  . GLN A 1 90  ? 146.624 139.779 -15.169 1.00 22.54 ? 90  GLN A CD  1 
ATOM   673  O OE1 . GLN A 1 90  ? 146.525 140.547 -16.129 1.00 21.81 ? 90  GLN A OE1 1 
ATOM   674  N NE2 . GLN A 1 90  ? 147.470 138.750 -15.158 1.00 16.96 ? 90  GLN A NE2 1 
ATOM   675  N N   . SER A 1 91  ? 143.553 139.481 -17.075 1.00 19.38 ? 91  SER A N   1 
ATOM   676  C CA  . SER A 1 91  ? 143.955 138.911 -18.344 1.00 19.34 ? 91  SER A CA  1 
ATOM   677  C C   . SER A 1 91  ? 144.694 139.948 -19.208 1.00 19.87 ? 91  SER A C   1 
ATOM   678  O O   . SER A 1 91  ? 144.747 139.818 -20.422 1.00 21.54 ? 91  SER A O   1 
ATOM   679  C CB  . SER A 1 91  ? 142.728 138.392 -19.095 1.00 16.63 ? 91  SER A CB  1 
ATOM   680  O OG  . SER A 1 91  ? 141.827 139.444 -19.388 1.00 16.84 ? 91  SER A OG  1 
ATOM   681  N N   . ASN A 1 92  ? 145.272 140.963 -18.580 1.00 21.54 ? 92  ASN A N   1 
ATOM   682  C CA  . ASN A 1 92  ? 146.001 142.004 -19.318 1.00 21.12 ? 92  ASN A CA  1 
ATOM   683  C C   . ASN A 1 92  ? 147.386 141.529 -19.744 1.00 21.42 ? 92  ASN A C   1 
ATOM   684  O O   . ASN A 1 92  ? 147.823 141.791 -20.864 1.00 21.32 ? 92  ASN A O   1 
ATOM   685  C CB  . ASN A 1 92  ? 146.145 143.259 -18.460 1.00 20.00 ? 92  ASN A CB  1 
ATOM   686  C CG  . ASN A 1 92  ? 146.801 144.416 -19.211 1.00 24.70 ? 92  ASN A CG  1 
ATOM   687  O OD1 . ASN A 1 92  ? 146.185 145.043 -20.087 1.00 24.17 ? 92  ASN A OD1 1 
ATOM   688  N ND2 . ASN A 1 92  ? 148.052 144.698 -18.875 1.00 19.17 ? 92  ASN A ND2 1 
ATOM   689  N N   . ARG A 1 93  ? 148.068 140.824 -18.845 1.00 18.52 ? 93  ARG A N   1 
ATOM   690  C CA  . ARG A 1 93  ? 149.403 140.313 -19.117 1.00 21.43 ? 93  ARG A CA  1 
ATOM   691  C C   . ARG A 1 93  ? 149.524 138.845 -18.713 1.00 23.26 ? 93  ARG A C   1 
ATOM   692  O O   . ARG A 1 93  ? 148.849 138.380 -17.790 1.00 22.71 ? 93  ARG A O   1 
ATOM   693  C CB  . ARG A 1 93  ? 150.460 141.100 -18.326 1.00 24.01 ? 93  ARG A CB  1 
ATOM   694  C CG  . ARG A 1 93  ? 150.675 142.529 -18.751 1.00 30.17 ? 93  ARG A CG  1 
ATOM   695  C CD  . ARG A 1 93  ? 151.788 143.172 -17.903 1.00 35.08 ? 93  ARG A CD  1 
ATOM   696  N NE  . ARG A 1 93  ? 151.874 144.612 -18.133 1.00 37.77 ? 93  ARG A NE  1 
ATOM   697  C CZ  . ARG A 1 93  ? 152.668 145.202 -19.028 1.00 39.03 ? 93  ARG A CZ  1 
ATOM   698  N NH1 . ARG A 1 93  ? 153.485 144.487 -19.797 1.00 33.49 ? 93  ARG A NH1 1 
ATOM   699  N NH2 . ARG A 1 93  ? 152.613 146.521 -19.177 1.00 38.62 ? 93  ARG A NH2 1 
ATOM   700  N N   . TRP A 1 94  ? 150.412 138.127 -19.389 1.00 22.54 ? 94  TRP A N   1 
ATOM   701  C CA  . TRP A 1 94  ? 150.645 136.727 -19.081 1.00 22.91 ? 94  TRP A CA  1 
ATOM   702  C C   . TRP A 1 94  ? 151.591 136.639 -17.876 1.00 23.04 ? 94  TRP A C   1 
ATOM   703  O O   . TRP A 1 94  ? 152.578 137.380 -17.797 1.00 24.65 ? 94  TRP A O   1 
ATOM   704  C CB  . TRP A 1 94  ? 151.281 136.019 -20.282 1.00 21.77 ? 94  TRP A CB  1 
ATOM   705  C CG  . TRP A 1 94  ? 151.152 134.531 -20.194 1.00 24.72 ? 94  TRP A CG  1 
ATOM   706  C CD1 . TRP A 1 94  ? 150.110 133.766 -20.650 1.00 22.68 ? 94  TRP A CD1 1 
ATOM   707  C CD2 . TRP A 1 94  ? 152.051 133.636 -19.535 1.00 22.55 ? 94  TRP A CD2 1 
ATOM   708  N NE1 . TRP A 1 94  ? 150.307 132.454 -20.311 1.00 22.74 ? 94  TRP A NE1 1 
ATOM   709  C CE2 . TRP A 1 94  ? 151.490 132.343 -19.624 1.00 22.70 ? 94  TRP A CE2 1 
ATOM   710  C CE3 . TRP A 1 94  ? 153.276 133.801 -18.873 1.00 23.12 ? 94  TRP A CE3 1 
ATOM   711  C CZ2 . TRP A 1 94  ? 152.113 131.214 -19.073 1.00 23.48 ? 94  TRP A CZ2 1 
ATOM   712  C CZ3 . TRP A 1 94  ? 153.899 132.676 -18.320 1.00 23.72 ? 94  TRP A CZ3 1 
ATOM   713  C CH2 . TRP A 1 94  ? 153.311 131.400 -18.427 1.00 26.46 ? 94  TRP A CH2 1 
ATOM   714  N N   . PRO A 1 95  ? 151.300 135.745 -16.916 1.00 23.10 ? 95  PRO A N   1 
ATOM   715  C CA  . PRO A 1 95  ? 150.144 134.847 -16.927 1.00 20.50 ? 95  PRO A CA  1 
ATOM   716  C C   . PRO A 1 95  ? 148.915 135.451 -16.263 1.00 21.28 ? 95  PRO A C   1 
ATOM   717  O O   . PRO A 1 95  ? 149.002 136.431 -15.510 1.00 19.75 ? 95  PRO A O   1 
ATOM   718  C CB  . PRO A 1 95  ? 150.651 133.636 -16.158 1.00 20.45 ? 95  PRO A CB  1 
ATOM   719  C CG  . PRO A 1 95  ? 151.494 134.272 -15.087 1.00 20.21 ? 95  PRO A CG  1 
ATOM   720  C CD  . PRO A 1 95  ? 152.278 135.319 -15.889 1.00 21.25 ? 95  PRO A CD  1 
ATOM   721  N N   . PHE A 1 96  ? 147.759 134.864 -16.550 1.00 22.06 ? 96  PHE A N   1 
ATOM   722  C CA  . PHE A 1 96  ? 146.520 135.315 -15.937 1.00 19.91 ? 96  PHE A CA  1 
ATOM   723  C C   . PHE A 1 96  ? 146.757 135.066 -14.452 1.00 19.96 ? 96  PHE A C   1 
ATOM   724  O O   . PHE A 1 96  ? 147.475 134.141 -14.089 1.00 20.35 ? 96  PHE A O   1 
ATOM   725  C CB  . PHE A 1 96  ? 145.339 134.472 -16.443 1.00 20.11 ? 96  PHE A CB  1 
ATOM   726  C CG  . PHE A 1 96  ? 144.994 134.694 -17.902 1.00 20.38 ? 96  PHE A CG  1 
ATOM   727  C CD1 . PHE A 1 96  ? 144.079 133.855 -18.547 1.00 22.16 ? 96  PHE A CD1 1 
ATOM   728  C CD2 . PHE A 1 96  ? 145.552 135.753 -18.622 1.00 21.87 ? 96  PHE A CD2 1 
ATOM   729  C CE1 . PHE A 1 96  ? 143.722 134.064 -19.879 1.00 23.15 ? 96  PHE A CE1 1 
ATOM   730  C CE2 . PHE A 1 96  ? 145.203 135.978 -19.962 1.00 19.80 ? 96  PHE A CE2 1 
ATOM   731  C CZ  . PHE A 1 96  ? 144.288 135.134 -20.594 1.00 23.90 ? 96  PHE A CZ  1 
ATOM   732  N N   . THR A 1 97  ? 146.196 135.905 -13.592 1.00 20.45 ? 97  THR A N   1 
ATOM   733  C CA  . THR A 1 97  ? 146.368 135.725 -12.153 1.00 19.97 ? 97  THR A CA  1 
ATOM   734  C C   . THR A 1 97  ? 145.034 135.999 -11.457 1.00 21.22 ? 97  THR A C   1 
ATOM   735  O O   . THR A 1 97  ? 144.168 136.684 -12.010 1.00 21.65 ? 97  THR A O   1 
ATOM   736  C CB  . THR A 1 97  ? 147.450 136.688 -11.567 1.00 21.37 ? 97  THR A CB  1 
ATOM   737  O OG1 . THR A 1 97  ? 147.217 138.017 -12.043 1.00 20.34 ? 97  THR A OG1 1 
ATOM   738  C CG2 . THR A 1 97  ? 148.853 136.250 -11.973 1.00 25.21 ? 97  THR A CG2 1 
ATOM   739  N N   . PHE A 1 98  ? 144.892 135.475 -10.244 1.00 21.86 ? 98  PHE A N   1 
ATOM   740  C CA  . PHE A 1 98  ? 143.680 135.621 -9.434  1.00 23.02 ? 98  PHE A CA  1 
ATOM   741  C C   . PHE A 1 98  ? 143.962 136.365 -8.134  1.00 24.18 ? 98  PHE A C   1 
ATOM   742  O O   . PHE A 1 98  ? 145.051 136.263 -7.583  1.00 25.92 ? 98  PHE A O   1 
ATOM   743  C CB  . PHE A 1 98  ? 143.132 134.248 -9.028  1.00 21.76 ? 98  PHE A CB  1 
ATOM   744  C CG  . PHE A 1 98  ? 142.456 133.486 -10.134 1.00 21.58 ? 98  PHE A CG  1 
ATOM   745  C CD1 . PHE A 1 98  ? 141.140 133.750 -10.470 1.00 22.17 ? 98  PHE A CD1 1 
ATOM   746  C CD2 . PHE A 1 98  ? 143.123 132.462 -10.795 1.00 24.35 ? 98  PHE A CD2 1 
ATOM   747  C CE1 . PHE A 1 98  ? 140.484 133.000 -11.450 1.00 23.58 ? 98  PHE A CE1 1 
ATOM   748  C CE2 . PHE A 1 98  ? 142.478 131.706 -11.776 1.00 24.32 ? 98  PHE A CE2 1 
ATOM   749  C CZ  . PHE A 1 98  ? 141.155 131.980 -12.099 1.00 23.56 ? 98  PHE A CZ  1 
ATOM   750  N N   . GLY A 1 99  ? 142.963 137.085 -7.639  1.00 23.82 ? 99  GLY A N   1 
ATOM   751  C CA  . GLY A 1 99  ? 143.107 137.766 -6.369  1.00 25.17 ? 99  GLY A CA  1 
ATOM   752  C C   . GLY A 1 99  ? 142.848 136.724 -5.287  1.00 26.28 ? 99  GLY A C   1 
ATOM   753  O O   . GLY A 1 99  ? 142.338 135.637 -5.581  1.00 24.24 ? 99  GLY A O   1 
ATOM   754  N N   . SER A 1 100 ? 143.181 137.056 -4.041  1.00 26.03 ? 100 SER A N   1 
ATOM   755  C CA  . SER A 1 100 ? 143.019 136.147 -2.910  1.00 27.84 ? 100 SER A CA  1 
ATOM   756  C C   . SER A 1 100 ? 141.573 135.882 -2.483  1.00 27.48 ? 100 SER A C   1 
ATOM   757  O O   . SER A 1 100 ? 141.319 134.976 -1.689  1.00 26.44 ? 100 SER A O   1 
ATOM   758  C CB  . SER A 1 100 ? 143.807 136.681 -1.711  1.00 30.01 ? 100 SER A CB  1 
ATOM   759  O OG  . SER A 1 100 ? 143.397 138.005 -1.402  1.00 34.22 ? 100 SER A OG  1 
ATOM   760  N N   . GLY A 1 101 ? 140.638 136.691 -2.977  1.00 25.83 ? 101 GLY A N   1 
ATOM   761  C CA  . GLY A 1 101 ? 139.237 136.486 -2.654  1.00 27.87 ? 101 GLY A CA  1 
ATOM   762  C C   . GLY A 1 101 ? 138.686 137.146 -1.406  1.00 26.91 ? 101 GLY A C   1 
ATOM   763  O O   . GLY A 1 101 ? 139.358 137.241 -0.391  1.00 27.22 ? 101 GLY A O   1 
ATOM   764  N N   . THR A 1 102 ? 137.443 137.606 -1.495  1.00 27.56 ? 102 THR A N   1 
ATOM   765  C CA  . THR A 1 102 ? 136.765 138.239 -0.367  1.00 28.93 ? 102 THR A CA  1 
ATOM   766  C C   . THR A 1 102 ? 135.453 137.490 -0.080  1.00 29.22 ? 102 THR A C   1 
ATOM   767  O O   . THR A 1 102 ? 134.671 137.209 -0.993  1.00 29.00 ? 102 THR A O   1 
ATOM   768  C CB  . THR A 1 102 ? 136.442 139.737 -0.659  1.00 28.00 ? 102 THR A CB  1 
ATOM   769  O OG1 . THR A 1 102 ? 137.663 140.485 -0.768  1.00 29.32 ? 102 THR A OG1 1 
ATOM   770  C CG2 . THR A 1 102 ? 135.593 140.337 0.465   1.00 29.15 ? 102 THR A CG2 1 
ATOM   771  N N   . LYS A 1 103 ? 135.228 137.159 1.187   1.00 29.22 ? 103 LYS A N   1 
ATOM   772  C CA  . LYS A 1 103 ? 134.014 136.463 1.601   1.00 30.47 ? 103 LYS A CA  1 
ATOM   773  C C   . LYS A 1 103 ? 132.920 137.462 1.981   1.00 31.04 ? 103 LYS A C   1 
ATOM   774  O O   . LYS A 1 103 ? 133.190 138.480 2.628   1.00 29.55 ? 103 LYS A O   1 
ATOM   775  C CB  . LYS A 1 103 ? 134.309 135.566 2.796   1.00 32.13 ? 103 LYS A CB  1 
ATOM   776  N N   . LEU A 1 104 ? 131.687 137.177 1.581   1.00 29.27 ? 104 LEU A N   1 
ATOM   777  C CA  . LEU A 1 104 ? 130.581 138.054 1.933   1.00 31.06 ? 104 LEU A CA  1 
ATOM   778  C C   . LEU A 1 104 ? 129.749 137.447 3.054   1.00 32.85 ? 104 LEU A C   1 
ATOM   779  O O   . LEU A 1 104 ? 129.225 136.344 2.914   1.00 32.49 ? 104 LEU A O   1 
ATOM   780  C CB  . LEU A 1 104 ? 129.670 138.300 0.742   1.00 29.71 ? 104 LEU A CB  1 
ATOM   781  C CG  . LEU A 1 104 ? 128.447 139.160 1.078   1.00 31.91 ? 104 LEU A CG  1 
ATOM   782  C CD1 . LEU A 1 104 ? 128.887 140.563 1.435   1.00 32.34 ? 104 LEU A CD1 1 
ATOM   783  C CD2 . LEU A 1 104 ? 127.492 139.187 -0.115  1.00 32.96 ? 104 LEU A CD2 1 
ATOM   784  N N   . GLU A 1 105 ? 129.633 138.173 4.160   1.00 35.19 ? 105 GLU A N   1 
ATOM   785  C CA  . GLU A 1 105 ? 128.839 137.728 5.303   1.00 38.73 ? 105 GLU A CA  1 
ATOM   786  C C   . GLU A 1 105 ? 127.639 138.659 5.442   1.00 39.24 ? 105 GLU A C   1 
ATOM   787  O O   . GLU A 1 105 ? 127.751 139.860 5.208   1.00 37.38 ? 105 GLU A O   1 
ATOM   788  C CB  . GLU A 1 105 ? 129.645 137.802 6.604   1.00 40.38 ? 105 GLU A CB  1 
ATOM   789  C CG  . GLU A 1 105 ? 130.732 136.763 6.783   1.00 45.50 ? 105 GLU A CG  1 
ATOM   790  C CD  . GLU A 1 105 ? 131.368 136.859 8.164   1.00 48.88 ? 105 GLU A CD  1 
ATOM   791  O OE1 . GLU A 1 105 ? 132.345 136.125 8.434   1.00 50.15 ? 105 GLU A OE1 1 
ATOM   792  O OE2 . GLU A 1 105 ? 130.882 137.675 8.982   1.00 49.99 ? 105 GLU A OE2 1 
ATOM   793  N N   . ILE A 1 106 ? 126.498 138.106 5.829   1.00 40.09 ? 106 ILE A N   1 
ATOM   794  C CA  . ILE A 1 106 ? 125.297 138.907 6.010   1.00 41.99 ? 106 ILE A CA  1 
ATOM   795  C C   . ILE A 1 106 ? 124.892 138.880 7.478   1.00 42.96 ? 106 ILE A C   1 
ATOM   796  O O   . ILE A 1 106 ? 124.725 137.810 8.062   1.00 43.22 ? 106 ILE A O   1 
ATOM   797  C CB  . ILE A 1 106 ? 124.132 138.369 5.165   1.00 42.60 ? 106 ILE A CB  1 
ATOM   798  C CG1 . ILE A 1 106 ? 124.490 138.450 3.678   1.00 42.67 ? 106 ILE A CG1 1 
ATOM   799  C CG2 . ILE A 1 106 ? 122.867 139.157 5.466   1.00 42.95 ? 106 ILE A CG2 1 
ATOM   800  C CD1 . ILE A 1 106 ? 123.419 137.902 2.762   1.00 43.59 ? 106 ILE A CD1 1 
ATOM   801  N N   . LYS A 1 107 ? 124.744 140.058 8.072   1.00 43.07 ? 107 LYS A N   1 
ATOM   802  C CA  . LYS A 1 107 ? 124.361 140.153 9.471   1.00 44.86 ? 107 LYS A CA  1 
ATOM   803  C C   . LYS A 1 107 ? 122.840 140.205 9.588   1.00 45.40 ? 107 LYS A C   1 
ATOM   804  O O   . LYS A 1 107 ? 122.235 141.274 9.519   1.00 47.76 ? 107 LYS A O   1 
ATOM   805  C CB  . LYS A 1 107 ? 124.998 141.397 10.106  1.00 44.76 ? 107 LYS A CB  1 
ATOM   806  N N   . ARG A 1 108 ? 122.225 139.039 9.750   1.00 45.61 ? 108 ARG A N   1 
ATOM   807  C CA  . ARG A 1 108 ? 120.776 138.942 9.874   1.00 45.72 ? 108 ARG A CA  1 
ATOM   808  C C   . ARG A 1 108 ? 120.320 139.005 11.331  1.00 46.56 ? 108 ARG A C   1 
ATOM   809  O O   . ARG A 1 108 ? 121.127 139.160 12.254  1.00 46.47 ? 108 ARG A O   1 
ATOM   810  C CB  . ARG A 1 108 ? 120.270 137.631 9.260   1.00 44.82 ? 108 ARG A CB  1 
ATOM   811  C CG  . ARG A 1 108 ? 120.811 136.373 9.943   1.00 43.76 ? 108 ARG A CG  1 
ATOM   812  C CD  . ARG A 1 108 ? 119.883 135.179 9.721   1.00 42.16 ? 108 ARG A CD  1 
ATOM   813  N NE  . ARG A 1 108 ? 118.666 135.272 10.528  1.00 42.01 ? 108 ARG A NE  1 
ATOM   814  C CZ  . ARG A 1 108 ? 117.532 134.632 10.255  1.00 42.12 ? 108 ARG A CZ  1 
ATOM   815  N NH1 . ARG A 1 108 ? 117.448 133.850 9.188   1.00 42.23 ? 108 ARG A NH1 1 
ATOM   816  N NH2 . ARG A 1 108 ? 116.479 134.775 11.049  1.00 41.43 ? 108 ARG A NH2 1 
ATOM   817  N N   . ALA A 1 109 ? 119.013 138.869 11.527  1.00 47.03 ? 109 ALA A N   1 
ATOM   818  C CA  . ALA A 1 109 ? 118.431 138.897 12.862  1.00 47.95 ? 109 ALA A CA  1 
ATOM   819  C C   . ALA A 1 109 ? 118.808 137.635 13.634  1.00 46.67 ? 109 ALA A C   1 
ATOM   820  O O   . ALA A 1 109 ? 119.024 136.574 13.045  1.00 46.36 ? 109 ALA A O   1 
ATOM   821  C CB  . ALA A 1 109 ? 116.906 139.018 12.766  1.00 47.35 ? 109 ALA A CB  1 
ATOM   822  N N   . ASP A 1 110 ? 118.897 137.766 14.953  1.00 46.27 ? 110 ASP A N   1 
ATOM   823  C CA  . ASP A 1 110 ? 119.226 136.645 15.822  1.00 45.11 ? 110 ASP A CA  1 
ATOM   824  C C   . ASP A 1 110 ? 118.153 135.578 15.700  1.00 43.72 ? 110 ASP A C   1 
ATOM   825  O O   . ASP A 1 110 ? 116.968 135.894 15.616  1.00 42.44 ? 110 ASP A O   1 
ATOM   826  C CB  . ASP A 1 110 ? 119.312 137.118 17.270  1.00 46.30 ? 110 ASP A CB  1 
ATOM   827  C CG  . ASP A 1 110 ? 120.602 137.843 17.562  1.00 48.43 ? 110 ASP A CG  1 
ATOM   828  O OD1 . ASP A 1 110 ? 121.212 138.376 16.609  1.00 49.57 ? 110 ASP A OD1 1 
ATOM   829  O OD2 . ASP A 1 110 ? 121.002 137.885 18.745  1.00 49.66 ? 110 ASP A OD2 1 
ATOM   830  N N   . ALA A 1 111 ? 118.571 134.318 15.683  1.00 43.05 ? 111 ALA A N   1 
ATOM   831  C CA  . ALA A 1 111 ? 117.629 133.209 15.578  1.00 42.10 ? 111 ALA A CA  1 
ATOM   832  C C   . ALA A 1 111 ? 118.074 132.027 16.433  1.00 41.75 ? 111 ALA A C   1 
ATOM   833  O O   . ALA A 1 111 ? 119.218 131.571 16.331  1.00 41.77 ? 111 ALA A O   1 
ATOM   834  C CB  . ALA A 1 111 ? 117.486 132.777 14.114  1.00 43.10 ? 111 ALA A CB  1 
ATOM   835  N N   . ALA A 1 112 ? 117.168 131.541 17.280  1.00 40.42 ? 112 ALA A N   1 
ATOM   836  C CA  . ALA A 1 112 ? 117.449 130.401 18.151  1.00 39.04 ? 112 ALA A CA  1 
ATOM   837  C C   . ALA A 1 112 ? 117.612 129.150 17.297  1.00 37.53 ? 112 ALA A C   1 
ATOM   838  O O   . ALA A 1 112 ? 116.987 129.018 16.244  1.00 35.56 ? 112 ALA A O   1 
ATOM   839  C CB  . ALA A 1 112 ? 116.304 130.200 19.155  1.00 39.62 ? 112 ALA A CB  1 
ATOM   840  N N   . PRO A 1 113 ? 118.453 128.211 17.742  1.00 35.79 ? 113 PRO A N   1 
ATOM   841  C CA  . PRO A 1 113 ? 118.653 126.986 16.970  1.00 36.23 ? 113 PRO A CA  1 
ATOM   842  C C   . PRO A 1 113 ? 117.498 125.994 17.123  1.00 37.28 ? 113 PRO A C   1 
ATOM   843  O O   . PRO A 1 113 ? 116.809 125.979 18.148  1.00 36.19 ? 113 PRO A O   1 
ATOM   844  C CB  . PRO A 1 113 ? 119.956 126.444 17.538  1.00 35.05 ? 113 PRO A CB  1 
ATOM   845  C CG  . PRO A 1 113 ? 119.858 126.811 18.982  1.00 33.82 ? 113 PRO A CG  1 
ATOM   846  C CD  . PRO A 1 113 ? 119.336 128.241 18.924  1.00 36.80 ? 113 PRO A CD  1 
ATOM   847  N N   . THR A 1 114 ? 117.282 125.188 16.086  1.00 36.12 ? 114 THR A N   1 
ATOM   848  C CA  . THR A 1 114 ? 116.252 124.159 16.107  1.00 34.49 ? 114 THR A CA  1 
ATOM   849  C C   . THR A 1 114 ? 117.000 122.883 16.440  1.00 33.89 ? 114 THR A C   1 
ATOM   850  O O   . THR A 1 114 ? 117.789 122.397 15.634  1.00 34.34 ? 114 THR A O   1 
ATOM   851  C CB  . THR A 1 114 ? 115.583 124.005 14.735  1.00 35.71 ? 114 THR A CB  1 
ATOM   852  O OG1 . THR A 1 114 ? 114.834 125.189 14.442  1.00 35.93 ? 114 THR A OG1 1 
ATOM   853  C CG2 . THR A 1 114 ? 114.644 122.794 14.723  1.00 34.79 ? 114 THR A CG2 1 
ATOM   854  N N   . VAL A 1 115 ? 116.762 122.338 17.627  1.00 33.78 ? 115 VAL A N   1 
ATOM   855  C CA  . VAL A 1 115 ? 117.471 121.137 18.043  1.00 33.34 ? 115 VAL A CA  1 
ATOM   856  C C   . VAL A 1 115 ? 116.692 119.856 17.797  1.00 33.87 ? 115 VAL A C   1 
ATOM   857  O O   . VAL A 1 115 ? 115.497 119.772 18.073  1.00 34.53 ? 115 VAL A O   1 
ATOM   858  C CB  . VAL A 1 115 ? 117.855 121.210 19.535  1.00 33.64 ? 115 VAL A CB  1 
ATOM   859  C CG1 . VAL A 1 115 ? 118.765 120.045 19.889  1.00 33.62 ? 115 VAL A CG1 1 
ATOM   860  C CG2 . VAL A 1 115 ? 118.548 122.539 19.832  1.00 33.42 ? 115 VAL A CG2 1 
ATOM   861  N N   . SER A 1 116 ? 117.391 118.860 17.269  1.00 33.52 ? 116 SER A N   1 
ATOM   862  C CA  . SER A 1 116 ? 116.797 117.562 16.975  1.00 34.83 ? 116 SER A CA  1 
ATOM   863  C C   . SER A 1 116 ? 117.810 116.507 17.372  1.00 35.02 ? 116 SER A C   1 
ATOM   864  O O   . SER A 1 116 ? 118.964 116.567 16.943  1.00 33.43 ? 116 SER A O   1 
ATOM   865  C CB  . SER A 1 116 ? 116.505 117.417 15.475  1.00 33.88 ? 116 SER A CB  1 
ATOM   866  O OG  . SER A 1 116 ? 115.565 118.370 15.026  1.00 36.59 ? 116 SER A OG  1 
ATOM   867  N N   . ILE A 1 117 ? 117.392 115.552 18.195  1.00 35.34 ? 117 ILE A N   1 
ATOM   868  C CA  . ILE A 1 117 ? 118.296 114.484 18.602  1.00 37.45 ? 117 ILE A CA  1 
ATOM   869  C C   . ILE A 1 117 ? 117.838 113.199 17.917  1.00 38.74 ? 117 ILE A C   1 
ATOM   870  O O   . ILE A 1 117 ? 116.636 112.953 17.779  1.00 38.56 ? 117 ILE A O   1 
ATOM   871  C CB  . ILE A 1 117 ? 118.312 114.306 20.147  1.00 37.62 ? 117 ILE A CB  1 
ATOM   872  C CG1 . ILE A 1 117 ? 119.403 113.308 20.534  1.00 37.95 ? 117 ILE A CG1 1 
ATOM   873  C CG2 . ILE A 1 117 ? 116.942 113.846 20.649  1.00 36.40 ? 117 ILE A CG2 1 
ATOM   874  C CD1 . ILE A 1 117 ? 119.666 113.231 22.036  1.00 39.68 ? 117 ILE A CD1 1 
ATOM   875  N N   . PHE A 1 118 ? 118.794 112.392 17.468  1.00 39.95 ? 118 PHE A N   1 
ATOM   876  C CA  . PHE A 1 118 ? 118.469 111.150 16.784  1.00 41.27 ? 118 PHE A CA  1 
ATOM   877  C C   . PHE A 1 118 ? 119.163 109.937 17.383  1.00 42.93 ? 118 PHE A C   1 
ATOM   878  O O   . PHE A 1 118 ? 120.381 109.934 17.581  1.00 42.88 ? 118 PHE A O   1 
ATOM   879  C CB  . PHE A 1 118 ? 118.839 111.236 15.300  1.00 42.16 ? 118 PHE A CB  1 
ATOM   880  C CG  . PHE A 1 118 ? 118.169 112.363 14.564  1.00 42.58 ? 118 PHE A CG  1 
ATOM   881  C CD1 . PHE A 1 118 ? 118.771 113.616 14.484  1.00 42.64 ? 118 PHE A CD1 1 
ATOM   882  C CD2 . PHE A 1 118 ? 116.934 112.172 13.949  1.00 42.79 ? 118 PHE A CD2 1 
ATOM   883  C CE1 . PHE A 1 118 ? 118.150 114.664 13.799  1.00 43.58 ? 118 PHE A CE1 1 
ATOM   884  C CE2 . PHE A 1 118 ? 116.304 113.212 13.263  1.00 42.77 ? 118 PHE A CE2 1 
ATOM   885  C CZ  . PHE A 1 118 ? 116.913 114.460 13.187  1.00 43.46 ? 118 PHE A CZ  1 
ATOM   886  N N   . PRO A 1 119 ? 118.390 108.883 17.687  1.00 43.84 ? 119 PRO A N   1 
ATOM   887  C CA  . PRO A 1 119 ? 118.953 107.660 18.261  1.00 43.55 ? 119 PRO A CA  1 
ATOM   888  C C   . PRO A 1 119 ? 119.640 106.912 17.129  1.00 43.92 ? 119 PRO A C   1 
ATOM   889  O O   . PRO A 1 119 ? 119.310 107.119 15.964  1.00 45.09 ? 119 PRO A O   1 
ATOM   890  C CB  . PRO A 1 119 ? 117.719 106.904 18.756  1.00 43.58 ? 119 PRO A CB  1 
ATOM   891  C CG  . PRO A 1 119 ? 116.678 107.976 18.924  1.00 45.13 ? 119 PRO A CG  1 
ATOM   892  C CD  . PRO A 1 119 ? 116.919 108.846 17.730  1.00 44.23 ? 119 PRO A CD  1 
ATOM   893  N N   . PRO A 1 120 ? 120.601 106.034 17.449  1.00 44.85 ? 120 PRO A N   1 
ATOM   894  C CA  . PRO A 1 120 ? 121.273 105.296 16.375  1.00 46.31 ? 120 PRO A CA  1 
ATOM   895  C C   . PRO A 1 120 ? 120.302 104.381 15.630  1.00 48.07 ? 120 PRO A C   1 
ATOM   896  O O   . PRO A 1 120 ? 119.304 103.923 16.191  1.00 48.34 ? 120 PRO A O   1 
ATOM   897  C CB  . PRO A 1 120 ? 122.369 104.529 17.113  1.00 46.50 ? 120 PRO A CB  1 
ATOM   898  C CG  . PRO A 1 120 ? 121.787 104.329 18.474  1.00 46.27 ? 120 PRO A CG  1 
ATOM   899  C CD  . PRO A 1 120 ? 121.146 105.665 18.765  1.00 45.69 ? 120 PRO A CD  1 
ATOM   900  N N   . SER A 1 121 ? 120.596 104.124 14.361  1.00 49.65 ? 121 SER A N   1 
ATOM   901  C CA  . SER A 1 121 ? 119.739 103.283 13.537  1.00 50.83 ? 121 SER A CA  1 
ATOM   902  C C   . SER A 1 121 ? 119.873 101.801 13.863  1.00 51.93 ? 121 SER A C   1 
ATOM   903  O O   . SER A 1 121 ? 120.873 101.356 14.427  1.00 50.82 ? 121 SER A O   1 
ATOM   904  C CB  . SER A 1 121 ? 120.061 103.490 12.057  1.00 49.53 ? 121 SER A CB  1 
ATOM   905  O OG  . SER A 1 121 ? 121.340 102.968 11.749  1.00 47.60 ? 121 SER A OG  1 
ATOM   906  N N   . SER A 1 122 ? 118.848 101.046 13.491  1.00 53.85 ? 122 SER A N   1 
ATOM   907  C CA  . SER A 1 122 ? 118.833 99.612  13.707  1.00 55.61 ? 122 SER A CA  1 
ATOM   908  C C   . SER A 1 122 ? 119.943 99.006  12.848  1.00 55.86 ? 122 SER A C   1 
ATOM   909  O O   . SER A 1 122 ? 120.636 98.079  13.271  1.00 55.22 ? 122 SER A O   1 
ATOM   910  C CB  . SER A 1 122 ? 117.469 99.049  13.300  1.00 57.23 ? 122 SER A CB  1 
ATOM   911  O OG  . SER A 1 122 ? 117.379 97.665  13.583  1.00 60.68 ? 122 SER A OG  1 
ATOM   912  N N   . GLU A 1 123 ? 120.118 99.551  11.646  1.00 56.82 ? 123 GLU A N   1 
ATOM   913  C CA  . GLU A 1 123 ? 121.147 99.065  10.735  1.00 57.40 ? 123 GLU A CA  1 
ATOM   914  C C   . GLU A 1 123 ? 122.535 99.237  11.334  1.00 57.50 ? 123 GLU A C   1 
ATOM   915  O O   . GLU A 1 123 ? 123.366 98.331  11.249  1.00 57.87 ? 123 GLU A O   1 
ATOM   916  C CB  . GLU A 1 123 ? 121.084 99.799  9.390   1.00 58.28 ? 123 GLU A CB  1 
ATOM   917  C CG  . GLU A 1 123 ? 119.784 99.612  8.630   1.00 60.92 ? 123 GLU A CG  1 
ATOM   918  C CD  . GLU A 1 123 ? 118.770 100.705 8.922   1.00 62.42 ? 123 GLU A CD  1 
ATOM   919  O OE1 . GLU A 1 123 ? 118.522 100.996 10.114  1.00 62.15 ? 123 GLU A OE1 1 
ATOM   920  O OE2 . GLU A 1 123 ? 118.219 101.269 7.952   1.00 62.54 ? 123 GLU A OE2 1 
ATOM   921  N N   . GLN A 1 124 ? 122.789 100.395 11.941  1.00 57.02 ? 124 GLN A N   1 
ATOM   922  C CA  . GLN A 1 124 ? 124.095 100.643 12.535  1.00 57.75 ? 124 GLN A CA  1 
ATOM   923  C C   . GLN A 1 124 ? 124.363 99.701  13.703  1.00 58.24 ? 124 GLN A C   1 
ATOM   924  O O   . GLN A 1 124 ? 125.435 99.105  13.788  1.00 58.41 ? 124 GLN A O   1 
ATOM   925  C CB  . GLN A 1 124 ? 124.237 102.101 13.009  1.00 56.15 ? 124 GLN A CB  1 
ATOM   926  C CG  . GLN A 1 124 ? 125.578 102.354 13.712  1.00 54.27 ? 124 GLN A CG  1 
ATOM   927  C CD  . GLN A 1 124 ? 125.833 103.808 14.071  1.00 52.53 ? 124 GLN A CD  1 
ATOM   928  O OE1 . GLN A 1 124 ? 124.957 104.503 14.590  1.00 50.76 ? 124 GLN A OE1 1 
ATOM   929  N NE2 . GLN A 1 124 ? 127.054 104.268 13.817  1.00 52.14 ? 124 GLN A NE2 1 
ATOM   930  N N   . LEU A 1 125 ? 123.395 99.575  14.603  1.00 59.12 ? 125 LEU A N   1 
ATOM   931  C CA  . LEU A 1 125 ? 123.551 98.695  15.757  1.00 61.14 ? 125 LEU A CA  1 
ATOM   932  C C   . LEU A 1 125 ? 124.015 97.314  15.304  1.00 62.31 ? 125 LEU A C   1 
ATOM   933  O O   . LEU A 1 125 ? 124.898 96.713  15.916  1.00 62.89 ? 125 LEU A O   1 
ATOM   934  C CB  . LEU A 1 125 ? 122.225 98.579  16.512  1.00 60.42 ? 125 LEU A CB  1 
ATOM   935  C CG  . LEU A 1 125 ? 121.727 99.858  17.188  1.00 59.68 ? 125 LEU A CG  1 
ATOM   936  C CD1 . LEU A 1 125 ? 120.269 99.701  17.573  1.00 60.12 ? 125 LEU A CD1 1 
ATOM   937  C CD2 . LEU A 1 125 ? 122.584 100.161 18.404  1.00 58.36 ? 125 LEU A CD2 1 
ATOM   938  N N   . THR A 1 126 ? 123.422 96.829  14.217  1.00 63.65 ? 126 THR A N   1 
ATOM   939  C CA  . THR A 1 126 ? 123.752 95.521  13.660  1.00 64.97 ? 126 THR A CA  1 
ATOM   940  C C   . THR A 1 126 ? 125.249 95.337  13.399  1.00 65.90 ? 126 THR A C   1 
ATOM   941  O O   . THR A 1 126 ? 125.748 94.212  13.390  1.00 66.48 ? 126 THR A O   1 
ATOM   942  C CB  . THR A 1 126 ? 122.992 95.282  12.337  1.00 65.06 ? 126 THR A CB  1 
ATOM   943  O OG1 . THR A 1 126 ? 121.583 95.400  12.567  1.00 64.72 ? 126 THR A OG1 1 
ATOM   944  C CG2 . THR A 1 126 ? 123.292 93.894  11.792  1.00 65.14 ? 126 THR A CG2 1 
ATOM   945  N N   . SER A 1 127 ? 125.966 96.437  13.190  1.00 66.62 ? 127 SER A N   1 
ATOM   946  C CA  . SER A 1 127 ? 127.398 96.361  12.922  1.00 67.43 ? 127 SER A CA  1 
ATOM   947  C C   . SER A 1 127 ? 128.247 96.568  14.175  1.00 67.56 ? 127 SER A C   1 
ATOM   948  O O   . SER A 1 127 ? 129.464 96.745  14.085  1.00 68.60 ? 127 SER A O   1 
ATOM   949  C CB  . SER A 1 127 ? 127.796 97.389  11.856  1.00 68.71 ? 127 SER A CB  1 
ATOM   950  O OG  . SER A 1 127 ? 127.610 98.717  12.321  1.00 70.79 ? 127 SER A OG  1 
ATOM   951  N N   . GLY A 1 128 ? 127.606 96.546  15.341  1.00 66.87 ? 128 GLY A N   1 
ATOM   952  C CA  . GLY A 1 128 ? 128.336 96.720  16.586  1.00 65.06 ? 128 GLY A CA  1 
ATOM   953  C C   . GLY A 1 128 ? 128.730 98.155  16.887  1.00 63.86 ? 128 GLY A C   1 
ATOM   954  O O   . GLY A 1 128 ? 129.666 98.408  17.650  1.00 63.83 ? 128 GLY A O   1 
ATOM   955  N N   . GLY A 1 129 ? 128.012 99.099  16.289  1.00 62.13 ? 129 GLY A N   1 
ATOM   956  C CA  . GLY A 1 129 ? 128.307 100.501 16.513  1.00 59.51 ? 129 GLY A CA  1 
ATOM   957  C C   . GLY A 1 129 ? 127.054 101.306 16.793  1.00 57.24 ? 129 GLY A C   1 
ATOM   958  O O   . GLY A 1 129 ? 125.955 100.924 16.390  1.00 57.39 ? 129 GLY A O   1 
ATOM   959  N N   . ALA A 1 130 ? 127.215 102.425 17.487  1.00 54.67 ? 130 ALA A N   1 
ATOM   960  C CA  . ALA A 1 130 ? 126.083 103.279 17.811  1.00 52.25 ? 130 ALA A CA  1 
ATOM   961  C C   . ALA A 1 130 ? 126.490 104.748 17.805  1.00 50.71 ? 130 ALA A C   1 
ATOM   962  O O   . ALA A 1 130 ? 127.378 105.166 18.550  1.00 51.94 ? 130 ALA A O   1 
ATOM   963  C CB  . ALA A 1 130 ? 125.513 102.898 19.172  1.00 52.07 ? 130 ALA A CB  1 
ATOM   964  N N   . SER A 1 131 ? 125.839 105.528 16.951  1.00 47.33 ? 131 SER A N   1 
ATOM   965  C CA  . SER A 1 131 ? 126.118 106.950 16.860  1.00 44.06 ? 131 SER A CA  1 
ATOM   966  C C   . SER A 1 131 ? 124.851 107.730 17.192  1.00 42.28 ? 131 SER A C   1 
ATOM   967  O O   . SER A 1 131 ? 123.807 107.514 16.583  1.00 42.24 ? 131 SER A O   1 
ATOM   968  C CB  . SER A 1 131 ? 126.586 107.320 15.447  1.00 43.86 ? 131 SER A CB  1 
ATOM   969  O OG  . SER A 1 131 ? 127.788 106.656 15.102  1.00 41.07 ? 131 SER A OG  1 
ATOM   970  N N   . VAL A 1 132 ? 124.937 108.623 18.168  1.00 40.01 ? 132 VAL A N   1 
ATOM   971  C CA  . VAL A 1 132 ? 123.783 109.435 18.522  1.00 39.17 ? 132 VAL A CA  1 
ATOM   972  C C   . VAL A 1 132 ? 124.029 110.807 17.908  1.00 38.80 ? 132 VAL A C   1 
ATOM   973  O O   . VAL A 1 132 ? 124.987 111.499 18.268  1.00 39.11 ? 132 VAL A O   1 
ATOM   974  C CB  . VAL A 1 132 ? 123.618 109.563 20.046  1.00 38.47 ? 132 VAL A CB  1 
ATOM   975  C CG1 . VAL A 1 132 ? 122.296 110.240 20.357  1.00 35.93 ? 132 VAL A CG1 1 
ATOM   976  C CG2 . VAL A 1 132 ? 123.691 108.179 20.701  1.00 37.78 ? 132 VAL A CG2 1 
ATOM   977  N N   . VAL A 1 133 ? 123.163 111.189 16.974  1.00 37.60 ? 133 VAL A N   1 
ATOM   978  C CA  . VAL A 1 133 ? 123.303 112.452 16.268  1.00 35.80 ? 133 VAL A CA  1 
ATOM   979  C C   . VAL A 1 133 ? 122.372 113.545 16.747  1.00 36.20 ? 133 VAL A C   1 
ATOM   980  O O   . VAL A 1 133 ? 121.205 113.306 17.038  1.00 35.94 ? 133 VAL A O   1 
ATOM   981  C CB  . VAL A 1 133 ? 123.067 112.261 14.758  1.00 36.66 ? 133 VAL A CB  1 
ATOM   982  C CG1 . VAL A 1 133 ? 123.234 113.591 14.029  1.00 34.77 ? 133 VAL A CG1 1 
ATOM   983  C CG2 . VAL A 1 133 ? 124.029 111.223 14.214  1.00 36.08 ? 133 VAL A CG2 1 
ATOM   984  N N   . CYS A 1 134 ? 122.902 114.758 16.820  1.00 35.27 ? 134 CYS A N   1 
ATOM   985  C CA  . CYS A 1 134 ? 122.110 115.892 17.237  1.00 35.85 ? 134 CYS A CA  1 
ATOM   986  C C   . CYS A 1 134 ? 122.347 117.071 16.300  1.00 35.43 ? 134 CYS A C   1 
ATOM   987  O O   . CYS A 1 134 ? 123.489 117.388 15.977  1.00 35.09 ? 134 CYS A O   1 
ATOM   988  C CB  . CYS A 1 134 ? 122.475 116.288 18.661  1.00 36.86 ? 134 CYS A CB  1 
ATOM   989  S SG  . CYS A 1 134 ? 121.555 117.708 19.202  1.00 41.64 ? 134 CYS A SG  1 
ATOM   990  N N   . PHE A 1 135 ? 121.267 117.712 15.863  1.00 35.78 ? 135 PHE A N   1 
ATOM   991  C CA  . PHE A 1 135 ? 121.373 118.866 14.975  1.00 36.42 ? 135 PHE A CA  1 
ATOM   992  C C   . PHE A 1 135 ? 120.955 120.140 15.688  1.00 37.39 ? 135 PHE A C   1 
ATOM   993  O O   . PHE A 1 135 ? 119.946 120.163 16.394  1.00 37.95 ? 135 PHE A O   1 
ATOM   994  C CB  . PHE A 1 135 ? 120.470 118.735 13.734  1.00 35.26 ? 135 PHE A CB  1 
ATOM   995  C CG  . PHE A 1 135 ? 120.862 117.636 12.779  1.00 36.26 ? 135 PHE A CG  1 
ATOM   996  C CD1 . PHE A 1 135 ? 122.194 117.272 12.603  1.00 35.30 ? 135 PHE A CD1 1 
ATOM   997  C CD2 . PHE A 1 135 ? 119.887 116.990 12.020  1.00 34.36 ? 135 PHE A CD2 1 
ATOM   998  C CE1 . PHE A 1 135 ? 122.546 116.280 11.688  1.00 36.86 ? 135 PHE A CE1 1 
ATOM   999  C CE2 . PHE A 1 135 ? 120.229 115.998 11.101  1.00 33.22 ? 135 PHE A CE2 1 
ATOM   1000 C CZ  . PHE A 1 135 ? 121.557 115.642 10.935  1.00 36.21 ? 135 PHE A CZ  1 
ATOM   1001 N N   . LEU A 1 136 ? 121.747 121.192 15.502  1.00 36.56 ? 136 LEU A N   1 
ATOM   1002 C CA  . LEU A 1 136 ? 121.457 122.516 16.041  1.00 37.08 ? 136 LEU A CA  1 
ATOM   1003 C C   . LEU A 1 136 ? 121.335 123.301 14.725  1.00 37.48 ? 136 LEU A C   1 
ATOM   1004 O O   . LEU A 1 136 ? 122.326 123.805 14.186  1.00 35.88 ? 136 LEU A O   1 
ATOM   1005 C CB  . LEU A 1 136 ? 122.625 123.037 16.892  1.00 35.47 ? 136 LEU A CB  1 
ATOM   1006 C CG  . LEU A 1 136 ? 123.126 122.166 18.051  1.00 36.71 ? 136 LEU A CG  1 
ATOM   1007 C CD1 . LEU A 1 136 ? 124.025 123.008 18.948  1.00 34.07 ? 136 LEU A CD1 1 
ATOM   1008 C CD2 . LEU A 1 136 ? 121.964 121.624 18.857  1.00 36.68 ? 136 LEU A CD2 1 
ATOM   1009 N N   . ASN A 1 137 ? 120.114 123.376 14.206  1.00 37.21 ? 137 ASN A N   1 
ATOM   1010 C CA  . ASN A 1 137 ? 119.867 124.012 12.919  1.00 36.97 ? 137 ASN A CA  1 
ATOM   1011 C C   . ASN A 1 137 ? 119.352 125.440 12.845  1.00 36.42 ? 137 ASN A C   1 
ATOM   1012 O O   . ASN A 1 137 ? 118.556 125.891 13.672  1.00 37.20 ? 137 ASN A O   1 
ATOM   1013 C CB  . ASN A 1 137 ? 118.925 123.126 12.092  1.00 36.88 ? 137 ASN A CB  1 
ATOM   1014 C CG  . ASN A 1 137 ? 119.595 121.856 11.599  1.00 37.29 ? 137 ASN A CG  1 
ATOM   1015 O OD1 . ASN A 1 137 ? 118.936 120.960 11.060  1.00 36.84 ? 137 ASN A OD1 1 
ATOM   1016 N ND2 . ASN A 1 137 ? 120.907 121.774 11.769  1.00 35.16 ? 137 ASN A ND2 1 
ATOM   1017 N N   . ASN A 1 138 ? 119.824 126.124 11.804  1.00 35.51 ? 138 ASN A N   1 
ATOM   1018 C CA  . ASN A 1 138 ? 119.449 127.489 11.462  1.00 34.11 ? 138 ASN A CA  1 
ATOM   1019 C C   . ASN A 1 138 ? 119.441 128.527 12.573  1.00 33.09 ? 138 ASN A C   1 
ATOM   1020 O O   . ASN A 1 138 ? 118.423 129.160 12.842  1.00 33.15 ? 138 ASN A O   1 
ATOM   1021 C CB  . ASN A 1 138 ? 118.089 127.467 10.765  1.00 35.32 ? 138 ASN A CB  1 
ATOM   1022 C CG  . ASN A 1 138 ? 118.108 126.638 9.481   1.00 38.73 ? 138 ASN A CG  1 
ATOM   1023 O OD1 . ASN A 1 138 ? 118.411 127.146 8.393   1.00 38.85 ? 138 ASN A OD1 1 
ATOM   1024 N ND2 . ASN A 1 138 ? 117.806 125.352 9.609   1.00 34.74 ? 138 ASN A ND2 1 
ATOM   1025 N N   . PHE A 1 139 ? 120.585 128.722 13.205  1.00 32.04 ? 139 PHE A N   1 
ATOM   1026 C CA  . PHE A 1 139 ? 120.674 129.709 14.262  1.00 33.03 ? 139 PHE A CA  1 
ATOM   1027 C C   . PHE A 1 139 ? 121.597 130.852 13.833  1.00 34.29 ? 139 PHE A C   1 
ATOM   1028 O O   . PHE A 1 139 ? 122.311 130.746 12.829  1.00 31.44 ? 139 PHE A O   1 
ATOM   1029 C CB  . PHE A 1 139 ? 121.184 129.051 15.539  1.00 31.73 ? 139 PHE A CB  1 
ATOM   1030 C CG  . PHE A 1 139 ? 122.512 128.377 15.382  1.00 34.00 ? 139 PHE A CG  1 
ATOM   1031 C CD1 . PHE A 1 139 ? 123.696 129.098 15.529  1.00 33.94 ? 139 PHE A CD1 1 
ATOM   1032 C CD2 . PHE A 1 139 ? 122.584 127.020 15.086  1.00 31.84 ? 139 PHE A CD2 1 
ATOM   1033 C CE1 . PHE A 1 139 ? 124.931 128.474 15.386  1.00 33.26 ? 139 PHE A CE1 1 
ATOM   1034 C CE2 . PHE A 1 139 ? 123.809 126.389 14.941  1.00 32.08 ? 139 PHE A CE2 1 
ATOM   1035 C CZ  . PHE A 1 139 ? 124.987 127.115 15.092  1.00 34.69 ? 139 PHE A CZ  1 
ATOM   1036 N N   . TYR A 1 140 ? 121.556 131.949 14.584  1.00 35.48 ? 140 TYR A N   1 
ATOM   1037 C CA  . TYR A 1 140 ? 122.382 133.122 14.308  1.00 38.15 ? 140 TYR A CA  1 
ATOM   1038 C C   . TYR A 1 140 ? 122.381 133.990 15.561  1.00 39.02 ? 140 TYR A C   1 
ATOM   1039 O O   . TYR A 1 140 ? 121.312 134.299 16.098  1.00 39.06 ? 140 TYR A O   1 
ATOM   1040 C CB  . TYR A 1 140 ? 121.814 133.924 13.127  1.00 39.28 ? 140 TYR A CB  1 
ATOM   1041 C CG  . TYR A 1 140 ? 122.704 135.078 12.724  1.00 42.64 ? 140 TYR A CG  1 
ATOM   1042 C CD1 . TYR A 1 140 ? 122.770 136.242 13.495  1.00 43.45 ? 140 TYR A CD1 1 
ATOM   1043 C CD2 . TYR A 1 140 ? 123.562 134.965 11.633  1.00 42.19 ? 140 TYR A CD2 1 
ATOM   1044 C CE1 . TYR A 1 140 ? 123.679 137.256 13.194  1.00 44.59 ? 140 TYR A CE1 1 
ATOM   1045 C CE2 . TYR A 1 140 ? 124.473 135.970 11.323  1.00 43.74 ? 140 TYR A CE2 1 
ATOM   1046 C CZ  . TYR A 1 140 ? 124.532 137.110 12.108  1.00 45.01 ? 140 TYR A CZ  1 
ATOM   1047 O OH  . TYR A 1 140 ? 125.465 138.080 11.822  1.00 43.89 ? 140 TYR A OH  1 
ATOM   1048 N N   . PRO A 1 141 ? 123.567 134.426 16.035  1.00 39.93 ? 141 PRO A N   1 
ATOM   1049 C CA  . PRO A 1 141 ? 124.964 134.250 15.593  1.00 39.92 ? 141 PRO A CA  1 
ATOM   1050 C C   . PRO A 1 141 ? 125.503 132.818 15.511  1.00 39.26 ? 141 PRO A C   1 
ATOM   1051 O O   . PRO A 1 141 ? 124.886 131.875 16.002  1.00 40.34 ? 141 PRO A O   1 
ATOM   1052 C CB  . PRO A 1 141 ? 125.759 135.078 16.610  1.00 41.78 ? 141 PRO A CB  1 
ATOM   1053 C CG  . PRO A 1 141 ? 124.771 136.101 17.078  1.00 41.68 ? 141 PRO A CG  1 
ATOM   1054 C CD  . PRO A 1 141 ? 123.519 135.286 17.231  1.00 40.01 ? 141 PRO A CD  1 
ATOM   1055 N N   . LYS A 1 142 ? 126.680 132.679 14.908  1.00 37.29 ? 142 LYS A N   1 
ATOM   1056 C CA  . LYS A 1 142 ? 127.320 131.379 14.737  1.00 37.78 ? 142 LYS A CA  1 
ATOM   1057 C C   . LYS A 1 142 ? 127.853 130.794 16.038  1.00 37.58 ? 142 LYS A C   1 
ATOM   1058 O O   . LYS A 1 142 ? 128.058 129.588 16.141  1.00 38.35 ? 142 LYS A O   1 
ATOM   1059 C CB  . LYS A 1 142 ? 128.451 131.482 13.713  1.00 37.15 ? 142 LYS A CB  1 
ATOM   1060 N N   . ASP A 1 143 ? 128.080 131.641 17.032  1.00 37.49 ? 143 ASP A N   1 
ATOM   1061 C CA  . ASP A 1 143 ? 128.589 131.171 18.315  1.00 39.71 ? 143 ASP A CA  1 
ATOM   1062 C C   . ASP A 1 143 ? 127.533 130.311 18.999  1.00 38.71 ? 143 ASP A C   1 
ATOM   1063 O O   . ASP A 1 143 ? 126.381 130.720 19.118  1.00 37.58 ? 143 ASP A O   1 
ATOM   1064 C CB  . ASP A 1 143 ? 128.928 132.365 19.201  1.00 42.69 ? 143 ASP A CB  1 
ATOM   1065 C CG  . ASP A 1 143 ? 129.819 133.361 18.498  1.00 47.45 ? 143 ASP A CG  1 
ATOM   1066 O OD1 . ASP A 1 143 ? 131.015 133.041 18.304  1.00 49.15 ? 143 ASP A OD1 1 
ATOM   1067 O OD2 . ASP A 1 143 ? 129.318 134.449 18.124  1.00 49.15 ? 143 ASP A OD2 1 
ATOM   1068 N N   . ILE A 1 144 ? 127.927 129.127 19.453  1.00 37.51 ? 144 ILE A N   1 
ATOM   1069 C CA  . ILE A 1 144 ? 126.985 128.239 20.115  1.00 39.49 ? 144 ILE A CA  1 
ATOM   1070 C C   . ILE A 1 144 ? 127.752 127.102 20.774  1.00 40.13 ? 144 ILE A C   1 
ATOM   1071 O O   . ILE A 1 144 ? 128.818 126.706 20.298  1.00 40.88 ? 144 ILE A O   1 
ATOM   1072 C CB  . ILE A 1 144 ? 125.973 127.666 19.090  1.00 39.14 ? 144 ILE A CB  1 
ATOM   1073 C CG1 . ILE A 1 144 ? 124.779 127.035 19.809  1.00 41.44 ? 144 ILE A CG1 1 
ATOM   1074 C CG2 . ILE A 1 144 ? 126.666 126.650 18.205  1.00 39.51 ? 144 ILE A CG2 1 
ATOM   1075 C CD1 . ILE A 1 144 ? 123.609 126.719 18.895  1.00 40.47 ? 144 ILE A CD1 1 
ATOM   1076 N N   . ASN A 1 145 ? 127.220 126.589 21.877  1.00 40.87 ? 145 ASN A N   1 
ATOM   1077 C CA  . ASN A 1 145 ? 127.868 125.491 22.591  1.00 41.35 ? 145 ASN A CA  1 
ATOM   1078 C C   . ASN A 1 145 ? 126.912 124.313 22.733  1.00 40.88 ? 145 ASN A C   1 
ATOM   1079 O O   . ASN A 1 145 ? 125.721 124.494 22.984  1.00 39.86 ? 145 ASN A O   1 
ATOM   1080 C CB  . ASN A 1 145 ? 128.337 125.962 23.976  1.00 41.97 ? 145 ASN A CB  1 
ATOM   1081 N N   . VAL A 1 146 ? 127.439 123.107 22.558  1.00 41.04 ? 146 VAL A N   1 
ATOM   1082 C CA  . VAL A 1 146 ? 126.632 121.902 22.680  1.00 42.38 ? 146 VAL A CA  1 
ATOM   1083 C C   . VAL A 1 146 ? 127.221 121.003 23.766  1.00 42.93 ? 146 VAL A C   1 
ATOM   1084 O O   . VAL A 1 146 ? 128.434 120.792 23.822  1.00 42.13 ? 146 VAL A O   1 
ATOM   1085 C CB  . VAL A 1 146 ? 126.571 121.124 21.340  1.00 42.42 ? 146 VAL A CB  1 
ATOM   1086 C CG1 . VAL A 1 146 ? 127.937 120.556 20.993  1.00 42.53 ? 146 VAL A CG1 1 
ATOM   1087 C CG2 . VAL A 1 146 ? 125.534 120.021 21.431  1.00 42.83 ? 146 VAL A CG2 1 
ATOM   1088 N N   . LYS A 1 147 ? 126.359 120.485 24.634  1.00 42.69 ? 147 LYS A N   1 
ATOM   1089 C CA  . LYS A 1 147 ? 126.806 119.617 25.716  1.00 43.26 ? 147 LYS A CA  1 
ATOM   1090 C C   . LYS A 1 147 ? 126.004 118.327 25.745  1.00 44.04 ? 147 LYS A C   1 
ATOM   1091 O O   . LYS A 1 147 ? 124.777 118.341 25.635  1.00 42.07 ? 147 LYS A O   1 
ATOM   1092 C CB  . LYS A 1 147 ? 126.674 120.338 27.058  1.00 42.20 ? 147 LYS A CB  1 
ATOM   1093 N N   . TRP A 1 148 ? 126.709 117.211 25.879  1.00 44.07 ? 148 TRP A N   1 
ATOM   1094 C CA  . TRP A 1 148 ? 126.059 115.921 25.954  1.00 45.79 ? 148 TRP A CA  1 
ATOM   1095 C C   . TRP A 1 148 ? 126.026 115.441 27.394  1.00 47.58 ? 148 TRP A C   1 
ATOM   1096 O O   . TRP A 1 148 ? 126.925 115.747 28.185  1.00 48.28 ? 148 TRP A O   1 
ATOM   1097 C CB  . TRP A 1 148 ? 126.797 114.884 25.113  1.00 44.92 ? 148 TRP A CB  1 
ATOM   1098 C CG  . TRP A 1 148 ? 126.613 115.064 23.660  1.00 44.07 ? 148 TRP A CG  1 
ATOM   1099 C CD1 . TRP A 1 148 ? 127.323 115.890 22.838  1.00 44.05 ? 148 TRP A CD1 1 
ATOM   1100 C CD2 . TRP A 1 148 ? 125.637 114.419 22.840  1.00 43.14 ? 148 TRP A CD2 1 
ATOM   1101 N NE1 . TRP A 1 148 ? 126.851 115.797 21.553  1.00 44.17 ? 148 TRP A NE1 1 
ATOM   1102 C CE2 . TRP A 1 148 ? 125.814 114.902 21.524  1.00 43.92 ? 148 TRP A CE2 1 
ATOM   1103 C CE3 . TRP A 1 148 ? 124.628 113.479 23.087  1.00 42.12 ? 148 TRP A CE3 1 
ATOM   1104 C CZ2 . TRP A 1 148 ? 125.015 114.476 20.453  1.00 41.91 ? 148 TRP A CZ2 1 
ATOM   1105 C CZ3 . TRP A 1 148 ? 123.834 113.054 22.022  1.00 41.74 ? 148 TRP A CZ3 1 
ATOM   1106 C CH2 . TRP A 1 148 ? 124.034 113.555 20.721  1.00 42.74 ? 148 TRP A CH2 1 
ATOM   1107 N N   . LYS A 1 149 ? 124.975 114.696 27.721  1.00 48.13 ? 149 LYS A N   1 
ATOM   1108 C CA  . LYS A 1 149 ? 124.790 114.114 29.045  1.00 48.78 ? 149 LYS A CA  1 
ATOM   1109 C C   . LYS A 1 149 ? 124.207 112.714 28.890  1.00 48.77 ? 149 LYS A C   1 
ATOM   1110 O O   . LYS A 1 149 ? 123.248 112.510 28.145  1.00 48.87 ? 149 LYS A O   1 
ATOM   1111 C CB  . LYS A 1 149 ? 123.838 114.961 29.898  1.00 49.03 ? 149 LYS A CB  1 
ATOM   1112 C CG  . LYS A 1 149 ? 124.472 116.176 30.544  1.00 47.50 ? 149 LYS A CG  1 
ATOM   1113 C CD  . LYS A 1 149 ? 123.503 116.857 31.486  1.00 46.81 ? 149 LYS A CD  1 
ATOM   1114 C CE  . LYS A 1 149 ? 124.187 117.992 32.230  1.00 47.89 ? 149 LYS A CE  1 
ATOM   1115 N NZ  . LYS A 1 149 ? 123.253 118.701 33.151  1.00 48.96 ? 149 LYS A NZ  1 
ATOM   1116 N N   . ILE A 1 150 ? 124.808 111.754 29.582  1.00 49.17 ? 150 ILE A N   1 
ATOM   1117 C CA  . ILE A 1 150 ? 124.355 110.372 29.555  1.00 49.32 ? 150 ILE A CA  1 
ATOM   1118 C C   . ILE A 1 150 ? 123.888 110.037 30.968  1.00 50.16 ? 150 ILE A C   1 
ATOM   1119 O O   . ILE A 1 150 ? 124.663 110.114 31.926  1.00 48.74 ? 150 ILE A O   1 
ATOM   1120 C CB  . ILE A 1 150 ? 125.490 109.411 29.143  1.00 48.75 ? 150 ILE A CB  1 
ATOM   1121 C CG1 . ILE A 1 150 ? 125.899 109.678 27.692  1.00 48.46 ? 150 ILE A CG1 1 
ATOM   1122 C CG2 . ILE A 1 150 ? 125.033 107.968 29.295  1.00 50.36 ? 150 ILE A CG2 1 
ATOM   1123 C CD1 . ILE A 1 150 ? 127.000 108.770 27.186  1.00 46.57 ? 150 ILE A CD1 1 
ATOM   1124 N N   . ASP A 1 151 ? 122.614 109.677 31.084  1.00 50.44 ? 151 ASP A N   1 
ATOM   1125 C CA  . ASP A 1 151 ? 122.005 109.354 32.371  1.00 51.41 ? 151 ASP A CA  1 
ATOM   1126 C C   . ASP A 1 151 ? 122.237 110.466 33.392  1.00 51.80 ? 151 ASP A C   1 
ATOM   1127 O O   . ASP A 1 151 ? 122.564 110.206 34.551  1.00 50.57 ? 151 ASP A O   1 
ATOM   1128 C CB  . ASP A 1 151 ? 122.537 108.020 32.910  1.00 51.09 ? 151 ASP A CB  1 
ATOM   1129 C CG  . ASP A 1 151 ? 122.105 106.835 32.059  1.00 51.63 ? 151 ASP A CG  1 
ATOM   1130 O OD1 . ASP A 1 151 ? 120.922 106.791 31.655  1.00 50.77 ? 151 ASP A OD1 1 
ATOM   1131 O OD2 . ASP A 1 151 ? 122.942 105.943 31.801  1.00 52.68 ? 151 ASP A OD2 1 
ATOM   1132 N N   . GLY A 1 152 ? 122.075 111.708 32.943  1.00 51.80 ? 152 GLY A N   1 
ATOM   1133 C CA  . GLY A 1 152 ? 122.242 112.845 33.830  1.00 52.13 ? 152 GLY A CA  1 
ATOM   1134 C C   . GLY A 1 152 ? 123.650 113.382 34.008  1.00 52.13 ? 152 GLY A C   1 
ATOM   1135 O O   . GLY A 1 152 ? 123.827 114.479 34.538  1.00 51.35 ? 152 GLY A O   1 
ATOM   1136 N N   . SER A 1 153 ? 124.655 112.627 33.575  1.00 53.18 ? 153 SER A N   1 
ATOM   1137 C CA  . SER A 1 153 ? 126.037 113.075 33.718  1.00 55.52 ? 153 SER A CA  1 
ATOM   1138 C C   . SER A 1 153 ? 126.685 113.488 32.397  1.00 55.52 ? 153 SER A C   1 
ATOM   1139 O O   . SER A 1 153 ? 126.637 112.754 31.409  1.00 54.42 ? 153 SER A O   1 
ATOM   1140 C CB  . SER A 1 153 ? 126.872 111.984 34.392  1.00 56.41 ? 153 SER A CB  1 
ATOM   1141 O OG  . SER A 1 153 ? 126.447 111.786 35.730  1.00 59.03 ? 153 SER A OG  1 
ATOM   1142 N N   . GLU A 1 154 ? 127.299 114.667 32.397  1.00 56.54 ? 154 GLU A N   1 
ATOM   1143 C CA  . GLU A 1 154 ? 127.962 115.206 31.213  1.00 57.60 ? 154 GLU A CA  1 
ATOM   1144 C C   . GLU A 1 154 ? 128.954 114.230 30.579  1.00 56.87 ? 154 GLU A C   1 
ATOM   1145 O O   . GLU A 1 154 ? 129.740 113.585 31.270  1.00 56.32 ? 154 GLU A O   1 
ATOM   1146 C CB  . GLU A 1 154 ? 128.675 116.515 31.568  1.00 58.69 ? 154 GLU A CB  1 
ATOM   1147 C CG  . GLU A 1 154 ? 129.460 117.135 30.421  1.00 61.08 ? 154 GLU A CG  1 
ATOM   1148 C CD  . GLU A 1 154 ? 130.034 118.495 30.777  1.00 62.33 ? 154 GLU A CD  1 
ATOM   1149 O OE1 . GLU A 1 154 ? 130.805 118.582 31.755  1.00 63.68 ? 154 GLU A OE1 1 
ATOM   1150 O OE2 . GLU A 1 154 ? 129.714 119.479 30.078  1.00 62.87 ? 154 GLU A OE2 1 
ATOM   1151 N N   . ARG A 1 155 ? 128.902 114.128 29.255  1.00 56.56 ? 155 ARG A N   1 
ATOM   1152 C CA  . ARG A 1 155 ? 129.789 113.245 28.504  1.00 57.17 ? 155 ARG A CA  1 
ATOM   1153 C C   . ARG A 1 155 ? 130.591 114.060 27.488  1.00 57.38 ? 155 ARG A C   1 
ATOM   1154 O O   . ARG A 1 155 ? 130.044 114.935 26.817  1.00 57.69 ? 155 ARG A O   1 
ATOM   1155 C CB  . ARG A 1 155 ? 128.967 112.177 27.780  1.00 56.88 ? 155 ARG A CB  1 
ATOM   1156 C CG  . ARG A 1 155 ? 129.776 111.256 26.878  1.00 57.17 ? 155 ARG A CG  1 
ATOM   1157 C CD  . ARG A 1 155 ? 130.888 110.568 27.648  1.00 56.93 ? 155 ARG A CD  1 
ATOM   1158 N NE  . ARG A 1 155 ? 131.598 109.587 26.834  1.00 56.69 ? 155 ARG A NE  1 
ATOM   1159 C CZ  . ARG A 1 155 ? 131.129 108.381 26.530  1.00 57.62 ? 155 ARG A CZ  1 
ATOM   1160 N NH1 . ARG A 1 155 ? 129.941 107.996 26.976  1.00 57.96 ? 155 ARG A NH1 1 
ATOM   1161 N NH2 . ARG A 1 155 ? 131.854 107.557 25.783  1.00 57.35 ? 155 ARG A NH2 1 
ATOM   1162 N N   . GLN A 1 156 ? 131.884 113.774 27.370  1.00 57.33 ? 156 GLN A N   1 
ATOM   1163 C CA  . GLN A 1 156 ? 132.726 114.506 26.431  1.00 57.28 ? 156 GLN A CA  1 
ATOM   1164 C C   . GLN A 1 156 ? 133.468 113.602 25.458  1.00 55.92 ? 156 GLN A C   1 
ATOM   1165 O O   . GLN A 1 156 ? 133.740 113.995 24.327  1.00 56.23 ? 156 GLN A O   1 
ATOM   1166 C CB  . GLN A 1 156 ? 133.736 115.372 27.188  1.00 60.13 ? 156 GLN A CB  1 
ATOM   1167 C CG  . GLN A 1 156 ? 133.104 116.380 28.141  1.00 62.90 ? 156 GLN A CG  1 
ATOM   1168 C CD  . GLN A 1 156 ? 134.127 117.306 28.776  1.00 64.31 ? 156 GLN A CD  1 
ATOM   1169 O OE1 . GLN A 1 156 ? 135.153 116.859 29.284  1.00 65.48 ? 156 GLN A OE1 1 
ATOM   1170 N NE2 . GLN A 1 156 ? 133.845 118.604 28.758  1.00 65.32 ? 156 GLN A NE2 1 
ATOM   1171 N N   . ASN A 1 157 ? 133.796 112.391 25.893  1.00 54.35 ? 157 ASN A N   1 
ATOM   1172 C CA  . ASN A 1 157 ? 134.510 111.457 25.034  1.00 53.84 ? 157 ASN A CA  1 
ATOM   1173 C C   . ASN A 1 157 ? 133.598 110.925 23.930  1.00 53.53 ? 157 ASN A C   1 
ATOM   1174 O O   . ASN A 1 157 ? 132.422 110.653 24.167  1.00 53.18 ? 157 ASN A O   1 
ATOM   1175 C CB  . ASN A 1 157 ? 135.067 110.299 25.865  1.00 53.54 ? 157 ASN A CB  1 
ATOM   1176 N N   . GLY A 1 158 ? 134.149 110.794 22.725  1.00 52.94 ? 158 GLY A N   1 
ATOM   1177 C CA  . GLY A 1 158 ? 133.386 110.285 21.596  1.00 51.99 ? 158 GLY A CA  1 
ATOM   1178 C C   . GLY A 1 158 ? 132.534 111.301 20.852  1.00 51.20 ? 158 GLY A C   1 
ATOM   1179 O O   . GLY A 1 158 ? 131.797 110.942 19.930  1.00 51.41 ? 158 GLY A O   1 
ATOM   1180 N N   . VAL A 1 159 ? 132.632 112.567 21.243  1.00 49.92 ? 159 VAL A N   1 
ATOM   1181 C CA  . VAL A 1 159 ? 131.856 113.627 20.605  1.00 48.24 ? 159 VAL A CA  1 
ATOM   1182 C C   . VAL A 1 159 ? 132.648 114.357 19.522  1.00 47.27 ? 159 VAL A C   1 
ATOM   1183 O O   . VAL A 1 159 ? 133.772 114.796 19.754  1.00 47.33 ? 159 VAL A O   1 
ATOM   1184 C CB  . VAL A 1 159 ? 131.383 114.671 21.641  1.00 47.43 ? 159 VAL A CB  1 
ATOM   1185 C CG1 . VAL A 1 159 ? 130.540 115.737 20.957  1.00 47.29 ? 159 VAL A CG1 1 
ATOM   1186 C CG2 . VAL A 1 159 ? 130.590 113.990 22.743  1.00 46.24 ? 159 VAL A CG2 1 
ATOM   1187 N N   . LEU A 1 160 ? 132.054 114.475 18.338  1.00 45.44 ? 160 LEU A N   1 
ATOM   1188 C CA  . LEU A 1 160 ? 132.684 115.169 17.216  1.00 43.85 ? 160 LEU A CA  1 
ATOM   1189 C C   . LEU A 1 160 ? 131.692 116.176 16.655  1.00 42.33 ? 160 LEU A C   1 
ATOM   1190 O O   . LEU A 1 160 ? 130.549 115.827 16.335  1.00 41.95 ? 160 LEU A O   1 
ATOM   1191 C CB  . LEU A 1 160 ? 133.089 114.178 16.123  1.00 43.12 ? 160 LEU A CB  1 
ATOM   1192 C CG  . LEU A 1 160 ? 134.171 113.168 16.504  1.00 44.77 ? 160 LEU A CG  1 
ATOM   1193 C CD1 . LEU A 1 160 ? 134.393 112.191 15.359  1.00 44.67 ? 160 LEU A CD1 1 
ATOM   1194 C CD2 . LEU A 1 160 ? 135.465 113.901 16.835  1.00 46.16 ? 160 LEU A CD2 1 
ATOM   1195 N N   . ASN A 1 161 ? 132.127 117.426 16.544  1.00 40.19 ? 161 ASN A N   1 
ATOM   1196 C CA  . ASN A 1 161 ? 131.264 118.481 16.032  1.00 39.95 ? 161 ASN A CA  1 
ATOM   1197 C C   . ASN A 1 161 ? 131.649 118.966 14.637  1.00 39.24 ? 161 ASN A C   1 
ATOM   1198 O O   . ASN A 1 161 ? 132.806 118.872 14.229  1.00 38.42 ? 161 ASN A O   1 
ATOM   1199 C CB  . ASN A 1 161 ? 131.258 119.670 16.992  1.00 39.55 ? 161 ASN A CB  1 
ATOM   1200 C CG  . ASN A 1 161 ? 130.792 119.293 18.387  1.00 43.09 ? 161 ASN A CG  1 
ATOM   1201 O OD1 . ASN A 1 161 ? 129.845 118.519 18.547  1.00 39.92 ? 161 ASN A OD1 1 
ATOM   1202 N ND2 . ASN A 1 161 ? 131.446 119.855 19.407  1.00 41.13 ? 161 ASN A ND2 1 
ATOM   1203 N N   . SER A 1 162 ? 130.658 119.483 13.916  1.00 38.92 ? 162 SER A N   1 
ATOM   1204 C CA  . SER A 1 162 ? 130.857 120.009 12.570  1.00 38.47 ? 162 SER A CA  1 
ATOM   1205 C C   . SER A 1 162 ? 129.964 121.235 12.391  1.00 37.92 ? 162 SER A C   1 
ATOM   1206 O O   . SER A 1 162 ? 128.779 121.207 12.724  1.00 37.24 ? 162 SER A O   1 
ATOM   1207 C CB  . SER A 1 162 ? 130.503 118.947 11.523  1.00 38.64 ? 162 SER A CB  1 
ATOM   1208 O OG  . SER A 1 162 ? 130.762 119.414 10.207  1.00 39.46 ? 162 SER A OG  1 
ATOM   1209 N N   . TRP A 1 163 ? 130.537 122.313 11.872  1.00 38.47 ? 163 TRP A N   1 
ATOM   1210 C CA  . TRP A 1 163 ? 129.786 123.545 11.658  1.00 39.50 ? 163 TRP A CA  1 
ATOM   1211 C C   . TRP A 1 163 ? 129.736 123.865 10.173  1.00 38.98 ? 163 TRP A C   1 
ATOM   1212 O O   . TRP A 1 163 ? 130.736 123.713 9.476   1.00 37.46 ? 163 TRP A O   1 
ATOM   1213 C CB  . TRP A 1 163 ? 130.461 124.722 12.372  1.00 41.59 ? 163 TRP A CB  1 
ATOM   1214 C CG  . TRP A 1 163 ? 130.593 124.565 13.841  1.00 44.63 ? 163 TRP A CG  1 
ATOM   1215 C CD1 . TRP A 1 163 ? 129.824 125.154 14.806  1.00 44.20 ? 163 TRP A CD1 1 
ATOM   1216 C CD2 . TRP A 1 163 ? 131.555 123.758 14.528  1.00 45.67 ? 163 TRP A CD2 1 
ATOM   1217 N NE1 . TRP A 1 163 ? 130.250 124.761 16.055  1.00 45.32 ? 163 TRP A NE1 1 
ATOM   1218 C CE2 . TRP A 1 163 ? 131.310 123.905 15.913  1.00 45.10 ? 163 TRP A CE2 1 
ATOM   1219 C CE3 . TRP A 1 163 ? 132.601 122.924 14.106  1.00 48.27 ? 163 TRP A CE3 1 
ATOM   1220 C CZ2 . TRP A 1 163 ? 132.073 123.248 16.882  1.00 46.69 ? 163 TRP A CZ2 1 
ATOM   1221 C CZ3 . TRP A 1 163 ? 133.364 122.267 15.074  1.00 49.67 ? 163 TRP A CZ3 1 
ATOM   1222 C CH2 . TRP A 1 163 ? 133.093 122.436 16.446  1.00 48.65 ? 163 TRP A CH2 1 
ATOM   1223 N N   . THR A 1 164 ? 128.578 124.310 9.695   1.00 37.31 ? 164 THR A N   1 
ATOM   1224 C CA  . THR A 1 164 ? 128.442 124.681 8.296   1.00 38.44 ? 164 THR A CA  1 
ATOM   1225 C C   . THR A 1 164 ? 128.915 126.122 8.169   1.00 40.42 ? 164 THR A C   1 
ATOM   1226 O O   . THR A 1 164 ? 129.141 126.806 9.174   1.00 38.24 ? 164 THR A O   1 
ATOM   1227 C CB  . THR A 1 164 ? 126.974 124.655 7.821   1.00 38.62 ? 164 THR A CB  1 
ATOM   1228 O OG1 . THR A 1 164 ? 126.225 125.647 8.536   1.00 38.26 ? 164 THR A OG1 1 
ATOM   1229 C CG2 . THR A 1 164 ? 126.352 123.284 8.049   1.00 39.25 ? 164 THR A CG2 1 
ATOM   1230 N N   . ASP A 1 165 ? 129.084 126.574 6.932   1.00 41.14 ? 165 ASP A N   1 
ATOM   1231 C CA  . ASP A 1 165 ? 129.470 127.956 6.685   1.00 43.10 ? 165 ASP A CA  1 
ATOM   1232 C C   . ASP A 1 165 ? 128.133 128.667 6.617   1.00 42.12 ? 165 ASP A C   1 
ATOM   1233 O O   . ASP A 1 165 ? 127.094 128.003 6.536   1.00 40.80 ? 165 ASP A O   1 
ATOM   1234 C CB  . ASP A 1 165 ? 130.200 128.101 5.349   1.00 46.91 ? 165 ASP A CB  1 
ATOM   1235 C CG  . ASP A 1 165 ? 131.706 128.126 5.510   1.00 50.48 ? 165 ASP A CG  1 
ATOM   1236 O OD1 . ASP A 1 165 ? 132.294 127.052 5.764   1.00 52.08 ? 165 ASP A OD1 1 
ATOM   1237 O OD2 . ASP A 1 165 ? 132.298 129.227 5.395   1.00 52.56 ? 165 ASP A OD2 1 
ATOM   1238 N N   . GLN A 1 166 ? 128.137 129.995 6.649   1.00 39.18 ? 166 GLN A N   1 
ATOM   1239 C CA  . GLN A 1 166 ? 126.869 130.704 6.588   1.00 38.10 ? 166 GLN A CA  1 
ATOM   1240 C C   . GLN A 1 166 ? 126.043 130.157 5.419   1.00 38.41 ? 166 GLN A C   1 
ATOM   1241 O O   . GLN A 1 166 ? 126.557 129.920 4.317   1.00 36.23 ? 166 GLN A O   1 
ATOM   1242 C CB  . GLN A 1 166 ? 127.084 132.212 6.459   1.00 36.81 ? 166 GLN A CB  1 
ATOM   1243 C CG  . GLN A 1 166 ? 125.791 133.008 6.580   1.00 36.97 ? 166 GLN A CG  1 
ATOM   1244 C CD  . GLN A 1 166 ? 126.027 134.482 6.847   1.00 38.47 ? 166 GLN A CD  1 
ATOM   1245 O OE1 . GLN A 1 166 ? 126.903 135.100 6.241   1.00 38.44 ? 166 GLN A OE1 1 
ATOM   1246 N NE2 . GLN A 1 166 ? 125.234 135.058 7.750   1.00 35.01 ? 166 GLN A NE2 1 
ATOM   1247 N N   . ASP A 1 167 ? 124.762 129.940 5.692   1.00 38.70 ? 167 ASP A N   1 
ATOM   1248 C CA  . ASP A 1 167 ? 123.811 129.376 4.735   1.00 38.68 ? 167 ASP A CA  1 
ATOM   1249 C C   . ASP A 1 167 ? 123.361 130.375 3.663   1.00 38.53 ? 167 ASP A C   1 
ATOM   1250 O O   . ASP A 1 167 ? 122.827 131.440 3.980   1.00 34.85 ? 167 ASP A O   1 
ATOM   1251 C CB  . ASP A 1 167 ? 122.596 128.855 5.513   1.00 39.99 ? 167 ASP A CB  1 
ATOM   1252 C CG  . ASP A 1 167 ? 121.731 127.914 4.702   1.00 42.91 ? 167 ASP A CG  1 
ATOM   1253 O OD1 . ASP A 1 167 ? 121.417 126.816 5.214   1.00 44.92 ? 167 ASP A OD1 1 
ATOM   1254 O OD2 . ASP A 1 167 ? 121.357 128.266 3.566   1.00 43.53 ? 167 ASP A OD2 1 
ATOM   1255 N N   . SER A 1 168 ? 123.565 130.024 2.394   1.00 39.36 ? 168 SER A N   1 
ATOM   1256 C CA  . SER A 1 168 ? 123.167 130.906 1.301   1.00 41.41 ? 168 SER A CA  1 
ATOM   1257 C C   . SER A 1 168 ? 121.653 130.902 1.098   1.00 41.80 ? 168 SER A C   1 
ATOM   1258 O O   . SER A 1 168 ? 121.139 131.573 0.204   1.00 42.37 ? 168 SER A O   1 
ATOM   1259 C CB  . SER A 1 168 ? 123.874 130.509 -0.003  1.00 42.12 ? 168 SER A CB  1 
ATOM   1260 O OG  . SER A 1 168 ? 123.518 129.203 -0.419  1.00 44.48 ? 168 SER A OG  1 
ATOM   1261 N N   . LYS A 1 169 ? 120.940 130.152 1.937   1.00 40.98 ? 169 LYS A N   1 
ATOM   1262 C CA  . LYS A 1 169 ? 119.486 130.086 1.847   1.00 41.89 ? 169 LYS A CA  1 
ATOM   1263 C C   . LYS A 1 169 ? 118.804 131.085 2.789   1.00 42.51 ? 169 LYS A C   1 
ATOM   1264 O O   . LYS A 1 169 ? 117.821 131.728 2.410   1.00 42.51 ? 169 LYS A O   1 
ATOM   1265 C CB  . LYS A 1 169 ? 119.002 128.661 2.144   1.00 42.69 ? 169 LYS A CB  1 
ATOM   1266 N N   . ASP A 1 170 ? 119.319 131.224 4.011   1.00 42.22 ? 170 ASP A N   1 
ATOM   1267 C CA  . ASP A 1 170 ? 118.723 132.150 4.979   1.00 41.59 ? 170 ASP A CA  1 
ATOM   1268 C C   . ASP A 1 170 ? 119.717 132.917 5.862   1.00 39.40 ? 170 ASP A C   1 
ATOM   1269 O O   . ASP A 1 170 ? 119.314 133.543 6.841   1.00 40.02 ? 170 ASP A O   1 
ATOM   1270 C CB  . ASP A 1 170 ? 117.734 131.403 5.881   1.00 42.88 ? 170 ASP A CB  1 
ATOM   1271 C CG  . ASP A 1 170 ? 118.370 130.223 6.593   1.00 43.90 ? 170 ASP A CG  1 
ATOM   1272 O OD1 . ASP A 1 170 ? 119.611 130.192 6.706   1.00 45.05 ? 170 ASP A OD1 1 
ATOM   1273 O OD2 . ASP A 1 170 ? 117.628 129.328 7.050   1.00 48.16 ? 170 ASP A OD2 1 
ATOM   1274 N N   . SER A 1 171 ? 121.003 132.864 5.522   1.00 36.94 ? 171 SER A N   1 
ATOM   1275 C CA  . SER A 1 171 ? 122.047 133.569 6.277   1.00 35.42 ? 171 SER A CA  1 
ATOM   1276 C C   . SER A 1 171 ? 122.250 133.060 7.707   1.00 34.26 ? 171 SER A C   1 
ATOM   1277 O O   . SER A 1 171 ? 122.797 133.771 8.552   1.00 33.28 ? 171 SER A O   1 
ATOM   1278 C CB  . SER A 1 171 ? 121.752 135.073 6.324   1.00 34.63 ? 171 SER A CB  1 
ATOM   1279 O OG  . SER A 1 171 ? 121.631 135.616 5.022   1.00 39.10 ? 171 SER A OG  1 
ATOM   1280 N N   . THR A 1 172 ? 121.816 131.834 7.978   1.00 33.31 ? 172 THR A N   1 
ATOM   1281 C CA  . THR A 1 172 ? 121.978 131.257 9.311   1.00 30.78 ? 172 THR A CA  1 
ATOM   1282 C C   . THR A 1 172 ? 123.125 130.264 9.284   1.00 28.75 ? 172 THR A C   1 
ATOM   1283 O O   . THR A 1 172 ? 123.738 130.040 8.249   1.00 27.86 ? 172 THR A O   1 
ATOM   1284 C CB  . THR A 1 172 ? 120.722 130.475 9.757   1.00 32.08 ? 172 THR A CB  1 
ATOM   1285 O OG1 . THR A 1 172 ? 120.572 129.309 8.934   1.00 31.60 ? 172 THR A OG1 1 
ATOM   1286 C CG2 . THR A 1 172 ? 119.472 131.344 9.650   1.00 30.84 ? 172 THR A CG2 1 
ATOM   1287 N N   . TYR A 1 173 ? 123.416 129.678 10.435  1.00 29.61 ? 173 TYR A N   1 
ATOM   1288 C CA  . TYR A 1 173 ? 124.450 128.659 10.531  1.00 29.61 ? 173 TYR A CA  1 
ATOM   1289 C C   . TYR A 1 173 ? 123.785 127.436 11.157  1.00 30.84 ? 173 TYR A C   1 
ATOM   1290 O O   . TYR A 1 173 ? 122.707 127.540 11.738  1.00 30.21 ? 173 TYR A O   1 
ATOM   1291 C CB  . TYR A 1 173 ? 125.606 129.116 11.424  1.00 32.26 ? 173 TYR A CB  1 
ATOM   1292 C CG  . TYR A 1 173 ? 126.361 130.331 10.917  1.00 34.68 ? 173 TYR A CG  1 
ATOM   1293 C CD1 . TYR A 1 173 ? 125.827 131.615 11.048  1.00 36.09 ? 173 TYR A CD1 1 
ATOM   1294 C CD2 . TYR A 1 173 ? 127.615 130.196 10.316  1.00 36.01 ? 173 TYR A CD2 1 
ATOM   1295 C CE1 . TYR A 1 173 ? 126.525 132.741 10.594  1.00 36.54 ? 173 TYR A CE1 1 
ATOM   1296 C CE2 . TYR A 1 173 ? 128.323 131.316 9.856   1.00 37.52 ? 173 TYR A CE2 1 
ATOM   1297 C CZ  . TYR A 1 173 ? 127.769 132.582 10.003  1.00 36.69 ? 173 TYR A CZ  1 
ATOM   1298 O OH  . TYR A 1 173 ? 128.463 133.690 9.569   1.00 40.05 ? 173 TYR A OH  1 
ATOM   1299 N N   . SER A 1 174 ? 124.425 126.282 11.027  1.00 30.24 ? 174 SER A N   1 
ATOM   1300 C CA  . SER A 1 174 ? 123.915 125.051 11.608  1.00 30.96 ? 174 SER A CA  1 
ATOM   1301 C C   . SER A 1 174 ? 125.137 124.286 12.069  1.00 32.02 ? 174 SER A C   1 
ATOM   1302 O O   . SER A 1 174 ? 126.245 124.549 11.612  1.00 32.41 ? 174 SER A O   1 
ATOM   1303 C CB  . SER A 1 174 ? 123.133 124.234 10.570  1.00 29.36 ? 174 SER A CB  1 
ATOM   1304 O OG  . SER A 1 174 ? 121.953 124.922 10.192  1.00 28.35 ? 174 SER A OG  1 
ATOM   1305 N N   . MET A 1 175 ? 124.940 123.346 12.980  1.00 34.04 ? 175 MET A N   1 
ATOM   1306 C CA  . MET A 1 175 ? 126.046 122.559 13.493  1.00 35.81 ? 175 MET A CA  1 
ATOM   1307 C C   . MET A 1 175 ? 125.544 121.181 13.864  1.00 35.19 ? 175 MET A C   1 
ATOM   1308 O O   . MET A 1 175 ? 124.391 121.024 14.261  1.00 36.30 ? 175 MET A O   1 
ATOM   1309 C CB  . MET A 1 175 ? 126.632 123.229 14.737  1.00 38.29 ? 175 MET A CB  1 
ATOM   1310 C CG  . MET A 1 175 ? 127.722 122.418 15.409  1.00 44.92 ? 175 MET A CG  1 
ATOM   1311 S SD  . MET A 1 175 ? 127.590 122.463 17.210  1.00 53.12 ? 175 MET A SD  1 
ATOM   1312 C CE  . MET A 1 175 ? 126.667 120.975 17.493  1.00 52.14 ? 175 MET A CE  1 
ATOM   1313 N N   . SER A 1 176 ? 126.408 120.184 13.735  1.00 35.05 ? 176 SER A N   1 
ATOM   1314 C CA  . SER A 1 176 ? 126.035 118.825 14.095  1.00 37.51 ? 176 SER A CA  1 
ATOM   1315 C C   . SER A 1 176 ? 126.982 118.346 15.184  1.00 37.37 ? 176 SER A C   1 
ATOM   1316 O O   . SER A 1 176 ? 128.160 118.694 15.190  1.00 37.26 ? 176 SER A O   1 
ATOM   1317 C CB  . SER A 1 176 ? 126.113 117.892 12.878  1.00 36.27 ? 176 SER A CB  1 
ATOM   1318 O OG  . SER A 1 176 ? 127.453 117.699 12.464  1.00 36.33 ? 176 SER A OG  1 
ATOM   1319 N N   . SER A 1 177 ? 126.452 117.571 16.120  1.00 38.71 ? 177 SER A N   1 
ATOM   1320 C CA  . SER A 1 177 ? 127.244 117.031 17.218  1.00 40.57 ? 177 SER A CA  1 
ATOM   1321 C C   . SER A 1 177 ? 126.941 115.542 17.244  1.00 41.42 ? 177 SER A C   1 
ATOM   1322 O O   . SER A 1 177 ? 125.800 115.134 17.468  1.00 41.66 ? 177 SER A O   1 
ATOM   1323 C CB  . SER A 1 177 ? 126.842 117.687 18.546  1.00 41.45 ? 177 SER A CB  1 
ATOM   1324 O OG  . SER A 1 177 ? 127.670 117.250 19.613  1.00 40.28 ? 177 SER A OG  1 
ATOM   1325 N N   . THR A 1 178 ? 127.963 114.734 17.004  1.00 42.19 ? 178 THR A N   1 
ATOM   1326 C CA  . THR A 1 178 ? 127.779 113.294 16.965  1.00 43.97 ? 178 THR A CA  1 
ATOM   1327 C C   . THR A 1 178 ? 128.553 112.521 18.037  1.00 44.86 ? 178 THR A C   1 
ATOM   1328 O O   . THR A 1 178 ? 129.785 112.556 18.088  1.00 44.35 ? 178 THR A O   1 
ATOM   1329 C CB  . THR A 1 178 ? 128.158 112.758 15.570  1.00 43.52 ? 178 THR A CB  1 
ATOM   1330 O OG1 . THR A 1 178 ? 127.368 113.428 14.577  1.00 44.18 ? 178 THR A OG1 1 
ATOM   1331 C CG2 . THR A 1 178 ? 127.916 111.257 15.480  1.00 43.95 ? 178 THR A CG2 1 
ATOM   1332 N N   . LEU A 1 179 ? 127.807 111.826 18.893  1.00 46.36 ? 179 LEU A N   1 
ATOM   1333 C CA  . LEU A 1 179 ? 128.386 111.011 19.957  1.00 47.21 ? 179 LEU A CA  1 
ATOM   1334 C C   . LEU A 1 179 ? 128.443 109.566 19.469  1.00 48.22 ? 179 LEU A C   1 
ATOM   1335 O O   . LEU A 1 179 ? 127.409 108.949 19.199  1.00 47.62 ? 179 LEU A O   1 
ATOM   1336 C CB  . LEU A 1 179 ? 127.532 111.104 21.226  1.00 46.04 ? 179 LEU A CB  1 
ATOM   1337 C CG  . LEU A 1 179 ? 127.836 110.091 22.336  1.00 45.74 ? 179 LEU A CG  1 
ATOM   1338 C CD1 . LEU A 1 179 ? 129.298 110.166 22.725  1.00 45.66 ? 179 LEU A CD1 1 
ATOM   1339 C CD2 . LEU A 1 179 ? 126.945 110.367 23.535  1.00 45.67 ? 179 LEU A CD2 1 
ATOM   1340 N N   . THR A 1 180 ? 129.652 109.028 19.356  1.00 50.53 ? 180 THR A N   1 
ATOM   1341 C CA  . THR A 1 180 ? 129.829 107.662 18.877  1.00 54.27 ? 180 THR A CA  1 
ATOM   1342 C C   . THR A 1 180 ? 130.497 106.734 19.893  1.00 55.62 ? 180 THR A C   1 
ATOM   1343 O O   . THR A 1 180 ? 131.558 107.041 20.436  1.00 55.69 ? 180 THR A O   1 
ATOM   1344 C CB  . THR A 1 180 ? 130.673 107.636 17.581  1.00 54.60 ? 180 THR A CB  1 
ATOM   1345 O OG1 . THR A 1 180 ? 130.094 108.517 16.611  1.00 57.29 ? 180 THR A OG1 1 
ATOM   1346 C CG2 . THR A 1 180 ? 130.719 106.227 17.003  1.00 55.74 ? 180 THR A CG2 1 
ATOM   1347 N N   . LEU A 1 181 ? 129.865 105.591 20.137  1.00 57.69 ? 181 LEU A N   1 
ATOM   1348 C CA  . LEU A 1 181 ? 130.394 104.596 21.060  1.00 59.38 ? 181 LEU A CA  1 
ATOM   1349 C C   . LEU A 1 181 ? 129.927 103.212 20.638  1.00 60.67 ? 181 LEU A C   1 
ATOM   1350 O O   . LEU A 1 181 ? 128.959 103.081 19.888  1.00 60.89 ? 181 LEU A O   1 
ATOM   1351 C CB  . LEU A 1 181 ? 129.952 104.912 22.494  1.00 60.27 ? 181 LEU A CB  1 
ATOM   1352 C CG  . LEU A 1 181 ? 128.559 105.511 22.699  1.00 60.02 ? 181 LEU A CG  1 
ATOM   1353 C CD1 . LEU A 1 181 ? 127.505 104.494 22.314  1.00 61.52 ? 181 LEU A CD1 1 
ATOM   1354 C CD2 . LEU A 1 181 ? 128.389 105.931 24.146  1.00 60.32 ? 181 LEU A CD2 1 
ATOM   1355 N N   . THR A 1 182 ? 130.628 102.182 21.099  1.00 61.64 ? 182 THR A N   1 
ATOM   1356 C CA  . THR A 1 182 ? 130.280 100.807 20.759  1.00 62.69 ? 182 THR A CA  1 
ATOM   1357 C C   . THR A 1 182 ? 128.835 100.511 21.130  1.00 62.40 ? 182 THR A C   1 
ATOM   1358 O O   . THR A 1 182 ? 128.260 101.179 21.988  1.00 62.23 ? 182 THR A O   1 
ATOM   1359 C CB  . THR A 1 182 ? 131.182 99.802  21.501  1.00 63.33 ? 182 THR A CB  1 
ATOM   1360 O OG1 . THR A 1 182 ? 131.084 100.027 22.914  1.00 63.99 ? 182 THR A OG1 1 
ATOM   1361 C CG2 . THR A 1 182 ? 132.630 99.956  21.062  1.00 64.18 ? 182 THR A CG2 1 
ATOM   1362 N N   . LYS A 1 183 ? 128.248 99.513  20.476  1.00 62.62 ? 183 LYS A N   1 
ATOM   1363 C CA  . LYS A 1 183 ? 126.873 99.133  20.766  1.00 63.36 ? 183 LYS A CA  1 
ATOM   1364 C C   . LYS A 1 183 ? 126.791 98.758  22.243  1.00 63.55 ? 183 LYS A C   1 
ATOM   1365 O O   . LYS A 1 183 ? 125.799 99.043  22.912  1.00 63.50 ? 183 LYS A O   1 
ATOM   1366 C CB  . LYS A 1 183 ? 126.456 97.951  19.894  1.00 63.14 ? 183 LYS A CB  1 
ATOM   1367 N N   . ASP A 1 184 ? 127.854 98.131  22.740  1.00 64.05 ? 184 ASP A N   1 
ATOM   1368 C CA  . ASP A 1 184 ? 127.944 97.705  24.135  1.00 64.85 ? 184 ASP A CA  1 
ATOM   1369 C C   . ASP A 1 184 ? 127.742 98.840  25.134  1.00 64.41 ? 184 ASP A C   1 
ATOM   1370 O O   . ASP A 1 184 ? 126.843 98.782  25.978  1.00 64.11 ? 184 ASP A O   1 
ATOM   1371 C CB  . ASP A 1 184 ? 129.303 97.046  24.397  1.00 66.79 ? 184 ASP A CB  1 
ATOM   1372 C CG  . ASP A 1 184 ? 129.316 95.568  24.049  1.00 69.08 ? 184 ASP A CG  1 
ATOM   1373 O OD1 . ASP A 1 184 ? 128.894 95.210  22.928  1.00 69.48 ? 184 ASP A OD1 1 
ATOM   1374 O OD2 . ASP A 1 184 ? 129.756 94.764  24.901  1.00 70.07 ? 184 ASP A OD2 1 
ATOM   1375 N N   . GLU A 1 185 ? 128.584 99.866  25.049  1.00 62.98 ? 185 GLU A N   1 
ATOM   1376 C CA  . GLU A 1 185 ? 128.473 100.985 25.973  1.00 62.63 ? 185 GLU A CA  1 
ATOM   1377 C C   . GLU A 1 185 ? 127.150 101.709 25.786  1.00 61.07 ? 185 GLU A C   1 
ATOM   1378 O O   . GLU A 1 185 ? 126.605 102.280 26.728  1.00 61.04 ? 185 GLU A O   1 
ATOM   1379 C CB  . GLU A 1 185 ? 129.635 101.966 25.790  1.00 63.81 ? 185 GLU A CB  1 
ATOM   1380 C CG  . GLU A 1 185 ? 129.642 103.072 26.838  1.00 66.30 ? 185 GLU A CG  1 
ATOM   1381 C CD  . GLU A 1 185 ? 130.926 103.878 26.854  1.00 68.18 ? 185 GLU A CD  1 
ATOM   1382 O OE1 . GLU A 1 185 ? 131.041 104.785 27.707  1.00 68.22 ? 185 GLU A OE1 1 
ATOM   1383 O OE2 . GLU A 1 185 ? 131.820 103.607 26.021  1.00 69.95 ? 185 GLU A OE2 1 
ATOM   1384 N N   . TYR A 1 186 ? 126.635 101.683 24.564  1.00 59.96 ? 186 TYR A N   1 
ATOM   1385 C CA  . TYR A 1 186 ? 125.364 102.330 24.271  1.00 58.83 ? 186 TYR A CA  1 
ATOM   1386 C C   . TYR A 1 186 ? 124.246 101.590 25.000  1.00 59.69 ? 186 TYR A C   1 
ATOM   1387 O O   . TYR A 1 186 ? 123.324 102.206 25.541  1.00 58.71 ? 186 TYR A O   1 
ATOM   1388 C CB  . TYR A 1 186 ? 125.093 102.315 22.761  1.00 54.89 ? 186 TYR A CB  1 
ATOM   1389 C CG  . TYR A 1 186 ? 123.703 102.783 22.389  1.00 51.20 ? 186 TYR A CG  1 
ATOM   1390 C CD1 . TYR A 1 186 ? 123.281 104.077 22.689  1.00 49.75 ? 186 TYR A CD1 1 
ATOM   1391 C CD2 . TYR A 1 186 ? 122.796 101.920 21.771  1.00 49.15 ? 186 TYR A CD2 1 
ATOM   1392 C CE1 . TYR A 1 186 ? 121.990 104.501 22.388  1.00 48.65 ? 186 TYR A CE1 1 
ATOM   1393 C CE2 . TYR A 1 186 ? 121.502 102.336 21.465  1.00 47.60 ? 186 TYR A CE2 1 
ATOM   1394 C CZ  . TYR A 1 186 ? 121.107 103.627 21.779  1.00 46.56 ? 186 TYR A CZ  1 
ATOM   1395 O OH  . TYR A 1 186 ? 119.832 104.049 21.490  1.00 47.25 ? 186 TYR A OH  1 
ATOM   1396 N N   . GLU A 1 187 ? 124.347 100.263 25.015  1.00 60.93 ? 187 GLU A N   1 
ATOM   1397 C CA  . GLU A 1 187 ? 123.348 99.415  25.655  1.00 62.86 ? 187 GLU A CA  1 
ATOM   1398 C C   . GLU A 1 187 ? 123.349 99.477  27.177  1.00 63.29 ? 187 GLU A C   1 
ATOM   1399 O O   . GLU A 1 187 ? 122.350 99.133  27.809  1.00 63.56 ? 187 GLU A O   1 
ATOM   1400 C CB  . GLU A 1 187 ? 123.523 97.959  25.203  1.00 63.65 ? 187 GLU A CB  1 
ATOM   1401 C CG  . GLU A 1 187 ? 123.239 97.727  23.723  1.00 64.59 ? 187 GLU A CG  1 
ATOM   1402 C CD  . GLU A 1 187 ? 121.820 98.109  23.327  1.00 66.31 ? 187 GLU A CD  1 
ATOM   1403 O OE1 . GLU A 1 187 ? 121.501 98.043  22.120  1.00 67.57 ? 187 GLU A OE1 1 
ATOM   1404 O OE2 . GLU A 1 187 ? 121.020 98.475  24.216  1.00 67.40 ? 187 GLU A OE2 1 
ATOM   1405 N N   . ARG A 1 188 ? 124.455 99.911  27.774  1.00 63.93 ? 188 ARG A N   1 
ATOM   1406 C CA  . ARG A 1 188 ? 124.512 99.993  29.230  1.00 64.59 ? 188 ARG A CA  1 
ATOM   1407 C C   . ARG A 1 188 ? 124.235 101.402 29.760  1.00 63.13 ? 188 ARG A C   1 
ATOM   1408 O O   . ARG A 1 188 ? 124.812 101.826 30.761  1.00 63.33 ? 188 ARG A O   1 
ATOM   1409 C CB  . ARG A 1 188 ? 125.862 99.482  29.744  1.00 66.34 ? 188 ARG A CB  1 
ATOM   1410 C CG  . ARG A 1 188 ? 127.062 100.294 29.317  1.00 71.19 ? 188 ARG A CG  1 
ATOM   1411 C CD  . ARG A 1 188 ? 128.335 99.710  29.909  1.00 73.86 ? 188 ARG A CD  1 
ATOM   1412 N NE  . ARG A 1 188 ? 129.480 100.595 29.721  1.00 77.56 ? 188 ARG A NE  1 
ATOM   1413 C CZ  . ARG A 1 188 ? 130.690 100.364 30.220  1.00 79.33 ? 188 ARG A CZ  1 
ATOM   1414 N NH1 . ARG A 1 188 ? 130.915 99.271  30.938  1.00 79.84 ? 188 ARG A NH1 1 
ATOM   1415 N NH2 . ARG A 1 188 ? 131.673 101.229 30.005  1.00 80.57 ? 188 ARG A NH2 1 
ATOM   1416 N N   . HIS A 1 189 ? 123.338 102.112 29.077  1.00 60.98 ? 189 HIS A N   1 
ATOM   1417 C CA  . HIS A 1 189 ? 122.928 103.467 29.446  1.00 58.55 ? 189 HIS A CA  1 
ATOM   1418 C C   . HIS A 1 189 ? 121.488 103.692 28.977  1.00 56.47 ? 189 HIS A C   1 
ATOM   1419 O O   . HIS A 1 189 ? 121.075 103.165 27.945  1.00 55.25 ? 189 HIS A O   1 
ATOM   1420 C CB  . HIS A 1 189 ? 123.861 104.502 28.812  1.00 59.94 ? 189 HIS A CB  1 
ATOM   1421 C CG  . HIS A 1 189 ? 125.220 104.552 29.438  1.00 61.13 ? 189 HIS A CG  1 
ATOM   1422 N ND1 . HIS A 1 189 ? 125.423 104.944 30.745  1.00 61.86 ? 189 HIS A ND1 1 
ATOM   1423 C CD2 . HIS A 1 189 ? 126.444 104.251 28.942  1.00 62.23 ? 189 HIS A CD2 1 
ATOM   1424 C CE1 . HIS A 1 189 ? 126.712 104.881 31.026  1.00 62.25 ? 189 HIS A CE1 1 
ATOM   1425 N NE2 . HIS A 1 189 ? 127.354 104.464 29.950  1.00 62.16 ? 189 HIS A NE2 1 
ATOM   1426 N N   . ASN A 1 190 ? 120.728 104.479 29.730  1.00 54.67 ? 190 ASN A N   1 
ATOM   1427 C CA  . ASN A 1 190 ? 119.334 104.723 29.388  1.00 53.24 ? 190 ASN A CA  1 
ATOM   1428 C C   . ASN A 1 190 ? 119.043 106.012 28.625  1.00 52.33 ? 190 ASN A C   1 
ATOM   1429 O O   . ASN A 1 190 ? 118.639 105.971 27.464  1.00 51.20 ? 190 ASN A O   1 
ATOM   1430 C CB  . ASN A 1 190 ? 118.480 104.671 30.651  1.00 52.94 ? 190 ASN A CB  1 
ATOM   1431 N N   . SER A 1 191 ? 119.236 107.156 29.273  1.00 51.60 ? 191 SER A N   1 
ATOM   1432 C CA  . SER A 1 191 ? 118.942 108.430 28.629  1.00 51.66 ? 191 SER A CA  1 
ATOM   1433 C C   . SER A 1 191 ? 120.129 109.180 28.037  1.00 50.81 ? 191 SER A C   1 
ATOM   1434 O O   . SER A 1 191 ? 121.202 109.274 28.638  1.00 50.61 ? 191 SER A O   1 
ATOM   1435 C CB  . SER A 1 191 ? 118.197 109.357 29.599  1.00 52.06 ? 191 SER A CB  1 
ATOM   1436 O OG  . SER A 1 191 ? 118.993 109.689 30.722  1.00 52.62 ? 191 SER A OG  1 
ATOM   1437 N N   . TYR A 1 192 ? 119.911 109.710 26.839  1.00 49.55 ? 192 TYR A N   1 
ATOM   1438 C CA  . TYR A 1 192 ? 120.915 110.486 26.131  1.00 48.06 ? 192 TYR A CA  1 
ATOM   1439 C C   . TYR A 1 192 ? 120.317 111.861 25.893  1.00 47.89 ? 192 TYR A C   1 
ATOM   1440 O O   . TYR A 1 192 ? 119.187 111.988 25.422  1.00 47.20 ? 192 TYR A O   1 
ATOM   1441 C CB  . TYR A 1 192 ? 121.272 109.823 24.805  1.00 46.18 ? 192 TYR A CB  1 
ATOM   1442 C CG  . TYR A 1 192 ? 121.994 108.510 24.971  1.00 45.02 ? 192 TYR A CG  1 
ATOM   1443 C CD1 . TYR A 1 192 ? 121.297 107.338 25.264  1.00 45.06 ? 192 TYR A CD1 1 
ATOM   1444 C CD2 . TYR A 1 192 ? 123.384 108.442 24.861  1.00 44.09 ? 192 TYR A CD2 1 
ATOM   1445 C CE1 . TYR A 1 192 ? 121.970 106.126 25.443  1.00 44.71 ? 192 TYR A CE1 1 
ATOM   1446 C CE2 . TYR A 1 192 ? 124.065 107.242 25.038  1.00 43.70 ? 192 TYR A CE2 1 
ATOM   1447 C CZ  . TYR A 1 192 ? 123.354 106.089 25.328  1.00 45.05 ? 192 TYR A CZ  1 
ATOM   1448 O OH  . TYR A 1 192 ? 124.028 104.904 25.500  1.00 46.31 ? 192 TYR A OH  1 
ATOM   1449 N N   . THR A 1 193 ? 121.070 112.895 26.238  1.00 47.07 ? 193 THR A N   1 
ATOM   1450 C CA  . THR A 1 193 ? 120.571 114.245 26.071  1.00 46.62 ? 193 THR A CA  1 
ATOM   1451 C C   . THR A 1 193 ? 121.584 115.192 25.441  1.00 46.55 ? 193 THR A C   1 
ATOM   1452 O O   . THR A 1 193 ? 122.785 115.138 25.720  1.00 44.55 ? 193 THR A O   1 
ATOM   1453 C CB  . THR A 1 193 ? 120.083 114.816 27.434  1.00 47.48 ? 193 THR A CB  1 
ATOM   1454 O OG1 . THR A 1 193 ? 120.015 116.245 27.369  1.00 47.30 ? 193 THR A OG1 1 
ATOM   1455 C CG2 . THR A 1 193 ? 121.009 114.405 28.550  1.00 48.38 ? 193 THR A CG2 1 
ATOM   1456 N N   . CYS A 1 194 ? 121.078 116.049 24.566  1.00 46.39 ? 194 CYS A N   1 
ATOM   1457 C CA  . CYS A 1 194 ? 121.902 117.029 23.892  1.00 46.00 ? 194 CYS A CA  1 
ATOM   1458 C C   . CYS A 1 194 ? 121.366 118.404 24.276  1.00 44.40 ? 194 CYS A C   1 
ATOM   1459 O O   . CYS A 1 194 ? 120.172 118.662 24.149  1.00 43.86 ? 194 CYS A O   1 
ATOM   1460 C CB  . CYS A 1 194 ? 121.819 116.831 22.385  1.00 48.51 ? 194 CYS A CB  1 
ATOM   1461 S SG  . CYS A 1 194 ? 122.878 117.967 21.509  1.00 58.05 ? 194 CYS A SG  1 
ATOM   1462 N N   . GLU A 1 195 ? 122.246 119.284 24.745  1.00 43.55 ? 195 GLU A N   1 
ATOM   1463 C CA  . GLU A 1 195 ? 121.826 120.616 25.166  1.00 43.25 ? 195 GLU A CA  1 
ATOM   1464 C C   . GLU A 1 195 ? 122.553 121.727 24.426  1.00 44.27 ? 195 GLU A C   1 
ATOM   1465 O O   . GLU A 1 195 ? 123.786 121.757 24.371  1.00 43.17 ? 195 GLU A O   1 
ATOM   1466 C CB  . GLU A 1 195 ? 122.060 120.792 26.667  1.00 45.20 ? 195 GLU A CB  1 
ATOM   1467 C CG  . GLU A 1 195 ? 121.870 119.527 27.479  1.00 46.67 ? 195 GLU A CG  1 
ATOM   1468 C CD  . GLU A 1 195 ? 121.780 119.806 28.965  1.00 48.51 ? 195 GLU A CD  1 
ATOM   1469 O OE1 . GLU A 1 195 ? 122.563 120.640 29.468  1.00 47.12 ? 195 GLU A OE1 1 
ATOM   1470 O OE2 . GLU A 1 195 ? 120.927 119.181 29.632  1.00 50.88 ? 195 GLU A OE2 1 
ATOM   1471 N N   . ALA A 1 196 ? 121.781 122.656 23.874  1.00 43.54 ? 196 ALA A N   1 
ATOM   1472 C CA  . ALA A 1 196 ? 122.357 123.768 23.139  1.00 44.06 ? 196 ALA A CA  1 
ATOM   1473 C C   . ALA A 1 196 ? 122.208 125.062 23.920  1.00 43.13 ? 196 ALA A C   1 
ATOM   1474 O O   . ALA A 1 196 ? 121.115 125.408 24.372  1.00 42.24 ? 196 ALA A O   1 
ATOM   1475 C CB  . ALA A 1 196 ? 121.687 123.900 21.765  1.00 41.72 ? 196 ALA A CB  1 
ATOM   1476 N N   . THR A 1 197 ? 123.321 125.767 24.080  1.00 44.06 ? 197 THR A N   1 
ATOM   1477 C CA  . THR A 1 197 ? 123.337 127.047 24.782  1.00 44.89 ? 197 THR A CA  1 
ATOM   1478 C C   . THR A 1 197 ? 123.605 128.112 23.727  1.00 43.85 ? 197 THR A C   1 
ATOM   1479 O O   . THR A 1 197 ? 124.654 128.115 23.085  1.00 42.10 ? 197 THR A O   1 
ATOM   1480 C CB  . THR A 1 197 ? 124.445 127.087 25.842  1.00 46.44 ? 197 THR A CB  1 
ATOM   1481 O OG1 . THR A 1 197 ? 124.266 125.996 26.757  1.00 49.04 ? 197 THR A OG1 1 
ATOM   1482 C CG2 . THR A 1 197 ? 124.402 128.413 26.606  1.00 46.66 ? 197 THR A CG2 1 
ATOM   1483 N N   . HIS A 1 198 ? 122.653 129.014 23.546  1.00 44.45 ? 198 HIS A N   1 
ATOM   1484 C CA  . HIS A 1 198 ? 122.803 130.042 22.535  1.00 45.59 ? 198 HIS A CA  1 
ATOM   1485 C C   . HIS A 1 198 ? 122.403 131.418 23.037  1.00 48.21 ? 198 HIS A C   1 
ATOM   1486 O O   . HIS A 1 198 ? 121.533 131.558 23.896  1.00 47.81 ? 198 HIS A O   1 
ATOM   1487 C CB  . HIS A 1 198 ? 121.969 129.670 21.309  1.00 43.03 ? 198 HIS A CB  1 
ATOM   1488 C CG  . HIS A 1 198 ? 122.256 130.504 20.098  1.00 40.58 ? 198 HIS A CG  1 
ATOM   1489 N ND1 . HIS A 1 198 ? 121.385 131.465 19.632  1.00 39.81 ? 198 HIS A ND1 1 
ATOM   1490 C CD2 . HIS A 1 198 ? 123.297 130.489 19.233  1.00 39.11 ? 198 HIS A CD2 1 
ATOM   1491 C CE1 . HIS A 1 198 ? 121.874 132.002 18.528  1.00 39.68 ? 198 HIS A CE1 1 
ATOM   1492 N NE2 . HIS A 1 198 ? 123.033 131.427 18.264  1.00 39.96 ? 198 HIS A NE2 1 
ATOM   1493 N N   . LYS A 1 199 ? 123.064 132.423 22.476  1.00 49.40 ? 199 LYS A N   1 
ATOM   1494 C CA  . LYS A 1 199 ? 122.843 133.826 22.794  1.00 52.27 ? 199 LYS A CA  1 
ATOM   1495 C C   . LYS A 1 199 ? 121.360 134.197 22.851  1.00 53.05 ? 199 LYS A C   1 
ATOM   1496 O O   . LYS A 1 199 ? 120.961 135.087 23.603  1.00 53.09 ? 199 LYS A O   1 
ATOM   1497 C CB  . LYS A 1 199 ? 123.556 134.676 21.736  1.00 53.52 ? 199 LYS A CB  1 
ATOM   1498 C CG  . LYS A 1 199 ? 123.299 136.162 21.801  1.00 55.84 ? 199 LYS A CG  1 
ATOM   1499 C CD  . LYS A 1 199 ? 124.056 136.874 20.684  1.00 56.79 ? 199 LYS A CD  1 
ATOM   1500 C CE  . LYS A 1 199 ? 123.956 138.387 20.816  1.00 57.99 ? 199 LYS A CE  1 
ATOM   1501 N NZ  . LYS A 1 199 ? 122.545 138.872 20.783  1.00 58.20 ? 199 LYS A NZ  1 
ATOM   1502 N N   . THR A 1 200 ? 120.550 133.508 22.056  1.00 53.60 ? 200 THR A N   1 
ATOM   1503 C CA  . THR A 1 200 ? 119.119 133.775 21.988  1.00 54.21 ? 200 THR A CA  1 
ATOM   1504 C C   . THR A 1 200 ? 118.313 133.390 23.226  1.00 55.56 ? 200 THR A C   1 
ATOM   1505 O O   . THR A 1 200 ? 117.127 133.713 23.318  1.00 55.63 ? 200 THR A O   1 
ATOM   1506 C CB  . THR A 1 200 ? 118.503 133.069 20.782  1.00 53.54 ? 200 THR A CB  1 
ATOM   1507 O OG1 . THR A 1 200 ? 118.865 131.683 20.814  1.00 52.99 ? 200 THR A OG1 1 
ATOM   1508 C CG2 . THR A 1 200 ? 119.004 133.700 19.486  1.00 54.36 ? 200 THR A CG2 1 
ATOM   1509 N N   . SER A 1 201 ? 118.939 132.702 24.176  1.00 56.48 ? 201 SER A N   1 
ATOM   1510 C CA  . SER A 1 201 ? 118.225 132.299 25.382  1.00 57.68 ? 201 SER A CA  1 
ATOM   1511 C C   . SER A 1 201 ? 119.117 131.986 26.576  1.00 57.63 ? 201 SER A C   1 
ATOM   1512 O O   . SER A 1 201 ? 120.145 131.318 26.452  1.00 57.04 ? 201 SER A O   1 
ATOM   1513 C CB  . SER A 1 201 ? 117.339 131.088 25.092  1.00 58.51 ? 201 SER A CB  1 
ATOM   1514 O OG  . SER A 1 201 ? 116.667 130.677 26.267  1.00 60.85 ? 201 SER A OG  1 
ATOM   1515 N N   . THR A 1 202 ? 118.692 132.469 27.739  1.00 58.53 ? 202 THR A N   1 
ATOM   1516 C CA  . THR A 1 202 ? 119.414 132.262 28.988  1.00 58.36 ? 202 THR A CA  1 
ATOM   1517 C C   . THR A 1 202 ? 119.458 130.775 29.333  1.00 57.62 ? 202 THR A C   1 
ATOM   1518 O O   . THR A 1 202 ? 120.482 130.255 29.776  1.00 57.04 ? 202 THR A O   1 
ATOM   1519 C CB  . THR A 1 202 ? 118.726 133.025 30.144  1.00 59.13 ? 202 THR A CB  1 
ATOM   1520 O OG1 . THR A 1 202 ? 118.720 134.430 29.856  1.00 58.06 ? 202 THR A OG1 1 
ATOM   1521 C CG2 . THR A 1 202 ? 119.456 132.780 31.459  1.00 59.90 ? 202 THR A CG2 1 
ATOM   1522 N N   . SER A 1 203 ? 118.334 130.100 29.122  1.00 57.02 ? 203 SER A N   1 
ATOM   1523 C CA  . SER A 1 203 ? 118.222 128.677 29.407  1.00 55.50 ? 203 SER A CA  1 
ATOM   1524 C C   . SER A 1 203 ? 118.609 127.885 28.165  1.00 54.25 ? 203 SER A C   1 
ATOM   1525 O O   . SER A 1 203 ? 118.352 128.316 27.042  1.00 54.56 ? 203 SER A O   1 
ATOM   1526 C CB  . SER A 1 203 ? 116.784 128.342 29.808  1.00 57.39 ? 203 SER A CB  1 
ATOM   1527 O OG  . SER A 1 203 ? 116.346 129.166 30.877  1.00 59.17 ? 203 SER A OG  1 
ATOM   1528 N N   . PRO A 1 204 ? 119.237 126.714 28.349  1.00 51.74 ? 204 PRO A N   1 
ATOM   1529 C CA  . PRO A 1 204 ? 119.638 125.898 27.203  1.00 49.79 ? 204 PRO A CA  1 
ATOM   1530 C C   . PRO A 1 204 ? 118.453 125.169 26.573  1.00 48.91 ? 204 PRO A C   1 
ATOM   1531 O O   . PRO A 1 204 ? 117.453 124.894 27.243  1.00 47.13 ? 204 PRO A O   1 
ATOM   1532 C CB  . PRO A 1 204 ? 120.637 124.926 27.817  1.00 49.97 ? 204 PRO A CB  1 
ATOM   1533 C CG  . PRO A 1 204 ? 120.032 124.675 29.159  1.00 50.10 ? 204 PRO A CG  1 
ATOM   1534 C CD  . PRO A 1 204 ? 119.664 126.083 29.610  1.00 51.16 ? 204 PRO A CD  1 
ATOM   1535 N N   . ILE A 1 205 ? 118.562 124.881 25.280  1.00 46.81 ? 205 ILE A N   1 
ATOM   1536 C CA  . ILE A 1 205 ? 117.522 124.149 24.581  1.00 44.93 ? 205 ILE A CA  1 
ATOM   1537 C C   . ILE A 1 205 ? 117.999 122.716 24.718  1.00 44.66 ? 205 ILE A C   1 
ATOM   1538 O O   . ILE A 1 205 ? 119.125 122.395 24.344  1.00 43.38 ? 205 ILE A O   1 
ATOM   1539 C CB  . ILE A 1 205 ? 117.435 124.553 23.092  1.00 46.07 ? 205 ILE A CB  1 
ATOM   1540 C CG1 . ILE A 1 205 ? 116.931 125.997 22.977  1.00 47.15 ? 205 ILE A CG1 1 
ATOM   1541 C CG2 . ILE A 1 205 ? 116.498 123.613 22.347  1.00 45.97 ? 205 ILE A CG2 1 
ATOM   1542 C CD1 . ILE A 1 205 ? 116.844 126.510 21.560  1.00 48.10 ? 205 ILE A CD1 1 
ATOM   1543 N N   . VAL A 1 206 ? 117.151 121.859 25.268  1.00 44.02 ? 206 VAL A N   1 
ATOM   1544 C CA  . VAL A 1 206 ? 117.539 120.478 25.489  1.00 45.01 ? 206 VAL A CA  1 
ATOM   1545 C C   . VAL A 1 206 ? 116.586 119.451 24.882  1.00 44.25 ? 206 VAL A C   1 
ATOM   1546 O O   . VAL A 1 206 ? 115.365 119.598 24.942  1.00 43.80 ? 206 VAL A O   1 
ATOM   1547 C CB  . VAL A 1 206 ? 117.674 120.220 26.999  1.00 45.98 ? 206 VAL A CB  1 
ATOM   1548 C CG1 . VAL A 1 206 ? 116.377 120.576 27.676  1.00 48.90 ? 206 VAL A CG1 1 
ATOM   1549 C CG2 . VAL A 1 206 ? 118.044 118.771 27.270  1.00 46.33 ? 206 VAL A CG2 1 
ATOM   1550 N N   . LYS A 1 207 ? 117.174 118.410 24.301  1.00 43.28 ? 207 LYS A N   1 
ATOM   1551 C CA  . LYS A 1 207 ? 116.435 117.320 23.676  1.00 43.96 ? 207 LYS A CA  1 
ATOM   1552 C C   . LYS A 1 207 ? 117.073 116.014 24.137  1.00 44.41 ? 207 LYS A C   1 
ATOM   1553 O O   . LYS A 1 207 ? 118.302 115.884 24.138  1.00 42.29 ? 207 LYS A O   1 
ATOM   1554 C CB  . LYS A 1 207 ? 116.517 117.418 22.150  1.00 43.39 ? 207 LYS A CB  1 
ATOM   1555 C CG  . LYS A 1 207 ? 115.887 118.672 21.566  1.00 43.69 ? 207 LYS A CG  1 
ATOM   1556 C CD  . LYS A 1 207 ? 114.368 118.621 21.603  1.00 45.57 ? 207 LYS A CD  1 
ATOM   1557 C CE  . LYS A 1 207 ? 113.775 119.891 21.015  1.00 47.60 ? 207 LYS A CE  1 
ATOM   1558 N NZ  . LYS A 1 207 ? 112.303 119.808 20.844  1.00 48.61 ? 207 LYS A NZ  1 
ATOM   1559 N N   . SER A 1 208 ? 116.241 115.057 24.539  1.00 44.83 ? 208 SER A N   1 
ATOM   1560 C CA  . SER A 1 208 ? 116.740 113.767 25.010  1.00 47.06 ? 208 SER A CA  1 
ATOM   1561 C C   . SER A 1 208 ? 115.870 112.631 24.487  1.00 47.83 ? 208 SER A C   1 
ATOM   1562 O O   . SER A 1 208 ? 114.843 112.857 23.843  1.00 47.68 ? 208 SER A O   1 
ATOM   1563 C CB  . SER A 1 208 ? 116.728 113.710 26.545  1.00 46.30 ? 208 SER A CB  1 
ATOM   1564 O OG  . SER A 1 208 ? 117.228 114.895 27.137  1.00 45.38 ? 208 SER A OG  1 
ATOM   1565 N N   . PHE A 1 209 ? 116.299 111.408 24.773  1.00 48.77 ? 209 PHE A N   1 
ATOM   1566 C CA  . PHE A 1 209 ? 115.557 110.216 24.396  1.00 50.84 ? 209 PHE A CA  1 
ATOM   1567 C C   . PHE A 1 209 ? 116.101 109.074 25.243  1.00 52.91 ? 209 PHE A C   1 
ATOM   1568 O O   . PHE A 1 209 ? 117.295 109.037 25.546  1.00 51.78 ? 209 PHE A O   1 
ATOM   1569 C CB  . PHE A 1 209 ? 115.717 109.915 22.899  1.00 49.66 ? 209 PHE A CB  1 
ATOM   1570 C CG  . PHE A 1 209 ? 117.002 109.223 22.541  1.00 50.39 ? 209 PHE A CG  1 
ATOM   1571 C CD1 . PHE A 1 209 ? 117.132 107.843 22.691  1.00 49.87 ? 209 PHE A CD1 1 
ATOM   1572 C CD2 . PHE A 1 209 ? 118.083 109.947 22.048  1.00 50.38 ? 209 PHE A CD2 1 
ATOM   1573 C CE1 . PHE A 1 209 ? 118.315 107.194 22.354  1.00 48.98 ? 209 PHE A CE1 1 
ATOM   1574 C CE2 . PHE A 1 209 ? 119.275 109.306 21.708  1.00 50.23 ? 209 PHE A CE2 1 
ATOM   1575 C CZ  . PHE A 1 209 ? 119.390 107.926 21.862  1.00 50.42 ? 209 PHE A CZ  1 
ATOM   1576 N N   . ASN A 1 210 ? 115.219 108.166 25.651  1.00 55.65 ? 210 ASN A N   1 
ATOM   1577 C CA  . ASN A 1 210 ? 115.622 107.017 26.454  1.00 58.21 ? 210 ASN A CA  1 
ATOM   1578 C C   . ASN A 1 210 ? 115.692 105.808 25.536  1.00 59.38 ? 210 ASN A C   1 
ATOM   1579 O O   . ASN A 1 210 ? 114.764 105.554 24.765  1.00 60.28 ? 210 ASN A O   1 
ATOM   1580 C CB  . ASN A 1 210 ? 114.610 106.747 27.571  1.00 59.12 ? 210 ASN A CB  1 
ATOM   1581 C CG  . ASN A 1 210 ? 114.406 107.943 28.476  1.00 60.93 ? 210 ASN A CG  1 
ATOM   1582 O OD1 . ASN A 1 210 ? 115.359 108.491 29.027  1.00 61.90 ? 210 ASN A OD1 1 
ATOM   1583 N ND2 . ASN A 1 210 ? 113.152 108.354 28.639  1.00 63.21 ? 210 ASN A ND2 1 
ATOM   1584 N N   . ARG A 1 211 ? 116.790 105.066 25.616  1.00 60.39 ? 211 ARG A N   1 
ATOM   1585 C CA  . ARG A 1 211 ? 116.973 103.885 24.783  1.00 62.24 ? 211 ARG A CA  1 
ATOM   1586 C C   . ARG A 1 211 ? 115.812 102.895 24.961  1.00 63.33 ? 211 ARG A C   1 
ATOM   1587 O O   . ARG A 1 211 ? 115.130 102.602 23.956  1.00 38.81 ? 211 ARG A O   1 
ATOM   1588 C CB  . ARG A 1 211 ? 118.307 103.214 25.134  1.00 62.57 ? 211 ARG A CB  1 
ATOM   1589 C CG  . ARG A 1 211 ? 118.677 102.027 24.258  1.00 63.56 ? 211 ARG A CG  1 
ATOM   1590 C CD  . ARG A 1 211 ? 120.054 101.492 24.621  1.00 65.70 ? 211 ARG A CD  1 
ATOM   1591 N NE  . ARG A 1 211 ? 120.148 101.120 26.032  1.00 67.79 ? 211 ARG A NE  1 
ATOM   1592 C CZ  . ARG A 1 211 ? 119.437 100.151 26.601  1.00 69.06 ? 211 ARG A CZ  1 
ATOM   1593 N NH1 . ARG A 1 211 ? 118.574 99.446  25.879  1.00 69.91 ? 211 ARG A NH1 1 
ATOM   1594 N NH2 . ARG A 1 211 ? 119.588 99.885  27.893  1.00 68.98 ? 211 ARG A NH2 1 
ATOM   1595 N N   . GLN B 2 1   ? 123.428 122.238 -21.413 1.00 51.19 ? 1   GLN B N   1 
ATOM   1596 C CA  . GLN B 2 1   ? 124.105 120.990 -20.965 1.00 51.44 ? 1   GLN B CA  1 
ATOM   1597 C C   . GLN B 2 1   ? 125.538 121.278 -20.510 1.00 50.53 ? 1   GLN B C   1 
ATOM   1598 O O   . GLN B 2 1   ? 126.215 122.146 -21.068 1.00 50.60 ? 1   GLN B O   1 
ATOM   1599 C CB  . GLN B 2 1   ? 124.096 119.948 -22.094 1.00 52.26 ? 1   GLN B CB  1 
ATOM   1600 C CG  . GLN B 2 1   ? 124.812 120.350 -23.388 1.00 53.45 ? 1   GLN B CG  1 
ATOM   1601 C CD  . GLN B 2 1   ? 124.305 121.657 -23.991 1.00 57.10 ? 1   GLN B CD  1 
ATOM   1602 O OE1 . GLN B 2 1   ? 123.171 122.079 -23.742 1.00 57.40 ? 1   GLN B OE1 1 
ATOM   1603 N NE2 . GLN B 2 1   ? 125.146 122.296 -24.808 1.00 59.13 ? 1   GLN B NE2 1 
ATOM   1604 N N   . VAL B 2 2   ? 125.982 120.550 -19.486 1.00 49.50 ? 2   VAL B N   1 
ATOM   1605 C CA  . VAL B 2 2   ? 127.321 120.712 -18.923 1.00 48.47 ? 2   VAL B CA  1 
ATOM   1606 C C   . VAL B 2 2   ? 128.381 120.828 -20.017 1.00 47.12 ? 2   VAL B C   1 
ATOM   1607 O O   . VAL B 2 2   ? 128.556 119.916 -20.827 1.00 47.79 ? 2   VAL B O   1 
ATOM   1608 C CB  . VAL B 2 2   ? 127.678 119.522 -18.000 1.00 50.42 ? 2   VAL B CB  1 
ATOM   1609 C CG1 . VAL B 2 2   ? 129.021 119.771 -17.327 1.00 51.02 ? 2   VAL B CG1 1 
ATOM   1610 C CG2 . VAL B 2 2   ? 126.586 119.326 -16.954 1.00 50.60 ? 2   VAL B CG2 1 
ATOM   1611 N N   . GLN B 2 3   ? 129.097 121.947 -20.038 1.00 44.35 ? 3   GLN B N   1 
ATOM   1612 C CA  . GLN B 2 3   ? 130.115 122.149 -21.063 1.00 41.25 ? 3   GLN B CA  1 
ATOM   1613 C C   . GLN B 2 3   ? 131.427 121.405 -20.781 1.00 39.08 ? 3   GLN B C   1 
ATOM   1614 O O   . GLN B 2 3   ? 132.092 120.943 -21.707 1.00 36.99 ? 3   GLN B O   1 
ATOM   1615 C CB  . GLN B 2 3   ? 130.369 123.649 -21.243 1.00 42.79 ? 3   GLN B CB  1 
ATOM   1616 C CG  . GLN B 2 3   ? 129.086 124.483 -21.278 1.00 42.72 ? 3   GLN B CG  1 
ATOM   1617 C CD  . GLN B 2 3   ? 129.306 125.911 -21.759 1.00 45.68 ? 3   GLN B CD  1 
ATOM   1618 O OE1 . GLN B 2 3   ? 128.467 126.792 -21.527 1.00 46.47 ? 3   GLN B OE1 1 
ATOM   1619 N NE2 . GLN B 2 3   ? 130.426 126.146 -22.445 1.00 44.01 ? 3   GLN B NE2 1 
ATOM   1620 N N   . LEU B 2 4   ? 131.784 121.266 -19.506 1.00 37.27 ? 4   LEU B N   1 
ATOM   1621 C CA  . LEU B 2 4   ? 133.023 120.591 -19.110 1.00 35.75 ? 4   LEU B CA  1 
ATOM   1622 C C   . LEU B 2 4   ? 132.750 119.506 -18.067 1.00 35.04 ? 4   LEU B C   1 
ATOM   1623 O O   . LEU B 2 4   ? 132.283 119.803 -16.968 1.00 35.06 ? 4   LEU B O   1 
ATOM   1624 C CB  . LEU B 2 4   ? 134.016 121.613 -18.529 1.00 35.96 ? 4   LEU B CB  1 
ATOM   1625 C CG  . LEU B 2 4   ? 134.858 122.522 -19.439 1.00 37.33 ? 4   LEU B CG  1 
ATOM   1626 C CD1 . LEU B 2 4   ? 134.051 122.994 -20.613 1.00 37.54 ? 4   LEU B CD1 1 
ATOM   1627 C CD2 . LEU B 2 4   ? 135.383 123.718 -18.634 1.00 35.68 ? 4   LEU B CD2 1 
ATOM   1628 N N   . GLN B 2 5   ? 133.070 118.258 -18.400 1.00 32.35 ? 5   GLN B N   1 
ATOM   1629 C CA  . GLN B 2 5   ? 132.833 117.148 -17.483 1.00 31.90 ? 5   GLN B CA  1 
ATOM   1630 C C   . GLN B 2 5   ? 134.105 116.578 -16.871 1.00 29.07 ? 5   GLN B C   1 
ATOM   1631 O O   . GLN B 2 5   ? 134.987 116.108 -17.581 1.00 30.45 ? 5   GLN B O   1 
ATOM   1632 C CB  . GLN B 2 5   ? 132.053 116.032 -18.205 1.00 32.39 ? 5   GLN B CB  1 
ATOM   1633 N N   . GLN B 2 6   ? 134.188 116.606 -15.547 1.00 29.51 ? 6   GLN B N   1 
ATOM   1634 C CA  . GLN B 2 6   ? 135.351 116.083 -14.832 1.00 30.49 ? 6   GLN B CA  1 
ATOM   1635 C C   . GLN B 2 6   ? 134.938 115.002 -13.833 1.00 32.23 ? 6   GLN B C   1 
ATOM   1636 O O   . GLN B 2 6   ? 133.862 115.082 -13.233 1.00 32.21 ? 6   GLN B O   1 
ATOM   1637 C CB  . GLN B 2 6   ? 136.042 117.184 -14.019 1.00 28.69 ? 6   GLN B CB  1 
ATOM   1638 C CG  . GLN B 2 6   ? 136.572 118.398 -14.773 1.00 27.92 ? 6   GLN B CG  1 
ATOM   1639 C CD  . GLN B 2 6   ? 137.357 119.327 -13.841 1.00 23.19 ? 6   GLN B CD  1 
ATOM   1640 O OE1 . GLN B 2 6   ? 138.465 119.003 -13.410 1.00 23.67 ? 6   GLN B OE1 1 
ATOM   1641 N NE2 . GLN B 2 6   ? 136.766 120.464 -13.503 1.00 20.32 ? 6   GLN B NE2 1 
ATOM   1642 N N   . PRO B 2 7   ? 135.795 113.984 -13.633 1.00 33.95 ? 7   PRO B N   1 
ATOM   1643 C CA  . PRO B 2 7   ? 135.486 112.914 -12.677 1.00 34.22 ? 7   PRO B CA  1 
ATOM   1644 C C   . PRO B 2 7   ? 135.456 113.555 -11.289 1.00 34.24 ? 7   PRO B C   1 
ATOM   1645 O O   . PRO B 2 7   ? 136.168 114.526 -11.038 1.00 33.83 ? 7   PRO B O   1 
ATOM   1646 C CB  . PRO B 2 7   ? 136.666 111.958 -12.828 1.00 35.54 ? 7   PRO B CB  1 
ATOM   1647 C CG  . PRO B 2 7   ? 137.086 112.166 -14.267 1.00 37.59 ? 7   PRO B CG  1 
ATOM   1648 C CD  . PRO B 2 7   ? 137.011 113.667 -14.403 1.00 33.99 ? 7   PRO B CD  1 
ATOM   1649 N N   . GLY B 2 8   ? 134.644 113.015 -10.389 1.00 32.80 ? 8   GLY B N   1 
ATOM   1650 C CA  . GLY B 2 8   ? 134.547 113.584 -9.058  1.00 32.24 ? 8   GLY B CA  1 
ATOM   1651 C C   . GLY B 2 8   ? 135.768 113.460 -8.167  1.00 32.87 ? 8   GLY B C   1 
ATOM   1652 O O   . GLY B 2 8   ? 136.084 114.384 -7.416  1.00 31.88 ? 8   GLY B O   1 
ATOM   1653 N N   . ALA B 2 9   ? 136.471 112.335 -8.234  1.00 33.08 ? 9   ALA B N   1 
ATOM   1654 C CA  . ALA B 2 9   ? 137.631 112.157 -7.374  1.00 33.72 ? 9   ALA B CA  1 
ATOM   1655 C C   . ALA B 2 9   ? 138.688 111.203 -7.902  1.00 35.75 ? 9   ALA B C   1 
ATOM   1656 O O   . ALA B 2 9   ? 138.459 110.457 -8.851  1.00 34.69 ? 9   ALA B O   1 
ATOM   1657 C CB  . ALA B 2 9   ? 137.179 111.699 -5.996  1.00 34.37 ? 9   ALA B CB  1 
ATOM   1658 N N   . GLU B 2 10  ? 139.854 111.255 -7.266  1.00 37.10 ? 10  GLU B N   1 
ATOM   1659 C CA  . GLU B 2 10  ? 140.988 110.410 -7.603  1.00 38.52 ? 10  GLU B CA  1 
ATOM   1660 C C   . GLU B 2 10  ? 141.843 110.231 -6.351  1.00 40.06 ? 10  GLU B C   1 
ATOM   1661 O O   . GLU B 2 10  ? 142.258 111.214 -5.731  1.00 40.65 ? 10  GLU B O   1 
ATOM   1662 C CB  . GLU B 2 10  ? 141.851 111.059 -8.687  1.00 40.22 ? 10  GLU B CB  1 
ATOM   1663 C CG  . GLU B 2 10  ? 141.297 111.003 -10.102 1.00 43.24 ? 10  GLU B CG  1 
ATOM   1664 C CD  . GLU B 2 10  ? 141.130 109.583 -10.604 1.00 45.89 ? 10  GLU B CD  1 
ATOM   1665 O OE1 . GLU B 2 10  ? 141.928 108.708 -10.200 1.00 48.35 ? 10  GLU B OE1 1 
ATOM   1666 O OE2 . GLU B 2 10  ? 140.208 109.341 -11.412 1.00 47.18 ? 10  GLU B OE2 1 
ATOM   1667 N N   . LEU B 2 11  ? 142.088 108.983 -5.966  1.00 40.04 ? 11  LEU B N   1 
ATOM   1668 C CA  . LEU B 2 11  ? 142.938 108.711 -4.814  1.00 41.15 ? 11  LEU B CA  1 
ATOM   1669 C C   . LEU B 2 11  ? 144.303 108.387 -5.408  1.00 41.90 ? 11  LEU B C   1 
ATOM   1670 O O   . LEU B 2 11  ? 144.398 107.629 -6.375  1.00 41.48 ? 11  LEU B O   1 
ATOM   1671 C CB  . LEU B 2 11  ? 142.419 107.519 -4.003  1.00 40.33 ? 11  LEU B CB  1 
ATOM   1672 C CG  . LEU B 2 11  ? 143.274 107.156 -2.780  1.00 41.58 ? 11  LEU B CG  1 
ATOM   1673 C CD1 . LEU B 2 11  ? 143.333 108.337 -1.834  1.00 39.54 ? 11  LEU B CD1 1 
ATOM   1674 C CD2 . LEU B 2 11  ? 142.691 105.937 -2.071  1.00 41.34 ? 11  LEU B CD2 1 
ATOM   1675 N N   . VAL B 2 12  ? 145.353 108.976 -4.844  1.00 42.79 ? 12  VAL B N   1 
ATOM   1676 C CA  . VAL B 2 12  ? 146.708 108.764 -5.335  1.00 43.87 ? 12  VAL B CA  1 
ATOM   1677 C C   . VAL B 2 12  ? 147.673 108.520 -4.179  1.00 44.64 ? 12  VAL B C   1 
ATOM   1678 O O   . VAL B 2 12  ? 147.619 109.201 -3.155  1.00 43.07 ? 12  VAL B O   1 
ATOM   1679 C CB  . VAL B 2 12  ? 147.203 109.994 -6.148  1.00 44.73 ? 12  VAL B CB  1 
ATOM   1680 C CG1 . VAL B 2 12  ? 148.599 109.734 -6.706  1.00 44.31 ? 12  VAL B CG1 1 
ATOM   1681 C CG2 . VAL B 2 12  ? 146.229 110.296 -7.273  1.00 44.03 ? 12  VAL B CG2 1 
ATOM   1682 N N   . LYS B 2 13  ? 148.550 107.536 -4.346  1.00 47.00 ? 13  LYS B N   1 
ATOM   1683 C CA  . LYS B 2 13  ? 149.530 107.219 -3.315  1.00 49.67 ? 13  LYS B CA  1 
ATOM   1684 C C   . LYS B 2 13  ? 150.688 108.194 -3.452  1.00 50.72 ? 13  LYS B C   1 
ATOM   1685 O O   . LYS B 2 13  ? 151.055 108.572 -4.564  1.00 50.86 ? 13  LYS B O   1 
ATOM   1686 C CB  . LYS B 2 13  ? 150.052 105.785 -3.485  1.00 50.85 ? 13  LYS B CB  1 
ATOM   1687 C CG  . LYS B 2 13  ? 148.986 104.712 -3.351  1.00 51.89 ? 13  LYS B CG  1 
ATOM   1688 C CD  . LYS B 2 13  ? 149.591 103.320 -3.375  1.00 52.82 ? 13  LYS B CD  1 
ATOM   1689 C CE  . LYS B 2 13  ? 148.525 102.268 -3.122  1.00 54.88 ? 13  LYS B CE  1 
ATOM   1690 N NZ  . LYS B 2 13  ? 147.841 102.503 -1.817  1.00 53.53 ? 13  LYS B NZ  1 
ATOM   1691 N N   . PRO B 2 14  ? 151.271 108.626 -2.323  1.00 51.45 ? 14  PRO B N   1 
ATOM   1692 C CA  . PRO B 2 14  ? 152.391 109.562 -2.428  1.00 51.38 ? 14  PRO B CA  1 
ATOM   1693 C C   . PRO B 2 14  ? 153.461 108.985 -3.349  1.00 51.76 ? 14  PRO B C   1 
ATOM   1694 O O   . PRO B 2 14  ? 153.830 107.816 -3.227  1.00 51.96 ? 14  PRO B O   1 
ATOM   1695 C CB  . PRO B 2 14  ? 152.861 109.711 -0.980  1.00 51.39 ? 14  PRO B CB  1 
ATOM   1696 C CG  . PRO B 2 14  ? 152.432 108.423 -0.339  1.00 52.72 ? 14  PRO B CG  1 
ATOM   1697 C CD  . PRO B 2 14  ? 151.068 108.199 -0.928  1.00 51.24 ? 14  PRO B CD  1 
ATOM   1698 N N   . GLY B 2 15  ? 153.929 109.805 -4.285  1.00 51.20 ? 15  GLY B N   1 
ATOM   1699 C CA  . GLY B 2 15  ? 154.941 109.365 -5.227  1.00 49.98 ? 15  GLY B CA  1 
ATOM   1700 C C   . GLY B 2 15  ? 154.352 108.944 -6.559  1.00 49.38 ? 15  GLY B C   1 
ATOM   1701 O O   . GLY B 2 15  ? 155.009 109.054 -7.593  1.00 50.04 ? 15  GLY B O   1 
ATOM   1702 N N   . ALA B 2 16  ? 153.112 108.465 -6.536  1.00 48.07 ? 16  ALA B N   1 
ATOM   1703 C CA  . ALA B 2 16  ? 152.438 108.021 -7.750  1.00 47.57 ? 16  ALA B CA  1 
ATOM   1704 C C   . ALA B 2 16  ? 151.938 109.196 -8.587  1.00 48.14 ? 16  ALA B C   1 
ATOM   1705 O O   . ALA B 2 16  ? 152.046 110.355 -8.180  1.00 47.99 ? 16  ALA B O   1 
ATOM   1706 C CB  . ALA B 2 16  ? 151.274 107.104 -7.393  1.00 48.45 ? 16  ALA B CB  1 
ATOM   1707 N N   . SER B 2 17  ? 151.386 108.879 -9.756  1.00 48.01 ? 17  SER B N   1 
ATOM   1708 C CA  . SER B 2 17  ? 150.864 109.878 -10.683 1.00 47.76 ? 17  SER B CA  1 
ATOM   1709 C C   . SER B 2 17  ? 149.426 109.567 -11.082 1.00 47.43 ? 17  SER B C   1 
ATOM   1710 O O   . SER B 2 17  ? 148.973 108.429 -10.969 1.00 47.11 ? 17  SER B O   1 
ATOM   1711 C CB  . SER B 2 17  ? 151.730 109.925 -11.941 1.00 48.85 ? 17  SER B CB  1 
ATOM   1712 O OG  . SER B 2 17  ? 153.076 110.219 -11.615 1.00 52.02 ? 17  SER B OG  1 
ATOM   1713 N N   . VAL B 2 18  ? 148.717 110.587 -11.555 1.00 45.71 ? 18  VAL B N   1 
ATOM   1714 C CA  . VAL B 2 18  ? 147.329 110.437 -11.979 1.00 44.09 ? 18  VAL B CA  1 
ATOM   1715 C C   . VAL B 2 18  ? 147.069 111.317 -13.197 1.00 43.25 ? 18  VAL B C   1 
ATOM   1716 O O   . VAL B 2 18  ? 147.698 112.360 -13.364 1.00 42.79 ? 18  VAL B O   1 
ATOM   1717 C CB  . VAL B 2 18  ? 146.349 110.841 -10.852 1.00 44.69 ? 18  VAL B CB  1 
ATOM   1718 C CG1 . VAL B 2 18  ? 146.586 112.290 -10.452 1.00 43.22 ? 18  VAL B CG1 1 
ATOM   1719 C CG2 . VAL B 2 18  ? 144.914 110.646 -11.317 1.00 43.50 ? 18  VAL B CG2 1 
ATOM   1720 N N   . LYS B 2 19  ? 146.138 110.895 -14.045 1.00 42.35 ? 19  LYS B N   1 
ATOM   1721 C CA  . LYS B 2 19  ? 145.816 111.646 -15.246 1.00 42.60 ? 19  LYS B CA  1 
ATOM   1722 C C   . LYS B 2 19  ? 144.360 112.097 -15.202 1.00 42.01 ? 19  LYS B C   1 
ATOM   1723 O O   . LYS B 2 19  ? 143.451 111.307 -15.442 1.00 41.75 ? 19  LYS B O   1 
ATOM   1724 C CB  . LYS B 2 19  ? 146.065 110.773 -16.477 1.00 45.21 ? 19  LYS B CB  1 
ATOM   1725 C CG  . LYS B 2 19  ? 146.122 111.528 -17.796 1.00 48.15 ? 19  LYS B CG  1 
ATOM   1726 C CD  . LYS B 2 19  ? 146.635 110.627 -18.920 1.00 50.59 ? 19  LYS B CD  1 
ATOM   1727 C CE  . LYS B 2 19  ? 147.032 111.435 -20.153 1.00 52.21 ? 19  LYS B CE  1 
ATOM   1728 N NZ  . LYS B 2 19  ? 147.563 110.574 -21.249 1.00 52.09 ? 19  LYS B NZ  1 
ATOM   1729 N N   . LEU B 2 20  ? 144.141 113.369 -14.890 1.00 39.55 ? 20  LEU B N   1 
ATOM   1730 C CA  . LEU B 2 20  ? 142.787 113.900 -14.814 1.00 38.55 ? 20  LEU B CA  1 
ATOM   1731 C C   . LEU B 2 20  ? 142.254 114.212 -16.205 1.00 37.42 ? 20  LEU B C   1 
ATOM   1732 O O   . LEU B 2 20  ? 143.013 114.574 -17.104 1.00 36.75 ? 20  LEU B O   1 
ATOM   1733 C CB  . LEU B 2 20  ? 142.765 115.158 -13.947 1.00 39.20 ? 20  LEU B CB  1 
ATOM   1734 C CG  . LEU B 2 20  ? 143.472 115.035 -12.592 1.00 39.46 ? 20  LEU B CG  1 
ATOM   1735 C CD1 . LEU B 2 20  ? 143.139 116.261 -11.756 1.00 40.00 ? 20  LEU B CD1 1 
ATOM   1736 C CD2 . LEU B 2 20  ? 143.031 113.772 -11.875 1.00 39.62 ? 20  LEU B CD2 1 
ATOM   1737 N N   . SER B 2 21  ? 140.944 114.075 -16.380 1.00 36.55 ? 21  SER B N   1 
ATOM   1738 C CA  . SER B 2 21  ? 140.332 114.325 -17.678 1.00 35.51 ? 21  SER B CA  1 
ATOM   1739 C C   . SER B 2 21  ? 139.306 115.448 -17.628 1.00 34.40 ? 21  SER B C   1 
ATOM   1740 O O   . SER B 2 21  ? 138.756 115.769 -16.578 1.00 32.61 ? 21  SER B O   1 
ATOM   1741 C CB  . SER B 2 21  ? 139.666 113.051 -18.196 1.00 36.23 ? 21  SER B CB  1 
ATOM   1742 O OG  . SER B 2 21  ? 138.549 112.703 -17.393 1.00 36.50 ? 21  SER B OG  1 
ATOM   1743 N N   . CYS B 2 22  ? 139.043 116.033 -18.784 1.00 34.96 ? 22  CYS B N   1 
ATOM   1744 C CA  . CYS B 2 22  ? 138.097 117.131 -18.887 1.00 36.22 ? 22  CYS B CA  1 
ATOM   1745 C C   . CYS B 2 22  ? 137.450 117.053 -20.255 1.00 36.29 ? 22  CYS B C   1 
ATOM   1746 O O   . CYS B 2 22  ? 138.000 117.556 -21.233 1.00 35.53 ? 22  CYS B O   1 
ATOM   1747 C CB  . CYS B 2 22  ? 138.837 118.467 -18.725 1.00 36.11 ? 22  CYS B CB  1 
ATOM   1748 S SG  . CYS B 2 22  ? 137.879 119.924 -19.190 1.00 41.49 ? 22  CYS B SG  1 
ATOM   1749 N N   . LYS B 2 23  ? 136.285 116.413 -20.322 1.00 38.02 ? 23  LYS B N   1 
ATOM   1750 C CA  . LYS B 2 23  ? 135.561 116.258 -21.578 1.00 37.33 ? 23  LYS B CA  1 
ATOM   1751 C C   . LYS B 2 23  ? 134.665 117.463 -21.828 1.00 37.81 ? 23  LYS B C   1 
ATOM   1752 O O   . LYS B 2 23  ? 133.761 117.760 -21.048 1.00 38.26 ? 23  LYS B O   1 
ATOM   1753 C CB  . LYS B 2 23  ? 134.738 114.978 -21.550 1.00 39.25 ? 23  LYS B CB  1 
ATOM   1754 N N   . ALA B 2 24  ? 134.923 118.149 -22.936 1.00 38.56 ? 24  ALA B N   1 
ATOM   1755 C CA  . ALA B 2 24  ? 134.177 119.343 -23.291 1.00 38.79 ? 24  ALA B CA  1 
ATOM   1756 C C   . ALA B 2 24  ? 133.102 119.089 -24.328 1.00 38.94 ? 24  ALA B C   1 
ATOM   1757 O O   . ALA B 2 24  ? 133.265 118.245 -25.203 1.00 40.58 ? 24  ALA B O   1 
ATOM   1758 C CB  . ALA B 2 24  ? 135.142 120.409 -23.806 1.00 38.09 ? 24  ALA B CB  1 
ATOM   1759 N N   . SER B 2 25  ? 132.006 119.836 -24.219 1.00 40.83 ? 25  SER B N   1 
ATOM   1760 C CA  . SER B 2 25  ? 130.889 119.745 -25.161 1.00 43.25 ? 25  SER B CA  1 
ATOM   1761 C C   . SER B 2 25  ? 130.484 121.182 -25.491 1.00 43.32 ? 25  SER B C   1 
ATOM   1762 O O   . SER B 2 25  ? 131.076 122.126 -24.970 1.00 43.96 ? 25  SER B O   1 
ATOM   1763 C CB  . SER B 2 25  ? 129.708 118.984 -24.545 1.00 42.48 ? 25  SER B CB  1 
ATOM   1764 O OG  . SER B 2 25  ? 129.062 119.755 -23.550 1.00 46.26 ? 25  SER B OG  1 
ATOM   1765 N N   . GLY B 2 26  ? 129.491 121.356 -26.353 1.00 43.21 ? 26  GLY B N   1 
ATOM   1766 C CA  . GLY B 2 26  ? 129.076 122.700 -26.717 1.00 44.59 ? 26  GLY B CA  1 
ATOM   1767 C C   . GLY B 2 26  ? 129.943 123.248 -27.842 1.00 46.34 ? 26  GLY B C   1 
ATOM   1768 O O   . GLY B 2 26  ? 130.669 122.494 -28.490 1.00 46.65 ? 26  GLY B O   1 
ATOM   1769 N N   . TYR B 2 27  ? 129.872 124.556 -28.078 1.00 46.52 ? 27  TYR B N   1 
ATOM   1770 C CA  . TYR B 2 27  ? 130.662 125.190 -29.133 1.00 47.75 ? 27  TYR B CA  1 
ATOM   1771 C C   . TYR B 2 27  ? 132.169 125.068 -28.908 1.00 48.28 ? 27  TYR B C   1 
ATOM   1772 O O   . TYR B 2 27  ? 132.658 125.273 -27.795 1.00 48.16 ? 27  TYR B O   1 
ATOM   1773 C CB  . TYR B 2 27  ? 130.303 126.676 -29.245 1.00 48.16 ? 27  TYR B CB  1 
ATOM   1774 C CG  . TYR B 2 27  ? 128.986 126.954 -29.930 1.00 50.05 ? 27  TYR B CG  1 
ATOM   1775 C CD1 . TYR B 2 27  ? 127.936 127.571 -29.247 1.00 50.79 ? 27  TYR B CD1 1 
ATOM   1776 C CD2 . TYR B 2 27  ? 128.790 126.611 -31.267 1.00 49.79 ? 27  TYR B CD2 1 
ATOM   1777 C CE1 . TYR B 2 27  ? 126.722 127.839 -29.881 1.00 51.86 ? 27  TYR B CE1 1 
ATOM   1778 C CE2 . TYR B 2 27  ? 127.584 126.873 -31.909 1.00 52.17 ? 27  TYR B CE2 1 
ATOM   1779 C CZ  . TYR B 2 27  ? 126.554 127.486 -31.211 1.00 51.92 ? 27  TYR B CZ  1 
ATOM   1780 O OH  . TYR B 2 27  ? 125.357 127.732 -31.845 1.00 53.50 ? 27  TYR B OH  1 
ATOM   1781 N N   . THR B 2 28  ? 132.899 124.731 -29.969 1.00 47.83 ? 28  THR B N   1 
ATOM   1782 C CA  . THR B 2 28  ? 134.351 124.613 -29.900 1.00 49.13 ? 28  THR B CA  1 
ATOM   1783 C C   . THR B 2 28  ? 134.985 125.434 -31.028 1.00 50.32 ? 28  THR B C   1 
ATOM   1784 O O   . THR B 2 28  ? 134.630 125.282 -32.200 1.00 50.53 ? 28  THR B O   1 
ATOM   1785 C CB  . THR B 2 28  ? 134.823 123.136 -30.009 1.00 49.08 ? 28  THR B CB  1 
ATOM   1786 O OG1 . THR B 2 28  ? 134.164 122.498 -31.108 1.00 50.39 ? 28  THR B OG1 1 
ATOM   1787 C CG2 . THR B 2 28  ? 134.522 122.377 -28.724 1.00 48.65 ? 28  THR B CG2 1 
ATOM   1788 N N   . PHE B 2 29  ? 135.914 126.313 -30.662 1.00 49.36 ? 29  PHE B N   1 
ATOM   1789 C CA  . PHE B 2 29  ? 136.592 127.165 -31.632 1.00 49.23 ? 29  PHE B CA  1 
ATOM   1790 C C   . PHE B 2 29  ? 138.100 126.931 -31.593 1.00 49.17 ? 29  PHE B C   1 
ATOM   1791 O O   . PHE B 2 29  ? 138.653 126.529 -30.566 1.00 49.28 ? 29  PHE B O   1 
ATOM   1792 C CB  . PHE B 2 29  ? 136.295 128.636 -31.332 1.00 49.89 ? 29  PHE B CB  1 
ATOM   1793 C CG  . PHE B 2 29  ? 134.828 128.957 -31.261 1.00 51.12 ? 29  PHE B CG  1 
ATOM   1794 C CD1 . PHE B 2 29  ? 134.008 128.792 -32.376 1.00 51.97 ? 29  PHE B CD1 1 
ATOM   1795 C CD2 . PHE B 2 29  ? 134.262 129.418 -30.078 1.00 50.90 ? 29  PHE B CD2 1 
ATOM   1796 C CE1 . PHE B 2 29  ? 132.644 129.081 -32.312 1.00 52.21 ? 29  PHE B CE1 1 
ATOM   1797 C CE2 . PHE B 2 29  ? 132.899 129.709 -30.003 1.00 52.44 ? 29  PHE B CE2 1 
ATOM   1798 C CZ  . PHE B 2 29  ? 132.090 129.540 -31.121 1.00 51.57 ? 29  PHE B CZ  1 
ATOM   1799 N N   . THR B 2 30  ? 138.762 127.190 -32.715 1.00 47.32 ? 30  THR B N   1 
ATOM   1800 C CA  . THR B 2 30  ? 140.204 127.010 -32.814 1.00 45.58 ? 30  THR B CA  1 
ATOM   1801 C C   . THR B 2 30  ? 140.912 127.954 -31.843 1.00 43.30 ? 30  THR B C   1 
ATOM   1802 O O   . THR B 2 30  ? 142.079 127.772 -31.511 1.00 43.07 ? 30  THR B O   1 
ATOM   1803 C CB  . THR B 2 30  ? 140.685 127.290 -34.264 1.00 46.21 ? 30  THR B CB  1 
ATOM   1804 O OG1 . THR B 2 30  ? 142.088 127.018 -34.368 1.00 48.02 ? 30  THR B OG1 1 
ATOM   1805 C CG2 . THR B 2 30  ? 140.418 128.740 -34.649 1.00 45.11 ? 30  THR B CG2 1 
ATOM   1806 N N   . SER B 2 31  ? 140.183 128.960 -31.385 1.00 42.27 ? 31  SER B N   1 
ATOM   1807 C CA  . SER B 2 31  ? 140.715 129.944 -30.457 1.00 42.03 ? 31  SER B CA  1 
ATOM   1808 C C   . SER B 2 31  ? 140.465 129.583 -28.987 1.00 40.97 ? 31  SER B C   1 
ATOM   1809 O O   . SER B 2 31  ? 140.696 130.406 -28.099 1.00 40.90 ? 31  SER B O   1 
ATOM   1810 C CB  . SER B 2 31  ? 140.093 131.308 -30.756 1.00 42.35 ? 31  SER B CB  1 
ATOM   1811 O OG  . SER B 2 31  ? 138.678 131.211 -30.795 1.00 43.19 ? 31  SER B OG  1 
ATOM   1812 N N   . ASP B 2 32  ? 139.994 128.363 -28.731 1.00 37.31 ? 32  ASP B N   1 
ATOM   1813 C CA  . ASP B 2 32  ? 139.714 127.936 -27.362 1.00 33.85 ? 32  ASP B CA  1 
ATOM   1814 C C   . ASP B 2 32  ? 140.933 127.487 -26.572 1.00 31.67 ? 32  ASP B C   1 
ATOM   1815 O O   . ASP B 2 32  ? 141.798 126.776 -27.085 1.00 29.49 ? 32  ASP B O   1 
ATOM   1816 C CB  . ASP B 2 32  ? 138.727 126.762 -27.334 1.00 32.93 ? 32  ASP B CB  1 
ATOM   1817 C CG  . ASP B 2 32  ? 137.334 127.145 -27.756 1.00 32.15 ? 32  ASP B CG  1 
ATOM   1818 O OD1 . ASP B 2 32  ? 136.989 128.344 -27.717 1.00 31.27 ? 32  ASP B OD1 1 
ATOM   1819 O OD2 . ASP B 2 32  ? 136.567 126.225 -28.111 1.00 35.76 ? 32  ASP B OD2 1 
ATOM   1820 N N   . TRP B 2 33  ? 140.987 127.880 -25.306 1.00 30.22 ? 33  TRP B N   1 
ATOM   1821 C CA  . TRP B 2 33  ? 142.074 127.441 -24.445 1.00 30.15 ? 33  TRP B CA  1 
ATOM   1822 C C   . TRP B 2 33  ? 141.446 126.775 -23.236 1.00 30.23 ? 33  TRP B C   1 
ATOM   1823 O O   . TRP B 2 33  ? 140.478 127.284 -22.682 1.00 31.42 ? 33  TRP B O   1 
ATOM   1824 C CB  . TRP B 2 33  ? 142.938 128.617 -23.981 1.00 29.26 ? 33  TRP B CB  1 
ATOM   1825 C CG  . TRP B 2 33  ? 143.708 129.268 -25.087 1.00 29.39 ? 33  TRP B CG  1 
ATOM   1826 C CD1 . TRP B 2 33  ? 143.208 130.078 -26.068 1.00 27.91 ? 33  TRP B CD1 1 
ATOM   1827 C CD2 . TRP B 2 33  ? 145.119 129.172 -25.322 1.00 27.42 ? 33  TRP B CD2 1 
ATOM   1828 N NE1 . TRP B 2 33  ? 144.221 130.495 -26.898 1.00 27.84 ? 33  TRP B NE1 1 
ATOM   1829 C CE2 . TRP B 2 33  ? 145.405 129.955 -26.463 1.00 28.76 ? 33  TRP B CE2 1 
ATOM   1830 C CE3 . TRP B 2 33  ? 146.171 128.500 -24.679 1.00 28.19 ? 33  TRP B CE3 1 
ATOM   1831 C CZ2 . TRP B 2 33  ? 146.705 130.088 -26.978 1.00 26.58 ? 33  TRP B CZ2 1 
ATOM   1832 C CZ3 . TRP B 2 33  ? 147.467 128.632 -25.191 1.00 28.64 ? 33  TRP B CZ3 1 
ATOM   1833 C CH2 . TRP B 2 33  ? 147.718 129.421 -26.329 1.00 27.35 ? 33  TRP B CH2 1 
ATOM   1834 N N   . ILE B 2 34  ? 141.985 125.631 -22.838 1.00 29.79 ? 34  ILE B N   1 
ATOM   1835 C CA  . ILE B 2 34  ? 141.483 124.940 -21.664 1.00 28.34 ? 34  ILE B CA  1 
ATOM   1836 C C   . ILE B 2 34  ? 142.493 125.183 -20.555 1.00 27.03 ? 34  ILE B C   1 
ATOM   1837 O O   . ILE B 2 34  ? 143.664 124.858 -20.699 1.00 27.10 ? 34  ILE B O   1 
ATOM   1838 C CB  . ILE B 2 34  ? 141.343 123.419 -21.896 1.00 28.83 ? 34  ILE B CB  1 
ATOM   1839 C CG1 . ILE B 2 34  ? 140.301 123.147 -22.990 1.00 28.19 ? 34  ILE B CG1 1 
ATOM   1840 C CG2 . ILE B 2 34  ? 140.956 122.733 -20.591 1.00 29.05 ? 34  ILE B CG2 1 
ATOM   1841 C CD1 . ILE B 2 34  ? 138.938 123.740 -22.712 1.00 26.27 ? 34  ILE B CD1 1 
ATOM   1842 N N   . HIS B 2 35  ? 142.025 125.770 -19.459 1.00 27.13 ? 35  HIS B N   1 
ATOM   1843 C CA  . HIS B 2 35  ? 142.873 126.078 -18.315 1.00 27.43 ? 35  HIS B CA  1 
ATOM   1844 C C   . HIS B 2 35  ? 142.632 125.109 -17.171 1.00 26.91 ? 35  HIS B C   1 
ATOM   1845 O O   . HIS B 2 35  ? 141.603 124.435 -17.109 1.00 27.03 ? 35  HIS B O   1 
ATOM   1846 C CB  . HIS B 2 35  ? 142.588 127.492 -17.805 1.00 26.84 ? 35  HIS B CB  1 
ATOM   1847 C CG  . HIS B 2 35  ? 142.930 128.571 -18.782 1.00 30.08 ? 35  HIS B CG  1 
ATOM   1848 N ND1 . HIS B 2 35  ? 143.946 129.476 -18.563 1.00 28.42 ? 35  HIS B ND1 1 
ATOM   1849 C CD2 . HIS B 2 35  ? 142.381 128.902 -19.974 1.00 28.26 ? 35  HIS B CD2 1 
ATOM   1850 C CE1 . HIS B 2 35  ? 144.007 130.318 -19.577 1.00 29.31 ? 35  HIS B CE1 1 
ATOM   1851 N NE2 . HIS B 2 35  ? 143.068 129.992 -20.446 1.00 28.50 ? 35  HIS B NE2 1 
ATOM   1852 N N   . TRP B 2 36  ? 143.596 125.054 -16.263 1.00 26.14 ? 36  TRP B N   1 
ATOM   1853 C CA  . TRP B 2 36  ? 143.504 124.212 -15.087 1.00 24.07 ? 36  TRP B CA  1 
ATOM   1854 C C   . TRP B 2 36  ? 143.843 125.092 -13.898 1.00 25.50 ? 36  TRP B C   1 
ATOM   1855 O O   . TRP B 2 36  ? 144.834 125.834 -13.916 1.00 21.90 ? 36  TRP B O   1 
ATOM   1856 C CB  . TRP B 2 36  ? 144.464 123.026 -15.189 1.00 24.72 ? 36  TRP B CB  1 
ATOM   1857 C CG  . TRP B 2 36  ? 144.034 122.061 -16.247 1.00 28.18 ? 36  TRP B CG  1 
ATOM   1858 C CD1 . TRP B 2 36  ? 144.268 122.156 -17.592 1.00 28.16 ? 36  TRP B CD1 1 
ATOM   1859 C CD2 . TRP B 2 36  ? 143.251 120.880 -16.058 1.00 27.97 ? 36  TRP B CD2 1 
ATOM   1860 N NE1 . TRP B 2 36  ? 143.679 121.103 -18.250 1.00 28.62 ? 36  TRP B NE1 1 
ATOM   1861 C CE2 . TRP B 2 36  ? 143.048 120.304 -17.332 1.00 31.39 ? 36  TRP B CE2 1 
ATOM   1862 C CE3 . TRP B 2 36  ? 142.700 120.250 -14.933 1.00 30.60 ? 36  TRP B CE3 1 
ATOM   1863 C CZ2 . TRP B 2 36  ? 142.315 119.124 -17.513 1.00 32.47 ? 36  TRP B CZ2 1 
ATOM   1864 C CZ3 . TRP B 2 36  ? 141.972 119.078 -15.111 1.00 31.19 ? 36  TRP B CZ3 1 
ATOM   1865 C CH2 . TRP B 2 36  ? 141.786 118.527 -16.393 1.00 32.54 ? 36  TRP B CH2 1 
ATOM   1866 N N   . VAL B 2 37  ? 142.986 125.020 -12.887 1.00 22.99 ? 37  VAL B N   1 
ATOM   1867 C CA  . VAL B 2 37  ? 143.121 125.804 -11.677 1.00 24.46 ? 37  VAL B CA  1 
ATOM   1868 C C   . VAL B 2 37  ? 143.131 124.873 -10.465 1.00 26.16 ? 37  VAL B C   1 
ATOM   1869 O O   . VAL B 2 37  ? 142.332 123.938 -10.378 1.00 26.23 ? 37  VAL B O   1 
ATOM   1870 C CB  . VAL B 2 37  ? 141.941 126.795 -11.560 1.00 25.77 ? 37  VAL B CB  1 
ATOM   1871 C CG1 . VAL B 2 37  ? 141.938 127.485 -10.196 1.00 23.70 ? 37  VAL B CG1 1 
ATOM   1872 C CG2 . VAL B 2 37  ? 142.022 127.804 -12.672 1.00 23.78 ? 37  VAL B CG2 1 
ATOM   1873 N N   . LYS B 2 38  ? 144.046 125.129 -9.540  1.00 27.02 ? 38  LYS B N   1 
ATOM   1874 C CA  . LYS B 2 38  ? 144.168 124.322 -8.333  1.00 27.58 ? 38  LYS B CA  1 
ATOM   1875 C C   . LYS B 2 38  ? 143.618 125.068 -7.125  1.00 28.67 ? 38  LYS B C   1 
ATOM   1876 O O   . LYS B 2 38  ? 143.906 126.246 -6.935  1.00 27.45 ? 38  LYS B O   1 
ATOM   1877 C CB  . LYS B 2 38  ? 145.636 123.976 -8.086  1.00 26.76 ? 38  LYS B CB  1 
ATOM   1878 C CG  . LYS B 2 38  ? 145.909 123.321 -6.732  1.00 29.84 ? 38  LYS B CG  1 
ATOM   1879 C CD  . LYS B 2 38  ? 147.390 122.972 -6.593  1.00 33.35 ? 38  LYS B CD  1 
ATOM   1880 C CE  . LYS B 2 38  ? 147.716 122.395 -5.221  1.00 34.23 ? 38  LYS B CE  1 
ATOM   1881 N NZ  . LYS B 2 38  ? 149.173 122.057 -5.087  1.00 37.82 ? 38  LYS B NZ  1 
ATOM   1882 N N   . GLN B 2 39  ? 142.819 124.384 -6.313  1.00 29.39 ? 39  GLN B N   1 
ATOM   1883 C CA  . GLN B 2 39  ? 142.264 125.002 -5.116  1.00 30.71 ? 39  GLN B CA  1 
ATOM   1884 C C   . GLN B 2 39  ? 142.361 124.059 -3.926  1.00 32.30 ? 39  GLN B C   1 
ATOM   1885 O O   . GLN B 2 39  ? 141.658 123.056 -3.863  1.00 29.05 ? 39  GLN B O   1 
ATOM   1886 C CB  . GLN B 2 39  ? 140.806 125.401 -5.322  1.00 29.37 ? 39  GLN B CB  1 
ATOM   1887 C CG  . GLN B 2 39  ? 140.168 125.969 -4.062  1.00 29.05 ? 39  GLN B CG  1 
ATOM   1888 C CD  . GLN B 2 39  ? 138.868 126.688 -4.343  1.00 28.71 ? 39  GLN B CD  1 
ATOM   1889 O OE1 . GLN B 2 39  ? 137.953 126.126 -4.944  1.00 31.46 ? 39  GLN B OE1 1 
ATOM   1890 N NE2 . GLN B 2 39  ? 138.777 127.938 -3.911  1.00 26.71 ? 39  GLN B NE2 1 
ATOM   1891 N N   . ARG B 2 40  ? 143.249 124.387 -2.995  1.00 34.41 ? 40  ARG B N   1 
ATOM   1892 C CA  . ARG B 2 40  ? 143.440 123.581 -1.802  1.00 37.29 ? 40  ARG B CA  1 
ATOM   1893 C C   . ARG B 2 40  ? 142.350 123.973 -0.814  1.00 40.58 ? 40  ARG B C   1 
ATOM   1894 O O   . ARG B 2 40  ? 141.835 125.093 -0.858  1.00 38.66 ? 40  ARG B O   1 
ATOM   1895 C CB  . ARG B 2 40  ? 144.827 123.835 -1.207  1.00 38.11 ? 40  ARG B CB  1 
ATOM   1896 N N   . PRO B 2 41  ? 141.982 123.053 0.093   1.00 44.80 ? 41  PRO B N   1 
ATOM   1897 C CA  . PRO B 2 41  ? 140.936 123.341 1.080   1.00 47.00 ? 41  PRO B CA  1 
ATOM   1898 C C   . PRO B 2 41  ? 141.175 124.641 1.836   1.00 47.88 ? 41  PRO B C   1 
ATOM   1899 O O   . PRO B 2 41  ? 142.267 124.884 2.352   1.00 47.31 ? 41  PRO B O   1 
ATOM   1900 C CB  . PRO B 2 41  ? 140.962 122.108 1.986   1.00 48.24 ? 41  PRO B CB  1 
ATOM   1901 C CG  . PRO B 2 41  ? 142.393 121.645 1.889   1.00 48.90 ? 41  PRO B CG  1 
ATOM   1902 C CD  . PRO B 2 41  ? 142.663 121.785 0.410   1.00 47.27 ? 41  PRO B CD  1 
ATOM   1903 N N   . GLY B 2 42  ? 140.145 125.479 1.876   1.00 49.25 ? 42  GLY B N   1 
ATOM   1904 C CA  . GLY B 2 42  ? 140.245 126.750 2.569   1.00 50.52 ? 42  GLY B CA  1 
ATOM   1905 C C   . GLY B 2 42  ? 141.013 127.838 1.837   1.00 51.55 ? 42  GLY B C   1 
ATOM   1906 O O   . GLY B 2 42  ? 140.939 129.005 2.225   1.00 52.97 ? 42  GLY B O   1 
ATOM   1907 N N   . HIS B 2 43  ? 141.747 127.481 0.784   1.00 50.74 ? 43  HIS B N   1 
ATOM   1908 C CA  . HIS B 2 43  ? 142.516 128.481 0.042   1.00 49.99 ? 43  HIS B CA  1 
ATOM   1909 C C   . HIS B 2 43  ? 141.842 129.010 -1.220  1.00 46.48 ? 43  HIS B C   1 
ATOM   1910 O O   . HIS B 2 43  ? 140.719 128.626 -1.549  1.00 44.85 ? 43  HIS B O   1 
ATOM   1911 C CB  . HIS B 2 43  ? 143.902 127.940 -0.311  1.00 53.73 ? 43  HIS B CB  1 
ATOM   1912 C CG  . HIS B 2 43  ? 144.802 127.777 0.874   1.00 58.96 ? 43  HIS B CG  1 
ATOM   1913 N ND1 . HIS B 2 43  ? 146.160 127.567 0.754   1.00 60.42 ? 43  HIS B ND1 1 
ATOM   1914 C CD2 . HIS B 2 43  ? 144.537 127.785 2.203   1.00 60.04 ? 43  HIS B CD2 1 
ATOM   1915 C CE1 . HIS B 2 43  ? 146.693 127.455 1.958   1.00 62.23 ? 43  HIS B CE1 1 
ATOM   1916 N NE2 . HIS B 2 43  ? 145.730 127.584 2.855   1.00 62.52 ? 43  HIS B NE2 1 
ATOM   1917 N N   . GLY B 2 44  ? 142.545 129.899 -1.919  1.00 42.22 ? 44  GLY B N   1 
ATOM   1918 C CA  . GLY B 2 44  ? 142.005 130.491 -3.128  1.00 37.77 ? 44  GLY B CA  1 
ATOM   1919 C C   . GLY B 2 44  ? 142.282 129.724 -4.407  1.00 34.82 ? 44  GLY B C   1 
ATOM   1920 O O   . GLY B 2 44  ? 142.677 128.555 -4.383  1.00 32.41 ? 44  GLY B O   1 
ATOM   1921 N N   . LEU B 2 45  ? 142.079 130.404 -5.531  1.00 31.60 ? 45  LEU B N   1 
ATOM   1922 C CA  . LEU B 2 45  ? 142.281 129.820 -6.845  1.00 29.71 ? 45  LEU B CA  1 
ATOM   1923 C C   . LEU B 2 45  ? 143.707 130.058 -7.332  1.00 30.47 ? 45  LEU B C   1 
ATOM   1924 O O   . LEU B 2 45  ? 144.198 131.186 -7.334  1.00 32.13 ? 45  LEU B O   1 
ATOM   1925 C CB  . LEU B 2 45  ? 141.271 130.425 -7.832  1.00 29.78 ? 45  LEU B CB  1 
ATOM   1926 C CG  . LEU B 2 45  ? 139.803 130.338 -7.387  1.00 27.87 ? 45  LEU B CG  1 
ATOM   1927 C CD1 . LEU B 2 45  ? 138.928 131.078 -8.382  1.00 27.59 ? 45  LEU B CD1 1 
ATOM   1928 C CD2 . LEU B 2 45  ? 139.377 128.875 -7.267  1.00 28.10 ? 45  LEU B CD2 1 
ATOM   1929 N N   . GLU B 2 46  ? 144.364 128.987 -7.751  1.00 28.89 ? 46  GLU B N   1 
ATOM   1930 C CA  . GLU B 2 46  ? 145.733 129.065 -8.239  1.00 30.36 ? 46  GLU B CA  1 
ATOM   1931 C C   . GLU B 2 46  ? 145.816 128.509 -9.664  1.00 29.23 ? 46  GLU B C   1 
ATOM   1932 O O   . GLU B 2 46  ? 145.473 127.355 -9.915  1.00 29.94 ? 46  GLU B O   1 
ATOM   1933 C CB  . GLU B 2 46  ? 146.657 128.275 -7.298  1.00 34.05 ? 46  GLU B CB  1 
ATOM   1934 C CG  . GLU B 2 46  ? 148.132 128.308 -7.660  1.00 39.87 ? 46  GLU B CG  1 
ATOM   1935 C CD  . GLU B 2 46  ? 149.000 127.616 -6.612  1.00 44.83 ? 46  GLU B CD  1 
ATOM   1936 O OE1 . GLU B 2 46  ? 148.743 126.427 -6.310  1.00 46.35 ? 46  GLU B OE1 1 
ATOM   1937 O OE2 . GLU B 2 46  ? 149.939 128.260 -6.090  1.00 45.78 ? 46  GLU B OE2 1 
ATOM   1938 N N   . TRP B 2 47  ? 146.262 129.347 -10.591 1.00 26.06 ? 47  TRP B N   1 
ATOM   1939 C CA  . TRP B 2 47  ? 146.395 128.963 -11.988 1.00 25.25 ? 47  TRP B CA  1 
ATOM   1940 C C   . TRP B 2 47  ? 147.541 127.971 -12.198 1.00 25.64 ? 47  TRP B C   1 
ATOM   1941 O O   . TRP B 2 47  ? 148.665 128.219 -11.767 1.00 24.94 ? 47  TRP B O   1 
ATOM   1942 C CB  . TRP B 2 47  ? 146.633 130.205 -12.834 1.00 22.25 ? 47  TRP B CB  1 
ATOM   1943 C CG  . TRP B 2 47  ? 146.543 129.942 -14.287 1.00 23.60 ? 47  TRP B CG  1 
ATOM   1944 C CD1 . TRP B 2 47  ? 145.415 129.659 -14.997 1.00 23.56 ? 47  TRP B CD1 1 
ATOM   1945 C CD2 . TRP B 2 47  ? 147.625 129.926 -15.225 1.00 23.00 ? 47  TRP B CD2 1 
ATOM   1946 N NE1 . TRP B 2 47  ? 145.723 129.471 -16.322 1.00 23.90 ? 47  TRP B NE1 1 
ATOM   1947 C CE2 . TRP B 2 47  ? 147.074 129.626 -16.491 1.00 21.56 ? 47  TRP B CE2 1 
ATOM   1948 C CE3 . TRP B 2 47  ? 149.009 130.134 -15.119 1.00 22.89 ? 47  TRP B CE3 1 
ATOM   1949 C CZ2 . TRP B 2 47  ? 147.858 129.527 -17.651 1.00 21.49 ? 47  TRP B CZ2 1 
ATOM   1950 C CZ3 . TRP B 2 47  ? 149.793 130.036 -16.274 1.00 20.80 ? 47  TRP B CZ3 1 
ATOM   1951 C CH2 . TRP B 2 47  ? 149.212 129.735 -17.520 1.00 23.29 ? 47  TRP B CH2 1 
ATOM   1952 N N   . ILE B 2 48  ? 147.261 126.851 -12.862 1.00 24.30 ? 48  ILE B N   1 
ATOM   1953 C CA  . ILE B 2 48  ? 148.298 125.842 -13.098 1.00 24.39 ? 48  ILE B CA  1 
ATOM   1954 C C   . ILE B 2 48  ? 148.906 125.965 -14.487 1.00 23.33 ? 48  ILE B C   1 
ATOM   1955 O O   . ILE B 2 48  ? 150.125 125.997 -14.649 1.00 25.52 ? 48  ILE B O   1 
ATOM   1956 C CB  . ILE B 2 48  ? 147.743 124.409 -12.973 1.00 26.35 ? 48  ILE B CB  1 
ATOM   1957 C CG1 . ILE B 2 48  ? 147.093 124.210 -11.606 1.00 27.31 ? 48  ILE B CG1 1 
ATOM   1958 C CG2 . ILE B 2 48  ? 148.878 123.390 -13.154 1.00 25.86 ? 48  ILE B CG2 1 
ATOM   1959 C CD1 . ILE B 2 48  ? 146.425 122.843 -11.450 1.00 27.38 ? 48  ILE B CD1 1 
ATOM   1960 N N   . GLY B 2 49  ? 148.046 126.027 -15.490 1.00 23.73 ? 49  GLY B N   1 
ATOM   1961 C CA  . GLY B 2 49  ? 148.514 126.128 -16.860 1.00 24.55 ? 49  GLY B CA  1 
ATOM   1962 C C   . GLY B 2 49  ? 147.343 126.176 -17.821 1.00 24.91 ? 49  GLY B C   1 
ATOM   1963 O O   . GLY B 2 49  ? 146.183 126.192 -17.401 1.00 24.97 ? 49  GLY B O   1 
ATOM   1964 N N   . GLU B 2 50  ? 147.651 126.181 -19.112 1.00 23.65 ? 50  GLU B N   1 
ATOM   1965 C CA  . GLU B 2 50  ? 146.634 126.253 -20.149 1.00 24.54 ? 50  GLU B CA  1 
ATOM   1966 C C   . GLU B 2 50  ? 147.144 125.484 -21.360 1.00 24.61 ? 50  GLU B C   1 
ATOM   1967 O O   . GLU B 2 50  ? 148.320 125.162 -21.445 1.00 22.40 ? 50  GLU B O   1 
ATOM   1968 C CB  . GLU B 2 50  ? 146.423 127.710 -20.563 1.00 24.96 ? 50  GLU B CB  1 
ATOM   1969 C CG  . GLU B 2 50  ? 147.618 128.280 -21.350 1.00 23.83 ? 50  GLU B CG  1 
ATOM   1970 C CD  . GLU B 2 50  ? 147.634 129.801 -21.428 1.00 27.71 ? 50  GLU B CD  1 
ATOM   1971 O OE1 . GLU B 2 50  ? 146.543 130.413 -21.509 1.00 29.24 ? 50  GLU B OE1 1 
ATOM   1972 O OE2 . GLU B 2 50  ? 148.744 130.383 -21.427 1.00 24.85 ? 50  GLU B OE2 1 
ATOM   1973 N N   . ILE B 2 51  ? 146.245 125.198 -22.292 1.00 25.36 ? 51  ILE B N   1 
ATOM   1974 C CA  . ILE B 2 51  ? 146.614 124.511 -23.515 1.00 26.36 ? 51  ILE B CA  1 
ATOM   1975 C C   . ILE B 2 51  ? 145.604 124.882 -24.584 1.00 28.81 ? 51  ILE B C   1 
ATOM   1976 O O   . ILE B 2 51  ? 144.426 125.109 -24.290 1.00 29.05 ? 51  ILE B O   1 
ATOM   1977 C CB  . ILE B 2 51  ? 146.628 122.974 -23.343 1.00 28.25 ? 51  ILE B CB  1 
ATOM   1978 C CG1 . ILE B 2 51  ? 147.101 122.320 -24.645 1.00 27.17 ? 51  ILE B CG1 1 
ATOM   1979 C CG2 . ILE B 2 51  ? 145.233 122.472 -22.971 1.00 27.50 ? 51  ILE B CG2 1 
ATOM   1980 C CD1 . ILE B 2 51  ? 147.377 120.841 -24.537 1.00 28.39 ? 51  ILE B CD1 1 
ATOM   1981 N N   . ILE B 2 52  ? 146.076 124.988 -25.819 1.00 29.06 ? 52  ILE B N   1 
ATOM   1982 C CA  . ILE B 2 52  ? 145.201 125.299 -26.931 1.00 31.14 ? 52  ILE B CA  1 
ATOM   1983 C C   . ILE B 2 52  ? 145.172 124.020 -27.760 1.00 34.19 ? 52  ILE B C   1 
ATOM   1984 O O   . ILE B 2 52  ? 146.127 123.688 -28.457 1.00 33.41 ? 52  ILE B O   1 
ATOM   1985 C CB  . ILE B 2 52  ? 145.727 126.504 -27.758 1.00 30.81 ? 52  ILE B CB  1 
ATOM   1986 C CG1 . ILE B 2 52  ? 144.802 126.753 -28.950 1.00 30.42 ? 52  ILE B CG1 1 
ATOM   1987 C CG2 . ILE B 2 52  ? 147.167 126.261 -28.204 1.00 29.42 ? 52  ILE B CG2 1 
ATOM   1988 C CD1 . ILE B 2 52  ? 145.097 128.053 -29.688 1.00 31.05 ? 52  ILE B CD1 1 
ATOM   1989 N N   . PRO B 2 53  ? 144.077 123.257 -27.649 1.00 36.74 ? 53  PRO B N   1 
ATOM   1990 C CA  . PRO B 2 53  ? 143.892 121.994 -28.368 1.00 37.96 ? 53  PRO B CA  1 
ATOM   1991 C C   . PRO B 2 53  ? 144.084 122.098 -29.876 1.00 39.13 ? 53  PRO B C   1 
ATOM   1992 O O   . PRO B 2 53  ? 144.657 121.201 -30.487 1.00 38.78 ? 53  PRO B O   1 
ATOM   1993 C CB  . PRO B 2 53  ? 142.464 121.592 -27.999 1.00 39.66 ? 53  PRO B CB  1 
ATOM   1994 C CG  . PRO B 2 53  ? 142.298 122.178 -26.624 1.00 39.03 ? 53  PRO B CG  1 
ATOM   1995 C CD  . PRO B 2 53  ? 142.911 123.551 -26.798 1.00 36.45 ? 53  PRO B CD  1 
ATOM   1996 N N   . SER B 2 54  ? 143.612 123.190 -30.473 1.00 40.39 ? 54  SER B N   1 
ATOM   1997 C CA  . SER B 2 54  ? 143.728 123.366 -31.918 1.00 42.62 ? 54  SER B CA  1 
ATOM   1998 C C   . SER B 2 54  ? 145.182 123.329 -32.390 1.00 44.55 ? 54  SER B C   1 
ATOM   1999 O O   . SER B 2 54  ? 145.454 123.096 -33.570 1.00 45.04 ? 54  SER B O   1 
ATOM   2000 C CB  . SER B 2 54  ? 143.060 124.680 -32.365 1.00 41.94 ? 54  SER B CB  1 
ATOM   2001 O OG  . SER B 2 54  ? 143.816 125.826 -32.001 1.00 43.97 ? 54  SER B OG  1 
ATOM   2002 N N   . TYR B 2 55  ? 146.115 123.536 -31.465 1.00 45.22 ? 55  TYR B N   1 
ATOM   2003 C CA  . TYR B 2 55  ? 147.530 123.538 -31.814 1.00 45.53 ? 55  TYR B CA  1 
ATOM   2004 C C   . TYR B 2 55  ? 148.368 122.604 -30.930 1.00 44.16 ? 55  TYR B C   1 
ATOM   2005 O O   . TYR B 2 55  ? 149.427 122.143 -31.347 1.00 44.93 ? 55  TYR B O   1 
ATOM   2006 C CB  . TYR B 2 55  ? 148.073 124.967 -31.728 1.00 47.57 ? 55  TYR B CB  1 
ATOM   2007 C CG  . TYR B 2 55  ? 149.363 125.180 -32.480 1.00 51.39 ? 55  TYR B CG  1 
ATOM   2008 C CD1 . TYR B 2 55  ? 149.359 125.447 -33.850 1.00 53.05 ? 55  TYR B CD1 1 
ATOM   2009 C CD2 . TYR B 2 55  ? 150.595 125.118 -31.821 1.00 53.05 ? 55  TYR B CD2 1 
ATOM   2010 C CE1 . TYR B 2 55  ? 150.553 125.652 -34.548 1.00 54.16 ? 55  TYR B CE1 1 
ATOM   2011 C CE2 . TYR B 2 55  ? 151.792 125.319 -32.507 1.00 54.43 ? 55  TYR B CE2 1 
ATOM   2012 C CZ  . TYR B 2 55  ? 151.763 125.588 -33.867 1.00 54.63 ? 55  TYR B CZ  1 
ATOM   2013 O OH  . TYR B 2 55  ? 152.944 125.805 -34.539 1.00 56.94 ? 55  TYR B OH  1 
ATOM   2014 N N   . GLY B 2 56  ? 147.900 122.332 -29.714 1.00 43.57 ? 56  GLY B N   1 
ATOM   2015 C CA  . GLY B 2 56  ? 148.627 121.442 -28.819 1.00 41.37 ? 56  GLY B CA  1 
ATOM   2016 C C   . GLY B 2 56  ? 149.697 122.107 -27.966 1.00 40.76 ? 56  GLY B C   1 
ATOM   2017 O O   . GLY B 2 56  ? 150.450 121.432 -27.256 1.00 41.05 ? 56  GLY B O   1 
ATOM   2018 N N   . ARG B 2 57  ? 149.771 123.431 -28.038 1.00 38.54 ? 57  ARG B N   1 
ATOM   2019 C CA  . ARG B 2 57  ? 150.746 124.204 -27.271 1.00 37.83 ? 57  ARG B CA  1 
ATOM   2020 C C   . ARG B 2 57  ? 150.256 124.372 -25.829 1.00 35.58 ? 57  ARG B C   1 
ATOM   2021 O O   . ARG B 2 57  ? 149.073 124.630 -25.605 1.00 36.23 ? 57  ARG B O   1 
ATOM   2022 C CB  . ARG B 2 57  ? 150.922 125.578 -27.926 1.00 40.86 ? 57  ARG B CB  1 
ATOM   2023 C CG  . ARG B 2 57  ? 151.616 126.625 -27.069 1.00 47.19 ? 57  ARG B CG  1 
ATOM   2024 C CD  . ARG B 2 57  ? 153.127 126.562 -27.182 1.00 52.03 ? 57  ARG B CD  1 
ATOM   2025 N NE  . ARG B 2 57  ? 153.752 127.684 -26.483 1.00 57.57 ? 57  ARG B NE  1 
ATOM   2026 C CZ  . ARG B 2 57  ? 155.030 128.032 -26.614 1.00 61.75 ? 57  ARG B CZ  1 
ATOM   2027 N NH1 . ARG B 2 57  ? 155.827 127.342 -27.424 1.00 61.76 ? 57  ARG B NH1 1 
ATOM   2028 N NH2 . ARG B 2 57  ? 155.513 129.073 -25.939 1.00 63.16 ? 57  ARG B NH2 1 
ATOM   2029 N N   . ALA B 2 58  ? 151.159 124.230 -24.860 1.00 31.61 ? 58  ALA B N   1 
ATOM   2030 C CA  . ALA B 2 58  ? 150.799 124.382 -23.452 1.00 30.53 ? 58  ALA B CA  1 
ATOM   2031 C C   . ALA B 2 58  ? 151.771 125.291 -22.699 1.00 29.60 ? 58  ALA B C   1 
ATOM   2032 O O   . ALA B 2 58  ? 152.976 125.237 -22.931 1.00 29.65 ? 58  ALA B O   1 
ATOM   2033 C CB  . ALA B 2 58  ? 150.743 123.015 -22.772 1.00 32.13 ? 58  ALA B CB  1 
ATOM   2034 N N   . ASN B 2 59  ? 151.238 126.123 -21.803 1.00 26.40 ? 59  ASN B N   1 
ATOM   2035 C CA  . ASN B 2 59  ? 152.055 127.025 -20.993 1.00 27.00 ? 59  ASN B CA  1 
ATOM   2036 C C   . ASN B 2 59  ? 151.757 126.731 -19.536 1.00 26.66 ? 59  ASN B C   1 
ATOM   2037 O O   . ASN B 2 59  ? 150.653 126.298 -19.193 1.00 25.83 ? 59  ASN B O   1 
ATOM   2038 C CB  . ASN B 2 59  ? 151.732 128.483 -21.319 1.00 25.74 ? 59  ASN B CB  1 
ATOM   2039 C CG  . ASN B 2 59  ? 151.879 128.782 -22.798 1.00 26.03 ? 59  ASN B CG  1 
ATOM   2040 O OD1 . ASN B 2 59  ? 152.924 128.519 -23.384 1.00 23.36 ? 59  ASN B OD1 1 
ATOM   2041 N ND2 . ASN B 2 59  ? 150.830 129.326 -23.408 1.00 25.37 ? 59  ASN B ND2 1 
ATOM   2042 N N   . TYR B 2 60  ? 152.740 126.964 -18.679 1.00 27.29 ? 60  TYR B N   1 
ATOM   2043 C CA  . TYR B 2 60  ? 152.584 126.673 -17.265 1.00 29.14 ? 60  TYR B CA  1 
ATOM   2044 C C   . TYR B 2 60  ? 152.986 127.812 -16.355 1.00 29.89 ? 60  TYR B C   1 
ATOM   2045 O O   . TYR B 2 60  ? 153.821 128.645 -16.715 1.00 29.92 ? 60  TYR B O   1 
ATOM   2046 C CB  . TYR B 2 60  ? 153.418 125.438 -16.898 1.00 30.30 ? 60  TYR B CB  1 
ATOM   2047 C CG  . TYR B 2 60  ? 153.137 124.226 -17.762 1.00 31.53 ? 60  TYR B CG  1 
ATOM   2048 C CD1 . TYR B 2 60  ? 153.750 124.070 -19.010 1.00 27.09 ? 60  TYR B CD1 1 
ATOM   2049 C CD2 . TYR B 2 60  ? 152.227 123.249 -17.344 1.00 29.56 ? 60  TYR B CD2 1 
ATOM   2050 C CE1 . TYR B 2 60  ? 153.459 122.965 -19.819 1.00 28.55 ? 60  TYR B CE1 1 
ATOM   2051 C CE2 . TYR B 2 60  ? 151.928 122.151 -18.141 1.00 28.07 ? 60  TYR B CE2 1 
ATOM   2052 C CZ  . TYR B 2 60  ? 152.542 122.009 -19.374 1.00 28.82 ? 60  TYR B CZ  1 
ATOM   2053 O OH  . TYR B 2 60  ? 152.236 120.915 -20.157 1.00 28.20 ? 60  TYR B OH  1 
ATOM   2054 N N   . ASN B 2 61  ? 152.379 127.827 -15.171 1.00 31.52 ? 61  ASN B N   1 
ATOM   2055 C CA  . ASN B 2 61  ? 152.658 128.813 -14.130 1.00 32.97 ? 61  ASN B CA  1 
ATOM   2056 C C   . ASN B 2 61  ? 154.121 128.602 -13.733 1.00 34.91 ? 61  ASN B C   1 
ATOM   2057 O O   . ASN B 2 61  ? 154.502 127.511 -13.299 1.00 33.46 ? 61  ASN B O   1 
ATOM   2058 C CB  . ASN B 2 61  ? 151.762 128.546 -12.914 1.00 32.56 ? 61  ASN B CB  1 
ATOM   2059 C CG  . ASN B 2 61  ? 151.839 129.648 -11.866 1.00 32.58 ? 61  ASN B CG  1 
ATOM   2060 O OD1 . ASN B 2 61  ? 152.876 130.293 -11.702 1.00 35.21 ? 61  ASN B OD1 1 
ATOM   2061 N ND2 . ASN B 2 61  ? 150.740 129.858 -11.140 1.00 24.37 ? 61  ASN B ND2 1 
ATOM   2062 N N   . GLU B 2 62  ? 154.938 129.639 -13.867 1.00 36.66 ? 62  GLU B N   1 
ATOM   2063 C CA  . GLU B 2 62  ? 156.353 129.519 -13.541 1.00 40.50 ? 62  GLU B CA  1 
ATOM   2064 C C   . GLU B 2 62  ? 156.661 129.688 -12.059 1.00 41.41 ? 62  GLU B C   1 
ATOM   2065 O O   . GLU B 2 62  ? 157.731 129.290 -11.597 1.00 40.76 ? 62  GLU B O   1 
ATOM   2066 C CB  . GLU B 2 62  ? 157.157 130.556 -14.316 1.00 41.43 ? 62  GLU B CB  1 
ATOM   2067 C CG  . GLU B 2 62  ? 156.807 130.656 -15.777 1.00 46.56 ? 62  GLU B CG  1 
ATOM   2068 C CD  . GLU B 2 62  ? 157.682 131.664 -16.487 1.00 50.07 ? 62  GLU B CD  1 
ATOM   2069 O OE1 . GLU B 2 62  ? 158.113 132.631 -15.813 1.00 52.32 ? 62  GLU B OE1 1 
ATOM   2070 O OE2 . GLU B 2 62  ? 157.930 131.499 -17.707 1.00 49.96 ? 62  GLU B OE2 1 
ATOM   2071 N N   . LYS B 2 63  ? 155.726 130.283 -11.323 1.00 41.65 ? 63  LYS B N   1 
ATOM   2072 C CA  . LYS B 2 63  ? 155.912 130.540 -9.900  1.00 43.84 ? 63  LYS B CA  1 
ATOM   2073 C C   . LYS B 2 63  ? 155.836 129.309 -8.994  1.00 45.63 ? 63  LYS B C   1 
ATOM   2074 O O   . LYS B 2 63  ? 156.337 129.339 -7.869  1.00 45.87 ? 63  LYS B O   1 
ATOM   2075 C CB  . LYS B 2 63  ? 154.900 131.594 -9.435  1.00 44.40 ? 63  LYS B CB  1 
ATOM   2076 N N   . ILE B 2 64  ? 155.218 128.231 -9.473  1.00 46.20 ? 64  ILE B N   1 
ATOM   2077 C CA  . ILE B 2 64  ? 155.087 127.016 -8.668  1.00 47.05 ? 64  ILE B CA  1 
ATOM   2078 C C   . ILE B 2 64  ? 155.858 125.850 -9.276  1.00 47.89 ? 64  ILE B C   1 
ATOM   2079 O O   . ILE B 2 64  ? 156.185 125.868 -10.462 1.00 48.22 ? 64  ILE B O   1 
ATOM   2080 C CB  . ILE B 2 64  ? 153.609 126.594 -8.529  1.00 45.77 ? 64  ILE B CB  1 
ATOM   2081 C CG1 . ILE B 2 64  ? 153.041 126.240 -9.905  1.00 45.68 ? 64  ILE B CG1 1 
ATOM   2082 C CG2 . ILE B 2 64  ? 152.802 127.715 -7.891  1.00 46.52 ? 64  ILE B CG2 1 
ATOM   2083 C CD1 . ILE B 2 64  ? 151.630 125.679 -9.866  1.00 46.29 ? 64  ILE B CD1 1 
ATOM   2084 N N   . GLN B 2 65  ? 156.141 124.834 -8.464  1.00 48.80 ? 65  GLN B N   1 
ATOM   2085 C CA  . GLN B 2 65  ? 156.870 123.661 -8.940  1.00 49.01 ? 65  GLN B CA  1 
ATOM   2086 C C   . GLN B 2 65  ? 156.025 122.954 -9.990  1.00 49.14 ? 65  GLN B C   1 
ATOM   2087 O O   . GLN B 2 65  ? 154.850 122.681 -9.756  1.00 50.13 ? 65  GLN B O   1 
ATOM   2088 C CB  . GLN B 2 65  ? 157.164 122.715 -7.775  1.00 48.89 ? 65  GLN B CB  1 
ATOM   2089 N N   . LYS B 2 66  ? 156.616 122.659 -11.144 1.00 49.29 ? 66  LYS B N   1 
ATOM   2090 C CA  . LYS B 2 66  ? 155.877 121.996 -12.211 1.00 49.96 ? 66  LYS B CA  1 
ATOM   2091 C C   . LYS B 2 66  ? 155.525 120.545 -11.880 1.00 49.76 ? 66  LYS B C   1 
ATOM   2092 O O   . LYS B 2 66  ? 156.399 119.682 -11.800 1.00 51.64 ? 66  LYS B O   1 
ATOM   2093 C CB  . LYS B 2 66  ? 156.658 122.038 -13.527 1.00 49.55 ? 66  LYS B CB  1 
ATOM   2094 C CG  . LYS B 2 66  ? 155.869 121.439 -14.682 1.00 52.46 ? 66  LYS B CG  1 
ATOM   2095 C CD  . LYS B 2 66  ? 156.604 121.509 -16.006 1.00 53.60 ? 66  LYS B CD  1 
ATOM   2096 C CE  . LYS B 2 66  ? 155.759 120.889 -17.110 1.00 54.22 ? 66  LYS B CE  1 
ATOM   2097 N NZ  . LYS B 2 66  ? 156.408 120.992 -18.449 1.00 57.35 ? 66  LYS B NZ  1 
ATOM   2098 N N   . LYS B 2 67  ? 154.233 120.285 -11.707 1.00 47.84 ? 67  LYS B N   1 
ATOM   2099 C CA  . LYS B 2 67  ? 153.741 118.953 -11.380 1.00 46.56 ? 67  LYS B CA  1 
ATOM   2100 C C   . LYS B 2 67  ? 152.865 118.406 -12.506 1.00 45.31 ? 67  LYS B C   1 
ATOM   2101 O O   . LYS B 2 67  ? 152.616 117.199 -12.588 1.00 44.75 ? 67  LYS B O   1 
ATOM   2102 C CB  . LYS B 2 67  ? 152.909 119.007 -10.093 1.00 47.94 ? 67  LYS B CB  1 
ATOM   2103 C CG  . LYS B 2 67  ? 153.432 118.164 -8.945  1.00 50.36 ? 67  LYS B CG  1 
ATOM   2104 C CD  . LYS B 2 67  ? 154.693 118.749 -8.344  1.00 51.35 ? 67  LYS B CD  1 
ATOM   2105 C CE  . LYS B 2 67  ? 155.170 117.895 -7.190  1.00 53.01 ? 67  LYS B CE  1 
ATOM   2106 N NZ  . LYS B 2 67  ? 155.411 116.501 -7.644  1.00 54.40 ? 67  LYS B NZ  1 
ATOM   2107 N N   . ALA B 2 68  ? 152.416 119.299 -13.382 1.00 42.64 ? 68  ALA B N   1 
ATOM   2108 C CA  . ALA B 2 68  ? 151.528 118.916 -14.468 1.00 39.94 ? 68  ALA B CA  1 
ATOM   2109 C C   . ALA B 2 68  ? 152.103 118.911 -15.878 1.00 38.69 ? 68  ALA B C   1 
ATOM   2110 O O   . ALA B 2 68  ? 153.117 119.542 -16.166 1.00 37.49 ? 68  ALA B O   1 
ATOM   2111 C CB  . ALA B 2 68  ? 150.287 119.809 -14.436 1.00 39.74 ? 68  ALA B CB  1 
ATOM   2112 N N   . THR B 2 69  ? 151.410 118.177 -16.745 1.00 37.06 ? 69  THR B N   1 
ATOM   2113 C CA  . THR B 2 69  ? 151.727 118.052 -18.159 1.00 36.43 ? 69  THR B CA  1 
ATOM   2114 C C   . THR B 2 69  ? 150.365 118.024 -18.841 1.00 36.32 ? 69  THR B C   1 
ATOM   2115 O O   . THR B 2 69  ? 149.566 117.113 -18.619 1.00 37.03 ? 69  THR B O   1 
ATOM   2116 C CB  . THR B 2 69  ? 152.480 116.741 -18.477 1.00 36.00 ? 69  THR B CB  1 
ATOM   2117 O OG1 . THR B 2 69  ? 153.788 116.791 -17.900 1.00 36.24 ? 69  THR B OG1 1 
ATOM   2118 C CG2 . THR B 2 69  ? 152.604 116.549 -19.977 1.00 37.08 ? 69  THR B CG2 1 
ATOM   2119 N N   . LEU B 2 70  ? 150.098 119.031 -19.659 1.00 35.09 ? 70  LEU B N   1 
ATOM   2120 C CA  . LEU B 2 70  ? 148.819 119.117 -20.335 1.00 34.76 ? 70  LEU B CA  1 
ATOM   2121 C C   . LEU B 2 70  ? 148.865 118.619 -21.759 1.00 36.35 ? 70  LEU B C   1 
ATOM   2122 O O   . LEU B 2 70  ? 149.778 118.950 -22.522 1.00 36.05 ? 70  LEU B O   1 
ATOM   2123 C CB  . LEU B 2 70  ? 148.323 120.564 -20.339 1.00 31.73 ? 70  LEU B CB  1 
ATOM   2124 C CG  . LEU B 2 70  ? 148.313 121.262 -18.980 1.00 31.42 ? 70  LEU B CG  1 
ATOM   2125 C CD1 . LEU B 2 70  ? 147.789 122.687 -19.147 1.00 29.78 ? 70  LEU B CD1 1 
ATOM   2126 C CD2 . LEU B 2 70  ? 147.449 120.478 -18.012 1.00 28.15 ? 70  LEU B CD2 1 
ATOM   2127 N N   . THR B 2 71  ? 147.866 117.819 -22.105 1.00 36.57 ? 71  THR B N   1 
ATOM   2128 C CA  . THR B 2 71  ? 147.724 117.288 -23.448 1.00 39.75 ? 71  THR B CA  1 
ATOM   2129 C C   . THR B 2 71  ? 146.252 117.441 -23.785 1.00 40.64 ? 71  THR B C   1 
ATOM   2130 O O   . THR B 2 71  ? 145.442 117.779 -22.921 1.00 40.79 ? 71  THR B O   1 
ATOM   2131 C CB  . THR B 2 71  ? 148.115 115.786 -23.538 1.00 40.60 ? 71  THR B CB  1 
ATOM   2132 O OG1 . THR B 2 71  ? 147.294 115.016 -22.652 1.00 42.53 ? 71  THR B OG1 1 
ATOM   2133 C CG2 . THR B 2 71  ? 149.581 115.594 -23.173 1.00 38.32 ? 71  THR B CG2 1 
ATOM   2134 N N   . ALA B 2 72  ? 145.905 117.204 -25.039 1.00 41.64 ? 72  ALA B N   1 
ATOM   2135 C CA  . ALA B 2 72  ? 144.522 117.315 -25.462 1.00 43.99 ? 72  ALA B CA  1 
ATOM   2136 C C   . ALA B 2 72  ? 144.252 116.346 -26.605 1.00 46.58 ? 72  ALA B C   1 
ATOM   2137 O O   . ALA B 2 72  ? 145.160 115.988 -27.361 1.00 46.73 ? 72  ALA B O   1 
ATOM   2138 C CB  . ALA B 2 72  ? 144.220 118.742 -25.898 1.00 44.89 ? 72  ALA B CB  1 
ATOM   2139 N N   . ASP B 2 73  ? 143.000 115.917 -26.713 1.00 48.03 ? 73  ASP B N   1 
ATOM   2140 C CA  . ASP B 2 73  ? 142.586 114.996 -27.762 1.00 49.07 ? 73  ASP B CA  1 
ATOM   2141 C C   . ASP B 2 73  ? 141.442 115.645 -28.536 1.00 48.66 ? 73  ASP B C   1 
ATOM   2142 O O   . ASP B 2 73  ? 140.297 115.649 -28.084 1.00 48.10 ? 73  ASP B O   1 
ATOM   2143 C CB  . ASP B 2 73  ? 142.134 113.671 -27.145 1.00 50.06 ? 73  ASP B CB  1 
ATOM   2144 C CG  . ASP B 2 73  ? 141.806 112.626 -28.190 1.00 51.19 ? 73  ASP B CG  1 
ATOM   2145 O OD1 . ASP B 2 73  ? 140.789 112.791 -28.898 1.00 51.57 ? 73  ASP B OD1 1 
ATOM   2146 O OD2 . ASP B 2 73  ? 142.571 111.647 -28.306 1.00 50.65 ? 73  ASP B OD2 1 
ATOM   2147 N N   . LYS B 2 74  ? 141.767 116.194 -29.703 1.00 48.24 ? 74  LYS B N   1 
ATOM   2148 C CA  . LYS B 2 74  ? 140.794 116.878 -30.546 1.00 49.37 ? 74  LYS B CA  1 
ATOM   2149 C C   . LYS B 2 74  ? 139.607 116.021 -30.981 1.00 50.13 ? 74  LYS B C   1 
ATOM   2150 O O   . LYS B 2 74  ? 138.477 116.506 -31.040 1.00 49.18 ? 74  LYS B O   1 
ATOM   2151 C CB  . LYS B 2 74  ? 141.498 117.457 -31.778 1.00 49.49 ? 74  LYS B CB  1 
ATOM   2152 N N   . SER B 2 75  ? 139.855 114.752 -31.288 1.00 51.90 ? 75  SER B N   1 
ATOM   2153 C CA  . SER B 2 75  ? 138.780 113.868 -31.729 1.00 53.67 ? 75  SER B CA  1 
ATOM   2154 C C   . SER B 2 75  ? 137.729 113.615 -30.646 1.00 53.55 ? 75  SER B C   1 
ATOM   2155 O O   . SER B 2 75  ? 136.529 113.637 -30.924 1.00 53.99 ? 75  SER B O   1 
ATOM   2156 C CB  . SER B 2 75  ? 139.359 112.538 -32.226 1.00 54.67 ? 75  SER B CB  1 
ATOM   2157 O OG  . SER B 2 75  ? 140.186 111.935 -31.248 1.00 57.29 ? 75  SER B OG  1 
ATOM   2158 N N   . SER B 2 76  ? 138.176 113.382 -29.415 1.00 52.87 ? 76  SER B N   1 
ATOM   2159 C CA  . SER B 2 76  ? 137.252 113.137 -28.309 1.00 51.41 ? 76  SER B CA  1 
ATOM   2160 C C   . SER B 2 76  ? 136.997 114.407 -27.500 1.00 49.48 ? 76  SER B C   1 
ATOM   2161 O O   . SER B 2 76  ? 136.364 114.360 -26.447 1.00 48.79 ? 76  SER B O   1 
ATOM   2162 C CB  . SER B 2 76  ? 137.802 112.044 -27.387 1.00 52.48 ? 76  SER B CB  1 
ATOM   2163 O OG  . SER B 2 76  ? 139.040 112.427 -26.820 1.00 53.50 ? 76  SER B OG  1 
ATOM   2164 N N   . SER B 2 77  ? 137.486 115.537 -28.006 1.00 47.36 ? 77  SER B N   1 
ATOM   2165 C CA  . SER B 2 77  ? 137.322 116.831 -27.343 1.00 46.20 ? 77  SER B CA  1 
ATOM   2166 C C   . SER B 2 77  ? 137.654 116.761 -25.851 1.00 42.58 ? 77  SER B C   1 
ATOM   2167 O O   . SER B 2 77  ? 136.956 117.350 -25.027 1.00 41.27 ? 77  SER B O   1 
ATOM   2168 C CB  . SER B 2 77  ? 135.887 117.340 -27.514 1.00 46.87 ? 77  SER B CB  1 
ATOM   2169 O OG  . SER B 2 77  ? 135.596 117.617 -28.871 1.00 50.90 ? 77  SER B OG  1 
ATOM   2170 N N   . THR B 2 78  ? 138.715 116.046 -25.504 1.00 39.59 ? 78  THR B N   1 
ATOM   2171 C CA  . THR B 2 78  ? 139.086 115.923 -24.104 1.00 40.04 ? 78  THR B CA  1 
ATOM   2172 C C   . THR B 2 78  ? 140.470 116.483 -23.800 1.00 39.74 ? 78  THR B C   1 
ATOM   2173 O O   . THR B 2 78  ? 141.414 116.294 -24.565 1.00 39.90 ? 78  THR B O   1 
ATOM   2174 C CB  . THR B 2 78  ? 139.032 114.452 -23.648 1.00 39.48 ? 78  THR B CB  1 
ATOM   2175 O OG1 . THR B 2 78  ? 137.724 113.925 -23.903 1.00 39.34 ? 78  THR B OG1 1 
ATOM   2176 C CG2 . THR B 2 78  ? 139.326 114.343 -22.156 1.00 40.14 ? 78  THR B CG2 1 
ATOM   2177 N N   . ALA B 2 79  ? 140.576 117.185 -22.677 1.00 39.90 ? 79  ALA B N   1 
ATOM   2178 C CA  . ALA B 2 79  ? 141.843 117.759 -22.247 1.00 38.78 ? 79  ALA B CA  1 
ATOM   2179 C C   . ALA B 2 79  ? 142.302 116.950 -21.047 1.00 38.06 ? 79  ALA B C   1 
ATOM   2180 O O   . ALA B 2 79  ? 141.490 116.582 -20.195 1.00 38.93 ? 79  ALA B O   1 
ATOM   2181 C CB  . ALA B 2 79  ? 141.662 119.220 -21.863 1.00 39.55 ? 79  ALA B CB  1 
ATOM   2182 N N   . PHE B 2 80  ? 143.597 116.666 -20.981 1.00 37.00 ? 80  PHE B N   1 
ATOM   2183 C CA  . PHE B 2 80  ? 144.135 115.881 -19.881 1.00 38.68 ? 80  PHE B CA  1 
ATOM   2184 C C   . PHE B 2 80  ? 145.241 116.602 -19.119 1.00 38.56 ? 80  PHE B C   1 
ATOM   2185 O O   . PHE B 2 80  ? 145.970 117.421 -19.678 1.00 39.86 ? 80  PHE B O   1 
ATOM   2186 C CB  . PHE B 2 80  ? 144.698 114.551 -20.398 1.00 40.40 ? 80  PHE B CB  1 
ATOM   2187 C CG  . PHE B 2 80  ? 143.728 113.753 -21.229 1.00 43.11 ? 80  PHE B CG  1 
ATOM   2188 C CD1 . PHE B 2 80  ? 143.452 114.115 -22.546 1.00 44.85 ? 80  PHE B CD1 1 
ATOM   2189 C CD2 . PHE B 2 80  ? 143.097 112.628 -20.696 1.00 43.95 ? 80  PHE B CD2 1 
ATOM   2190 C CE1 . PHE B 2 80  ? 142.563 113.368 -23.325 1.00 44.88 ? 80  PHE B CE1 1 
ATOM   2191 C CE2 . PHE B 2 80  ? 142.206 111.876 -21.464 1.00 45.43 ? 80  PHE B CE2 1 
ATOM   2192 C CZ  . PHE B 2 80  ? 141.939 112.247 -22.782 1.00 45.56 ? 80  PHE B CZ  1 
ATOM   2193 N N   . MET B 2 81  ? 145.357 116.295 -17.833 1.00 38.29 ? 81  MET B N   1 
ATOM   2194 C CA  . MET B 2 81  ? 146.412 116.874 -17.018 1.00 38.43 ? 81  MET B CA  1 
ATOM   2195 C C   . MET B 2 81  ? 147.076 115.769 -16.224 1.00 39.26 ? 81  MET B C   1 
ATOM   2196 O O   . MET B 2 81  ? 146.458 115.155 -15.352 1.00 39.60 ? 81  MET B O   1 
ATOM   2197 C CB  . MET B 2 81  ? 145.888 117.932 -16.050 1.00 35.61 ? 81  MET B CB  1 
ATOM   2198 C CG  . MET B 2 81  ? 147.001 118.451 -15.151 1.00 35.64 ? 81  MET B CG  1 
ATOM   2199 S SD  . MET B 2 81  ? 146.576 119.867 -14.143 1.00 36.59 ? 81  MET B SD  1 
ATOM   2200 C CE  . MET B 2 81  ? 145.676 119.072 -12.822 1.00 34.41 ? 81  MET B CE  1 
ATOM   2201 N N   . GLN B 2 82  ? 148.339 115.515 -16.531 1.00 41.47 ? 82  GLN B N   1 
ATOM   2202 C CA  . GLN B 2 82  ? 149.085 114.483 -15.838 1.00 43.12 ? 82  GLN B CA  1 
ATOM   2203 C C   . GLN B 2 82  ? 149.809 115.093 -14.647 1.00 43.24 ? 82  GLN B C   1 
ATOM   2204 O O   . GLN B 2 82  ? 150.693 115.935 -14.807 1.00 42.60 ? 82  GLN B O   1 
ATOM   2205 C CB  . GLN B 2 82  ? 150.100 113.840 -16.788 1.00 45.42 ? 82  GLN B CB  1 
ATOM   2206 C CG  . GLN B 2 82  ? 150.856 112.651 -16.203 1.00 50.56 ? 82  GLN B CG  1 
ATOM   2207 C CD  . GLN B 2 82  ? 149.962 111.441 -15.974 1.00 54.17 ? 82  GLN B CD  1 
ATOM   2208 O OE1 . GLN B 2 82  ? 149.284 110.972 -16.891 1.00 55.63 ? 82  GLN B OE1 1 
ATOM   2209 N NE2 . GLN B 2 82  ? 149.962 110.927 -14.747 1.00 55.80 ? 82  GLN B NE2 1 
ATOM   2210 N N   . LEU B 2 83  ? 149.408 114.683 -13.450 1.00 43.24 ? 83  LEU B N   1 
ATOM   2211 C CA  . LEU B 2 83  ? 150.038 115.152 -12.226 1.00 44.49 ? 83  LEU B CA  1 
ATOM   2212 C C   . LEU B 2 83  ? 150.962 114.002 -11.844 1.00 45.70 ? 83  LEU B C   1 
ATOM   2213 O O   . LEU B 2 83  ? 150.514 112.859 -11.773 1.00 45.88 ? 83  LEU B O   1 
ATOM   2214 C CB  . LEU B 2 83  ? 148.978 115.385 -11.140 1.00 43.38 ? 83  LEU B CB  1 
ATOM   2215 C CG  . LEU B 2 83  ? 147.954 116.501 -11.398 1.00 43.33 ? 83  LEU B CG  1 
ATOM   2216 C CD1 . LEU B 2 83  ? 146.856 116.476 -10.341 1.00 40.81 ? 83  LEU B CD1 1 
ATOM   2217 C CD2 . LEU B 2 83  ? 148.663 117.849 -11.398 1.00 42.14 ? 83  LEU B CD2 1 
ATOM   2218 N N   . SER B 2 84  ? 152.243 114.282 -11.615 1.00 47.04 ? 84  SER B N   1 
ATOM   2219 C CA  . SER B 2 84  ? 153.179 113.208 -11.277 1.00 49.08 ? 84  SER B CA  1 
ATOM   2220 C C   . SER B 2 84  ? 153.942 113.388 -9.969  1.00 49.31 ? 84  SER B C   1 
ATOM   2221 O O   . SER B 2 84  ? 154.206 114.510 -9.540  1.00 49.94 ? 84  SER B O   1 
ATOM   2222 C CB  . SER B 2 84  ? 154.180 113.010 -12.419 1.00 49.40 ? 84  SER B CB  1 
ATOM   2223 O OG  . SER B 2 84  ? 155.008 114.147 -12.566 1.00 50.39 ? 84  SER B OG  1 
ATOM   2224 N N   . SER B 2 85  ? 154.297 112.264 -9.350  1.00 50.16 ? 85  SER B N   1 
ATOM   2225 C CA  . SER B 2 85  ? 155.037 112.253 -8.087  1.00 49.91 ? 85  SER B CA  1 
ATOM   2226 C C   . SER B 2 85  ? 154.425 113.204 -7.071  1.00 49.21 ? 85  SER B C   1 
ATOM   2227 O O   . SER B 2 85  ? 155.080 114.127 -6.583  1.00 48.50 ? 85  SER B O   1 
ATOM   2228 C CB  . SER B 2 85  ? 156.502 112.618 -8.331  1.00 49.90 ? 85  SER B CB  1 
ATOM   2229 O OG  . SER B 2 85  ? 157.126 111.642 -9.147  1.00 51.04 ? 85  SER B OG  1 
ATOM   2230 N N   . LEU B 2 86  ? 153.166 112.950 -6.739  1.00 48.86 ? 86  LEU B N   1 
ATOM   2231 C CA  . LEU B 2 86  ? 152.428 113.785 -5.803  1.00 49.39 ? 86  LEU B CA  1 
ATOM   2232 C C   . LEU B 2 86  ? 152.766 113.566 -4.330  1.00 49.12 ? 86  LEU B C   1 
ATOM   2233 O O   . LEU B 2 86  ? 153.295 112.522 -3.942  1.00 49.26 ? 86  LEU B O   1 
ATOM   2234 C CB  . LEU B 2 86  ? 150.927 113.563 -6.011  1.00 49.56 ? 86  LEU B CB  1 
ATOM   2235 C CG  . LEU B 2 86  ? 150.437 113.645 -7.460  1.00 49.71 ? 86  LEU B CG  1 
ATOM   2236 C CD1 . LEU B 2 86  ? 148.937 113.394 -7.515  1.00 49.47 ? 86  LEU B CD1 1 
ATOM   2237 C CD2 . LEU B 2 86  ? 150.776 115.012 -8.036  1.00 49.36 ? 86  LEU B CD2 1 
ATOM   2238 N N   . THR B 2 87  ? 152.453 114.572 -3.520  1.00 48.30 ? 87  THR B N   1 
ATOM   2239 C CA  . THR B 2 87  ? 152.655 114.525 -2.074  1.00 48.14 ? 87  THR B CA  1 
ATOM   2240 C C   . THR B 2 87  ? 151.357 115.089 -1.499  1.00 47.59 ? 87  THR B C   1 
ATOM   2241 O O   . THR B 2 87  ? 150.467 115.478 -2.257  1.00 47.19 ? 87  THR B O   1 
ATOM   2242 C CB  . THR B 2 87  ? 153.845 115.407 -1.620  1.00 48.43 ? 87  THR B CB  1 
ATOM   2243 O OG1 . THR B 2 87  ? 153.452 116.784 -1.598  1.00 48.03 ? 87  THR B OG1 1 
ATOM   2244 C CG2 . THR B 2 87  ? 155.020 115.248 -2.579  1.00 49.56 ? 87  THR B CG2 1 
ATOM   2245 N N   . SER B 2 88  ? 151.234 115.140 -0.177  1.00 47.29 ? 88  SER B N   1 
ATOM   2246 C CA  . SER B 2 88  ? 150.012 115.664 0.431   1.00 47.57 ? 88  SER B CA  1 
ATOM   2247 C C   . SER B 2 88  ? 149.759 117.118 0.018   1.00 46.47 ? 88  SER B C   1 
ATOM   2248 O O   . SER B 2 88  ? 148.634 117.617 0.117   1.00 44.61 ? 88  SER B O   1 
ATOM   2249 C CB  . SER B 2 88  ? 150.092 115.568 1.958   1.00 48.00 ? 88  SER B CB  1 
ATOM   2250 O OG  . SER B 2 88  ? 151.161 116.345 2.463   1.00 50.37 ? 88  SER B OG  1 
ATOM   2251 N N   . GLU B 2 89  ? 150.813 117.789 -0.443  1.00 44.95 ? 89  GLU B N   1 
ATOM   2252 C CA  . GLU B 2 89  ? 150.718 119.180 -0.874  1.00 43.25 ? 89  GLU B CA  1 
ATOM   2253 C C   . GLU B 2 89  ? 149.918 119.306 -2.172  1.00 41.52 ? 89  GLU B C   1 
ATOM   2254 O O   . GLU B 2 89  ? 149.422 120.383 -2.507  1.00 42.05 ? 89  GLU B O   1 
ATOM   2255 C CB  . GLU B 2 89  ? 152.122 119.766 -1.060  1.00 44.43 ? 89  GLU B CB  1 
ATOM   2256 N N   . ASP B 2 90  ? 149.785 118.200 -2.894  1.00 39.15 ? 90  ASP B N   1 
ATOM   2257 C CA  . ASP B 2 90  ? 149.050 118.193 -4.150  1.00 38.08 ? 90  ASP B CA  1 
ATOM   2258 C C   . ASP B 2 90  ? 147.579 117.818 -3.972  1.00 37.08 ? 90  ASP B C   1 
ATOM   2259 O O   . ASP B 2 90  ? 146.821 117.762 -4.945  1.00 36.93 ? 90  ASP B O   1 
ATOM   2260 C CB  . ASP B 2 90  ? 149.724 117.236 -5.137  1.00 38.53 ? 90  ASP B CB  1 
ATOM   2261 C CG  . ASP B 2 90  ? 151.163 117.620 -5.418  1.00 37.93 ? 90  ASP B CG  1 
ATOM   2262 O OD1 . ASP B 2 90  ? 151.398 118.761 -5.872  1.00 37.55 ? 90  ASP B OD1 1 
ATOM   2263 O OD2 . ASP B 2 90  ? 152.062 116.788 -5.185  1.00 38.50 ? 90  ASP B OD2 1 
ATOM   2264 N N   . SER B 2 91  ? 147.178 117.557 -2.731  1.00 34.90 ? 91  SER B N   1 
ATOM   2265 C CA  . SER B 2 91  ? 145.790 117.216 -2.440  1.00 33.56 ? 91  SER B CA  1 
ATOM   2266 C C   . SER B 2 91  ? 144.957 118.495 -2.563  1.00 33.86 ? 91  SER B C   1 
ATOM   2267 O O   . SER B 2 91  ? 145.202 119.477 -1.858  1.00 33.18 ? 91  SER B O   1 
ATOM   2268 C CB  . SER B 2 91  ? 145.660 116.652 -1.021  1.00 34.17 ? 91  SER B CB  1 
ATOM   2269 O OG  . SER B 2 91  ? 146.242 115.364 -0.923  1.00 35.49 ? 91  SER B OG  1 
ATOM   2270 N N   . ALA B 2 92  ? 143.981 118.484 -3.463  1.00 32.75 ? 92  ALA B N   1 
ATOM   2271 C CA  . ALA B 2 92  ? 143.129 119.649 -3.666  1.00 31.56 ? 92  ALA B CA  1 
ATOM   2272 C C   . ALA B 2 92  ? 142.120 119.371 -4.752  1.00 30.26 ? 92  ALA B C   1 
ATOM   2273 O O   . ALA B 2 92  ? 142.132 118.309 -5.375  1.00 30.21 ? 92  ALA B O   1 
ATOM   2274 C CB  . ALA B 2 92  ? 143.982 120.864 -4.068  1.00 33.34 ? 92  ALA B CB  1 
ATOM   2275 N N   . VAL B 2 93  ? 141.236 120.335 -4.965  1.00 28.56 ? 93  VAL B N   1 
ATOM   2276 C CA  . VAL B 2 93  ? 140.251 120.233 -6.026  1.00 28.48 ? 93  VAL B CA  1 
ATOM   2277 C C   . VAL B 2 93  ? 140.925 120.874 -7.241  1.00 28.98 ? 93  VAL B C   1 
ATOM   2278 O O   . VAL B 2 93  ? 141.510 121.948 -7.131  1.00 28.38 ? 93  VAL B O   1 
ATOM   2279 C CB  . VAL B 2 93  ? 138.976 121.010 -5.677  1.00 27.84 ? 93  VAL B CB  1 
ATOM   2280 C CG1 . VAL B 2 93  ? 138.031 121.036 -6.878  1.00 26.86 ? 93  VAL B CG1 1 
ATOM   2281 C CG2 . VAL B 2 93  ? 138.299 120.358 -4.473  1.00 28.43 ? 93  VAL B CG2 1 
ATOM   2282 N N   . TYR B 2 94  ? 140.866 120.194 -8.379  1.00 28.36 ? 94  TYR B N   1 
ATOM   2283 C CA  . TYR B 2 94  ? 141.459 120.688 -9.613  1.00 27.05 ? 94  TYR B CA  1 
ATOM   2284 C C   . TYR B 2 94  ? 140.347 120.953 -10.618 1.00 27.14 ? 94  TYR B C   1 
ATOM   2285 O O   . TYR B 2 94  ? 139.661 120.030 -11.048 1.00 26.96 ? 94  TYR B O   1 
ATOM   2286 C CB  . TYR B 2 94  ? 142.436 119.651 -10.179 1.00 27.06 ? 94  TYR B CB  1 
ATOM   2287 C CG  . TYR B 2 94  ? 143.720 119.507 -9.382  1.00 27.65 ? 94  TYR B CG  1 
ATOM   2288 C CD1 . TYR B 2 94  ? 144.826 120.323 -9.642  1.00 27.95 ? 94  TYR B CD1 1 
ATOM   2289 C CD2 . TYR B 2 94  ? 143.820 118.579 -8.353  1.00 25.69 ? 94  TYR B CD2 1 
ATOM   2290 C CE1 . TYR B 2 94  ? 146.000 120.208 -8.890  1.00 27.75 ? 94  TYR B CE1 1 
ATOM   2291 C CE2 . TYR B 2 94  ? 144.976 118.458 -7.598  1.00 26.05 ? 94  TYR B CE2 1 
ATOM   2292 C CZ  . TYR B 2 94  ? 146.064 119.275 -7.871  1.00 30.00 ? 94  TYR B CZ  1 
ATOM   2293 O OH  . TYR B 2 94  ? 147.210 119.150 -7.119  1.00 29.56 ? 94  TYR B OH  1 
ATOM   2294 N N   . TYR B 2 95  ? 140.171 122.217 -10.985 1.00 26.73 ? 95  TYR B N   1 
ATOM   2295 C CA  . TYR B 2 95  ? 139.137 122.604 -11.945 1.00 26.59 ? 95  TYR B CA  1 
ATOM   2296 C C   . TYR B 2 95  ? 139.708 122.815 -13.336 1.00 27.60 ? 95  TYR B C   1 
ATOM   2297 O O   . TYR B 2 95  ? 140.860 123.234 -13.490 1.00 28.40 ? 95  TYR B O   1 
ATOM   2298 C CB  . TYR B 2 95  ? 138.493 123.936 -11.553 1.00 23.53 ? 95  TYR B CB  1 
ATOM   2299 C CG  . TYR B 2 95  ? 137.766 123.968 -10.237 1.00 24.10 ? 95  TYR B CG  1 
ATOM   2300 C CD1 . TYR B 2 95  ? 136.453 123.525 -10.138 1.00 23.83 ? 95  TYR B CD1 1 
ATOM   2301 C CD2 . TYR B 2 95  ? 138.383 124.478 -9.093  1.00 25.57 ? 95  TYR B CD2 1 
ATOM   2302 C CE1 . TYR B 2 95  ? 135.763 123.592 -8.933  1.00 25.51 ? 95  TYR B CE1 1 
ATOM   2303 C CE2 . TYR B 2 95  ? 137.704 124.544 -7.875  1.00 24.69 ? 95  TYR B CE2 1 
ATOM   2304 C CZ  . TYR B 2 95  ? 136.393 124.100 -7.806  1.00 24.92 ? 95  TYR B CZ  1 
ATOM   2305 O OH  . TYR B 2 95  ? 135.710 124.151 -6.614  1.00 28.16 ? 95  TYR B OH  1 
ATOM   2306 N N   . CYS B 2 96  ? 138.908 122.520 -14.354 1.00 26.21 ? 96  CYS B N   1 
ATOM   2307 C CA  . CYS B 2 96  ? 139.332 122.813 -15.713 1.00 27.02 ? 96  CYS B CA  1 
ATOM   2308 C C   . CYS B 2 96  ? 138.352 123.924 -16.096 1.00 25.64 ? 96  CYS B C   1 
ATOM   2309 O O   . CYS B 2 96  ? 137.254 123.999 -15.548 1.00 25.44 ? 96  CYS B O   1 
ATOM   2310 C CB  . CYS B 2 96  ? 139.184 121.610 -16.634 1.00 28.68 ? 96  CYS B CB  1 
ATOM   2311 S SG  . CYS B 2 96  ? 137.524 120.958 -16.734 1.00 34.58 ? 96  CYS B SG  1 
ATOM   2312 N N   . ALA B 2 97  ? 138.755 124.822 -16.983 1.00 24.58 ? 97  ALA B N   1 
ATOM   2313 C CA  . ALA B 2 97  ? 137.865 125.900 -17.383 1.00 25.18 ? 97  ALA B CA  1 
ATOM   2314 C C   . ALA B 2 97  ? 138.120 126.218 -18.832 1.00 26.44 ? 97  ALA B C   1 
ATOM   2315 O O   . ALA B 2 97  ? 139.217 125.982 -19.352 1.00 28.05 ? 97  ALA B O   1 
ATOM   2316 C CB  . ALA B 2 97  ? 138.097 127.154 -16.525 1.00 25.12 ? 97  ALA B CB  1 
ATOM   2317 N N   . ARG B 2 98  ? 137.109 126.756 -19.492 1.00 24.58 ? 98  ARG B N   1 
ATOM   2318 C CA  . ARG B 2 98  ? 137.283 127.091 -20.885 1.00 27.43 ? 98  ARG B CA  1 
ATOM   2319 C C   . ARG B 2 98  ? 137.311 128.592 -21.098 1.00 26.27 ? 98  ARG B C   1 
ATOM   2320 O O   . ARG B 2 98  ? 136.465 129.329 -20.578 1.00 24.08 ? 98  ARG B O   1 
ATOM   2321 C CB  . ARG B 2 98  ? 136.162 126.503 -21.735 1.00 28.60 ? 98  ARG B CB  1 
ATOM   2322 C CG  . ARG B 2 98  ? 136.165 127.052 -23.159 1.00 32.46 ? 98  ARG B CG  1 
ATOM   2323 C CD  . ARG B 2 98  ? 134.864 126.742 -23.858 1.00 36.69 ? 98  ARG B CD  1 
ATOM   2324 N NE  . ARG B 2 98  ? 134.868 125.398 -24.401 1.00 39.05 ? 98  ARG B NE  1 
ATOM   2325 C CZ  . ARG B 2 98  ? 133.771 124.696 -24.660 1.00 41.39 ? 98  ARG B CZ  1 
ATOM   2326 N NH1 . ARG B 2 98  ? 132.563 125.205 -24.414 1.00 40.69 ? 98  ARG B NH1 1 
ATOM   2327 N NH2 . ARG B 2 98  ? 133.885 123.489 -25.192 1.00 41.23 ? 98  ARG B NH2 1 
ATOM   2328 N N   . GLU B 2 99  ? 138.284 129.031 -21.884 1.00 24.51 ? 99  GLU B N   1 
ATOM   2329 C CA  . GLU B 2 99  ? 138.425 130.445 -22.216 1.00 24.28 ? 99  GLU B CA  1 
ATOM   2330 C C   . GLU B 2 99  ? 138.394 130.549 -23.735 1.00 23.29 ? 99  GLU B C   1 
ATOM   2331 O O   . GLU B 2 99  ? 139.074 129.795 -24.424 1.00 23.85 ? 99  GLU B O   1 
ATOM   2332 C CB  . GLU B 2 99  ? 139.755 130.985 -21.671 1.00 21.09 ? 99  GLU B CB  1 
ATOM   2333 C CG  . GLU B 2 99  ? 140.029 132.441 -22.040 1.00 21.68 ? 99  GLU B CG  1 
ATOM   2334 C CD  . GLU B 2 99  ? 141.407 132.626 -22.639 1.00 18.65 ? 99  GLU B CD  1 
ATOM   2335 O OE1 . GLU B 2 99  ? 141.728 133.753 -23.050 1.00 18.99 ? 99  GLU B OE1 1 
ATOM   2336 O OE2 . GLU B 2 99  ? 142.169 131.633 -22.701 1.00 22.41 ? 99  GLU B OE2 1 
ATOM   2337 N N   . ARG B 2 100 ? 137.591 131.468 -24.256 1.00 25.40 ? 100 ARG B N   1 
ATOM   2338 C CA  . ARG B 2 100 ? 137.479 131.655 -25.702 1.00 28.88 ? 100 ARG B CA  1 
ATOM   2339 C C   . ARG B 2 100 ? 138.619 132.500 -26.301 1.00 29.20 ? 100 ARG B C   1 
ATOM   2340 O O   . ARG B 2 100 ? 138.457 133.095 -27.362 1.00 31.20 ? 100 ARG B O   1 
ATOM   2341 C CB  . ARG B 2 100 ? 136.144 132.322 -26.039 1.00 28.55 ? 100 ARG B CB  1 
ATOM   2342 C CG  . ARG B 2 100 ? 134.915 131.550 -25.581 1.00 34.32 ? 100 ARG B CG  1 
ATOM   2343 C CD  . ARG B 2 100 ? 134.789 130.229 -26.318 1.00 35.00 ? 100 ARG B CD  1 
ATOM   2344 N NE  . ARG B 2 100 ? 133.580 129.506 -25.934 1.00 37.92 ? 100 ARG B NE  1 
ATOM   2345 C CZ  . ARG B 2 100 ? 133.259 128.294 -26.374 1.00 37.59 ? 100 ARG B CZ  1 
ATOM   2346 N NH1 . ARG B 2 100 ? 134.063 127.661 -27.221 1.00 35.54 ? 100 ARG B NH1 1 
ATOM   2347 N NH2 . ARG B 2 100 ? 132.139 127.712 -25.959 1.00 37.39 ? 100 ARG B NH2 1 
ATOM   2348 N N   . GLY B 2 101 ? 139.761 132.565 -25.625 1.00 29.33 ? 101 GLY B N   1 
ATOM   2349 C CA  . GLY B 2 101 ? 140.865 133.351 -26.153 1.00 27.45 ? 101 GLY B CA  1 
ATOM   2350 C C   . GLY B 2 101 ? 140.686 134.842 -25.931 1.00 26.60 ? 101 GLY B C   1 
ATOM   2351 O O   . GLY B 2 101 ? 141.427 135.664 -26.486 1.00 24.88 ? 101 GLY B O   1 
ATOM   2352 N N   . ASP B 2 102 ? 139.692 135.198 -25.126 1.00 25.11 ? 102 ASP B N   1 
ATOM   2353 C CA  . ASP B 2 102 ? 139.446 136.593 -24.821 1.00 24.42 ? 102 ASP B CA  1 
ATOM   2354 C C   . ASP B 2 102 ? 139.667 136.933 -23.345 1.00 25.05 ? 102 ASP B C   1 
ATOM   2355 O O   . ASP B 2 102 ? 139.123 137.916 -22.845 1.00 24.12 ? 102 ASP B O   1 
ATOM   2356 C CB  . ASP B 2 102 ? 138.048 137.028 -25.270 1.00 26.46 ? 102 ASP B CB  1 
ATOM   2357 C CG  . ASP B 2 102 ? 136.973 136.027 -24.901 1.00 29.14 ? 102 ASP B CG  1 
ATOM   2358 O OD1 . ASP B 2 102 ? 137.235 135.129 -24.069 1.00 28.71 ? 102 ASP B OD1 1 
ATOM   2359 O OD2 . ASP B 2 102 ? 135.857 136.156 -25.444 1.00 32.60 ? 102 ASP B OD2 1 
ATOM   2360 N N   . GLY B 2 103 ? 140.437 136.095 -22.646 1.00 22.46 ? 103 GLY B N   1 
ATOM   2361 C CA  . GLY B 2 103 ? 140.798 136.393 -21.270 1.00 23.47 ? 103 GLY B CA  1 
ATOM   2362 C C   . GLY B 2 103 ? 140.016 135.984 -20.037 1.00 25.82 ? 103 GLY B C   1 
ATOM   2363 O O   . GLY B 2 103 ? 140.568 136.041 -18.939 1.00 26.10 ? 103 GLY B O   1 
ATOM   2364 N N   . TYR B 2 104 ? 138.761 135.579 -20.174 1.00 26.93 ? 104 TYR B N   1 
ATOM   2365 C CA  . TYR B 2 104 ? 137.993 135.196 -18.994 1.00 27.44 ? 104 TYR B CA  1 
ATOM   2366 C C   . TYR B 2 104 ? 137.505 133.757 -19.091 1.00 28.29 ? 104 TYR B C   1 
ATOM   2367 O O   . TYR B 2 104 ? 137.359 133.210 -20.182 1.00 28.72 ? 104 TYR B O   1 
ATOM   2368 C CB  . TYR B 2 104 ? 136.817 136.168 -18.803 1.00 26.88 ? 104 TYR B CB  1 
ATOM   2369 C CG  . TYR B 2 104 ? 135.885 136.216 -19.991 1.00 29.28 ? 104 TYR B CG  1 
ATOM   2370 C CD1 . TYR B 2 104 ? 134.866 135.273 -20.138 1.00 30.51 ? 104 TYR B CD1 1 
ATOM   2371 C CD2 . TYR B 2 104 ? 136.047 137.178 -20.993 1.00 28.61 ? 104 TYR B CD2 1 
ATOM   2372 C CE1 . TYR B 2 104 ? 134.026 135.283 -21.256 1.00 31.22 ? 104 TYR B CE1 1 
ATOM   2373 C CE2 . TYR B 2 104 ? 135.216 137.200 -22.116 1.00 30.26 ? 104 TYR B CE2 1 
ATOM   2374 C CZ  . TYR B 2 104 ? 134.206 136.247 -22.235 1.00 32.63 ? 104 TYR B CZ  1 
ATOM   2375 O OH  . TYR B 2 104 ? 133.362 136.270 -23.317 1.00 33.72 ? 104 TYR B OH  1 
ATOM   2376 N N   . PHE B 2 105 ? 137.281 133.140 -17.937 1.00 29.85 ? 105 PHE B N   1 
ATOM   2377 C CA  . PHE B 2 105 ? 136.812 131.761 -17.878 1.00 31.37 ? 105 PHE B CA  1 
ATOM   2378 C C   . PHE B 2 105 ? 135.289 131.765 -17.885 1.00 30.86 ? 105 PHE B C   1 
ATOM   2379 O O   . PHE B 2 105 ? 134.655 131.911 -16.844 1.00 31.54 ? 105 PHE B O   1 
ATOM   2380 C CB  . PHE B 2 105 ? 137.348 131.089 -16.611 1.00 31.86 ? 105 PHE B CB  1 
ATOM   2381 C CG  . PHE B 2 105 ? 138.842 131.135 -16.495 1.00 34.52 ? 105 PHE B CG  1 
ATOM   2382 C CD1 . PHE B 2 105 ? 139.452 131.702 -15.383 1.00 35.78 ? 105 PHE B CD1 1 
ATOM   2383 C CD2 . PHE B 2 105 ? 139.645 130.629 -17.509 1.00 35.60 ? 105 PHE B CD2 1 
ATOM   2384 C CE1 . PHE B 2 105 ? 140.835 131.760 -15.287 1.00 34.97 ? 105 PHE B CE1 1 
ATOM   2385 C CE2 . PHE B 2 105 ? 141.032 130.685 -17.417 1.00 35.82 ? 105 PHE B CE2 1 
ATOM   2386 C CZ  . PHE B 2 105 ? 141.626 131.250 -16.305 1.00 34.66 ? 105 PHE B CZ  1 
ATOM   2387 N N   . ALA B 2 106 ? 134.711 131.613 -19.072 1.00 31.46 ? 106 ALA B N   1 
ATOM   2388 C CA  . ALA B 2 106 ? 133.263 131.621 -19.236 1.00 31.45 ? 106 ALA B CA  1 
ATOM   2389 C C   . ALA B 2 106 ? 132.595 130.423 -18.579 1.00 30.80 ? 106 ALA B C   1 
ATOM   2390 O O   . ALA B 2 106 ? 131.476 130.529 -18.083 1.00 29.58 ? 106 ALA B O   1 
ATOM   2391 C CB  . ALA B 2 106 ? 132.907 131.662 -20.732 1.00 34.26 ? 106 ALA B CB  1 
ATOM   2392 N N   . VAL B 2 107 ? 133.278 129.283 -18.580 1.00 30.15 ? 107 VAL B N   1 
ATOM   2393 C CA  . VAL B 2 107 ? 132.719 128.077 -17.989 1.00 31.62 ? 107 VAL B CA  1 
ATOM   2394 C C   . VAL B 2 107 ? 133.775 127.254 -17.254 1.00 30.84 ? 107 VAL B C   1 
ATOM   2395 O O   . VAL B 2 107 ? 134.917 127.166 -17.694 1.00 29.01 ? 107 VAL B O   1 
ATOM   2396 C CB  . VAL B 2 107 ? 132.047 127.187 -19.079 1.00 32.40 ? 107 VAL B CB  1 
ATOM   2397 C CG1 . VAL B 2 107 ? 133.101 126.503 -19.917 1.00 31.30 ? 107 VAL B CG1 1 
ATOM   2398 C CG2 . VAL B 2 107 ? 131.132 126.156 -18.426 1.00 35.92 ? 107 VAL B CG2 1 
ATOM   2399 N N   . TRP B 2 108 ? 133.371 126.668 -16.128 1.00 30.49 ? 108 TRP B N   1 
ATOM   2400 C CA  . TRP B 2 108 ? 134.243 125.833 -15.302 1.00 29.86 ? 108 TRP B CA  1 
ATOM   2401 C C   . TRP B 2 108 ? 133.670 124.427 -15.147 1.00 31.42 ? 108 TRP B C   1 
ATOM   2402 O O   . TRP B 2 108 ? 132.459 124.224 -15.243 1.00 31.15 ? 108 TRP B O   1 
ATOM   2403 C CB  . TRP B 2 108 ? 134.388 126.415 -13.893 1.00 30.77 ? 108 TRP B CB  1 
ATOM   2404 C CG  . TRP B 2 108 ? 135.039 127.760 -13.812 1.00 30.56 ? 108 TRP B CG  1 
ATOM   2405 C CD1 . TRP B 2 108 ? 134.551 128.937 -14.294 1.00 27.75 ? 108 TRP B CD1 1 
ATOM   2406 C CD2 . TRP B 2 108 ? 136.286 128.065 -13.185 1.00 29.27 ? 108 TRP B CD2 1 
ATOM   2407 N NE1 . TRP B 2 108 ? 135.418 129.961 -14.004 1.00 30.01 ? 108 TRP B NE1 1 
ATOM   2408 C CE2 . TRP B 2 108 ? 136.494 129.453 -13.324 1.00 31.05 ? 108 TRP B CE2 1 
ATOM   2409 C CE3 . TRP B 2 108 ? 137.251 127.299 -12.519 1.00 29.62 ? 108 TRP B CE3 1 
ATOM   2410 C CZ2 . TRP B 2 108 ? 137.630 130.096 -12.820 1.00 30.89 ? 108 TRP B CZ2 1 
ATOM   2411 C CZ3 . TRP B 2 108 ? 138.383 127.938 -12.017 1.00 29.09 ? 108 TRP B CZ3 1 
ATOM   2412 C CH2 . TRP B 2 108 ? 138.561 129.322 -12.171 1.00 29.79 ? 108 TRP B CH2 1 
ATOM   2413 N N   . GLY B 2 109 ? 134.549 123.462 -14.895 1.00 31.41 ? 109 GLY B N   1 
ATOM   2414 C CA  . GLY B 2 109 ? 134.110 122.099 -14.680 1.00 30.08 ? 109 GLY B CA  1 
ATOM   2415 C C   . GLY B 2 109 ? 133.705 121.994 -13.221 1.00 30.89 ? 109 GLY B C   1 
ATOM   2416 O O   . GLY B 2 109 ? 133.939 122.921 -12.445 1.00 28.88 ? 109 GLY B O   1 
ATOM   2417 N N   . ALA B 2 110 ? 133.095 120.874 -12.845 1.00 31.80 ? 110 ALA B N   1 
ATOM   2418 C CA  . ALA B 2 110 ? 132.648 120.661 -11.473 1.00 32.09 ? 110 ALA B CA  1 
ATOM   2419 C C   . ALA B 2 110 ? 133.850 120.443 -10.571 1.00 31.59 ? 110 ALA B C   1 
ATOM   2420 O O   . ALA B 2 110 ? 133.773 120.629 -9.360  1.00 32.54 ? 110 ALA B O   1 
ATOM   2421 C CB  . ALA B 2 110 ? 131.712 119.448 -11.409 1.00 32.42 ? 110 ALA B CB  1 
ATOM   2422 N N   . GLY B 2 111 ? 134.958 120.027 -11.175 1.00 30.45 ? 111 GLY B N   1 
ATOM   2423 C CA  . GLY B 2 111 ? 136.173 119.809 -10.418 1.00 28.79 ? 111 GLY B CA  1 
ATOM   2424 C C   . GLY B 2 111 ? 136.392 118.394 -9.926  1.00 30.53 ? 111 GLY B C   1 
ATOM   2425 O O   . GLY B 2 111 ? 135.452 117.692 -9.555  1.00 29.26 ? 111 GLY B O   1 
ATOM   2426 N N   . THR B 2 112 ? 137.651 117.974 -9.923  1.00 29.58 ? 112 THR B N   1 
ATOM   2427 C CA  . THR B 2 112 ? 138.006 116.651 -9.446  1.00 29.11 ? 112 THR B CA  1 
ATOM   2428 C C   . THR B 2 112 ? 138.774 116.789 -8.140  1.00 29.35 ? 112 THR B C   1 
ATOM   2429 O O   . THR B 2 112 ? 139.794 117.489 -8.084  1.00 26.35 ? 112 THR B O   1 
ATOM   2430 C CB  . THR B 2 112 ? 138.908 115.917 -10.434 1.00 28.24 ? 112 THR B CB  1 
ATOM   2431 O OG1 . THR B 2 112 ? 138.295 115.916 -11.725 1.00 30.71 ? 112 THR B OG1 1 
ATOM   2432 C CG2 . THR B 2 112 ? 139.129 114.477 -9.974  1.00 31.99 ? 112 THR B CG2 1 
ATOM   2433 N N   . THR B 2 113 ? 138.284 116.128 -7.095  1.00 27.05 ? 113 THR B N   1 
ATOM   2434 C CA  . THR B 2 113 ? 138.949 116.167 -5.804  1.00 29.64 ? 113 THR B CA  1 
ATOM   2435 C C   . THR B 2 113 ? 140.028 115.097 -5.799  1.00 31.42 ? 113 THR B C   1 
ATOM   2436 O O   . THR B 2 113 ? 139.734 113.907 -5.920  1.00 30.81 ? 113 THR B O   1 
ATOM   2437 C CB  . THR B 2 113 ? 137.967 115.886 -4.651  1.00 29.94 ? 113 THR B CB  1 
ATOM   2438 O OG1 . THR B 2 113 ? 136.938 116.879 -4.654  1.00 30.23 ? 113 THR B OG1 1 
ATOM   2439 C CG2 . THR B 2 113 ? 138.689 115.926 -3.296  1.00 32.19 ? 113 THR B CG2 1 
ATOM   2440 N N   . VAL B 2 114 ? 141.279 115.528 -5.688  1.00 33.20 ? 114 VAL B N   1 
ATOM   2441 C CA  . VAL B 2 114 ? 142.401 114.606 -5.659  1.00 33.89 ? 114 VAL B CA  1 
ATOM   2442 C C   . VAL B 2 114 ? 142.925 114.521 -4.231  1.00 36.37 ? 114 VAL B C   1 
ATOM   2443 O O   . VAL B 2 114 ? 143.197 115.539 -3.588  1.00 36.90 ? 114 VAL B O   1 
ATOM   2444 C CB  . VAL B 2 114 ? 143.561 115.074 -6.583  1.00 34.55 ? 114 VAL B CB  1 
ATOM   2445 C CG1 . VAL B 2 114 ? 144.724 114.094 -6.495  1.00 33.05 ? 114 VAL B CG1 1 
ATOM   2446 C CG2 . VAL B 2 114 ? 143.079 115.192 -8.028  1.00 33.43 ? 114 VAL B CG2 1 
ATOM   2447 N N   . THR B 2 115 ? 143.054 113.297 -3.737  1.00 37.58 ? 115 THR B N   1 
ATOM   2448 C CA  . THR B 2 115 ? 143.561 113.057 -2.395  1.00 39.46 ? 115 THR B CA  1 
ATOM   2449 C C   . THR B 2 115 ? 144.818 112.199 -2.516  1.00 40.59 ? 115 THR B C   1 
ATOM   2450 O O   . THR B 2 115 ? 144.793 111.124 -3.119  1.00 41.71 ? 115 THR B O   1 
ATOM   2451 C CB  . THR B 2 115 ? 142.530 112.308 -1.523  1.00 39.24 ? 115 THR B CB  1 
ATOM   2452 O OG1 . THR B 2 115 ? 141.297 113.040 -1.498  1.00 40.05 ? 115 THR B OG1 1 
ATOM   2453 C CG2 . THR B 2 115 ? 143.049 112.159 -0.096  1.00 39.06 ? 115 THR B CG2 1 
ATOM   2454 N N   . VAL B 2 116 ? 145.921 112.692 -1.970  1.00 41.83 ? 116 VAL B N   1 
ATOM   2455 C CA  . VAL B 2 116 ? 147.176 111.956 -2.004  1.00 43.29 ? 116 VAL B CA  1 
ATOM   2456 C C   . VAL B 2 116 ? 147.336 111.327 -0.628  1.00 44.18 ? 116 VAL B C   1 
ATOM   2457 O O   . VAL B 2 116 ? 147.606 112.017 0.355   1.00 44.47 ? 116 VAL B O   1 
ATOM   2458 C CB  . VAL B 2 116 ? 148.365 112.892 -2.304  1.00 42.95 ? 116 VAL B CB  1 
ATOM   2459 C CG1 . VAL B 2 116 ? 149.660 112.091 -2.368  1.00 43.57 ? 116 VAL B CG1 1 
ATOM   2460 C CG2 . VAL B 2 116 ? 148.126 113.615 -3.623  1.00 40.88 ? 116 VAL B CG2 1 
ATOM   2461 N N   . SER B 2 117 ? 147.142 110.016 -0.560  1.00 46.35 ? 117 SER B N   1 
ATOM   2462 C CA  . SER B 2 117 ? 147.235 109.295 0.703   1.00 48.29 ? 117 SER B CA  1 
ATOM   2463 C C   . SER B 2 117 ? 147.555 107.824 0.486   1.00 49.45 ? 117 SER B C   1 
ATOM   2464 O O   . SER B 2 117 ? 147.362 107.288 -0.607  1.00 47.27 ? 117 SER B O   1 
ATOM   2465 C CB  . SER B 2 117 ? 145.915 109.418 1.468   1.00 48.25 ? 117 SER B CB  1 
ATOM   2466 O OG  . SER B 2 117 ? 145.961 108.707 2.690   1.00 48.73 ? 117 SER B OG  1 
ATOM   2467 N N   . SER B 2 118 ? 148.035 107.176 1.543   1.00 51.74 ? 118 SER B N   1 
ATOM   2468 C CA  . SER B 2 118 ? 148.391 105.762 1.486   1.00 53.89 ? 118 SER B CA  1 
ATOM   2469 C C   . SER B 2 118 ? 147.197 104.877 1.829   1.00 53.88 ? 118 SER B C   1 
ATOM   2470 O O   . SER B 2 118 ? 147.197 103.680 1.537   1.00 54.04 ? 118 SER B O   1 
ATOM   2471 C CB  . SER B 2 118 ? 149.534 105.474 2.461   1.00 54.45 ? 118 SER B CB  1 
ATOM   2472 O OG  . SER B 2 118 ? 150.629 106.341 2.223   1.00 58.15 ? 118 SER B OG  1 
ATOM   2473 N N   . ALA B 2 119 ? 146.182 105.475 2.446   1.00 53.92 ? 119 ALA B N   1 
ATOM   2474 C CA  . ALA B 2 119 ? 144.980 104.748 2.846   1.00 53.61 ? 119 ALA B CA  1 
ATOM   2475 C C   . ALA B 2 119 ? 144.251 104.110 1.668   1.00 53.64 ? 119 ALA B C   1 
ATOM   2476 O O   . ALA B 2 119 ? 144.531 104.415 0.508   1.00 54.36 ? 119 ALA B O   1 
ATOM   2477 C CB  . ALA B 2 119 ? 144.039 105.678 3.602   1.00 53.97 ? 119 ALA B CB  1 
ATOM   2478 N N   . LYS B 2 120 ? 143.309 103.222 1.977   1.00 52.71 ? 120 LYS B N   1 
ATOM   2479 C CA  . LYS B 2 120 ? 142.544 102.528 0.952   1.00 51.79 ? 120 LYS B CA  1 
ATOM   2480 C C   . LYS B 2 120 ? 141.145 103.106 0.792   1.00 51.06 ? 120 LYS B C   1 
ATOM   2481 O O   . LYS B 2 120 ? 140.564 103.637 1.740   1.00 50.32 ? 120 LYS B O   1 
ATOM   2482 C CB  . LYS B 2 120 ? 142.454 101.042 1.290   1.00 53.02 ? 120 LYS B CB  1 
ATOM   2483 N N   . THR B 2 121 ? 140.610 103.003 -0.418  1.00 49.89 ? 121 THR B N   1 
ATOM   2484 C CA  . THR B 2 121 ? 139.272 103.492 -0.695  1.00 50.16 ? 121 THR B CA  1 
ATOM   2485 C C   . THR B 2 121 ? 138.303 102.730 0.201   1.00 50.49 ? 121 THR B C   1 
ATOM   2486 O O   . THR B 2 121 ? 138.521 101.558 0.503   1.00 51.32 ? 121 THR B O   1 
ATOM   2487 C CB  . THR B 2 121 ? 138.889 103.251 -2.163  1.00 50.20 ? 121 THR B CB  1 
ATOM   2488 O OG1 . THR B 2 121 ? 139.820 103.930 -3.013  1.00 51.04 ? 121 THR B OG1 1 
ATOM   2489 C CG2 . THR B 2 121 ? 137.484 103.764 -2.442  1.00 49.79 ? 121 THR B CG2 1 
ATOM   2490 N N   . THR B 2 122 ? 137.238 103.400 0.628   1.00 50.29 ? 122 THR B N   1 
ATOM   2491 C CA  . THR B 2 122 ? 136.237 102.790 1.494   1.00 48.89 ? 122 THR B CA  1 
ATOM   2492 C C   . THR B 2 122 ? 134.888 103.448 1.267   1.00 47.57 ? 122 THR B C   1 
ATOM   2493 O O   . THR B 2 122 ? 134.709 104.630 1.566   1.00 47.09 ? 122 THR B O   1 
ATOM   2494 C CB  . THR B 2 122 ? 136.597 102.960 2.987   1.00 49.38 ? 122 THR B CB  1 
ATOM   2495 O OG1 . THR B 2 122 ? 137.846 102.313 3.262   1.00 50.13 ? 122 THR B OG1 1 
ATOM   2496 C CG2 . THR B 2 122 ? 135.504 102.359 3.870   1.00 50.19 ? 122 THR B CG2 1 
ATOM   2497 N N   . PRO B 2 123 ? 133.919 102.695 0.730   1.00 46.66 ? 123 PRO B N   1 
ATOM   2498 C CA  . PRO B 2 123 ? 132.600 103.280 0.497   1.00 45.38 ? 123 PRO B CA  1 
ATOM   2499 C C   . PRO B 2 123 ? 131.948 103.610 1.839   1.00 44.30 ? 123 PRO B C   1 
ATOM   2500 O O   . PRO B 2 123 ? 132.328 103.063 2.876   1.00 44.61 ? 123 PRO B O   1 
ATOM   2501 C CB  . PRO B 2 123 ? 131.872 102.186 -0.276  1.00 45.80 ? 123 PRO B CB  1 
ATOM   2502 C CG  . PRO B 2 123 ? 132.489 100.933 0.267   1.00 47.04 ? 123 PRO B CG  1 
ATOM   2503 C CD  . PRO B 2 123 ? 133.953 101.282 0.315   1.00 47.07 ? 123 PRO B CD  1 
ATOM   2504 N N   . PRO B 2 124 ? 130.964 104.518 1.838   1.00 43.36 ? 124 PRO B N   1 
ATOM   2505 C CA  . PRO B 2 124 ? 130.271 104.918 3.066   1.00 43.50 ? 124 PRO B CA  1 
ATOM   2506 C C   . PRO B 2 124 ? 129.084 104.052 3.478   1.00 43.51 ? 124 PRO B C   1 
ATOM   2507 O O   . PRO B 2 124 ? 128.398 103.476 2.635   1.00 44.33 ? 124 PRO B O   1 
ATOM   2508 C CB  . PRO B 2 124 ? 129.821 106.332 2.742   1.00 42.60 ? 124 PRO B CB  1 
ATOM   2509 C CG  . PRO B 2 124 ? 129.410 106.186 1.302   1.00 42.23 ? 124 PRO B CG  1 
ATOM   2510 C CD  . PRO B 2 124 ? 130.556 105.373 0.707   1.00 41.78 ? 124 PRO B CD  1 
ATOM   2511 N N   . SER B 2 125 ? 128.853 103.969 4.785   1.00 43.84 ? 125 SER B N   1 
ATOM   2512 C CA  . SER B 2 125 ? 127.709 103.241 5.317   1.00 43.44 ? 125 SER B CA  1 
ATOM   2513 C C   . SER B 2 125 ? 126.700 104.348 5.565   1.00 42.77 ? 125 SER B C   1 
ATOM   2514 O O   . SER B 2 125 ? 127.013 105.332 6.237   1.00 42.67 ? 125 SER B O   1 
ATOM   2515 C CB  . SER B 2 125 ? 128.055 102.547 6.638   1.00 44.21 ? 125 SER B CB  1 
ATOM   2516 O OG  . SER B 2 125 ? 128.849 101.395 6.422   1.00 45.93 ? 125 SER B OG  1 
ATOM   2517 N N   . VAL B 2 126 ? 125.500 104.206 5.017   1.00 42.98 ? 126 VAL B N   1 
ATOM   2518 C CA  . VAL B 2 126 ? 124.478 105.234 5.178   1.00 42.54 ? 126 VAL B CA  1 
ATOM   2519 C C   . VAL B 2 126 ? 123.334 104.777 6.080   1.00 43.96 ? 126 VAL B C   1 
ATOM   2520 O O   . VAL B 2 126 ? 122.596 103.849 5.739   1.00 44.84 ? 126 VAL B O   1 
ATOM   2521 C CB  . VAL B 2 126 ? 123.909 105.642 3.807   1.00 42.04 ? 126 VAL B CB  1 
ATOM   2522 C CG1 . VAL B 2 126 ? 122.981 106.824 3.959   1.00 40.59 ? 126 VAL B CG1 1 
ATOM   2523 C CG2 . VAL B 2 126 ? 125.048 105.968 2.852   1.00 41.84 ? 126 VAL B CG2 1 
ATOM   2524 N N   . TYR B 2 127 ? 123.193 105.434 7.229   1.00 43.49 ? 127 TYR B N   1 
ATOM   2525 C CA  . TYR B 2 127 ? 122.142 105.097 8.185   1.00 42.76 ? 127 TYR B CA  1 
ATOM   2526 C C   . TYR B 2 127 ? 121.109 106.219 8.262   1.00 42.59 ? 127 TYR B C   1 
ATOM   2527 O O   . TYR B 2 127 ? 121.453 107.401 8.175   1.00 40.78 ? 127 TYR B O   1 
ATOM   2528 C CB  . TYR B 2 127 ? 122.734 104.878 9.579   1.00 42.98 ? 127 TYR B CB  1 
ATOM   2529 C CG  . TYR B 2 127 ? 123.917 103.939 9.628   1.00 44.17 ? 127 TYR B CG  1 
ATOM   2530 C CD1 . TYR B 2 127 ? 123.811 102.617 9.202   1.00 44.43 ? 127 TYR B CD1 1 
ATOM   2531 C CD2 . TYR B 2 127 ? 125.144 104.373 10.122  1.00 45.41 ? 127 TYR B CD2 1 
ATOM   2532 C CE1 . TYR B 2 127 ? 124.903 101.749 9.272   1.00 45.53 ? 127 TYR B CE1 1 
ATOM   2533 C CE2 . TYR B 2 127 ? 126.237 103.520 10.195  1.00 46.00 ? 127 TYR B CE2 1 
ATOM   2534 C CZ  . TYR B 2 127 ? 126.114 102.211 9.771   1.00 45.53 ? 127 TYR B CZ  1 
ATOM   2535 O OH  . TYR B 2 127 ? 127.211 101.380 9.853   1.00 48.07 ? 127 TYR B OH  1 
ATOM   2536 N N   . PRO B 2 128 ? 119.826 105.862 8.439   1.00 41.97 ? 128 PRO B N   1 
ATOM   2537 C CA  . PRO B 2 128 ? 118.744 106.847 8.529   1.00 41.95 ? 128 PRO B CA  1 
ATOM   2538 C C   . PRO B 2 128 ? 118.687 107.564 9.878   1.00 42.17 ? 128 PRO B C   1 
ATOM   2539 O O   . PRO B 2 128 ? 119.159 107.048 10.892  1.00 43.53 ? 128 PRO B O   1 
ATOM   2540 C CB  . PRO B 2 128 ? 117.499 106.005 8.277   1.00 42.51 ? 128 PRO B CB  1 
ATOM   2541 C CG  . PRO B 2 128 ? 117.857 104.712 8.943   1.00 42.07 ? 128 PRO B CG  1 
ATOM   2542 C CD  . PRO B 2 128 ? 119.285 104.490 8.473   1.00 41.77 ? 128 PRO B CD  1 
ATOM   2543 N N   . LEU B 2 129 ? 118.108 108.760 9.878   1.00 41.91 ? 129 LEU B N   1 
ATOM   2544 C CA  . LEU B 2 129 ? 117.960 109.542 11.096  1.00 43.15 ? 129 LEU B CA  1 
ATOM   2545 C C   . LEU B 2 129 ? 116.505 109.985 11.222  1.00 43.77 ? 129 LEU B C   1 
ATOM   2546 O O   . LEU B 2 129 ? 116.115 111.024 10.687  1.00 43.20 ? 129 LEU B O   1 
ATOM   2547 C CB  . LEU B 2 129 ? 118.877 110.774 11.075  1.00 43.13 ? 129 LEU B CB  1 
ATOM   2548 C CG  . LEU B 2 129 ? 120.395 110.551 11.102  1.00 45.71 ? 129 LEU B CG  1 
ATOM   2549 C CD1 . LEU B 2 129 ? 121.103 111.903 11.000  1.00 45.56 ? 129 LEU B CD1 1 
ATOM   2550 C CD2 . LEU B 2 129 ? 120.805 109.827 12.383  1.00 43.66 ? 129 LEU B CD2 1 
ATOM   2551 N N   . ALA B 2 130 ? 115.705 109.176 11.914  1.00 44.28 ? 130 ALA B N   1 
ATOM   2552 C CA  . ALA B 2 130 ? 114.292 109.478 12.126  1.00 45.07 ? 130 ALA B CA  1 
ATOM   2553 C C   . ALA B 2 130 ? 114.109 109.835 13.598  1.00 44.99 ? 130 ALA B C   1 
ATOM   2554 O O   . ALA B 2 130 ? 114.814 109.310 14.460  1.00 43.53 ? 130 ALA B O   1 
ATOM   2555 C CB  . ALA B 2 130 ? 113.438 108.279 11.763  1.00 46.07 ? 130 ALA B CB  1 
ATOM   2556 N N   . PRO B 2 131 ? 113.158 110.731 13.902  1.00 46.06 ? 131 PRO B N   1 
ATOM   2557 C CA  . PRO B 2 131 ? 112.885 111.171 15.274  1.00 47.56 ? 131 PRO B CA  1 
ATOM   2558 C C   . PRO B 2 131 ? 112.595 110.037 16.240  1.00 49.05 ? 131 PRO B C   1 
ATOM   2559 O O   . PRO B 2 131 ? 112.104 108.979 15.843  1.00 47.86 ? 131 PRO B O   1 
ATOM   2560 C CB  . PRO B 2 131 ? 111.676 112.091 15.112  1.00 46.46 ? 131 PRO B CB  1 
ATOM   2561 C CG  . PRO B 2 131 ? 111.806 112.586 13.706  1.00 48.20 ? 131 PRO B CG  1 
ATOM   2562 C CD  . PRO B 2 131 ? 112.202 111.342 12.965  1.00 45.97 ? 131 PRO B CD  1 
ATOM   2563 N N   . GLY B 2 132 ? 112.906 110.274 17.510  1.00 50.38 ? 132 GLY B N   1 
ATOM   2564 C CA  . GLY B 2 132 ? 112.645 109.282 18.534  1.00 51.43 ? 132 GLY B CA  1 
ATOM   2565 C C   . GLY B 2 132 ? 111.150 109.238 18.783  1.00 52.10 ? 132 GLY B C   1 
ATOM   2566 O O   . GLY B 2 132 ? 110.414 110.106 18.310  1.00 50.35 ? 132 GLY B O   1 
ATOM   2567 N N   . SER B 2 133 ? 110.702 108.241 19.536  1.00 54.03 ? 133 SER B N   1 
ATOM   2568 C CA  . SER B 2 133 ? 109.282 108.074 19.823  1.00 56.02 ? 133 SER B CA  1 
ATOM   2569 C C   . SER B 2 133 ? 108.651 109.202 20.641  1.00 56.37 ? 133 SER B C   1 
ATOM   2570 O O   . SER B 2 133 ? 107.506 109.588 20.391  1.00 56.17 ? 133 SER B O   1 
ATOM   2571 C CB  . SER B 2 133 ? 109.050 106.740 20.536  1.00 57.67 ? 133 SER B CB  1 
ATOM   2572 O OG  . SER B 2 133 ? 107.666 106.499 20.710  1.00 60.17 ? 133 SER B OG  1 
ATOM   2573 N N   . ALA B 2 134 ? 109.393 109.728 21.613  1.00 56.26 ? 134 ALA B N   1 
ATOM   2574 C CA  . ALA B 2 134 ? 108.879 110.795 22.467  1.00 56.26 ? 134 ALA B CA  1 
ATOM   2575 C C   . ALA B 2 134 ? 109.147 112.193 21.926  1.00 56.52 ? 134 ALA B C   1 
ATOM   2576 O O   . ALA B 2 134 ? 108.928 113.184 22.623  1.00 56.73 ? 134 ALA B O   1 
ATOM   2577 C CB  . ALA B 2 134 ? 109.459 110.663 23.865  1.00 56.60 ? 134 ALA B CB  1 
ATOM   2578 N N   . ALA B 2 135 ? 109.618 112.277 20.686  1.00 56.09 ? 135 ALA B N   1 
ATOM   2579 C CA  . ALA B 2 135 ? 109.900 113.569 20.076  1.00 55.56 ? 135 ALA B CA  1 
ATOM   2580 C C   . ALA B 2 135 ? 108.611 114.222 19.583  1.00 55.84 ? 135 ALA B C   1 
ATOM   2581 O O   . ALA B 2 135 ? 107.893 113.654 18.762  1.00 54.85 ? 135 ALA B O   1 
ATOM   2582 C CB  . ALA B 2 135 ? 110.879 113.399 18.916  1.00 54.92 ? 135 ALA B CB  1 
ATOM   2583 N N   . GLN B 2 136 ? 108.319 115.412 20.096  1.00 56.42 ? 136 GLN B N   1 
ATOM   2584 C CA  . GLN B 2 136 ? 107.125 116.146 19.694  1.00 58.01 ? 136 GLN B CA  1 
ATOM   2585 C C   . GLN B 2 136 ? 107.439 116.927 18.420  1.00 59.54 ? 136 GLN B C   1 
ATOM   2586 O O   . GLN B 2 136 ? 108.452 117.622 18.344  1.00 59.56 ? 136 GLN B O   1 
ATOM   2587 C CB  . GLN B 2 136 ? 106.694 117.098 20.807  1.00 58.20 ? 136 GLN B CB  1 
ATOM   2588 N N   . THR B 2 137 ? 106.574 116.812 17.419  1.00 60.40 ? 137 THR B N   1 
ATOM   2589 C CA  . THR B 2 137 ? 106.788 117.510 16.155  1.00 60.34 ? 137 THR B CA  1 
ATOM   2590 C C   . THR B 2 137 ? 106.013 118.821 16.094  1.00 59.96 ? 137 THR B C   1 
ATOM   2591 O O   . THR B 2 137 ? 105.013 118.994 16.787  1.00 60.33 ? 137 THR B O   1 
ATOM   2592 C CB  . THR B 2 137 ? 106.382 116.608 14.989  1.00 60.21 ? 137 THR B CB  1 
ATOM   2593 N N   . ASN B 2 138 ? 106.493 119.748 15.270  1.00 59.70 ? 138 ASN B N   1 
ATOM   2594 C CA  . ASN B 2 138 ? 105.833 121.039 15.083  1.00 58.84 ? 138 ASN B CA  1 
ATOM   2595 C C   . ASN B 2 138 ? 105.243 121.033 13.675  1.00 57.58 ? 138 ASN B C   1 
ATOM   2596 O O   . ASN B 2 138 ? 104.913 119.974 13.143  1.00 57.55 ? 138 ASN B O   1 
ATOM   2597 C CB  . ASN B 2 138 ? 106.842 122.181 15.230  1.00 60.02 ? 138 ASN B CB  1 
ATOM   2598 N N   . SER B 2 139 ? 105.113 122.205 13.064  1.00 56.41 ? 139 SER B N   1 
ATOM   2599 C CA  . SER B 2 139 ? 104.571 122.277 11.713  1.00 54.88 ? 139 SER B CA  1 
ATOM   2600 C C   . SER B 2 139 ? 105.614 121.762 10.719  1.00 53.09 ? 139 SER B C   1 
ATOM   2601 O O   . SER B 2 139 ? 105.340 121.621 9.525   1.00 54.16 ? 139 SER B O   1 
ATOM   2602 C CB  . SER B 2 139 ? 104.186 123.718 11.367  1.00 56.40 ? 139 SER B CB  1 
ATOM   2603 O OG  . SER B 2 139 ? 105.324 124.562 11.352  1.00 57.18 ? 139 SER B OG  1 
ATOM   2604 N N   . MET B 2 140 ? 106.807 121.474 11.228  1.00 50.35 ? 140 MET B N   1 
ATOM   2605 C CA  . MET B 2 140 ? 107.910 120.976 10.414  1.00 46.83 ? 140 MET B CA  1 
ATOM   2606 C C   . MET B 2 140 ? 108.571 119.796 11.114  1.00 43.78 ? 140 MET B C   1 
ATOM   2607 O O   . MET B 2 140 ? 108.553 119.701 12.340  1.00 43.03 ? 140 MET B O   1 
ATOM   2608 C CB  . MET B 2 140 ? 108.965 122.071 10.214  1.00 49.21 ? 140 MET B CB  1 
ATOM   2609 C CG  . MET B 2 140 ? 108.477 123.331 9.522   1.00 51.16 ? 140 MET B CG  1 
ATOM   2610 S SD  . MET B 2 140 ? 107.902 123.012 7.847   1.00 55.69 ? 140 MET B SD  1 
ATOM   2611 C CE  . MET B 2 140 ? 109.456 122.664 7.002   1.00 53.55 ? 140 MET B CE  1 
ATOM   2612 N N   . VAL B 2 141 ? 109.158 118.896 10.337  1.00 40.56 ? 141 VAL B N   1 
ATOM   2613 C CA  . VAL B 2 141 ? 109.845 117.751 10.911  1.00 38.63 ? 141 VAL B CA  1 
ATOM   2614 C C   . VAL B 2 141 ? 111.246 117.665 10.318  1.00 36.51 ? 141 VAL B C   1 
ATOM   2615 O O   . VAL B 2 141 ? 111.436 117.875 9.123   1.00 35.96 ? 141 VAL B O   1 
ATOM   2616 C CB  . VAL B 2 141 ? 109.099 116.432 10.630  1.00 38.95 ? 141 VAL B CB  1 
ATOM   2617 C CG1 . VAL B 2 141 ? 108.969 116.211 9.134   1.00 38.92 ? 141 VAL B CG1 1 
ATOM   2618 C CG2 . VAL B 2 141 ? 109.842 115.280 11.279  1.00 37.36 ? 141 VAL B CG2 1 
ATOM   2619 N N   . THR B 2 142 ? 112.229 117.353 11.153  1.00 34.73 ? 142 THR B N   1 
ATOM   2620 C CA  . THR B 2 142 ? 113.599 117.261 10.683  1.00 33.63 ? 142 THR B CA  1 
ATOM   2621 C C   . THR B 2 142 ? 114.084 115.826 10.614  1.00 33.65 ? 142 THR B C   1 
ATOM   2622 O O   . THR B 2 142 ? 114.014 115.084 11.590  1.00 34.51 ? 142 THR B O   1 
ATOM   2623 C CB  . THR B 2 142 ? 114.544 118.094 11.583  1.00 34.01 ? 142 THR B CB  1 
ATOM   2624 O OG1 . THR B 2 142 ? 114.162 119.472 11.513  1.00 33.67 ? 142 THR B OG1 1 
ATOM   2625 C CG2 . THR B 2 142 ? 115.992 117.952 11.135  1.00 33.27 ? 142 THR B CG2 1 
ATOM   2626 N N   . LEU B 2 143 ? 114.580 115.444 9.442   1.00 32.72 ? 143 LEU B N   1 
ATOM   2627 C CA  . LEU B 2 143 ? 115.087 114.101 9.218   1.00 33.29 ? 143 LEU B CA  1 
ATOM   2628 C C   . LEU B 2 143 ? 116.519 114.205 8.713   1.00 35.13 ? 143 LEU B C   1 
ATOM   2629 O O   . LEU B 2 143 ? 117.004 115.302 8.434   1.00 36.51 ? 143 LEU B O   1 
ATOM   2630 C CB  . LEU B 2 143 ? 114.215 113.387 8.178   1.00 33.50 ? 143 LEU B CB  1 
ATOM   2631 C CG  . LEU B 2 143 ? 112.713 113.329 8.499   1.00 33.59 ? 143 LEU B CG  1 
ATOM   2632 C CD1 . LEU B 2 143 ? 111.939 112.692 7.353   1.00 32.82 ? 143 LEU B CD1 1 
ATOM   2633 C CD2 . LEU B 2 143 ? 112.512 112.537 9.768   1.00 33.28 ? 143 LEU B CD2 1 
ATOM   2634 N N   . GLY B 2 144 ? 117.199 113.072 8.590   1.00 36.25 ? 144 GLY B N   1 
ATOM   2635 C CA  . GLY B 2 144 ? 118.560 113.109 8.099   1.00 36.08 ? 144 GLY B CA  1 
ATOM   2636 C C   . GLY B 2 144 ? 119.130 111.747 7.781   1.00 38.13 ? 144 GLY B C   1 
ATOM   2637 O O   . GLY B 2 144 ? 118.429 110.737 7.817   1.00 36.18 ? 144 GLY B O   1 
ATOM   2638 N N   . CYS B 2 145 ? 120.411 111.725 7.439   1.00 39.40 ? 145 CYS B N   1 
ATOM   2639 C CA  . CYS B 2 145 ? 121.090 110.475 7.156   1.00 42.95 ? 145 CYS B CA  1 
ATOM   2640 C C   . CYS B 2 145 ? 122.554 110.623 7.547   1.00 41.59 ? 145 CYS B C   1 
ATOM   2641 O O   . CYS B 2 145 ? 123.172 111.669 7.329   1.00 42.16 ? 145 CYS B O   1 
ATOM   2642 C CB  . CYS B 2 145 ? 120.951 110.092 5.679   1.00 45.51 ? 145 CYS B CB  1 
ATOM   2643 S SG  . CYS B 2 145 ? 121.739 111.212 4.534   1.00 56.11 ? 145 CYS B SG  1 
ATOM   2644 N N   . LEU B 2 146 ? 123.089 109.571 8.153   1.00 39.76 ? 146 LEU B N   1 
ATOM   2645 C CA  . LEU B 2 146 ? 124.467 109.542 8.605   1.00 38.88 ? 146 LEU B CA  1 
ATOM   2646 C C   . LEU B 2 146 ? 125.330 108.840 7.568   1.00 38.00 ? 146 LEU B C   1 
ATOM   2647 O O   . LEU B 2 146 ? 125.052 107.703 7.200   1.00 38.70 ? 146 LEU B O   1 
ATOM   2648 C CB  . LEU B 2 146 ? 124.549 108.800 9.945   1.00 37.11 ? 146 LEU B CB  1 
ATOM   2649 C CG  . LEU B 2 146 ? 125.943 108.545 10.515  1.00 37.56 ? 146 LEU B CG  1 
ATOM   2650 C CD1 . LEU B 2 146 ? 126.571 109.875 10.937  1.00 36.51 ? 146 LEU B CD1 1 
ATOM   2651 C CD2 . LEU B 2 146 ? 125.844 107.592 11.709  1.00 37.19 ? 146 LEU B CD2 1 
ATOM   2652 N N   . VAL B 2 147 ? 126.373 109.518 7.097   1.00 37.81 ? 147 VAL B N   1 
ATOM   2653 C CA  . VAL B 2 147 ? 127.278 108.948 6.099   1.00 37.91 ? 147 VAL B CA  1 
ATOM   2654 C C   . VAL B 2 147 ? 128.592 108.714 6.824   1.00 39.19 ? 147 VAL B C   1 
ATOM   2655 O O   . VAL B 2 147 ? 129.427 109.615 6.950   1.00 39.10 ? 147 VAL B O   1 
ATOM   2656 C CB  . VAL B 2 147 ? 127.471 109.917 4.914   1.00 37.69 ? 147 VAL B CB  1 
ATOM   2657 C CG1 . VAL B 2 147 ? 128.239 109.239 3.801   1.00 35.78 ? 147 VAL B CG1 1 
ATOM   2658 C CG2 . VAL B 2 147 ? 126.109 110.385 4.411   1.00 37.82 ? 147 VAL B CG2 1 
ATOM   2659 N N   . LYS B 2 148 ? 128.769 107.485 7.291   1.00 40.32 ? 148 LYS B N   1 
ATOM   2660 C CA  . LYS B 2 148 ? 129.930 107.124 8.085   1.00 41.53 ? 148 LYS B CA  1 
ATOM   2661 C C   . LYS B 2 148 ? 130.981 106.205 7.478   1.00 41.55 ? 148 LYS B C   1 
ATOM   2662 O O   . LYS B 2 148 ? 130.684 105.339 6.656   1.00 42.35 ? 148 LYS B O   1 
ATOM   2663 C CB  . LYS B 2 148 ? 129.435 106.518 9.407   1.00 43.11 ? 148 LYS B CB  1 
ATOM   2664 C CG  . LYS B 2 148 ? 130.532 106.071 10.358  1.00 47.22 ? 148 LYS B CG  1 
ATOM   2665 C CD  . LYS B 2 148 ? 129.961 105.602 11.690  1.00 49.65 ? 148 LYS B CD  1 
ATOM   2666 C CE  . LYS B 2 148 ? 131.079 105.291 12.677  1.00 51.44 ? 148 LYS B CE  1 
ATOM   2667 N NZ  . LYS B 2 148 ? 131.972 106.475 12.891  1.00 52.16 ? 148 LYS B NZ  1 
ATOM   2668 N N   . GLY B 2 149 ? 132.219 106.420 7.916   1.00 41.38 ? 149 GLY B N   1 
ATOM   2669 C CA  . GLY B 2 149 ? 133.346 105.606 7.495   1.00 41.23 ? 149 GLY B CA  1 
ATOM   2670 C C   . GLY B 2 149 ? 133.717 105.512 6.030   1.00 40.84 ? 149 GLY B C   1 
ATOM   2671 O O   . GLY B 2 149 ? 133.797 104.410 5.488   1.00 41.35 ? 149 GLY B O   1 
ATOM   2672 N N   . TYR B 2 150 ? 133.970 106.648 5.386   1.00 39.60 ? 150 TYR B N   1 
ATOM   2673 C CA  . TYR B 2 150 ? 134.349 106.619 3.983   1.00 39.06 ? 150 TYR B CA  1 
ATOM   2674 C C   . TYR B 2 150 ? 135.688 107.304 3.741   1.00 39.35 ? 150 TYR B C   1 
ATOM   2675 O O   . TYR B 2 150 ? 136.185 108.069 4.574   1.00 38.64 ? 150 TYR B O   1 
ATOM   2676 C CB  . TYR B 2 150 ? 133.249 107.250 3.117   1.00 38.43 ? 150 TYR B CB  1 
ATOM   2677 C CG  . TYR B 2 150 ? 133.094 108.748 3.255   1.00 39.02 ? 150 TYR B CG  1 
ATOM   2678 C CD1 . TYR B 2 150 ? 133.946 109.625 2.580   1.00 40.04 ? 150 TYR B CD1 1 
ATOM   2679 C CD2 . TYR B 2 150 ? 132.080 109.293 4.041   1.00 37.99 ? 150 TYR B CD2 1 
ATOM   2680 C CE1 . TYR B 2 150 ? 133.785 111.003 2.684   1.00 38.82 ? 150 TYR B CE1 1 
ATOM   2681 C CE2 . TYR B 2 150 ? 131.914 110.666 4.154   1.00 38.42 ? 150 TYR B CE2 1 
ATOM   2682 C CZ  . TYR B 2 150 ? 132.769 111.514 3.473   1.00 38.39 ? 150 TYR B CZ  1 
ATOM   2683 O OH  . TYR B 2 150 ? 132.609 112.872 3.586   1.00 38.99 ? 150 TYR B OH  1 
ATOM   2684 N N   . PHE B 2 151 ? 136.278 106.999 2.595   1.00 39.42 ? 151 PHE B N   1 
ATOM   2685 C CA  . PHE B 2 151 ? 137.552 107.575 2.215   1.00 39.81 ? 151 PHE B CA  1 
ATOM   2686 C C   . PHE B 2 151 ? 137.783 107.273 0.743   1.00 39.88 ? 151 PHE B C   1 
ATOM   2687 O O   . PHE B 2 151 ? 137.489 106.175 0.282   1.00 41.98 ? 151 PHE B O   1 
ATOM   2688 C CB  . PHE B 2 151 ? 138.689 106.965 3.035   1.00 40.29 ? 151 PHE B CB  1 
ATOM   2689 C CG  . PHE B 2 151 ? 139.997 107.692 2.882   1.00 41.64 ? 151 PHE B CG  1 
ATOM   2690 C CD1 . PHE B 2 151 ? 140.312 108.768 3.711   1.00 42.07 ? 151 PHE B CD1 1 
ATOM   2691 C CD2 . PHE B 2 151 ? 140.906 107.321 1.892   1.00 42.79 ? 151 PHE B CD2 1 
ATOM   2692 C CE1 . PHE B 2 151 ? 141.517 109.466 3.558   1.00 42.15 ? 151 PHE B CE1 1 
ATOM   2693 C CE2 . PHE B 2 151 ? 142.110 108.010 1.729   1.00 43.00 ? 151 PHE B CE2 1 
ATOM   2694 C CZ  . PHE B 2 151 ? 142.415 109.085 2.566   1.00 42.57 ? 151 PHE B CZ  1 
ATOM   2695 N N   . PRO B 2 152 ? 138.269 108.260 -0.025  1.00 38.64 ? 152 PRO B N   1 
ATOM   2696 C CA  . PRO B 2 152 ? 138.587 109.610 0.444   1.00 37.01 ? 152 PRO B CA  1 
ATOM   2697 C C   . PRO B 2 152 ? 137.383 110.492 0.140   1.00 36.25 ? 152 PRO B C   1 
ATOM   2698 O O   . PRO B 2 152 ? 136.321 109.990 -0.243  1.00 33.98 ? 152 PRO B O   1 
ATOM   2699 C CB  . PRO B 2 152 ? 139.784 109.983 -0.411  1.00 37.06 ? 152 PRO B CB  1 
ATOM   2700 C CG  . PRO B 2 152 ? 139.384 109.401 -1.747  1.00 37.98 ? 152 PRO B CG  1 
ATOM   2701 C CD  . PRO B 2 152 ? 138.830 108.031 -1.371  1.00 37.80 ? 152 PRO B CD  1 
ATOM   2702 N N   . GLU B 2 153 ? 137.543 111.800 0.310   1.00 34.90 ? 153 GLU B N   1 
ATOM   2703 C CA  . GLU B 2 153 ? 136.461 112.722 0.004   1.00 35.00 ? 153 GLU B CA  1 
ATOM   2704 C C   . GLU B 2 153 ? 136.342 112.761 -1.519  1.00 33.65 ? 153 GLU B C   1 
ATOM   2705 O O   . GLU B 2 153 ? 137.270 112.376 -2.228  1.00 34.83 ? 153 GLU B O   1 
ATOM   2706 C CB  . GLU B 2 153 ? 136.779 114.120 0.544   1.00 34.80 ? 153 GLU B CB  1 
ATOM   2707 C CG  . GLU B 2 153 ? 136.550 114.291 2.042   1.00 37.17 ? 153 GLU B CG  1 
ATOM   2708 C CD  . GLU B 2 153 ? 135.176 114.874 2.367   1.00 39.42 ? 153 GLU B CD  1 
ATOM   2709 O OE1 . GLU B 2 153 ? 134.153 114.352 1.861   1.00 39.63 ? 153 GLU B OE1 1 
ATOM   2710 O OE2 . GLU B 2 153 ? 135.119 115.857 3.135   1.00 40.92 ? 153 GLU B OE2 1 
ATOM   2711 N N   . PRO B 2 154 ? 135.188 113.195 -2.042  1.00 33.20 ? 154 PRO B N   1 
ATOM   2712 C CA  . PRO B 2 154 ? 134.031 113.629 -1.257  1.00 34.20 ? 154 PRO B CA  1 
ATOM   2713 C C   . PRO B 2 154 ? 132.859 112.671 -1.478  1.00 34.75 ? 154 PRO B C   1 
ATOM   2714 O O   . PRO B 2 154 ? 133.015 111.586 -2.037  1.00 33.88 ? 154 PRO B O   1 
ATOM   2715 C CB  . PRO B 2 154 ? 133.727 114.981 -1.857  1.00 34.65 ? 154 PRO B CB  1 
ATOM   2716 C CG  . PRO B 2 154 ? 133.866 114.657 -3.346  1.00 35.25 ? 154 PRO B CG  1 
ATOM   2717 C CD  . PRO B 2 154 ? 135.122 113.763 -3.403  1.00 33.49 ? 154 PRO B CD  1 
ATOM   2718 N N   . VAL B 2 155 ? 131.690 113.104 -1.027  1.00 34.70 ? 155 VAL B N   1 
ATOM   2719 C CA  . VAL B 2 155 ? 130.449 112.380 -1.219  1.00 36.15 ? 155 VAL B CA  1 
ATOM   2720 C C   . VAL B 2 155 ? 129.451 113.484 -1.542  1.00 36.21 ? 155 VAL B C   1 
ATOM   2721 O O   . VAL B 2 155 ? 129.608 114.617 -1.075  1.00 35.52 ? 155 VAL B O   1 
ATOM   2722 C CB  . VAL B 2 155 ? 129.970 111.638 0.062   1.00 35.53 ? 155 VAL B CB  1 
ATOM   2723 C CG1 . VAL B 2 155 ? 130.936 110.525 0.419   1.00 35.61 ? 155 VAL B CG1 1 
ATOM   2724 C CG2 . VAL B 2 155 ? 129.821 112.620 1.214   1.00 36.32 ? 155 VAL B CG2 1 
ATOM   2725 N N   . THR B 2 156 ? 128.449 113.161 -2.352  1.00 36.52 ? 156 THR B N   1 
ATOM   2726 C CA  . THR B 2 156 ? 127.409 114.117 -2.713  1.00 38.06 ? 156 THR B CA  1 
ATOM   2727 C C   . THR B 2 156 ? 126.081 113.574 -2.199  1.00 37.62 ? 156 THR B C   1 
ATOM   2728 O O   . THR B 2 156 ? 125.636 112.502 -2.611  1.00 38.71 ? 156 THR B O   1 
ATOM   2729 C CB  . THR B 2 156 ? 127.306 114.313 -4.245  1.00 38.74 ? 156 THR B CB  1 
ATOM   2730 O OG1 . THR B 2 156 ? 128.528 114.875 -4.743  1.00 40.78 ? 156 THR B OG1 1 
ATOM   2731 C CG2 . THR B 2 156 ? 126.147 115.254 -4.582  1.00 40.55 ? 156 THR B CG2 1 
ATOM   2732 N N   . VAL B 2 157 ? 125.451 114.319 -1.299  1.00 36.91 ? 157 VAL B N   1 
ATOM   2733 C CA  . VAL B 2 157 ? 124.185 113.908 -0.718  1.00 35.06 ? 157 VAL B CA  1 
ATOM   2734 C C   . VAL B 2 157 ? 123.016 114.714 -1.269  1.00 36.48 ? 157 VAL B C   1 
ATOM   2735 O O   . VAL B 2 157 ? 123.012 115.942 -1.195  1.00 36.76 ? 157 VAL B O   1 
ATOM   2736 C CB  . VAL B 2 157 ? 124.202 114.073 0.818   1.00 33.42 ? 157 VAL B CB  1 
ATOM   2737 C CG1 . VAL B 2 157 ? 122.950 113.456 1.419   1.00 31.89 ? 157 VAL B CG1 1 
ATOM   2738 C CG2 . VAL B 2 157 ? 125.441 113.419 1.396   1.00 31.06 ? 157 VAL B CG2 1 
ATOM   2739 N N   . THR B 2 158 ? 122.028 114.015 -1.821  1.00 36.38 ? 158 THR B N   1 
ATOM   2740 C CA  . THR B 2 158 ? 120.834 114.655 -2.366  1.00 37.21 ? 158 THR B CA  1 
ATOM   2741 C C   . THR B 2 158 ? 119.595 114.075 -1.683  1.00 37.36 ? 158 THR B C   1 
ATOM   2742 O O   . THR B 2 158 ? 119.657 113.010 -1.069  1.00 36.30 ? 158 THR B O   1 
ATOM   2743 C CB  . THR B 2 158 ? 120.706 114.410 -3.885  1.00 38.33 ? 158 THR B CB  1 
ATOM   2744 O OG1 . THR B 2 158 ? 120.592 113.000 -4.135  1.00 38.45 ? 158 THR B OG1 1 
ATOM   2745 C CG2 . THR B 2 158 ? 121.933 114.953 -4.620  1.00 38.43 ? 158 THR B CG2 1 
ATOM   2746 N N   . TRP B 2 159 ? 118.473 114.780 -1.781  1.00 39.17 ? 159 TRP B N   1 
ATOM   2747 C CA  . TRP B 2 159 ? 117.231 114.295 -1.193  1.00 38.59 ? 159 TRP B CA  1 
ATOM   2748 C C   . TRP B 2 159 ? 116.172 114.119 -2.274  1.00 39.69 ? 159 TRP B C   1 
ATOM   2749 O O   . TRP B 2 159 ? 115.931 115.017 -3.087  1.00 37.62 ? 159 TRP B O   1 
ATOM   2750 C CB  . TRP B 2 159 ? 116.750 115.241 -0.088  1.00 38.68 ? 159 TRP B CB  1 
ATOM   2751 C CG  . TRP B 2 159 ? 117.657 115.202 1.107   1.00 40.71 ? 159 TRP B CG  1 
ATOM   2752 C CD1 . TRP B 2 159 ? 118.733 116.009 1.349   1.00 40.51 ? 159 TRP B CD1 1 
ATOM   2753 C CD2 . TRP B 2 159 ? 117.638 114.235 2.165   1.00 41.45 ? 159 TRP B CD2 1 
ATOM   2754 N NE1 . TRP B 2 159 ? 119.387 115.602 2.487   1.00 39.58 ? 159 TRP B NE1 1 
ATOM   2755 C CE2 . TRP B 2 159 ? 118.737 114.516 3.009   1.00 40.23 ? 159 TRP B CE2 1 
ATOM   2756 C CE3 . TRP B 2 159 ? 116.801 113.154 2.481   1.00 41.40 ? 159 TRP B CE3 1 
ATOM   2757 C CZ2 . TRP B 2 159 ? 119.022 113.755 4.152   1.00 41.26 ? 159 TRP B CZ2 1 
ATOM   2758 C CZ3 . TRP B 2 159 ? 117.087 112.395 3.619   1.00 42.87 ? 159 TRP B CZ3 1 
ATOM   2759 C CH2 . TRP B 2 159 ? 118.188 112.701 4.439   1.00 42.90 ? 159 TRP B CH2 1 
ATOM   2760 N N   . ASN B 2 160 ? 115.548 112.945 -2.275  1.00 39.48 ? 160 ASN B N   1 
ATOM   2761 C CA  . ASN B 2 160 ? 114.535 112.603 -3.260  1.00 40.91 ? 160 ASN B CA  1 
ATOM   2762 C C   . ASN B 2 160 ? 115.086 112.838 -4.662  1.00 41.52 ? 160 ASN B C   1 
ATOM   2763 O O   . ASN B 2 160 ? 114.486 113.528 -5.488  1.00 41.04 ? 160 ASN B O   1 
ATOM   2764 C CB  . ASN B 2 160 ? 113.252 113.404 -3.011  1.00 39.58 ? 160 ASN B CB  1 
ATOM   2765 C CG  . ASN B 2 160 ? 112.462 112.869 -1.824  1.00 38.01 ? 160 ASN B CG  1 
ATOM   2766 O OD1 . ASN B 2 160 ? 112.861 111.891 -1.193  1.00 37.32 ? 160 ASN B OD1 1 
ATOM   2767 N ND2 . ASN B 2 160 ? 111.340 113.504 -1.518  1.00 35.34 ? 160 ASN B ND2 1 
ATOM   2768 N N   . SER B 2 161 ? 116.258 112.252 -4.900  1.00 42.98 ? 161 SER B N   1 
ATOM   2769 C CA  . SER B 2 161 ? 116.949 112.340 -6.176  1.00 44.18 ? 161 SER B CA  1 
ATOM   2770 C C   . SER B 2 161 ? 117.190 113.768 -6.651  1.00 45.03 ? 161 SER B C   1 
ATOM   2771 O O   . SER B 2 161 ? 117.275 114.021 -7.851  1.00 46.43 ? 161 SER B O   1 
ATOM   2772 C CB  . SER B 2 161 ? 116.162 111.566 -7.232  1.00 43.73 ? 161 SER B CB  1 
ATOM   2773 O OG  . SER B 2 161 ? 116.109 110.188 -6.914  1.00 41.18 ? 161 SER B OG  1 
ATOM   2774 N N   . GLY B 2 162 ? 117.296 114.699 -5.710  1.00 45.50 ? 162 GLY B N   1 
ATOM   2775 C CA  . GLY B 2 162 ? 117.542 116.083 -6.070  1.00 46.47 ? 162 GLY B CA  1 
ATOM   2776 C C   . GLY B 2 162 ? 116.312 116.970 -6.143  1.00 48.61 ? 162 GLY B C   1 
ATOM   2777 O O   . GLY B 2 162 ? 116.440 118.197 -6.201  1.00 48.76 ? 162 GLY B O   1 
ATOM   2778 N N   . SER B 2 163 ? 115.123 116.368 -6.133  1.00 49.22 ? 163 SER B N   1 
ATOM   2779 C CA  . SER B 2 163 ? 113.875 117.132 -6.211  1.00 50.27 ? 163 SER B CA  1 
ATOM   2780 C C   . SER B 2 163 ? 113.560 117.891 -4.923  1.00 50.82 ? 163 SER B C   1 
ATOM   2781 O O   . SER B 2 163 ? 112.695 118.766 -4.903  1.00 51.00 ? 163 SER B O   1 
ATOM   2782 C CB  . SER B 2 163 ? 112.705 116.201 -6.550  1.00 51.30 ? 163 SER B CB  1 
ATOM   2783 O OG  . SER B 2 163 ? 112.538 115.210 -5.554  1.00 48.82 ? 163 SER B OG  1 
ATOM   2784 N N   . LEU B 2 164 ? 114.263 117.546 -3.850  1.00 50.80 ? 164 LEU B N   1 
ATOM   2785 C CA  . LEU B 2 164 ? 114.071 118.194 -2.557  1.00 51.35 ? 164 LEU B CA  1 
ATOM   2786 C C   . LEU B 2 164 ? 115.368 118.935 -2.230  1.00 51.28 ? 164 LEU B C   1 
ATOM   2787 O O   . LEU B 2 164 ? 116.324 118.337 -1.740  1.00 50.97 ? 164 LEU B O   1 
ATOM   2788 C CB  . LEU B 2 164 ? 113.773 117.130 -1.495  1.00 52.00 ? 164 LEU B CB  1 
ATOM   2789 C CG  . LEU B 2 164 ? 113.151 117.558 -0.164  1.00 52.48 ? 164 LEU B CG  1 
ATOM   2790 C CD1 . LEU B 2 164 ? 111.904 118.393 -0.419  1.00 53.52 ? 164 LEU B CD1 1 
ATOM   2791 C CD2 . LEU B 2 164 ? 112.806 116.318 0.649   1.00 51.56 ? 164 LEU B CD2 1 
ATOM   2792 N N   . SER B 2 165 ? 115.399 120.234 -2.513  1.00 51.71 ? 165 SER B N   1 
ATOM   2793 C CA  . SER B 2 165 ? 116.597 121.044 -2.281  1.00 52.13 ? 165 SER B CA  1 
ATOM   2794 C C   . SER B 2 165 ? 116.478 122.000 -1.100  1.00 51.66 ? 165 SER B C   1 
ATOM   2795 O O   . SER B 2 165 ? 117.463 122.269 -0.408  1.00 51.26 ? 165 SER B O   1 
ATOM   2796 C CB  . SER B 2 165 ? 116.944 121.829 -3.552  1.00 51.03 ? 165 SER B CB  1 
ATOM   2797 N N   . SER B 2 166 ? 115.274 122.515 -0.875  1.00 51.19 ? 166 SER B N   1 
ATOM   2798 C CA  . SER B 2 166 ? 115.041 123.447 0.218   1.00 50.23 ? 166 SER B CA  1 
ATOM   2799 C C   . SER B 2 166 ? 114.997 122.729 1.567   1.00 49.67 ? 166 SER B C   1 
ATOM   2800 O O   . SER B 2 166 ? 114.433 121.639 1.684   1.00 50.59 ? 166 SER B O   1 
ATOM   2801 C CB  . SER B 2 166 ? 113.738 124.208 -0.021  1.00 50.88 ? 166 SER B CB  1 
ATOM   2802 N N   . GLY B 2 167 ? 115.599 123.352 2.579   1.00 47.41 ? 167 GLY B N   1 
ATOM   2803 C CA  . GLY B 2 167 ? 115.624 122.780 3.915   1.00 44.39 ? 167 GLY B CA  1 
ATOM   2804 C C   . GLY B 2 167 ? 116.681 121.707 4.106   1.00 41.89 ? 167 GLY B C   1 
ATOM   2805 O O   . GLY B 2 167 ? 116.537 120.845 4.968   1.00 41.69 ? 167 GLY B O   1 
ATOM   2806 N N   . VAL B 2 168 ? 117.749 121.768 3.315   1.00 38.98 ? 168 VAL B N   1 
ATOM   2807 C CA  . VAL B 2 168 ? 118.822 120.779 3.388   1.00 37.16 ? 168 VAL B CA  1 
ATOM   2808 C C   . VAL B 2 168 ? 120.196 121.320 3.804   1.00 37.74 ? 168 VAL B C   1 
ATOM   2809 O O   . VAL B 2 168 ? 120.690 122.279 3.217   1.00 38.18 ? 168 VAL B O   1 
ATOM   2810 C CB  . VAL B 2 168 ? 118.986 120.071 2.022   1.00 36.03 ? 168 VAL B CB  1 
ATOM   2811 C CG1 . VAL B 2 168 ? 120.166 119.112 2.061   1.00 34.48 ? 168 VAL B CG1 1 
ATOM   2812 C CG2 . VAL B 2 168 ? 117.705 119.327 1.668   1.00 36.92 ? 168 VAL B CG2 1 
ATOM   2813 N N   . HIS B 2 169 ? 120.797 120.702 4.822   1.00 37.94 ? 169 HIS B N   1 
ATOM   2814 C CA  . HIS B 2 169 ? 122.140 121.068 5.286   1.00 38.84 ? 169 HIS B CA  1 
ATOM   2815 C C   . HIS B 2 169 ? 122.971 119.803 5.246   1.00 37.42 ? 169 HIS B C   1 
ATOM   2816 O O   . HIS B 2 169 ? 122.568 118.783 5.796   1.00 38.76 ? 169 HIS B O   1 
ATOM   2817 C CB  . HIS B 2 169 ? 122.209 121.507 6.762   1.00 39.46 ? 169 HIS B CB  1 
ATOM   2818 C CG  . HIS B 2 169 ? 121.206 122.533 7.159   1.00 39.75 ? 169 HIS B CG  1 
ATOM   2819 N ND1 . HIS B 2 169 ? 121.003 123.694 6.445   1.00 42.41 ? 169 HIS B ND1 1 
ATOM   2820 C CD2 . HIS B 2 169 ? 120.365 122.585 8.217   1.00 40.25 ? 169 HIS B CD2 1 
ATOM   2821 C CE1 . HIS B 2 169 ? 120.074 124.417 7.045   1.00 45.15 ? 169 HIS B CE1 1 
ATOM   2822 N NE2 . HIS B 2 169 ? 119.670 123.766 8.123   1.00 44.13 ? 169 HIS B NE2 1 
ATOM   2823 N N   . THR B 2 170 ? 124.122 119.852 4.605   1.00 35.37 ? 170 THR B N   1 
ATOM   2824 C CA  . THR B 2 170 ? 124.996 118.698 4.626   1.00 34.64 ? 170 THR B CA  1 
ATOM   2825 C C   . THR B 2 170 ? 126.251 119.242 5.302   1.00 35.09 ? 170 THR B C   1 
ATOM   2826 O O   . THR B 2 170 ? 126.952 120.095 4.755   1.00 35.43 ? 170 THR B O   1 
ATOM   2827 C CB  . THR B 2 170 ? 125.287 118.181 3.225   1.00 32.58 ? 170 THR B CB  1 
ATOM   2828 O OG1 . THR B 2 170 ? 124.069 117.710 2.646   1.00 32.02 ? 170 THR B OG1 1 
ATOM   2829 C CG2 . THR B 2 170 ? 126.271 117.034 3.275   1.00 31.46 ? 170 THR B CG2 1 
ATOM   2830 N N   . PHE B 2 171 ? 126.488 118.778 6.524   1.00 33.29 ? 171 PHE B N   1 
ATOM   2831 C CA  . PHE B 2 171 ? 127.626 119.221 7.318   1.00 32.56 ? 171 PHE B CA  1 
ATOM   2832 C C   . PHE B 2 171 ? 128.960 118.757 6.755   1.00 32.62 ? 171 PHE B C   1 
ATOM   2833 O O   . PHE B 2 171 ? 129.047 117.705 6.128   1.00 33.98 ? 171 PHE B O   1 
ATOM   2834 C CB  . PHE B 2 171 ? 127.467 118.727 8.761   1.00 30.18 ? 171 PHE B CB  1 
ATOM   2835 C CG  . PHE B 2 171 ? 126.214 119.222 9.428   1.00 30.75 ? 171 PHE B CG  1 
ATOM   2836 C CD1 . PHE B 2 171 ? 126.197 120.447 10.088  1.00 28.53 ? 171 PHE B CD1 1 
ATOM   2837 C CD2 . PHE B 2 171 ? 125.027 118.487 9.348   1.00 30.23 ? 171 PHE B CD2 1 
ATOM   2838 C CE1 . PHE B 2 171 ? 125.021 120.941 10.657  1.00 28.33 ? 171 PHE B CE1 1 
ATOM   2839 C CE2 . PHE B 2 171 ? 123.848 118.974 9.913   1.00 29.67 ? 171 PHE B CE2 1 
ATOM   2840 C CZ  . PHE B 2 171 ? 123.845 120.202 10.568  1.00 29.13 ? 171 PHE B CZ  1 
ATOM   2841 N N   . PRO B 2 172 ? 130.016 119.561 6.950   1.00 33.15 ? 172 PRO B N   1 
ATOM   2842 C CA  . PRO B 2 172 ? 131.356 119.220 6.466   1.00 32.97 ? 172 PRO B CA  1 
ATOM   2843 C C   . PRO B 2 172 ? 131.801 117.929 7.141   1.00 33.87 ? 172 PRO B C   1 
ATOM   2844 O O   . PRO B 2 172 ? 131.516 117.712 8.317   1.00 33.59 ? 172 PRO B O   1 
ATOM   2845 C CB  . PRO B 2 172 ? 132.194 120.414 6.915   1.00 32.90 ? 172 PRO B CB  1 
ATOM   2846 C CG  . PRO B 2 172 ? 131.213 121.543 6.839   1.00 34.49 ? 172 PRO B CG  1 
ATOM   2847 C CD  . PRO B 2 172 ? 129.983 120.939 7.469   1.00 32.16 ? 172 PRO B CD  1 
ATOM   2848 N N   . ALA B 2 173 ? 132.502 117.078 6.403   1.00 33.95 ? 173 ALA B N   1 
ATOM   2849 C CA  . ALA B 2 173 ? 132.968 115.815 6.957   1.00 37.83 ? 173 ALA B CA  1 
ATOM   2850 C C   . ALA B 2 173 ? 133.989 116.010 8.071   1.00 39.93 ? 173 ALA B C   1 
ATOM   2851 O O   . ALA B 2 173 ? 134.596 117.070 8.199   1.00 42.90 ? 173 ALA B O   1 
ATOM   2852 C CB  . ALA B 2 173 ? 133.566 114.949 5.850   1.00 35.01 ? 173 ALA B CB  1 
ATOM   2853 N N   . VAL B 2 174 ? 134.164 114.975 8.880   1.00 42.89 ? 174 VAL B N   1 
ATOM   2854 C CA  . VAL B 2 174 ? 135.121 114.991 9.976   1.00 45.86 ? 174 VAL B CA  1 
ATOM   2855 C C   . VAL B 2 174 ? 136.028 113.784 9.800   1.00 47.63 ? 174 VAL B C   1 
ATOM   2856 O O   . VAL B 2 174 ? 135.553 112.668 9.589   1.00 48.19 ? 174 VAL B O   1 
ATOM   2857 C CB  . VAL B 2 174 ? 134.417 114.913 11.340  1.00 47.32 ? 174 VAL B CB  1 
ATOM   2858 C CG1 . VAL B 2 174 ? 135.434 114.657 12.429  1.00 48.90 ? 174 VAL B CG1 1 
ATOM   2859 C CG2 . VAL B 2 174 ? 133.683 116.220 11.618  1.00 47.87 ? 174 VAL B CG2 1 
ATOM   2860 N N   . LEU B 2 175 ? 137.334 114.011 9.878   1.00 50.41 ? 175 LEU B N   1 
ATOM   2861 C CA  . LEU B 2 175 ? 138.302 112.941 9.697   1.00 53.22 ? 175 LEU B CA  1 
ATOM   2862 C C   . LEU B 2 175 ? 138.799 112.342 11.002  1.00 54.49 ? 175 LEU B C   1 
ATOM   2863 O O   . LEU B 2 175 ? 139.237 113.058 11.899  1.00 53.43 ? 175 LEU B O   1 
ATOM   2864 C CB  . LEU B 2 175 ? 139.500 113.452 8.893   1.00 54.76 ? 175 LEU B CB  1 
ATOM   2865 C CG  . LEU B 2 175 ? 140.625 112.444 8.649   1.00 55.65 ? 175 LEU B CG  1 
ATOM   2866 C CD1 . LEU B 2 175 ? 140.106 111.309 7.789   1.00 56.28 ? 175 LEU B CD1 1 
ATOM   2867 C CD2 . LEU B 2 175 ? 141.802 113.127 7.970   1.00 56.63 ? 175 LEU B CD2 1 
ATOM   2868 N N   . GLN B 2 176 ? 138.737 111.018 11.089  1.00 57.16 ? 176 GLN B N   1 
ATOM   2869 C CA  . GLN B 2 176 ? 139.194 110.298 12.271  1.00 59.76 ? 176 GLN B CA  1 
ATOM   2870 C C   . GLN B 2 176 ? 139.646 108.877 11.920  1.00 59.86 ? 176 GLN B C   1 
ATOM   2871 O O   . GLN B 2 176 ? 138.838 108.036 11.522  1.00 60.57 ? 176 GLN B O   1 
ATOM   2872 C CB  . GLN B 2 176 ? 138.083 110.255 13.327  1.00 61.41 ? 176 GLN B CB  1 
ATOM   2873 C CG  . GLN B 2 176 ? 138.450 109.472 14.584  1.00 65.20 ? 176 GLN B CG  1 
ATOM   2874 C CD  . GLN B 2 176 ? 137.487 109.719 15.733  1.00 66.84 ? 176 GLN B CD  1 
ATOM   2875 O OE1 . GLN B 2 176 ? 137.601 110.712 16.456  1.00 67.19 ? 176 GLN B OE1 1 
ATOM   2876 N NE2 . GLN B 2 176 ? 136.522 108.822 15.897  1.00 66.41 ? 176 GLN B NE2 1 
ATOM   2877 N N   . SER B 2 177 ? 140.947 108.628 12.061  1.00 59.38 ? 177 SER B N   1 
ATOM   2878 C CA  . SER B 2 177 ? 141.537 107.323 11.776  1.00 58.75 ? 177 SER B CA  1 
ATOM   2879 C C   . SER B 2 177 ? 141.339 106.867 10.329  1.00 58.11 ? 177 SER B C   1 
ATOM   2880 O O   . SER B 2 177 ? 140.804 105.785 10.077  1.00 59.04 ? 177 SER B O   1 
ATOM   2881 C CB  . SER B 2 177 ? 140.973 106.275 12.737  1.00 59.09 ? 177 SER B CB  1 
ATOM   2882 N N   . ASP B 2 178 ? 141.777 107.699 9.387   1.00 56.06 ? 178 ASP B N   1 
ATOM   2883 C CA  . ASP B 2 178 ? 141.684 107.404 7.958   1.00 53.46 ? 178 ASP B CA  1 
ATOM   2884 C C   . ASP B 2 178 ? 140.269 107.181 7.413   1.00 51.20 ? 178 ASP B C   1 
ATOM   2885 O O   . ASP B 2 178 ? 140.095 106.508 6.398   1.00 50.29 ? 178 ASP B O   1 
ATOM   2886 C CB  . ASP B 2 178 ? 142.569 106.199 7.621   1.00 54.75 ? 178 ASP B CB  1 
ATOM   2887 N N   . LEU B 2 179 ? 139.264 107.747 8.078   1.00 49.47 ? 179 LEU B N   1 
ATOM   2888 C CA  . LEU B 2 179 ? 137.876 107.610 7.629   1.00 47.52 ? 179 LEU B CA  1 
ATOM   2889 C C   . LEU B 2 179 ? 137.053 108.871 7.898   1.00 45.73 ? 179 LEU B C   1 
ATOM   2890 O O   . LEU B 2 179 ? 137.137 109.468 8.974   1.00 44.89 ? 179 LEU B O   1 
ATOM   2891 C CB  . LEU B 2 179 ? 137.199 106.416 8.310   1.00 47.61 ? 179 LEU B CB  1 
ATOM   2892 C CG  . LEU B 2 179 ? 137.632 104.992 7.934   1.00 49.40 ? 179 LEU B CG  1 
ATOM   2893 C CD1 . LEU B 2 179 ? 136.809 103.991 8.746   1.00 48.08 ? 179 LEU B CD1 1 
ATOM   2894 C CD2 . LEU B 2 179 ? 137.428 104.751 6.447   1.00 48.06 ? 179 LEU B CD2 1 
ATOM   2895 N N   . TYR B 2 180 ? 136.248 109.264 6.916   1.00 43.17 ? 180 TYR B N   1 
ATOM   2896 C CA  . TYR B 2 180 ? 135.412 110.452 7.047   1.00 40.93 ? 180 TYR B CA  1 
ATOM   2897 C C   . TYR B 2 180 ? 133.984 110.122 7.456   1.00 40.36 ? 180 TYR B C   1 
ATOM   2898 O O   . TYR B 2 180 ? 133.492 109.021 7.218   1.00 40.01 ? 180 TYR B O   1 
ATOM   2899 C CB  . TYR B 2 180 ? 135.376 111.236 5.729   1.00 39.95 ? 180 TYR B CB  1 
ATOM   2900 C CG  . TYR B 2 180 ? 136.687 111.896 5.352   1.00 39.50 ? 180 TYR B CG  1 
ATOM   2901 C CD1 . TYR B 2 180 ? 137.480 111.384 4.327   1.00 37.99 ? 180 TYR B CD1 1 
ATOM   2902 C CD2 . TYR B 2 180 ? 137.128 113.040 6.014   1.00 38.49 ? 180 TYR B CD2 1 
ATOM   2903 C CE1 . TYR B 2 180 ? 138.677 111.997 3.968   1.00 36.73 ? 180 TYR B CE1 1 
ATOM   2904 C CE2 . TYR B 2 180 ? 138.327 113.661 5.661   1.00 38.31 ? 180 TYR B CE2 1 
ATOM   2905 C CZ  . TYR B 2 180 ? 139.094 113.136 4.637   1.00 38.77 ? 180 TYR B CZ  1 
ATOM   2906 O OH  . TYR B 2 180 ? 140.273 113.757 4.269   1.00 39.74 ? 180 TYR B OH  1 
ATOM   2907 N N   . THR B 2 181 ? 133.319 111.096 8.066   1.00 39.26 ? 181 THR B N   1 
ATOM   2908 C CA  . THR B 2 181 ? 131.940 110.925 8.492   1.00 37.59 ? 181 THR B CA  1 
ATOM   2909 C C   . THR B 2 181 ? 131.202 112.256 8.505   1.00 36.60 ? 181 THR B C   1 
ATOM   2910 O O   . THR B 2 181 ? 131.720 113.263 8.996   1.00 36.81 ? 181 THR B O   1 
ATOM   2911 C CB  . THR B 2 181 ? 131.866 110.313 9.912   1.00 37.87 ? 181 THR B CB  1 
ATOM   2912 O OG1 . THR B 2 181 ? 132.474 109.015 9.906   1.00 39.61 ? 181 THR B OG1 1 
ATOM   2913 C CG2 . THR B 2 181 ? 130.423 110.199 10.373  1.00 35.71 ? 181 THR B CG2 1 
ATOM   2914 N N   . LEU B 2 182 ? 129.992 112.262 7.958   1.00 36.37 ? 182 LEU B N   1 
ATOM   2915 C CA  . LEU B 2 182 ? 129.176 113.470 7.957   1.00 35.20 ? 182 LEU B CA  1 
ATOM   2916 C C   . LEU B 2 182 ? 127.700 113.103 8.015   1.00 35.21 ? 182 LEU B C   1 
ATOM   2917 O O   . LEU B 2 182 ? 127.324 111.947 7.828   1.00 35.11 ? 182 LEU B O   1 
ATOM   2918 C CB  . LEU B 2 182 ? 129.453 114.312 6.705   1.00 35.65 ? 182 LEU B CB  1 
ATOM   2919 C CG  . LEU B 2 182 ? 129.069 113.758 5.326   1.00 34.05 ? 182 LEU B CG  1 
ATOM   2920 C CD1 . LEU B 2 182 ? 127.562 113.741 5.164   1.00 32.14 ? 182 LEU B CD1 1 
ATOM   2921 C CD2 . LEU B 2 182 ? 129.682 114.639 4.246   1.00 34.49 ? 182 LEU B CD2 1 
ATOM   2922 N N   . SER B 2 183 ? 126.871 114.100 8.284   1.00 34.40 ? 183 SER B N   1 
ATOM   2923 C CA  . SER B 2 183 ? 125.438 113.907 8.332   1.00 34.73 ? 183 SER B CA  1 
ATOM   2924 C C   . SER B 2 183 ? 124.812 114.984 7.474   1.00 34.05 ? 183 SER B C   1 
ATOM   2925 O O   . SER B 2 183 ? 125.366 116.077 7.334   1.00 33.72 ? 183 SER B O   1 
ATOM   2926 C CB  . SER B 2 183 ? 124.901 114.039 9.762   1.00 35.96 ? 183 SER B CB  1 
ATOM   2927 O OG  . SER B 2 183 ? 125.158 112.879 10.534  1.00 38.77 ? 183 SER B OG  1 
ATOM   2928 N N   . SER B 2 184 ? 123.664 114.665 6.891   1.00 32.96 ? 184 SER B N   1 
ATOM   2929 C CA  . SER B 2 184 ? 122.941 115.619 6.076   1.00 32.85 ? 184 SER B CA  1 
ATOM   2930 C C   . SER B 2 184 ? 121.570 115.762 6.724   1.00 32.99 ? 184 SER B C   1 
ATOM   2931 O O   . SER B 2 184 ? 121.002 114.790 7.222   1.00 33.03 ? 184 SER B O   1 
ATOM   2932 C CB  . SER B 2 184 ? 122.818 115.125 4.639   1.00 31.80 ? 184 SER B CB  1 
ATOM   2933 O OG  . SER B 2 184 ? 122.143 116.089 3.852   1.00 34.56 ? 184 SER B OG  1 
ATOM   2934 N N   . SER B 2 185 ? 121.056 116.983 6.728   1.00 33.29 ? 185 SER B N   1 
ATOM   2935 C CA  . SER B 2 185 ? 119.778 117.295 7.344   1.00 34.60 ? 185 SER B CA  1 
ATOM   2936 C C   . SER B 2 185 ? 118.745 117.822 6.353   1.00 35.48 ? 185 SER B C   1 
ATOM   2937 O O   . SER B 2 185 ? 119.062 118.621 5.470   1.00 34.55 ? 185 SER B O   1 
ATOM   2938 C CB  . SER B 2 185 ? 120.016 118.329 8.458   1.00 36.59 ? 185 SER B CB  1 
ATOM   2939 O OG  . SER B 2 185 ? 118.841 119.036 8.807   1.00 39.16 ? 185 SER B OG  1 
ATOM   2940 N N   . VAL B 2 186 ? 117.507 117.364 6.498   1.00 34.74 ? 186 VAL B N   1 
ATOM   2941 C CA  . VAL B 2 186 ? 116.430 117.823 5.637   1.00 35.03 ? 186 VAL B CA  1 
ATOM   2942 C C   . VAL B 2 186 ? 115.218 118.106 6.506   1.00 36.48 ? 186 VAL B C   1 
ATOM   2943 O O   . VAL B 2 186 ? 114.924 117.360 7.441   1.00 35.90 ? 186 VAL B O   1 
ATOM   2944 C CB  . VAL B 2 186 ? 116.067 116.778 4.540   1.00 36.04 ? 186 VAL B CB  1 
ATOM   2945 C CG1 . VAL B 2 186 ? 115.589 115.474 5.170   1.00 35.46 ? 186 VAL B CG1 1 
ATOM   2946 C CG2 . VAL B 2 186 ? 114.994 117.351 3.626   1.00 34.92 ? 186 VAL B CG2 1 
ATOM   2947 N N   . THR B 2 187 ? 114.528 119.200 6.205   1.00 38.29 ? 187 THR B N   1 
ATOM   2948 C CA  . THR B 2 187 ? 113.349 119.600 6.960   1.00 40.89 ? 187 THR B CA  1 
ATOM   2949 C C   . THR B 2 187 ? 112.160 119.809 6.024   1.00 41.86 ? 187 THR B C   1 
ATOM   2950 O O   . THR B 2 187 ? 112.240 120.589 5.075   1.00 42.19 ? 187 THR B O   1 
ATOM   2951 C CB  . THR B 2 187 ? 113.612 120.912 7.735   1.00 41.93 ? 187 THR B CB  1 
ATOM   2952 O OG1 . THR B 2 187 ? 114.617 120.686 8.733   1.00 42.94 ? 187 THR B OG1 1 
ATOM   2953 C CG2 . THR B 2 187 ? 112.339 121.405 8.411   1.00 43.19 ? 187 THR B CG2 1 
ATOM   2954 N N   . VAL B 2 188 ? 111.061 119.107 6.296   1.00 42.95 ? 188 VAL B N   1 
ATOM   2955 C CA  . VAL B 2 188 ? 109.847 119.219 5.486   1.00 42.38 ? 188 VAL B CA  1 
ATOM   2956 C C   . VAL B 2 188 ? 108.632 119.404 6.391   1.00 42.68 ? 188 VAL B C   1 
ATOM   2957 O O   . VAL B 2 188 ? 108.713 119.190 7.602   1.00 41.82 ? 188 VAL B O   1 
ATOM   2958 C CB  . VAL B 2 188 ? 109.626 117.954 4.611   1.00 42.02 ? 188 VAL B CB  1 
ATOM   2959 C CG1 . VAL B 2 188 ? 110.819 117.750 3.690   1.00 41.66 ? 188 VAL B CG1 1 
ATOM   2960 C CG2 . VAL B 2 188 ? 109.417 116.729 5.495   1.00 41.85 ? 188 VAL B CG2 1 
ATOM   2961 N N   . PRO B 2 189 ? 107.493 119.832 5.818   1.00 43.12 ? 189 PRO B N   1 
ATOM   2962 C CA  . PRO B 2 189 ? 106.300 120.018 6.648   1.00 43.79 ? 189 PRO B CA  1 
ATOM   2963 C C   . PRO B 2 189 ? 105.972 118.691 7.314   1.00 43.42 ? 189 PRO B C   1 
ATOM   2964 O O   . PRO B 2 189 ? 105.947 117.654 6.652   1.00 42.67 ? 189 PRO B O   1 
ATOM   2965 C CB  . PRO B 2 189 ? 105.245 120.451 5.635   1.00 43.67 ? 189 PRO B CB  1 
ATOM   2966 C CG  . PRO B 2 189 ? 106.067 121.232 4.634   1.00 44.33 ? 189 PRO B CG  1 
ATOM   2967 C CD  . PRO B 2 189 ? 107.258 120.313 4.445   1.00 43.20 ? 189 PRO B CD  1 
ATOM   2968 N N   . SER B 2 190 ? 105.751 118.725 8.624   1.00 43.64 ? 190 SER B N   1 
ATOM   2969 C CA  . SER B 2 190 ? 105.451 117.513 9.382   1.00 45.92 ? 190 SER B CA  1 
ATOM   2970 C C   . SER B 2 190 ? 104.292 116.725 8.784   1.00 45.89 ? 190 SER B C   1 
ATOM   2971 O O   . SER B 2 190 ? 104.256 115.501 8.870   1.00 46.31 ? 190 SER B O   1 
ATOM   2972 C CB  . SER B 2 190 ? 105.140 117.868 10.839  1.00 45.23 ? 190 SER B CB  1 
ATOM   2973 O OG  . SER B 2 190 ? 104.120 118.847 10.912  1.00 47.35 ? 190 SER B OG  1 
ATOM   2974 N N   . SER B 2 191 ? 103.357 117.431 8.161   1.00 47.19 ? 191 SER B N   1 
ATOM   2975 C CA  . SER B 2 191 ? 102.199 116.786 7.555   1.00 48.13 ? 191 SER B CA  1 
ATOM   2976 C C   . SER B 2 191 ? 102.549 115.956 6.317   1.00 47.04 ? 191 SER B C   1 
ATOM   2977 O O   . SER B 2 191 ? 101.818 115.035 5.963   1.00 47.72 ? 191 SER B O   1 
ATOM   2978 C CB  . SER B 2 191 ? 101.152 117.842 7.176   1.00 48.88 ? 191 SER B CB  1 
ATOM   2979 O OG  . SER B 2 191 ? 101.619 118.671 6.123   1.00 51.61 ? 191 SER B OG  1 
ATOM   2980 N N   . SER B 2 192 ? 103.671 116.268 5.674   1.00 45.55 ? 192 SER B N   1 
ATOM   2981 C CA  . SER B 2 192 ? 104.074 115.560 4.459   1.00 44.01 ? 192 SER B CA  1 
ATOM   2982 C C   . SER B 2 192 ? 104.809 114.236 4.669   1.00 43.52 ? 192 SER B C   1 
ATOM   2983 O O   . SER B 2 192 ? 104.946 113.452 3.734   1.00 43.42 ? 192 SER B O   1 
ATOM   2984 C CB  . SER B 2 192 ? 104.943 116.475 3.586   1.00 45.67 ? 192 SER B CB  1 
ATOM   2985 O OG  . SER B 2 192 ? 106.234 116.653 4.149   1.00 42.47 ? 192 SER B OG  1 
ATOM   2986 N N   . TRP B 2 193 ? 105.291 113.985 5.881   1.00 42.08 ? 193 TRP B N   1 
ATOM   2987 C CA  . TRP B 2 193 ? 106.011 112.740 6.160   1.00 41.31 ? 193 TRP B CA  1 
ATOM   2988 C C   . TRP B 2 193 ? 105.278 111.977 7.260   1.00 42.36 ? 193 TRP B C   1 
ATOM   2989 O O   . TRP B 2 193 ? 104.773 112.579 8.204   1.00 43.15 ? 193 TRP B O   1 
ATOM   2990 C CB  . TRP B 2 193 ? 107.443 113.056 6.607   1.00 37.35 ? 193 TRP B CB  1 
ATOM   2991 C CG  . TRP B 2 193 ? 108.316 111.857 6.872   1.00 31.73 ? 193 TRP B CG  1 
ATOM   2992 C CD1 . TRP B 2 193 ? 108.945 111.076 5.943   1.00 32.56 ? 193 TRP B CD1 1 
ATOM   2993 C CD2 . TRP B 2 193 ? 108.683 111.330 8.152   1.00 28.77 ? 193 TRP B CD2 1 
ATOM   2994 N NE1 . TRP B 2 193 ? 109.687 110.099 6.567   1.00 29.92 ? 193 TRP B NE1 1 
ATOM   2995 C CE2 . TRP B 2 193 ? 109.541 110.233 7.923   1.00 29.50 ? 193 TRP B CE2 1 
ATOM   2996 C CE3 . TRP B 2 193 ? 108.367 111.679 9.474   1.00 31.65 ? 193 TRP B CE3 1 
ATOM   2997 C CZ2 . TRP B 2 193 ? 110.093 109.479 8.968   1.00 30.73 ? 193 TRP B CZ2 1 
ATOM   2998 C CZ3 . TRP B 2 193 ? 108.915 110.928 10.518  1.00 29.43 ? 193 TRP B CZ3 1 
ATOM   2999 C CH2 . TRP B 2 193 ? 109.769 109.841 10.255  1.00 31.67 ? 193 TRP B CH2 1 
ATOM   3000 N N   . PRO B 2 194 ? 105.223 110.639 7.162   1.00 44.50 ? 194 PRO B N   1 
ATOM   3001 C CA  . PRO B 2 194 ? 105.800 109.811 6.097   1.00 45.67 ? 194 PRO B CA  1 
ATOM   3002 C C   . PRO B 2 194 ? 104.906 109.573 4.873   1.00 46.85 ? 194 PRO B C   1 
ATOM   3003 O O   . PRO B 2 194 ? 105.222 108.734 4.029   1.00 46.42 ? 194 PRO B O   1 
ATOM   3004 C CB  . PRO B 2 194 ? 106.135 108.517 6.827   1.00 45.71 ? 194 PRO B CB  1 
ATOM   3005 C CG  . PRO B 2 194 ? 104.975 108.385 7.759   1.00 45.87 ? 194 PRO B CG  1 
ATOM   3006 C CD  . PRO B 2 194 ? 104.773 109.799 8.289   1.00 45.08 ? 194 PRO B CD  1 
ATOM   3007 N N   . SER B 2 195 ? 103.801 110.307 4.768   1.00 48.92 ? 195 SER B N   1 
ATOM   3008 C CA  . SER B 2 195 ? 102.893 110.146 3.631   1.00 51.02 ? 195 SER B CA  1 
ATOM   3009 C C   . SER B 2 195 ? 103.648 110.264 2.316   1.00 51.65 ? 195 SER B C   1 
ATOM   3010 O O   . SER B 2 195 ? 103.524 109.415 1.431   1.00 51.82 ? 195 SER B O   1 
ATOM   3011 C CB  . SER B 2 195 ? 101.787 111.198 3.673   1.00 51.68 ? 195 SER B CB  1 
ATOM   3012 O OG  . SER B 2 195 ? 100.967 111.013 4.812   1.00 55.55 ? 195 SER B OG  1 
ATOM   3013 N N   . GLU B 2 196 ? 104.422 111.333 2.195   1.00 51.71 ? 196 GLU B N   1 
ATOM   3014 C CA  . GLU B 2 196 ? 105.220 111.570 1.004   1.00 52.15 ? 196 GLU B CA  1 
ATOM   3015 C C   . GLU B 2 196 ? 106.632 111.123 1.361   1.00 50.67 ? 196 GLU B C   1 
ATOM   3016 O O   . GLU B 2 196 ? 107.210 111.580 2.344   1.00 51.33 ? 196 GLU B O   1 
ATOM   3017 C CB  . GLU B 2 196 ? 105.159 113.052 0.638   1.00 54.64 ? 196 GLU B CB  1 
ATOM   3018 C CG  . GLU B 2 196 ? 103.717 113.556 0.562   1.00 59.74 ? 196 GLU B CG  1 
ATOM   3019 C CD  . GLU B 2 196 ? 103.598 115.010 0.141   1.00 62.56 ? 196 GLU B CD  1 
ATOM   3020 O OE1 . GLU B 2 196 ? 104.169 115.890 0.823   1.00 65.42 ? 196 GLU B OE1 1 
ATOM   3021 O OE2 . GLU B 2 196 ? 102.920 115.274 -0.874  1.00 64.66 ? 196 GLU B OE2 1 
ATOM   3022 N N   . THR B 2 197 ? 107.169 110.206 0.567   1.00 48.98 ? 197 THR B N   1 
ATOM   3023 C CA  . THR B 2 197 ? 108.489 109.638 0.809   1.00 48.26 ? 197 THR B CA  1 
ATOM   3024 C C   . THR B 2 197 ? 109.672 110.617 0.840   1.00 46.59 ? 197 THR B C   1 
ATOM   3025 O O   . THR B 2 197 ? 109.683 111.641 0.155   1.00 44.65 ? 197 THR B O   1 
ATOM   3026 C CB  . THR B 2 197 ? 108.788 108.527 -0.226  1.00 48.42 ? 197 THR B CB  1 
ATOM   3027 O OG1 . THR B 2 197 ? 109.970 107.817 0.160   1.00 51.01 ? 197 THR B OG1 1 
ATOM   3028 C CG2 . THR B 2 197 ? 108.996 109.124 -1.609  1.00 50.99 ? 197 THR B CG2 1 
ATOM   3029 N N   . VAL B 2 198 ? 110.661 110.279 1.660   1.00 45.12 ? 198 VAL B N   1 
ATOM   3030 C CA  . VAL B 2 198 ? 111.878 111.064 1.813   1.00 44.29 ? 198 VAL B CA  1 
ATOM   3031 C C   . VAL B 2 198 ? 113.046 110.084 1.796   1.00 44.02 ? 198 VAL B C   1 
ATOM   3032 O O   . VAL B 2 198 ? 113.153 109.215 2.663   1.00 44.61 ? 198 VAL B O   1 
ATOM   3033 C CB  . VAL B 2 198 ? 111.889 111.845 3.151   1.00 44.40 ? 198 VAL B CB  1 
ATOM   3034 C CG1 . VAL B 2 198 ? 113.262 112.464 3.380   1.00 42.14 ? 198 VAL B CG1 1 
ATOM   3035 C CG2 . VAL B 2 198 ? 110.816 112.937 3.131   1.00 41.91 ? 198 VAL B CG2 1 
ATOM   3036 N N   . THR B 2 199 ? 113.917 110.219 0.804   1.00 42.57 ? 199 THR B N   1 
ATOM   3037 C CA  . THR B 2 199 ? 115.066 109.327 0.680   1.00 43.57 ? 199 THR B CA  1 
ATOM   3038 C C   . THR B 2 199 ? 116.349 110.129 0.427   1.00 43.60 ? 199 THR B C   1 
ATOM   3039 O O   . THR B 2 199 ? 116.334 111.139 -0.279  1.00 42.68 ? 199 THR B O   1 
ATOM   3040 C CB  . THR B 2 199 ? 114.860 108.327 -0.496  1.00 43.94 ? 199 THR B CB  1 
ATOM   3041 O OG1 . THR B 2 199 ? 113.582 107.689 -0.366  1.00 44.49 ? 199 THR B OG1 1 
ATOM   3042 C CG2 . THR B 2 199 ? 115.944 107.262 -0.498  1.00 43.88 ? 199 THR B CG2 1 
ATOM   3043 N N   . CYS B 2 200 ? 117.457 109.694 1.014   1.00 43.85 ? 200 CYS B N   1 
ATOM   3044 C CA  . CYS B 2 200 ? 118.714 110.390 0.789   1.00 45.43 ? 200 CYS B CA  1 
ATOM   3045 C C   . CYS B 2 200 ? 119.542 109.558 -0.185  1.00 44.90 ? 200 CYS B C   1 
ATOM   3046 O O   . CYS B 2 200 ? 119.608 108.334 -0.074  1.00 45.12 ? 200 CYS B O   1 
ATOM   3047 C CB  . CYS B 2 200 ? 119.482 110.599 2.101   1.00 46.38 ? 200 CYS B CB  1 
ATOM   3048 S SG  . CYS B 2 200 ? 120.297 109.140 2.774   1.00 51.36 ? 200 CYS B SG  1 
ATOM   3049 N N   . ASN B 2 201 ? 120.150 110.236 -1.153  1.00 43.91 ? 201 ASN B N   1 
ATOM   3050 C CA  . ASN B 2 201 ? 120.969 109.580 -2.158  1.00 42.36 ? 201 ASN B CA  1 
ATOM   3051 C C   . ASN B 2 201 ? 122.413 109.979 -1.896  1.00 41.33 ? 201 ASN B C   1 
ATOM   3052 O O   . ASN B 2 201 ? 122.746 111.163 -1.901  1.00 41.00 ? 201 ASN B O   1 
ATOM   3053 C CB  . ASN B 2 201 ? 120.532 110.038 -3.546  1.00 41.78 ? 201 ASN B CB  1 
ATOM   3054 C CG  . ASN B 2 201 ? 119.033 110.233 -3.640  1.00 42.15 ? 201 ASN B CG  1 
ATOM   3055 O OD1 . ASN B 2 201 ? 118.548 111.352 -3.820  1.00 41.97 ? 201 ASN B OD1 1 
ATOM   3056 N ND2 . ASN B 2 201 ? 118.287 109.143 -3.506  1.00 43.76 ? 201 ASN B ND2 1 
ATOM   3057 N N   . VAL B 2 202 ? 123.264 108.988 -1.663  1.00 41.67 ? 202 VAL B N   1 
ATOM   3058 C CA  . VAL B 2 202 ? 124.664 109.245 -1.374  1.00 41.96 ? 202 VAL B CA  1 
ATOM   3059 C C   . VAL B 2 202 ? 125.596 108.668 -2.425  1.00 43.19 ? 202 VAL B C   1 
ATOM   3060 O O   . VAL B 2 202 ? 125.679 107.452 -2.610  1.00 44.86 ? 202 VAL B O   1 
ATOM   3061 C CB  . VAL B 2 202 ? 125.064 108.669 0.006   1.00 42.06 ? 202 VAL B CB  1 
ATOM   3062 C CG1 . VAL B 2 202 ? 126.541 108.918 0.265   1.00 42.46 ? 202 VAL B CG1 1 
ATOM   3063 C CG2 . VAL B 2 202 ? 124.221 109.304 1.102   1.00 40.91 ? 202 VAL B CG2 1 
ATOM   3064 N N   . ALA B 2 203 ? 126.305 109.553 -3.111  1.00 42.15 ? 203 ALA B N   1 
ATOM   3065 C CA  . ALA B 2 203 ? 127.247 109.135 -4.132  1.00 41.91 ? 203 ALA B CA  1 
ATOM   3066 C C   . ALA B 2 203 ? 128.662 109.299 -3.594  1.00 41.06 ? 203 ALA B C   1 
ATOM   3067 O O   . ALA B 2 203 ? 128.987 110.313 -2.980  1.00 39.95 ? 203 ALA B O   1 
ATOM   3068 C CB  . ALA B 2 203 ? 127.064 109.978 -5.388  1.00 41.96 ? 203 ALA B CB  1 
ATOM   3069 N N   . HIS B 2 204 ? 129.489 108.282 -3.803  1.00 40.64 ? 204 HIS B N   1 
ATOM   3070 C CA  . HIS B 2 204 ? 130.876 108.320 -3.374  1.00 40.83 ? 204 HIS B CA  1 
ATOM   3071 C C   . HIS B 2 204 ? 131.707 107.990 -4.606  1.00 41.35 ? 204 HIS B C   1 
ATOM   3072 O O   . HIS B 2 204 ? 132.139 106.853 -4.793  1.00 39.00 ? 204 HIS B O   1 
ATOM   3073 C CB  . HIS B 2 204 ? 131.145 107.294 -2.274  1.00 40.21 ? 204 HIS B CB  1 
ATOM   3074 C CG  . HIS B 2 204 ? 132.541 107.346 -1.740  1.00 41.45 ? 204 HIS B CG  1 
ATOM   3075 N ND1 . HIS B 2 204 ? 133.375 106.249 -1.723  1.00 42.57 ? 204 HIS B ND1 1 
ATOM   3076 C CD2 . HIS B 2 204 ? 133.255 108.369 -1.211  1.00 41.37 ? 204 HIS B CD2 1 
ATOM   3077 C CE1 . HIS B 2 204 ? 134.541 106.592 -1.206  1.00 42.24 ? 204 HIS B CE1 1 
ATOM   3078 N NE2 . HIS B 2 204 ? 134.494 107.873 -0.887  1.00 40.70 ? 204 HIS B NE2 1 
ATOM   3079 N N   . PRO B 2 205 ? 131.948 108.998 -5.462  1.00 42.91 ? 205 PRO B N   1 
ATOM   3080 C CA  . PRO B 2 205 ? 132.720 108.848 -6.698  1.00 42.39 ? 205 PRO B CA  1 
ATOM   3081 C C   . PRO B 2 205 ? 134.012 108.045 -6.607  1.00 41.90 ? 205 PRO B C   1 
ATOM   3082 O O   . PRO B 2 205 ? 134.339 107.304 -7.530  1.00 41.51 ? 205 PRO B O   1 
ATOM   3083 C CB  . PRO B 2 205 ? 132.945 110.294 -7.146  1.00 43.86 ? 205 PRO B CB  1 
ATOM   3084 C CG  . PRO B 2 205 ? 132.855 111.079 -5.866  1.00 43.77 ? 205 PRO B CG  1 
ATOM   3085 C CD  . PRO B 2 205 ? 131.690 110.421 -5.184  1.00 42.75 ? 205 PRO B CD  1 
ATOM   3086 N N   . ALA B 2 206 ? 134.734 108.173 -5.501  1.00 42.66 ? 206 ALA B N   1 
ATOM   3087 C CA  . ALA B 2 206 ? 135.995 107.452 -5.331  1.00 44.03 ? 206 ALA B CA  1 
ATOM   3088 C C   . ALA B 2 206 ? 135.861 105.927 -5.379  1.00 45.68 ? 206 ALA B C   1 
ATOM   3089 O O   . ALA B 2 206 ? 136.830 105.219 -5.676  1.00 45.70 ? 206 ALA B O   1 
ATOM   3090 C CB  . ALA B 2 206 ? 136.657 107.869 -4.027  1.00 43.07 ? 206 ALA B CB  1 
ATOM   3091 N N   . SER B 2 207 ? 134.670 105.419 -5.083  1.00 46.16 ? 207 SER B N   1 
ATOM   3092 C CA  . SER B 2 207 ? 134.446 103.977 -5.099  1.00 47.95 ? 207 SER B CA  1 
ATOM   3093 C C   . SER B 2 207 ? 133.325 103.596 -6.061  1.00 49.15 ? 207 SER B C   1 
ATOM   3094 O O   . SER B 2 207 ? 132.827 102.470 -6.037  1.00 50.02 ? 207 SER B O   1 
ATOM   3095 C CB  . SER B 2 207 ? 134.113 103.481 -3.690  1.00 47.23 ? 207 SER B CB  1 
ATOM   3096 O OG  . SER B 2 207 ? 132.917 104.073 -3.217  1.00 46.20 ? 207 SER B OG  1 
ATOM   3097 N N   . SER B 2 208 ? 132.932 104.545 -6.905  1.00 50.10 ? 208 SER B N   1 
ATOM   3098 C CA  . SER B 2 208 ? 131.874 104.322 -7.885  1.00 50.64 ? 208 SER B CA  1 
ATOM   3099 C C   . SER B 2 208 ? 130.598 103.762 -7.266  1.00 50.85 ? 208 SER B C   1 
ATOM   3100 O O   . SER B 2 208 ? 129.929 102.922 -7.869  1.00 50.15 ? 208 SER B O   1 
ATOM   3101 C CB  . SER B 2 208 ? 132.366 103.373 -8.980  1.00 51.31 ? 208 SER B CB  1 
ATOM   3102 O OG  . SER B 2 208 ? 133.492 103.916 -9.648  1.00 52.45 ? 208 SER B OG  1 
ATOM   3103 N N   . THR B 2 209 ? 130.259 104.228 -6.067  1.00 50.63 ? 209 THR B N   1 
ATOM   3104 C CA  . THR B 2 209 ? 129.052 103.758 -5.397  1.00 50.89 ? 209 THR B CA  1 
ATOM   3105 C C   . THR B 2 209 ? 128.067 104.886 -5.140  1.00 51.00 ? 209 THR B C   1 
ATOM   3106 O O   . THR B 2 209 ? 128.449 106.003 -4.793  1.00 50.55 ? 209 THR B O   1 
ATOM   3107 C CB  . THR B 2 209 ? 129.362 103.102 -4.040  1.00 50.67 ? 209 THR B CB  1 
ATOM   3108 O OG1 . THR B 2 209 ? 129.756 104.109 -3.100  1.00 51.35 ? 209 THR B OG1 1 
ATOM   3109 C CG2 . THR B 2 209 ? 130.481 102.084 -4.185  1.00 51.71 ? 209 THR B CG2 1 
ATOM   3110 N N   . LYS B 2 210 ? 126.792 104.577 -5.326  1.00 50.63 ? 210 LYS B N   1 
ATOM   3111 C CA  . LYS B 2 210 ? 125.720 105.527 -5.092  1.00 51.07 ? 210 LYS B CA  1 
ATOM   3112 C C   . LYS B 2 210 ? 124.609 104.701 -4.466  1.00 51.25 ? 210 LYS B C   1 
ATOM   3113 O O   . LYS B 2 210 ? 123.998 103.864 -5.129  1.00 50.65 ? 210 LYS B O   1 
ATOM   3114 C CB  . LYS B 2 210 ? 125.238 106.153 -6.405  1.00 51.29 ? 210 LYS B CB  1 
ATOM   3115 C CG  . LYS B 2 210 ? 124.192 107.255 -6.206  1.00 52.69 ? 210 LYS B CG  1 
ATOM   3116 C CD  . LYS B 2 210 ? 123.809 107.945 -7.514  1.00 51.74 ? 210 LYS B CD  1 
ATOM   3117 C CE  . LYS B 2 210 ? 122.842 109.092 -7.257  1.00 52.52 ? 210 LYS B CE  1 
ATOM   3118 N NZ  . LYS B 2 210 ? 122.398 109.741 -8.528  1.00 54.99 ? 210 LYS B NZ  1 
ATOM   3119 N N   . VAL B 2 211 ? 124.363 104.925 -3.182  1.00 50.81 ? 211 VAL B N   1 
ATOM   3120 C CA  . VAL B 2 211 ? 123.338 104.173 -2.484  1.00 50.65 ? 211 VAL B CA  1 
ATOM   3121 C C   . VAL B 2 211 ? 122.197 105.055 -2.005  1.00 50.86 ? 211 VAL B C   1 
ATOM   3122 O O   . VAL B 2 211 ? 122.373 106.254 -1.780  1.00 49.69 ? 211 VAL B O   1 
ATOM   3123 C CB  . VAL B 2 211 ? 123.947 103.422 -1.286  1.00 50.49 ? 211 VAL B CB  1 
ATOM   3124 C CG1 . VAL B 2 211 ? 125.121 102.573 -1.760  1.00 50.58 ? 211 VAL B CG1 1 
ATOM   3125 C CG2 . VAL B 2 211 ? 124.404 104.408 -0.226  1.00 50.10 ? 211 VAL B CG2 1 
ATOM   3126 N N   . ASP B 2 212 ? 121.018 104.455 -1.875  1.00 51.37 ? 212 ASP B N   1 
ATOM   3127 C CA  . ASP B 2 212 ? 119.845 105.174 -1.408  1.00 51.94 ? 212 ASP B CA  1 
ATOM   3128 C C   . ASP B 2 212 ? 119.486 104.695 -0.015  1.00 52.23 ? 212 ASP B C   1 
ATOM   3129 O O   . ASP B 2 212 ? 119.896 103.612 0.410   1.00 53.15 ? 212 ASP B O   1 
ATOM   3130 C CB  . ASP B 2 212 ? 118.646 104.935 -2.326  1.00 54.55 ? 212 ASP B CB  1 
ATOM   3131 C CG  . ASP B 2 212 ? 118.814 105.571 -3.689  1.00 56.84 ? 212 ASP B CG  1 
ATOM   3132 O OD1 . ASP B 2 212 ? 119.249 106.740 -3.755  1.00 58.87 ? 212 ASP B OD1 1 
ATOM   3133 O OD2 . ASP B 2 212 ? 118.492 104.906 -4.697  1.00 58.50 ? 212 ASP B OD2 1 
ATOM   3134 N N   . LYS B 2 213 ? 118.726 105.515 0.697   1.00 50.90 ? 213 LYS B N   1 
ATOM   3135 C CA  . LYS B 2 213 ? 118.282 105.172 2.036   1.00 49.62 ? 213 LYS B CA  1 
ATOM   3136 C C   . LYS B 2 213 ? 116.996 105.923 2.346   1.00 48.35 ? 213 LYS B C   1 
ATOM   3137 O O   . LYS B 2 213 ? 116.990 107.139 2.516   1.00 46.31 ? 213 LYS B O   1 
ATOM   3138 C CB  . LYS B 2 213 ? 119.360 105.506 3.071   1.00 51.43 ? 213 LYS B CB  1 
ATOM   3139 C CG  . LYS B 2 213 ? 118.907 105.330 4.515   1.00 53.08 ? 213 LYS B CG  1 
ATOM   3140 C CD  . LYS B 2 213 ? 118.372 103.924 4.798   1.00 55.74 ? 213 LYS B CD  1 
ATOM   3141 C CE  . LYS B 2 213 ? 119.466 102.859 4.721   1.00 57.85 ? 213 LYS B CE  1 
ATOM   3142 N NZ  . LYS B 2 213 ? 118.963 101.516 5.146   1.00 58.83 ? 213 LYS B NZ  1 
ATOM   3143 N N   . LYS B 2 214 ? 115.900 105.178 2.400   1.00 47.88 ? 214 LYS B N   1 
ATOM   3144 C CA  . LYS B 2 214 ? 114.586 105.739 2.679   1.00 46.77 ? 214 LYS B CA  1 
ATOM   3145 C C   . LYS B 2 214 ? 114.481 106.007 4.176   1.00 45.37 ? 214 LYS B C   1 
ATOM   3146 O O   . LYS B 2 214 ? 114.929 105.197 4.990   1.00 45.40 ? 214 LYS B O   1 
ATOM   3147 C CB  . LYS B 2 214 ? 113.513 104.739 2.231   1.00 48.01 ? 214 LYS B CB  1 
ATOM   3148 C CG  . LYS B 2 214 ? 112.069 105.197 2.351   1.00 49.62 ? 214 LYS B CG  1 
ATOM   3149 C CD  . LYS B 2 214 ? 111.145 104.093 1.821   1.00 52.70 ? 214 LYS B CD  1 
ATOM   3150 C CE  . LYS B 2 214 ? 109.666 104.394 2.048   1.00 52.87 ? 214 LYS B CE  1 
ATOM   3151 N NZ  . LYS B 2 214 ? 109.203 105.582 1.282   1.00 54.84 ? 214 LYS B NZ  1 
ATOM   3152 N N   . ILE B 2 215 ? 113.907 107.148 4.538   1.00 43.70 ? 215 ILE B N   1 
ATOM   3153 C CA  . ILE B 2 215 ? 113.746 107.497 5.946   1.00 42.92 ? 215 ILE B CA  1 
ATOM   3154 C C   . ILE B 2 215 ? 112.304 107.211 6.368   1.00 42.74 ? 215 ILE B C   1 
ATOM   3155 O O   . ILE B 2 215 ? 111.371 107.893 5.936   1.00 41.44 ? 215 ILE B O   1 
ATOM   3156 C CB  . ILE B 2 215 ? 114.045 108.993 6.205   1.00 42.10 ? 215 ILE B CB  1 
ATOM   3157 C CG1 . ILE B 2 215 ? 115.409 109.376 5.614   1.00 40.58 ? 215 ILE B CG1 1 
ATOM   3158 C CG2 . ILE B 2 215 ? 113.995 109.276 7.705   1.00 41.41 ? 215 ILE B CG2 1 
ATOM   3159 C CD1 . ILE B 2 215 ? 116.578 108.578 6.143   1.00 40.02 ? 215 ILE B CD1 1 
ATOM   3160 N N   . VAL B 2 216 ? 112.131 106.197 7.210   1.00 43.49 ? 216 VAL B N   1 
ATOM   3161 C CA  . VAL B 2 216 ? 110.805 105.818 7.685   1.00 45.16 ? 216 VAL B CA  1 
ATOM   3162 C C   . VAL B 2 216 ? 110.706 105.933 9.200   1.00 46.10 ? 216 VAL B C   1 
ATOM   3163 O O   . VAL B 2 216 ? 111.699 105.783 9.912   1.00 46.41 ? 216 VAL B O   1 
ATOM   3164 C CB  . VAL B 2 216 ? 110.463 104.375 7.276   1.00 45.31 ? 216 VAL B CB  1 
ATOM   3165 C CG1 . VAL B 2 216 ? 110.469 104.254 5.756   1.00 44.25 ? 216 VAL B CG1 1 
ATOM   3166 C CG2 . VAL B 2 216 ? 111.464 103.410 7.894   1.00 45.05 ? 216 VAL B CG2 1 
ATOM   3167 N N   . PRO B 2 217 ? 109.498 106.204 9.713   1.00 47.48 ? 217 PRO B N   1 
ATOM   3168 C CA  . PRO B 2 217 ? 109.310 106.334 11.159  1.00 49.20 ? 217 PRO B CA  1 
ATOM   3169 C C   . PRO B 2 217 ? 109.877 105.149 11.928  1.00 51.08 ? 217 PRO B C   1 
ATOM   3170 O O   . PRO B 2 217 ? 109.906 104.024 11.429  1.00 49.81 ? 217 PRO B O   1 
ATOM   3171 C CB  . PRO B 2 217 ? 107.795 106.444 11.296  1.00 48.40 ? 217 PRO B CB  1 
ATOM   3172 C CG  . PRO B 2 217 ? 107.408 107.165 10.045  1.00 47.23 ? 217 PRO B CG  1 
ATOM   3173 C CD  . PRO B 2 217 ? 108.235 106.456 8.997   1.00 46.26 ? 217 PRO B CD  1 
ATOM   3174 N N   . ARG B 2 218 ? 110.348 105.414 13.141  1.00 54.24 ? 218 ARG B N   1 
ATOM   3175 C CA  . ARG B 2 218 ? 110.896 104.365 13.988  1.00 57.23 ? 218 ARG B CA  1 
ATOM   3176 C C   . ARG B 2 218 ? 109.740 103.561 14.563  1.00 60.02 ? 218 ARG B C   1 
ATOM   3177 O O   . ARG B 2 218 ? 108.851 104.118 15.210  1.00 60.10 ? 218 ARG B O   1 
ATOM   3178 C CB  . ARG B 2 218 ? 111.707 104.967 15.137  1.00 56.03 ? 218 ARG B CB  1 
ATOM   3179 C CG  . ARG B 2 218 ? 112.980 105.673 14.717  1.00 55.81 ? 218 ARG B CG  1 
ATOM   3180 C CD  . ARG B 2 218 ? 113.668 106.286 15.925  1.00 55.28 ? 218 ARG B CD  1 
ATOM   3181 N NE  . ARG B 2 218 ? 114.133 105.271 16.863  1.00 55.29 ? 218 ARG B NE  1 
ATOM   3182 C CZ  . ARG B 2 218 ? 115.205 104.510 16.671  1.00 55.84 ? 218 ARG B CZ  1 
ATOM   3183 N NH1 . ARG B 2 218 ? 115.934 104.648 15.571  1.00 55.30 ? 218 ARG B NH1 1 
ATOM   3184 N NH2 . ARG B 2 218 ? 115.553 103.613 17.582  1.00 56.11 ? 218 ARG B NH2 1 
ATOM   3185 N N   . ASP B 2 219 ? 109.751 102.255 14.315  1.00 63.60 ? 219 ASP B N   1 
ATOM   3186 C CA  . ASP B 2 219 ? 108.707 101.364 14.815  1.00 67.02 ? 219 ASP B CA  1 
ATOM   3187 C C   . ASP B 2 219 ? 108.969 99.938  14.347  1.00 68.69 ? 219 ASP B C   1 
ATOM   3188 O O   . ASP B 2 219 ? 108.134 99.352  13.620  1.00 38.81 ? 219 ASP B O   1 
ATOM   3189 C CB  . ASP B 2 219 ? 107.334 101.829 14.329  1.00 67.25 ? 219 ASP B CB  1 
ATOM   3190 O OXT . ASP B 2 219 ? 110.036 99.406  14.719  1.00 38.81 ? 219 ASP B OXT 1 
ATOM   3191 N N   . SER C 3 22  ? 139.068 142.990 -66.679 1.00 50.54 ? 22  SER C N   1 
ATOM   3192 C CA  . SER C 3 22  ? 139.851 143.628 -65.575 1.00 49.94 ? 22  SER C CA  1 
ATOM   3193 C C   . SER C 3 22  ? 141.360 143.550 -65.826 1.00 48.86 ? 22  SER C C   1 
ATOM   3194 O O   . SER C 3 22  ? 141.919 142.463 -65.998 1.00 49.49 ? 22  SER C O   1 
ATOM   3195 C CB  . SER C 3 22  ? 139.508 142.960 -64.242 1.00 50.28 ? 22  SER C CB  1 
ATOM   3196 N N   . ALA C 3 23  ? 142.016 144.707 -65.845 1.00 46.84 ? 23  ALA C N   1 
ATOM   3197 C CA  . ALA C 3 23  ? 143.460 144.759 -66.064 1.00 44.69 ? 23  ALA C CA  1 
ATOM   3198 C C   . ALA C 3 23  ? 144.210 144.067 -64.918 1.00 43.37 ? 23  ALA C C   1 
ATOM   3199 O O   . ALA C 3 23  ? 143.668 143.868 -63.826 1.00 41.19 ? 23  ALA C O   1 
ATOM   3200 C CB  . ALA C 3 23  ? 143.920 146.213 -66.195 1.00 43.40 ? 23  ALA C CB  1 
ATOM   3201 N N   . LEU C 3 24  ? 145.460 143.704 -65.181 1.00 41.87 ? 24  LEU C N   1 
ATOM   3202 C CA  . LEU C 3 24  ? 146.300 143.034 -64.197 1.00 41.84 ? 24  LEU C CA  1 
ATOM   3203 C C   . LEU C 3 24  ? 146.407 143.770 -62.861 1.00 40.90 ? 24  LEU C C   1 
ATOM   3204 O O   . LEU C 3 24  ? 146.105 143.207 -61.813 1.00 40.75 ? 24  LEU C O   1 
ATOM   3205 C CB  . LEU C 3 24  ? 147.710 142.842 -64.755 1.00 41.22 ? 24  LEU C CB  1 
ATOM   3206 C CG  . LEU C 3 24  ? 148.694 142.210 -63.767 1.00 42.56 ? 24  LEU C CG  1 
ATOM   3207 C CD1 . LEU C 3 24  ? 148.352 140.743 -63.602 1.00 43.00 ? 24  LEU C CD1 1 
ATOM   3208 C CD2 . LEU C 3 24  ? 150.119 142.359 -64.269 1.00 41.95 ? 24  LEU C CD2 1 
ATOM   3209 N N   . HIS C 3 25  ? 146.842 145.024 -62.902 1.00 38.20 ? 25  HIS C N   1 
ATOM   3210 C CA  . HIS C 3 25  ? 147.022 145.794 -61.679 1.00 37.94 ? 25  HIS C CA  1 
ATOM   3211 C C   . HIS C 3 25  ? 145.815 145.830 -60.759 1.00 37.61 ? 25  HIS C C   1 
ATOM   3212 O O   . HIS C 3 25  ? 145.971 145.795 -59.542 1.00 38.04 ? 25  HIS C O   1 
ATOM   3213 C CB  . HIS C 3 25  ? 147.498 147.215 -62.002 1.00 33.21 ? 25  HIS C CB  1 
ATOM   3214 C CG  . HIS C 3 25  ? 146.754 147.873 -63.121 1.00 34.59 ? 25  HIS C CG  1 
ATOM   3215 N ND1 . HIS C 3 25  ? 145.763 148.808 -62.909 1.00 33.97 ? 25  HIS C ND1 1 
ATOM   3216 C CD2 . HIS C 3 25  ? 146.889 147.766 -64.464 1.00 33.31 ? 25  HIS C CD2 1 
ATOM   3217 C CE1 . HIS C 3 25  ? 145.325 149.255 -64.073 1.00 34.15 ? 25  HIS C CE1 1 
ATOM   3218 N NE2 . HIS C 3 25  ? 145.992 148.638 -65.033 1.00 36.09 ? 25  HIS C NE2 1 
ATOM   3219 N N   . TRP C 3 26  ? 144.616 145.895 -61.322 1.00 38.41 ? 26  TRP C N   1 
ATOM   3220 C CA  . TRP C 3 26  ? 143.421 145.914 -60.490 1.00 40.37 ? 26  TRP C CA  1 
ATOM   3221 C C   . TRP C 3 26  ? 143.217 144.536 -59.860 1.00 40.15 ? 26  TRP C C   1 
ATOM   3222 O O   . TRP C 3 26  ? 142.824 144.427 -58.695 1.00 38.24 ? 26  TRP C O   1 
ATOM   3223 C CB  . TRP C 3 26  ? 142.196 146.299 -61.318 1.00 42.55 ? 26  TRP C CB  1 
ATOM   3224 C CG  . TRP C 3 26  ? 142.232 147.712 -61.821 1.00 45.05 ? 26  TRP C CG  1 
ATOM   3225 C CD1 . TRP C 3 26  ? 141.913 148.139 -63.077 1.00 44.71 ? 26  TRP C CD1 1 
ATOM   3226 C CD2 . TRP C 3 26  ? 142.577 148.885 -61.073 1.00 46.14 ? 26  TRP C CD2 1 
ATOM   3227 N NE1 . TRP C 3 26  ? 142.038 149.503 -63.160 1.00 46.17 ? 26  TRP C NE1 1 
ATOM   3228 C CE2 . TRP C 3 26  ? 142.444 149.988 -61.944 1.00 46.32 ? 26  TRP C CE2 1 
ATOM   3229 C CE3 . TRP C 3 26  ? 142.985 149.113 -59.750 1.00 47.57 ? 26  TRP C CE3 1 
ATOM   3230 C CZ2 . TRP C 3 26  ? 142.705 151.303 -61.537 1.00 46.62 ? 26  TRP C CZ2 1 
ATOM   3231 C CZ3 . TRP C 3 26  ? 143.246 150.423 -59.345 1.00 47.61 ? 26  TRP C CZ3 1 
ATOM   3232 C CH2 . TRP C 3 26  ? 143.104 151.499 -60.238 1.00 47.22 ? 26  TRP C CH2 1 
ATOM   3233 N N   . ARG C 3 27  ? 143.498 143.493 -60.637 1.00 38.80 ? 27  ARG C N   1 
ATOM   3234 C CA  . ARG C 3 27  ? 143.357 142.119 -60.166 1.00 39.35 ? 27  ARG C CA  1 
ATOM   3235 C C   . ARG C 3 27  ? 144.353 141.857 -59.042 1.00 38.03 ? 27  ARG C C   1 
ATOM   3236 O O   . ARG C 3 27  ? 144.009 141.262 -58.025 1.00 37.09 ? 27  ARG C O   1 
ATOM   3237 C CB  . ARG C 3 27  ? 143.593 141.137 -61.318 1.00 38.12 ? 27  ARG C CB  1 
ATOM   3238 N N   . ALA C 3 28  ? 145.588 142.305 -59.235 1.00 36.43 ? 28  ALA C N   1 
ATOM   3239 C CA  . ALA C 3 28  ? 146.632 142.121 -58.236 1.00 37.40 ? 28  ALA C CA  1 
ATOM   3240 C C   . ALA C 3 28  ? 146.292 142.894 -56.962 1.00 36.61 ? 28  ALA C C   1 
ATOM   3241 O O   . ALA C 3 28  ? 146.589 142.446 -55.856 1.00 36.71 ? 28  ALA C O   1 
ATOM   3242 C CB  . ALA C 3 28  ? 147.976 142.584 -58.795 1.00 37.10 ? 28  ALA C CB  1 
ATOM   3243 N N   . ALA C 3 29  ? 145.668 144.056 -57.126 1.00 35.80 ? 29  ALA C N   1 
ATOM   3244 C CA  . ALA C 3 29  ? 145.285 144.880 -55.991 1.00 37.40 ? 29  ALA C CA  1 
ATOM   3245 C C   . ALA C 3 29  ? 144.285 144.100 -55.151 1.00 37.98 ? 29  ALA C C   1 
ATOM   3246 O O   . ALA C 3 29  ? 144.449 143.958 -53.940 1.00 37.95 ? 29  ALA C O   1 
ATOM   3247 C CB  . ALA C 3 29  ? 144.661 146.189 -56.471 1.00 36.35 ? 29  ALA C CB  1 
ATOM   3248 N N   . GLY C 3 30  ? 143.247 143.596 -55.809 1.00 38.71 ? 30  GLY C N   1 
ATOM   3249 C CA  . GLY C 3 30  ? 142.235 142.829 -55.110 1.00 38.60 ? 30  GLY C CA  1 
ATOM   3250 C C   . GLY C 3 30  ? 142.868 141.658 -54.394 1.00 38.39 ? 30  GLY C C   1 
ATOM   3251 O O   . GLY C 3 30  ? 142.652 141.463 -53.197 1.00 39.40 ? 30  GLY C O   1 
ATOM   3252 N N   . ALA C 3 31  ? 143.658 140.881 -55.128 1.00 35.79 ? 31  ALA C N   1 
ATOM   3253 C CA  . ALA C 3 31  ? 144.326 139.722 -54.560 1.00 36.37 ? 31  ALA C CA  1 
ATOM   3254 C C   . ALA C 3 31  ? 145.193 140.113 -53.371 1.00 37.17 ? 31  ALA C C   1 
ATOM   3255 O O   . ALA C 3 31  ? 145.256 139.390 -52.367 1.00 35.79 ? 31  ALA C O   1 
ATOM   3256 C CB  . ALA C 3 31  ? 145.180 139.047 -55.608 1.00 36.08 ? 31  ALA C CB  1 
ATOM   3257 N N   . ALA C 3 32  ? 145.871 141.251 -53.493 1.00 35.50 ? 32  ALA C N   1 
ATOM   3258 C CA  . ALA C 3 32  ? 146.736 141.720 -52.425 1.00 34.98 ? 32  ALA C CA  1 
ATOM   3259 C C   . ALA C 3 32  ? 145.898 141.989 -51.186 1.00 33.50 ? 32  ALA C C   1 
ATOM   3260 O O   . ALA C 3 32  ? 146.311 141.687 -50.070 1.00 33.45 ? 32  ALA C O   1 
ATOM   3261 C CB  . ALA C 3 32  ? 147.466 142.981 -52.858 1.00 34.07 ? 32  ALA C CB  1 
ATOM   3262 N N   . THR C 3 33  ? 144.712 142.545 -51.396 1.00 33.88 ? 33  THR C N   1 
ATOM   3263 C CA  . THR C 3 33  ? 143.799 142.865 -50.305 1.00 36.09 ? 33  THR C CA  1 
ATOM   3264 C C   . THR C 3 33  ? 143.289 141.625 -49.570 1.00 37.40 ? 33  THR C C   1 
ATOM   3265 O O   . THR C 3 33  ? 143.270 141.581 -48.336 1.00 37.48 ? 33  THR C O   1 
ATOM   3266 C CB  . THR C 3 33  ? 142.593 143.670 -50.826 1.00 36.24 ? 33  THR C CB  1 
ATOM   3267 O OG1 . THR C 3 33  ? 143.055 144.928 -51.331 1.00 38.53 ? 33  THR C OG1 1 
ATOM   3268 C CG2 . THR C 3 33  ? 141.578 143.927 -49.708 1.00 38.76 ? 33  THR C CG2 1 
ATOM   3269 N N   . VAL C 3 34  ? 142.867 140.621 -50.328 1.00 36.00 ? 34  VAL C N   1 
ATOM   3270 C CA  . VAL C 3 34  ? 142.362 139.400 -49.726 1.00 36.71 ? 34  VAL C CA  1 
ATOM   3271 C C   . VAL C 3 34  ? 143.494 138.730 -48.955 1.00 36.73 ? 34  VAL C C   1 
ATOM   3272 O O   . VAL C 3 34  ? 143.308 138.241 -47.837 1.00 38.25 ? 34  VAL C O   1 
ATOM   3273 C CB  . VAL C 3 34  ? 141.836 138.417 -50.807 1.00 38.26 ? 34  VAL C CB  1 
ATOM   3274 C CG1 . VAL C 3 34  ? 141.222 137.189 -50.139 1.00 39.58 ? 34  VAL C CG1 1 
ATOM   3275 C CG2 . VAL C 3 34  ? 140.802 139.116 -51.695 1.00 38.07 ? 34  VAL C CG2 1 
ATOM   3276 N N   . LEU C 3 35  ? 144.673 138.718 -49.561 1.00 35.71 ? 35  LEU C N   1 
ATOM   3277 C CA  . LEU C 3 35  ? 145.838 138.117 -48.944 1.00 36.33 ? 35  LEU C CA  1 
ATOM   3278 C C   . LEU C 3 35  ? 146.198 138.850 -47.642 1.00 35.07 ? 35  LEU C C   1 
ATOM   3279 O O   . LEU C 3 35  ? 146.566 138.217 -46.654 1.00 34.67 ? 35  LEU C O   1 
ATOM   3280 C CB  . LEU C 3 35  ? 147.005 138.157 -49.929 1.00 38.91 ? 35  LEU C CB  1 
ATOM   3281 C CG  . LEU C 3 35  ? 148.001 136.999 -49.886 1.00 43.02 ? 35  LEU C CG  1 
ATOM   3282 C CD1 . LEU C 3 35  ? 147.270 135.664 -50.011 1.00 44.17 ? 35  LEU C CD1 1 
ATOM   3283 C CD2 . LEU C 3 35  ? 148.990 137.167 -51.025 1.00 43.99 ? 35  LEU C CD2 1 
ATOM   3284 N N   . LEU C 3 36  ? 146.087 140.177 -47.635 1.00 33.57 ? 36  LEU C N   1 
ATOM   3285 C CA  . LEU C 3 36  ? 146.406 140.941 -46.431 1.00 33.84 ? 36  LEU C CA  1 
ATOM   3286 C C   . LEU C 3 36  ? 145.441 140.522 -45.324 1.00 32.38 ? 36  LEU C C   1 
ATOM   3287 O O   . LEU C 3 36  ? 145.856 140.256 -44.197 1.00 30.24 ? 36  LEU C O   1 
ATOM   3288 C CB  . LEU C 3 36  ? 146.292 142.448 -46.688 1.00 31.63 ? 36  LEU C CB  1 
ATOM   3289 C CG  . LEU C 3 36  ? 146.647 143.338 -45.492 1.00 31.17 ? 36  LEU C CG  1 
ATOM   3290 C CD1 . LEU C 3 36  ? 148.075 143.060 -45.037 1.00 28.12 ? 36  LEU C CD1 1 
ATOM   3291 C CD2 . LEU C 3 36  ? 146.486 144.798 -45.868 1.00 29.24 ? 36  LEU C CD2 1 
ATOM   3292 N N   . VAL C 3 37  ? 144.153 140.456 -45.654 1.00 32.66 ? 37  VAL C N   1 
ATOM   3293 C CA  . VAL C 3 37  ? 143.148 140.039 -44.682 1.00 32.89 ? 37  VAL C CA  1 
ATOM   3294 C C   . VAL C 3 37  ? 143.526 138.675 -44.102 1.00 31.54 ? 37  VAL C C   1 
ATOM   3295 O O   . VAL C 3 37  ? 143.427 138.457 -42.899 1.00 32.89 ? 37  VAL C O   1 
ATOM   3296 C CB  . VAL C 3 37  ? 141.751 139.923 -45.319 1.00 35.02 ? 37  VAL C CB  1 
ATOM   3297 C CG1 . VAL C 3 37  ? 140.780 139.307 -44.310 1.00 34.89 ? 37  VAL C CG1 1 
ATOM   3298 C CG2 . VAL C 3 37  ? 141.258 141.295 -45.765 1.00 31.49 ? 37  VAL C CG2 1 
ATOM   3299 N N   . ILE C 3 38  ? 143.964 137.756 -44.956 1.00 30.84 ? 38  ILE C N   1 
ATOM   3300 C CA  . ILE C 3 38  ? 144.363 136.430 -44.488 1.00 30.51 ? 38  ILE C CA  1 
ATOM   3301 C C   . ILE C 3 38  ? 145.569 136.515 -43.555 1.00 29.08 ? 38  ILE C C   1 
ATOM   3302 O O   . ILE C 3 38  ? 145.617 135.841 -42.528 1.00 29.26 ? 38  ILE C O   1 
ATOM   3303 C CB  . ILE C 3 38  ? 144.715 135.498 -45.660 1.00 31.02 ? 38  ILE C CB  1 
ATOM   3304 C CG1 . ILE C 3 38  ? 143.466 135.230 -46.501 1.00 33.44 ? 38  ILE C CG1 1 
ATOM   3305 C CG2 . ILE C 3 38  ? 145.278 134.180 -45.136 1.00 31.72 ? 38  ILE C CG2 1 
ATOM   3306 C CD1 . ILE C 3 38  ? 143.736 134.366 -47.727 1.00 34.44 ? 38  ILE C CD1 1 
ATOM   3307 N N   . VAL C 3 39  ? 146.546 137.338 -43.924 1.00 28.08 ? 39  VAL C N   1 
ATOM   3308 C CA  . VAL C 3 39  ? 147.741 137.516 -43.110 1.00 25.33 ? 39  VAL C CA  1 
ATOM   3309 C C   . VAL C 3 39  ? 147.361 138.108 -41.756 1.00 25.04 ? 39  VAL C C   1 
ATOM   3310 O O   . VAL C 3 39  ? 147.905 137.707 -40.736 1.00 25.64 ? 39  VAL C O   1 
ATOM   3311 C CB  . VAL C 3 39  ? 148.771 138.451 -43.817 1.00 27.15 ? 39  VAL C CB  1 
ATOM   3312 C CG1 . VAL C 3 39  ? 149.895 138.856 -42.851 1.00 26.76 ? 39  VAL C CG1 1 
ATOM   3313 C CG2 . VAL C 3 39  ? 149.371 137.736 -45.011 1.00 28.20 ? 39  VAL C CG2 1 
ATOM   3314 N N   . LEU C 3 40  ? 146.426 139.058 -41.745 1.00 23.20 ? 40  LEU C N   1 
ATOM   3315 C CA  . LEU C 3 40  ? 146.000 139.680 -40.494 1.00 25.09 ? 40  LEU C CA  1 
ATOM   3316 C C   . LEU C 3 40  ? 145.397 138.657 -39.541 1.00 25.82 ? 40  LEU C C   1 
ATOM   3317 O O   . LEU C 3 40  ? 145.783 138.595 -38.371 1.00 27.58 ? 40  LEU C O   1 
ATOM   3318 C CB  . LEU C 3 40  ? 144.976 140.787 -40.755 1.00 26.75 ? 40  LEU C CB  1 
ATOM   3319 C CG  . LEU C 3 40  ? 145.456 141.993 -41.562 1.00 27.59 ? 40  LEU C CG  1 
ATOM   3320 C CD1 . LEU C 3 40  ? 144.272 142.913 -41.814 1.00 26.40 ? 40  LEU C CD1 1 
ATOM   3321 C CD2 . LEU C 3 40  ? 146.561 142.736 -40.809 1.00 25.55 ? 40  LEU C CD2 1 
ATOM   3322 N N   . LEU C 3 41  ? 144.459 137.853 -40.041 1.00 24.38 ? 41  LEU C N   1 
ATOM   3323 C CA  . LEU C 3 41  ? 143.815 136.816 -39.231 1.00 24.61 ? 41  LEU C CA  1 
ATOM   3324 C C   . LEU C 3 41  ? 144.823 135.766 -38.738 1.00 25.16 ? 41  LEU C C   1 
ATOM   3325 O O   . LEU C 3 41  ? 144.855 135.449 -37.555 1.00 25.48 ? 41  LEU C O   1 
ATOM   3326 C CB  . LEU C 3 41  ? 142.698 136.128 -40.040 1.00 26.88 ? 41  LEU C CB  1 
ATOM   3327 C CG  . LEU C 3 41  ? 141.543 137.027 -40.511 1.00 28.71 ? 41  LEU C CG  1 
ATOM   3328 C CD1 . LEU C 3 41  ? 140.618 136.236 -41.429 1.00 31.81 ? 41  LEU C CD1 1 
ATOM   3329 C CD2 . LEU C 3 41  ? 140.778 137.567 -39.311 1.00 29.18 ? 41  LEU C CD2 1 
ATOM   3330 N N   . ALA C 3 42  ? 145.646 135.227 -39.633 1.00 24.39 ? 42  ALA C N   1 
ATOM   3331 C CA  . ALA C 3 42  ? 146.640 134.229 -39.220 1.00 27.81 ? 42  ALA C CA  1 
ATOM   3332 C C   . ALA C 3 42  ? 147.664 134.881 -38.287 1.00 28.69 ? 42  ALA C C   1 
ATOM   3333 O O   . ALA C 3 42  ? 148.108 134.273 -37.315 1.00 31.83 ? 42  ALA C O   1 
ATOM   3334 C CB  . ALA C 3 42  ? 147.346 133.634 -40.441 1.00 25.22 ? 42  ALA C CB  1 
ATOM   3335 N N   . GLY C 3 43  ? 148.034 136.121 -38.590 1.00 28.04 ? 43  GLY C N   1 
ATOM   3336 C CA  . GLY C 3 43  ? 148.980 136.836 -37.752 1.00 28.38 ? 43  GLY C CA  1 
ATOM   3337 C C   . GLY C 3 43  ? 148.430 137.014 -36.344 1.00 26.59 ? 43  GLY C C   1 
ATOM   3338 O O   . GLY C 3 43  ? 149.143 136.819 -35.359 1.00 26.59 ? 43  GLY C O   1 
ATOM   3339 N N   . SER C 3 44  ? 147.160 137.389 -36.241 1.00 25.96 ? 44  SER C N   1 
ATOM   3340 C CA  . SER C 3 44  ? 146.540 137.565 -34.930 1.00 26.50 ? 44  SER C CA  1 
ATOM   3341 C C   . SER C 3 44  ? 146.561 136.243 -34.172 1.00 25.93 ? 44  SER C C   1 
ATOM   3342 O O   . SER C 3 44  ? 146.918 136.194 -32.996 1.00 23.70 ? 44  SER C O   1 
ATOM   3343 C CB  . SER C 3 44  ? 145.091 138.025 -35.071 1.00 28.65 ? 44  SER C CB  1 
ATOM   3344 O OG  . SER C 3 44  ? 145.026 139.276 -35.735 1.00 35.99 ? 44  SER C OG  1 
ATOM   3345 N N   . TYR C 3 45  ? 146.173 135.172 -34.853 1.00 26.50 ? 45  TYR C N   1 
ATOM   3346 C CA  . TYR C 3 45  ? 146.135 133.850 -34.230 1.00 27.78 ? 45  TYR C CA  1 
ATOM   3347 C C   . TYR C 3 45  ? 147.512 133.405 -33.758 1.00 25.95 ? 45  TYR C C   1 
ATOM   3348 O O   . TYR C 3 45  ? 147.675 132.974 -32.614 1.00 25.02 ? 45  TYR C O   1 
ATOM   3349 C CB  . TYR C 3 45  ? 145.588 132.815 -35.213 1.00 31.04 ? 45  TYR C CB  1 
ATOM   3350 C CG  . TYR C 3 45  ? 145.602 131.394 -34.684 1.00 36.07 ? 45  TYR C CG  1 
ATOM   3351 C CD1 . TYR C 3 45  ? 144.548 130.898 -33.909 1.00 37.62 ? 45  TYR C CD1 1 
ATOM   3352 C CD2 . TYR C 3 45  ? 146.672 130.544 -34.960 1.00 37.10 ? 45  TYR C CD2 1 
ATOM   3353 C CE1 . TYR C 3 45  ? 144.563 129.582 -33.426 1.00 39.13 ? 45  TYR C CE1 1 
ATOM   3354 C CE2 . TYR C 3 45  ? 146.698 129.236 -34.485 1.00 39.72 ? 45  TYR C CE2 1 
ATOM   3355 C CZ  . TYR C 3 45  ? 145.643 128.761 -33.720 1.00 39.86 ? 45  TYR C CZ  1 
ATOM   3356 O OH  . TYR C 3 45  ? 145.686 127.467 -33.253 1.00 41.49 ? 45  TYR C OH  1 
ATOM   3357 N N   . LEU C 3 46  ? 148.499 133.531 -34.642 1.00 23.09 ? 46  LEU C N   1 
ATOM   3358 C CA  . LEU C 3 46  ? 149.858 133.112 -34.342 1.00 23.71 ? 46  LEU C CA  1 
ATOM   3359 C C   . LEU C 3 46  ? 150.584 133.961 -33.302 1.00 21.81 ? 46  LEU C C   1 
ATOM   3360 O O   . LEU C 3 46  ? 151.422 133.449 -32.567 1.00 20.86 ? 46  LEU C O   1 
ATOM   3361 C CB  . LEU C 3 46  ? 150.676 133.047 -35.639 1.00 26.14 ? 46  LEU C CB  1 
ATOM   3362 C CG  . LEU C 3 46  ? 150.287 131.917 -36.600 1.00 26.93 ? 46  LEU C CG  1 
ATOM   3363 C CD1 . LEU C 3 46  ? 150.909 132.148 -37.974 1.00 29.96 ? 46  LEU C CD1 1 
ATOM   3364 C CD2 . LEU C 3 46  ? 150.761 130.586 -36.021 1.00 28.66 ? 46  LEU C CD2 1 
ATOM   3365 N N   . ALA C 3 47  ? 150.268 135.248 -33.236 1.00 22.75 ? 47  ALA C N   1 
ATOM   3366 C CA  . ALA C 3 47  ? 150.911 136.135 -32.265 1.00 23.67 ? 47  ALA C CA  1 
ATOM   3367 C C   . ALA C 3 47  ? 150.541 135.676 -30.856 1.00 24.51 ? 47  ALA C C   1 
ATOM   3368 O O   . ALA C 3 47  ? 151.397 135.576 -29.973 1.00 24.55 ? 47  ALA C O   1 
ATOM   3369 C CB  . ALA C 3 47  ? 150.456 137.578 -32.483 1.00 23.80 ? 47  ALA C CB  1 
ATOM   3370 N N   . VAL C 3 48  ? 149.259 135.391 -30.653 1.00 24.54 ? 48  VAL C N   1 
ATOM   3371 C CA  . VAL C 3 48  ? 148.783 134.940 -29.355 1.00 22.24 ? 48  VAL C CA  1 
ATOM   3372 C C   . VAL C 3 48  ? 149.497 133.654 -28.988 1.00 23.61 ? 48  VAL C C   1 
ATOM   3373 O O   . VAL C 3 48  ? 149.985 133.500 -27.874 1.00 23.52 ? 48  VAL C O   1 
ATOM   3374 C CB  . VAL C 3 48  ? 147.266 134.674 -29.381 1.00 24.21 ? 48  VAL C CB  1 
ATOM   3375 C CG1 . VAL C 3 48  ? 146.817 134.003 -28.071 1.00 22.36 ? 48  VAL C CG1 1 
ATOM   3376 C CG2 . VAL C 3 48  ? 146.519 135.976 -29.581 1.00 20.67 ? 48  VAL C CG2 1 
ATOM   3377 N N   . LEU C 3 49  ? 149.560 132.735 -29.945 1.00 25.33 ? 49  LEU C N   1 
ATOM   3378 C CA  . LEU C 3 49  ? 150.201 131.442 -29.737 1.00 26.22 ? 49  LEU C CA  1 
ATOM   3379 C C   . LEU C 3 49  ? 151.659 131.596 -29.347 1.00 25.21 ? 49  LEU C C   1 
ATOM   3380 O O   . LEU C 3 49  ? 152.157 130.874 -28.493 1.00 24.47 ? 49  LEU C O   1 
ATOM   3381 C CB  . LEU C 3 49  ? 150.114 130.602 -31.008 1.00 27.80 ? 49  LEU C CB  1 
ATOM   3382 C CG  . LEU C 3 49  ? 150.577 129.159 -30.857 1.00 32.13 ? 49  LEU C CG  1 
ATOM   3383 C CD1 . LEU C 3 49  ? 149.589 128.394 -29.973 1.00 32.63 ? 49  LEU C CD1 1 
ATOM   3384 C CD2 . LEU C 3 49  ? 150.674 128.517 -32.236 1.00 33.15 ? 49  LEU C CD2 1 
ATOM   3385 N N   . ALA C 3 50  ? 152.339 132.545 -29.978 1.00 25.02 ? 50  ALA C N   1 
ATOM   3386 C CA  . ALA C 3 50  ? 153.752 132.782 -29.698 1.00 23.97 ? 50  ALA C CA  1 
ATOM   3387 C C   . ALA C 3 50  ? 154.001 133.525 -28.385 1.00 23.03 ? 50  ALA C C   1 
ATOM   3388 O O   . ALA C 3 50  ? 154.940 133.205 -27.655 1.00 24.36 ? 50  ALA C O   1 
ATOM   3389 C CB  . ALA C 3 50  ? 154.384 133.563 -30.859 1.00 23.35 ? 50  ALA C CB  1 
ATOM   3390 N N   . GLU C 3 51  ? 153.144 134.497 -28.079 1.00 20.39 ? 51  GLU C N   1 
ATOM   3391 C CA  . GLU C 3 51  ? 153.312 135.321 -26.887 1.00 21.38 ? 51  GLU C CA  1 
ATOM   3392 C C   . GLU C 3 51  ? 152.860 134.742 -25.554 1.00 22.08 ? 51  GLU C C   1 
ATOM   3393 O O   . GLU C 3 51  ? 153.444 135.081 -24.528 1.00 18.77 ? 51  GLU C O   1 
ATOM   3394 C CB  . GLU C 3 51  ? 152.638 136.680 -27.107 1.00 20.45 ? 51  GLU C CB  1 
ATOM   3395 C CG  . GLU C 3 51  ? 153.193 137.442 -28.291 1.00 21.30 ? 51  GLU C CG  1 
ATOM   3396 C CD  . GLU C 3 51  ? 154.561 138.037 -28.016 1.00 21.68 ? 51  GLU C CD  1 
ATOM   3397 O OE1 . GLU C 3 51  ? 154.671 138.848 -27.076 1.00 20.56 ? 51  GLU C OE1 1 
ATOM   3398 O OE2 . GLU C 3 51  ? 155.526 137.697 -28.737 1.00 23.87 ? 51  GLU C OE2 1 
ATOM   3399 N N   . ARG C 3 52  ? 151.813 133.908 -25.540 1.00 22.63 ? 52  ARG C N   1 
ATOM   3400 C CA  . ARG C 3 52  ? 151.385 133.329 -24.271 1.00 20.84 ? 52  ARG C CA  1 
ATOM   3401 C C   . ARG C 3 52  ? 152.551 132.474 -23.818 1.00 23.71 ? 52  ARG C C   1 
ATOM   3402 O O   . ARG C 3 52  ? 153.147 131.764 -24.621 1.00 21.18 ? 52  ARG C O   1 
ATOM   3403 C CB  . ARG C 3 52  ? 150.116 132.475 -24.421 1.00 22.78 ? 52  ARG C CB  1 
ATOM   3404 C CG  . ARG C 3 52  ? 148.845 133.311 -24.549 1.00 22.23 ? 52  ARG C CG  1 
ATOM   3405 C CD  . ARG C 3 52  ? 147.571 132.545 -24.188 1.00 20.32 ? 52  ARG C CD  1 
ATOM   3406 N NE  . ARG C 3 52  ? 146.385 133.377 -24.422 1.00 22.42 ? 52  ARG C NE  1 
ATOM   3407 C CZ  . ARG C 3 52  ? 145.153 133.067 -24.030 1.00 22.99 ? 52  ARG C CZ  1 
ATOM   3408 N NH1 . ARG C 3 52  ? 144.924 131.940 -23.372 1.00 20.06 ? 52  ARG C NH1 1 
ATOM   3409 N NH2 . ARG C 3 52  ? 144.141 133.881 -24.316 1.00 23.62 ? 52  ARG C NH2 1 
ATOM   3410 N N   . GLY C 3 53  ? 152.890 132.561 -22.538 1.00 23.27 ? 53  GLY C N   1 
ATOM   3411 C CA  . GLY C 3 53  ? 154.018 131.806 -22.038 1.00 23.74 ? 53  GLY C CA  1 
ATOM   3412 C C   . GLY C 3 53  ? 155.180 132.746 -21.768 1.00 25.56 ? 53  GLY C C   1 
ATOM   3413 O O   . GLY C 3 53  ? 156.180 132.347 -21.179 1.00 25.52 ? 53  GLY C O   1 
ATOM   3414 N N   . ALA C 3 54  ? 155.064 133.998 -22.207 1.00 23.96 ? 54  ALA C N   1 
ATOM   3415 C CA  . ALA C 3 54  ? 156.126 134.971 -21.961 1.00 24.14 ? 54  ALA C CA  1 
ATOM   3416 C C   . ALA C 3 54  ? 155.647 135.935 -20.884 1.00 24.17 ? 54  ALA C C   1 
ATOM   3417 O O   . ALA C 3 54  ? 154.771 136.759 -21.133 1.00 23.98 ? 54  ALA C O   1 
ATOM   3418 C CB  . ALA C 3 54  ? 156.459 135.734 -23.240 1.00 23.27 ? 54  ALA C CB  1 
ATOM   3419 N N   . PRO C 3 55  ? 156.210 135.842 -19.668 1.00 24.87 ? 55  PRO C N   1 
ATOM   3420 C CA  . PRO C 3 55  ? 155.809 136.725 -18.570 1.00 25.18 ? 55  PRO C CA  1 
ATOM   3421 C C   . PRO C 3 55  ? 155.892 138.178 -19.007 1.00 25.29 ? 55  PRO C C   1 
ATOM   3422 O O   . PRO C 3 55  ? 156.925 138.609 -19.513 1.00 24.51 ? 55  PRO C O   1 
ATOM   3423 C CB  . PRO C 3 55  ? 156.818 136.392 -17.469 1.00 27.87 ? 55  PRO C CB  1 
ATOM   3424 C CG  . PRO C 3 55  ? 157.114 134.950 -17.709 1.00 27.45 ? 55  PRO C CG  1 
ATOM   3425 C CD  . PRO C 3 55  ? 157.271 134.917 -19.228 1.00 27.73 ? 55  PRO C CD  1 
ATOM   3426 N N   . GLY C 3 56  ? 154.799 138.920 -18.822 1.00 23.95 ? 56  GLY C N   1 
ATOM   3427 C CA  . GLY C 3 56  ? 154.768 140.316 -19.214 1.00 22.63 ? 56  GLY C CA  1 
ATOM   3428 C C   . GLY C 3 56  ? 154.118 140.608 -20.567 1.00 24.19 ? 56  GLY C C   1 
ATOM   3429 O O   . GLY C 3 56  ? 153.757 141.751 -20.846 1.00 25.23 ? 56  GLY C O   1 
ATOM   3430 N N   . ALA C 3 57  ? 153.950 139.599 -21.415 1.00 22.36 ? 57  ALA C N   1 
ATOM   3431 C CA  . ALA C 3 57  ? 153.345 139.826 -22.731 1.00 23.09 ? 57  ALA C CA  1 
ATOM   3432 C C   . ALA C 3 57  ? 151.877 140.282 -22.661 1.00 22.38 ? 57  ALA C C   1 
ATOM   3433 O O   . ALA C 3 57  ? 151.092 139.788 -21.843 1.00 19.98 ? 57  ALA C O   1 
ATOM   3434 C CB  . ALA C 3 57  ? 153.456 138.565 -23.581 1.00 19.30 ? 57  ALA C CB  1 
ATOM   3435 N N   . GLN C 3 58  ? 151.523 141.223 -23.532 1.00 21.16 ? 58  GLN C N   1 
ATOM   3436 C CA  . GLN C 3 58  ? 150.165 141.758 -23.602 1.00 23.76 ? 58  GLN C CA  1 
ATOM   3437 C C   . GLN C 3 58  ? 149.427 141.341 -24.878 1.00 22.41 ? 58  GLN C C   1 
ATOM   3438 O O   . GLN C 3 58  ? 148.212 141.484 -24.964 1.00 22.91 ? 58  GLN C O   1 
ATOM   3439 C CB  . GLN C 3 58  ? 150.184 143.291 -23.544 1.00 25.78 ? 58  GLN C CB  1 
ATOM   3440 C CG  . GLN C 3 58  ? 150.679 143.902 -22.244 1.00 30.43 ? 58  GLN C CG  1 
ATOM   3441 C CD  . GLN C 3 58  ? 150.530 145.428 -22.225 1.00 35.20 ? 58  GLN C CD  1 
ATOM   3442 O OE1 . GLN C 3 58  ? 151.160 146.136 -23.023 1.00 37.19 ? 58  GLN C OE1 1 
ATOM   3443 N NE2 . GLN C 3 58  ? 149.687 145.936 -21.322 1.00 28.88 ? 58  GLN C NE2 1 
ATOM   3444 N N   . LEU C 3 59  ? 150.154 140.840 -25.872 1.00 22.55 ? 59  LEU C N   1 
ATOM   3445 C CA  . LEU C 3 59  ? 149.540 140.434 -27.140 1.00 23.85 ? 59  LEU C CA  1 
ATOM   3446 C C   . LEU C 3 59  ? 149.077 138.990 -26.965 1.00 24.13 ? 59  LEU C C   1 
ATOM   3447 O O   . LEU C 3 59  ? 149.558 138.083 -27.659 1.00 23.87 ? 59  LEU C O   1 
ATOM   3448 C CB  . LEU C 3 59  ? 150.579 140.552 -28.272 1.00 24.41 ? 59  LEU C CB  1 
ATOM   3449 C CG  . LEU C 3 59  ? 150.119 140.449 -29.734 1.00 23.81 ? 59  LEU C CG  1 
ATOM   3450 C CD1 . LEU C 3 59  ? 149.031 141.488 -30.004 1.00 21.46 ? 59  LEU C CD1 1 
ATOM   3451 C CD2 . LEU C 3 59  ? 151.310 140.692 -30.667 1.00 22.10 ? 59  LEU C CD2 1 
ATOM   3452 N N   . ILE C 3 60  ? 148.123 138.798 -26.052 1.00 20.65 ? 60  ILE C N   1 
ATOM   3453 C CA  . ILE C 3 60  ? 147.650 137.464 -25.686 1.00 20.46 ? 60  ILE C CA  1 
ATOM   3454 C C   . ILE C 3 60  ? 146.169 137.067 -25.784 1.00 20.68 ? 60  ILE C C   1 
ATOM   3455 O O   . ILE C 3 60  ? 145.801 135.982 -25.335 1.00 21.18 ? 60  ILE C O   1 
ATOM   3456 C CB  . ILE C 3 60  ? 148.146 137.141 -24.266 1.00 20.19 ? 60  ILE C CB  1 
ATOM   3457 C CG1 . ILE C 3 60  ? 147.562 138.143 -23.263 1.00 19.02 ? 60  ILE C CG1 1 
ATOM   3458 C CG2 . ILE C 3 60  ? 149.681 137.193 -24.242 1.00 18.55 ? 60  ILE C CG2 1 
ATOM   3459 C CD1 . ILE C 3 60  ? 148.090 137.986 -21.828 1.00 16.24 ? 60  ILE C CD1 1 
ATOM   3460 N N   . THR C 3 61  ? 145.326 137.940 -26.332 1.00 22.50 ? 61  THR C N   1 
ATOM   3461 C CA  . THR C 3 61  ? 143.907 137.635 -26.553 1.00 22.24 ? 61  THR C CA  1 
ATOM   3462 C C   . THR C 3 61  ? 143.618 138.027 -28.014 1.00 23.25 ? 61  THR C C   1 
ATOM   3463 O O   . THR C 3 61  ? 144.113 139.045 -28.491 1.00 25.58 ? 61  THR C O   1 
ATOM   3464 C CB  . THR C 3 61  ? 142.967 138.400 -25.570 1.00 24.61 ? 61  THR C CB  1 
ATOM   3465 O OG1 . THR C 3 61  ? 143.382 139.759 -25.453 1.00 23.08 ? 61  THR C OG1 1 
ATOM   3466 C CG2 . THR C 3 61  ? 142.980 137.748 -24.178 1.00 23.18 ? 61  THR C CG2 1 
ATOM   3467 N N   . TYR C 3 62  ? 142.832 137.218 -28.722 1.00 23.73 ? 62  TYR C N   1 
ATOM   3468 C CA  . TYR C 3 62  ? 142.541 137.441 -30.147 1.00 24.13 ? 62  TYR C CA  1 
ATOM   3469 C C   . TYR C 3 62  ? 141.953 138.780 -30.624 1.00 24.10 ? 62  TYR C C   1 
ATOM   3470 O O   . TYR C 3 62  ? 142.376 139.314 -31.647 1.00 24.24 ? 62  TYR C O   1 
ATOM   3471 C CB  . TYR C 3 62  ? 141.686 136.278 -30.667 1.00 24.06 ? 62  TYR C CB  1 
ATOM   3472 C CG  . TYR C 3 62  ? 142.354 134.950 -30.414 1.00 24.72 ? 62  TYR C CG  1 
ATOM   3473 C CD1 . TYR C 3 62  ? 141.834 134.046 -29.488 1.00 24.94 ? 62  TYR C CD1 1 
ATOM   3474 C CD2 . TYR C 3 62  ? 143.552 134.627 -31.044 1.00 23.67 ? 62  TYR C CD2 1 
ATOM   3475 C CE1 . TYR C 3 62  ? 142.497 132.858 -29.193 1.00 24.29 ? 62  TYR C CE1 1 
ATOM   3476 C CE2 . TYR C 3 62  ? 144.223 133.438 -30.759 1.00 25.67 ? 62  TYR C CE2 1 
ATOM   3477 C CZ  . TYR C 3 62  ? 143.686 132.559 -29.831 1.00 26.64 ? 62  TYR C CZ  1 
ATOM   3478 O OH  . TYR C 3 62  ? 144.339 131.379 -29.553 1.00 27.46 ? 62  TYR C OH  1 
ATOM   3479 N N   . PRO C 3 63  ? 140.963 139.328 -29.908 1.00 24.35 ? 63  PRO C N   1 
ATOM   3480 C CA  . PRO C 3 63  ? 140.407 140.607 -30.359 1.00 23.26 ? 63  PRO C CA  1 
ATOM   3481 C C   . PRO C 3 63  ? 141.464 141.721 -30.477 1.00 23.66 ? 63  PRO C C   1 
ATOM   3482 O O   . PRO C 3 63  ? 141.607 142.330 -31.535 1.00 21.24 ? 63  PRO C O   1 
ATOM   3483 C CB  . PRO C 3 63  ? 139.343 140.909 -29.303 1.00 26.15 ? 63  PRO C CB  1 
ATOM   3484 C CG  . PRO C 3 63  ? 138.846 139.512 -28.936 1.00 24.50 ? 63  PRO C CG  1 
ATOM   3485 C CD  . PRO C 3 63  ? 140.153 138.742 -28.820 1.00 23.58 ? 63  PRO C CD  1 
ATOM   3486 N N   . ARG C 3 64  ? 142.209 141.980 -29.405 1.00 20.90 ? 64  ARG C N   1 
ATOM   3487 C CA  . ARG C 3 64  ? 143.228 143.025 -29.458 1.00 21.53 ? 64  ARG C CA  1 
ATOM   3488 C C   . ARG C 3 64  ? 144.393 142.619 -30.363 1.00 22.22 ? 64  ARG C C   1 
ATOM   3489 O O   . ARG C 3 64  ? 145.065 143.482 -30.939 1.00 22.78 ? 64  ARG C O   1 
ATOM   3490 C CB  . ARG C 3 64  ? 143.721 143.387 -28.040 1.00 21.20 ? 64  ARG C CB  1 
ATOM   3491 C CG  . ARG C 3 64  ? 144.479 142.306 -27.277 1.00 21.13 ? 64  ARG C CG  1 
ATOM   3492 C CD  . ARG C 3 64  ? 144.631 142.721 -25.801 1.00 21.91 ? 64  ARG C CD  1 
ATOM   3493 N NE  . ARG C 3 64  ? 143.316 142.934 -25.193 1.00 22.22 ? 64  ARG C NE  1 
ATOM   3494 C CZ  . ARG C 3 64  ? 143.083 143.505 -24.012 1.00 25.56 ? 64  ARG C CZ  1 
ATOM   3495 N NH1 . ARG C 3 64  ? 144.079 143.953 -23.251 1.00 18.62 ? 64  ARG C NH1 1 
ATOM   3496 N NH2 . ARG C 3 64  ? 141.830 143.644 -23.594 1.00 24.20 ? 64  ARG C NH2 1 
ATOM   3497 N N   . ALA C 3 65  ? 144.626 141.312 -30.503 1.00 20.04 ? 65  ALA C N   1 
ATOM   3498 C CA  . ALA C 3 65  ? 145.687 140.844 -31.385 1.00 21.44 ? 65  ALA C CA  1 
ATOM   3499 C C   . ALA C 3 65  ? 145.320 141.221 -32.823 1.00 22.26 ? 65  ALA C C   1 
ATOM   3500 O O   . ALA C 3 65  ? 146.179 141.618 -33.604 1.00 24.64 ? 65  ALA C O   1 
ATOM   3501 C CB  . ALA C 3 65  ? 145.853 139.353 -31.280 1.00 18.21 ? 65  ALA C CB  1 
ATOM   3502 N N   . LEU C 3 66  ? 144.044 141.104 -33.168 1.00 23.77 ? 66  LEU C N   1 
ATOM   3503 C CA  . LEU C 3 66  ? 143.610 141.464 -34.522 1.00 25.05 ? 66  LEU C CA  1 
ATOM   3504 C C   . LEU C 3 66  ? 143.844 142.958 -34.730 1.00 23.21 ? 66  LEU C C   1 
ATOM   3505 O O   . LEU C 3 66  ? 144.319 143.377 -35.780 1.00 22.77 ? 66  LEU C O   1 
ATOM   3506 C CB  . LEU C 3 66  ? 142.129 141.128 -34.733 1.00 23.44 ? 66  LEU C CB  1 
ATOM   3507 C CG  . LEU C 3 66  ? 141.601 141.337 -36.162 1.00 27.92 ? 66  LEU C CG  1 
ATOM   3508 C CD1 . LEU C 3 66  ? 142.532 140.661 -37.182 1.00 26.60 ? 66  LEU C CD1 1 
ATOM   3509 C CD2 . LEU C 3 66  ? 140.185 140.760 -36.276 1.00 26.49 ? 66  LEU C CD2 1 
ATOM   3510 N N   . TRP C 3 67  ? 143.522 143.757 -33.716 1.00 23.35 ? 67  TRP C N   1 
ATOM   3511 C CA  . TRP C 3 67  ? 143.726 145.204 -33.788 1.00 23.52 ? 67  TRP C CA  1 
ATOM   3512 C C   . TRP C 3 67  ? 145.227 145.471 -33.905 1.00 20.89 ? 67  TRP C C   1 
ATOM   3513 O O   . TRP C 3 67  ? 145.655 146.310 -34.695 1.00 20.31 ? 67  TRP C O   1 
ATOM   3514 C CB  . TRP C 3 67  ? 143.133 145.884 -32.538 1.00 24.16 ? 67  TRP C CB  1 
ATOM   3515 C CG  . TRP C 3 67  ? 143.700 147.253 -32.204 1.00 23.94 ? 67  TRP C CG  1 
ATOM   3516 C CD1 . TRP C 3 67  ? 144.437 147.580 -31.103 1.00 22.88 ? 67  TRP C CD1 1 
ATOM   3517 C CD2 . TRP C 3 67  ? 143.550 148.470 -32.961 1.00 20.93 ? 67  TRP C CD2 1 
ATOM   3518 N NE1 . TRP C 3 67  ? 144.753 148.920 -31.122 1.00 20.56 ? 67  TRP C NE1 1 
ATOM   3519 C CE2 . TRP C 3 67  ? 144.223 149.487 -32.254 1.00 20.87 ? 67  TRP C CE2 1 
ATOM   3520 C CE3 . TRP C 3 67  ? 142.915 148.793 -34.169 1.00 23.12 ? 67  TRP C CE3 1 
ATOM   3521 C CZ2 . TRP C 3 67  ? 144.283 150.817 -32.715 1.00 21.94 ? 67  TRP C CZ2 1 
ATOM   3522 C CZ3 . TRP C 3 67  ? 142.970 150.113 -34.629 1.00 22.13 ? 67  TRP C CZ3 1 
ATOM   3523 C CH2 . TRP C 3 67  ? 143.654 151.110 -33.897 1.00 19.83 ? 67  TRP C CH2 1 
ATOM   3524 N N   . TRP C 3 68  ? 146.027 144.744 -33.131 1.00 19.77 ? 68  TRP C N   1 
ATOM   3525 C CA  . TRP C 3 68  ? 147.479 144.908 -33.205 1.00 19.60 ? 68  TRP C CA  1 
ATOM   3526 C C   . TRP C 3 68  ? 147.957 144.609 -34.630 1.00 22.01 ? 68  TRP C C   1 
ATOM   3527 O O   . TRP C 3 68  ? 148.830 145.304 -35.169 1.00 18.85 ? 68  TRP C O   1 
ATOM   3528 C CB  . TRP C 3 68  ? 148.191 143.943 -32.247 1.00 19.13 ? 68  TRP C CB  1 
ATOM   3529 C CG  . TRP C 3 68  ? 149.634 143.751 -32.577 1.00 20.06 ? 68  TRP C CG  1 
ATOM   3530 C CD1 . TRP C 3 68  ? 150.675 144.602 -32.280 1.00 19.35 ? 68  TRP C CD1 1 
ATOM   3531 C CD2 . TRP C 3 68  ? 150.201 142.673 -33.335 1.00 17.54 ? 68  TRP C CD2 1 
ATOM   3532 N NE1 . TRP C 3 68  ? 151.851 144.110 -32.812 1.00 18.07 ? 68  TRP C NE1 1 
ATOM   3533 C CE2 . TRP C 3 68  ? 151.586 142.931 -33.461 1.00 18.27 ? 68  TRP C CE2 1 
ATOM   3534 C CE3 . TRP C 3 68  ? 149.672 141.517 -33.921 1.00 19.18 ? 68  TRP C CE3 1 
ATOM   3535 C CZ2 . TRP C 3 68  ? 152.450 142.068 -34.149 1.00 19.06 ? 68  TRP C CZ2 1 
ATOM   3536 C CZ3 . TRP C 3 68  ? 150.530 140.660 -34.606 1.00 19.44 ? 68  TRP C CZ3 1 
ATOM   3537 C CH2 . TRP C 3 68  ? 151.905 140.943 -34.712 1.00 19.91 ? 68  TRP C CH2 1 
ATOM   3538 N N   . SER C 3 69  ? 147.377 143.575 -35.244 1.00 20.61 ? 69  SER C N   1 
ATOM   3539 C CA  . SER C 3 69  ? 147.789 143.188 -36.588 1.00 21.38 ? 69  SER C CA  1 
ATOM   3540 C C   . SER C 3 69  ? 147.499 144.278 -37.611 1.00 21.62 ? 69  SER C C   1 
ATOM   3541 O O   . SER C 3 69  ? 148.304 144.515 -38.518 1.00 22.17 ? 69  SER C O   1 
ATOM   3542 C CB  . SER C 3 69  ? 147.109 141.871 -37.002 1.00 24.13 ? 69  SER C CB  1 
ATOM   3543 O OG  . SER C 3 69  ? 145.733 142.060 -37.280 1.00 26.62 ? 69  SER C OG  1 
ATOM   3544 N N   . VAL C 3 70  ? 146.363 144.960 -37.458 1.00 22.04 ? 70  VAL C N   1 
ATOM   3545 C CA  . VAL C 3 70  ? 145.994 146.031 -38.383 1.00 22.30 ? 70  VAL C CA  1 
ATOM   3546 C C   . VAL C 3 70  ? 146.913 147.248 -38.211 1.00 24.00 ? 70  VAL C C   1 
ATOM   3547 O O   . VAL C 3 70  ? 147.445 147.780 -39.193 1.00 24.45 ? 70  VAL C O   1 
ATOM   3548 C CB  . VAL C 3 70  ? 144.516 146.471 -38.183 1.00 25.62 ? 70  VAL C CB  1 
ATOM   3549 C CG1 . VAL C 3 70  ? 144.196 147.635 -39.088 1.00 24.43 ? 70  VAL C CG1 1 
ATOM   3550 C CG2 . VAL C 3 70  ? 143.576 145.312 -38.509 1.00 27.38 ? 70  VAL C CG2 1 
ATOM   3551 N N   . GLU C 3 71  ? 147.122 147.685 -36.974 1.00 22.59 ? 71  GLU C N   1 
ATOM   3552 C CA  . GLU C 3 71  ? 147.979 148.845 -36.770 1.00 24.85 ? 71  GLU C CA  1 
ATOM   3553 C C   . GLU C 3 71  ? 149.436 148.534 -37.091 1.00 23.72 ? 71  GLU C C   1 
ATOM   3554 O O   . GLU C 3 71  ? 150.260 149.430 -37.202 1.00 26.75 ? 71  GLU C O   1 
ATOM   3555 C CB  . GLU C 3 71  ? 147.831 149.404 -35.345 1.00 25.54 ? 71  GLU C CB  1 
ATOM   3556 C CG  . GLU C 3 71  ? 148.137 148.448 -34.221 1.00 23.25 ? 71  GLU C CG  1 
ATOM   3557 C CD  . GLU C 3 71  ? 148.397 149.181 -32.915 1.00 27.35 ? 71  GLU C CD  1 
ATOM   3558 O OE1 . GLU C 3 71  ? 149.201 150.141 -32.929 1.00 25.03 ? 71  GLU C OE1 1 
ATOM   3559 O OE2 . GLU C 3 71  ? 147.811 148.801 -31.880 1.00 25.79 ? 71  GLU C OE2 1 
ATOM   3560 N N   . THR C 3 72  ? 149.755 147.256 -37.249 1.00 26.13 ? 72  THR C N   1 
ATOM   3561 C CA  . THR C 3 72  ? 151.110 146.863 -37.601 1.00 20.79 ? 72  THR C CA  1 
ATOM   3562 C C   . THR C 3 72  ? 151.200 146.857 -39.124 1.00 22.67 ? 72  THR C C   1 
ATOM   3563 O O   . THR C 3 72  ? 152.153 147.383 -39.696 1.00 22.37 ? 72  THR C O   1 
ATOM   3564 C CB  . THR C 3 72  ? 151.444 145.468 -37.038 1.00 23.22 ? 72  THR C CB  1 
ATOM   3565 O OG1 . THR C 3 72  ? 151.451 145.537 -35.606 1.00 22.39 ? 72  THR C OG1 1 
ATOM   3566 C CG2 . THR C 3 72  ? 152.816 144.987 -37.521 1.00 19.08 ? 72  THR C CG2 1 
ATOM   3567 N N   . ALA C 3 73  ? 150.183 146.292 -39.777 1.00 20.22 ? 73  ALA C N   1 
ATOM   3568 C CA  . ALA C 3 73  ? 150.145 146.223 -41.229 1.00 17.75 ? 73  ALA C CA  1 
ATOM   3569 C C   . ALA C 3 73  ? 150.180 147.603 -41.864 1.00 19.46 ? 73  ALA C C   1 
ATOM   3570 O O   . ALA C 3 73  ? 150.762 147.777 -42.932 1.00 20.24 ? 73  ALA C O   1 
ATOM   3571 C CB  . ALA C 3 73  ? 148.889 145.479 -41.697 1.00 19.09 ? 73  ALA C CB  1 
ATOM   3572 N N   . THR C 3 74  ? 149.540 148.572 -41.210 1.00 20.20 ? 74  THR C N   1 
ATOM   3573 C CA  . THR C 3 74  ? 149.490 149.950 -41.685 1.00 19.03 ? 74  THR C CA  1 
ATOM   3574 C C   . THR C 3 74  ? 150.722 150.711 -41.170 1.00 20.59 ? 74  THR C C   1 
ATOM   3575 O O   . THR C 3 74  ? 150.890 151.898 -41.444 1.00 16.19 ? 74  THR C O   1 
ATOM   3576 C CB  . THR C 3 74  ? 148.240 150.691 -41.138 1.00 18.47 ? 74  THR C CB  1 
ATOM   3577 O OG1 . THR C 3 74  ? 148.236 150.613 -39.706 1.00 20.47 ? 74  THR C OG1 1 
ATOM   3578 C CG2 . THR C 3 74  ? 146.945 150.080 -41.678 1.00 17.45 ? 74  THR C CG2 1 
ATOM   3579 N N   . CYS C 3 75  ? 151.546 150.020 -40.389 1.00 20.34 ? 75  CYS C N   1 
ATOM   3580 C CA  . CYS C 3 75  ? 152.745 150.600 -39.793 1.00 23.38 ? 75  CYS C CA  1 
ATOM   3581 C C   . CYS C 3 75  ? 152.466 151.812 -38.889 1.00 23.32 ? 75  CYS C C   1 
ATOM   3582 O O   . CYS C 3 75  ? 153.334 152.653 -38.703 1.00 23.01 ? 75  CYS C O   1 
ATOM   3583 C CB  . CYS C 3 75  ? 153.761 150.982 -40.884 1.00 22.09 ? 75  CYS C CB  1 
ATOM   3584 S SG  . CYS C 3 75  ? 154.414 149.557 -41.835 1.00 32.27 ? 75  CYS C SG  1 
ATOM   3585 N N   . VAL C 3 76  ? 151.266 151.912 -38.328 1.00 21.53 ? 76  VAL C N   1 
ATOM   3586 C CA  . VAL C 3 76  ? 150.980 153.036 -37.437 1.00 22.01 ? 76  VAL C CA  1 
ATOM   3587 C C   . VAL C 3 76  ? 151.784 152.836 -36.134 1.00 23.73 ? 76  VAL C C   1 
ATOM   3588 O O   . VAL C 3 76  ? 152.460 153.741 -35.659 1.00 22.43 ? 76  VAL C O   1 
ATOM   3589 C CB  . VAL C 3 76  ? 149.480 153.120 -37.116 1.00 22.25 ? 76  VAL C CB  1 
ATOM   3590 C CG1 . VAL C 3 76  ? 149.224 154.232 -36.107 1.00 24.19 ? 76  VAL C CG1 1 
ATOM   3591 C CG2 . VAL C 3 76  ? 148.694 153.379 -38.393 1.00 18.16 ? 76  VAL C CG2 1 
ATOM   3592 N N   . GLY C 3 77  ? 151.708 151.633 -35.574 1.00 25.41 ? 77  GLY C N   1 
ATOM   3593 C CA  . GLY C 3 77  ? 152.454 151.305 -34.366 1.00 28.20 ? 77  GLY C CA  1 
ATOM   3594 C C   . GLY C 3 77  ? 152.338 152.202 -33.140 1.00 28.07 ? 77  GLY C C   1 
ATOM   3595 O O   . GLY C 3 77  ? 153.361 152.634 -32.583 1.00 26.10 ? 77  GLY C O   1 
ATOM   3596 N N   . TYR C 3 78  ? 151.107 152.464 -32.706 1.00 25.40 ? 78  TYR C N   1 
ATOM   3597 C CA  . TYR C 3 78  ? 150.862 153.300 -31.533 1.00 24.63 ? 78  TYR C CA  1 
ATOM   3598 C C   . TYR C 3 78  ? 151.762 152.929 -30.365 1.00 22.16 ? 78  TYR C C   1 
ATOM   3599 O O   . TYR C 3 78  ? 152.244 153.796 -29.638 1.00 19.99 ? 78  TYR C O   1 
ATOM   3600 C CB  . TYR C 3 78  ? 149.407 153.167 -31.061 1.00 22.85 ? 78  TYR C CB  1 
ATOM   3601 C CG  . TYR C 3 78  ? 148.389 153.763 -31.994 1.00 22.16 ? 78  TYR C CG  1 
ATOM   3602 C CD1 . TYR C 3 78  ? 147.385 152.974 -32.555 1.00 21.04 ? 78  TYR C CD1 1 
ATOM   3603 C CD2 . TYR C 3 78  ? 148.415 155.121 -32.306 1.00 21.15 ? 78  TYR C CD2 1 
ATOM   3604 C CE1 . TYR C 3 78  ? 146.429 153.522 -33.406 1.00 21.63 ? 78  TYR C CE1 1 
ATOM   3605 C CE2 . TYR C 3 78  ? 147.460 155.682 -33.155 1.00 20.16 ? 78  TYR C CE2 1 
ATOM   3606 C CZ  . TYR C 3 78  ? 146.470 154.875 -33.697 1.00 21.98 ? 78  TYR C CZ  1 
ATOM   3607 O OH  . TYR C 3 78  ? 145.498 155.418 -34.498 1.00 22.18 ? 78  TYR C OH  1 
ATOM   3608 N N   . GLY C 3 79  ? 151.979 151.634 -30.175 1.00 21.79 ? 79  GLY C N   1 
ATOM   3609 C CA  . GLY C 3 79  ? 152.802 151.205 -29.058 1.00 19.25 ? 79  GLY C CA  1 
ATOM   3610 C C   . GLY C 3 79  ? 151.940 150.713 -27.903 1.00 22.99 ? 79  GLY C C   1 
ATOM   3611 O O   . GLY C 3 79  ? 152.437 150.502 -26.789 1.00 23.50 ? 79  GLY C O   1 
ATOM   3612 N N   . ASP C 3 80  ? 150.641 150.533 -28.149 1.00 22.24 ? 80  ASP C N   1 
ATOM   3613 C CA  . ASP C 3 80  ? 149.763 150.039 -27.095 1.00 24.55 ? 80  ASP C CA  1 
ATOM   3614 C C   . ASP C 3 80  ? 149.951 148.536 -26.965 1.00 23.39 ? 80  ASP C C   1 
ATOM   3615 O O   . ASP C 3 80  ? 149.769 147.978 -25.895 1.00 24.32 ? 80  ASP C O   1 
ATOM   3616 C CB  . ASP C 3 80  ? 148.289 150.389 -27.371 1.00 23.50 ? 80  ASP C CB  1 
ATOM   3617 C CG  . ASP C 3 80  ? 147.810 149.929 -28.734 1.00 25.46 ? 80  ASP C CG  1 
ATOM   3618 O OD1 . ASP C 3 80  ? 148.644 149.741 -29.641 1.00 24.18 ? 80  ASP C OD1 1 
ATOM   3619 O OD2 . ASP C 3 80  ? 146.584 149.775 -28.906 1.00 25.25 ? 80  ASP C OD2 1 
ATOM   3620 N N   . LEU C 3 81  ? 150.352 147.891 -28.058 1.00 24.47 ? 81  LEU C N   1 
ATOM   3621 C CA  . LEU C 3 81  ? 150.574 146.453 -28.055 1.00 21.55 ? 81  LEU C CA  1 
ATOM   3622 C C   . LEU C 3 81  ? 151.695 146.094 -29.006 1.00 21.22 ? 81  LEU C C   1 
ATOM   3623 O O   . LEU C 3 81  ? 151.801 146.675 -30.083 1.00 19.85 ? 81  LEU C O   1 
ATOM   3624 C CB  . LEU C 3 81  ? 149.304 145.715 -28.505 1.00 24.67 ? 81  LEU C CB  1 
ATOM   3625 C CG  . LEU C 3 81  ? 148.037 145.849 -27.656 1.00 26.04 ? 81  LEU C CG  1 
ATOM   3626 C CD1 . LEU C 3 81  ? 146.830 145.389 -28.466 1.00 29.82 ? 81  LEU C CD1 1 
ATOM   3627 C CD2 . LEU C 3 81  ? 148.179 145.018 -26.380 1.00 25.63 ? 81  LEU C CD2 1 
ATOM   3628 N N   . TYR C 3 82  ? 152.514 145.116 -28.622 1.00 17.33 ? 82  TYR C N   1 
ATOM   3629 C CA  . TYR C 3 82  ? 153.601 144.665 -29.473 1.00 17.45 ? 82  TYR C CA  1 
ATOM   3630 C C   . TYR C 3 82  ? 154.154 143.364 -28.911 1.00 17.84 ? 82  TYR C C   1 
ATOM   3631 O O   . TYR C 3 82  ? 154.042 143.100 -27.713 1.00 15.24 ? 82  TYR C O   1 
ATOM   3632 C CB  . TYR C 3 82  ? 154.702 145.744 -29.550 1.00 19.93 ? 82  TYR C CB  1 
ATOM   3633 C CG  . TYR C 3 82  ? 155.117 146.306 -28.208 1.00 22.53 ? 82  TYR C CG  1 
ATOM   3634 C CD1 . TYR C 3 82  ? 155.992 145.605 -27.370 1.00 23.43 ? 82  TYR C CD1 1 
ATOM   3635 C CD2 . TYR C 3 82  ? 154.626 147.538 -27.768 1.00 23.24 ? 82  TYR C CD2 1 
ATOM   3636 C CE1 . TYR C 3 82  ? 156.371 146.128 -26.123 1.00 25.97 ? 82  TYR C CE1 1 
ATOM   3637 C CE2 . TYR C 3 82  ? 154.991 148.065 -26.527 1.00 25.39 ? 82  TYR C CE2 1 
ATOM   3638 C CZ  . TYR C 3 82  ? 155.863 147.360 -25.714 1.00 27.89 ? 82  TYR C CZ  1 
ATOM   3639 O OH  . TYR C 3 82  ? 156.231 147.897 -24.505 1.00 30.17 ? 82  TYR C OH  1 
ATOM   3640 N N   . PRO C 3 83  ? 154.747 142.525 -29.770 1.00 18.22 ? 83  PRO C N   1 
ATOM   3641 C CA  . PRO C 3 83  ? 155.318 141.238 -29.347 1.00 18.91 ? 83  PRO C CA  1 
ATOM   3642 C C   . PRO C 3 83  ? 156.632 141.354 -28.580 1.00 20.77 ? 83  PRO C C   1 
ATOM   3643 O O   . PRO C 3 83  ? 157.454 142.230 -28.867 1.00 20.19 ? 83  PRO C O   1 
ATOM   3644 C CB  . PRO C 3 83  ? 155.520 140.506 -30.671 1.00 18.89 ? 83  PRO C CB  1 
ATOM   3645 C CG  . PRO C 3 83  ? 155.922 141.642 -31.588 1.00 18.29 ? 83  PRO C CG  1 
ATOM   3646 C CD  . PRO C 3 83  ? 154.882 142.704 -31.229 1.00 18.48 ? 83  PRO C CD  1 
ATOM   3647 N N   . VAL C 3 84  ? 156.837 140.456 -27.621 1.00 20.53 ? 84  VAL C N   1 
ATOM   3648 C CA  . VAL C 3 84  ? 158.071 140.452 -26.854 1.00 22.70 ? 84  VAL C CA  1 
ATOM   3649 C C   . VAL C 3 84  ? 158.899 139.188 -27.132 1.00 22.74 ? 84  VAL C C   1 
ATOM   3650 O O   . VAL C 3 84  ? 160.063 139.109 -26.746 1.00 25.22 ? 84  VAL C O   1 
ATOM   3651 C CB  . VAL C 3 84  ? 157.799 140.582 -25.321 1.00 25.80 ? 84  VAL C CB  1 
ATOM   3652 C CG1 . VAL C 3 84  ? 157.237 141.971 -25.009 1.00 24.63 ? 84  VAL C CG1 1 
ATOM   3653 C CG2 . VAL C 3 84  ? 156.819 139.499 -24.856 1.00 23.78 ? 84  VAL C CG2 1 
ATOM   3654 N N   . THR C 3 85  ? 158.317 138.211 -27.824 1.00 23.46 ? 85  THR C N   1 
ATOM   3655 C CA  . THR C 3 85  ? 159.049 136.978 -28.120 1.00 22.00 ? 85  THR C CA  1 
ATOM   3656 C C   . THR C 3 85  ? 159.597 136.930 -29.539 1.00 21.93 ? 85  THR C C   1 
ATOM   3657 O O   . THR C 3 85  ? 159.157 137.665 -30.430 1.00 18.66 ? 85  THR C O   1 
ATOM   3658 C CB  . THR C 3 85  ? 158.171 135.718 -27.921 1.00 23.25 ? 85  THR C CB  1 
ATOM   3659 O OG1 . THR C 3 85  ? 157.167 135.664 -28.943 1.00 21.14 ? 85  THR C OG1 1 
ATOM   3660 C CG2 . THR C 3 85  ? 157.501 135.748 -26.555 1.00 24.92 ? 85  THR C CG2 1 
ATOM   3661 N N   . LEU C 3 86  ? 160.562 136.038 -29.738 1.00 20.44 ? 86  LEU C N   1 
ATOM   3662 C CA  . LEU C 3 86  ? 161.186 135.848 -31.030 1.00 21.29 ? 86  LEU C CA  1 
ATOM   3663 C C   . LEU C 3 86  ? 160.159 135.530 -32.099 1.00 19.35 ? 86  LEU C C   1 
ATOM   3664 O O   . LEU C 3 86  ? 160.138 136.157 -33.158 1.00 20.71 ? 86  LEU C O   1 
ATOM   3665 C CB  . LEU C 3 86  ? 162.196 134.709 -30.953 1.00 23.58 ? 86  LEU C CB  1 
ATOM   3666 C CG  . LEU C 3 86  ? 162.767 134.185 -32.274 1.00 26.10 ? 86  LEU C CG  1 
ATOM   3667 C CD1 . LEU C 3 86  ? 163.524 135.290 -33.017 1.00 28.38 ? 86  LEU C CD1 1 
ATOM   3668 C CD2 . LEU C 3 86  ? 163.718 133.024 -31.954 1.00 30.40 ? 86  LEU C CD2 1 
ATOM   3669 N N   . TRP C 3 87  ? 159.306 134.549 -31.831 1.00 19.96 ? 87  TRP C N   1 
ATOM   3670 C CA  . TRP C 3 87  ? 158.314 134.168 -32.823 1.00 22.21 ? 87  TRP C CA  1 
ATOM   3671 C C   . TRP C 3 87  ? 157.204 135.195 -32.968 1.00 22.45 ? 87  TRP C C   1 
ATOM   3672 O O   . TRP C 3 87  ? 156.662 135.358 -34.050 1.00 22.39 ? 87  TRP C O   1 
ATOM   3673 C CB  . TRP C 3 87  ? 157.757 132.772 -32.517 1.00 28.30 ? 87  TRP C CB  1 
ATOM   3674 C CG  . TRP C 3 87  ? 158.769 131.694 -32.818 1.00 35.34 ? 87  TRP C CG  1 
ATOM   3675 C CD1 . TRP C 3 87  ? 159.601 131.071 -31.927 1.00 38.05 ? 87  TRP C CD1 1 
ATOM   3676 C CD2 . TRP C 3 87  ? 159.131 131.198 -34.115 1.00 37.21 ? 87  TRP C CD2 1 
ATOM   3677 N NE1 . TRP C 3 87  ? 160.462 130.225 -32.591 1.00 40.44 ? 87  TRP C NE1 1 
ATOM   3678 C CE2 . TRP C 3 87  ? 160.195 130.284 -33.934 1.00 39.75 ? 87  TRP C CE2 1 
ATOM   3679 C CE3 . TRP C 3 87  ? 158.660 131.441 -35.413 1.00 39.18 ? 87  TRP C CE3 1 
ATOM   3680 C CZ2 . TRP C 3 87  ? 160.799 129.610 -35.006 1.00 41.68 ? 87  TRP C CZ2 1 
ATOM   3681 C CZ3 . TRP C 3 87  ? 159.261 130.771 -36.483 1.00 40.89 ? 87  TRP C CZ3 1 
ATOM   3682 C CH2 . TRP C 3 87  ? 160.320 129.866 -36.269 1.00 40.27 ? 87  TRP C CH2 1 
ATOM   3683 N N   . GLY C 3 88  ? 156.875 135.898 -31.889 1.00 20.95 ? 88  GLY C N   1 
ATOM   3684 C CA  . GLY C 3 88  ? 155.852 136.918 -31.995 1.00 21.80 ? 88  GLY C CA  1 
ATOM   3685 C C   . GLY C 3 88  ? 156.397 138.015 -32.898 1.00 23.07 ? 88  GLY C C   1 
ATOM   3686 O O   . GLY C 3 88  ? 155.690 138.566 -33.737 1.00 21.65 ? 88  GLY C O   1 
ATOM   3687 N N   . ARG C 3 89  ? 157.679 138.324 -32.724 1.00 22.36 ? 89  ARG C N   1 
ATOM   3688 C CA  . ARG C 3 89  ? 158.319 139.355 -33.521 1.00 20.86 ? 89  ARG C CA  1 
ATOM   3689 C C   . ARG C 3 89  ? 158.466 138.930 -34.972 1.00 22.41 ? 89  ARG C C   1 
ATOM   3690 O O   . ARG C 3 89  ? 158.315 139.756 -35.875 1.00 24.24 ? 89  ARG C O   1 
ATOM   3691 C CB  . ARG C 3 89  ? 159.668 139.725 -32.893 1.00 17.24 ? 89  ARG C CB  1 
ATOM   3692 C CG  . ARG C 3 89  ? 159.458 140.551 -31.633 1.00 17.61 ? 89  ARG C CG  1 
ATOM   3693 C CD  . ARG C 3 89  ? 160.693 140.690 -30.762 1.00 19.01 ? 89  ARG C CD  1 
ATOM   3694 N NE  . ARG C 3 89  ? 160.452 141.659 -29.700 1.00 18.70 ? 89  ARG C NE  1 
ATOM   3695 C CZ  . ARG C 3 89  ? 161.333 141.975 -28.760 1.00 19.52 ? 89  ARG C CZ  1 
ATOM   3696 N NH1 . ARG C 3 89  ? 162.529 141.387 -28.736 1.00 17.18 ? 89  ARG C NH1 1 
ATOM   3697 N NH2 . ARG C 3 89  ? 161.026 142.900 -27.863 1.00 16.82 ? 89  ARG C NH2 1 
ATOM   3698 N N   . LEU C 3 90  ? 158.750 137.648 -35.204 1.00 24.27 ? 90  LEU C N   1 
ATOM   3699 C CA  . LEU C 3 90  ? 158.872 137.150 -36.570 1.00 24.04 ? 90  LEU C CA  1 
ATOM   3700 C C   . LEU C 3 90  ? 157.515 137.268 -37.249 1.00 24.67 ? 90  LEU C C   1 
ATOM   3701 O O   . LEU C 3 90  ? 157.419 137.636 -38.423 1.00 25.83 ? 90  LEU C O   1 
ATOM   3702 C CB  . LEU C 3 90  ? 159.341 135.688 -36.588 1.00 25.38 ? 90  LEU C CB  1 
ATOM   3703 C CG  . LEU C 3 90  ? 160.828 135.424 -36.336 1.00 25.49 ? 90  LEU C CG  1 
ATOM   3704 C CD1 . LEU C 3 90  ? 161.108 133.930 -36.375 1.00 25.56 ? 90  LEU C CD1 1 
ATOM   3705 C CD2 . LEU C 3 90  ? 161.660 136.137 -37.394 1.00 27.89 ? 90  LEU C CD2 1 
ATOM   3706 N N   . VAL C 3 91  ? 156.460 136.950 -36.508 1.00 23.77 ? 91  VAL C N   1 
ATOM   3707 C CA  . VAL C 3 91  ? 155.114 137.054 -37.047 1.00 20.95 ? 91  VAL C CA  1 
ATOM   3708 C C   . VAL C 3 91  ? 154.823 138.517 -37.395 1.00 21.88 ? 91  VAL C C   1 
ATOM   3709 O O   . VAL C 3 91  ? 154.188 138.818 -38.413 1.00 19.92 ? 91  VAL C O   1 
ATOM   3710 C CB  . VAL C 3 91  ? 154.064 136.545 -36.025 1.00 22.06 ? 91  VAL C CB  1 
ATOM   3711 C CG1 . VAL C 3 91  ? 152.661 137.049 -36.399 1.00 15.78 ? 91  VAL C CG1 1 
ATOM   3712 C CG2 . VAL C 3 91  ? 154.087 135.023 -35.989 1.00 18.53 ? 91  VAL C CG2 1 
ATOM   3713 N N   . ALA C 3 92  ? 155.293 139.421 -36.542 1.00 20.81 ? 92  ALA C N   1 
ATOM   3714 C CA  . ALA C 3 92  ? 155.090 140.854 -36.757 1.00 21.10 ? 92  ALA C CA  1 
ATOM   3715 C C   . ALA C 3 92  ? 155.761 141.304 -38.057 1.00 22.39 ? 92  ALA C C   1 
ATOM   3716 O O   . ALA C 3 92  ? 155.196 142.092 -38.832 1.00 20.57 ? 92  ALA C O   1 
ATOM   3717 C CB  . ALA C 3 92  ? 155.657 141.640 -35.577 1.00 19.37 ? 92  ALA C CB  1 
ATOM   3718 N N   . VAL C 3 93  ? 156.972 140.809 -38.296 1.00 21.69 ? 93  VAL C N   1 
ATOM   3719 C CA  . VAL C 3 93  ? 157.691 141.184 -39.508 1.00 23.65 ? 93  VAL C CA  1 
ATOM   3720 C C   . VAL C 3 93  ? 156.886 140.803 -40.750 1.00 22.48 ? 93  VAL C C   1 
ATOM   3721 O O   . VAL C 3 93  ? 156.782 141.589 -41.693 1.00 22.56 ? 93  VAL C O   1 
ATOM   3722 C CB  . VAL C 3 93  ? 159.099 140.520 -39.567 1.00 24.19 ? 93  VAL C CB  1 
ATOM   3723 C CG1 . VAL C 3 93  ? 159.749 140.761 -40.932 1.00 25.86 ? 93  VAL C CG1 1 
ATOM   3724 C CG2 . VAL C 3 93  ? 159.987 141.110 -38.474 1.00 25.84 ? 93  VAL C CG2 1 
ATOM   3725 N N   . VAL C 3 94  ? 156.302 139.610 -40.743 1.00 22.38 ? 94  VAL C N   1 
ATOM   3726 C CA  . VAL C 3 94  ? 155.508 139.157 -41.881 1.00 21.61 ? 94  VAL C CA  1 
ATOM   3727 C C   . VAL C 3 94  ? 154.322 140.096 -42.092 1.00 22.69 ? 94  VAL C C   1 
ATOM   3728 O O   . VAL C 3 94  ? 154.025 140.488 -43.221 1.00 22.93 ? 94  VAL C O   1 
ATOM   3729 C CB  . VAL C 3 94  ? 155.010 137.700 -41.670 1.00 23.43 ? 94  VAL C CB  1 
ATOM   3730 C CG1 . VAL C 3 94  ? 154.040 137.282 -42.788 1.00 24.72 ? 94  VAL C CG1 1 
ATOM   3731 C CG2 . VAL C 3 94  ? 156.201 136.756 -41.672 1.00 23.56 ? 94  VAL C CG2 1 
ATOM   3732 N N   . VAL C 3 95  ? 153.658 140.475 -40.998 1.00 22.76 ? 95  VAL C N   1 
ATOM   3733 C CA  . VAL C 3 95  ? 152.508 141.368 -41.081 1.00 22.69 ? 95  VAL C CA  1 
ATOM   3734 C C   . VAL C 3 95  ? 152.927 142.730 -41.646 1.00 20.35 ? 95  VAL C C   1 
ATOM   3735 O O   . VAL C 3 95  ? 152.265 143.270 -42.523 1.00 19.38 ? 95  VAL C O   1 
ATOM   3736 C CB  . VAL C 3 95  ? 151.840 141.567 -39.688 1.00 22.13 ? 95  VAL C CB  1 
ATOM   3737 C CG1 . VAL C 3 95  ? 150.679 142.554 -39.803 1.00 20.25 ? 95  VAL C CG1 1 
ATOM   3738 C CG2 . VAL C 3 95  ? 151.334 140.233 -39.157 1.00 20.55 ? 95  VAL C CG2 1 
ATOM   3739 N N   . MET C 3 96  ? 154.027 143.279 -41.131 1.00 23.21 ? 96  MET C N   1 
ATOM   3740 C CA  . MET C 3 96  ? 154.550 144.560 -41.604 1.00 21.22 ? 96  MET C CA  1 
ATOM   3741 C C   . MET C 3 96  ? 154.816 144.519 -43.107 1.00 21.85 ? 96  MET C C   1 
ATOM   3742 O O   . MET C 3 96  ? 154.352 145.378 -43.858 1.00 21.26 ? 96  MET C O   1 
ATOM   3743 C CB  . MET C 3 96  ? 155.867 144.898 -40.901 1.00 23.61 ? 96  MET C CB  1 
ATOM   3744 C CG  . MET C 3 96  ? 155.774 145.132 -39.397 1.00 24.96 ? 96  MET C CG  1 
ATOM   3745 S SD  . MET C 3 96  ? 157.438 145.277 -38.687 1.00 27.97 ? 96  MET C SD  1 
ATOM   3746 C CE  . MET C 3 96  ? 157.090 145.239 -36.925 1.00 25.58 ? 96  MET C CE  1 
ATOM   3747 N N   . VAL C 3 97  ? 155.589 143.524 -43.533 1.00 20.85 ? 97  VAL C N   1 
ATOM   3748 C CA  . VAL C 3 97  ? 155.945 143.383 -44.940 1.00 23.16 ? 97  VAL C CA  1 
ATOM   3749 C C   . VAL C 3 97  ? 154.713 143.185 -45.821 1.00 20.93 ? 97  VAL C C   1 
ATOM   3750 O O   . VAL C 3 97  ? 154.620 143.774 -46.891 1.00 23.51 ? 97  VAL C O   1 
ATOM   3751 C CB  . VAL C 3 97  ? 156.939 142.200 -45.154 1.00 24.48 ? 97  VAL C CB  1 
ATOM   3752 C CG1 . VAL C 3 97  ? 157.155 141.950 -46.646 1.00 27.28 ? 97  VAL C CG1 1 
ATOM   3753 C CG2 . VAL C 3 97  ? 158.257 142.513 -44.494 1.00 26.40 ? 97  VAL C CG2 1 
ATOM   3754 N N   . ALA C 3 98  ? 153.767 142.368 -45.368 1.00 20.51 ? 98  ALA C N   1 
ATOM   3755 C CA  . ALA C 3 98  ? 152.542 142.124 -46.129 1.00 19.41 ? 98  ALA C CA  1 
ATOM   3756 C C   . ALA C 3 98  ? 151.746 143.430 -46.276 1.00 22.27 ? 98  ALA C C   1 
ATOM   3757 O O   . ALA C 3 98  ? 151.175 143.712 -47.342 1.00 21.36 ? 98  ALA C O   1 
ATOM   3758 C CB  . ALA C 3 98  ? 151.676 141.062 -45.424 1.00 19.39 ? 98  ALA C CB  1 
ATOM   3759 N N   . GLY C 3 99  ? 151.701 144.220 -45.208 1.00 19.59 ? 99  GLY C N   1 
ATOM   3760 C CA  . GLY C 3 99  ? 150.969 145.479 -45.268 1.00 22.73 ? 99  GLY C CA  1 
ATOM   3761 C C   . GLY C 3 99  ? 151.650 146.469 -46.198 1.00 22.32 ? 99  GLY C C   1 
ATOM   3762 O O   . GLY C 3 99  ? 151.018 147.032 -47.100 1.00 21.79 ? 99  GLY C O   1 
ATOM   3763 N N   . ILE C 3 100 ? 152.945 146.677 -45.989 1.00 21.82 ? 100 ILE C N   1 
ATOM   3764 C CA  . ILE C 3 100 ? 153.709 147.602 -46.828 1.00 25.95 ? 100 ILE C CA  1 
ATOM   3765 C C   . ILE C 3 100 ? 153.597 147.219 -48.306 1.00 26.10 ? 100 ILE C C   1 
ATOM   3766 O O   . ILE C 3 100 ? 153.329 148.060 -49.162 1.00 26.19 ? 100 ILE C O   1 
ATOM   3767 C CB  . ILE C 3 100 ? 155.194 147.617 -46.410 1.00 23.88 ? 100 ILE C CB  1 
ATOM   3768 C CG1 . ILE C 3 100 ? 155.316 148.245 -45.021 1.00 27.25 ? 100 ILE C CG1 1 
ATOM   3769 C CG2 . ILE C 3 100 ? 156.025 148.401 -47.415 1.00 24.75 ? 100 ILE C CG2 1 
ATOM   3770 C CD1 . ILE C 3 100 ? 156.730 148.234 -44.450 1.00 27.03 ? 100 ILE C CD1 1 
ATOM   3771 N N   . THR C 3 101 ? 153.795 145.939 -48.587 1.00 27.48 ? 101 THR C N   1 
ATOM   3772 C CA  . THR C 3 101 ? 153.713 145.403 -49.940 1.00 29.13 ? 101 THR C CA  1 
ATOM   3773 C C   . THR C 3 101 ? 152.340 145.597 -50.551 1.00 27.92 ? 101 THR C C   1 
ATOM   3774 O O   . THR C 3 101 ? 152.216 146.027 -51.695 1.00 28.91 ? 101 THR C O   1 
ATOM   3775 C CB  . THR C 3 101 ? 154.025 143.900 -49.944 1.00 28.14 ? 101 THR C CB  1 
ATOM   3776 O OG1 . THR C 3 101 ? 155.400 143.710 -49.596 1.00 32.55 ? 101 THR C OG1 1 
ATOM   3777 C CG2 . THR C 3 101 ? 153.747 143.291 -51.310 1.00 33.55 ? 101 THR C CG2 1 
ATOM   3778 N N   . SER C 3 102 ? 151.312 145.254 -49.787 1.00 28.08 ? 102 SER C N   1 
ATOM   3779 C CA  . SER C 3 102 ? 149.938 145.383 -50.246 1.00 29.33 ? 102 SER C CA  1 
ATOM   3780 C C   . SER C 3 102 ? 149.555 146.819 -50.574 1.00 28.42 ? 102 SER C C   1 
ATOM   3781 O O   . SER C 3 102 ? 149.059 147.098 -51.664 1.00 28.26 ? 102 SER C O   1 
ATOM   3782 C CB  . SER C 3 102 ? 148.979 144.827 -49.192 1.00 30.37 ? 102 SER C CB  1 
ATOM   3783 O OG  . SER C 3 102 ? 149.107 143.422 -49.115 1.00 35.21 ? 102 SER C OG  1 
ATOM   3784 N N   . PHE C 3 103 ? 149.774 147.737 -49.637 1.00 29.02 ? 103 PHE C N   1 
ATOM   3785 C CA  . PHE C 3 103 ? 149.425 149.129 -49.901 1.00 28.84 ? 103 PHE C CA  1 
ATOM   3786 C C   . PHE C 3 103 ? 150.329 149.675 -51.007 1.00 28.38 ? 103 PHE C C   1 
ATOM   3787 O O   . PHE C 3 103 ? 149.895 150.462 -51.843 1.00 27.18 ? 103 PHE C O   1 
ATOM   3788 C CB  . PHE C 3 103 ? 149.540 149.974 -48.624 1.00 28.89 ? 103 PHE C CB  1 
ATOM   3789 C CG  . PHE C 3 103 ? 148.469 149.673 -47.598 1.00 29.40 ? 103 PHE C CG  1 
ATOM   3790 C CD1 . PHE C 3 103 ? 148.768 148.957 -46.443 1.00 29.77 ? 103 PHE C CD1 1 
ATOM   3791 C CD2 . PHE C 3 103 ? 147.155 150.094 -47.801 1.00 32.79 ? 103 PHE C CD2 1 
ATOM   3792 C CE1 . PHE C 3 103 ? 147.776 148.662 -45.505 1.00 31.34 ? 103 PHE C CE1 1 
ATOM   3793 C CE2 . PHE C 3 103 ? 146.151 149.805 -46.870 1.00 32.16 ? 103 PHE C CE2 1 
ATOM   3794 C CZ  . PHE C 3 103 ? 146.462 149.087 -45.722 1.00 32.50 ? 103 PHE C CZ  1 
ATOM   3795 N N   . GLY C 3 104 ? 151.582 149.236 -51.026 1.00 28.11 ? 104 GLY C N   1 
ATOM   3796 C CA  . GLY C 3 104 ? 152.493 149.707 -52.054 1.00 28.39 ? 104 GLY C CA  1 
ATOM   3797 C C   . GLY C 3 104 ? 151.989 149.264 -53.416 1.00 29.83 ? 104 GLY C C   1 
ATOM   3798 O O   . GLY C 3 104 ? 152.092 149.986 -54.412 1.00 27.93 ? 104 GLY C O   1 
ATOM   3799 N N   . LEU C 3 105 ? 151.413 148.070 -53.452 1.00 29.59 ? 105 LEU C N   1 
ATOM   3800 C CA  . LEU C 3 105 ? 150.902 147.538 -54.693 1.00 29.33 ? 105 LEU C CA  1 
ATOM   3801 C C   . LEU C 3 105 ? 149.680 148.313 -55.184 1.00 30.19 ? 105 LEU C C   1 
ATOM   3802 O O   . LEU C 3 105 ? 149.461 148.431 -56.388 1.00 31.64 ? 105 LEU C O   1 
ATOM   3803 C CB  . LEU C 3 105 ? 150.584 146.060 -54.523 1.00 29.22 ? 105 LEU C CB  1 
ATOM   3804 C CG  . LEU C 3 105 ? 150.249 145.364 -55.835 1.00 31.15 ? 105 LEU C CG  1 
ATOM   3805 C CD1 . LEU C 3 105 ? 150.834 143.960 -55.839 1.00 30.32 ? 105 LEU C CD1 1 
ATOM   3806 C CD2 . LEU C 3 105 ? 148.738 145.367 -56.026 1.00 30.36 ? 105 LEU C CD2 1 
ATOM   3807 N N   . VAL C 3 106 ? 148.886 148.842 -54.260 1.00 28.64 ? 106 VAL C N   1 
ATOM   3808 C CA  . VAL C 3 106 ? 147.714 149.619 -54.638 1.00 26.64 ? 106 VAL C CA  1 
ATOM   3809 C C   . VAL C 3 106 ? 148.198 150.926 -55.275 1.00 26.97 ? 106 VAL C C   1 
ATOM   3810 O O   . VAL C 3 106 ? 147.650 151.397 -56.278 1.00 25.29 ? 106 VAL C O   1 
ATOM   3811 C CB  . VAL C 3 106 ? 146.825 149.939 -53.411 1.00 27.29 ? 106 VAL C CB  1 
ATOM   3812 C CG1 . VAL C 3 106 ? 145.709 150.898 -53.811 1.00 28.65 ? 106 VAL C CG1 1 
ATOM   3813 C CG2 . VAL C 3 106 ? 146.219 148.654 -52.854 1.00 27.57 ? 106 VAL C CG2 1 
ATOM   3814 N N   . THR C 3 107 ? 149.231 151.511 -54.681 1.00 24.45 ? 107 THR C N   1 
ATOM   3815 C CA  . THR C 3 107 ? 149.799 152.745 -55.204 1.00 24.05 ? 107 THR C CA  1 
ATOM   3816 C C   . THR C 3 107 ? 150.277 152.557 -56.637 1.00 24.15 ? 107 THR C C   1 
ATOM   3817 O O   . THR C 3 107 ? 150.039 153.412 -57.496 1.00 24.48 ? 107 THR C O   1 
ATOM   3818 C CB  . THR C 3 107 ? 150.982 153.210 -54.340 1.00 23.57 ? 107 THR C CB  1 
ATOM   3819 O OG1 . THR C 3 107 ? 150.493 153.569 -53.045 1.00 25.53 ? 107 THR C OG1 1 
ATOM   3820 C CG2 . THR C 3 107 ? 151.690 154.405 -54.972 1.00 22.96 ? 107 THR C CG2 1 
ATOM   3821 N N   . ALA C 3 108 ? 150.942 151.431 -56.890 1.00 22.71 ? 108 ALA C N   1 
ATOM   3822 C CA  . ALA C 3 108 ? 151.466 151.128 -58.218 1.00 22.82 ? 108 ALA C CA  1 
ATOM   3823 C C   . ALA C 3 108 ? 150.349 150.939 -59.221 1.00 23.60 ? 108 ALA C C   1 
ATOM   3824 O O   . ALA C 3 108 ? 150.514 151.242 -60.406 1.00 23.79 ? 108 ALA C O   1 
ATOM   3825 C CB  . ALA C 3 108 ? 152.333 149.869 -58.167 1.00 23.90 ? 108 ALA C CB  1 
ATOM   3826 N N   . ALA C 3 109 ? 149.217 150.424 -58.746 1.00 23.66 ? 109 ALA C N   1 
ATOM   3827 C CA  . ALA C 3 109 ? 148.065 150.188 -59.606 1.00 24.69 ? 109 ALA C CA  1 
ATOM   3828 C C   . ALA C 3 109 ? 147.437 151.530 -59.968 1.00 27.23 ? 109 ALA C C   1 
ATOM   3829 O O   . ALA C 3 109 ? 146.992 151.742 -61.112 1.00 26.92 ? 109 ALA C O   1 
ATOM   3830 C CB  . ALA C 3 109 ? 147.053 149.304 -58.898 1.00 22.81 ? 109 ALA C CB  1 
ATOM   3831 N N   . LEU C 3 110 ? 147.395 152.431 -58.988 1.00 25.00 ? 110 LEU C N   1 
ATOM   3832 C CA  . LEU C 3 110 ? 146.848 153.759 -59.216 1.00 27.53 ? 110 LEU C CA  1 
ATOM   3833 C C   . LEU C 3 110 ? 147.734 154.499 -60.214 1.00 28.29 ? 110 LEU C C   1 
ATOM   3834 O O   . LEU C 3 110 ? 147.235 155.209 -61.089 1.00 29.23 ? 110 LEU C O   1 
ATOM   3835 C CB  . LEU C 3 110 ? 146.778 154.543 -57.907 1.00 28.06 ? 110 LEU C CB  1 
ATOM   3836 C CG  . LEU C 3 110 ? 145.717 154.070 -56.916 1.00 27.97 ? 110 LEU C CG  1 
ATOM   3837 C CD1 . LEU C 3 110 ? 145.874 154.833 -55.610 1.00 29.16 ? 110 LEU C CD1 1 
ATOM   3838 C CD2 . LEU C 3 110 ? 144.336 154.306 -57.505 1.00 29.78 ? 110 LEU C CD2 1 
ATOM   3839 N N   . ALA C 3 111 ? 149.048 154.325 -60.092 1.00 28.14 ? 111 ALA C N   1 
ATOM   3840 C CA  . ALA C 3 111 ? 149.978 154.991 -61.006 1.00 29.62 ? 111 ALA C CA  1 
ATOM   3841 C C   . ALA C 3 111 ? 149.751 154.501 -62.437 1.00 29.85 ? 111 ALA C C   1 
ATOM   3842 O O   . ALA C 3 111 ? 149.711 155.289 -63.383 1.00 30.23 ? 111 ALA C O   1 
ATOM   3843 C CB  . ALA C 3 111 ? 151.424 154.723 -60.588 1.00 26.35 ? 111 ALA C CB  1 
ATOM   3844 N N   . THR C 3 112 ? 149.602 153.193 -62.587 1.00 30.31 ? 112 THR C N   1 
ATOM   3845 C CA  . THR C 3 112 ? 149.382 152.608 -63.900 1.00 30.64 ? 112 THR C CA  1 
ATOM   3846 C C   . THR C 3 112 ? 148.097 153.165 -64.515 1.00 31.62 ? 112 THR C C   1 
ATOM   3847 O O   . THR C 3 112 ? 148.050 153.507 -65.702 1.00 31.59 ? 112 THR C O   1 
ATOM   3848 C CB  . THR C 3 112 ? 149.303 151.095 -63.782 1.00 30.93 ? 112 THR C CB  1 
ATOM   3849 O OG1 . THR C 3 112 ? 150.510 150.618 -63.169 1.00 28.77 ? 112 THR C OG1 1 
ATOM   3850 C CG2 . THR C 3 112 ? 149.133 150.453 -65.161 1.00 30.62 ? 112 THR C CG2 1 
ATOM   3851 N N   . TRP C 3 113 ? 147.058 153.269 -63.695 1.00 31.80 ? 113 TRP C N   1 
ATOM   3852 C CA  . TRP C 3 113 ? 145.780 153.796 -64.147 1.00 32.44 ? 113 TRP C CA  1 
ATOM   3853 C C   . TRP C 3 113 ? 145.957 155.229 -64.658 1.00 31.66 ? 113 TRP C C   1 
ATOM   3854 O O   . TRP C 3 113 ? 145.482 155.561 -65.745 1.00 30.29 ? 113 TRP C O   1 
ATOM   3855 C CB  . TRP C 3 113 ? 144.759 153.752 -63.003 1.00 34.83 ? 113 TRP C CB  1 
ATOM   3856 C CG  . TRP C 3 113 ? 143.437 154.371 -63.345 1.00 39.86 ? 113 TRP C CG  1 
ATOM   3857 C CD1 . TRP C 3 113 ? 142.744 154.234 -64.513 1.00 40.73 ? 113 TRP C CD1 1 
ATOM   3858 C CD2 . TRP C 3 113 ? 142.630 155.199 -62.495 1.00 42.17 ? 113 TRP C CD2 1 
ATOM   3859 N NE1 . TRP C 3 113 ? 141.556 154.923 -64.446 1.00 42.25 ? 113 TRP C NE1 1 
ATOM   3860 C CE2 . TRP C 3 113 ? 141.460 155.525 -63.219 1.00 43.10 ? 113 TRP C CE2 1 
ATOM   3861 C CE3 . TRP C 3 113 ? 142.781 155.697 -61.192 1.00 43.56 ? 113 TRP C CE3 1 
ATOM   3862 C CZ2 . TRP C 3 113 ? 140.441 156.330 -62.681 1.00 43.82 ? 113 TRP C CZ2 1 
ATOM   3863 C CZ3 . TRP C 3 113 ? 141.767 156.499 -60.656 1.00 44.92 ? 113 TRP C CZ3 1 
ATOM   3864 C CH2 . TRP C 3 113 ? 140.613 156.805 -61.404 1.00 44.05 ? 113 TRP C CH2 1 
ATOM   3865 N N   . PHE C 3 114 ? 146.641 156.072 -63.884 1.00 29.82 ? 114 PHE C N   1 
ATOM   3866 C CA  . PHE C 3 114 ? 146.870 157.458 -64.302 1.00 29.61 ? 114 PHE C CA  1 
ATOM   3867 C C   . PHE C 3 114 ? 147.776 157.540 -65.530 1.00 28.71 ? 114 PHE C C   1 
ATOM   3868 O O   . PHE C 3 114 ? 147.577 158.389 -66.401 1.00 26.63 ? 114 PHE C O   1 
ATOM   3869 C CB  . PHE C 3 114 ? 147.505 158.295 -63.179 1.00 31.56 ? 114 PHE C CB  1 
ATOM   3870 C CG  . PHE C 3 114 ? 146.627 158.478 -61.968 1.00 34.36 ? 114 PHE C CG  1 
ATOM   3871 C CD1 . PHE C 3 114 ? 145.240 158.410 -62.069 1.00 35.31 ? 114 PHE C CD1 1 
ATOM   3872 C CD2 . PHE C 3 114 ? 147.196 158.758 -60.726 1.00 35.26 ? 114 PHE C CD2 1 
ATOM   3873 C CE1 . PHE C 3 114 ? 144.430 158.621 -60.948 1.00 37.26 ? 114 PHE C CE1 1 
ATOM   3874 C CE2 . PHE C 3 114 ? 146.395 158.971 -59.598 1.00 36.66 ? 114 PHE C CE2 1 
ATOM   3875 C CZ  . PHE C 3 114 ? 145.013 158.902 -59.710 1.00 36.15 ? 114 PHE C CZ  1 
ATOM   3876 N N   . VAL C 3 115 ? 148.791 156.681 -65.588 1.00 27.17 ? 115 VAL C N   1 
ATOM   3877 C CA  . VAL C 3 115 ? 149.703 156.689 -66.731 1.00 28.86 ? 115 VAL C CA  1 
ATOM   3878 C C   . VAL C 3 115 ? 148.935 156.332 -68.009 1.00 29.25 ? 115 VAL C C   1 
ATOM   3879 O O   . VAL C 3 115 ? 149.129 156.953 -69.061 1.00 29.83 ? 115 VAL C O   1 
ATOM   3880 C CB  . VAL C 3 115 ? 150.879 155.695 -66.518 1.00 29.07 ? 115 VAL C CB  1 
ATOM   3881 C CG1 . VAL C 3 115 ? 151.592 155.432 -67.839 1.00 29.34 ? 115 VAL C CG1 1 
ATOM   3882 C CG2 . VAL C 3 115 ? 151.872 156.275 -65.503 1.00 27.89 ? 115 VAL C CG2 1 
ATOM   3883 N N   . GLY C 3 116 ? 148.050 155.343 -67.906 1.00 31.21 ? 116 GLY C N   1 
ATOM   3884 C CA  . GLY C 3 116 ? 147.260 154.928 -69.054 1.00 31.71 ? 116 GLY C CA  1 
ATOM   3885 C C   . GLY C 3 116 ? 146.314 156.021 -69.518 1.00 33.16 ? 116 GLY C C   1 
ATOM   3886 O O   . GLY C 3 116 ? 146.231 156.327 -70.710 1.00 30.84 ? 116 GLY C O   1 
ATOM   3887 N N   . ARG C 3 117 ? 145.602 156.621 -68.570 1.00 33.43 ? 117 ARG C N   1 
ATOM   3888 C CA  . ARG C 3 117 ? 144.661 157.682 -68.890 1.00 34.62 ? 117 ARG C CA  1 
ATOM   3889 C C   . ARG C 3 117 ? 145.371 158.878 -69.524 1.00 35.85 ? 117 ARG C C   1 
ATOM   3890 O O   . ARG C 3 117 ? 144.881 159.451 -70.496 1.00 35.84 ? 117 ARG C O   1 
ATOM   3891 C CB  . ARG C 3 117 ? 143.918 158.118 -67.627 1.00 36.43 ? 117 ARG C CB  1 
ATOM   3892 N N   . GLU C 3 118 ? 146.525 159.255 -68.979 1.00 34.58 ? 118 GLU C N   1 
ATOM   3893 C CA  . GLU C 3 118 ? 147.265 160.387 -69.518 1.00 36.40 ? 118 GLU C CA  1 
ATOM   3894 C C   . GLU C 3 118 ? 147.815 160.104 -70.922 1.00 36.82 ? 118 GLU C C   1 
ATOM   3895 O O   . GLU C 3 118 ? 147.880 161.002 -71.758 1.00 35.82 ? 118 GLU C O   1 
ATOM   3896 C CB  . GLU C 3 118 ? 148.403 160.770 -68.570 1.00 38.60 ? 118 GLU C CB  1 
ATOM   3897 C CG  . GLU C 3 118 ? 149.109 162.071 -68.916 1.00 43.26 ? 118 GLU C CG  1 
ATOM   3898 C CD  . GLU C 3 118 ? 148.154 163.252 -69.050 1.00 46.51 ? 118 GLU C CD  1 
ATOM   3899 O OE1 . GLU C 3 118 ? 147.098 163.277 -68.369 1.00 47.33 ? 118 GLU C OE1 1 
ATOM   3900 O OE2 . GLU C 3 118 ? 148.473 164.168 -69.832 1.00 48.71 ? 118 GLU C OE2 1 
ATOM   3901 N N   . GLN C 3 119 ? 148.217 158.863 -71.182 1.00 36.72 ? 119 GLN C N   1 
ATOM   3902 C CA  . GLN C 3 119 ? 148.733 158.515 -72.504 1.00 37.59 ? 119 GLN C CA  1 
ATOM   3903 C C   . GLN C 3 119 ? 147.612 158.700 -73.538 1.00 39.00 ? 119 GLN C C   1 
ATOM   3904 O O   . GLN C 3 119 ? 147.858 159.147 -74.657 1.00 37.98 ? 119 GLN C O   1 
ATOM   3905 C CB  . GLN C 3 119 ? 149.251 157.070 -72.516 1.00 35.02 ? 119 GLN C CB  1 
ATOM   3906 N N   . GLU C 3 120 ? 146.384 158.362 -73.150 1.00 41.13 ? 120 GLU C N   1 
ATOM   3907 C CA  . GLU C 3 120 ? 145.222 158.506 -74.025 1.00 45.31 ? 120 GLU C CA  1 
ATOM   3908 C C   . GLU C 3 120 ? 144.958 159.989 -74.289 1.00 45.86 ? 120 GLU C C   1 
ATOM   3909 O O   . GLU C 3 120 ? 144.824 160.425 -75.433 1.00 45.52 ? 120 GLU C O   1 
ATOM   3910 C CB  . GLU C 3 120 ? 143.983 157.902 -73.364 1.00 47.84 ? 120 GLU C CB  1 
ATOM   3911 C CG  . GLU C 3 120 ? 144.020 156.400 -73.179 1.00 53.19 ? 120 GLU C CG  1 
ATOM   3912 C CD  . GLU C 3 120 ? 142.768 155.878 -72.499 1.00 56.11 ? 120 GLU C CD  1 
ATOM   3913 O OE1 . GLU C 3 120 ? 141.656 156.241 -72.947 1.00 58.77 ? 120 GLU C OE1 1 
ATOM   3914 O OE2 . GLU C 3 120 ? 142.893 155.106 -71.524 1.00 57.09 ? 120 GLU C OE2 1 
ATOM   3915 N N   . ARG C 3 121 ? 144.879 160.750 -73.203 1.00 45.80 ? 121 ARG C N   1 
ATOM   3916 C CA  . ARG C 3 121 ? 144.628 162.182 -73.252 1.00 46.33 ? 121 ARG C CA  1 
ATOM   3917 C C   . ARG C 3 121 ? 145.680 162.910 -74.088 1.00 46.19 ? 121 ARG C C   1 
ATOM   3918 O O   . ARG C 3 121 ? 145.447 164.017 -74.564 1.00 44.68 ? 121 ARG C O   1 
ATOM   3919 C CB  . ARG C 3 121 ? 144.596 162.724 -71.819 1.00 48.50 ? 121 ARG C CB  1 
ATOM   3920 C CG  . ARG C 3 121 ? 144.348 164.208 -71.665 1.00 50.20 ? 121 ARG C CG  1 
ATOM   3921 C CD  . ARG C 3 121 ? 144.036 164.512 -70.205 1.00 53.56 ? 121 ARG C CD  1 
ATOM   3922 N NE  . ARG C 3 121 ? 144.188 165.926 -69.874 1.00 56.27 ? 121 ARG C NE  1 
ATOM   3923 C CZ  . ARG C 3 121 ? 145.350 166.573 -69.889 1.00 57.13 ? 121 ARG C CZ  1 
ATOM   3924 N NH1 . ARG C 3 121 ? 146.464 165.933 -70.220 1.00 56.00 ? 121 ARG C NH1 1 
ATOM   3925 N NH2 . ARG C 3 121 ? 145.399 167.862 -69.569 1.00 59.00 ? 121 ARG C NH2 1 
ATOM   3926 N N   . ARG C 3 122 ? 146.840 162.287 -74.264 1.00 45.86 ? 122 ARG C N   1 
ATOM   3927 C CA  . ARG C 3 122 ? 147.903 162.888 -75.058 1.00 46.60 ? 122 ARG C CA  1 
ATOM   3928 C C   . ARG C 3 122 ? 147.816 162.349 -76.483 1.00 46.22 ? 122 ARG C C   1 
ATOM   3929 O O   . ARG C 3 122 ? 148.632 162.686 -77.342 1.00 47.55 ? 122 ARG C O   1 
ATOM   3930 C CB  . ARG C 3 122 ? 149.274 162.570 -74.449 1.00 47.65 ? 122 ARG C CB  1 
ATOM   3931 N N   . GLY C 3 123 ? 146.818 161.507 -76.725 1.00 44.76 ? 123 GLY C N   1 
ATOM   3932 C CA  . GLY C 3 123 ? 146.644 160.934 -78.045 1.00 45.43 ? 123 GLY C CA  1 
ATOM   3933 C C   . GLY C 3 123 ? 147.767 160.001 -78.467 1.00 45.60 ? 123 GLY C C   1 
ATOM   3934 O O   . GLY C 3 123 ? 148.137 159.966 -79.639 1.00 44.42 ? 123 GLY C O   1 
ATOM   3935 N N   . HIS C 3 124 ? 148.321 159.255 -77.516 1.00 44.96 ? 124 HIS C N   1 
ATOM   3936 C CA  . HIS C 3 124 ? 149.392 158.305 -77.815 1.00 45.94 ? 124 HIS C CA  1 
ATOM   3937 C C   . HIS C 3 124 ? 148.845 156.910 -77.559 1.00 45.68 ? 124 HIS C C   1 
ATOM   3938 O O   . HIS C 3 124 ? 148.821 156.104 -78.513 1.00 38.81 ? 124 HIS C O   1 
ATOM   3939 C CB  . HIS C 3 124 ? 150.618 158.567 -76.927 1.00 44.71 ? 124 HIS C CB  1 
ATOM   3940 O OXT . HIS C 3 124 ? 148.446 156.638 -76.407 1.00 38.81 ? 124 HIS C OXT 1 
HETATM 3941 C C1  . F09 D 4 .   ? 155.752 132.678 -39.748 1.00 65.60 ? 302 F09 B C1  1 
HETATM 3942 C C2  . F09 D 4 .   ? 155.661 131.415 -38.906 1.00 65.57 ? 302 F09 B C2  1 
HETATM 3943 C C3  . F09 D 4 .   ? 155.128 131.721 -37.514 1.00 64.82 ? 302 F09 B C3  1 
HETATM 3944 C C4  . F09 D 4 .   ? 155.059 130.472 -36.647 1.00 64.20 ? 302 F09 B C4  1 
HETATM 3945 C C5  . F09 D 4 .   ? 154.629 130.815 -35.228 1.00 63.78 ? 302 F09 B C5  1 
HETATM 3946 C C6  . F09 D 4 .   ? 154.853 129.642 -34.294 1.00 64.77 ? 302 F09 B C6  1 
HETATM 3947 C C7  . F09 D 4 .   ? 154.821 130.079 -32.842 1.00 65.30 ? 302 F09 B C7  1 
HETATM 3948 C C8  . F09 D 4 .   ? 155.398 129.006 -31.931 1.00 66.78 ? 302 F09 B C8  1 
HETATM 3949 C C9  . F09 D 4 .   ? 155.617 129.541 -30.516 1.00 68.35 ? 302 F09 B C9  1 
HETATM 3950 O OXT . F09 D 4 .   ? 156.189 128.859 -29.658 1.00 69.25 ? 302 F09 B OXT 1 
HETATM 3951 K K   . K   E 5 .   ? 154.705 154.705 -30.863 0.25 22.94 ? 401 K   C K   1 
HETATM 3952 K K   . K   F 5 .   ? 154.705 154.705 -34.193 0.25 30.40 ? 402 K   C K   1 
HETATM 3953 K K   . K   G 5 .   ? 154.705 154.705 -37.684 0.25 22.06 ? 403 K   C K   1 
HETATM 3954 K K   . K   H 5 .   ? 154.705 154.705 -42.792 0.25 75.25 ? 404 K   C K   1 
HETATM 3955 K K   . K   I 5 .   ? 154.705 154.705 -46.926 0.25 57.64 ? 405 K   C K   1 
HETATM 3956 K K   . K   J 5 .   ? 154.705 154.705 -26.653 0.25 73.60 ? 406 K   C K   1 
HETATM 3957 K K   . K   K 5 .   ? 154.705 154.705 -23.202 0.25 58.75 ? 407 K   C K   1 
HETATM 3958 C CA1 . DGA L 6 .   ? 167.173 134.782 -28.687 1.00 81.14 ? 301 DGA C CA1 1 
HETATM 3959 C CA2 . DGA L 6 .   ? 166.967 134.764 -30.211 1.00 80.41 ? 301 DGA C CA2 1 
HETATM 3960 C CA3 . DGA L 6 .   ? 168.138 135.430 -30.932 1.00 79.14 ? 301 DGA C CA3 1 
HETATM 3961 C CA4 . DGA L 6 .   ? 167.900 135.539 -32.430 1.00 78.64 ? 301 DGA C CA4 1 
HETATM 3962 C CA5 . DGA L 6 .   ? 169.002 136.341 -33.104 1.00 77.14 ? 301 DGA C CA5 1 
HETATM 3963 O OA1 . DGA L 6 .   ? 168.037 134.061 -28.172 1.00 82.60 ? 301 DGA C OA1 1 
HETATM 3964 C CB1 . DGA L 6 .   ? 164.198 138.190 -28.318 1.00 71.54 ? 301 DGA C CB1 1 
HETATM 3965 C CB2 . DGA L 6 .   ? 164.823 138.102 -29.727 1.00 68.34 ? 301 DGA C CB2 1 
HETATM 3966 C CB3 . DGA L 6 .   ? 164.052 138.886 -30.772 1.00 64.52 ? 301 DGA C CB3 1 
HETATM 3967 C CB4 . DGA L 6 .   ? 164.708 138.742 -32.137 1.00 62.36 ? 301 DGA C CB4 1 
HETATM 3968 C CB5 . DGA L 6 .   ? 163.867 139.356 -33.248 1.00 60.26 ? 301 DGA C CB5 1 
HETATM 3969 C CB6 . DGA L 6 .   ? 164.518 139.119 -34.602 1.00 60.22 ? 301 DGA C CB6 1 
HETATM 3970 C CB7 . DGA L 6 .   ? 163.699 139.679 -35.759 1.00 58.15 ? 301 DGA C CB7 1 
HETATM 3971 C CB8 . DGA L 6 .   ? 164.393 139.385 -37.083 1.00 58.90 ? 301 DGA C CB8 1 
HETATM 3972 C CB9 . DGA L 6 .   ? 163.596 139.885 -38.273 1.00 59.72 ? 301 DGA C CB9 1 
HETATM 3973 O OB1 . DGA L 6 .   ? 164.286 139.246 -27.670 1.00 72.27 ? 301 DGA C OB1 1 
HETATM 3974 O OG1 . DGA L 6 .   ? 166.393 135.688 -27.853 1.00 81.15 ? 301 DGA C OG1 1 
HETATM 3975 C CG1 . DGA L 6 .   ? 165.108 135.137 -27.429 1.00 79.10 ? 301 DGA C CG1 1 
HETATM 3976 C CG2 . DGA L 6 .   ? 164.255 136.224 -26.746 1.00 77.40 ? 301 DGA C CG2 1 
HETATM 3977 O OG2 . DGA L 6 .   ? 163.471 137.016 -27.736 1.00 74.20 ? 301 DGA C OG2 1 
HETATM 3978 C CG3 . DGA L 6 .   ? 163.307 135.569 -25.752 1.00 77.79 ? 301 DGA C CG3 1 
HETATM 3979 O OXT . DGA L 6 .   ? 162.699 136.546 -24.882 1.00 78.13 ? 301 DGA C OXT 1 
HETATM 3980 O O   . HOH M 7 .   ? 149.219 132.619 -12.453 1.00 25.60 ? 213 HOH A O   1 
HETATM 3981 O O   . HOH M 7 .   ? 137.281 141.907 -3.091  1.00 24.25 ? 214 HOH A O   1 
HETATM 3982 O O   . HOH M 7 .   ? 142.548 154.486 -16.044 1.00 44.78 ? 215 HOH A O   1 
HETATM 3983 O O   . HOH M 7 .   ? 147.185 137.929 -7.288  1.00 26.91 ? 216 HOH A O   1 
HETATM 3984 O O   . HOH M 7 .   ? 156.505 134.435 -14.022 1.00 31.47 ? 217 HOH A O   1 
HETATM 3985 O O   . HOH M 7 .   ? 143.199 133.019 -5.141  1.00 23.53 ? 218 HOH A O   1 
HETATM 3986 O O   . HOH M 7 .   ? 147.847 132.697 -18.296 1.00 28.74 ? 219 HOH A O   1 
HETATM 3987 O O   . HOH M 7 .   ? 128.903 115.967 14.061  1.00 31.75 ? 220 HOH A O   1 
HETATM 3988 O O   . HOH M 7 .   ? 150.762 138.384 -14.574 1.00 24.45 ? 221 HOH A O   1 
HETATM 3989 O O   . HOH M 7 .   ? 129.514 128.715 -7.000  1.00 31.78 ? 222 HOH A O   1 
HETATM 3990 O O   . HOH M 7 .   ? 128.416 146.696 -14.381 1.00 38.36 ? 223 HOH A O   1 
HETATM 3991 O O   . HOH M 7 .   ? 129.632 124.420 4.977   1.00 35.14 ? 224 HOH A O   1 
HETATM 3992 O O   . HOH M 7 .   ? 141.599 145.627 -2.353  1.00 32.65 ? 225 HOH A O   1 
HETATM 3993 O O   . HOH M 7 .   ? 147.994 144.323 -5.887  1.00 27.85 ? 226 HOH A O   1 
HETATM 3994 O O   . HOH M 7 .   ? 135.399 145.891 -11.909 1.00 31.30 ? 227 HOH A O   1 
HETATM 3995 O O   . HOH M 7 .   ? 142.057 140.492 -21.861 1.00 28.91 ? 228 HOH A O   1 
HETATM 3996 O O   . HOH M 7 .   ? 135.166 147.471 -20.702 1.00 43.29 ? 229 HOH A O   1 
HETATM 3997 O O   . HOH M 7 .   ? 120.793 120.099 32.223  1.00 46.49 ? 230 HOH A O   1 
HETATM 3998 O O   . HOH M 7 .   ? 128.568 132.720 -15.703 1.00 34.26 ? 231 HOH A O   1 
HETATM 3999 O O   . HOH M 7 .   ? 136.392 129.931 -2.202  1.00 33.32 ? 232 HOH A O   1 
HETATM 4000 O O   . HOH M 7 .   ? 122.048 127.044 8.475   1.00 40.81 ? 233 HOH A O   1 
HETATM 4001 O O   . HOH M 7 .   ? 137.170 144.253 -0.546  1.00 38.48 ? 234 HOH A O   1 
HETATM 4002 O O   . HOH M 7 .   ? 153.101 139.315 -15.939 1.00 30.27 ? 235 HOH A O   1 
HETATM 4003 O O   . HOH M 7 .   ? 117.270 120.298 13.991  1.00 37.17 ? 236 HOH A O   1 
HETATM 4004 O O   . HOH M 7 .   ? 131.103 149.020 -8.749  1.00 40.07 ? 237 HOH A O   1 
HETATM 4005 O O   . HOH M 7 .   ? 114.441 123.036 19.434  1.00 35.13 ? 238 HOH A O   1 
HETATM 4006 O O   . HOH M 7 .   ? 142.808 153.134 -11.025 1.00 36.64 ? 239 HOH A O   1 
HETATM 4007 O O   . HOH M 7 .   ? 133.440 112.151 29.205  1.00 37.57 ? 240 HOH A O   1 
HETATM 4008 O O   . HOH M 7 .   ? 140.298 149.391 -21.501 1.00 46.63 ? 241 HOH A O   1 
HETATM 4009 O O   . HOH M 7 .   ? 151.982 133.237 -11.541 1.00 37.59 ? 242 HOH A O   1 
HETATM 4010 O O   . HOH M 7 .   ? 120.928 111.833 30.189  1.00 44.15 ? 243 HOH A O   1 
HETATM 4011 O O   . HOH M 7 .   ? 153.260 149.740 -20.250 1.00 40.62 ? 244 HOH A O   1 
HETATM 4012 O O   . HOH M 7 .   ? 150.934 150.979 -13.982 1.00 47.99 ? 245 HOH A O   1 
HETATM 4013 O O   . HOH M 7 .   ? 129.569 134.336 5.131   1.00 35.13 ? 246 HOH A O   1 
HETATM 4014 O O   . HOH M 7 .   ? 124.506 122.585 28.819  1.00 47.33 ? 247 HOH A O   1 
HETATM 4015 O O   . HOH M 7 .   ? 133.991 126.752 -1.186  1.00 48.00 ? 248 HOH A O   1 
HETATM 4016 O O   . HOH M 7 .   ? 154.921 146.751 -21.342 1.00 51.47 ? 249 HOH A O   1 
HETATM 4017 O O   . HOH M 7 .   ? 147.036 148.555 -20.145 1.00 50.87 ? 250 HOH A O   1 
HETATM 4018 O O   . HOH M 7 .   ? 155.365 144.218 -22.418 1.00 40.79 ? 251 HOH A O   1 
HETATM 4019 O O   . HOH M 7 .   ? 134.011 142.915 -24.519 1.00 53.43 ? 252 HOH A O   1 
HETATM 4020 O O   . HOH M 7 .   ? 124.936 133.382 -9.396  1.00 49.75 ? 253 HOH A O   1 
HETATM 4021 O O   . HOH M 7 .   ? 128.062 115.691 10.699  1.00 39.07 ? 254 HOH A O   1 
HETATM 4022 O O   . HOH M 7 .   ? 128.123 130.076 -0.269  1.00 39.62 ? 255 HOH A O   1 
HETATM 4023 O O   . HOH M 7 .   ? 128.709 149.379 -13.770 1.00 38.94 ? 256 HOH A O   1 
HETATM 4024 O O   . HOH M 7 .   ? 114.568 122.881 26.397  1.00 44.40 ? 257 HOH A O   1 
HETATM 4025 O O   . HOH M 7 .   ? 113.293 115.956 24.102  1.00 44.92 ? 258 HOH A O   1 
HETATM 4026 O O   . HOH M 7 .   ? 124.367 147.255 5.953   1.00 50.60 ? 259 HOH A O   1 
HETATM 4027 O O   . HOH M 7 .   ? 124.513 141.862 -13.562 1.00 38.15 ? 260 HOH A O   1 
HETATM 4028 O O   . HOH M 7 .   ? 127.525 148.812 -17.478 1.00 64.05 ? 261 HOH A O   1 
HETATM 4029 O O   . HOH M 7 .   ? 128.194 136.138 10.678  1.00 40.61 ? 262 HOH A O   1 
HETATM 4030 O O   . HOH M 7 .   ? 114.406 114.190 16.756  1.00 38.05 ? 263 HOH A O   1 
HETATM 4031 O O   . HOH M 7 .   ? 125.645 145.448 -14.449 1.00 52.17 ? 264 HOH A O   1 
HETATM 4032 O O   . HOH M 7 .   ? 141.922 146.904 -21.004 1.00 39.94 ? 265 HOH A O   1 
HETATM 4033 O O   . HOH M 7 .   ? 138.405 134.878 2.424   1.00 46.91 ? 266 HOH A O   1 
HETATM 4034 O O   . HOH M 7 .   ? 138.962 142.185 -25.688 1.00 55.56 ? 267 HOH A O   1 
HETATM 4035 O O   . HOH M 7 .   ? 126.889 136.865 -21.572 1.00 49.64 ? 268 HOH A O   1 
HETATM 4036 O O   . HOH M 7 .   ? 118.102 140.327 16.361  1.00 51.94 ? 269 HOH A O   1 
HETATM 4037 O O   . HOH M 7 .   ? 128.782 127.259 -10.750 1.00 51.81 ? 270 HOH A O   1 
HETATM 4038 O O   . HOH M 7 .   ? 130.904 127.933 -14.172 1.00 43.40 ? 271 HOH A O   1 
HETATM 4039 O O   . HOH M 7 .   ? 134.463 148.747 -18.419 1.00 44.18 ? 272 HOH A O   1 
HETATM 4040 O O   . HOH M 7 .   ? 128.941 149.668 -0.357  1.00 56.31 ? 273 HOH A O   1 
HETATM 4041 O O   . HOH M 7 .   ? 127.782 142.222 -21.996 1.00 42.34 ? 274 HOH A O   1 
HETATM 4042 O O   . HOH M 7 .   ? 116.107 127.824 13.896  1.00 35.39 ? 275 HOH A O   1 
HETATM 4043 O O   . HOH M 7 .   ? 117.537 107.279 13.763  1.00 43.57 ? 276 HOH A O   1 
HETATM 4044 O O   . HOH M 7 .   ? 139.529 148.825 -5.765  1.00 46.36 ? 277 HOH A O   1 
HETATM 4045 O O   . HOH M 7 .   ? 156.155 138.802 -10.683 1.00 47.97 ? 278 HOH A O   1 
HETATM 4046 O O   . HOH M 7 .   ? 153.287 144.192 -11.001 1.00 43.33 ? 279 HOH A O   1 
HETATM 4047 O O   . HOH M 7 .   ? 145.440 149.906 -4.794  1.00 66.19 ? 280 HOH A O   1 
HETATM 4048 O O   . HOH M 7 .   ? 113.302 112.920 21.351  1.00 48.74 ? 281 HOH A O   1 
HETATM 4049 O O   . HOH M 7 .   ? 130.786 123.085 21.759  1.00 61.54 ? 282 HOH A O   1 
HETATM 4050 O O   . HOH M 7 .   ? 121.667 116.347 34.454  1.00 40.65 ? 283 HOH A O   1 
HETATM 4051 O O   . HOH M 7 .   ? 120.150 129.173 24.724  1.00 43.50 ? 284 HOH A O   1 
HETATM 4052 O O   . HOH M 7 .   ? 134.816 117.873 17.080  1.00 48.63 ? 285 HOH A O   1 
HETATM 4053 O O   . HOH M 7 .   ? 119.245 145.874 -9.264  1.00 54.69 ? 286 HOH A O   1 
HETATM 4054 O O   . HOH M 7 .   ? 151.628 137.038 -9.586  1.00 47.72 ? 287 HOH A O   1 
HETATM 4055 O O   . HOH M 7 .   ? 123.662 150.313 1.978   1.00 54.80 ? 288 HOH A O   1 
HETATM 4056 O O   . HOH M 7 .   ? 125.534 132.528 20.908  1.00 45.88 ? 289 HOH A O   1 
HETATM 4057 O O   . HOH M 7 .   ? 148.040 141.338 -1.967  1.00 57.80 ? 290 HOH A O   1 
HETATM 4058 O O   . HOH M 7 .   ? 118.869 141.500 -8.989  1.00 49.02 ? 291 HOH A O   1 
HETATM 4059 O O   . HOH M 7 .   ? 135.140 151.973 -8.933  1.00 51.02 ? 292 HOH A O   1 
HETATM 4060 O O   . HOH M 7 .   ? 122.773 105.335 13.156  1.00 46.25 ? 293 HOH A O   1 
HETATM 4061 O O   . HOH M 7 .   ? 134.432 104.636 27.401  1.00 66.21 ? 294 HOH A O   1 
HETATM 4062 O O   . HOH M 7 .   ? 135.188 144.215 6.702   1.00 49.97 ? 295 HOH A O   1 
HETATM 4063 O O   . HOH M 7 .   ? 113.848 106.269 21.272  1.00 63.92 ? 296 HOH A O   1 
HETATM 4064 O O   . HOH M 7 .   ? 142.108 135.191 1.479   1.00 58.89 ? 297 HOH A O   1 
HETATM 4065 O O   . HOH M 7 .   ? 133.224 121.474 10.585  1.00 55.87 ? 298 HOH A O   1 
HETATM 4066 O O   . HOH M 7 .   ? 118.458 137.617 2.365   1.00 51.18 ? 299 HOH A O   1 
HETATM 4067 O O   . HOH M 7 .   ? 130.857 131.204 6.587   1.00 43.03 ? 300 HOH A O   1 
HETATM 4068 O O   . HOH M 7 .   ? 140.828 147.387 3.805   1.00 63.11 ? 301 HOH A O   1 
HETATM 4069 O O   . HOH M 7 .   ? 114.003 126.579 19.194  1.00 52.13 ? 302 HOH A O   1 
HETATM 4070 O O   . HOH M 7 .   ? 144.966 147.649 -21.737 1.00 44.29 ? 303 HOH A O   1 
HETATM 4071 O O   . HOH M 7 .   ? 127.791 135.077 13.234  1.00 45.43 ? 304 HOH A O   1 
HETATM 4072 O O   . HOH M 7 .   ? 114.220 97.925  13.244  1.00 69.20 ? 305 HOH A O   1 
HETATM 4073 O O   . HOH M 7 .   ? 111.911 104.149 24.952  1.00 50.92 ? 306 HOH A O   1 
HETATM 4074 O O   . HOH M 7 .   ? 154.653 147.975 -17.327 1.00 50.36 ? 307 HOH A O   1 
HETATM 4075 O O   . HOH M 7 .   ? 115.240 124.061 11.098  1.00 39.82 ? 308 HOH A O   1 
HETATM 4076 O O   . HOH M 7 .   ? 147.116 137.622 -4.276  1.00 58.01 ? 309 HOH A O   1 
HETATM 4077 O O   . HOH M 7 .   ? 123.168 140.529 -16.690 1.00 58.88 ? 310 HOH A O   1 
HETATM 4078 O O   . HOH M 7 .   ? 131.323 120.108 22.427  1.00 58.50 ? 311 HOH A O   1 
HETATM 4079 O O   . HOH N 7 .   ? 147.046 133.076 -21.047 1.00 26.74 ? 303 HOH B O   1 
HETATM 4080 O O   . HOH N 7 .   ? 144.956 126.651 -3.664  1.00 38.61 ? 304 HOH B O   1 
HETATM 4081 O O   . HOH N 7 .   ? 137.516 123.239 -27.006 1.00 44.70 ? 305 HOH B O   1 
HETATM 4082 O O   . HOH N 7 .   ? 147.645 131.822 -10.099 1.00 31.72 ? 306 HOH B O   1 
HETATM 4083 O O   . HOH N 7 .   ? 136.011 133.192 -22.631 1.00 35.84 ? 307 HOH B O   1 
HETATM 4084 O O   . HOH N 7 .   ? 148.430 115.170 -20.237 1.00 34.30 ? 308 HOH B O   1 
HETATM 4085 O O   . HOH N 7 .   ? 134.898 116.725 -6.632  1.00 29.68 ? 309 HOH B O   1 
HETATM 4086 O O   . HOH N 7 .   ? 132.417 118.721 -14.487 1.00 36.04 ? 310 HOH B O   1 
HETATM 4087 O O   . HOH N 7 .   ? 130.818 122.643 -17.001 1.00 35.54 ? 311 HOH B O   1 
HETATM 4088 O O   . HOH N 7 .   ? 150.545 131.202 -8.412  1.00 34.88 ? 312 HOH B O   1 
HETATM 4089 O O   . HOH N 7 .   ? 128.354 123.937 -17.923 1.00 36.79 ? 313 HOH B O   1 
HETATM 4090 O O   . HOH N 7 .   ? 139.872 113.143 1.068   1.00 35.64 ? 314 HOH B O   1 
HETATM 4091 O O   . HOH N 7 .   ? 138.607 135.530 -29.011 1.00 41.64 ? 315 HOH B O   1 
HETATM 4092 O O   . HOH N 7 .   ? 130.695 130.776 -15.440 1.00 41.32 ? 316 HOH B O   1 
HETATM 4093 O O   . HOH N 7 .   ? 139.292 119.896 -25.883 1.00 46.04 ? 317 HOH B O   1 
HETATM 4094 O O   . HOH N 7 .   ? 135.041 110.389 -3.378  1.00 36.22 ? 318 HOH B O   1 
HETATM 4095 O O   . HOH N 7 .   ? 123.516 111.985 -4.392  1.00 42.24 ? 319 HOH B O   1 
HETATM 4096 O O   . HOH N 7 .   ? 139.734 112.414 -3.568  1.00 36.21 ? 320 HOH B O   1 
HETATM 4097 O O   . HOH N 7 .   ? 131.770 130.804 -23.864 1.00 36.50 ? 321 HOH B O   1 
HETATM 4098 O O   . HOH N 7 .   ? 152.242 124.368 -13.328 1.00 42.03 ? 322 HOH B O   1 
HETATM 4099 O O   . HOH N 7 .   ? 146.438 132.724 -6.841  1.00 35.32 ? 323 HOH B O   1 
HETATM 4100 O O   . HOH N 7 .   ? 130.823 115.689 10.089  1.00 38.59 ? 324 HOH B O   1 
HETATM 4101 O O   . HOH N 7 .   ? 149.694 120.239 -7.464  1.00 31.74 ? 325 HOH B O   1 
HETATM 4102 O O   . HOH N 7 .   ? 149.309 120.472 -34.866 1.00 64.00 ? 326 HOH B O   1 
HETATM 4103 O O   . HOH N 7 .   ? 126.490 116.894 -0.604  1.00 45.26 ? 327 HOH B O   1 
HETATM 4104 O O   . HOH N 7 .   ? 120.509 112.338 -7.010  1.00 45.70 ? 328 HOH B O   1 
HETATM 4105 O O   . HOH N 7 .   ? 126.520 101.756 -6.257  1.00 51.36 ? 329 HOH B O   1 
HETATM 4106 O O   . HOH N 7 .   ? 124.822 122.200 2.541   1.00 40.47 ? 330 HOH B O   1 
HETATM 4107 O O   . HOH N 7 .   ? 129.682 121.122 3.729   1.00 50.00 ? 331 HOH B O   1 
HETATM 4108 O O   . HOH N 7 .   ? 131.884 115.707 1.039   1.00 44.07 ? 332 HOH B O   1 
HETATM 4109 O O   . HOH N 7 .   ? 139.711 116.445 -14.042 1.00 30.72 ? 333 HOH B O   1 
HETATM 4110 O O   . HOH N 7 .   ? 129.444 107.625 -7.533  1.00 47.50 ? 334 HOH B O   1 
HETATM 4111 O O   . HOH N 7 .   ? 132.875 117.496 3.577   1.00 43.94 ? 335 HOH B O   1 
HETATM 4112 O O   . HOH N 7 .   ? 127.504 113.220 11.831  1.00 36.40 ? 336 HOH B O   1 
HETATM 4113 O O   . HOH N 7 .   ? 159.852 134.745 -15.642 1.00 32.79 ? 337 HOH B O   1 
HETATM 4114 O O   . HOH N 7 .   ? 132.972 122.683 -7.077  1.00 55.37 ? 338 HOH B O   1 
HETATM 4115 O O   . HOH N 7 .   ? 152.939 112.854 1.015   1.00 43.89 ? 339 HOH B O   1 
HETATM 4116 O O   . HOH N 7 .   ? 111.804 117.030 13.965  1.00 44.77 ? 340 HOH B O   1 
HETATM 4117 O O   . HOH N 7 .   ? 155.218 127.870 -19.774 1.00 33.41 ? 341 HOH B O   1 
HETATM 4118 O O   . HOH N 7 .   ? 154.429 132.633 -14.571 1.00 48.72 ? 342 HOH B O   1 
HETATM 4119 O O   . HOH N 7 .   ? 155.359 125.163 -5.586  1.00 44.95 ? 343 HOH B O   1 
HETATM 4120 O O   . HOH N 7 .   ? 138.369 107.257 -8.758  1.00 47.90 ? 344 HOH B O   1 
HETATM 4121 O O   . HOH N 7 .   ? 144.984 119.808 -20.705 1.00 35.53 ? 345 HOH B O   1 
HETATM 4122 O O   . HOH N 7 .   ? 132.782 128.582 -22.655 1.00 51.00 ? 346 HOH B O   1 
HETATM 4123 O O   . HOH N 7 .   ? 110.850 116.809 21.509  1.00 45.82 ? 347 HOH B O   1 
HETATM 4124 O O   . HOH N 7 .   ? 118.849 117.245 -2.890  1.00 42.98 ? 348 HOH B O   1 
HETATM 4125 O O   . HOH N 7 .   ? 136.174 118.373 -2.534  1.00 39.16 ? 349 HOH B O   1 
HETATM 4126 O O   . HOH N 7 .   ? 141.762 116.437 -0.880  1.00 56.08 ? 350 HOH B O   1 
HETATM 4127 O O   . HOH N 7 .   ? 134.387 121.590 -5.014  1.00 63.52 ? 351 HOH B O   1 
HETATM 4128 O O   . HOH N 7 .   ? 141.753 125.561 -29.631 1.00 32.53 ? 352 HOH B O   1 
HETATM 4129 O O   . HOH N 7 .   ? 115.405 109.127 -4.140  1.00 42.30 ? 353 HOH B O   1 
HETATM 4130 O O   . HOH N 7 .   ? 125.113 127.390 -34.556 1.00 54.22 ? 354 HOH B O   1 
HETATM 4131 O O   . HOH N 7 .   ? 139.533 110.479 -15.975 1.00 53.21 ? 355 HOH B O   1 
HETATM 4132 O O   . HOH N 7 .   ? 153.724 122.719 -25.210 1.00 52.70 ? 356 HOH B O   1 
HETATM 4133 O O   . HOH N 7 .   ? 133.385 116.530 -10.972 1.00 47.58 ? 357 HOH B O   1 
HETATM 4134 O O   . HOH N 7 .   ? 121.350 123.905 -24.517 1.00 44.46 ? 358 HOH B O   1 
HETATM 4135 O O   . HOH N 7 .   ? 102.749 120.410 8.685   1.00 46.16 ? 359 HOH B O   1 
HETATM 4136 O O   . HOH N 7 .   ? 157.155 125.709 -14.550 1.00 50.02 ? 360 HOH B O   1 
HETATM 4137 O O   . HOH N 7 .   ? 148.187 117.390 -26.759 1.00 43.48 ? 361 HOH B O   1 
HETATM 4138 O O   . HOH N 7 .   ? 147.121 120.054 -0.003  1.00 46.00 ? 362 HOH B O   1 
HETATM 4139 O O   . HOH N 7 .   ? 116.015 121.510 11.841  1.00 37.99 ? 363 HOH B O   1 
HETATM 4140 O O   . HOH N 7 .   ? 136.738 127.468 -35.376 1.00 51.64 ? 364 HOH B O   1 
HETATM 4141 O O   . HOH N 7 .   ? 157.064 117.698 -4.758  1.00 60.60 ? 365 HOH B O   1 
HETATM 4142 O O   . HOH N 7 .   ? 111.842 120.943 2.319   1.00 49.11 ? 366 HOH B O   1 
HETATM 4143 O O   . HOH N 7 .   ? 104.974 111.853 10.943  1.00 43.26 ? 367 HOH B O   1 
HETATM 4144 O O   . HOH N 7 .   ? 147.340 117.847 2.878   1.00 56.11 ? 368 HOH B O   1 
HETATM 4145 O O   . HOH N 7 .   ? 104.821 114.706 16.991  1.00 56.58 ? 369 HOH B O   1 
HETATM 4146 O O   . HOH N 7 .   ? 120.979 101.649 -2.605  1.00 52.67 ? 370 HOH B O   1 
HETATM 4147 O O   . HOH N 7 .   ? 124.093 118.105 0.025   1.00 51.42 ? 371 HOH B O   1 
HETATM 4148 O O   . HOH N 7 .   ? 121.269 103.418 -6.792  1.00 58.69 ? 372 HOH B O   1 
HETATM 4149 O O   . HOH N 7 .   ? 155.513 127.425 -22.528 1.00 54.90 ? 373 HOH B O   1 
HETATM 4150 O O   . HOH N 7 .   ? 133.226 117.522 -31.080 1.00 50.03 ? 374 HOH B O   1 
HETATM 4151 O O   . HOH N 7 .   ? 119.397 108.761 -6.743  1.00 64.27 ? 375 HOH B O   1 
HETATM 4152 O O   . HOH N 7 .   ? 131.451 124.324 -32.662 1.00 55.64 ? 376 HOH B O   1 
HETATM 4153 O O   . HOH N 7 .   ? 149.853 108.220 -15.308 1.00 59.05 ? 377 HOH B O   1 
HETATM 4154 O O   . HOH N 7 .   ? 116.019 104.736 12.724  1.00 50.08 ? 378 HOH B O   1 
HETATM 4155 O O   . HOH N 7 .   ? 133.047 110.544 -11.068 1.00 44.61 ? 379 HOH B O   1 
HETATM 4156 O O   . HOH N 7 .   ? 109.965 107.983 3.555   1.00 44.81 ? 380 HOH B O   1 
HETATM 4157 O O   . HOH N 7 .   ? 135.377 109.756 -9.646  1.00 44.72 ? 381 HOH B O   1 
HETATM 4158 O O   . HOH N 7 .   ? 105.918 109.997 -2.086  1.00 53.99 ? 382 HOH B O   1 
HETATM 4159 O O   . HOH N 7 .   ? 152.095 122.043 -11.667 1.00 44.60 ? 383 HOH B O   1 
HETATM 4160 O O   . HOH N 7 .   ? 130.778 118.134 -21.436 1.00 44.90 ? 384 HOH B O   1 
HETATM 4161 O O   . HOH N 7 .   ? 143.548 113.152 3.989   1.00 49.98 ? 385 HOH B O   1 
HETATM 4162 O O   . HOH N 7 .   ? 136.465 119.716 -30.682 1.00 60.61 ? 386 HOH B O   1 
HETATM 4163 O O   . HOH N 7 .   ? 103.845 106.589 1.638   1.00 64.66 ? 387 HOH B O   1 
HETATM 4164 O O   . HOH N 7 .   ? 147.055 106.697 -9.542  1.00 55.01 ? 388 HOH B O   1 
HETATM 4165 O O   . HOH N 7 .   ? 105.663 108.586 22.558  1.00 58.90 ? 389 HOH B O   1 
HETATM 4166 O O   . HOH N 7 .   ? 127.697 105.445 -1.891  1.00 45.39 ? 390 HOH B O   1 
HETATM 4167 O O   . HOH N 7 .   ? 153.168 122.945 -7.591  1.00 54.93 ? 391 HOH B O   1 
HETATM 4168 O O   . HOH N 7 .   ? 116.337 102.445 1.965   1.00 47.36 ? 392 HOH B O   1 
HETATM 4169 O O   . HOH N 7 .   ? 101.927 113.902 9.959   1.00 58.39 ? 393 HOH B O   1 
HETATM 4170 O O   . HOH N 7 .   ? 113.217 105.183 -1.855  1.00 46.67 ? 394 HOH B O   1 
HETATM 4171 O O   . HOH N 7 .   ? 140.619 106.837 -7.255  1.00 46.91 ? 395 HOH B O   1 
HETATM 4172 O O   . HOH N 7 .   ? 158.224 128.903 -26.480 1.00 65.43 ? 396 HOH B O   1 
HETATM 4173 O O   . HOH N 7 .   ? 136.468 123.864 -3.972  1.00 52.05 ? 397 HOH B O   1 
HETATM 4174 O O   . HOH N 7 .   ? 136.949 117.828 0.131   1.00 61.94 ? 398 HOH B O   1 
HETATM 4175 O O   . HOH O 7 .   ? 153.218 140.983 -26.065 1.00 23.54 ? 408 HOH C O   1 
HETATM 4176 O O   . HOH O 7 .   ? 141.448 141.276 -26.633 1.00 28.37 ? 409 HOH C O   1 
HETATM 4177 O O   . HOH O 7 .   ? 151.130 149.044 -31.293 1.00 26.22 ? 410 HOH C O   1 
HETATM 4178 O O   . HOH O 7 .   ? 146.723 142.768 -23.149 1.00 21.19 ? 411 HOH C O   1 
HETATM 4179 O O   . HOH O 7 .   ? 146.499 130.884 -31.203 1.00 26.95 ? 412 HOH C O   1 
HETATM 4180 O O   . HOH O 7 .   ? 144.500 140.650 -23.092 1.00 26.46 ? 413 HOH C O   1 
HETATM 4181 O O   . HOH O 7 .   ? 160.794 133.949 -27.260 1.00 50.97 ? 414 HOH C O   1 
HETATM 4182 O O   . HOH O 7 .   ? 153.713 143.514 -24.467 1.00 41.25 ? 415 HOH C O   1 
HETATM 4183 O O   . HOH O 7 .   ? 159.604 133.069 -29.468 1.00 30.39 ? 416 HOH C O   1 
HETATM 4184 O O   . HOH O 7 .   ? 152.252 149.082 -23.713 1.00 49.59 ? 417 HOH C O   1 
HETATM 4185 O O   . HOH O 7 .   ? 158.812 137.812 -21.401 1.00 35.74 ? 418 HOH C O   1 
HETATM 4186 O O   . HOH O 7 .   ? 152.182 152.835 -44.243 1.00 44.36 ? 419 HOH C O   1 
HETATM 4187 O O   . HOH O 7 .   ? 146.622 146.010 -23.192 1.00 44.18 ? 420 HOH C O   1 
HETATM 4188 O O   . HOH O 7 .   ? 138.880 140.272 -68.518 1.00 45.48 ? 421 HOH C O   1 
HETATM 4189 O O   . HOH O 7 .   ? 151.668 129.679 -26.044 1.00 39.54 ? 422 HOH C O   1 
HETATM 4190 O O   . HOH O 7 .   ? 155.976 132.163 -25.287 1.00 42.25 ? 423 HOH C O   1 
HETATM 4191 O O   . HOH O 7 .   ? 158.222 141.125 -19.637 1.00 38.24 ? 424 HOH C O   1 
HETATM 4192 O O   . HOH O 7 .   ? 157.883 155.432 -23.870 1.00 53.63 ? 425 HOH C O   1 
HETATM 4193 O O   . HOH O 7 .   ? 163.158 143.391 -25.881 1.00 44.76 ? 426 HOH C O   1 
HETATM 4194 O O   . HOH O 7 .   ? 140.298 147.314 -66.001 1.00 45.47 ? 427 HOH C O   1 
HETATM 4195 O O   . HOH O 7 .   ? 150.969 140.459 -49.325 1.00 60.69 ? 428 HOH C O   1 
HETATM 4196 O O   . HOH O 7 .   ? 148.303 148.299 -23.594 1.00 48.82 ? 429 HOH C O   1 
HETATM 4197 O O   . HOH O 7 .   ? 148.716 152.322 -68.172 1.00 50.77 ? 430 HOH C O   1 
HETATM 4198 O O   . HOH O 7 .   ? 159.744 145.062 -25.210 1.00 51.19 ? 431 HOH C O   1 
HETATM 4199 O O   . HOH O 7 .   ? 145.045 147.005 -49.373 1.00 44.52 ? 432 HOH C O   1 
HETATM 4200 O O   . HOH O 7 .   ? 166.272 131.450 -27.861 1.00 69.15 ? 433 HOH C O   1 
HETATM 4201 O O   . HOH O 7 .   ? 151.742 158.665 -69.898 1.00 46.25 ? 434 HOH C O   1 
HETATM 4202 O O   . HOH O 7 .   ? 144.209 153.979 -67.584 1.00 38.27 ? 435 HOH C O   1 
HETATM 4203 O O   . HOH O 7 .   ? 147.879 165.934 -77.681 1.00 57.58 ? 436 HOH C O   1 
HETATM 4204 O O   . HOH O 7 .   ? 150.071 154.093 -74.060 1.00 60.95 ? 437 HOH C O   1 
HETATM 4205 O O   . HOH O 7 .   ? 160.567 135.283 -23.304 1.00 60.73 ? 438 HOH C O   1 
HETATM 4206 O O   . HOH O 7 .   ? 171.174 134.036 -29.886 1.00 62.14 ? 439 HOH C O   1 
HETATM 4207 O O   . HOH O 7 .   ? 154.705 154.705 -76.923 0.25 22.39 ? 440 HOH C O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   1   1   ASP ASP A . n 
A 1 2   ILE 2   2   2   ILE ILE A . n 
A 1 3   LEU 3   3   3   LEU LEU A . n 
A 1 4   LEU 4   4   4   LEU LEU A . n 
A 1 5   THR 5   5   5   THR THR A . n 
A 1 6   GLN 6   6   6   GLN GLN A . n 
A 1 7   SER 7   7   7   SER SER A . n 
A 1 8   PRO 8   8   8   PRO PRO A . n 
A 1 9   ALA 9   9   9   ALA ALA A . n 
A 1 10  ILE 10  10  10  ILE ILE A . n 
A 1 11  LEU 11  11  11  LEU LEU A . n 
A 1 12  SER 12  12  12  SER SER A . n 
A 1 13  VAL 13  13  13  VAL VAL A . n 
A 1 14  SER 14  14  14  SER SER A . n 
A 1 15  PRO 15  15  15  PRO PRO A . n 
A 1 16  GLY 16  16  16  GLY GLY A . n 
A 1 17  GLU 17  17  17  GLU GLU A . n 
A 1 18  ARG 18  18  18  ARG ARG A . n 
A 1 19  VAL 19  19  19  VAL VAL A . n 
A 1 20  SER 20  20  20  SER SER A . n 
A 1 21  PHE 21  21  21  PHE PHE A . n 
A 1 22  SER 22  22  22  SER SER A . n 
A 1 23  CYS 23  23  23  CYS CYS A . n 
A 1 24  ARG 24  24  24  ARG ARG A . n 
A 1 25  ALA 25  25  25  ALA ALA A . n 
A 1 26  SER 26  26  26  SER SER A . n 
A 1 27  GLN 27  27  27  GLN GLN A . n 
A 1 28  SER 28  28  28  SER SER A . n 
A 1 29  ILE 29  29  29  ILE ILE A . n 
A 1 30  GLY 30  30  30  GLY GLY A . n 
A 1 31  THR 31  31  31  THR THR A . n 
A 1 32  ASP 32  32  32  ASP ASP A . n 
A 1 33  ILE 33  33  33  ILE ILE A . n 
A 1 34  HIS 34  34  34  HIS HIS A . n 
A 1 35  TRP 35  35  35  TRP TRP A . n 
A 1 36  TYR 36  36  36  TYR TYR A . n 
A 1 37  GLN 37  37  37  GLN GLN A . n 
A 1 38  GLN 38  38  38  GLN GLN A . n 
A 1 39  ARG 39  39  39  ARG ARG A . n 
A 1 40  THR 40  40  40  THR THR A . n 
A 1 41  ASN 41  41  41  ASN ASN A . n 
A 1 42  GLY 42  42  42  GLY GLY A . n 
A 1 43  SER 43  43  43  SER SER A . n 
A 1 44  PRO 44  44  44  PRO PRO A . n 
A 1 45  ARG 45  45  45  ARG ARG A . n 
A 1 46  LEU 46  46  46  LEU LEU A . n 
A 1 47  LEU 47  47  47  LEU LEU A . n 
A 1 48  ILE 48  48  48  ILE ILE A . n 
A 1 49  LYS 49  49  49  LYS LYS A . n 
A 1 50  TYR 50  50  50  TYR TYR A . n 
A 1 51  ALA 51  51  51  ALA ALA A . n 
A 1 52  SER 52  52  52  SER SER A . n 
A 1 53  GLU 53  53  53  GLU GLU A . n 
A 1 54  SER 54  54  54  SER SER A . n 
A 1 55  ILE 55  55  55  ILE ILE A . n 
A 1 56  SER 56  56  56  SER SER A . n 
A 1 57  GLY 57  57  57  GLY GLY A . n 
A 1 58  ILE 58  58  58  ILE ILE A . n 
A 1 59  PRO 59  59  59  PRO PRO A . n 
A 1 60  SER 60  60  60  SER SER A . n 
A 1 61  ARG 61  61  61  ARG ARG A . n 
A 1 62  PHE 62  62  62  PHE PHE A . n 
A 1 63  SER 63  63  63  SER SER A . n 
A 1 64  GLY 64  64  64  GLY GLY A . n 
A 1 65  SER 65  65  65  SER SER A . n 
A 1 66  GLY 66  66  66  GLY GLY A . n 
A 1 67  SER 67  67  67  SER SER A . n 
A 1 68  GLY 68  68  68  GLY GLY A . n 
A 1 69  THR 69  69  69  THR THR A . n 
A 1 70  ASP 70  70  70  ASP ASP A . n 
A 1 71  PHE 71  71  71  PHE PHE A . n 
A 1 72  THR 72  72  72  THR THR A . n 
A 1 73  LEU 73  73  73  LEU LEU A . n 
A 1 74  SER 74  74  74  SER SER A . n 
A 1 75  ILE 75  75  75  ILE ILE A . n 
A 1 76  ASN 76  76  76  ASN ASN A . n 
A 1 77  SER 77  77  77  SER SER A . n 
A 1 78  VAL 78  78  78  VAL VAL A . n 
A 1 79  GLU 79  79  79  GLU GLU A . n 
A 1 80  SER 80  80  80  SER SER A . n 
A 1 81  GLU 81  81  81  GLU GLU A . n 
A 1 82  ASP 82  82  82  ASP ASP A . n 
A 1 83  ILE 83  83  83  ILE ILE A . n 
A 1 84  ALA 84  84  84  ALA ALA A . n 
A 1 85  ASN 85  85  85  ASN ASN A . n 
A 1 86  TYR 86  86  86  TYR TYR A . n 
A 1 87  TYR 87  87  87  TYR TYR A . n 
A 1 88  CYS 88  88  88  CYS CYS A . n 
A 1 89  GLN 89  89  89  GLN GLN A . n 
A 1 90  GLN 90  90  90  GLN GLN A . n 
A 1 91  SER 91  91  91  SER SER A . n 
A 1 92  ASN 92  92  92  ASN ASN A . n 
A 1 93  ARG 93  93  93  ARG ARG A . n 
A 1 94  TRP 94  94  94  TRP TRP A . n 
A 1 95  PRO 95  95  95  PRO PRO A . n 
A 1 96  PHE 96  96  96  PHE PHE A . n 
A 1 97  THR 97  97  97  THR THR A . n 
A 1 98  PHE 98  98  98  PHE PHE A . n 
A 1 99  GLY 99  99  99  GLY GLY A . n 
A 1 100 SER 100 100 100 SER SER A . n 
A 1 101 GLY 101 101 101 GLY GLY A . n 
A 1 102 THR 102 102 102 THR THR A . n 
A 1 103 LYS 103 103 103 LYS LYS A . n 
A 1 104 LEU 104 104 104 LEU LEU A . n 
A 1 105 GLU 105 105 105 GLU GLU A . n 
A 1 106 ILE 106 106 106 ILE ILE A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 ARG 108 108 108 ARG ARG A . n 
A 1 109 ALA 109 109 109 ALA ALA A . n 
A 1 110 ASP 110 110 110 ASP ASP A . n 
A 1 111 ALA 111 111 111 ALA ALA A . n 
A 1 112 ALA 112 112 112 ALA ALA A . n 
A 1 113 PRO 113 113 113 PRO PRO A . n 
A 1 114 THR 114 114 114 THR THR A . n 
A 1 115 VAL 115 115 115 VAL VAL A . n 
A 1 116 SER 116 116 116 SER SER A . n 
A 1 117 ILE 117 117 117 ILE ILE A . n 
A 1 118 PHE 118 118 118 PHE PHE A . n 
A 1 119 PRO 119 119 119 PRO PRO A . n 
A 1 120 PRO 120 120 120 PRO PRO A . n 
A 1 121 SER 121 121 121 SER SER A . n 
A 1 122 SER 122 122 122 SER SER A . n 
A 1 123 GLU 123 123 123 GLU GLU A . n 
A 1 124 GLN 124 124 124 GLN GLN A . n 
A 1 125 LEU 125 125 125 LEU LEU A . n 
A 1 126 THR 126 126 126 THR THR A . n 
A 1 127 SER 127 127 127 SER SER A . n 
A 1 128 GLY 128 128 128 GLY GLY A . n 
A 1 129 GLY 129 129 129 GLY GLY A . n 
A 1 130 ALA 130 130 130 ALA ALA A . n 
A 1 131 SER 131 131 131 SER SER A . n 
A 1 132 VAL 132 132 132 VAL VAL A . n 
A 1 133 VAL 133 133 133 VAL VAL A . n 
A 1 134 CYS 134 134 134 CYS CYS A . n 
A 1 135 PHE 135 135 135 PHE PHE A . n 
A 1 136 LEU 136 136 136 LEU LEU A . n 
A 1 137 ASN 137 137 137 ASN ASN A . n 
A 1 138 ASN 138 138 138 ASN ASN A . n 
A 1 139 PHE 139 139 139 PHE PHE A . n 
A 1 140 TYR 140 140 140 TYR TYR A . n 
A 1 141 PRO 141 141 141 PRO PRO A . n 
A 1 142 LYS 142 142 142 LYS LYS A . n 
A 1 143 ASP 143 143 143 ASP ASP A . n 
A 1 144 ILE 144 144 144 ILE ILE A . n 
A 1 145 ASN 145 145 145 ASN ASN A . n 
A 1 146 VAL 146 146 146 VAL VAL A . n 
A 1 147 LYS 147 147 147 LYS LYS A . n 
A 1 148 TRP 148 148 148 TRP TRP A . n 
A 1 149 LYS 149 149 149 LYS LYS A . n 
A 1 150 ILE 150 150 150 ILE ILE A . n 
A 1 151 ASP 151 151 151 ASP ASP A . n 
A 1 152 GLY 152 152 152 GLY GLY A . n 
A 1 153 SER 153 153 153 SER SER A . n 
A 1 154 GLU 154 154 154 GLU GLU A . n 
A 1 155 ARG 155 155 155 ARG ARG A . n 
A 1 156 GLN 156 156 156 GLN GLN A . n 
A 1 157 ASN 157 157 157 ASN ASN A . n 
A 1 158 GLY 158 158 158 GLY GLY A . n 
A 1 159 VAL 159 159 159 VAL VAL A . n 
A 1 160 LEU 160 160 160 LEU LEU A . n 
A 1 161 ASN 161 161 161 ASN ASN A . n 
A 1 162 SER 162 162 162 SER SER A . n 
A 1 163 TRP 163 163 163 TRP TRP A . n 
A 1 164 THR 164 164 164 THR THR A . n 
A 1 165 ASP 165 165 165 ASP ASP A . n 
A 1 166 GLN 166 166 166 GLN GLN A . n 
A 1 167 ASP 167 167 167 ASP ASP A . n 
A 1 168 SER 168 168 168 SER SER A . n 
A 1 169 LYS 169 169 169 LYS LYS A . n 
A 1 170 ASP 170 170 170 ASP ASP A . n 
A 1 171 SER 171 171 171 SER SER A . n 
A 1 172 THR 172 172 172 THR THR A . n 
A 1 173 TYR 173 173 173 TYR TYR A . n 
A 1 174 SER 174 174 174 SER SER A . n 
A 1 175 MET 175 175 175 MET MET A . n 
A 1 176 SER 176 176 176 SER SER A . n 
A 1 177 SER 177 177 177 SER SER A . n 
A 1 178 THR 178 178 178 THR THR A . n 
A 1 179 LEU 179 179 179 LEU LEU A . n 
A 1 180 THR 180 180 180 THR THR A . n 
A 1 181 LEU 181 181 181 LEU LEU A . n 
A 1 182 THR 182 182 182 THR THR A . n 
A 1 183 LYS 183 183 183 LYS LYS A . n 
A 1 184 ASP 184 184 184 ASP ASP A . n 
A 1 185 GLU 185 185 185 GLU GLU A . n 
A 1 186 TYR 186 186 186 TYR TYR A . n 
A 1 187 GLU 187 187 187 GLU GLU A . n 
A 1 188 ARG 188 188 188 ARG ARG A . n 
A 1 189 HIS 189 189 189 HIS HIS A . n 
A 1 190 ASN 190 190 190 ASN ASN A . n 
A 1 191 SER 191 191 191 SER SER A . n 
A 1 192 TYR 192 192 192 TYR TYR A . n 
A 1 193 THR 193 193 193 THR THR A . n 
A 1 194 CYS 194 194 194 CYS CYS A . n 
A 1 195 GLU 195 195 195 GLU GLU A . n 
A 1 196 ALA 196 196 196 ALA ALA A . n 
A 1 197 THR 197 197 197 THR THR A . n 
A 1 198 HIS 198 198 198 HIS HIS A . n 
A 1 199 LYS 199 199 199 LYS LYS A . n 
A 1 200 THR 200 200 200 THR THR A . n 
A 1 201 SER 201 201 201 SER SER A . n 
A 1 202 THR 202 202 202 THR THR A . n 
A 1 203 SER 203 203 203 SER SER A . n 
A 1 204 PRO 204 204 204 PRO PRO A . n 
A 1 205 ILE 205 205 205 ILE ILE A . n 
A 1 206 VAL 206 206 206 VAL VAL A . n 
A 1 207 LYS 207 207 207 LYS LYS A . n 
A 1 208 SER 208 208 208 SER SER A . n 
A 1 209 PHE 209 209 209 PHE PHE A . n 
A 1 210 ASN 210 210 210 ASN ASN A . n 
A 1 211 ARG 211 211 211 ARG ARG A . n 
A 1 212 ASN 212 212 ?   ?   ?   A . n 
B 2 1   GLN 1   1   1   GLN GLN B . n 
B 2 2   VAL 2   2   2   VAL VAL B . n 
B 2 3   GLN 3   3   3   GLN GLN B . n 
B 2 4   LEU 4   4   4   LEU LEU B . n 
B 2 5   GLN 5   5   5   GLN GLN B . n 
B 2 6   GLN 6   6   6   GLN GLN B . n 
B 2 7   PRO 7   7   7   PRO PRO B . n 
B 2 8   GLY 8   8   8   GLY GLY B . n 
B 2 9   ALA 9   9   9   ALA ALA B . n 
B 2 10  GLU 10  10  10  GLU GLU B . n 
B 2 11  LEU 11  11  11  LEU LEU B . n 
B 2 12  VAL 12  12  12  VAL VAL B . n 
B 2 13  LYS 13  13  13  LYS LYS B . n 
B 2 14  PRO 14  14  14  PRO PRO B . n 
B 2 15  GLY 15  15  15  GLY GLY B . n 
B 2 16  ALA 16  16  16  ALA ALA B . n 
B 2 17  SER 17  17  17  SER SER B . n 
B 2 18  VAL 18  18  18  VAL VAL B . n 
B 2 19  LYS 19  19  19  LYS LYS B . n 
B 2 20  LEU 20  20  20  LEU LEU B . n 
B 2 21  SER 21  21  21  SER SER B . n 
B 2 22  CYS 22  22  22  CYS CYS B . n 
B 2 23  LYS 23  23  23  LYS LYS B . n 
B 2 24  ALA 24  24  24  ALA ALA B . n 
B 2 25  SER 25  25  25  SER SER B . n 
B 2 26  GLY 26  26  26  GLY GLY B . n 
B 2 27  TYR 27  27  27  TYR TYR B . n 
B 2 28  THR 28  28  28  THR THR B . n 
B 2 29  PHE 29  29  29  PHE PHE B . n 
B 2 30  THR 30  30  30  THR THR B . n 
B 2 31  SER 31  31  31  SER SER B . n 
B 2 32  ASP 32  32  32  ASP ASP B . n 
B 2 33  TRP 33  33  33  TRP TRP B . n 
B 2 34  ILE 34  34  34  ILE ILE B . n 
B 2 35  HIS 35  35  35  HIS HIS B . n 
B 2 36  TRP 36  36  36  TRP TRP B . n 
B 2 37  VAL 37  37  37  VAL VAL B . n 
B 2 38  LYS 38  38  38  LYS LYS B . n 
B 2 39  GLN 39  39  39  GLN GLN B . n 
B 2 40  ARG 40  40  40  ARG ARG B . n 
B 2 41  PRO 41  41  41  PRO PRO B . n 
B 2 42  GLY 42  42  42  GLY GLY B . n 
B 2 43  HIS 43  43  43  HIS HIS B . n 
B 2 44  GLY 44  44  44  GLY GLY B . n 
B 2 45  LEU 45  45  45  LEU LEU B . n 
B 2 46  GLU 46  46  46  GLU GLU B . n 
B 2 47  TRP 47  47  47  TRP TRP B . n 
B 2 48  ILE 48  48  48  ILE ILE B . n 
B 2 49  GLY 49  49  49  GLY GLY B . n 
B 2 50  GLU 50  50  50  GLU GLU B . n 
B 2 51  ILE 51  51  51  ILE ILE B . n 
B 2 52  ILE 52  52  52  ILE ILE B . n 
B 2 53  PRO 53  53  53  PRO PRO B . n 
B 2 54  SER 54  54  54  SER SER B . n 
B 2 55  TYR 55  55  55  TYR TYR B . n 
B 2 56  GLY 56  56  56  GLY GLY B . n 
B 2 57  ARG 57  57  57  ARG ARG B . n 
B 2 58  ALA 58  58  58  ALA ALA B . n 
B 2 59  ASN 59  59  59  ASN ASN B . n 
B 2 60  TYR 60  60  60  TYR TYR B . n 
B 2 61  ASN 61  61  61  ASN ASN B . n 
B 2 62  GLU 62  62  62  GLU GLU B . n 
B 2 63  LYS 63  63  63  LYS LYS B . n 
B 2 64  ILE 64  64  64  ILE ILE B . n 
B 2 65  GLN 65  65  65  GLN GLN B . n 
B 2 66  LYS 66  66  66  LYS LYS B . n 
B 2 67  LYS 67  67  67  LYS LYS B . n 
B 2 68  ALA 68  68  68  ALA ALA B . n 
B 2 69  THR 69  69  69  THR THR B . n 
B 2 70  LEU 70  70  70  LEU LEU B . n 
B 2 71  THR 71  71  71  THR THR B . n 
B 2 72  ALA 72  72  72  ALA ALA B . n 
B 2 73  ASP 73  73  73  ASP ASP B . n 
B 2 74  LYS 74  74  74  LYS LYS B . n 
B 2 75  SER 75  75  75  SER SER B . n 
B 2 76  SER 76  76  76  SER SER B . n 
B 2 77  SER 77  77  77  SER SER B . n 
B 2 78  THR 78  78  78  THR THR B . n 
B 2 79  ALA 79  79  79  ALA ALA B . n 
B 2 80  PHE 80  80  80  PHE PHE B . n 
B 2 81  MET 81  81  81  MET MET B . n 
B 2 82  GLN 82  82  82  GLN GLN B . n 
B 2 83  LEU 83  83  83  LEU LEU B . n 
B 2 84  SER 84  84  84  SER SER B . n 
B 2 85  SER 85  85  85  SER SER B . n 
B 2 86  LEU 86  86  86  LEU LEU B . n 
B 2 87  THR 87  87  87  THR THR B . n 
B 2 88  SER 88  88  88  SER SER B . n 
B 2 89  GLU 89  89  89  GLU GLU B . n 
B 2 90  ASP 90  90  90  ASP ASP B . n 
B 2 91  SER 91  91  91  SER SER B . n 
B 2 92  ALA 92  92  92  ALA ALA B . n 
B 2 93  VAL 93  93  93  VAL VAL B . n 
B 2 94  TYR 94  94  94  TYR TYR B . n 
B 2 95  TYR 95  95  95  TYR TYR B . n 
B 2 96  CYS 96  96  96  CYS CYS B . n 
B 2 97  ALA 97  97  97  ALA ALA B . n 
B 2 98  ARG 98  98  98  ARG ARG B . n 
B 2 99  GLU 99  99  99  GLU GLU B . n 
B 2 100 ARG 100 100 100 ARG ARG B . n 
B 2 101 GLY 101 101 101 GLY GLY B . n 
B 2 102 ASP 102 102 102 ASP ASP B . n 
B 2 103 GLY 103 103 103 GLY GLY B . n 
B 2 104 TYR 104 104 104 TYR TYR B . n 
B 2 105 PHE 105 105 105 PHE PHE B . n 
B 2 106 ALA 106 106 106 ALA ALA B . n 
B 2 107 VAL 107 107 107 VAL VAL B . n 
B 2 108 TRP 108 108 108 TRP TRP B . n 
B 2 109 GLY 109 109 109 GLY GLY B . n 
B 2 110 ALA 110 110 110 ALA ALA B . n 
B 2 111 GLY 111 111 111 GLY GLY B . n 
B 2 112 THR 112 112 112 THR THR B . n 
B 2 113 THR 113 113 113 THR THR B . n 
B 2 114 VAL 114 114 114 VAL VAL B . n 
B 2 115 THR 115 115 115 THR THR B . n 
B 2 116 VAL 116 116 116 VAL VAL B . n 
B 2 117 SER 117 117 117 SER SER B . n 
B 2 118 SER 118 118 118 SER SER B . n 
B 2 119 ALA 119 119 119 ALA ALA B . n 
B 2 120 LYS 120 120 120 LYS LYS B . n 
B 2 121 THR 121 121 121 THR THR B . n 
B 2 122 THR 122 122 122 THR THR B . n 
B 2 123 PRO 123 123 123 PRO PRO B . n 
B 2 124 PRO 124 124 124 PRO PRO B . n 
B 2 125 SER 125 125 125 SER SER B . n 
B 2 126 VAL 126 126 126 VAL VAL B . n 
B 2 127 TYR 127 127 127 TYR TYR B . n 
B 2 128 PRO 128 128 128 PRO PRO B . n 
B 2 129 LEU 129 129 129 LEU LEU B . n 
B 2 130 ALA 130 130 130 ALA ALA B . n 
B 2 131 PRO 131 131 131 PRO PRO B . n 
B 2 132 GLY 132 132 132 GLY GLY B . n 
B 2 133 SER 133 133 133 SER SER B . n 
B 2 134 ALA 134 134 134 ALA ALA B . n 
B 2 135 ALA 135 135 135 ALA ALA B . n 
B 2 136 GLN 136 136 136 GLN GLN B . n 
B 2 137 THR 137 137 137 THR THR B . n 
B 2 138 ASN 138 138 138 ASN ASN B . n 
B 2 139 SER 139 139 139 SER SER B . n 
B 2 140 MET 140 140 140 MET MET B . n 
B 2 141 VAL 141 141 141 VAL VAL B . n 
B 2 142 THR 142 142 142 THR THR B . n 
B 2 143 LEU 143 143 143 LEU LEU B . n 
B 2 144 GLY 144 144 144 GLY GLY B . n 
B 2 145 CYS 145 145 145 CYS CYS B . n 
B 2 146 LEU 146 146 146 LEU LEU B . n 
B 2 147 VAL 147 147 147 VAL VAL B . n 
B 2 148 LYS 148 148 148 LYS LYS B . n 
B 2 149 GLY 149 149 149 GLY GLY B . n 
B 2 150 TYR 150 150 150 TYR TYR B . n 
B 2 151 PHE 151 151 151 PHE PHE B . n 
B 2 152 PRO 152 152 152 PRO PRO B . n 
B 2 153 GLU 153 153 153 GLU GLU B . n 
B 2 154 PRO 154 154 154 PRO PRO B . n 
B 2 155 VAL 155 155 155 VAL VAL B . n 
B 2 156 THR 156 156 156 THR THR B . n 
B 2 157 VAL 157 157 157 VAL VAL B . n 
B 2 158 THR 158 158 158 THR THR B . n 
B 2 159 TRP 159 159 159 TRP TRP B . n 
B 2 160 ASN 160 160 160 ASN ASN B . n 
B 2 161 SER 161 161 161 SER SER B . n 
B 2 162 GLY 162 162 162 GLY GLY B . n 
B 2 163 SER 163 163 163 SER SER B . n 
B 2 164 LEU 164 164 164 LEU LEU B . n 
B 2 165 SER 165 165 165 SER SER B . n 
B 2 166 SER 166 166 166 SER SER B . n 
B 2 167 GLY 167 167 167 GLY GLY B . n 
B 2 168 VAL 168 168 168 VAL VAL B . n 
B 2 169 HIS 169 169 169 HIS HIS B . n 
B 2 170 THR 170 170 170 THR THR B . n 
B 2 171 PHE 171 171 171 PHE PHE B . n 
B 2 172 PRO 172 172 172 PRO PRO B . n 
B 2 173 ALA 173 173 173 ALA ALA B . n 
B 2 174 VAL 174 174 174 VAL VAL B . n 
B 2 175 LEU 175 175 175 LEU LEU B . n 
B 2 176 GLN 176 176 176 GLN GLN B . n 
B 2 177 SER 177 177 177 SER SER B . n 
B 2 178 ASP 178 178 178 ASP ASP B . n 
B 2 179 LEU 179 179 179 LEU LEU B . n 
B 2 180 TYR 180 180 180 TYR TYR B . n 
B 2 181 THR 181 181 181 THR THR B . n 
B 2 182 LEU 182 182 182 LEU LEU B . n 
B 2 183 SER 183 183 183 SER SER B . n 
B 2 184 SER 184 184 184 SER SER B . n 
B 2 185 SER 185 185 185 SER SER B . n 
B 2 186 VAL 186 186 186 VAL VAL B . n 
B 2 187 THR 187 187 187 THR THR B . n 
B 2 188 VAL 188 188 188 VAL VAL B . n 
B 2 189 PRO 189 189 189 PRO PRO B . n 
B 2 190 SER 190 190 190 SER SER B . n 
B 2 191 SER 191 191 191 SER SER B . n 
B 2 192 SER 192 192 192 SER SER B . n 
B 2 193 TRP 193 193 193 TRP TRP B . n 
B 2 194 PRO 194 194 194 PRO PRO B . n 
B 2 195 SER 195 195 195 SER SER B . n 
B 2 196 GLU 196 196 196 GLU GLU B . n 
B 2 197 THR 197 197 197 THR THR B . n 
B 2 198 VAL 198 198 198 VAL VAL B . n 
B 2 199 THR 199 199 199 THR THR B . n 
B 2 200 CYS 200 200 200 CYS CYS B . n 
B 2 201 ASN 201 201 201 ASN ASN B . n 
B 2 202 VAL 202 202 202 VAL VAL B . n 
B 2 203 ALA 203 203 203 ALA ALA B . n 
B 2 204 HIS 204 204 204 HIS HIS B . n 
B 2 205 PRO 205 205 205 PRO PRO B . n 
B 2 206 ALA 206 206 206 ALA ALA B . n 
B 2 207 SER 207 207 207 SER SER B . n 
B 2 208 SER 208 208 208 SER SER B . n 
B 2 209 THR 209 209 209 THR THR B . n 
B 2 210 LYS 210 210 210 LYS LYS B . n 
B 2 211 VAL 211 211 211 VAL VAL B . n 
B 2 212 ASP 212 212 212 ASP ASP B . n 
B 2 213 LYS 213 213 213 LYS LYS B . n 
B 2 214 LYS 214 214 214 LYS LYS B . n 
B 2 215 ILE 215 215 215 ILE ILE B . n 
B 2 216 VAL 216 216 216 VAL VAL B . n 
B 2 217 PRO 217 217 217 PRO PRO B . n 
B 2 218 ARG 218 218 218 ARG ARG B . n 
B 2 219 ASP 219 219 219 ASP ASP B . n 
C 3 1   MET 1   1   ?   ?   ?   C . n 
C 3 2   ALA 2   2   ?   ?   ?   C . n 
C 3 3   PRO 3   3   ?   ?   ?   C . n 
C 3 4   MET 4   4   ?   ?   ?   C . n 
C 3 5   LEU 5   5   ?   ?   ?   C . n 
C 3 6   SER 6   6   ?   ?   ?   C . n 
C 3 7   GLY 7   7   ?   ?   ?   C . n 
C 3 8   LEU 8   8   ?   ?   ?   C . n 
C 3 9   LEU 9   9   ?   ?   ?   C . n 
C 3 10  ALA 10  10  ?   ?   ?   C . n 
C 3 11  ARG 11  11  ?   ?   ?   C . n 
C 3 12  LEU 12  12  ?   ?   ?   C . n 
C 3 13  VAL 13  13  ?   ?   ?   C . n 
C 3 14  LYS 14  14  ?   ?   ?   C . n 
C 3 15  LEU 15  15  ?   ?   ?   C . n 
C 3 16  LEU 16  16  ?   ?   ?   C . n 
C 3 17  LEU 17  17  ?   ?   ?   C . n 
C 3 18  GLY 18  18  ?   ?   ?   C . n 
C 3 19  ARG 19  19  ?   ?   ?   C . n 
C 3 20  HIS 20  20  ?   ?   ?   C . n 
C 3 21  GLY 21  21  ?   ?   ?   C . n 
C 3 22  SER 22  22  22  SER SER C . n 
C 3 23  ALA 23  23  23  ALA ALA C . n 
C 3 24  LEU 24  24  24  LEU LEU C . n 
C 3 25  HIS 25  25  25  HIS HIS C . n 
C 3 26  TRP 26  26  26  TRP TRP C . n 
C 3 27  ARG 27  27  27  ARG ARG C . n 
C 3 28  ALA 28  28  28  ALA ALA C . n 
C 3 29  ALA 29  29  29  ALA ALA C . n 
C 3 30  GLY 30  30  30  GLY GLY C . n 
C 3 31  ALA 31  31  31  ALA ALA C . n 
C 3 32  ALA 32  32  32  ALA ALA C . n 
C 3 33  THR 33  33  33  THR THR C . n 
C 3 34  VAL 34  34  34  VAL VAL C . n 
C 3 35  LEU 35  35  35  LEU LEU C . n 
C 3 36  LEU 36  36  36  LEU LEU C . n 
C 3 37  VAL 37  37  37  VAL VAL C . n 
C 3 38  ILE 38  38  38  ILE ILE C . n 
C 3 39  VAL 39  39  39  VAL VAL C . n 
C 3 40  LEU 40  40  40  LEU LEU C . n 
C 3 41  LEU 41  41  41  LEU LEU C . n 
C 3 42  ALA 42  42  42  ALA ALA C . n 
C 3 43  GLY 43  43  43  GLY GLY C . n 
C 3 44  SER 44  44  44  SER SER C . n 
C 3 45  TYR 45  45  45  TYR TYR C . n 
C 3 46  LEU 46  46  46  LEU LEU C . n 
C 3 47  ALA 47  47  47  ALA ALA C . n 
C 3 48  VAL 48  48  48  VAL VAL C . n 
C 3 49  LEU 49  49  49  LEU LEU C . n 
C 3 50  ALA 50  50  50  ALA ALA C . n 
C 3 51  GLU 51  51  51  GLU GLU C . n 
C 3 52  ARG 52  52  52  ARG ARG C . n 
C 3 53  GLY 53  53  53  GLY GLY C . n 
C 3 54  ALA 54  54  54  ALA ALA C . n 
C 3 55  PRO 55  55  55  PRO PRO C . n 
C 3 56  GLY 56  56  56  GLY GLY C . n 
C 3 57  ALA 57  57  57  ALA ALA C . n 
C 3 58  GLN 58  58  58  GLN GLN C . n 
C 3 59  LEU 59  59  59  LEU LEU C . n 
C 3 60  ILE 60  60  60  ILE ILE C . n 
C 3 61  THR 61  61  61  THR THR C . n 
C 3 62  TYR 62  62  62  TYR TYR C . n 
C 3 63  PRO 63  63  63  PRO PRO C . n 
C 3 64  ARG 64  64  64  ARG ARG C . n 
C 3 65  ALA 65  65  65  ALA ALA C . n 
C 3 66  LEU 66  66  66  LEU LEU C . n 
C 3 67  TRP 67  67  67  TRP TRP C . n 
C 3 68  TRP 68  68  68  TRP TRP C . n 
C 3 69  SER 69  69  69  SER SER C . n 
C 3 70  VAL 70  70  70  VAL VAL C . n 
C 3 71  GLU 71  71  71  GLU GLU C . n 
C 3 72  THR 72  72  72  THR THR C . n 
C 3 73  ALA 73  73  73  ALA ALA C . n 
C 3 74  THR 74  74  74  THR THR C . n 
C 3 75  CYS 75  75  75  CYS CYS C . n 
C 3 76  VAL 76  76  76  VAL VAL C . n 
C 3 77  GLY 77  77  77  GLY GLY C . n 
C 3 78  TYR 78  78  78  TYR TYR C . n 
C 3 79  GLY 79  79  79  GLY GLY C . n 
C 3 80  ASP 80  80  80  ASP ASP C . n 
C 3 81  LEU 81  81  81  LEU LEU C . n 
C 3 82  TYR 82  82  82  TYR TYR C . n 
C 3 83  PRO 83  83  83  PRO PRO C . n 
C 3 84  VAL 84  84  84  VAL VAL C . n 
C 3 85  THR 85  85  85  THR THR C . n 
C 3 86  LEU 86  86  86  LEU LEU C . n 
C 3 87  TRP 87  87  87  TRP TRP C . n 
C 3 88  GLY 88  88  88  GLY GLY C . n 
C 3 89  ARG 89  89  89  ARG ARG C . n 
C 3 90  LEU 90  90  90  LEU LEU C . n 
C 3 91  VAL 91  91  91  VAL VAL C . n 
C 3 92  ALA 92  92  92  ALA ALA C . n 
C 3 93  VAL 93  93  93  VAL VAL C . n 
C 3 94  VAL 94  94  94  VAL VAL C . n 
C 3 95  VAL 95  95  95  VAL VAL C . n 
C 3 96  MET 96  96  96  MET MET C . n 
C 3 97  VAL 97  97  97  VAL VAL C . n 
C 3 98  ALA 98  98  98  ALA ALA C . n 
C 3 99  GLY 99  99  99  GLY GLY C . n 
C 3 100 ILE 100 100 100 ILE ILE C . n 
C 3 101 THR 101 101 101 THR THR C . n 
C 3 102 SER 102 102 102 SER SER C . n 
C 3 103 PHE 103 103 103 PHE PHE C . n 
C 3 104 GLY 104 104 104 GLY GLY C . n 
C 3 105 LEU 105 105 105 LEU LEU C . n 
C 3 106 VAL 106 106 106 VAL VAL C . n 
C 3 107 THR 107 107 107 THR THR C . n 
C 3 108 ALA 108 108 108 ALA ALA C . n 
C 3 109 ALA 109 109 109 ALA ALA C . n 
C 3 110 LEU 110 110 110 LEU LEU C . n 
C 3 111 ALA 111 111 111 ALA ALA C . n 
C 3 112 THR 112 112 112 THR THR C . n 
C 3 113 TRP 113 113 113 TRP TRP C . n 
C 3 114 PHE 114 114 114 PHE PHE C . n 
C 3 115 VAL 115 115 115 VAL VAL C . n 
C 3 116 GLY 116 116 116 GLY GLY C . n 
C 3 117 ARG 117 117 117 ARG ARG C . n 
C 3 118 GLU 118 118 118 GLU GLU C . n 
C 3 119 GLN 119 119 119 GLN GLN C . n 
C 3 120 GLU 120 120 120 GLU GLU C . n 
C 3 121 ARG 121 121 121 ARG ARG C . n 
C 3 122 ARG 122 122 122 ARG ARG C . n 
C 3 123 GLY 123 123 123 GLY GLY C . n 
C 3 124 HIS 124 124 124 HIS HIS C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 F09 1  302 302 F09 F09 B . 
E 5 K   1  401 401 K   K   C . 
F 5 K   1  402 402 K   K   C . 
G 5 K   1  403 403 K   K   C . 
H 5 K   1  404 404 K   K   C . 
I 5 K   1  405 405 K   K   C . 
J 5 K   1  406 406 K   K   C . 
K 5 K   1  407 407 K   K   C . 
L 6 DGA 1  301 301 DGA DGA C . 
M 7 HOH 1  213 2   HOH HOH A . 
M 7 HOH 2  214 4   HOH HOH A . 
M 7 HOH 3  215 6   HOH HOH A . 
M 7 HOH 4  216 7   HOH HOH A . 
M 7 HOH 5  217 8   HOH HOH A . 
M 7 HOH 6  218 10  HOH HOH A . 
M 7 HOH 7  219 11  HOH HOH A . 
M 7 HOH 8  220 14  HOH HOH A . 
M 7 HOH 9  221 15  HOH HOH A . 
M 7 HOH 10 222 17  HOH HOH A . 
M 7 HOH 11 223 20  HOH HOH A . 
M 7 HOH 12 224 22  HOH HOH A . 
M 7 HOH 13 225 23  HOH HOH A . 
M 7 HOH 14 226 25  HOH HOH A . 
M 7 HOH 15 227 27  HOH HOH A . 
M 7 HOH 16 228 35  HOH HOH A . 
M 7 HOH 17 229 36  HOH HOH A . 
M 7 HOH 18 230 37  HOH HOH A . 
M 7 HOH 19 231 39  HOH HOH A . 
M 7 HOH 20 232 42  HOH HOH A . 
M 7 HOH 21 233 44  HOH HOH A . 
M 7 HOH 22 234 47  HOH HOH A . 
M 7 HOH 23 235 48  HOH HOH A . 
M 7 HOH 24 236 49  HOH HOH A . 
M 7 HOH 25 237 50  HOH HOH A . 
M 7 HOH 26 238 52  HOH HOH A . 
M 7 HOH 27 239 53  HOH HOH A . 
M 7 HOH 28 240 55  HOH HOH A . 
M 7 HOH 29 241 57  HOH HOH A . 
M 7 HOH 30 242 64  HOH HOH A . 
M 7 HOH 31 243 65  HOH HOH A . 
M 7 HOH 32 244 71  HOH HOH A . 
M 7 HOH 33 245 73  HOH HOH A . 
M 7 HOH 34 246 74  HOH HOH A . 
M 7 HOH 35 247 76  HOH HOH A . 
M 7 HOH 36 248 77  HOH HOH A . 
M 7 HOH 37 249 79  HOH HOH A . 
M 7 HOH 38 250 84  HOH HOH A . 
M 7 HOH 39 251 86  HOH HOH A . 
M 7 HOH 40 252 89  HOH HOH A . 
M 7 HOH 41 253 92  HOH HOH A . 
M 7 HOH 42 254 94  HOH HOH A . 
M 7 HOH 43 255 98  HOH HOH A . 
M 7 HOH 44 256 99  HOH HOH A . 
M 7 HOH 45 257 102 HOH HOH A . 
M 7 HOH 46 258 103 HOH HOH A . 
M 7 HOH 47 259 104 HOH HOH A . 
M 7 HOH 48 260 105 HOH HOH A . 
M 7 HOH 49 261 106 HOH HOH A . 
M 7 HOH 50 262 107 HOH HOH A . 
M 7 HOH 51 263 108 HOH HOH A . 
M 7 HOH 52 264 109 HOH HOH A . 
M 7 HOH 53 265 110 HOH HOH A . 
M 7 HOH 54 266 112 HOH HOH A . 
M 7 HOH 55 267 116 HOH HOH A . 
M 7 HOH 56 268 118 HOH HOH A . 
M 7 HOH 57 269 122 HOH HOH A . 
M 7 HOH 58 270 123 HOH HOH A . 
M 7 HOH 59 271 126 HOH HOH A . 
M 7 HOH 60 272 129 HOH HOH A . 
M 7 HOH 61 273 130 HOH HOH A . 
M 7 HOH 62 274 131 HOH HOH A . 
M 7 HOH 63 275 133 HOH HOH A . 
M 7 HOH 64 276 135 HOH HOH A . 
M 7 HOH 65 277 136 HOH HOH A . 
M 7 HOH 66 278 137 HOH HOH A . 
M 7 HOH 67 279 141 HOH HOH A . 
M 7 HOH 68 280 144 HOH HOH A . 
M 7 HOH 69 281 146 HOH HOH A . 
M 7 HOH 70 282 151 HOH HOH A . 
M 7 HOH 71 283 152 HOH HOH A . 
M 7 HOH 72 284 156 HOH HOH A . 
M 7 HOH 73 285 159 HOH HOH A . 
M 7 HOH 74 286 163 HOH HOH A . 
M 7 HOH 75 287 171 HOH HOH A . 
M 7 HOH 76 288 177 HOH HOH A . 
M 7 HOH 77 289 183 HOH HOH A . 
M 7 HOH 78 290 185 HOH HOH A . 
M 7 HOH 79 291 186 HOH HOH A . 
M 7 HOH 80 292 187 HOH HOH A . 
M 7 HOH 81 293 190 HOH HOH A . 
M 7 HOH 82 294 191 HOH HOH A . 
M 7 HOH 83 295 193 HOH HOH A . 
M 7 HOH 84 296 194 HOH HOH A . 
M 7 HOH 85 297 196 HOH HOH A . 
M 7 HOH 86 298 197 HOH HOH A . 
M 7 HOH 87 299 198 HOH HOH A . 
M 7 HOH 88 300 201 HOH HOH A . 
M 7 HOH 89 301 203 HOH HOH A . 
M 7 HOH 90 302 204 HOH HOH A . 
M 7 HOH 91 303 210 HOH HOH A . 
M 7 HOH 92 304 212 HOH HOH A . 
M 7 HOH 93 305 213 HOH HOH A . 
M 7 HOH 94 306 214 HOH HOH A . 
M 7 HOH 95 307 215 HOH HOH A . 
M 7 HOH 96 308 216 HOH HOH A . 
M 7 HOH 97 309 218 HOH HOH A . 
M 7 HOH 98 310 225 HOH HOH A . 
M 7 HOH 99 311 233 HOH HOH A . 
N 7 HOH 1  303 1   HOH HOH B . 
N 7 HOH 2  304 12  HOH HOH B . 
N 7 HOH 3  305 18  HOH HOH B . 
N 7 HOH 4  306 21  HOH HOH B . 
N 7 HOH 5  307 26  HOH HOH B . 
N 7 HOH 6  308 28  HOH HOH B . 
N 7 HOH 7  309 29  HOH HOH B . 
N 7 HOH 8  310 30  HOH HOH B . 
N 7 HOH 9  311 31  HOH HOH B . 
N 7 HOH 10 312 32  HOH HOH B . 
N 7 HOH 11 313 38  HOH HOH B . 
N 7 HOH 12 314 40  HOH HOH B . 
N 7 HOH 13 315 41  HOH HOH B . 
N 7 HOH 14 316 43  HOH HOH B . 
N 7 HOH 15 317 45  HOH HOH B . 
N 7 HOH 16 318 51  HOH HOH B . 
N 7 HOH 17 319 54  HOH HOH B . 
N 7 HOH 18 320 58  HOH HOH B . 
N 7 HOH 19 321 60  HOH HOH B . 
N 7 HOH 20 322 61  HOH HOH B . 
N 7 HOH 21 323 62  HOH HOH B . 
N 7 HOH 22 324 63  HOH HOH B . 
N 7 HOH 23 325 66  HOH HOH B . 
N 7 HOH 24 326 67  HOH HOH B . 
N 7 HOH 25 327 69  HOH HOH B . 
N 7 HOH 26 328 70  HOH HOH B . 
N 7 HOH 27 329 72  HOH HOH B . 
N 7 HOH 28 330 75  HOH HOH B . 
N 7 HOH 29 331 81  HOH HOH B . 
N 7 HOH 30 332 82  HOH HOH B . 
N 7 HOH 31 333 83  HOH HOH B . 
N 7 HOH 32 334 87  HOH HOH B . 
N 7 HOH 33 335 90  HOH HOH B . 
N 7 HOH 34 336 91  HOH HOH B . 
N 7 HOH 35 337 93  HOH HOH B . 
N 7 HOH 36 338 95  HOH HOH B . 
N 7 HOH 37 339 100 HOH HOH B . 
N 7 HOH 38 340 101 HOH HOH B . 
N 7 HOH 39 341 113 HOH HOH B . 
N 7 HOH 40 342 114 HOH HOH B . 
N 7 HOH 41 343 115 HOH HOH B . 
N 7 HOH 42 344 120 HOH HOH B . 
N 7 HOH 43 345 121 HOH HOH B . 
N 7 HOH 44 346 125 HOH HOH B . 
N 7 HOH 45 347 128 HOH HOH B . 
N 7 HOH 46 348 132 HOH HOH B . 
N 7 HOH 47 349 134 HOH HOH B . 
N 7 HOH 48 350 138 HOH HOH B . 
N 7 HOH 49 351 139 HOH HOH B . 
N 7 HOH 50 352 140 HOH HOH B . 
N 7 HOH 51 353 143 HOH HOH B . 
N 7 HOH 52 354 145 HOH HOH B . 
N 7 HOH 53 355 148 HOH HOH B . 
N 7 HOH 54 356 149 HOH HOH B . 
N 7 HOH 55 357 150 HOH HOH B . 
N 7 HOH 56 358 154 HOH HOH B . 
N 7 HOH 57 359 157 HOH HOH B . 
N 7 HOH 58 360 158 HOH HOH B . 
N 7 HOH 59 361 161 HOH HOH B . 
N 7 HOH 60 362 165 HOH HOH B . 
N 7 HOH 61 363 166 HOH HOH B . 
N 7 HOH 62 364 167 HOH HOH B . 
N 7 HOH 63 365 172 HOH HOH B . 
N 7 HOH 64 366 173 HOH HOH B . 
N 7 HOH 65 367 175 HOH HOH B . 
N 7 HOH 66 368 176 HOH HOH B . 
N 7 HOH 67 369 178 HOH HOH B . 
N 7 HOH 68 370 179 HOH HOH B . 
N 7 HOH 69 371 180 HOH HOH B . 
N 7 HOH 70 372 181 HOH HOH B . 
N 7 HOH 71 373 182 HOH HOH B . 
N 7 HOH 72 374 184 HOH HOH B . 
N 7 HOH 73 375 188 HOH HOH B . 
N 7 HOH 74 376 189 HOH HOH B . 
N 7 HOH 75 377 192 HOH HOH B . 
N 7 HOH 76 378 195 HOH HOH B . 
N 7 HOH 77 379 199 HOH HOH B . 
N 7 HOH 78 380 200 HOH HOH B . 
N 7 HOH 79 381 202 HOH HOH B . 
N 7 HOH 80 382 206 HOH HOH B . 
N 7 HOH 81 383 207 HOH HOH B . 
N 7 HOH 82 384 208 HOH HOH B . 
N 7 HOH 83 385 209 HOH HOH B . 
N 7 HOH 84 386 211 HOH HOH B . 
N 7 HOH 85 387 219 HOH HOH B . 
N 7 HOH 86 388 220 HOH HOH B . 
N 7 HOH 87 389 221 HOH HOH B . 
N 7 HOH 88 390 222 HOH HOH B . 
N 7 HOH 89 391 223 HOH HOH B . 
N 7 HOH 90 392 224 HOH HOH B . 
N 7 HOH 91 393 226 HOH HOH B . 
N 7 HOH 92 394 227 HOH HOH B . 
N 7 HOH 93 395 228 HOH HOH B . 
N 7 HOH 94 396 229 HOH HOH B . 
N 7 HOH 95 397 231 HOH HOH B . 
N 7 HOH 96 398 232 HOH HOH B . 
O 7 HOH 1  408 3   HOH HOH C . 
O 7 HOH 2  409 5   HOH HOH C . 
O 7 HOH 3  410 9   HOH HOH C . 
O 7 HOH 4  411 13  HOH HOH C . 
O 7 HOH 5  412 16  HOH HOH C . 
O 7 HOH 6  413 19  HOH HOH C . 
O 7 HOH 7  414 24  HOH HOH C . 
O 7 HOH 8  415 33  HOH HOH C . 
O 7 HOH 9  416 34  HOH HOH C . 
O 7 HOH 10 417 46  HOH HOH C . 
O 7 HOH 11 418 56  HOH HOH C . 
O 7 HOH 12 419 59  HOH HOH C . 
O 7 HOH 13 420 68  HOH HOH C . 
O 7 HOH 14 421 78  HOH HOH C . 
O 7 HOH 15 422 80  HOH HOH C . 
O 7 HOH 16 423 85  HOH HOH C . 
O 7 HOH 17 424 88  HOH HOH C . 
O 7 HOH 18 425 96  HOH HOH C . 
O 7 HOH 19 426 97  HOH HOH C . 
O 7 HOH 20 427 117 HOH HOH C . 
O 7 HOH 21 428 124 HOH HOH C . 
O 7 HOH 22 429 127 HOH HOH C . 
O 7 HOH 23 430 142 HOH HOH C . 
O 7 HOH 24 431 153 HOH HOH C . 
O 7 HOH 25 432 160 HOH HOH C . 
O 7 HOH 26 433 164 HOH HOH C . 
O 7 HOH 27 434 168 HOH HOH C . 
O 7 HOH 28 435 169 HOH HOH C . 
O 7 HOH 29 436 170 HOH HOH C . 
O 7 HOH 30 437 174 HOH HOH C . 
O 7 HOH 31 438 205 HOH HOH C . 
O 7 HOH 32 439 230 HOH HOH C . 
O 7 HOH 33 440 234 HOH HOH C . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dodecameric 
_pdbx_struct_assembly.oligomeric_count     12 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2,3,4 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z       1.0000000000  0.0000000000  0.0000000000 0.0000000000   0.0000000000  
1.0000000000  0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_775 -x+2,-y+2,z -1.0000000000 0.0000000000  0.0000000000 309.4100000000 0.0000000000  
-1.0000000000 0.0000000000 309.4100000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
3 'crystal symmetry operation' 3_755 -y+2,x,z    0.0000000000  -1.0000000000 0.0000000000 309.4100000000 1.0000000000  
0.0000000000  0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000 0.0000000000 
4 'crystal symmetry operation' 4_575 y,-x+2,z    0.0000000000  1.0000000000  0.0000000000 0.0000000000   -1.0000000000 
0.0000000000  0.0000000000 309.4100000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 C K   401 ? E K   . 
2 1 C K   402 ? F K   . 
3 1 C K   403 ? G K   . 
4 1 C K   404 ? H K   . 
5 1 C K   405 ? I K   . 
6 1 C K   406 ? J K   . 
7 1 C K   407 ? K K   . 
8 1 C HOH 440 ? O HOH . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1   O ? C CYS 75 ? C CYS 75  ? 1_555 K ? G K . ? C K 403 ? 1_555 O ? C CYS 75 ? C CYS 75  ? 4_575 81.6  ? 
2   O ? C CYS 75 ? C CYS 75  ? 1_555 K ? G K . ? C K 403 ? 1_555 O ? C CYS 75 ? C CYS 75  ? 3_755 81.6  ? 
3   O ? C CYS 75 ? C CYS 75  ? 4_575 K ? G K . ? C K 403 ? 1_555 O ? C CYS 75 ? C CYS 75  ? 3_755 135.1 ? 
4   O ? C CYS 75 ? C CYS 75  ? 1_555 K ? G K . ? C K 403 ? 1_555 O ? C CYS 75 ? C CYS 75  ? 2_775 135.1 ? 
5   O ? C CYS 75 ? C CYS 75  ? 4_575 K ? G K . ? C K 403 ? 1_555 O ? C CYS 75 ? C CYS 75  ? 2_775 81.6  ? 
6   O ? C CYS 75 ? C CYS 75  ? 3_755 K ? G K . ? C K 403 ? 1_555 O ? C CYS 75 ? C CYS 75  ? 2_775 81.6  ? 
7   O ? C CYS 75 ? C CYS 75  ? 1_555 K ? G K . ? C K 403 ? 1_555 O ? C VAL 76 ? C VAL 76  ? 1_555 69.3  ? 
8   O ? C CYS 75 ? C CYS 75  ? 4_575 K ? G K . ? C K 403 ? 1_555 O ? C VAL 76 ? C VAL 76  ? 1_555 81.7  ? 
9   O ? C CYS 75 ? C CYS 75  ? 3_755 K ? G K . ? C K 403 ? 1_555 O ? C VAL 76 ? C VAL 76  ? 1_555 129.1 ? 
10  O ? C CYS 75 ? C CYS 75  ? 2_775 K ? G K . ? C K 403 ? 1_555 O ? C VAL 76 ? C VAL 76  ? 1_555 147.2 ? 
11  O ? C CYS 75 ? C CYS 75  ? 1_555 K ? G K . ? C K 403 ? 1_555 O ? C VAL 76 ? C VAL 76  ? 4_575 129.1 ? 
12  O ? C CYS 75 ? C CYS 75  ? 4_575 K ? G K . ? C K 403 ? 1_555 O ? C VAL 76 ? C VAL 76  ? 4_575 69.3  ? 
13  O ? C CYS 75 ? C CYS 75  ? 3_755 K ? G K . ? C K 403 ? 1_555 O ? C VAL 76 ? C VAL 76  ? 4_575 147.2 ? 
14  O ? C CYS 75 ? C CYS 75  ? 2_775 K ? G K . ? C K 403 ? 1_555 O ? C VAL 76 ? C VAL 76  ? 4_575 81.7  ? 
15  O ? C VAL 76 ? C VAL 76  ? 1_555 K ? G K . ? C K 403 ? 1_555 O ? C VAL 76 ? C VAL 76  ? 4_575 66.0  ? 
16  O ? C CYS 75 ? C CYS 75  ? 1_555 K ? G K . ? C K 403 ? 1_555 O ? C VAL 76 ? C VAL 76  ? 3_755 81.7  ? 
17  O ? C CYS 75 ? C CYS 75  ? 4_575 K ? G K . ? C K 403 ? 1_555 O ? C VAL 76 ? C VAL 76  ? 3_755 147.2 ? 
18  O ? C CYS 75 ? C CYS 75  ? 3_755 K ? G K . ? C K 403 ? 1_555 O ? C VAL 76 ? C VAL 76  ? 3_755 69.3  ? 
19  O ? C CYS 75 ? C CYS 75  ? 2_775 K ? G K . ? C K 403 ? 1_555 O ? C VAL 76 ? C VAL 76  ? 3_755 129.1 ? 
20  O ? C VAL 76 ? C VAL 76  ? 1_555 K ? G K . ? C K 403 ? 1_555 O ? C VAL 76 ? C VAL 76  ? 3_755 66.0  ? 
21  O ? C VAL 76 ? C VAL 76  ? 4_575 K ? G K . ? C K 403 ? 1_555 O ? C VAL 76 ? C VAL 76  ? 3_755 100.7 ? 
22  O ? C CYS 75 ? C CYS 75  ? 1_555 K ? G K . ? C K 403 ? 1_555 O ? C VAL 76 ? C VAL 76  ? 2_775 147.2 ? 
23  O ? C CYS 75 ? C CYS 75  ? 4_575 K ? G K . ? C K 403 ? 1_555 O ? C VAL 76 ? C VAL 76  ? 2_775 129.1 ? 
24  O ? C CYS 75 ? C CYS 75  ? 3_755 K ? G K . ? C K 403 ? 1_555 O ? C VAL 76 ? C VAL 76  ? 2_775 81.7  ? 
25  O ? C CYS 75 ? C CYS 75  ? 2_775 K ? G K . ? C K 403 ? 1_555 O ? C VAL 76 ? C VAL 76  ? 2_775 69.3  ? 
26  O ? C VAL 76 ? C VAL 76  ? 1_555 K ? G K . ? C K 403 ? 1_555 O ? C VAL 76 ? C VAL 76  ? 2_775 100.7 ? 
27  O ? C VAL 76 ? C VAL 76  ? 4_575 K ? G K . ? C K 403 ? 1_555 O ? C VAL 76 ? C VAL 76  ? 2_775 66.0  ? 
28  O ? C VAL 76 ? C VAL 76  ? 3_755 K ? G K . ? C K 403 ? 1_555 O ? C VAL 76 ? C VAL 76  ? 2_775 66.0  ? 
29  O ? C VAL 76 ? C VAL 76  ? 1_555 K ? F K . ? C K 402 ? 1_555 O ? C VAL 76 ? C VAL 76  ? 4_575 74.6  ? 
30  O ? C VAL 76 ? C VAL 76  ? 1_555 K ? F K . ? C K 402 ? 1_555 O ? C VAL 76 ? C VAL 76  ? 3_755 74.6  ? 
31  O ? C VAL 76 ? C VAL 76  ? 4_575 K ? F K . ? C K 402 ? 1_555 O ? C VAL 76 ? C VAL 76  ? 3_755 118.1 ? 
32  O ? C VAL 76 ? C VAL 76  ? 1_555 K ? F K . ? C K 402 ? 1_555 O ? C VAL 76 ? C VAL 76  ? 2_775 118.1 ? 
33  O ? C VAL 76 ? C VAL 76  ? 4_575 K ? F K . ? C K 402 ? 1_555 O ? C VAL 76 ? C VAL 76  ? 2_775 74.6  ? 
34  O ? C VAL 76 ? C VAL 76  ? 3_755 K ? F K . ? C K 402 ? 1_555 O ? C VAL 76 ? C VAL 76  ? 2_775 74.6  ? 
35  O ? C VAL 76 ? C VAL 76  ? 1_555 K ? F K . ? C K 402 ? 1_555 O ? C GLY 77 ? C GLY 77  ? 1_555 71.6  ? 
36  O ? C VAL 76 ? C VAL 76  ? 4_575 K ? F K . ? C K 402 ? 1_555 O ? C GLY 77 ? C GLY 77  ? 1_555 132.9 ? 
37  O ? C VAL 76 ? C VAL 76  ? 3_755 K ? F K . ? C K 402 ? 1_555 O ? C GLY 77 ? C GLY 77  ? 1_555 83.2  ? 
38  O ? C VAL 76 ? C VAL 76  ? 2_775 K ? F K . ? C K 402 ? 1_555 O ? C GLY 77 ? C GLY 77  ? 1_555 151.4 ? 
39  O ? C VAL 76 ? C VAL 76  ? 1_555 K ? F K . ? C K 402 ? 1_555 O ? C GLY 77 ? C GLY 77  ? 4_575 83.2  ? 
40  O ? C VAL 76 ? C VAL 76  ? 4_575 K ? F K . ? C K 402 ? 1_555 O ? C GLY 77 ? C GLY 77  ? 4_575 71.6  ? 
41  O ? C VAL 76 ? C VAL 76  ? 3_755 K ? F K . ? C K 402 ? 1_555 O ? C GLY 77 ? C GLY 77  ? 4_575 151.4 ? 
42  O ? C VAL 76 ? C VAL 76  ? 2_775 K ? F K . ? C K 402 ? 1_555 O ? C GLY 77 ? C GLY 77  ? 4_575 132.9 ? 
43  O ? C GLY 77 ? C GLY 77  ? 1_555 K ? F K . ? C K 402 ? 1_555 O ? C GLY 77 ? C GLY 77  ? 4_575 72.6  ? 
44  O ? C VAL 76 ? C VAL 76  ? 1_555 K ? F K . ? C K 402 ? 1_555 O ? C GLY 77 ? C GLY 77  ? 3_755 132.9 ? 
45  O ? C VAL 76 ? C VAL 76  ? 4_575 K ? F K . ? C K 402 ? 1_555 O ? C GLY 77 ? C GLY 77  ? 3_755 151.4 ? 
46  O ? C VAL 76 ? C VAL 76  ? 3_755 K ? F K . ? C K 402 ? 1_555 O ? C GLY 77 ? C GLY 77  ? 3_755 71.6  ? 
47  O ? C VAL 76 ? C VAL 76  ? 2_775 K ? F K . ? C K 402 ? 1_555 O ? C GLY 77 ? C GLY 77  ? 3_755 83.2  ? 
48  O ? C GLY 77 ? C GLY 77  ? 1_555 K ? F K . ? C K 402 ? 1_555 O ? C GLY 77 ? C GLY 77  ? 3_755 72.6  ? 
49  O ? C GLY 77 ? C GLY 77  ? 4_575 K ? F K . ? C K 402 ? 1_555 O ? C GLY 77 ? C GLY 77  ? 3_755 113.8 ? 
50  O ? C VAL 76 ? C VAL 76  ? 1_555 K ? F K . ? C K 402 ? 1_555 O ? C GLY 77 ? C GLY 77  ? 2_775 151.4 ? 
51  O ? C VAL 76 ? C VAL 76  ? 4_575 K ? F K . ? C K 402 ? 1_555 O ? C GLY 77 ? C GLY 77  ? 2_775 83.2  ? 
52  O ? C VAL 76 ? C VAL 76  ? 3_755 K ? F K . ? C K 402 ? 1_555 O ? C GLY 77 ? C GLY 77  ? 2_775 132.9 ? 
53  O ? C VAL 76 ? C VAL 76  ? 2_775 K ? F K . ? C K 402 ? 1_555 O ? C GLY 77 ? C GLY 77  ? 2_775 71.6  ? 
54  O ? C GLY 77 ? C GLY 77  ? 1_555 K ? F K . ? C K 402 ? 1_555 O ? C GLY 77 ? C GLY 77  ? 2_775 113.8 ? 
55  O ? C GLY 77 ? C GLY 77  ? 4_575 K ? F K . ? C K 402 ? 1_555 O ? C GLY 77 ? C GLY 77  ? 2_775 72.6  ? 
56  O ? C GLY 77 ? C GLY 77  ? 3_755 K ? F K . ? C K 402 ? 1_555 O ? C GLY 77 ? C GLY 77  ? 2_775 72.6  ? 
57  O ? C VAL 76 ? C VAL 76  ? 1_555 K ? F K . ? C K 402 ? 1_555 K ? G K   .  ? C K   403 ? 1_555 59.0  ? 
58  O ? C VAL 76 ? C VAL 76  ? 4_575 K ? F K . ? C K 402 ? 1_555 K ? G K   .  ? C K   403 ? 1_555 59.0  ? 
59  O ? C VAL 76 ? C VAL 76  ? 3_755 K ? F K . ? C K 402 ? 1_555 K ? G K   .  ? C K   403 ? 1_555 59.0  ? 
60  O ? C VAL 76 ? C VAL 76  ? 2_775 K ? F K . ? C K 402 ? 1_555 K ? G K   .  ? C K   403 ? 1_555 59.0  ? 
61  O ? C GLY 77 ? C GLY 77  ? 1_555 K ? F K . ? C K 402 ? 1_555 K ? G K   .  ? C K   403 ? 1_555 123.1 ? 
62  O ? C GLY 77 ? C GLY 77  ? 4_575 K ? F K . ? C K 402 ? 1_555 K ? G K   .  ? C K   403 ? 1_555 123.1 ? 
63  O ? C GLY 77 ? C GLY 77  ? 3_755 K ? F K . ? C K 402 ? 1_555 K ? G K   .  ? C K   403 ? 1_555 123.1 ? 
64  O ? C GLY 77 ? C GLY 77  ? 2_775 K ? F K . ? C K 402 ? 1_555 K ? G K   .  ? C K   403 ? 1_555 123.1 ? 
65  O ? C VAL 76 ? C VAL 76  ? 1_555 K ? F K . ? C K 402 ? 1_555 K ? G K   .  ? C K   403 ? 2_775 59.0  ? 
66  O ? C VAL 76 ? C VAL 76  ? 4_575 K ? F K . ? C K 402 ? 1_555 K ? G K   .  ? C K   403 ? 2_775 59.0  ? 
67  O ? C VAL 76 ? C VAL 76  ? 3_755 K ? F K . ? C K 402 ? 1_555 K ? G K   .  ? C K   403 ? 2_775 59.0  ? 
68  O ? C VAL 76 ? C VAL 76  ? 2_775 K ? F K . ? C K 402 ? 1_555 K ? G K   .  ? C K   403 ? 2_775 59.0  ? 
69  O ? C GLY 77 ? C GLY 77  ? 1_555 K ? F K . ? C K 402 ? 1_555 K ? G K   .  ? C K   403 ? 2_775 123.1 ? 
70  O ? C GLY 77 ? C GLY 77  ? 4_575 K ? F K . ? C K 402 ? 1_555 K ? G K   .  ? C K   403 ? 2_775 123.1 ? 
71  O ? C GLY 77 ? C GLY 77  ? 3_755 K ? F K . ? C K 402 ? 1_555 K ? G K   .  ? C K   403 ? 2_775 123.1 ? 
72  O ? C GLY 77 ? C GLY 77  ? 2_775 K ? F K . ? C K 402 ? 1_555 K ? G K   .  ? C K   403 ? 2_775 123.1 ? 
73  K ? G K   .  ? C K   403 ? 1_555 K ? F K . ? C K 402 ? 1_555 K ? G K   .  ? C K   403 ? 2_775 0.0   ? 
74  O ? C VAL 76 ? C VAL 76  ? 1_555 K ? F K . ? C K 402 ? 1_555 K ? G K   .  ? C K   403 ? 3_755 59.0  ? 
75  O ? C VAL 76 ? C VAL 76  ? 4_575 K ? F K . ? C K 402 ? 1_555 K ? G K   .  ? C K   403 ? 3_755 59.0  ? 
76  O ? C VAL 76 ? C VAL 76  ? 3_755 K ? F K . ? C K 402 ? 1_555 K ? G K   .  ? C K   403 ? 3_755 59.0  ? 
77  O ? C VAL 76 ? C VAL 76  ? 2_775 K ? F K . ? C K 402 ? 1_555 K ? G K   .  ? C K   403 ? 3_755 59.0  ? 
78  O ? C GLY 77 ? C GLY 77  ? 1_555 K ? F K . ? C K 402 ? 1_555 K ? G K   .  ? C K   403 ? 3_755 123.1 ? 
79  O ? C GLY 77 ? C GLY 77  ? 4_575 K ? F K . ? C K 402 ? 1_555 K ? G K   .  ? C K   403 ? 3_755 123.1 ? 
80  O ? C GLY 77 ? C GLY 77  ? 3_755 K ? F K . ? C K 402 ? 1_555 K ? G K   .  ? C K   403 ? 3_755 123.1 ? 
81  O ? C GLY 77 ? C GLY 77  ? 2_775 K ? F K . ? C K 402 ? 1_555 K ? G K   .  ? C K   403 ? 3_755 123.1 ? 
82  K ? G K   .  ? C K   403 ? 1_555 K ? F K . ? C K 402 ? 1_555 K ? G K   .  ? C K   403 ? 3_755 0.0   ? 
83  K ? G K   .  ? C K   403 ? 2_775 K ? F K . ? C K 402 ? 1_555 K ? G K   .  ? C K   403 ? 3_755 0.0   ? 
84  O ? C VAL 76 ? C VAL 76  ? 1_555 K ? F K . ? C K 402 ? 1_555 K ? G K   .  ? C K   403 ? 4_575 59.0  ? 
85  O ? C VAL 76 ? C VAL 76  ? 4_575 K ? F K . ? C K 402 ? 1_555 K ? G K   .  ? C K   403 ? 4_575 59.0  ? 
86  O ? C VAL 76 ? C VAL 76  ? 3_755 K ? F K . ? C K 402 ? 1_555 K ? G K   .  ? C K   403 ? 4_575 59.0  ? 
87  O ? C VAL 76 ? C VAL 76  ? 2_775 K ? F K . ? C K 402 ? 1_555 K ? G K   .  ? C K   403 ? 4_575 59.0  ? 
88  O ? C GLY 77 ? C GLY 77  ? 1_555 K ? F K . ? C K 402 ? 1_555 K ? G K   .  ? C K   403 ? 4_575 123.1 ? 
89  O ? C GLY 77 ? C GLY 77  ? 4_575 K ? F K . ? C K 402 ? 1_555 K ? G K   .  ? C K   403 ? 4_575 123.1 ? 
90  O ? C GLY 77 ? C GLY 77  ? 3_755 K ? F K . ? C K 402 ? 1_555 K ? G K   .  ? C K   403 ? 4_575 123.1 ? 
91  O ? C GLY 77 ? C GLY 77  ? 2_775 K ? F K . ? C K 402 ? 1_555 K ? G K   .  ? C K   403 ? 4_575 123.1 ? 
92  K ? G K   .  ? C K   403 ? 1_555 K ? F K . ? C K 402 ? 1_555 K ? G K   .  ? C K   403 ? 4_575 0.0   ? 
93  K ? G K   .  ? C K   403 ? 2_775 K ? F K . ? C K 402 ? 1_555 K ? G K   .  ? C K   403 ? 4_575 0.0   ? 
94  K ? G K   .  ? C K   403 ? 3_755 K ? F K . ? C K 402 ? 1_555 K ? G K   .  ? C K   403 ? 4_575 0.0   ? 
95  O ? C GLY 77 ? C GLY 77  ? 1_555 K ? E K . ? C K 401 ? 1_555 O ? C GLY 77 ? C GLY 77  ? 4_575 70.9  ? 
96  O ? C GLY 77 ? C GLY 77  ? 1_555 K ? E K . ? C K 401 ? 1_555 O ? C GLY 77 ? C GLY 77  ? 3_755 70.9  ? 
97  O ? C GLY 77 ? C GLY 77  ? 4_575 K ? E K . ? C K 401 ? 1_555 O ? C GLY 77 ? C GLY 77  ? 3_755 110.3 ? 
98  O ? C GLY 77 ? C GLY 77  ? 1_555 K ? E K . ? C K 401 ? 1_555 O ? C GLY 77 ? C GLY 77  ? 2_775 110.3 ? 
99  O ? C GLY 77 ? C GLY 77  ? 4_575 K ? E K . ? C K 401 ? 1_555 O ? C GLY 77 ? C GLY 77  ? 2_775 70.9  ? 
100 O ? C GLY 77 ? C GLY 77  ? 3_755 K ? E K . ? C K 401 ? 1_555 O ? C GLY 77 ? C GLY 77  ? 2_775 70.9  ? 
101 O ? C GLY 77 ? C GLY 77  ? 1_555 K ? E K . ? C K 401 ? 1_555 O ? C TYR 78 ? C TYR 78  ? 1_555 69.3  ? 
102 O ? C GLY 77 ? C GLY 77  ? 4_575 K ? E K . ? C K 401 ? 1_555 O ? C TYR 78 ? C TYR 78  ? 1_555 78.3  ? 
103 O ? C GLY 77 ? C GLY 77  ? 3_755 K ? E K . ? C K 401 ? 1_555 O ? C TYR 78 ? C TYR 78  ? 1_555 133.4 ? 
104 O ? C GLY 77 ? C GLY 77  ? 2_775 K ? E K . ? C K 401 ? 1_555 O ? C TYR 78 ? C TYR 78  ? 1_555 146.9 ? 
105 O ? C GLY 77 ? C GLY 77  ? 1_555 K ? E K . ? C K 401 ? 1_555 O ? C TYR 78 ? C TYR 78  ? 4_575 133.4 ? 
106 O ? C GLY 77 ? C GLY 77  ? 4_575 K ? E K . ? C K 401 ? 1_555 O ? C TYR 78 ? C TYR 78  ? 4_575 69.3  ? 
107 O ? C GLY 77 ? C GLY 77  ? 3_755 K ? E K . ? C K 401 ? 1_555 O ? C TYR 78 ? C TYR 78  ? 4_575 146.9 ? 
108 O ? C GLY 77 ? C GLY 77  ? 2_775 K ? E K . ? C K 401 ? 1_555 O ? C TYR 78 ? C TYR 78  ? 4_575 78.3  ? 
109 O ? C TYR 78 ? C TYR 78  ? 1_555 K ? E K . ? C K 401 ? 1_555 O ? C TYR 78 ? C TYR 78  ? 4_575 79.7  ? 
110 O ? C GLY 77 ? C GLY 77  ? 1_555 K ? E K . ? C K 401 ? 1_555 O ? C TYR 78 ? C TYR 78  ? 3_755 78.3  ? 
111 O ? C GLY 77 ? C GLY 77  ? 4_575 K ? E K . ? C K 401 ? 1_555 O ? C TYR 78 ? C TYR 78  ? 3_755 146.9 ? 
112 O ? C GLY 77 ? C GLY 77  ? 3_755 K ? E K . ? C K 401 ? 1_555 O ? C TYR 78 ? C TYR 78  ? 3_755 69.3  ? 
113 O ? C GLY 77 ? C GLY 77  ? 2_775 K ? E K . ? C K 401 ? 1_555 O ? C TYR 78 ? C TYR 78  ? 3_755 133.4 ? 
114 O ? C TYR 78 ? C TYR 78  ? 1_555 K ? E K . ? C K 401 ? 1_555 O ? C TYR 78 ? C TYR 78  ? 3_755 79.7  ? 
115 O ? C TYR 78 ? C TYR 78  ? 4_575 K ? E K . ? C K 401 ? 1_555 O ? C TYR 78 ? C TYR 78  ? 3_755 129.9 ? 
116 O ? C GLY 77 ? C GLY 77  ? 1_555 K ? E K . ? C K 401 ? 1_555 O ? C TYR 78 ? C TYR 78  ? 2_775 146.9 ? 
117 O ? C GLY 77 ? C GLY 77  ? 4_575 K ? E K . ? C K 401 ? 1_555 O ? C TYR 78 ? C TYR 78  ? 2_775 133.4 ? 
118 O ? C GLY 77 ? C GLY 77  ? 3_755 K ? E K . ? C K 401 ? 1_555 O ? C TYR 78 ? C TYR 78  ? 2_775 78.3  ? 
119 O ? C GLY 77 ? C GLY 77  ? 2_775 K ? E K . ? C K 401 ? 1_555 O ? C TYR 78 ? C TYR 78  ? 2_775 69.3  ? 
120 O ? C TYR 78 ? C TYR 78  ? 1_555 K ? E K . ? C K 401 ? 1_555 O ? C TYR 78 ? C TYR 78  ? 2_775 129.9 ? 
121 O ? C TYR 78 ? C TYR 78  ? 4_575 K ? E K . ? C K 401 ? 1_555 O ? C TYR 78 ? C TYR 78  ? 2_775 79.7  ? 
122 O ? C TYR 78 ? C TYR 78  ? 3_755 K ? E K . ? C K 401 ? 1_555 O ? C TYR 78 ? C TYR 78  ? 2_775 79.7  ? 
123 O ? C GLY 77 ? C GLY 77  ? 1_555 K ? E K . ? C K 401 ? 1_555 K ? F K   .  ? C K   402 ? 1_555 55.1  ? 
124 O ? C GLY 77 ? C GLY 77  ? 4_575 K ? E K . ? C K 401 ? 1_555 K ? F K   .  ? C K   402 ? 1_555 55.1  ? 
125 O ? C GLY 77 ? C GLY 77  ? 3_755 K ? E K . ? C K 401 ? 1_555 K ? F K   .  ? C K   402 ? 1_555 55.1  ? 
126 O ? C GLY 77 ? C GLY 77  ? 2_775 K ? E K . ? C K 401 ? 1_555 K ? F K   .  ? C K   402 ? 1_555 55.1  ? 
127 O ? C TYR 78 ? C TYR 78  ? 1_555 K ? E K . ? C K 401 ? 1_555 K ? F K   .  ? C K   402 ? 1_555 115.0 ? 
128 O ? C TYR 78 ? C TYR 78  ? 4_575 K ? E K . ? C K 401 ? 1_555 K ? F K   .  ? C K   402 ? 1_555 115.0 ? 
129 O ? C TYR 78 ? C TYR 78  ? 3_755 K ? E K . ? C K 401 ? 1_555 K ? F K   .  ? C K   402 ? 1_555 115.0 ? 
130 O ? C TYR 78 ? C TYR 78  ? 2_775 K ? E K . ? C K 401 ? 1_555 K ? F K   .  ? C K   402 ? 1_555 115.0 ? 
131 O ? C GLY 77 ? C GLY 77  ? 1_555 K ? E K . ? C K 401 ? 1_555 K ? F K   .  ? C K   402 ? 2_775 55.1  ? 
132 O ? C GLY 77 ? C GLY 77  ? 4_575 K ? E K . ? C K 401 ? 1_555 K ? F K   .  ? C K   402 ? 2_775 55.1  ? 
133 O ? C GLY 77 ? C GLY 77  ? 3_755 K ? E K . ? C K 401 ? 1_555 K ? F K   .  ? C K   402 ? 2_775 55.1  ? 
134 O ? C GLY 77 ? C GLY 77  ? 2_775 K ? E K . ? C K 401 ? 1_555 K ? F K   .  ? C K   402 ? 2_775 55.1  ? 
135 O ? C TYR 78 ? C TYR 78  ? 1_555 K ? E K . ? C K 401 ? 1_555 K ? F K   .  ? C K   402 ? 2_775 115.0 ? 
136 O ? C TYR 78 ? C TYR 78  ? 4_575 K ? E K . ? C K 401 ? 1_555 K ? F K   .  ? C K   402 ? 2_775 115.0 ? 
137 O ? C TYR 78 ? C TYR 78  ? 3_755 K ? E K . ? C K 401 ? 1_555 K ? F K   .  ? C K   402 ? 2_775 115.0 ? 
138 O ? C TYR 78 ? C TYR 78  ? 2_775 K ? E K . ? C K 401 ? 1_555 K ? F K   .  ? C K   402 ? 2_775 115.0 ? 
139 K ? F K   .  ? C K   402 ? 1_555 K ? E K . ? C K 401 ? 1_555 K ? F K   .  ? C K   402 ? 2_775 0.0   ? 
140 O ? C GLY 77 ? C GLY 77  ? 1_555 K ? E K . ? C K 401 ? 1_555 K ? F K   .  ? C K   402 ? 3_755 55.1  ? 
141 O ? C GLY 77 ? C GLY 77  ? 4_575 K ? E K . ? C K 401 ? 1_555 K ? F K   .  ? C K   402 ? 3_755 55.1  ? 
142 O ? C GLY 77 ? C GLY 77  ? 3_755 K ? E K . ? C K 401 ? 1_555 K ? F K   .  ? C K   402 ? 3_755 55.1  ? 
143 O ? C GLY 77 ? C GLY 77  ? 2_775 K ? E K . ? C K 401 ? 1_555 K ? F K   .  ? C K   402 ? 3_755 55.1  ? 
144 O ? C TYR 78 ? C TYR 78  ? 1_555 K ? E K . ? C K 401 ? 1_555 K ? F K   .  ? C K   402 ? 3_755 115.0 ? 
145 O ? C TYR 78 ? C TYR 78  ? 4_575 K ? E K . ? C K 401 ? 1_555 K ? F K   .  ? C K   402 ? 3_755 115.0 ? 
146 O ? C TYR 78 ? C TYR 78  ? 3_755 K ? E K . ? C K 401 ? 1_555 K ? F K   .  ? C K   402 ? 3_755 115.0 ? 
147 O ? C TYR 78 ? C TYR 78  ? 2_775 K ? E K . ? C K 401 ? 1_555 K ? F K   .  ? C K   402 ? 3_755 115.0 ? 
148 K ? F K   .  ? C K   402 ? 1_555 K ? E K . ? C K 401 ? 1_555 K ? F K   .  ? C K   402 ? 3_755 0.0   ? 
149 K ? F K   .  ? C K   402 ? 2_775 K ? E K . ? C K 401 ? 1_555 K ? F K   .  ? C K   402 ? 3_755 0.0   ? 
150 O ? C GLY 77 ? C GLY 77  ? 1_555 K ? E K . ? C K 401 ? 1_555 K ? F K   .  ? C K   402 ? 4_575 55.1  ? 
151 O ? C GLY 77 ? C GLY 77  ? 4_575 K ? E K . ? C K 401 ? 1_555 K ? F K   .  ? C K   402 ? 4_575 55.1  ? 
152 O ? C GLY 77 ? C GLY 77  ? 3_755 K ? E K . ? C K 401 ? 1_555 K ? F K   .  ? C K   402 ? 4_575 55.1  ? 
153 O ? C GLY 77 ? C GLY 77  ? 2_775 K ? E K . ? C K 401 ? 1_555 K ? F K   .  ? C K   402 ? 4_575 55.1  ? 
154 O ? C TYR 78 ? C TYR 78  ? 1_555 K ? E K . ? C K 401 ? 1_555 K ? F K   .  ? C K   402 ? 4_575 115.0 ? 
155 O ? C TYR 78 ? C TYR 78  ? 4_575 K ? E K . ? C K 401 ? 1_555 K ? F K   .  ? C K   402 ? 4_575 115.0 ? 
156 O ? C TYR 78 ? C TYR 78  ? 3_755 K ? E K . ? C K 401 ? 1_555 K ? F K   .  ? C K   402 ? 4_575 115.0 ? 
157 O ? C TYR 78 ? C TYR 78  ? 2_775 K ? E K . ? C K 401 ? 1_555 K ? F K   .  ? C K   402 ? 4_575 115.0 ? 
158 K ? F K   .  ? C K   402 ? 1_555 K ? E K . ? C K 401 ? 1_555 K ? F K   .  ? C K   402 ? 4_575 0.0   ? 
159 K ? F K   .  ? C K   402 ? 2_775 K ? E K . ? C K 401 ? 1_555 K ? F K   .  ? C K   402 ? 4_575 0.0   ? 
160 K ? F K   .  ? C K   402 ? 3_755 K ? E K . ? C K 401 ? 1_555 K ? F K   .  ? C K   402 ? 4_575 0.0   ? 
161 O ? O HOH .  ? C HOH 419 ? 1_555 K ? H K . ? C K 404 ? 1_555 O ? O HOH .  ? C HOH 419 ? 4_575 79.9  ? 
162 O ? O HOH .  ? C HOH 419 ? 1_555 K ? H K . ? C K 404 ? 1_555 O ? O HOH .  ? C HOH 419 ? 3_755 79.9  ? 
163 O ? O HOH .  ? C HOH 419 ? 4_575 K ? H K . ? C K 404 ? 1_555 O ? O HOH .  ? C HOH 419 ? 3_755 130.4 ? 
164 O ? O HOH .  ? C HOH 419 ? 1_555 K ? H K . ? C K 404 ? 1_555 O ? O HOH .  ? C HOH 419 ? 2_775 130.4 ? 
165 O ? O HOH .  ? C HOH 419 ? 4_575 K ? H K . ? C K 404 ? 1_555 O ? O HOH .  ? C HOH 419 ? 2_775 79.9  ? 
166 O ? O HOH .  ? C HOH 419 ? 3_755 K ? H K . ? C K 404 ? 1_555 O ? O HOH .  ? C HOH 419 ? 2_775 79.9  ? 
167 K ? K K   .  ? C K   407 ? 1_555 K ? J K . ? C K 406 ? 1_555 K ? K K   .  ? C K   407 ? 2_775 0.0   ? 
168 K ? K K   .  ? C K   407 ? 1_555 K ? J K . ? C K 406 ? 1_555 K ? K K   .  ? C K   407 ? 3_755 0.0   ? 
169 K ? K K   .  ? C K   407 ? 2_775 K ? J K . ? C K 406 ? 1_555 K ? K K   .  ? C K   407 ? 3_755 0.0   ? 
170 K ? K K   .  ? C K   407 ? 1_555 K ? J K . ? C K 406 ? 1_555 K ? K K   .  ? C K   407 ? 4_575 0.0   ? 
171 K ? K K   .  ? C K   407 ? 2_775 K ? J K . ? C K 406 ? 1_555 K ? K K   .  ? C K   407 ? 4_575 0.0   ? 
172 K ? K K   .  ? C K   407 ? 3_755 K ? J K . ? C K 406 ? 1_555 K ? K K   .  ? C K   407 ? 4_575 0.0   ? 
173 O ? O HOH .  ? C HOH 425 ? 1_555 K ? K K . ? C K 407 ? 1_555 O ? O HOH .  ? C HOH 425 ? 2_775 156.8 ? 
174 O ? O HOH .  ? C HOH 425 ? 1_555 K ? K K . ? C K 407 ? 1_555 O ? O HOH .  ? C HOH 425 ? 3_755 87.7  ? 
175 O ? O HOH .  ? C HOH 425 ? 2_775 K ? K K . ? C K 407 ? 1_555 O ? O HOH .  ? C HOH 425 ? 3_755 87.7  ? 
176 O ? O HOH .  ? C HOH 425 ? 1_555 K ? K K . ? C K 407 ? 1_555 O ? O HOH .  ? C HOH 425 ? 4_575 87.7  ? 
177 O ? O HOH .  ? C HOH 425 ? 2_775 K ? K K . ? C K 407 ? 1_555 O ? O HOH .  ? C HOH 425 ? 4_575 87.7  ? 
178 O ? O HOH .  ? C HOH 425 ? 3_755 K ? K K . ? C K 407 ? 1_555 O ? O HOH .  ? C HOH 425 ? 4_575 156.8 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-05-18 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2011-11-16 
5 'Structure model' 1 4 2021-10-27 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Atomic model'              
4 5 'Structure model' 'Database references'       
5 5 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 5 'Structure model' database_2             
2 5 'Structure model' pdbx_struct_conn_angle 
3 5 'Structure model' struct_conn            
4 5 'Structure model' struct_ref_seq_dif     
5 5 'Structure model' struct_site            
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  5 'Structure model' '_database_2.pdbx_DOI'                        
2  5 'Structure model' '_database_2.pdbx_database_accession'         
3  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
4  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
5  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 
6  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
7  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
8  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id'  
9  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_symmetry'      
10 5 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id'   
11 5 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 
12 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
13 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
14 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 
15 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
16 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
17 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id'  
18 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_symmetry'      
19 5 'Structure model' '_pdbx_struct_conn_angle.value'               
20 5 'Structure model' '_struct_conn.pdbx_dist_value'                
21 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
22 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
23 5 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
24 5 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
25 5 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
26 5 'Structure model' '_struct_conn.ptnr1_label_seq_id'             
27 5 'Structure model' '_struct_conn.ptnr1_symmetry'                 
28 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id'             
29 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
30 5 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
31 5 'Structure model' '_struct_conn.ptnr2_label_atom_id'            
32 5 'Structure model' '_struct_conn.ptnr2_label_comp_id'            
33 5 'Structure model' '_struct_conn.ptnr2_label_seq_id'             
34 5 'Structure model' '_struct_conn.ptnr2_symmetry'                 
35 5 'Structure model' '_struct_ref_seq_dif.details'                 
36 5 'Structure model' '_struct_site.pdbx_auth_asym_id'              
37 5 'Structure model' '_struct_site.pdbx_auth_comp_id'              
38 5 'Structure model' '_struct_site.pdbx_auth_seq_id'               
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement       1.1 ? 1 
HKL-2000  'data reduction' .   ? 2 
SCALEPACK 'data scaling'   .   ? 3 
CNS       phasing          .   ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASN A 41  ? ? 58.50   17.97   
2  1 ALA A 51  ? ? 65.67   -38.10  
3  1 SER A 52  ? ? -140.87 -3.52   
4  1 SER A 77  ? ? 62.70   83.36   
5  1 ALA A 84  ? ? 176.33  -174.34 
6  1 ASP A 170 ? ? -141.73 11.68   
7  1 ARG A 188 ? ? -97.98  35.21   
8  1 ASN A 190 ? ? -97.41  -67.11  
9  1 ALA B 92  ? ? 179.35  175.99  
10 1 ASN B 138 ? ? -109.87 -151.81 
11 1 PRO B 154 ? ? -114.38 -167.51 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A GLU 17  ? CG  ? A GLU 17  CG  
2   1 Y 1 A GLU 17  ? CD  ? A GLU 17  CD  
3   1 Y 1 A GLU 17  ? OE1 ? A GLU 17  OE1 
4   1 Y 1 A GLU 17  ? OE2 ? A GLU 17  OE2 
5   1 Y 1 A ARG 24  ? CG  ? A ARG 24  CG  
6   1 Y 1 A ARG 24  ? CD  ? A ARG 24  CD  
7   1 Y 1 A ARG 24  ? NE  ? A ARG 24  NE  
8   1 Y 1 A ARG 24  ? CZ  ? A ARG 24  CZ  
9   1 Y 1 A ARG 24  ? NH1 ? A ARG 24  NH1 
10  1 Y 1 A ARG 24  ? NH2 ? A ARG 24  NH2 
11  1 Y 1 A SER 60  ? OG  ? A SER 60  OG  
12  1 Y 1 A VAL 78  ? CG1 ? A VAL 78  CG1 
13  1 Y 1 A VAL 78  ? CG2 ? A VAL 78  CG2 
14  1 Y 1 A LYS 103 ? CG  ? A LYS 103 CG  
15  1 Y 1 A LYS 103 ? CD  ? A LYS 103 CD  
16  1 Y 1 A LYS 103 ? CE  ? A LYS 103 CE  
17  1 Y 1 A LYS 103 ? NZ  ? A LYS 103 NZ  
18  1 Y 1 A LYS 107 ? CG  ? A LYS 107 CG  
19  1 Y 1 A LYS 107 ? CD  ? A LYS 107 CD  
20  1 Y 1 A LYS 107 ? CE  ? A LYS 107 CE  
21  1 Y 1 A LYS 107 ? NZ  ? A LYS 107 NZ  
22  1 Y 1 A LYS 142 ? CG  ? A LYS 142 CG  
23  1 Y 1 A LYS 142 ? CD  ? A LYS 142 CD  
24  1 Y 1 A LYS 142 ? CE  ? A LYS 142 CE  
25  1 Y 1 A LYS 142 ? NZ  ? A LYS 142 NZ  
26  1 Y 1 A ASN 145 ? CG  ? A ASN 145 CG  
27  1 Y 1 A ASN 145 ? OD1 ? A ASN 145 OD1 
28  1 Y 1 A ASN 145 ? ND2 ? A ASN 145 ND2 
29  1 Y 1 A LYS 147 ? CG  ? A LYS 147 CG  
30  1 Y 1 A LYS 147 ? CD  ? A LYS 147 CD  
31  1 Y 1 A LYS 147 ? CE  ? A LYS 147 CE  
32  1 Y 1 A LYS 147 ? NZ  ? A LYS 147 NZ  
33  1 Y 1 A ASN 157 ? CG  ? A ASN 157 CG  
34  1 Y 1 A ASN 157 ? OD1 ? A ASN 157 OD1 
35  1 Y 1 A ASN 157 ? ND2 ? A ASN 157 ND2 
36  1 Y 1 A LYS 169 ? CG  ? A LYS 169 CG  
37  1 Y 1 A LYS 169 ? CD  ? A LYS 169 CD  
38  1 Y 1 A LYS 169 ? CE  ? A LYS 169 CE  
39  1 Y 1 A LYS 169 ? NZ  ? A LYS 169 NZ  
40  1 Y 1 A LYS 183 ? CG  ? A LYS 183 CG  
41  1 Y 1 A LYS 183 ? CD  ? A LYS 183 CD  
42  1 Y 1 A LYS 183 ? CE  ? A LYS 183 CE  
43  1 Y 1 A LYS 183 ? NZ  ? A LYS 183 NZ  
44  1 Y 1 A ASN 190 ? CG  ? A ASN 190 CG  
45  1 Y 1 A ASN 190 ? OD1 ? A ASN 190 OD1 
46  1 Y 1 A ASN 190 ? ND2 ? A ASN 190 ND2 
47  1 Y 1 B GLN 5   ? CG  ? B GLN 5   CG  
48  1 Y 1 B GLN 5   ? CD  ? B GLN 5   CD  
49  1 Y 1 B GLN 5   ? OE1 ? B GLN 5   OE1 
50  1 Y 1 B GLN 5   ? NE2 ? B GLN 5   NE2 
51  1 Y 1 B LYS 23  ? CG  ? B LYS 23  CG  
52  1 Y 1 B LYS 23  ? CD  ? B LYS 23  CD  
53  1 Y 1 B LYS 23  ? CE  ? B LYS 23  CE  
54  1 Y 1 B LYS 23  ? NZ  ? B LYS 23  NZ  
55  1 Y 1 B ARG 40  ? CG  ? B ARG 40  CG  
56  1 Y 1 B ARG 40  ? CD  ? B ARG 40  CD  
57  1 Y 1 B ARG 40  ? NE  ? B ARG 40  NE  
58  1 Y 1 B ARG 40  ? CZ  ? B ARG 40  CZ  
59  1 Y 1 B ARG 40  ? NH1 ? B ARG 40  NH1 
60  1 Y 1 B ARG 40  ? NH2 ? B ARG 40  NH2 
61  1 Y 1 B LYS 63  ? CG  ? B LYS 63  CG  
62  1 Y 1 B LYS 63  ? CD  ? B LYS 63  CD  
63  1 Y 1 B LYS 63  ? CE  ? B LYS 63  CE  
64  1 Y 1 B LYS 63  ? NZ  ? B LYS 63  NZ  
65  1 Y 1 B GLN 65  ? CG  ? B GLN 65  CG  
66  1 Y 1 B GLN 65  ? CD  ? B GLN 65  CD  
67  1 Y 1 B GLN 65  ? OE1 ? B GLN 65  OE1 
68  1 Y 1 B GLN 65  ? NE2 ? B GLN 65  NE2 
69  1 Y 1 B LYS 74  ? CG  ? B LYS 74  CG  
70  1 Y 1 B LYS 74  ? CD  ? B LYS 74  CD  
71  1 Y 1 B LYS 74  ? CE  ? B LYS 74  CE  
72  1 Y 1 B LYS 74  ? NZ  ? B LYS 74  NZ  
73  1 Y 1 B GLU 89  ? CG  ? B GLU 89  CG  
74  1 Y 1 B GLU 89  ? CD  ? B GLU 89  CD  
75  1 Y 1 B GLU 89  ? OE1 ? B GLU 89  OE1 
76  1 Y 1 B GLU 89  ? OE2 ? B GLU 89  OE2 
77  1 Y 1 B LYS 120 ? CG  ? B LYS 120 CG  
78  1 Y 1 B LYS 120 ? CD  ? B LYS 120 CD  
79  1 Y 1 B LYS 120 ? CE  ? B LYS 120 CE  
80  1 Y 1 B LYS 120 ? NZ  ? B LYS 120 NZ  
81  1 Y 1 B GLN 136 ? CG  ? B GLN 136 CG  
82  1 Y 1 B GLN 136 ? CD  ? B GLN 136 CD  
83  1 Y 1 B GLN 136 ? OE1 ? B GLN 136 OE1 
84  1 Y 1 B GLN 136 ? NE2 ? B GLN 136 NE2 
85  1 Y 1 B THR 137 ? OG1 ? B THR 137 OG1 
86  1 Y 1 B THR 137 ? CG2 ? B THR 137 CG2 
87  1 Y 1 B ASN 138 ? CG  ? B ASN 138 CG  
88  1 Y 1 B ASN 138 ? OD1 ? B ASN 138 OD1 
89  1 Y 1 B ASN 138 ? ND2 ? B ASN 138 ND2 
90  1 Y 1 B SER 165 ? OG  ? B SER 165 OG  
91  1 Y 1 B SER 166 ? OG  ? B SER 166 OG  
92  1 Y 1 B SER 177 ? OG  ? B SER 177 OG  
93  1 Y 1 B ASP 178 ? CG  ? B ASP 178 CG  
94  1 Y 1 B ASP 178 ? OD1 ? B ASP 178 OD1 
95  1 Y 1 B ASP 178 ? OD2 ? B ASP 178 OD2 
96  1 Y 1 B ASP 219 ? CG  ? B ASP 219 CG  
97  1 Y 1 B ASP 219 ? OD1 ? B ASP 219 OD1 
98  1 Y 1 B ASP 219 ? OD2 ? B ASP 219 OD2 
99  1 Y 1 C SER 22  ? OG  ? C SER 22  OG  
100 1 Y 1 C ARG 27  ? CG  ? C ARG 27  CG  
101 1 Y 1 C ARG 27  ? CD  ? C ARG 27  CD  
102 1 Y 1 C ARG 27  ? NE  ? C ARG 27  NE  
103 1 Y 1 C ARG 27  ? CZ  ? C ARG 27  CZ  
104 1 Y 1 C ARG 27  ? NH1 ? C ARG 27  NH1 
105 1 Y 1 C ARG 27  ? NH2 ? C ARG 27  NH2 
106 1 Y 1 C ARG 117 ? CG  ? C ARG 117 CG  
107 1 Y 1 C ARG 117 ? CD  ? C ARG 117 CD  
108 1 Y 1 C ARG 117 ? NE  ? C ARG 117 NE  
109 1 Y 1 C ARG 117 ? CZ  ? C ARG 117 CZ  
110 1 Y 1 C ARG 117 ? NH1 ? C ARG 117 NH1 
111 1 Y 1 C ARG 117 ? NH2 ? C ARG 117 NH2 
112 1 Y 1 C GLN 119 ? CG  ? C GLN 119 CG  
113 1 Y 1 C GLN 119 ? CD  ? C GLN 119 CD  
114 1 Y 1 C GLN 119 ? OE1 ? C GLN 119 OE1 
115 1 Y 1 C GLN 119 ? NE2 ? C GLN 119 NE2 
116 1 Y 1 C ARG 122 ? CG  ? C ARG 122 CG  
117 1 Y 1 C ARG 122 ? CD  ? C ARG 122 CD  
118 1 Y 1 C ARG 122 ? NE  ? C ARG 122 NE  
119 1 Y 1 C ARG 122 ? CZ  ? C ARG 122 CZ  
120 1 Y 1 C ARG 122 ? NH1 ? C ARG 122 NH1 
121 1 Y 1 C ARG 122 ? NH2 ? C ARG 122 NH2 
122 1 Y 1 C HIS 124 ? CG  ? C HIS 124 CG  
123 1 Y 1 C HIS 124 ? ND1 ? C HIS 124 ND1 
124 1 Y 1 C HIS 124 ? CD2 ? C HIS 124 CD2 
125 1 Y 1 C HIS 124 ? CE1 ? C HIS 124 CE1 
126 1 Y 1 C HIS 124 ? NE2 ? C HIS 124 NE2 
127 1 N 1 C DGA 301 ? CA6 ? L DGA 1   CA6 
128 1 N 1 C DGA 301 ? CA7 ? L DGA 1   CA7 
129 1 N 1 C DGA 301 ? CA8 ? L DGA 1   CA8 
130 1 N 1 C DGA 301 ? CA9 ? L DGA 1   CA9 
131 1 N 1 C DGA 301 ? CAA ? L DGA 1   CAA 
132 1 N 1 C DGA 301 ? CBA ? L DGA 1   CBA 
133 1 N 1 C DGA 301 ? CCA ? L DGA 1   CCA 
134 1 N 1 C DGA 301 ? CDA ? L DGA 1   CDA 
135 1 N 1 C DGA 301 ? CEA ? L DGA 1   CEA 
136 1 N 1 C DGA 301 ? CFA ? L DGA 1   CFA 
137 1 N 1 C DGA 301 ? CGA ? L DGA 1   CGA 
138 1 N 1 C DGA 301 ? CHA ? L DGA 1   CHA 
139 1 N 1 C DGA 301 ? CIA ? L DGA 1   CIA 
140 1 N 1 C DGA 301 ? CAB ? L DGA 1   CAB 
141 1 N 1 C DGA 301 ? CBB ? L DGA 1   CBB 
142 1 N 1 C DGA 301 ? CCB ? L DGA 1   CCB 
143 1 N 1 C DGA 301 ? CDB ? L DGA 1   CDB 
144 1 N 1 C DGA 301 ? CEB ? L DGA 1   CEB 
145 1 N 1 C DGA 301 ? CFB ? L DGA 1   CFB 
146 1 N 1 C DGA 301 ? CGB ? L DGA 1   CGB 
147 1 N 1 C DGA 301 ? CHB ? L DGA 1   CHB 
148 1 N 1 C DGA 301 ? CIB ? L DGA 1   CIB 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ASN 212 ? A ASN 212 
2  1 Y 1 C MET 1   ? C MET 1   
3  1 Y 1 C ALA 2   ? C ALA 2   
4  1 Y 1 C PRO 3   ? C PRO 3   
5  1 Y 1 C MET 4   ? C MET 4   
6  1 Y 1 C LEU 5   ? C LEU 5   
7  1 Y 1 C SER 6   ? C SER 6   
8  1 Y 1 C GLY 7   ? C GLY 7   
9  1 Y 1 C LEU 8   ? C LEU 8   
10 1 Y 1 C LEU 9   ? C LEU 9   
11 1 Y 1 C ALA 10  ? C ALA 10  
12 1 Y 1 C ARG 11  ? C ARG 11  
13 1 Y 1 C LEU 12  ? C LEU 12  
14 1 Y 1 C VAL 13  ? C VAL 13  
15 1 Y 1 C LYS 14  ? C LYS 14  
16 1 Y 1 C LEU 15  ? C LEU 15  
17 1 Y 1 C LEU 16  ? C LEU 16  
18 1 Y 1 C LEU 17  ? C LEU 17  
19 1 Y 1 C GLY 18  ? C GLY 18  
20 1 Y 1 C ARG 19  ? C ARG 19  
21 1 Y 1 C HIS 20  ? C HIS 20  
22 1 Y 1 C GLY 21  ? C GLY 21  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 NONAN-1-OL        F09 
5 'POTASSIUM ION'   K   
6 'DIACYL GLYCEROL' DGA 
7 water             HOH 
#