data_1S72
# 
_entry.id   1S72 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1S72         
NDB   RR0082       
RCSB  RCSB021448   
WWPDB D_1000021448 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1JJ2 . unspecified 
PDB 1FFK . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1S72 
_pdbx_database_status.recvd_initial_deposition_date   2004-01-28 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Klein, D.J.'    1 
'Schmeing, T.M.' 2 
'Moore, P.B.'    3 
'Steitz, T.A.'   4 
# 
_citation.id                        primary 
_citation.title                     
'The Roles of Ribosomal Proteins in the Structure, Assembly and Evolution of the Large Ribosomal Subunit' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            340 
_citation.page_first                141 
_citation.page_last                 177 
_citation.year                      2004 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15184028 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2004.03.076 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Klein, D.J.'  1 
primary 'Moore, P.B.'  2 
primary 'Steitz, T.A.' 3 
# 
_cell.entry_id           1S72 
_cell.length_a           211.660 
_cell.length_b           299.670 
_cell.length_c           573.770 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1S72 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat '23S ribosomal RNA'                   946090.438 1    ? ? ? ? 
2  polymer     nat '5S ribosomal RNA'                    39318.414  1    ? ? ? ? 
3  polymer     nat '50S ribosomal protein L2P'           25354.688  1    ? ? ? ? 
4  polymer     nat '50S ribosomal protein L3P'           37396.395  1    ? ? ? ? 
5  polymer     nat '50S ribosomal protein L4E'           26442.098  1    ? ? ? ? 
6  polymer     nat '50S ribosomal protein L5P'           19551.693  1    ? ? ? ? 
7  polymer     nat '50S ribosomal protein L6P'           19961.719  1    ? ? ? ? 
8  polymer     nat '50S ribosomal protein L7Ae'          12791.941  1    ? ? ? ? 
9  polymer     nat 'Acidic ribosomal protein P0 homolog' 37213.805  1    ? ? ? ? 
10 polymer     nat '50S ribosomal protein L10e'          19068.592  1    ? ? ? ? 
11 polymer     nat '50S ribosomal protein L11P'          17097.547  1    ? ? ? ? 
12 polymer     nat '50S ribosomal protein L13P'          16249.214  1    ? ? ? ? 
13 polymer     nat '50S ribosomal protein L14P'          14191.243  1    ? ? ? ? 
14 polymer     nat '50S ribosomal protein L15P'          18005.367  1    ? ? ? ? 
15 polymer     nat '50S ribosomal protein L15e'          22157.887  1    ? ? ? ? 
16 polymer     nat '50S ribosomal protein L18P'          20640.939  1    ? ? ? ? 
17 polymer     nat '50S ribosomal protein L18e'          12438.915  1    ? ? ? ? 
18 polymer     nat '50S ribosomal protein L19E'          16796.514  1    ? ? ? ? 
19 polymer     nat '50S ribosomal protein L21e'          10567.801  1    ? ? ? ? 
20 polymer     nat '50S ribosomal protein L22P'          16966.945  1    ? ? ? ? 
21 polymer     nat '50S ribosomal protein L23P'          9612.537   1    ? ? ? ? 
22 polymer     nat '50S ribosomal protein L24P'          13670.955  1    ? ? ? ? 
23 polymer     nat '50S ribosomal protein L24E'          7233.720   1    ? ? ? ? 
24 polymer     nat '50S ribosomal protein L29P'          7889.863   1    ? ? ? ? 
25 polymer     nat '50S ribosomal protein L30P'          17062.885  1    ? ? ? ? 
26 polymer     nat '50S ribosomal protein L31e'          10384.613  1    ? ? ? ? 
27 polymer     nat '50S ribosomal protein L32E'          26455.727  1    ? ? ? ? 
28 polymer     nat '50S ribosomal protein L37Ae'         8294.167   1    ? ? ? ? 
29 polymer     nat '50S ribosomal protein L37e'          6330.203   1    ? ? ? ? 
30 polymer     nat '50S ribosomal protein L39e'          6133.090   1    ? ? ? ? 
31 polymer     nat '50S ribosomal protein L44E'          10815.245  1    ? ? ? ? 
32 non-polymer syn 'MAGNESIUM ION'                       24.305     116  ? ? ? ? 
33 non-polymer syn 'POTASSIUM ION'                       39.098     2    ? ? ? ? 
34 non-polymer syn 'SODIUM ION'                          22.990     86   ? ? ? ? 
35 non-polymer syn 'CHLORIDE ION'                        35.453     22   ? ? ? ? 
36 non-polymer syn 'CADMIUM ION'                         112.411    5    ? ? ? ? 
37 water       nat water                                 18.015     7823 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
3  'Hmal2, HL4'         
4  'Hmal3, HL1'         
5  'Hmal4, HL6'         
6  'Hmal5, HL13'        
7  'Hmal6, HL10'        
8  HS6                  
9  'L10E, HMaL10'       
11 Hmal11               
12 Hmal13               
13 'Hmal14, HL27'       
14 'Hmal15, HL9'        
16 'Hmal18, HL12'       
17 'HL29, L19'          
18 'Hmal19, HL24'       
19 HL31                 
20 'Hmal22, HL23'       
21 'Hmal23, HL25, L21'  
22 'Hmal24, HL16, HL15' 
23 HL21/HL22            
24 'Hmal29, HL33'       
25 'Hmal30, HL20, HL16' 
26 'L34, HL30'          
27 HL5                  
29 L35e                 
30 'HL39e, HL46e'       
31 'LA, HLA'            
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  polyribonucleotide no yes 
;UUGGCUACUAUGCCAGCUGGUGGAUUGCUCGGCUCAGGCGCUGAUGAAGGACGUGCCAAGCUGCGAUAAGCCAUGGGGAG
CCGCACGGAGGCGAAGAACCAUGGAUUUCCGAAUGAGAAUCUCUCUAACAAUUGCUUCGCGCAAUGAGGAACCCCGAGAA
CUGAAACAUCUCAGUAUCGGGAGGAACAGAAAACGCAAUGUGAUGUCGUUAGUAACCGCGAGUGAACGCGAUACAGCCCA
AACCGAAGCCCUCACGGGCAAUGUGGUGUCAGGGCUACCUCUCAUCAGCCGACCGUCUCGACGAAGUCUCUUGGAACAGA
GCGUGAUACAGGGUGACAACCCCGUACUCGAGACCAGUACGACGUGCGGUAGUGCCAGAGUAGCGGGGGUUGGAUAUCCC
UCGCGAAUAACGCAGGCAUCGACUGCGAAGGCUAAACACAACCUGAGACCGAUAGUGAACAAGUAGUGUGAACGAACGCU
GCAAAGUACCCUCAGAAGGGAGGCGAAAUAGAGCAUGAAAUCAGUUGGCGAUCGAGCGACAGGGCAUACAAGGUCCCUCG
ACGAAUGACCGACGCGCGAGCGUCCAGUAAGACUCACGGGAAGCCGAUGUUCUGUCGUACGUUUUG(1MA)AAAACGAGC
CAGGGAGUGUGUCUGCAUGGCAAGUCUAACCGGAGUAUCCGGGGAGGCACAGGGAAACCGACAUGGCCGCAGGGCUUUGC
CCGAGGGCCGCCGUCUUCAAGGGCGGGGAGCCAUGUGGACACGACCCGAAUCCGGACGAUCUACGCAUGGACAAGAUGAA
GCGUGCCGAAAGGCACGUGGAAGUCUGUUAGAGUUGGUGUCCUACAAUACCCUCUCGUGAUCUAUGUGUAGGGGUGAAAG
GCCCAUCGAGUCCGGCAACAGCUGGUUCCAAUCGAAACAUGUCGAAGCAUGACCUCCGCCGAGGUAGUCUGUGAGGUAGA
GCGACCGAUUGGUGUGUCCGCCUCCGAGAGGAGUCGGCACACCUGUCAAACUCCAAACUUACAGACGCCGUUUGACGCGG
GGAUUCCGGUGCGCGGGGUAAGCCUGUGUACCAGGAGGGGAACAACCCAGAGAUAGGUUAAGGUCCCCAAGUGUGGAUUA
AGUGUAAUCCUCUGAAGGUGGUCUCGAGCCCUAGACAGCCGGGAGGUGAGCUUAGAAGCAGCUACCCUCUAAGAAAAGCG
UAACAGCUUACCGGCCGAGGUUUGAGGCGCCCAAAAUGAUCGGGACUCAAAUCCACCACCGAGACCUGUCCGUACCACUC
AUACUGGUAAUCGAGUAGAUUGGCGCUCUAAUUGGAUGGAAGUAGGGGUGAAAACUCCUAUGGACCGAUUAGUGACGAAA
AUCCUGGCCAUAGUAGCAGCGAUAGUCGGGUGAGAACCCCGACGGCCUAAUGGAUAAGGGUUCCUCAGCACUGCUGAUCA
GCUGAGGGUUAGCCGGUCCUAAGUCAUACCGCAACUCGACUAUGACGAAAUGGGAAACGGGUUAAUAUUCCCGUGCCACU
AUGCAGUGAAAGUUGACGCCCUGGGGUCGAUCACGCUGGGCAUUCGCCCAGUCGAACCGUCCAACUCCGUGGAAGCCGUA
AUGGCAGGAAGCGGACGAACGGCGGCAUAGGGAAACGUGAUUCAACCUGGGGCCCAUGAAAAGACGAGCAUAGUGUCCGU
ACCGAGAACCGACACAGGUGUCCAUGGCGGCGAAAGCCAAGGCCUGUCGGGAGCAACCAACGUUAGGGAAUUCGGCAAGU
UAGUCCCGUACCUUCGGAAGAAGGGAUGCCUGCUCCGGAACGGAGCAGGUCGCAGUGACUCGGAAGCUCGGACUGUCUAG
UAACAACAUAGGUGACCGCAAAUCCGCAAGGACUCGUACGGUCACUGAAUCCUGCCCAGUGCAGGUAUCUGAACACCUCG
UACAAGAGGACGAAGGACCUGUCAACGGCGGGGGUAACUAUGACCCUCUUAAGGUAGCGUAGUACCUUGCCGCAUCAGUA
GCGGCUUGCAUGAAUGGAUUAACCAGAGCUUCACUGUCCCAACGUUGGGCCCGGUGAACUGUACAUUCCAGUGCGGAGUC
UGGAGACACCCAGGGGGAAGCGAAGACCCUAUGGAGCUUUACUGCAGGCUGUCGCUGAGACGUGGUCGCCGAUGUGCAGC
AUAGGUAGGAGACACUACACAGGUACCCGCGCUAGCGGGCCACCGAGUCAACAGUGAAAUACUACCCGUCGGUGACUGCG
ACUCUCACUCCGGGAGGAGGACACCGAUAGCCGGGCAGUUUGACUGGGGCGGUACGCGCUCGAAAAGAUAUCGAGCGCGC
CCUAUGGCUAUCUCAGCCGGGACAGAGACCCGGCGAAGAGUGCAAGAGCAAAAGAUAGCUUGACAGUGUUCUUCCCAACG
AGGAACGCUGACGCGAAAGCGUGGUCUAGCGAACCAAUUAGCCUGCUUGAUGCGGGCAAUUGAUGACAGAAAAGCUACCC
UAGGGAUAACAGAGUCGUCACUCGCAAGAGCACAUAUCGACCGAGUGGCUUGCUACCUCGAUGUCGGUUCCCUCCAUCCU
GCCCGUGCAGAAGCGGGCAAGGGUGAGGU(OMU)(OMG)UUCGCCUAUUAAAGGAGGUCGUGAGCUGGG(UR3)U(PSU)
AGACCGUCGUGAGACAGGUCGGCUGCUAUCUACUGGGUGUGUAAUGGUGUCUGACAAGAACGACCGUAUAGUACGAGAGG
AACUACGGUUGGUGGCCACUGGUGUACCGGUUGUUCGAGAGAGCACGUGCCGGGUAGCCACGCCACACGGGGUAAGAGCU
GAACGCAUCUAAGCUCGAAACCCACUUGGAAAAGAGACACCGCCGAGGUCCCGCGUACAAGACGCGGUCGAUAGACUCGG
GGUGUGCGCGUCGAGGUAACGAGACGUUAAGCCCACGAGCACUAACAGACCAAAGCCAUCAU
;
;UUGGCUACUAUGCCAGCUGGUGGAUUGCUCGGCUCAGGCGCUGAUGAAGGACGUGCCAAGCUGCGAUAAGCCAUGGGGAG
CCGCACGGAGGCGAAGAACCAUGGAUUUCCGAAUGAGAAUCUCUCUAACAAUUGCUUCGCGCAAUGAGGAACCCCGAGAA
CUGAAACAUCUCAGUAUCGGGAGGAACAGAAAACGCAAUGUGAUGUCGUUAGUAACCGCGAGUGAACGCGAUACAGCCCA
AACCGAAGCCCUCACGGGCAAUGUGGUGUCAGGGCUACCUCUCAUCAGCCGACCGUCUCGACGAAGUCUCUUGGAACAGA
GCGUGAUACAGGGUGACAACCCCGUACUCGAGACCAGUACGACGUGCGGUAGUGCCAGAGUAGCGGGGGUUGGAUAUCCC
UCGCGAAUAACGCAGGCAUCGACUGCGAAGGCUAAACACAACCUGAGACCGAUAGUGAACAAGUAGUGUGAACGAACGCU
GCAAAGUACCCUCAGAAGGGAGGCGAAAUAGAGCAUGAAAUCAGUUGGCGAUCGAGCGACAGGGCAUACAAGGUCCCUCG
ACGAAUGACCGACGCGCGAGCGUCCAGUAAGACUCACGGGAAGCCGAUGUUCUGUCGUACGUUUUGAAAAACGAGCCAGG
GAGUGUGUCUGCAUGGCAAGUCUAACCGGAGUAUCCGGGGAGGCACAGGGAAACCGACAUGGCCGCAGGGCUUUGCCCGA
GGGCCGCCGUCUUCAAGGGCGGGGAGCCAUGUGGACACGACCCGAAUCCGGACGAUCUACGCAUGGACAAGAUGAAGCGU
GCCGAAAGGCACGUGGAAGUCUGUUAGAGUUGGUGUCCUACAAUACCCUCUCGUGAUCUAUGUGUAGGGGUGAAAGGCCC
AUCGAGUCCGGCAACAGCUGGUUCCAAUCGAAACAUGUCGAAGCAUGACCUCCGCCGAGGUAGUCUGUGAGGUAGAGCGA
CCGAUUGGUGUGUCCGCCUCCGAGAGGAGUCGGCACACCUGUCAAACUCCAAACUUACAGACGCCGUUUGACGCGGGGAU
UCCGGUGCGCGGGGUAAGCCUGUGUACCAGGAGGGGAACAACCCAGAGAUAGGUUAAGGUCCCCAAGUGUGGAUUAAGUG
UAAUCCUCUGAAGGUGGUCUCGAGCCCUAGACAGCCGGGAGGUGAGCUUAGAAGCAGCUACCCUCUAAGAAAAGCGUAAC
AGCUUACCGGCCGAGGUUUGAGGCGCCCAAAAUGAUCGGGACUCAAAUCCACCACCGAGACCUGUCCGUACCACUCAUAC
UGGUAAUCGAGUAGAUUGGCGCUCUAAUUGGAUGGAAGUAGGGGUGAAAACUCCUAUGGACCGAUUAGUGACGAAAAUCC
UGGCCAUAGUAGCAGCGAUAGUCGGGUGAGAACCCCGACGGCCUAAUGGAUAAGGGUUCCUCAGCACUGCUGAUCAGCUG
AGGGUUAGCCGGUCCUAAGUCAUACCGCAACUCGACUAUGACGAAAUGGGAAACGGGUUAAUAUUCCCGUGCCACUAUGC
AGUGAAAGUUGACGCCCUGGGGUCGAUCACGCUGGGCAUUCGCCCAGUCGAACCGUCCAACUCCGUGGAAGCCGUAAUGG
CAGGAAGCGGACGAACGGCGGCAUAGGGAAACGUGAUUCAACCUGGGGCCCAUGAAAAGACGAGCAUAGUGUCCGUACCG
AGAACCGACACAGGUGUCCAUGGCGGCGAAAGCCAAGGCCUGUCGGGAGCAACCAACGUUAGGGAAUUCGGCAAGUUAGU
CCCGUACCUUCGGAAGAAGGGAUGCCUGCUCCGGAACGGAGCAGGUCGCAGUGACUCGGAAGCUCGGACUGUCUAGUAAC
AACAUAGGUGACCGCAAAUCCGCAAGGACUCGUACGGUCACUGAAUCCUGCCCAGUGCAGGUAUCUGAACACCUCGUACA
AGAGGACGAAGGACCUGUCAACGGCGGGGGUAACUAUGACCCUCUUAAGGUAGCGUAGUACCUUGCCGCAUCAGUAGCGG
CUUGCAUGAAUGGAUUAACCAGAGCUUCACUGUCCCAACGUUGGGCCCGGUGAACUGUACAUUCCAGUGCGGAGUCUGGA
GACACCCAGGGGGAAGCGAAGACCCUAUGGAGCUUUACUGCAGGCUGUCGCUGAGACGUGGUCGCCGAUGUGCAGCAUAG
GUAGGAGACACUACACAGGUACCCGCGCUAGCGGGCCACCGAGUCAACAGUGAAAUACUACCCGUCGGUGACUGCGACUC
UCACUCCGGGAGGAGGACACCGAUAGCCGGGCAGUUUGACUGGGGCGGUACGCGCUCGAAAAGAUAUCGAGCGCGCCCUA
UGGCUAUCUCAGCCGGGACAGAGACCCGGCGAAGAGUGCAAGAGCAAAAGAUAGCUUGACAGUGUUCUUCCCAACGAGGA
ACGCUGACGCGAAAGCGUGGUCUAGCGAACCAAUUAGCCUGCUUGAUGCGGGCAAUUGAUGACAGAAAAGCUACCCUAGG
GAUAACAGAGUCGUCACUCGCAAGAGCACAUAUCGACCGAGUGGCUUGCUACCUCGAUGUCGGUUCCCUCCAUCCUGCCC
GUGCAGAAGCGGGCAAGGGUGAGGUUGUUCGCCUAUUAAAGGAGGUCGUGAGCUGGGUUUAGACCGUCGUGAGACAGGUC
GGCUGCUAUCUACUGGGUGUGUAAUGGUGUCUGACAAGAACGACCGUAUAGUACGAGAGGAACUACGGUUGGUGGCCACU
GGUGUACCGGUUGUUCGAGAGAGCACGUGCCGGGUAGCCACGCCACACGGGGUAAGAGCUGAACGCAUCUAAGCUCGAAA
CCCACUUGGAAAAGAGACACCGCCGAGGUCCCGCGUACAAGACGCGGUCGAUAGACUCGGGGUGUGCGCGUCGAGGUAAC
GAGACGUUAAGCCCACGAGCACUAACAGACCAAAGCCAUCAU
;
0 ? 
2  polyribonucleotide no no  
;UUAGGCGGCCACAGCGGUGGGGUUGCCUCCCGUACCCAUCCCGAACACGGAAGAUAAGCCCACCAGCGUUCCGGGGAGUA
CUGGAGUGCGCGAGCCUCUGGGAAACCCGGUUCGCCGCCACC
;
;UUAGGCGGCCACAGCGGUGGGGUUGCCUCCCGUACCCAUCCCGAACACGGAAGAUAAGCCCACCAGCGUUCCGGGGAGUA
CUGGAGUGCGCGAGCCUCUGGGAAACCCGGUUCGCCGCCACC
;
9 ? 
3  'polypeptide(L)'   no no  
;MGRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDE
LQVGVSAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVV
AGGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGGNE
;
;MGRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDE
LQVGVSAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVV
AGGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGGNE
;
A ? 
4  'polypeptide(L)'   no no  
;MPQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPM
RAVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKP
DVMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNL
GPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPND
QPRLDPEVRYVSNESNQG
;
;MPQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPM
RAVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKP
DVMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNL
GPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPND
QPRLDPEVRYVSNESNQG
;
B ? 
5  'polypeptide(L)'   no no  
;MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKLDGRARRV
PQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEAL
DVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESAL
AEVAER
;
;MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKLDGRARRV
PQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEAL
DVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESAL
AEVAER
;
C ? 
6  'polypeptide(L)'   no no  
;MSSESESGGDFHEMREPRIEKVVVHMGIGHGGRDLANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEM
AEEFLQTALPLAELATSQFDDTGNFSFGVEEHTEFPSQEYDPSIGIYGLDVTVNLVRPGYRVAKRDKASRSIPTKHRLNP
ADAVAFIESTYDVEVSE
;
;MSSESESGGDFHEMREPRIEKVVVHMGIGHGGRDLANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEM
AEEFLQTALPLAELATSQFDDTGNFSFGVEEHTEFPSQEYDPSIGIYGLDVTVNLVRPGYRVAKRDKASRSIPTKHRLNP
ADAVAFIESTYDVEVSE
;
D ? 
7  'polypeptide(L)'   no no  
;MPRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEG
WEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDV
RVFQDGVYITRKPNRGDA
;
;MPRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEG
WEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDV
RVFQDGVYITRKPNRGDA
;
E ? 
8  'polypeptide(L)'   no no  
;MPVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQ
QDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
;
;MPVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQ
QDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
;
F ? 
9  'polypeptide(L)'   no no  
;MSAESERKTETIPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGTAELRVSRNTLLERALDDVDDGLED
LNGYITGQVGLIGTDDNPFSLFQELEASKTPAPIGAGEVAPNDIVIPEGDTGVDPGPFVGELQSVGADARIQEGSIQVLS
DSTVLDTGEEVSQELSNVLNELGIEPKEVGLDLRAVFADGVLFEPEELELDIDEYRSDIQAAAGRAFNLSVNADYPTATT
APTMLQSDRGNAKSLALQAAIEDPEVVPDLVSKADAQVRALASQIDDEEALPEELQGVEADVATEEPTDDQDDDTASEDD
ADADDAAEEADDDDDDDEDAGDALGAMF
;
;MSAESERKTETIPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGTAELRVSRNTLLERALDDVDDGLED
LNGYITGQVGLIGTDDNPFSLFQELEASKTPAPIGAGEVAPNDIVIPEGDTGVDPGPFVGELQSVGADARIQEGSIQVLS
DSTVLDTGEEVSQELSNVLNELGIEPKEVGLDLRAVFADGVLFEPEELELDIDEYRSDIQAAAGRAFNLSVNADYPTATT
APTMLQSDRGNAKSLALQAAIEDPEVVPDLVSKADAQVRALASQIDDEEALPEELQGVEADVATEEPTDDQDDDTASEDD
ADADDAAEEADDDDDDDEDAGDALGAMF
;
G ? 
10 'polypeptide(L)'   no no  
;KPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKELGEE
GDYKMTLRKFPHQVLRENKQATGAGADRVSDGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKITPS
CRIDSSPAGNA
;
;KPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKELGEE
GDYKMTLRKFPHQVLRENKQATGAGADRVSDGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKITPS
CRIDSSPAGNA
;
H ? 
11 'polypeptide(L)'   no no  
;MAGTIEVLVPGGEANPGPPLGPELGPTPVDVQAVVQEINDQTAAFDGTEVPVTVKYDDDGSFEIEVGVPPTAELIKDEAG
FETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIEGENPREFKERIDAGEYDDVFAAEA
QA
;
;MAGTIEVLVPGGEANPGPPLGPELGPTPVDVQAVVQEINDQTAAFDGTEVPVTVKYDDDGSFEIEVGVPPTAELIKDEAG
FETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIEGENPREFKERIDAGEYDDVFAAEA
QA
;
I ? 
12 'polypeptide(L)'   no no  
;MSVAEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFK
RTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW
;
;MSVAEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFK
RTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW
;
J ? 
13 'polypeptide(L)'   no no  
;MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRLPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPI
RRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV
;
;MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRLPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPI
RRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV
;
K ? 
14 'polypeptide(L)'   no no  
;MTSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAAD
DVAEVEDGGFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQAEAEETEDA
DADEE
;
;MTSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAAD
DVAEVEDGGFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQAEAEETEDA
DADEE
;
L ? 
15 'polypeptide(L)'   no no  
;ARSAYSYIRDAWENPGDGQLAELQWQRQQEWRNEGAVERIERPTRLDKARSQGYKAKQGVIVARVSVRKGSARKRRHKAG
RRSKRQGVTRITRRKDIQRVAEERASRTFPNLRVLNSYSVGQDGRQKWHEVILIDPNHPAIQNDDDLSWICADDQADRVF
RGLTGAGRRNRGLSGKGKGSEKTRPSLRSNGGKA
;
;ARSAYSYIRDAWENPGDGQLAELQWQRQQEWRNEGAVERIERPTRLDKARSQGYKAKQGVIVARVSVRKGSARKRRHKAG
RRSKRQGVTRITRRKDIQRVAEERASRTFPNLRVLNSYSVGQDGRQKWHEVILIDPNHPAIQNDDDLSWICADDQADRVF
RGLTGAGRRNRGLSGKGKGSEKTRPSLRSNGGKA
;
M ? 
16 'polypeptide(L)'   no no  
;MATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMP
SAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLY
SGDFDAADLPEHFDELRETLLDGDIEL
;
;MATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMP
SAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLY
SGDFDAADLPEHFDELRETLLDGDIEL
;
N ? 
17 'polypeptide(L)'   no no  
;MSKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAV
DFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR
;
;MSKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAV
DFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR
;
O ? 
18 'polypeptide(L)'   no no  
;MTDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGS
RKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDANHGDA
;
;MTDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGS
RKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDANHGDA
;
P ? 
19 'polypeptide(L)'   no no  
;MPSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGG
KEKTIIVTAAHLRRQE
;
;MPSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGG
KEKTIIVTAAHLRRQE
;
Q ? 
20 'polypeptide(L)'   no no  
;MGISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGR
YPEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEPEVED
;
;MGISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGR
YPEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEPEVED
;
R ? 
21 'polypeptide(L)'   no no  
;MSWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVAS
RIGVF
;
;MSWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVAS
RIGVF
;
S ? 
22 'polypeptide(L)'   no no  
;MSKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTL
EKTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA
;
;MSKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTL
EKTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA
;
T ? 
23 'polypeptide(L)'   no no  PRTRECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTARGEAGEAEDEA 
PRTRECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTARGEAGEAEDEA U ? 
24 'polypeptide(L)'   no no  MTVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGDLQENE 
MTVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGDLQENE V ? 
25 'polypeptide(L)'   no no  
;MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVD
DEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR
;
;MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVD
DEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR
;
W ? 
26 'polypeptide(L)'   no no  
;MSASDFEERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEE
EGEAIVEAETAE
;
;MSASDFEERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEE
EGEAIVEAETAE
;
X ? 
27 'polypeptide(L)'   no no  
;MADNEEDVEAEEEYTELTDISGVGPSKAESLREAGFESVEDVRGADQSALADVSGIGNALAARIKADVGGLEVESETEAE
VEEEGGEEAPDEDVETELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKG
KGDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEVEVS
E
;
;MADNEEDVEAEEEYTELTDISGVGPSKAESLREAGFESVEDVRGADQSALADVSGIGNALAARIKADVGGLEVESETEAE
VEEEGGEEAPDEDVETELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKG
KGDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEVEVS
E
;
Y ? 
28 'polypeptide(L)'   no no  RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS 
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS Z ? 
29 'polypeptide(L)'   no no  MTGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE 
MTGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE 1 ? 
30 'polypeptide(L)'   no no  MGKKSKATKKRLAKLDNQNSRVPAWVMLKTDREVQRNHKRRHWRRNDTDE MGKKSKATKKRLAKLDNQNSRVPAWVMLKTDREVQRNHKRRHWRRNDTDE 
2 ? 
31 'polypeptide(L)'   no no  
;MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLR
EGWRAGRLEFQE
;
;MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLR
EGWRAGRLEFQE
;
3 ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1    U   n 
1  2    U   n 
1  3    G   n 
1  4    G   n 
1  5    C   n 
1  6    U   n 
1  7    A   n 
1  8    C   n 
1  9    U   n 
1  10   A   n 
1  11   U   n 
1  12   G   n 
1  13   C   n 
1  14   C   n 
1  15   A   n 
1  16   G   n 
1  17   C   n 
1  18   U   n 
1  19   G   n 
1  20   G   n 
1  21   U   n 
1  22   G   n 
1  23   G   n 
1  24   A   n 
1  25   U   n 
1  26   U   n 
1  27   G   n 
1  28   C   n 
1  29   U   n 
1  30   C   n 
1  31   G   n 
1  32   G   n 
1  33   C   n 
1  34   U   n 
1  35   C   n 
1  36   A   n 
1  37   G   n 
1  38   G   n 
1  39   C   n 
1  40   G   n 
1  41   C   n 
1  42   U   n 
1  43   G   n 
1  44   A   n 
1  45   U   n 
1  46   G   n 
1  47   A   n 
1  48   A   n 
1  49   G   n 
1  50   G   n 
1  51   A   n 
1  52   C   n 
1  53   G   n 
1  54   U   n 
1  55   G   n 
1  56   C   n 
1  57   C   n 
1  58   A   n 
1  59   A   n 
1  60   G   n 
1  61   C   n 
1  62   U   n 
1  63   G   n 
1  64   C   n 
1  65   G   n 
1  66   A   n 
1  67   U   n 
1  68   A   n 
1  69   A   n 
1  70   G   n 
1  71   C   n 
1  72   C   n 
1  73   A   n 
1  74   U   n 
1  75   G   n 
1  76   G   n 
1  77   G   n 
1  78   G   n 
1  79   A   n 
1  80   G   n 
1  81   C   n 
1  82   C   n 
1  83   G   n 
1  84   C   n 
1  85   A   n 
1  86   C   n 
1  87   G   n 
1  88   G   n 
1  89   A   n 
1  90   G   n 
1  91   G   n 
1  92   C   n 
1  93   G   n 
1  94   A   n 
1  95   A   n 
1  96   G   n 
1  97   A   n 
1  98   A   n 
1  99   C   n 
1  100  C   n 
1  101  A   n 
1  102  U   n 
1  103  G   n 
1  104  G   n 
1  105  A   n 
1  106  U   n 
1  107  U   n 
1  108  U   n 
1  109  C   n 
1  110  C   n 
1  111  G   n 
1  112  A   n 
1  113  A   n 
1  114  U   n 
1  115  G   n 
1  116  A   n 
1  117  G   n 
1  118  A   n 
1  119  A   n 
1  120  U   n 
1  121  C   n 
1  122  U   n 
1  123  C   n 
1  124  U   n 
1  125  C   n 
1  126  U   n 
1  127  A   n 
1  128  A   n 
1  129  C   n 
1  130  A   n 
1  131  A   n 
1  132  U   n 
1  133  U   n 
1  134  G   n 
1  135  C   n 
1  136  U   n 
1  137  U   n 
1  138  C   n 
1  139  G   n 
1  140  C   n 
1  141  G   n 
1  142  C   n 
1  143  A   n 
1  144  A   n 
1  145  U   n 
1  146  G   n 
1  147  A   n 
1  148  G   n 
1  149  G   n 
1  150  A   n 
1  151  A   n 
1  152  C   n 
1  153  C   n 
1  154  C   n 
1  155  C   n 
1  156  G   n 
1  157  A   n 
1  158  G   n 
1  159  A   n 
1  160  A   n 
1  161  C   n 
1  162  U   n 
1  163  G   n 
1  164  A   n 
1  165  A   n 
1  166  A   n 
1  167  C   n 
1  168  A   n 
1  169  U   n 
1  170  C   n 
1  171  U   n 
1  172  C   n 
1  173  A   n 
1  174  G   n 
1  175  U   n 
1  176  A   n 
1  177  U   n 
1  178  C   n 
1  179  G   n 
1  180  G   n 
1  181  G   n 
1  182  A   n 
1  183  G   n 
1  184  G   n 
1  185  A   n 
1  186  A   n 
1  187  C   n 
1  188  A   n 
1  189  G   n 
1  190  A   n 
1  191  A   n 
1  192  A   n 
1  193  A   n 
1  194  C   n 
1  195  G   n 
1  196  C   n 
1  197  A   n 
1  198  A   n 
1  199  U   n 
1  200  G   n 
1  201  U   n 
1  202  G   n 
1  203  A   n 
1  204  U   n 
1  205  G   n 
1  206  U   n 
1  207  C   n 
1  208  G   n 
1  209  U   n 
1  210  U   n 
1  211  A   n 
1  212  G   n 
1  213  U   n 
1  214  A   n 
1  215  A   n 
1  216  C   n 
1  217  C   n 
1  218  G   n 
1  219  C   n 
1  220  G   n 
1  221  A   n 
1  222  G   n 
1  223  U   n 
1  224  G   n 
1  225  A   n 
1  226  A   n 
1  227  C   n 
1  228  G   n 
1  229  C   n 
1  230  G   n 
1  231  A   n 
1  232  U   n 
1  233  A   n 
1  234  C   n 
1  235  A   n 
1  236  G   n 
1  237  C   n 
1  238  C   n 
1  239  C   n 
1  240  A   n 
1  241  A   n 
1  242  A   n 
1  243  C   n 
1  244  C   n 
1  245  G   n 
1  246  A   n 
1  247  A   n 
1  248  G   n 
1  249  C   n 
1  250  C   n 
1  251  C   n 
1  252  U   n 
1  253  C   n 
1  254  A   n 
1  255  C   n 
1  256  G   n 
1  257  G   n 
1  258  G   n 
1  259  C   n 
1  260  A   n 
1  261  A   n 
1  262  U   n 
1  263  G   n 
1  264  U   n 
1  265  G   n 
1  266  G   n 
1  267  U   n 
1  268  G   n 
1  269  U   n 
1  270  C   n 
1  271  A   n 
1  272  G   n 
1  273  G   n 
1  274  G   n 
1  275  C   n 
1  276  U   n 
1  277  A   n 
1  278  C   n 
1  279  C   n 
1  280  U   n 
1  281  C   n 
1  282  U   n 
1  283  C   n 
1  284  A   n 
1  285  U   n 
1  286  C   n 
1  287  A   n 
1  288  G   n 
1  289  C   n 
1  290  C   n 
1  291  G   n 
1  292  A   n 
1  293  C   n 
1  294  C   n 
1  295  G   n 
1  296  U   n 
1  297  C   n 
1  298  U   n 
1  299  C   n 
1  300  G   n 
1  301  A   n 
1  302  C   n 
1  303  G   n 
1  304  A   n 
1  305  A   n 
1  306  G   n 
1  307  U   n 
1  308  C   n 
1  309  U   n 
1  310  C   n 
1  311  U   n 
1  312  U   n 
1  313  G   n 
1  314  G   n 
1  315  A   n 
1  316  A   n 
1  317  C   n 
1  318  A   n 
1  319  G   n 
1  320  A   n 
1  321  G   n 
1  322  C   n 
1  323  G   n 
1  324  U   n 
1  325  G   n 
1  326  A   n 
1  327  U   n 
1  328  A   n 
1  329  C   n 
1  330  A   n 
1  331  G   n 
1  332  G   n 
1  333  G   n 
1  334  U   n 
1  335  G   n 
1  336  A   n 
1  337  C   n 
1  338  A   n 
1  339  A   n 
1  340  C   n 
1  341  C   n 
1  342  C   n 
1  343  C   n 
1  344  G   n 
1  345  U   n 
1  346  A   n 
1  347  C   n 
1  348  U   n 
1  349  C   n 
1  350  G   n 
1  351  A   n 
1  352  G   n 
1  353  A   n 
1  354  C   n 
1  355  C   n 
1  356  A   n 
1  357  G   n 
1  358  U   n 
1  359  A   n 
1  360  C   n 
1  361  G   n 
1  362  A   n 
1  363  C   n 
1  364  G   n 
1  365  U   n 
1  366  G   n 
1  367  C   n 
1  368  G   n 
1  369  G   n 
1  370  U   n 
1  371  A   n 
1  372  G   n 
1  373  U   n 
1  374  G   n 
1  375  C   n 
1  376  C   n 
1  377  A   n 
1  378  G   n 
1  379  A   n 
1  380  G   n 
1  381  U   n 
1  382  A   n 
1  383  G   n 
1  384  C   n 
1  385  G   n 
1  386  G   n 
1  387  G   n 
1  388  G   n 
1  389  G   n 
1  390  U   n 
1  391  U   n 
1  392  G   n 
1  393  G   n 
1  394  A   n 
1  395  U   n 
1  396  A   n 
1  397  U   n 
1  398  C   n 
1  399  C   n 
1  400  C   n 
1  401  U   n 
1  402  C   n 
1  403  G   n 
1  404  C   n 
1  405  G   n 
1  406  A   n 
1  407  A   n 
1  408  U   n 
1  409  A   n 
1  410  A   n 
1  411  C   n 
1  412  G   n 
1  413  C   n 
1  414  A   n 
1  415  G   n 
1  416  G   n 
1  417  C   n 
1  418  A   n 
1  419  U   n 
1  420  C   n 
1  421  G   n 
1  422  A   n 
1  423  C   n 
1  424  U   n 
1  425  G   n 
1  426  C   n 
1  427  G   n 
1  428  A   n 
1  429  A   n 
1  430  G   n 
1  431  G   n 
1  432  C   n 
1  433  U   n 
1  434  A   n 
1  435  A   n 
1  436  A   n 
1  437  C   n 
1  438  A   n 
1  439  C   n 
1  440  A   n 
1  441  A   n 
1  442  C   n 
1  443  C   n 
1  444  U   n 
1  445  G   n 
1  446  A   n 
1  447  G   n 
1  448  A   n 
1  449  C   n 
1  450  C   n 
1  451  G   n 
1  452  A   n 
1  453  U   n 
1  454  A   n 
1  455  G   n 
1  456  U   n 
1  457  G   n 
1  458  A   n 
1  459  A   n 
1  460  C   n 
1  461  A   n 
1  462  A   n 
1  463  G   n 
1  464  U   n 
1  465  A   n 
1  466  G   n 
1  467  U   n 
1  468  G   n 
1  469  U   n 
1  470  G   n 
1  471  A   n 
1  472  A   n 
1  473  C   n 
1  474  G   n 
1  475  A   n 
1  476  A   n 
1  477  C   n 
1  478  G   n 
1  479  C   n 
1  480  U   n 
1  481  G   n 
1  482  C   n 
1  483  A   n 
1  484  A   n 
1  485  A   n 
1  486  G   n 
1  487  U   n 
1  488  A   n 
1  489  C   n 
1  490  C   n 
1  491  C   n 
1  492  U   n 
1  493  C   n 
1  494  A   n 
1  495  G   n 
1  496  A   n 
1  497  A   n 
1  498  G   n 
1  499  G   n 
1  500  G   n 
1  501  A   n 
1  502  G   n 
1  503  G   n 
1  504  C   n 
1  505  G   n 
1  506  A   n 
1  507  A   n 
1  508  A   n 
1  509  U   n 
1  510  A   n 
1  511  G   n 
1  512  A   n 
1  513  G   n 
1  514  C   n 
1  515  A   n 
1  516  U   n 
1  517  G   n 
1  518  A   n 
1  519  A   n 
1  520  A   n 
1  521  U   n 
1  522  C   n 
1  523  A   n 
1  524  G   n 
1  525  U   n 
1  526  U   n 
1  527  G   n 
1  528  G   n 
1  529  C   n 
1  530  G   n 
1  531  A   n 
1  532  U   n 
1  533  C   n 
1  534  G   n 
1  535  A   n 
1  536  G   n 
1  537  C   n 
1  538  G   n 
1  539  A   n 
1  540  C   n 
1  541  A   n 
1  542  G   n 
1  543  G   n 
1  544  G   n 
1  545  C   n 
1  546  A   n 
1  547  U   n 
1  548  A   n 
1  549  C   n 
1  550  A   n 
1  551  A   n 
1  552  G   n 
1  553  G   n 
1  554  U   n 
1  555  C   n 
1  556  C   n 
1  557  C   n 
1  558  U   n 
1  559  C   n 
1  560  G   n 
1  561  A   n 
1  562  C   n 
1  563  G   n 
1  564  A   n 
1  565  A   n 
1  566  U   n 
1  567  G   n 
1  568  A   n 
1  569  C   n 
1  570  C   n 
1  571  G   n 
1  572  A   n 
1  573  C   n 
1  574  G   n 
1  575  C   n 
1  576  G   n 
1  577  C   n 
1  578  G   n 
1  579  A   n 
1  580  G   n 
1  581  C   n 
1  582  G   n 
1  583  U   n 
1  584  C   n 
1  585  C   n 
1  586  A   n 
1  587  G   n 
1  588  U   n 
1  589  A   n 
1  590  A   n 
1  591  G   n 
1  592  A   n 
1  593  C   n 
1  594  U   n 
1  595  C   n 
1  596  A   n 
1  597  C   n 
1  598  G   n 
1  599  G   n 
1  600  G   n 
1  601  A   n 
1  602  A   n 
1  603  G   n 
1  604  C   n 
1  605  C   n 
1  606  G   n 
1  607  A   n 
1  608  U   n 
1  609  G   n 
1  610  U   n 
1  611  U   n 
1  612  C   n 
1  613  U   n 
1  614  G   n 
1  615  U   n 
1  616  C   n 
1  617  G   n 
1  618  U   n 
1  619  A   n 
1  620  C   n 
1  621  G   n 
1  622  U   n 
1  623  U   n 
1  624  U   n 
1  625  U   n 
1  626  G   n 
1  627  1MA n 
1  628  A   n 
1  629  A   n 
1  630  A   n 
1  631  A   n 
1  632  C   n 
1  633  G   n 
1  634  A   n 
1  635  G   n 
1  636  C   n 
1  637  C   n 
1  638  A   n 
1  639  G   n 
1  640  G   n 
1  641  G   n 
1  642  A   n 
1  643  G   n 
1  644  U   n 
1  645  G   n 
1  646  U   n 
1  647  G   n 
1  648  U   n 
1  649  C   n 
1  650  U   n 
1  651  G   n 
1  652  C   n 
1  653  A   n 
1  654  U   n 
1  655  G   n 
1  656  G   n 
1  657  C   n 
1  658  A   n 
1  659  A   n 
1  660  G   n 
1  661  U   n 
1  662  C   n 
1  663  U   n 
1  664  A   n 
1  665  A   n 
1  666  C   n 
1  667  C   n 
1  668  G   n 
1  669  G   n 
1  670  A   n 
1  671  G   n 
1  672  U   n 
1  673  A   n 
1  674  U   n 
1  675  C   n 
1  676  C   n 
1  677  G   n 
1  678  G   n 
1  679  G   n 
1  680  G   n 
1  681  A   n 
1  682  G   n 
1  683  G   n 
1  684  C   n 
1  685  A   n 
1  686  C   n 
1  687  A   n 
1  688  G   n 
1  689  G   n 
1  690  G   n 
1  691  A   n 
1  692  A   n 
1  693  A   n 
1  694  C   n 
1  695  C   n 
1  696  G   n 
1  697  A   n 
1  698  C   n 
1  699  A   n 
1  700  U   n 
1  701  G   n 
1  702  G   n 
1  703  C   n 
1  704  C   n 
1  705  G   n 
1  706  C   n 
1  707  A   n 
1  708  G   n 
1  709  G   n 
1  710  G   n 
1  711  C   n 
1  712  U   n 
1  713  U   n 
1  714  U   n 
1  715  G   n 
1  716  C   n 
1  717  C   n 
1  718  C   n 
1  719  G   n 
1  720  A   n 
1  721  G   n 
1  722  G   n 
1  723  G   n 
1  724  C   n 
1  725  C   n 
1  726  G   n 
1  727  C   n 
1  728  C   n 
1  729  G   n 
1  730  U   n 
1  731  C   n 
1  732  U   n 
1  733  U   n 
1  734  C   n 
1  735  A   n 
1  736  A   n 
1  737  G   n 
1  738  G   n 
1  739  G   n 
1  740  C   n 
1  741  G   n 
1  742  G   n 
1  743  G   n 
1  744  G   n 
1  745  A   n 
1  746  G   n 
1  747  C   n 
1  748  C   n 
1  749  A   n 
1  750  U   n 
1  751  G   n 
1  752  U   n 
1  753  G   n 
1  754  G   n 
1  755  A   n 
1  756  C   n 
1  757  A   n 
1  758  C   n 
1  759  G   n 
1  760  A   n 
1  761  C   n 
1  762  C   n 
1  763  C   n 
1  764  G   n 
1  765  A   n 
1  766  A   n 
1  767  U   n 
1  768  C   n 
1  769  C   n 
1  770  G   n 
1  771  G   n 
1  772  A   n 
1  773  C   n 
1  774  G   n 
1  775  A   n 
1  776  U   n 
1  777  C   n 
1  778  U   n 
1  779  A   n 
1  780  C   n 
1  781  G   n 
1  782  C   n 
1  783  A   n 
1  784  U   n 
1  785  G   n 
1  786  G   n 
1  787  A   n 
1  788  C   n 
1  789  A   n 
1  790  A   n 
1  791  G   n 
1  792  A   n 
1  793  U   n 
1  794  G   n 
1  795  A   n 
1  796  A   n 
1  797  G   n 
1  798  C   n 
1  799  G   n 
1  800  U   n 
1  801  G   n 
1  802  C   n 
1  803  C   n 
1  804  G   n 
1  805  A   n 
1  806  A   n 
1  807  A   n 
1  808  G   n 
1  809  G   n 
1  810  C   n 
1  811  A   n 
1  812  C   n 
1  813  G   n 
1  814  U   n 
1  815  G   n 
1  816  G   n 
1  817  A   n 
1  818  A   n 
1  819  G   n 
1  820  U   n 
1  821  C   n 
1  822  U   n 
1  823  G   n 
1  824  U   n 
1  825  U   n 
1  826  A   n 
1  827  G   n 
1  828  A   n 
1  829  G   n 
1  830  U   n 
1  831  U   n 
1  832  G   n 
1  833  G   n 
1  834  U   n 
1  835  G   n 
1  836  U   n 
1  837  C   n 
1  838  C   n 
1  839  U   n 
1  840  A   n 
1  841  C   n 
1  842  A   n 
1  843  A   n 
1  844  U   n 
1  845  A   n 
1  846  C   n 
1  847  C   n 
1  848  C   n 
1  849  U   n 
1  850  C   n 
1  851  U   n 
1  852  C   n 
1  853  G   n 
1  854  U   n 
1  855  G   n 
1  856  A   n 
1  857  U   n 
1  858  C   n 
1  859  U   n 
1  860  A   n 
1  861  U   n 
1  862  G   n 
1  863  U   n 
1  864  G   n 
1  865  U   n 
1  866  A   n 
1  867  G   n 
1  868  G   n 
1  869  G   n 
1  870  G   n 
1  871  U   n 
1  872  G   n 
1  873  A   n 
1  874  A   n 
1  875  A   n 
1  876  G   n 
1  877  G   n 
1  878  C   n 
1  879  C   n 
1  880  C   n 
1  881  A   n 
1  882  U   n 
1  883  C   n 
1  884  G   n 
1  885  A   n 
1  886  G   n 
1  887  U   n 
1  888  C   n 
1  889  C   n 
1  890  G   n 
1  891  G   n 
1  892  C   n 
1  893  A   n 
1  894  A   n 
1  895  C   n 
1  896  A   n 
1  897  G   n 
1  898  C   n 
1  899  U   n 
1  900  G   n 
1  901  G   n 
1  902  U   n 
1  903  U   n 
1  904  C   n 
1  905  C   n 
1  906  A   n 
1  907  A   n 
1  908  U   n 
1  909  C   n 
1  910  G   n 
1  911  A   n 
1  912  A   n 
1  913  A   n 
1  914  C   n 
1  915  A   n 
1  916  U   n 
1  917  G   n 
1  918  U   n 
1  919  C   n 
1  920  G   n 
1  921  A   n 
1  922  A   n 
1  923  G   n 
1  924  C   n 
1  925  A   n 
1  926  U   n 
1  927  G   n 
1  928  A   n 
1  929  C   n 
1  930  C   n 
1  931  U   n 
1  932  C   n 
1  933  C   n 
1  934  G   n 
1  935  C   n 
1  936  C   n 
1  937  G   n 
1  938  A   n 
1  939  G   n 
1  940  G   n 
1  941  U   n 
1  942  A   n 
1  943  G   n 
1  944  U   n 
1  945  C   n 
1  946  U   n 
1  947  G   n 
1  948  U   n 
1  949  G   n 
1  950  A   n 
1  951  G   n 
1  952  G   n 
1  953  U   n 
1  954  A   n 
1  955  G   n 
1  956  A   n 
1  957  G   n 
1  958  C   n 
1  959  G   n 
1  960  A   n 
1  961  C   n 
1  962  C   n 
1  963  G   n 
1  964  A   n 
1  965  U   n 
1  966  U   n 
1  967  G   n 
1  968  G   n 
1  969  U   n 
1  970  G   n 
1  971  U   n 
1  972  G   n 
1  973  U   n 
1  974  C   n 
1  975  C   n 
1  976  G   n 
1  977  C   n 
1  978  C   n 
1  979  U   n 
1  980  C   n 
1  981  C   n 
1  982  G   n 
1  983  A   n 
1  984  G   n 
1  985  A   n 
1  986  G   n 
1  987  G   n 
1  988  A   n 
1  989  G   n 
1  990  U   n 
1  991  C   n 
1  992  G   n 
1  993  G   n 
1  994  C   n 
1  995  A   n 
1  996  C   n 
1  997  A   n 
1  998  C   n 
1  999  C   n 
1  1000 U   n 
1  1001 G   n 
1  1002 U   n 
1  1003 C   n 
1  1004 A   n 
1  1005 A   n 
1  1006 A   n 
1  1007 C   n 
1  1008 U   n 
1  1009 C   n 
1  1010 C   n 
1  1011 A   n 
1  1012 A   n 
1  1013 A   n 
1  1014 C   n 
1  1015 U   n 
1  1016 U   n 
1  1017 A   n 
1  1018 C   n 
1  1019 A   n 
1  1020 G   n 
1  1021 A   n 
1  1022 C   n 
1  1023 G   n 
1  1024 C   n 
1  1025 C   n 
1  1026 G   n 
1  1027 U   n 
1  1028 U   n 
1  1029 U   n 
1  1030 G   n 
1  1031 A   n 
1  1032 C   n 
1  1033 G   n 
1  1034 C   n 
1  1035 G   n 
1  1036 G   n 
1  1037 G   n 
1  1038 G   n 
1  1039 A   n 
1  1040 U   n 
1  1041 U   n 
1  1042 C   n 
1  1043 C   n 
1  1044 G   n 
1  1045 G   n 
1  1046 U   n 
1  1047 G   n 
1  1048 C   n 
1  1049 G   n 
1  1050 C   n 
1  1051 G   n 
1  1052 G   n 
1  1053 G   n 
1  1054 G   n 
1  1055 U   n 
1  1056 A   n 
1  1057 A   n 
1  1058 G   n 
1  1059 C   n 
1  1060 C   n 
1  1061 U   n 
1  1062 G   n 
1  1063 U   n 
1  1064 G   n 
1  1065 U   n 
1  1066 A   n 
1  1067 C   n 
1  1068 C   n 
1  1069 A   n 
1  1070 G   n 
1  1071 G   n 
1  1072 A   n 
1  1073 G   n 
1  1074 G   n 
1  1075 G   n 
1  1076 G   n 
1  1077 A   n 
1  1078 A   n 
1  1079 C   n 
1  1080 A   n 
1  1081 A   n 
1  1082 C   n 
1  1083 C   n 
1  1084 C   n 
1  1085 A   n 
1  1086 G   n 
1  1087 A   n 
1  1088 G   n 
1  1089 A   n 
1  1090 U   n 
1  1091 A   n 
1  1092 G   n 
1  1093 G   n 
1  1094 U   n 
1  1095 U   n 
1  1096 A   n 
1  1097 A   n 
1  1098 G   n 
1  1099 G   n 
1  1100 U   n 
1  1101 C   n 
1  1102 C   n 
1  1103 C   n 
1  1104 C   n 
1  1105 A   n 
1  1106 A   n 
1  1107 G   n 
1  1108 U   n 
1  1109 G   n 
1  1110 U   n 
1  1111 G   n 
1  1112 G   n 
1  1113 A   n 
1  1114 U   n 
1  1115 U   n 
1  1116 A   n 
1  1117 A   n 
1  1118 G   n 
1  1119 U   n 
1  1120 G   n 
1  1121 U   n 
1  1122 A   n 
1  1123 A   n 
1  1124 U   n 
1  1125 C   n 
1  1126 C   n 
1  1127 U   n 
1  1128 C   n 
1  1129 U   n 
1  1130 G   n 
1  1131 A   n 
1  1132 A   n 
1  1133 G   n 
1  1134 G   n 
1  1135 U   n 
1  1136 G   n 
1  1137 G   n 
1  1138 U   n 
1  1139 C   n 
1  1140 U   n 
1  1141 C   n 
1  1142 G   n 
1  1143 A   n 
1  1144 G   n 
1  1145 C   n 
1  1146 C   n 
1  1147 C   n 
1  1148 U   n 
1  1149 A   n 
1  1150 G   n 
1  1151 A   n 
1  1152 C   n 
1  1153 A   n 
1  1154 G   n 
1  1155 C   n 
1  1156 C   n 
1  1157 G   n 
1  1158 G   n 
1  1159 G   n 
1  1160 A   n 
1  1161 G   n 
1  1162 G   n 
1  1163 U   n 
1  1164 G   n 
1  1165 A   n 
1  1166 G   n 
1  1167 C   n 
1  1168 U   n 
1  1169 U   n 
1  1170 A   n 
1  1171 G   n 
1  1172 A   n 
1  1173 A   n 
1  1174 G   n 
1  1175 C   n 
1  1176 A   n 
1  1177 G   n 
1  1178 C   n 
1  1179 U   n 
1  1180 A   n 
1  1181 C   n 
1  1182 C   n 
1  1183 C   n 
1  1184 U   n 
1  1185 C   n 
1  1186 U   n 
1  1187 A   n 
1  1188 A   n 
1  1189 G   n 
1  1190 A   n 
1  1191 A   n 
1  1192 A   n 
1  1193 A   n 
1  1194 G   n 
1  1195 C   n 
1  1196 G   n 
1  1197 U   n 
1  1198 A   n 
1  1199 A   n 
1  1200 C   n 
1  1201 A   n 
1  1202 G   n 
1  1203 C   n 
1  1204 U   n 
1  1205 U   n 
1  1206 A   n 
1  1207 C   n 
1  1208 C   n 
1  1209 G   n 
1  1210 G   n 
1  1211 C   n 
1  1212 C   n 
1  1213 G   n 
1  1214 A   n 
1  1215 G   n 
1  1216 G   n 
1  1217 U   n 
1  1218 U   n 
1  1219 U   n 
1  1220 G   n 
1  1221 A   n 
1  1222 G   n 
1  1223 G   n 
1  1224 C   n 
1  1225 G   n 
1  1226 C   n 
1  1227 C   n 
1  1228 C   n 
1  1229 A   n 
1  1230 A   n 
1  1231 A   n 
1  1232 A   n 
1  1233 U   n 
1  1234 G   n 
1  1235 A   n 
1  1236 U   n 
1  1237 C   n 
1  1238 G   n 
1  1239 G   n 
1  1240 G   n 
1  1241 A   n 
1  1242 C   n 
1  1243 U   n 
1  1244 C   n 
1  1245 A   n 
1  1246 A   n 
1  1247 A   n 
1  1248 U   n 
1  1249 C   n 
1  1250 C   n 
1  1251 A   n 
1  1252 C   n 
1  1253 C   n 
1  1254 A   n 
1  1255 C   n 
1  1256 C   n 
1  1257 G   n 
1  1258 A   n 
1  1259 G   n 
1  1260 A   n 
1  1261 C   n 
1  1262 C   n 
1  1263 U   n 
1  1264 G   n 
1  1265 U   n 
1  1266 C   n 
1  1267 C   n 
1  1268 G   n 
1  1269 U   n 
1  1270 A   n 
1  1271 C   n 
1  1272 C   n 
1  1273 A   n 
1  1274 C   n 
1  1275 U   n 
1  1276 C   n 
1  1277 A   n 
1  1278 U   n 
1  1279 A   n 
1  1280 C   n 
1  1281 U   n 
1  1282 G   n 
1  1283 G   n 
1  1284 U   n 
1  1285 A   n 
1  1286 A   n 
1  1287 U   n 
1  1288 C   n 
1  1289 G   n 
1  1290 A   n 
1  1291 G   n 
1  1292 U   n 
1  1293 A   n 
1  1294 G   n 
1  1295 A   n 
1  1296 U   n 
1  1297 U   n 
1  1298 G   n 
1  1299 G   n 
1  1300 C   n 
1  1301 G   n 
1  1302 C   n 
1  1303 U   n 
1  1304 C   n 
1  1305 U   n 
1  1306 A   n 
1  1307 A   n 
1  1308 U   n 
1  1309 U   n 
1  1310 G   n 
1  1311 G   n 
1  1312 A   n 
1  1313 U   n 
1  1314 G   n 
1  1315 G   n 
1  1316 A   n 
1  1317 A   n 
1  1318 G   n 
1  1319 U   n 
1  1320 A   n 
1  1321 G   n 
1  1322 G   n 
1  1323 G   n 
1  1324 G   n 
1  1325 U   n 
1  1326 G   n 
1  1327 A   n 
1  1328 A   n 
1  1329 A   n 
1  1330 A   n 
1  1331 C   n 
1  1332 U   n 
1  1333 C   n 
1  1334 C   n 
1  1335 U   n 
1  1336 A   n 
1  1337 U   n 
1  1338 G   n 
1  1339 G   n 
1  1340 A   n 
1  1341 C   n 
1  1342 C   n 
1  1343 G   n 
1  1344 A   n 
1  1345 U   n 
1  1346 U   n 
1  1347 A   n 
1  1348 G   n 
1  1349 U   n 
1  1350 G   n 
1  1351 A   n 
1  1352 C   n 
1  1353 G   n 
1  1354 A   n 
1  1355 A   n 
1  1356 A   n 
1  1357 A   n 
1  1358 U   n 
1  1359 C   n 
1  1360 C   n 
1  1361 U   n 
1  1362 G   n 
1  1363 G   n 
1  1364 C   n 
1  1365 C   n 
1  1366 A   n 
1  1367 U   n 
1  1368 A   n 
1  1369 G   n 
1  1370 U   n 
1  1371 A   n 
1  1372 G   n 
1  1373 C   n 
1  1374 A   n 
1  1375 G   n 
1  1376 C   n 
1  1377 G   n 
1  1378 A   n 
1  1379 U   n 
1  1380 A   n 
1  1381 G   n 
1  1382 U   n 
1  1383 C   n 
1  1384 G   n 
1  1385 G   n 
1  1386 G   n 
1  1387 U   n 
1  1388 G   n 
1  1389 A   n 
1  1390 G   n 
1  1391 A   n 
1  1392 A   n 
1  1393 C   n 
1  1394 C   n 
1  1395 C   n 
1  1396 C   n 
1  1397 G   n 
1  1398 A   n 
1  1399 C   n 
1  1400 G   n 
1  1401 G   n 
1  1402 C   n 
1  1403 C   n 
1  1404 U   n 
1  1405 A   n 
1  1406 A   n 
1  1407 U   n 
1  1408 G   n 
1  1409 G   n 
1  1410 A   n 
1  1411 U   n 
1  1412 A   n 
1  1413 A   n 
1  1414 G   n 
1  1415 G   n 
1  1416 G   n 
1  1417 U   n 
1  1418 U   n 
1  1419 C   n 
1  1420 C   n 
1  1421 U   n 
1  1422 C   n 
1  1423 A   n 
1  1424 G   n 
1  1425 C   n 
1  1426 A   n 
1  1427 C   n 
1  1428 U   n 
1  1429 G   n 
1  1430 C   n 
1  1431 U   n 
1  1432 G   n 
1  1433 A   n 
1  1434 U   n 
1  1435 C   n 
1  1436 A   n 
1  1437 G   n 
1  1438 C   n 
1  1439 U   n 
1  1440 G   n 
1  1441 A   n 
1  1442 G   n 
1  1443 G   n 
1  1444 G   n 
1  1445 U   n 
1  1446 U   n 
1  1447 A   n 
1  1448 G   n 
1  1449 C   n 
1  1450 C   n 
1  1451 G   n 
1  1452 G   n 
1  1453 U   n 
1  1454 C   n 
1  1455 C   n 
1  1456 U   n 
1  1457 A   n 
1  1458 A   n 
1  1459 G   n 
1  1460 U   n 
1  1461 C   n 
1  1462 A   n 
1  1463 U   n 
1  1464 A   n 
1  1465 C   n 
1  1466 C   n 
1  1467 G   n 
1  1468 C   n 
1  1469 A   n 
1  1470 A   n 
1  1471 C   n 
1  1472 U   n 
1  1473 C   n 
1  1474 G   n 
1  1475 A   n 
1  1476 C   n 
1  1477 U   n 
1  1478 A   n 
1  1479 U   n 
1  1480 G   n 
1  1481 A   n 
1  1482 C   n 
1  1483 G   n 
1  1484 A   n 
1  1485 A   n 
1  1486 A   n 
1  1487 U   n 
1  1488 G   n 
1  1489 G   n 
1  1490 G   n 
1  1491 A   n 
1  1492 A   n 
1  1493 A   n 
1  1494 C   n 
1  1495 G   n 
1  1496 G   n 
1  1497 G   n 
1  1498 U   n 
1  1499 U   n 
1  1500 A   n 
1  1501 A   n 
1  1502 U   n 
1  1503 A   n 
1  1504 U   n 
1  1505 U   n 
1  1506 C   n 
1  1507 C   n 
1  1508 C   n 
1  1509 G   n 
1  1510 U   n 
1  1511 G   n 
1  1512 C   n 
1  1513 C   n 
1  1514 A   n 
1  1515 C   n 
1  1516 U   n 
1  1517 A   n 
1  1518 U   n 
1  1519 G   n 
1  1520 C   n 
1  1521 A   n 
1  1522 G   n 
1  1523 U   n 
1  1524 G   n 
1  1525 A   n 
1  1526 A   n 
1  1527 A   n 
1  1528 G   n 
1  1529 U   n 
1  1530 U   n 
1  1531 G   n 
1  1532 A   n 
1  1533 C   n 
1  1534 G   n 
1  1535 C   n 
1  1536 C   n 
1  1537 C   n 
1  1538 U   n 
1  1539 G   n 
1  1540 G   n 
1  1541 G   n 
1  1542 G   n 
1  1543 U   n 
1  1544 C   n 
1  1545 G   n 
1  1546 A   n 
1  1547 U   n 
1  1548 C   n 
1  1549 A   n 
1  1550 C   n 
1  1551 G   n 
1  1552 C   n 
1  1553 U   n 
1  1554 G   n 
1  1555 G   n 
1  1556 G   n 
1  1557 C   n 
1  1558 A   n 
1  1559 U   n 
1  1560 U   n 
1  1561 C   n 
1  1562 G   n 
1  1563 C   n 
1  1564 C   n 
1  1565 C   n 
1  1566 A   n 
1  1567 G   n 
1  1568 U   n 
1  1569 C   n 
1  1570 G   n 
1  1571 A   n 
1  1572 A   n 
1  1573 C   n 
1  1574 C   n 
1  1575 G   n 
1  1576 U   n 
1  1577 C   n 
1  1578 C   n 
1  1579 A   n 
1  1580 A   n 
1  1581 C   n 
1  1582 U   n 
1  1583 C   n 
1  1584 C   n 
1  1585 G   n 
1  1586 U   n 
1  1587 G   n 
1  1588 G   n 
1  1589 A   n 
1  1590 A   n 
1  1591 G   n 
1  1592 C   n 
1  1593 C   n 
1  1594 G   n 
1  1595 U   n 
1  1596 A   n 
1  1597 A   n 
1  1598 U   n 
1  1599 G   n 
1  1600 G   n 
1  1601 C   n 
1  1602 A   n 
1  1603 G   n 
1  1604 G   n 
1  1605 A   n 
1  1606 A   n 
1  1607 G   n 
1  1608 C   n 
1  1609 G   n 
1  1610 G   n 
1  1611 A   n 
1  1612 C   n 
1  1613 G   n 
1  1614 A   n 
1  1615 A   n 
1  1616 C   n 
1  1617 G   n 
1  1618 G   n 
1  1619 C   n 
1  1620 G   n 
1  1621 G   n 
1  1622 C   n 
1  1623 A   n 
1  1624 U   n 
1  1625 A   n 
1  1626 G   n 
1  1627 G   n 
1  1628 G   n 
1  1629 A   n 
1  1630 A   n 
1  1631 A   n 
1  1632 C   n 
1  1633 G   n 
1  1634 U   n 
1  1635 G   n 
1  1636 A   n 
1  1637 U   n 
1  1638 U   n 
1  1639 C   n 
1  1640 A   n 
1  1641 A   n 
1  1642 C   n 
1  1643 C   n 
1  1644 U   n 
1  1645 G   n 
1  1646 G   n 
1  1647 G   n 
1  1648 G   n 
1  1649 C   n 
1  1650 C   n 
1  1651 C   n 
1  1652 A   n 
1  1653 U   n 
1  1654 G   n 
1  1655 A   n 
1  1656 A   n 
1  1657 A   n 
1  1658 A   n 
1  1659 G   n 
1  1660 A   n 
1  1661 C   n 
1  1662 G   n 
1  1663 A   n 
1  1664 G   n 
1  1665 C   n 
1  1666 A   n 
1  1667 U   n 
1  1668 A   n 
1  1669 G   n 
1  1670 U   n 
1  1671 G   n 
1  1672 U   n 
1  1673 C   n 
1  1674 C   n 
1  1675 G   n 
1  1676 U   n 
1  1677 A   n 
1  1678 C   n 
1  1679 C   n 
1  1680 G   n 
1  1681 A   n 
1  1682 G   n 
1  1683 A   n 
1  1684 A   n 
1  1685 C   n 
1  1686 C   n 
1  1687 G   n 
1  1688 A   n 
1  1689 C   n 
1  1690 A   n 
1  1691 C   n 
1  1692 A   n 
1  1693 G   n 
1  1694 G   n 
1  1695 U   n 
1  1696 G   n 
1  1697 U   n 
1  1698 C   n 
1  1699 C   n 
1  1700 A   n 
1  1701 U   n 
1  1702 G   n 
1  1703 G   n 
1  1704 C   n 
1  1705 G   n 
1  1706 G   n 
1  1707 C   n 
1  1708 G   n 
1  1709 A   n 
1  1710 A   n 
1  1711 A   n 
1  1712 G   n 
1  1713 C   n 
1  1714 C   n 
1  1715 A   n 
1  1716 A   n 
1  1717 G   n 
1  1718 G   n 
1  1719 C   n 
1  1720 C   n 
1  1721 U   n 
1  1722 G   n 
1  1723 U   n 
1  1724 C   n 
1  1725 G   n 
1  1726 G   n 
1  1727 G   n 
1  1728 A   n 
1  1729 G   n 
1  1730 C   n 
1  1731 A   n 
1  1732 A   n 
1  1733 C   n 
1  1734 C   n 
1  1735 A   n 
1  1736 A   n 
1  1737 C   n 
1  1738 G   n 
1  1739 U   n 
1  1740 U   n 
1  1741 A   n 
1  1742 G   n 
1  1743 G   n 
1  1744 G   n 
1  1745 A   n 
1  1746 A   n 
1  1747 U   n 
1  1748 U   n 
1  1749 C   n 
1  1750 G   n 
1  1751 G   n 
1  1752 C   n 
1  1753 A   n 
1  1754 A   n 
1  1755 G   n 
1  1756 U   n 
1  1757 U   n 
1  1758 A   n 
1  1759 G   n 
1  1760 U   n 
1  1761 C   n 
1  1762 C   n 
1  1763 C   n 
1  1764 G   n 
1  1765 U   n 
1  1766 A   n 
1  1767 C   n 
1  1768 C   n 
1  1769 U   n 
1  1770 U   n 
1  1771 C   n 
1  1772 G   n 
1  1773 G   n 
1  1774 A   n 
1  1775 A   n 
1  1776 G   n 
1  1777 A   n 
1  1778 A   n 
1  1779 G   n 
1  1780 G   n 
1  1781 G   n 
1  1782 A   n 
1  1783 U   n 
1  1784 G   n 
1  1785 C   n 
1  1786 C   n 
1  1787 U   n 
1  1788 G   n 
1  1789 C   n 
1  1790 U   n 
1  1791 C   n 
1  1792 C   n 
1  1793 G   n 
1  1794 G   n 
1  1795 A   n 
1  1796 A   n 
1  1797 C   n 
1  1798 G   n 
1  1799 G   n 
1  1800 A   n 
1  1801 G   n 
1  1802 C   n 
1  1803 A   n 
1  1804 G   n 
1  1805 G   n 
1  1806 U   n 
1  1807 C   n 
1  1808 G   n 
1  1809 C   n 
1  1810 A   n 
1  1811 G   n 
1  1812 U   n 
1  1813 G   n 
1  1814 A   n 
1  1815 C   n 
1  1816 U   n 
1  1817 C   n 
1  1818 G   n 
1  1819 G   n 
1  1820 A   n 
1  1821 A   n 
1  1822 G   n 
1  1823 C   n 
1  1824 U   n 
1  1825 C   n 
1  1826 G   n 
1  1827 G   n 
1  1828 A   n 
1  1829 C   n 
1  1830 U   n 
1  1831 G   n 
1  1832 U   n 
1  1833 C   n 
1  1834 U   n 
1  1835 A   n 
1  1836 G   n 
1  1837 U   n 
1  1838 A   n 
1  1839 A   n 
1  1840 C   n 
1  1841 A   n 
1  1842 A   n 
1  1843 C   n 
1  1844 A   n 
1  1845 U   n 
1  1846 A   n 
1  1847 G   n 
1  1848 G   n 
1  1849 U   n 
1  1850 G   n 
1  1851 A   n 
1  1852 C   n 
1  1853 C   n 
1  1854 G   n 
1  1855 C   n 
1  1856 A   n 
1  1857 A   n 
1  1858 A   n 
1  1859 U   n 
1  1860 C   n 
1  1861 C   n 
1  1862 G   n 
1  1863 C   n 
1  1864 A   n 
1  1865 A   n 
1  1866 G   n 
1  1867 G   n 
1  1868 A   n 
1  1869 C   n 
1  1870 U   n 
1  1871 C   n 
1  1872 G   n 
1  1873 U   n 
1  1874 A   n 
1  1875 C   n 
1  1876 G   n 
1  1877 G   n 
1  1878 U   n 
1  1879 C   n 
1  1880 A   n 
1  1881 C   n 
1  1882 U   n 
1  1883 G   n 
1  1884 A   n 
1  1885 A   n 
1  1886 U   n 
1  1887 C   n 
1  1888 C   n 
1  1889 U   n 
1  1890 G   n 
1  1891 C   n 
1  1892 C   n 
1  1893 C   n 
1  1894 A   n 
1  1895 G   n 
1  1896 U   n 
1  1897 G   n 
1  1898 C   n 
1  1899 A   n 
1  1900 G   n 
1  1901 G   n 
1  1902 U   n 
1  1903 A   n 
1  1904 U   n 
1  1905 C   n 
1  1906 U   n 
1  1907 G   n 
1  1908 A   n 
1  1909 A   n 
1  1910 C   n 
1  1911 A   n 
1  1912 C   n 
1  1913 C   n 
1  1914 U   n 
1  1915 C   n 
1  1916 G   n 
1  1917 U   n 
1  1918 A   n 
1  1919 C   n 
1  1920 A   n 
1  1921 A   n 
1  1922 G   n 
1  1923 A   n 
1  1924 G   n 
1  1925 G   n 
1  1926 A   n 
1  1927 C   n 
1  1928 G   n 
1  1929 A   n 
1  1930 A   n 
1  1931 G   n 
1  1932 G   n 
1  1933 A   n 
1  1934 C   n 
1  1935 C   n 
1  1936 U   n 
1  1937 G   n 
1  1938 U   n 
1  1939 C   n 
1  1940 A   n 
1  1941 A   n 
1  1942 C   n 
1  1943 G   n 
1  1944 G   n 
1  1945 C   n 
1  1946 G   n 
1  1947 G   n 
1  1948 G   n 
1  1949 G   n 
1  1950 G   n 
1  1951 U   n 
1  1952 A   n 
1  1953 A   n 
1  1954 C   n 
1  1955 U   n 
1  1956 A   n 
1  1957 U   n 
1  1958 G   n 
1  1959 A   n 
1  1960 C   n 
1  1961 C   n 
1  1962 C   n 
1  1963 U   n 
1  1964 C   n 
1  1965 U   n 
1  1966 U   n 
1  1967 A   n 
1  1968 A   n 
1  1969 G   n 
1  1970 G   n 
1  1971 U   n 
1  1972 A   n 
1  1973 G   n 
1  1974 C   n 
1  1975 G   n 
1  1976 U   n 
1  1977 A   n 
1  1978 G   n 
1  1979 U   n 
1  1980 A   n 
1  1981 C   n 
1  1982 C   n 
1  1983 U   n 
1  1984 U   n 
1  1985 G   n 
1  1986 C   n 
1  1987 C   n 
1  1988 G   n 
1  1989 C   n 
1  1990 A   n 
1  1991 U   n 
1  1992 C   n 
1  1993 A   n 
1  1994 G   n 
1  1995 U   n 
1  1996 A   n 
1  1997 G   n 
1  1998 C   n 
1  1999 G   n 
1  2000 G   n 
1  2001 C   n 
1  2002 U   n 
1  2003 U   n 
1  2004 G   n 
1  2005 C   n 
1  2006 A   n 
1  2007 U   n 
1  2008 G   n 
1  2009 A   n 
1  2010 A   n 
1  2011 U   n 
1  2012 G   n 
1  2013 G   n 
1  2014 A   n 
1  2015 U   n 
1  2016 U   n 
1  2017 A   n 
1  2018 A   n 
1  2019 C   n 
1  2020 C   n 
1  2021 A   n 
1  2022 G   n 
1  2023 A   n 
1  2024 G   n 
1  2025 C   n 
1  2026 U   n 
1  2027 U   n 
1  2028 C   n 
1  2029 A   n 
1  2030 C   n 
1  2031 U   n 
1  2032 G   n 
1  2033 U   n 
1  2034 C   n 
1  2035 C   n 
1  2036 C   n 
1  2037 A   n 
1  2038 A   n 
1  2039 C   n 
1  2040 G   n 
1  2041 U   n 
1  2042 U   n 
1  2043 G   n 
1  2044 G   n 
1  2045 G   n 
1  2046 C   n 
1  2047 C   n 
1  2048 C   n 
1  2049 G   n 
1  2050 G   n 
1  2051 U   n 
1  2052 G   n 
1  2053 A   n 
1  2054 A   n 
1  2055 C   n 
1  2056 U   n 
1  2057 G   n 
1  2058 U   n 
1  2059 A   n 
1  2060 C   n 
1  2061 A   n 
1  2062 U   n 
1  2063 U   n 
1  2064 C   n 
1  2065 C   n 
1  2066 A   n 
1  2067 G   n 
1  2068 U   n 
1  2069 G   n 
1  2070 C   n 
1  2071 G   n 
1  2072 G   n 
1  2073 A   n 
1  2074 G   n 
1  2075 U   n 
1  2076 C   n 
1  2077 U   n 
1  2078 G   n 
1  2079 G   n 
1  2080 A   n 
1  2081 G   n 
1  2082 A   n 
1  2083 C   n 
1  2084 A   n 
1  2085 C   n 
1  2086 C   n 
1  2087 C   n 
1  2088 A   n 
1  2089 G   n 
1  2090 G   n 
1  2091 G   n 
1  2092 G   n 
1  2093 G   n 
1  2094 A   n 
1  2095 A   n 
1  2096 G   n 
1  2097 C   n 
1  2098 G   n 
1  2099 A   n 
1  2100 A   n 
1  2101 G   n 
1  2102 A   n 
1  2103 C   n 
1  2104 C   n 
1  2105 C   n 
1  2106 U   n 
1  2107 A   n 
1  2108 U   n 
1  2109 G   n 
1  2110 G   n 
1  2111 A   n 
1  2112 G   n 
1  2113 C   n 
1  2114 U   n 
1  2115 U   n 
1  2116 U   n 
1  2117 A   n 
1  2118 C   n 
1  2119 U   n 
1  2120 G   n 
1  2121 C   n 
1  2122 A   n 
1  2123 G   n 
1  2124 G   n 
1  2125 C   n 
1  2126 U   n 
1  2127 G   n 
1  2128 U   n 
1  2129 C   n 
1  2130 G   n 
1  2131 C   n 
1  2132 U   n 
1  2133 G   n 
1  2134 A   n 
1  2135 G   n 
1  2136 A   n 
1  2137 C   n 
1  2138 G   n 
1  2139 U   n 
1  2140 G   n 
1  2141 G   n 
1  2142 U   n 
1  2143 C   n 
1  2144 G   n 
1  2145 C   n 
1  2146 C   n 
1  2147 G   n 
1  2148 A   n 
1  2149 U   n 
1  2150 G   n 
1  2151 U   n 
1  2152 G   n 
1  2153 C   n 
1  2154 A   n 
1  2155 G   n 
1  2156 C   n 
1  2157 A   n 
1  2158 U   n 
1  2159 A   n 
1  2160 G   n 
1  2161 G   n 
1  2162 U   n 
1  2163 A   n 
1  2164 G   n 
1  2165 G   n 
1  2166 A   n 
1  2167 G   n 
1  2168 A   n 
1  2169 C   n 
1  2170 A   n 
1  2171 C   n 
1  2172 U   n 
1  2173 A   n 
1  2174 C   n 
1  2175 A   n 
1  2176 C   n 
1  2177 A   n 
1  2178 G   n 
1  2179 G   n 
1  2180 U   n 
1  2181 A   n 
1  2182 C   n 
1  2183 C   n 
1  2184 C   n 
1  2185 G   n 
1  2186 C   n 
1  2187 G   n 
1  2188 C   n 
1  2189 U   n 
1  2190 A   n 
1  2191 G   n 
1  2192 C   n 
1  2193 G   n 
1  2194 G   n 
1  2195 G   n 
1  2196 C   n 
1  2197 C   n 
1  2198 A   n 
1  2199 C   n 
1  2200 C   n 
1  2201 G   n 
1  2202 A   n 
1  2203 G   n 
1  2204 U   n 
1  2205 C   n 
1  2206 A   n 
1  2207 A   n 
1  2208 C   n 
1  2209 A   n 
1  2210 G   n 
1  2211 U   n 
1  2212 G   n 
1  2213 A   n 
1  2214 A   n 
1  2215 A   n 
1  2216 U   n 
1  2217 A   n 
1  2218 C   n 
1  2219 U   n 
1  2220 A   n 
1  2221 C   n 
1  2222 C   n 
1  2223 C   n 
1  2224 G   n 
1  2225 U   n 
1  2226 C   n 
1  2227 G   n 
1  2228 G   n 
1  2229 U   n 
1  2230 G   n 
1  2231 A   n 
1  2232 C   n 
1  2233 U   n 
1  2234 G   n 
1  2235 C   n 
1  2236 G   n 
1  2237 A   n 
1  2238 C   n 
1  2239 U   n 
1  2240 C   n 
1  2241 U   n 
1  2242 C   n 
1  2243 A   n 
1  2244 C   n 
1  2245 U   n 
1  2246 C   n 
1  2247 C   n 
1  2248 G   n 
1  2249 G   n 
1  2250 G   n 
1  2251 A   n 
1  2252 G   n 
1  2253 G   n 
1  2254 A   n 
1  2255 G   n 
1  2256 G   n 
1  2257 A   n 
1  2258 C   n 
1  2259 A   n 
1  2260 C   n 
1  2261 C   n 
1  2262 G   n 
1  2263 A   n 
1  2264 U   n 
1  2265 A   n 
1  2266 G   n 
1  2267 C   n 
1  2268 C   n 
1  2269 G   n 
1  2270 G   n 
1  2271 G   n 
1  2272 C   n 
1  2273 A   n 
1  2274 G   n 
1  2275 U   n 
1  2276 U   n 
1  2277 U   n 
1  2278 G   n 
1  2279 A   n 
1  2280 C   n 
1  2281 U   n 
1  2282 G   n 
1  2283 G   n 
1  2284 G   n 
1  2285 G   n 
1  2286 C   n 
1  2287 G   n 
1  2288 G   n 
1  2289 U   n 
1  2290 A   n 
1  2291 C   n 
1  2292 G   n 
1  2293 C   n 
1  2294 G   n 
1  2295 C   n 
1  2296 U   n 
1  2297 C   n 
1  2298 G   n 
1  2299 A   n 
1  2300 A   n 
1  2301 A   n 
1  2302 A   n 
1  2303 G   n 
1  2304 A   n 
1  2305 U   n 
1  2306 A   n 
1  2307 U   n 
1  2308 C   n 
1  2309 G   n 
1  2310 A   n 
1  2311 G   n 
1  2312 C   n 
1  2313 G   n 
1  2314 C   n 
1  2315 G   n 
1  2316 C   n 
1  2317 C   n 
1  2318 C   n 
1  2319 U   n 
1  2320 A   n 
1  2321 U   n 
1  2322 G   n 
1  2323 G   n 
1  2324 C   n 
1  2325 U   n 
1  2326 A   n 
1  2327 U   n 
1  2328 C   n 
1  2329 U   n 
1  2330 C   n 
1  2331 A   n 
1  2332 G   n 
1  2333 C   n 
1  2334 C   n 
1  2335 G   n 
1  2336 G   n 
1  2337 G   n 
1  2338 A   n 
1  2339 C   n 
1  2340 A   n 
1  2341 G   n 
1  2342 A   n 
1  2343 G   n 
1  2344 A   n 
1  2345 C   n 
1  2346 C   n 
1  2347 C   n 
1  2348 G   n 
1  2349 G   n 
1  2350 C   n 
1  2351 G   n 
1  2352 A   n 
1  2353 A   n 
1  2354 G   n 
1  2355 A   n 
1  2356 G   n 
1  2357 U   n 
1  2358 G   n 
1  2359 C   n 
1  2360 A   n 
1  2361 A   n 
1  2362 G   n 
1  2363 A   n 
1  2364 G   n 
1  2365 C   n 
1  2366 A   n 
1  2367 A   n 
1  2368 A   n 
1  2369 A   n 
1  2370 G   n 
1  2371 A   n 
1  2372 U   n 
1  2373 A   n 
1  2374 G   n 
1  2375 C   n 
1  2376 U   n 
1  2377 U   n 
1  2378 G   n 
1  2379 A   n 
1  2380 C   n 
1  2381 A   n 
1  2382 G   n 
1  2383 U   n 
1  2384 G   n 
1  2385 U   n 
1  2386 U   n 
1  2387 C   n 
1  2388 U   n 
1  2389 U   n 
1  2390 C   n 
1  2391 C   n 
1  2392 C   n 
1  2393 A   n 
1  2394 A   n 
1  2395 C   n 
1  2396 G   n 
1  2397 A   n 
1  2398 G   n 
1  2399 G   n 
1  2400 A   n 
1  2401 A   n 
1  2402 C   n 
1  2403 G   n 
1  2404 C   n 
1  2405 U   n 
1  2406 G   n 
1  2407 A   n 
1  2408 C   n 
1  2409 G   n 
1  2410 C   n 
1  2411 G   n 
1  2412 A   n 
1  2413 A   n 
1  2414 A   n 
1  2415 G   n 
1  2416 C   n 
1  2417 G   n 
1  2418 U   n 
1  2419 G   n 
1  2420 G   n 
1  2421 U   n 
1  2422 C   n 
1  2423 U   n 
1  2424 A   n 
1  2425 G   n 
1  2426 C   n 
1  2427 G   n 
1  2428 A   n 
1  2429 A   n 
1  2430 C   n 
1  2431 C   n 
1  2432 A   n 
1  2433 A   n 
1  2434 U   n 
1  2435 U   n 
1  2436 A   n 
1  2437 G   n 
1  2438 C   n 
1  2439 C   n 
1  2440 U   n 
1  2441 G   n 
1  2442 C   n 
1  2443 U   n 
1  2444 U   n 
1  2445 G   n 
1  2446 A   n 
1  2447 U   n 
1  2448 G   n 
1  2449 C   n 
1  2450 G   n 
1  2451 G   n 
1  2452 G   n 
1  2453 C   n 
1  2454 A   n 
1  2455 A   n 
1  2456 U   n 
1  2457 U   n 
1  2458 G   n 
1  2459 A   n 
1  2460 U   n 
1  2461 G   n 
1  2462 A   n 
1  2463 C   n 
1  2464 A   n 
1  2465 G   n 
1  2466 A   n 
1  2467 A   n 
1  2468 A   n 
1  2469 A   n 
1  2470 G   n 
1  2471 C   n 
1  2472 U   n 
1  2473 A   n 
1  2474 C   n 
1  2475 C   n 
1  2476 C   n 
1  2477 U   n 
1  2478 A   n 
1  2479 G   n 
1  2480 G   n 
1  2481 G   n 
1  2482 A   n 
1  2483 U   n 
1  2484 A   n 
1  2485 A   n 
1  2486 C   n 
1  2487 A   n 
1  2488 G   n 
1  2489 A   n 
1  2490 G   n 
1  2491 U   n 
1  2492 C   n 
1  2493 G   n 
1  2494 U   n 
1  2495 C   n 
1  2496 A   n 
1  2497 C   n 
1  2498 U   n 
1  2499 C   n 
1  2500 G   n 
1  2501 C   n 
1  2502 A   n 
1  2503 A   n 
1  2504 G   n 
1  2505 A   n 
1  2506 G   n 
1  2507 C   n 
1  2508 A   n 
1  2509 C   n 
1  2510 A   n 
1  2511 U   n 
1  2512 A   n 
1  2513 U   n 
1  2514 C   n 
1  2515 G   n 
1  2516 A   n 
1  2517 C   n 
1  2518 C   n 
1  2519 G   n 
1  2520 A   n 
1  2521 G   n 
1  2522 U   n 
1  2523 G   n 
1  2524 G   n 
1  2525 C   n 
1  2526 U   n 
1  2527 U   n 
1  2528 G   n 
1  2529 C   n 
1  2530 U   n 
1  2531 A   n 
1  2532 C   n 
1  2533 C   n 
1  2534 U   n 
1  2535 C   n 
1  2536 G   n 
1  2537 A   n 
1  2538 U   n 
1  2539 G   n 
1  2540 U   n 
1  2541 C   n 
1  2542 G   n 
1  2543 G   n 
1  2544 U   n 
1  2545 U   n 
1  2546 C   n 
1  2547 C   n 
1  2548 C   n 
1  2549 U   n 
1  2550 C   n 
1  2551 C   n 
1  2552 A   n 
1  2553 U   n 
1  2554 C   n 
1  2555 C   n 
1  2556 U   n 
1  2557 G   n 
1  2558 C   n 
1  2559 C   n 
1  2560 C   n 
1  2561 G   n 
1  2562 U   n 
1  2563 G   n 
1  2564 C   n 
1  2565 A   n 
1  2566 G   n 
1  2567 A   n 
1  2568 A   n 
1  2569 G   n 
1  2570 C   n 
1  2571 G   n 
1  2572 G   n 
1  2573 G   n 
1  2574 C   n 
1  2575 A   n 
1  2576 A   n 
1  2577 G   n 
1  2578 G   n 
1  2579 G   n 
1  2580 U   n 
1  2581 G   n 
1  2582 A   n 
1  2583 G   n 
1  2584 G   n 
1  2585 U   n 
1  2586 OMU n 
1  2587 OMG n 
1  2588 U   n 
1  2589 U   n 
1  2590 C   n 
1  2591 G   n 
1  2592 C   n 
1  2593 C   n 
1  2594 U   n 
1  2595 A   n 
1  2596 U   n 
1  2597 U   n 
1  2598 A   n 
1  2599 A   n 
1  2600 A   n 
1  2601 G   n 
1  2602 G   n 
1  2603 A   n 
1  2604 G   n 
1  2605 G   n 
1  2606 U   n 
1  2607 C   n 
1  2608 G   n 
1  2609 U   n 
1  2610 G   n 
1  2611 A   n 
1  2612 G   n 
1  2613 C   n 
1  2614 U   n 
1  2615 G   n 
1  2616 G   n 
1  2617 G   n 
1  2618 UR3 n 
1  2619 U   n 
1  2620 PSU n 
1  2621 A   n 
1  2622 G   n 
1  2623 A   n 
1  2624 C   n 
1  2625 C   n 
1  2626 G   n 
1  2627 U   n 
1  2628 C   n 
1  2629 G   n 
1  2630 U   n 
1  2631 G   n 
1  2632 A   n 
1  2633 G   n 
1  2634 A   n 
1  2635 C   n 
1  2636 A   n 
1  2637 G   n 
1  2638 G   n 
1  2639 U   n 
1  2640 C   n 
1  2641 G   n 
1  2642 G   n 
1  2643 C   n 
1  2644 U   n 
1  2645 G   n 
1  2646 C   n 
1  2647 U   n 
1  2648 A   n 
1  2649 U   n 
1  2650 C   n 
1  2651 U   n 
1  2652 A   n 
1  2653 C   n 
1  2654 U   n 
1  2655 G   n 
1  2656 G   n 
1  2657 G   n 
1  2658 U   n 
1  2659 G   n 
1  2660 U   n 
1  2661 G   n 
1  2662 U   n 
1  2663 A   n 
1  2664 A   n 
1  2665 U   n 
1  2666 G   n 
1  2667 G   n 
1  2668 U   n 
1  2669 G   n 
1  2670 U   n 
1  2671 C   n 
1  2672 U   n 
1  2673 G   n 
1  2674 A   n 
1  2675 C   n 
1  2676 A   n 
1  2677 A   n 
1  2678 G   n 
1  2679 A   n 
1  2680 A   n 
1  2681 C   n 
1  2682 G   n 
1  2683 A   n 
1  2684 C   n 
1  2685 C   n 
1  2686 G   n 
1  2687 U   n 
1  2688 A   n 
1  2689 U   n 
1  2690 A   n 
1  2691 G   n 
1  2692 U   n 
1  2693 A   n 
1  2694 C   n 
1  2695 G   n 
1  2696 A   n 
1  2697 G   n 
1  2698 A   n 
1  2699 G   n 
1  2700 G   n 
1  2701 A   n 
1  2702 A   n 
1  2703 C   n 
1  2704 U   n 
1  2705 A   n 
1  2706 C   n 
1  2707 G   n 
1  2708 G   n 
1  2709 U   n 
1  2710 U   n 
1  2711 G   n 
1  2712 G   n 
1  2713 U   n 
1  2714 G   n 
1  2715 G   n 
1  2716 C   n 
1  2717 C   n 
1  2718 A   n 
1  2719 C   n 
1  2720 U   n 
1  2721 G   n 
1  2722 G   n 
1  2723 U   n 
1  2724 G   n 
1  2725 U   n 
1  2726 A   n 
1  2727 C   n 
1  2728 C   n 
1  2729 G   n 
1  2730 G   n 
1  2731 U   n 
1  2732 U   n 
1  2733 G   n 
1  2734 U   n 
1  2735 U   n 
1  2736 C   n 
1  2737 G   n 
1  2738 A   n 
1  2739 G   n 
1  2740 A   n 
1  2741 G   n 
1  2742 A   n 
1  2743 G   n 
1  2744 C   n 
1  2745 A   n 
1  2746 C   n 
1  2747 G   n 
1  2748 U   n 
1  2749 G   n 
1  2750 C   n 
1  2751 C   n 
1  2752 G   n 
1  2753 G   n 
1  2754 G   n 
1  2755 U   n 
1  2756 A   n 
1  2757 G   n 
1  2758 C   n 
1  2759 C   n 
1  2760 A   n 
1  2761 C   n 
1  2762 G   n 
1  2763 C   n 
1  2764 C   n 
1  2765 A   n 
1  2766 C   n 
1  2767 A   n 
1  2768 C   n 
1  2769 G   n 
1  2770 G   n 
1  2771 G   n 
1  2772 G   n 
1  2773 U   n 
1  2774 A   n 
1  2775 A   n 
1  2776 G   n 
1  2777 A   n 
1  2778 G   n 
1  2779 C   n 
1  2780 U   n 
1  2781 G   n 
1  2782 A   n 
1  2783 A   n 
1  2784 C   n 
1  2785 G   n 
1  2786 C   n 
1  2787 A   n 
1  2788 U   n 
1  2789 C   n 
1  2790 U   n 
1  2791 A   n 
1  2792 A   n 
1  2793 G   n 
1  2794 C   n 
1  2795 U   n 
1  2796 C   n 
1  2797 G   n 
1  2798 A   n 
1  2799 A   n 
1  2800 A   n 
1  2801 C   n 
1  2802 C   n 
1  2803 C   n 
1  2804 A   n 
1  2805 C   n 
1  2806 U   n 
1  2807 U   n 
1  2808 G   n 
1  2809 G   n 
1  2810 A   n 
1  2811 A   n 
1  2812 A   n 
1  2813 A   n 
1  2814 G   n 
1  2815 A   n 
1  2816 G   n 
1  2817 A   n 
1  2818 C   n 
1  2819 A   n 
1  2820 C   n 
1  2821 C   n 
1  2822 G   n 
1  2823 C   n 
1  2824 C   n 
1  2825 G   n 
1  2826 A   n 
1  2827 G   n 
1  2828 G   n 
1  2829 U   n 
1  2830 C   n 
1  2831 C   n 
1  2832 C   n 
1  2833 G   n 
1  2834 C   n 
1  2835 G   n 
1  2836 U   n 
1  2837 A   n 
1  2838 C   n 
1  2839 A   n 
1  2840 A   n 
1  2841 G   n 
1  2842 A   n 
1  2843 C   n 
1  2844 G   n 
1  2845 C   n 
1  2846 G   n 
1  2847 G   n 
1  2848 U   n 
1  2849 C   n 
1  2850 G   n 
1  2851 A   n 
1  2852 U   n 
1  2853 A   n 
1  2854 G   n 
1  2855 A   n 
1  2856 C   n 
1  2857 U   n 
1  2858 C   n 
1  2859 G   n 
1  2860 G   n 
1  2861 G   n 
1  2862 G   n 
1  2863 U   n 
1  2864 G   n 
1  2865 U   n 
1  2866 G   n 
1  2867 C   n 
1  2868 G   n 
1  2869 C   n 
1  2870 G   n 
1  2871 U   n 
1  2872 C   n 
1  2873 G   n 
1  2874 A   n 
1  2875 G   n 
1  2876 G   n 
1  2877 U   n 
1  2878 A   n 
1  2879 A   n 
1  2880 C   n 
1  2881 G   n 
1  2882 A   n 
1  2883 G   n 
1  2884 A   n 
1  2885 C   n 
1  2886 G   n 
1  2887 U   n 
1  2888 U   n 
1  2889 A   n 
1  2890 A   n 
1  2891 G   n 
1  2892 C   n 
1  2893 C   n 
1  2894 C   n 
1  2895 A   n 
1  2896 C   n 
1  2897 G   n 
1  2898 A   n 
1  2899 G   n 
1  2900 C   n 
1  2901 A   n 
1  2902 C   n 
1  2903 U   n 
1  2904 A   n 
1  2905 A   n 
1  2906 C   n 
1  2907 A   n 
1  2908 G   n 
1  2909 A   n 
1  2910 C   n 
1  2911 C   n 
1  2912 A   n 
1  2913 A   n 
1  2914 A   n 
1  2915 G   n 
1  2916 C   n 
1  2917 C   n 
1  2918 A   n 
1  2919 U   n 
1  2920 C   n 
1  2921 A   n 
1  2922 U   n 
2  1    U   n 
2  2    U   n 
2  3    A   n 
2  4    G   n 
2  5    G   n 
2  6    C   n 
2  7    G   n 
2  8    G   n 
2  9    C   n 
2  10   C   n 
2  11   A   n 
2  12   C   n 
2  13   A   n 
2  14   G   n 
2  15   C   n 
2  16   G   n 
2  17   G   n 
2  18   U   n 
2  19   G   n 
2  20   G   n 
2  21   G   n 
2  22   G   n 
2  23   U   n 
2  24   U   n 
2  25   G   n 
2  26   C   n 
2  27   C   n 
2  28   U   n 
2  29   C   n 
2  30   C   n 
2  31   C   n 
2  32   G   n 
2  33   U   n 
2  34   A   n 
2  35   C   n 
2  36   C   n 
2  37   C   n 
2  38   A   n 
2  39   U   n 
2  40   C   n 
2  41   C   n 
2  42   C   n 
2  43   G   n 
2  44   A   n 
2  45   A   n 
2  46   C   n 
2  47   A   n 
2  48   C   n 
2  49   G   n 
2  50   G   n 
2  51   A   n 
2  52   A   n 
2  53   G   n 
2  54   A   n 
2  55   U   n 
2  56   A   n 
2  57   A   n 
2  58   G   n 
2  59   C   n 
2  60   C   n 
2  61   C   n 
2  62   A   n 
2  63   C   n 
2  64   C   n 
2  65   A   n 
2  66   G   n 
2  67   C   n 
2  68   G   n 
2  69   U   n 
2  70   U   n 
2  71   C   n 
2  72   C   n 
2  73   G   n 
2  74   G   n 
2  75   G   n 
2  76   G   n 
2  77   A   n 
2  78   G   n 
2  79   U   n 
2  80   A   n 
2  81   C   n 
2  82   U   n 
2  83   G   n 
2  84   G   n 
2  85   A   n 
2  86   G   n 
2  87   U   n 
2  88   G   n 
2  89   C   n 
2  90   G   n 
2  91   C   n 
2  92   G   n 
2  93   A   n 
2  94   G   n 
2  95   C   n 
2  96   C   n 
2  97   U   n 
2  98   C   n 
2  99   U   n 
2  100  G   n 
2  101  G   n 
2  102  G   n 
2  103  A   n 
2  104  A   n 
2  105  A   n 
2  106  C   n 
2  107  C   n 
2  108  C   n 
2  109  G   n 
2  110  G   n 
2  111  U   n 
2  112  U   n 
2  113  C   n 
2  114  G   n 
2  115  C   n 
2  116  C   n 
2  117  G   n 
2  118  C   n 
2  119  C   n 
2  120  A   n 
2  121  C   n 
2  122  C   n 
3  1    MET n 
3  2    GLY n 
3  3    ARG n 
3  4    ARG n 
3  5    ILE n 
3  6    GLN n 
3  7    GLY n 
3  8    GLN n 
3  9    ARG n 
3  10   ARG n 
3  11   GLY n 
3  12   ARG n 
3  13   GLY n 
3  14   THR n 
3  15   SER n 
3  16   THR n 
3  17   PHE n 
3  18   ARG n 
3  19   ALA n 
3  20   PRO n 
3  21   SER n 
3  22   HIS n 
3  23   ARG n 
3  24   TYR n 
3  25   LYS n 
3  26   ALA n 
3  27   ASP n 
3  28   LEU n 
3  29   GLU n 
3  30   HIS n 
3  31   ARG n 
3  32   LYS n 
3  33   VAL n 
3  34   GLU n 
3  35   ASP n 
3  36   GLY n 
3  37   ASP n 
3  38   VAL n 
3  39   ILE n 
3  40   ALA n 
3  41   GLY n 
3  42   THR n 
3  43   VAL n 
3  44   VAL n 
3  45   ASP n 
3  46   ILE n 
3  47   GLU n 
3  48   HIS n 
3  49   ASP n 
3  50   PRO n 
3  51   ALA n 
3  52   ARG n 
3  53   SER n 
3  54   ALA n 
3  55   PRO n 
3  56   VAL n 
3  57   ALA n 
3  58   ALA n 
3  59   VAL n 
3  60   GLU n 
3  61   PHE n 
3  62   GLU n 
3  63   ASP n 
3  64   GLY n 
3  65   ASP n 
3  66   ARG n 
3  67   ARG n 
3  68   LEU n 
3  69   ILE n 
3  70   LEU n 
3  71   ALA n 
3  72   PRO n 
3  73   GLU n 
3  74   GLY n 
3  75   VAL n 
3  76   GLY n 
3  77   VAL n 
3  78   GLY n 
3  79   ASP n 
3  80   GLU n 
3  81   LEU n 
3  82   GLN n 
3  83   VAL n 
3  84   GLY n 
3  85   VAL n 
3  86   SER n 
3  87   ALA n 
3  88   GLU n 
3  89   ILE n 
3  90   ALA n 
3  91   PRO n 
3  92   GLY n 
3  93   ASN n 
3  94   THR n 
3  95   LEU n 
3  96   PRO n 
3  97   LEU n 
3  98   ALA n 
3  99   GLU n 
3  100  ILE n 
3  101  PRO n 
3  102  GLU n 
3  103  GLY n 
3  104  VAL n 
3  105  PRO n 
3  106  VAL n 
3  107  CYS n 
3  108  ASN n 
3  109  VAL n 
3  110  GLU n 
3  111  SER n 
3  112  SER n 
3  113  PRO n 
3  114  GLY n 
3  115  ASP n 
3  116  GLY n 
3  117  GLY n 
3  118  LYS n 
3  119  PHE n 
3  120  ALA n 
3  121  ARG n 
3  122  ALA n 
3  123  SER n 
3  124  GLY n 
3  125  VAL n 
3  126  ASN n 
3  127  ALA n 
3  128  GLN n 
3  129  LEU n 
3  130  LEU n 
3  131  THR n 
3  132  HIS n 
3  133  ASP n 
3  134  ARG n 
3  135  ASN n 
3  136  VAL n 
3  137  ALA n 
3  138  VAL n 
3  139  VAL n 
3  140  LYS n 
3  141  LEU n 
3  142  PRO n 
3  143  SER n 
3  144  GLY n 
3  145  GLU n 
3  146  MET n 
3  147  LYS n 
3  148  ARG n 
3  149  LEU n 
3  150  ASP n 
3  151  PRO n 
3  152  GLN n 
3  153  CYS n 
3  154  ARG n 
3  155  ALA n 
3  156  THR n 
3  157  ILE n 
3  158  GLY n 
3  159  VAL n 
3  160  VAL n 
3  161  ALA n 
3  162  GLY n 
3  163  GLY n 
3  164  GLY n 
3  165  ARG n 
3  166  THR n 
3  167  ASP n 
3  168  LYS n 
3  169  PRO n 
3  170  PHE n 
3  171  VAL n 
3  172  LYS n 
3  173  ALA n 
3  174  GLY n 
3  175  ASN n 
3  176  LYS n 
3  177  HIS n 
3  178  HIS n 
3  179  LYS n 
3  180  MET n 
3  181  LYS n 
3  182  ALA n 
3  183  ARG n 
3  184  GLY n 
3  185  THR n 
3  186  LYS n 
3  187  TRP n 
3  188  PRO n 
3  189  ASN n 
3  190  VAL n 
3  191  ARG n 
3  192  GLY n 
3  193  VAL n 
3  194  ALA n 
3  195  MET n 
3  196  ASN n 
3  197  ALA n 
3  198  VAL n 
3  199  ASP n 
3  200  HIS n 
3  201  PRO n 
3  202  PHE n 
3  203  GLY n 
3  204  GLY n 
3  205  GLY n 
3  206  GLY n 
3  207  ARG n 
3  208  GLN n 
3  209  HIS n 
3  210  PRO n 
3  211  GLY n 
3  212  LYS n 
3  213  PRO n 
3  214  LYS n 
3  215  SER n 
3  216  ILE n 
3  217  SER n 
3  218  ARG n 
3  219  ASN n 
3  220  ALA n 
3  221  PRO n 
3  222  PRO n 
3  223  GLY n 
3  224  ARG n 
3  225  LYS n 
3  226  VAL n 
3  227  GLY n 
3  228  ASP n 
3  229  ILE n 
3  230  ALA n 
3  231  SER n 
3  232  LYS n 
3  233  ARG n 
3  234  THR n 
3  235  GLY n 
3  236  ARG n 
3  237  GLY n 
3  238  GLY n 
3  239  ASN n 
3  240  GLU n 
4  1    MET n 
4  2    PRO n 
4  3    GLN n 
4  4    PRO n 
4  5    SER n 
4  6    ARG n 
4  7    PRO n 
4  8    ARG n 
4  9    LYS n 
4  10   GLY n 
4  11   SER n 
4  12   LEU n 
4  13   GLY n 
4  14   PHE n 
4  15   GLY n 
4  16   PRO n 
4  17   ARG n 
4  18   LYS n 
4  19   ARG n 
4  20   SER n 
4  21   THR n 
4  22   SER n 
4  23   GLU n 
4  24   THR n 
4  25   PRO n 
4  26   ARG n 
4  27   PHE n 
4  28   ASN n 
4  29   SER n 
4  30   TRP n 
4  31   PRO n 
4  32   SER n 
4  33   ASP n 
4  34   ASP n 
4  35   GLY n 
4  36   GLN n 
4  37   PRO n 
4  38   GLY n 
4  39   VAL n 
4  40   GLN n 
4  41   GLY n 
4  42   PHE n 
4  43   ALA n 
4  44   GLY n 
4  45   TYR n 
4  46   LYS n 
4  47   ALA n 
4  48   GLY n 
4  49   MET n 
4  50   THR n 
4  51   HIS n 
4  52   VAL n 
4  53   VAL n 
4  54   LEU n 
4  55   VAL n 
4  56   ASN n 
4  57   ASP n 
4  58   GLU n 
4  59   PRO n 
4  60   ASN n 
4  61   SER n 
4  62   PRO n 
4  63   ARG n 
4  64   GLU n 
4  65   GLY n 
4  66   MET n 
4  67   GLU n 
4  68   GLU n 
4  69   THR n 
4  70   VAL n 
4  71   PRO n 
4  72   VAL n 
4  73   THR n 
4  74   VAL n 
4  75   ILE n 
4  76   GLU n 
4  77   THR n 
4  78   PRO n 
4  79   PRO n 
4  80   MET n 
4  81   ARG n 
4  82   ALA n 
4  83   VAL n 
4  84   ALA n 
4  85   LEU n 
4  86   ARG n 
4  87   ALA n 
4  88   TYR n 
4  89   GLU n 
4  90   ASP n 
4  91   THR n 
4  92   PRO n 
4  93   TYR n 
4  94   GLY n 
4  95   GLN n 
4  96   ARG n 
4  97   PRO n 
4  98   LEU n 
4  99   THR n 
4  100  GLU n 
4  101  VAL n 
4  102  TRP n 
4  103  THR n 
4  104  ASP n 
4  105  GLU n 
4  106  PHE n 
4  107  HIS n 
4  108  SER n 
4  109  GLU n 
4  110  LEU n 
4  111  ASP n 
4  112  ARG n 
4  113  THR n 
4  114  LEU n 
4  115  ASP n 
4  116  VAL n 
4  117  PRO n 
4  118  GLU n 
4  119  ASP n 
4  120  HIS n 
4  121  ASP n 
4  122  PRO n 
4  123  ASP n 
4  124  ALA n 
4  125  ALA n 
4  126  GLU n 
4  127  GLU n 
4  128  GLN n 
4  129  ILE n 
4  130  ARG n 
4  131  ASP n 
4  132  ALA n 
4  133  HIS n 
4  134  GLU n 
4  135  ALA n 
4  136  GLY n 
4  137  ASP n 
4  138  LEU n 
4  139  GLY n 
4  140  ASP n 
4  141  LEU n 
4  142  ARG n 
4  143  LEU n 
4  144  ILE n 
4  145  THR n 
4  146  HIS n 
4  147  THR n 
4  148  VAL n 
4  149  PRO n 
4  150  ASP n 
4  151  ALA n 
4  152  VAL n 
4  153  PRO n 
4  154  SER n 
4  155  VAL n 
4  156  PRO n 
4  157  LYS n 
4  158  LYS n 
4  159  LYS n 
4  160  PRO n 
4  161  ASP n 
4  162  VAL n 
4  163  MET n 
4  164  GLU n 
4  165  THR n 
4  166  ARG n 
4  167  VAL n 
4  168  GLY n 
4  169  GLY n 
4  170  GLY n 
4  171  SER n 
4  172  VAL n 
4  173  SER n 
4  174  ASP n 
4  175  ARG n 
4  176  LEU n 
4  177  ASP n 
4  178  HIS n 
4  179  ALA n 
4  180  LEU n 
4  181  ASP n 
4  182  ILE n 
4  183  VAL n 
4  184  GLU n 
4  185  ASP n 
4  186  GLY n 
4  187  GLY n 
4  188  GLU n 
4  189  HIS n 
4  190  ALA n 
4  191  MET n 
4  192  ASN n 
4  193  ASP n 
4  194  ILE n 
4  195  PHE n 
4  196  ARG n 
4  197  ALA n 
4  198  GLY n 
4  199  GLU n 
4  200  TYR n 
4  201  ALA n 
4  202  ASP n 
4  203  VAL n 
4  204  ALA n 
4  205  GLY n 
4  206  VAL n 
4  207  THR n 
4  208  LYS n 
4  209  GLY n 
4  210  LYS n 
4  211  GLY n 
4  212  THR n 
4  213  GLN n 
4  214  GLY n 
4  215  PRO n 
4  216  VAL n 
4  217  LYS n 
4  218  ARG n 
4  219  TRP n 
4  220  GLY n 
4  221  VAL n 
4  222  GLN n 
4  223  LYS n 
4  224  ARG n 
4  225  LYS n 
4  226  GLY n 
4  227  LYS n 
4  228  HIS n 
4  229  ALA n 
4  230  ARG n 
4  231  GLN n 
4  232  GLY n 
4  233  TRP n 
4  234  ARG n 
4  235  ARG n 
4  236  ARG n 
4  237  ILE n 
4  238  GLY n 
4  239  ASN n 
4  240  LEU n 
4  241  GLY n 
4  242  PRO n 
4  243  TRP n 
4  244  ASN n 
4  245  PRO n 
4  246  SER n 
4  247  ARG n 
4  248  VAL n 
4  249  ARG n 
4  250  SER n 
4  251  THR n 
4  252  VAL n 
4  253  PRO n 
4  254  GLN n 
4  255  GLN n 
4  256  GLY n 
4  257  GLN n 
4  258  THR n 
4  259  GLY n 
4  260  TYR n 
4  261  HIS n 
4  262  GLN n 
4  263  ARG n 
4  264  THR n 
4  265  GLU n 
4  266  LEU n 
4  267  ASN n 
4  268  LYS n 
4  269  ARG n 
4  270  LEU n 
4  271  ILE n 
4  272  ASP n 
4  273  ILE n 
4  274  GLY n 
4  275  GLU n 
4  276  GLY n 
4  277  ASP n 
4  278  GLU n 
4  279  PRO n 
4  280  THR n 
4  281  VAL n 
4  282  ASP n 
4  283  GLY n 
4  284  GLY n 
4  285  PHE n 
4  286  VAL n 
4  287  ASN n 
4  288  TYR n 
4  289  GLY n 
4  290  GLU n 
4  291  VAL n 
4  292  ASP n 
4  293  GLY n 
4  294  PRO n 
4  295  TYR n 
4  296  THR n 
4  297  LEU n 
4  298  VAL n 
4  299  LYS n 
4  300  GLY n 
4  301  SER n 
4  302  VAL n 
4  303  PRO n 
4  304  GLY n 
4  305  PRO n 
4  306  ASP n 
4  307  LYS n 
4  308  ARG n 
4  309  LEU n 
4  310  VAL n 
4  311  ARG n 
4  312  PHE n 
4  313  ARG n 
4  314  PRO n 
4  315  ALA n 
4  316  VAL n 
4  317  ARG n 
4  318  PRO n 
4  319  ASN n 
4  320  ASP n 
4  321  GLN n 
4  322  PRO n 
4  323  ARG n 
4  324  LEU n 
4  325  ASP n 
4  326  PRO n 
4  327  GLU n 
4  328  VAL n 
4  329  ARG n 
4  330  TYR n 
4  331  VAL n 
4  332  SER n 
4  333  ASN n 
4  334  GLU n 
4  335  SER n 
4  336  ASN n 
4  337  GLN n 
4  338  GLY n 
5  1    MET n 
5  2    GLN n 
5  3    ALA n 
5  4    THR n 
5  5    ILE n 
5  6    TYR n 
5  7    ASP n 
5  8    LEU n 
5  9    ASP n 
5  10   GLY n 
5  11   ASN n 
5  12   THR n 
5  13   ASP n 
5  14   GLY n 
5  15   GLU n 
5  16   VAL n 
5  17   ASP n 
5  18   LEU n 
5  19   PRO n 
5  20   ASP n 
5  21   VAL n 
5  22   PHE n 
5  23   GLU n 
5  24   THR n 
5  25   PRO n 
5  26   VAL n 
5  27   ARG n 
5  28   SER n 
5  29   ASP n 
5  30   LEU n 
5  31   ILE n 
5  32   GLY n 
5  33   LYS n 
5  34   ALA n 
5  35   VAL n 
5  36   ARG n 
5  37   ALA n 
5  38   ALA n 
5  39   GLN n 
5  40   ALA n 
5  41   ASN n 
5  42   ARG n 
5  43   LYS n 
5  44   GLN n 
5  45   ASP n 
5  46   TYR n 
5  47   GLY n 
5  48   SER n 
5  49   ASP n 
5  50   GLU n 
5  51   TYR n 
5  52   ALA n 
5  53   GLY n 
5  54   LEU n 
5  55   ARG n 
5  56   THR n 
5  57   PRO n 
5  58   ALA n 
5  59   GLU n 
5  60   SER n 
5  61   PHE n 
5  62   GLY n 
5  63   SER n 
5  64   GLY n 
5  65   ARG n 
5  66   GLY n 
5  67   GLN n 
5  68   ALA n 
5  69   HIS n 
5  70   VAL n 
5  71   PRO n 
5  72   LYS n 
5  73   LEU n 
5  74   ASP n 
5  75   GLY n 
5  76   ARG n 
5  77   ALA n 
5  78   ARG n 
5  79   ARG n 
5  80   VAL n 
5  81   PRO n 
5  82   GLN n 
5  83   ALA n 
5  84   VAL n 
5  85   LYS n 
5  86   GLY n 
5  87   ARG n 
5  88   SER n 
5  89   ALA n 
5  90   HIS n 
5  91   PRO n 
5  92   PRO n 
5  93   LYS n 
5  94   THR n 
5  95   GLU n 
5  96   LYS n 
5  97   ASP n 
5  98   ARG n 
5  99   SER n 
5  100  LEU n 
5  101  ASP n 
5  102  LEU n 
5  103  ASN n 
5  104  ASP n 
5  105  LYS n 
5  106  GLU n 
5  107  ARG n 
5  108  GLN n 
5  109  LEU n 
5  110  ALA n 
5  111  VAL n 
5  112  ARG n 
5  113  SER n 
5  114  ALA n 
5  115  LEU n 
5  116  ALA n 
5  117  ALA n 
5  118  THR n 
5  119  ALA n 
5  120  ASP n 
5  121  ALA n 
5  122  ASP n 
5  123  LEU n 
5  124  VAL n 
5  125  ALA n 
5  126  ASP n 
5  127  ARG n 
5  128  GLY n 
5  129  HIS n 
5  130  GLU n 
5  131  PHE n 
5  132  ASP n 
5  133  ARG n 
5  134  ASP n 
5  135  GLU n 
5  136  VAL n 
5  137  PRO n 
5  138  VAL n 
5  139  VAL n 
5  140  VAL n 
5  141  SER n 
5  142  ASP n 
5  143  ASP n 
5  144  PHE n 
5  145  GLU n 
5  146  ASP n 
5  147  LEU n 
5  148  VAL n 
5  149  LYS n 
5  150  THR n 
5  151  GLN n 
5  152  GLU n 
5  153  VAL n 
5  154  VAL n 
5  155  SER n 
5  156  LEU n 
5  157  LEU n 
5  158  GLU n 
5  159  ALA n 
5  160  LEU n 
5  161  ASP n 
5  162  VAL n 
5  163  HIS n 
5  164  ALA n 
5  165  ASP n 
5  166  ILE n 
5  167  ASP n 
5  168  ARG n 
5  169  ALA n 
5  170  ASP n 
5  171  GLU n 
5  172  THR n 
5  173  LYS n 
5  174  ILE n 
5  175  LYS n 
5  176  ALA n 
5  177  GLY n 
5  178  GLN n 
5  179  GLY n 
5  180  SER n 
5  181  ALA n 
5  182  ARG n 
5  183  GLY n 
5  184  ARG n 
5  185  LYS n 
5  186  TYR n 
5  187  ARG n 
5  188  ARG n 
5  189  PRO n 
5  190  ALA n 
5  191  SER n 
5  192  ILE n 
5  193  LEU n 
5  194  PHE n 
5  195  VAL n 
5  196  THR n 
5  197  SER n 
5  198  ASP n 
5  199  GLU n 
5  200  PRO n 
5  201  SER n 
5  202  THR n 
5  203  ALA n 
5  204  ALA n 
5  205  ARG n 
5  206  ASN n 
5  207  LEU n 
5  208  ALA n 
5  209  GLY n 
5  210  ALA n 
5  211  ASP n 
5  212  VAL n 
5  213  ALA n 
5  214  THR n 
5  215  ALA n 
5  216  SER n 
5  217  GLU n 
5  218  VAL n 
5  219  ASN n 
5  220  THR n 
5  221  GLU n 
5  222  ASP n 
5  223  LEU n 
5  224  ALA n 
5  225  PRO n 
5  226  GLY n 
5  227  GLY n 
5  228  ALA n 
5  229  PRO n 
5  230  GLY n 
5  231  ARG n 
5  232  LEU n 
5  233  THR n 
5  234  VAL n 
5  235  PHE n 
5  236  THR n 
5  237  GLU n 
5  238  SER n 
5  239  ALA n 
5  240  LEU n 
5  241  ALA n 
5  242  GLU n 
5  243  VAL n 
5  244  ALA n 
5  245  GLU n 
5  246  ARG n 
6  1    MET n 
6  2    SER n 
6  3    SER n 
6  4    GLU n 
6  5    SER n 
6  6    GLU n 
6  7    SER n 
6  8    GLY n 
6  9    GLY n 
6  10   ASP n 
6  11   PHE n 
6  12   HIS n 
6  13   GLU n 
6  14   MET n 
6  15   ARG n 
6  16   GLU n 
6  17   PRO n 
6  18   ARG n 
6  19   ILE n 
6  20   GLU n 
6  21   LYS n 
6  22   VAL n 
6  23   VAL n 
6  24   VAL n 
6  25   HIS n 
6  26   MET n 
6  27   GLY n 
6  28   ILE n 
6  29   GLY n 
6  30   HIS n 
6  31   GLY n 
6  32   GLY n 
6  33   ARG n 
6  34   ASP n 
6  35   LEU n 
6  36   ALA n 
6  37   ASN n 
6  38   ALA n 
6  39   GLU n 
6  40   ASP n 
6  41   ILE n 
6  42   LEU n 
6  43   GLY n 
6  44   GLU n 
6  45   ILE n 
6  46   THR n 
6  47   GLY n 
6  48   GLN n 
6  49   MET n 
6  50   PRO n 
6  51   VAL n 
6  52   ARG n 
6  53   THR n 
6  54   LYS n 
6  55   ALA n 
6  56   LYS n 
6  57   ARG n 
6  58   THR n 
6  59   VAL n 
6  60   GLY n 
6  61   GLU n 
6  62   PHE n 
6  63   ASP n 
6  64   ILE n 
6  65   ARG n 
6  66   GLU n 
6  67   GLY n 
6  68   ASP n 
6  69   PRO n 
6  70   ILE n 
6  71   GLY n 
6  72   ALA n 
6  73   LYS n 
6  74   VAL n 
6  75   THR n 
6  76   LEU n 
6  77   ARG n 
6  78   ASP n 
6  79   GLU n 
6  80   MET n 
6  81   ALA n 
6  82   GLU n 
6  83   GLU n 
6  84   PHE n 
6  85   LEU n 
6  86   GLN n 
6  87   THR n 
6  88   ALA n 
6  89   LEU n 
6  90   PRO n 
6  91   LEU n 
6  92   ALA n 
6  93   GLU n 
6  94   LEU n 
6  95   ALA n 
6  96   THR n 
6  97   SER n 
6  98   GLN n 
6  99   PHE n 
6  100  ASP n 
6  101  ASP n 
6  102  THR n 
6  103  GLY n 
6  104  ASN n 
6  105  PHE n 
6  106  SER n 
6  107  PHE n 
6  108  GLY n 
6  109  VAL n 
6  110  GLU n 
6  111  GLU n 
6  112  HIS n 
6  113  THR n 
6  114  GLU n 
6  115  PHE n 
6  116  PRO n 
6  117  SER n 
6  118  GLN n 
6  119  GLU n 
6  120  TYR n 
6  121  ASP n 
6  122  PRO n 
6  123  SER n 
6  124  ILE n 
6  125  GLY n 
6  126  ILE n 
6  127  TYR n 
6  128  GLY n 
6  129  LEU n 
6  130  ASP n 
6  131  VAL n 
6  132  THR n 
6  133  VAL n 
6  134  ASN n 
6  135  LEU n 
6  136  VAL n 
6  137  ARG n 
6  138  PRO n 
6  139  GLY n 
6  140  TYR n 
6  141  ARG n 
6  142  VAL n 
6  143  ALA n 
6  144  LYS n 
6  145  ARG n 
6  146  ASP n 
6  147  LYS n 
6  148  ALA n 
6  149  SER n 
6  150  ARG n 
6  151  SER n 
6  152  ILE n 
6  153  PRO n 
6  154  THR n 
6  155  LYS n 
6  156  HIS n 
6  157  ARG n 
6  158  LEU n 
6  159  ASN n 
6  160  PRO n 
6  161  ALA n 
6  162  ASP n 
6  163  ALA n 
6  164  VAL n 
6  165  ALA n 
6  166  PHE n 
6  167  ILE n 
6  168  GLU n 
6  169  SER n 
6  170  THR n 
6  171  TYR n 
6  172  ASP n 
6  173  VAL n 
6  174  GLU n 
6  175  VAL n 
6  176  SER n 
6  177  GLU n 
7  1    MET n 
7  2    PRO n 
7  3    ARG n 
7  4    VAL n 
7  5    GLU n 
7  6    LEU n 
7  7    GLU n 
7  8    ILE n 
7  9    PRO n 
7  10   GLU n 
7  11   ASP n 
7  12   VAL n 
7  13   ASP n 
7  14   ALA n 
7  15   GLU n 
7  16   GLN n 
7  17   ASP n 
7  18   HIS n 
7  19   LEU n 
7  20   ASP n 
7  21   ILE n 
7  22   THR n 
7  23   VAL n 
7  24   GLU n 
7  25   GLY n 
7  26   ASP n 
7  27   ASN n 
7  28   GLY n 
7  29   SER n 
7  30   VAL n 
7  31   THR n 
7  32   ARG n 
7  33   ARG n 
7  34   LEU n 
7  35   TRP n 
7  36   TYR n 
7  37   PRO n 
7  38   ASP n 
7  39   ILE n 
7  40   ASP n 
7  41   VAL n 
7  42   SER n 
7  43   VAL n 
7  44   ASP n 
7  45   GLY n 
7  46   ASP n 
7  47   THR n 
7  48   VAL n 
7  49   VAL n 
7  50   ILE n 
7  51   GLU n 
7  52   SER n 
7  53   ASP n 
7  54   GLU n 
7  55   ASP n 
7  56   ASN n 
7  57   ALA n 
7  58   LYS n 
7  59   THR n 
7  60   MET n 
7  61   SER n 
7  62   THR n 
7  63   ILE n 
7  64   GLY n 
7  65   THR n 
7  66   PHE n 
7  67   GLN n 
7  68   SER n 
7  69   HIS n 
7  70   ILE n 
7  71   GLU n 
7  72   ASN n 
7  73   MET n 
7  74   PHE n 
7  75   HIS n 
7  76   GLY n 
7  77   VAL n 
7  78   THR n 
7  79   GLU n 
7  80   GLY n 
7  81   TRP n 
7  82   GLU n 
7  83   TYR n 
7  84   GLY n 
7  85   MET n 
7  86   GLU n 
7  87   VAL n 
7  88   PHE n 
7  89   TYR n 
7  90   SER n 
7  91   HIS n 
7  92   PHE n 
7  93   PRO n 
7  94   MET n 
7  95   GLN n 
7  96   VAL n 
7  97   ASN n 
7  98   VAL n 
7  99   GLU n 
7  100  GLY n 
7  101  ASP n 
7  102  GLU n 
7  103  VAL n 
7  104  VAL n 
7  105  ILE n 
7  106  GLU n 
7  107  ASN n 
7  108  PHE n 
7  109  LEU n 
7  110  GLY n 
7  111  GLU n 
7  112  LYS n 
7  113  ALA n 
7  114  PRO n 
7  115  ARG n 
7  116  ARG n 
7  117  THR n 
7  118  THR n 
7  119  ILE n 
7  120  HIS n 
7  121  GLY n 
7  122  ASP n 
7  123  THR n 
7  124  ASP n 
7  125  VAL n 
7  126  GLU n 
7  127  ILE n 
7  128  ASP n 
7  129  GLY n 
7  130  GLU n 
7  131  GLU n 
7  132  LEU n 
7  133  THR n 
7  134  VAL n 
7  135  SER n 
7  136  GLY n 
7  137  PRO n 
7  138  ASP n 
7  139  ILE n 
7  140  GLU n 
7  141  ALA n 
7  142  VAL n 
7  143  GLY n 
7  144  GLN n 
7  145  THR n 
7  146  ALA n 
7  147  ALA n 
7  148  ASP n 
7  149  ILE n 
7  150  GLU n 
7  151  GLN n 
7  152  LEU n 
7  153  THR n 
7  154  ARG n 
7  155  ILE n 
7  156  ASN n 
7  157  ASP n 
7  158  LYS n 
7  159  ASP n 
7  160  VAL n 
7  161  ARG n 
7  162  VAL n 
7  163  PHE n 
7  164  GLN n 
7  165  ASP n 
7  166  GLY n 
7  167  VAL n 
7  168  TYR n 
7  169  ILE n 
7  170  THR n 
7  171  ARG n 
7  172  LYS n 
7  173  PRO n 
7  174  ASN n 
7  175  ARG n 
7  176  GLY n 
7  177  ASP n 
7  178  ALA n 
8  1    MET n 
8  2    PRO n 
8  3    VAL n 
8  4    TYR n 
8  5    VAL n 
8  6    ASP n 
8  7    PHE n 
8  8    ASP n 
8  9    VAL n 
8  10   PRO n 
8  11   ALA n 
8  12   ASP n 
8  13   LEU n 
8  14   GLU n 
8  15   ASP n 
8  16   ASP n 
8  17   ALA n 
8  18   LEU n 
8  19   GLU n 
8  20   ALA n 
8  21   LEU n 
8  22   GLU n 
8  23   VAL n 
8  24   ALA n 
8  25   ARG n 
8  26   ASP n 
8  27   THR n 
8  28   GLY n 
8  29   ALA n 
8  30   VAL n 
8  31   LYS n 
8  32   LYS n 
8  33   GLY n 
8  34   THR n 
8  35   ASN n 
8  36   GLU n 
8  37   THR n 
8  38   THR n 
8  39   LYS n 
8  40   SER n 
8  41   ILE n 
8  42   GLU n 
8  43   ARG n 
8  44   GLY n 
8  45   SER n 
8  46   ALA n 
8  47   GLU n 
8  48   LEU n 
8  49   VAL n 
8  50   PHE n 
8  51   VAL n 
8  52   ALA n 
8  53   GLU n 
8  54   ASP n 
8  55   VAL n 
8  56   GLN n 
8  57   PRO n 
8  58   GLU n 
8  59   GLU n 
8  60   ILE n 
8  61   VAL n 
8  62   MET n 
8  63   HIS n 
8  64   ILE n 
8  65   PRO n 
8  66   GLU n 
8  67   LEU n 
8  68   ALA n 
8  69   ASP n 
8  70   GLU n 
8  71   LYS n 
8  72   GLY n 
8  73   VAL n 
8  74   PRO n 
8  75   PHE n 
8  76   ILE n 
8  77   PHE n 
8  78   VAL n 
8  79   GLU n 
8  80   GLN n 
8  81   GLN n 
8  82   ASP n 
8  83   ASP n 
8  84   LEU n 
8  85   GLY n 
8  86   HIS n 
8  87   ALA n 
8  88   ALA n 
8  89   GLY n 
8  90   LEU n 
8  91   GLU n 
8  92   VAL n 
8  93   GLY n 
8  94   SER n 
8  95   ALA n 
8  96   ALA n 
8  97   ALA n 
8  98   ALA n 
8  99   VAL n 
8  100  THR n 
8  101  ASP n 
8  102  ALA n 
8  103  GLY n 
8  104  GLU n 
8  105  ALA n 
8  106  ASP n 
8  107  ALA n 
8  108  ASP n 
8  109  VAL n 
8  110  GLU n 
8  111  ASP n 
8  112  ILE n 
8  113  ALA n 
8  114  ASP n 
8  115  LYS n 
8  116  VAL n 
8  117  GLU n 
8  118  GLU n 
8  119  LEU n 
8  120  ARG n 
9  1    MET n 
9  2    SER n 
9  3    ALA n 
9  4    GLU n 
9  5    SER n 
9  6    GLU n 
9  7    ARG n 
9  8    LYS n 
9  9    THR n 
9  10   GLU n 
9  11   THR n 
9  12   ILE n 
9  13   PRO n 
9  14   GLU n 
9  15   TRP n 
9  16   LYS n 
9  17   GLN n 
9  18   GLU n 
9  19   GLU n 
9  20   VAL n 
9  21   ASP n 
9  22   ALA n 
9  23   ILE n 
9  24   VAL n 
9  25   GLU n 
9  26   MET n 
9  27   ILE n 
9  28   GLU n 
9  29   SER n 
9  30   TYR n 
9  31   GLU n 
9  32   SER n 
9  33   VAL n 
9  34   GLY n 
9  35   VAL n 
9  36   VAL n 
9  37   ASN n 
9  38   ILE n 
9  39   ALA n 
9  40   GLY n 
9  41   ILE n 
9  42   PRO n 
9  43   SER n 
9  44   ARG n 
9  45   GLN n 
9  46   LEU n 
9  47   GLN n 
9  48   ASP n 
9  49   MET n 
9  50   ARG n 
9  51   ARG n 
9  52   ASP n 
9  53   LEU n 
9  54   HIS n 
9  55   GLY n 
9  56   THR n 
9  57   ALA n 
9  58   GLU n 
9  59   LEU n 
9  60   ARG n 
9  61   VAL n 
9  62   SER n 
9  63   ARG n 
9  64   ASN n 
9  65   THR n 
9  66   LEU n 
9  67   LEU n 
9  68   GLU n 
9  69   ARG n 
9  70   ALA n 
9  71   LEU n 
9  72   ASP n 
9  73   ASP n 
9  74   VAL n 
9  75   ASP n 
9  76   ASP n 
9  77   GLY n 
9  78   LEU n 
9  79   GLU n 
9  80   ASP n 
9  81   LEU n 
9  82   ASN n 
9  83   GLY n 
9  84   TYR n 
9  85   ILE n 
9  86   THR n 
9  87   GLY n 
9  88   GLN n 
9  89   VAL n 
9  90   GLY n 
9  91   LEU n 
9  92   ILE n 
9  93   GLY n 
9  94   THR n 
9  95   ASP n 
9  96   ASP n 
9  97   ASN n 
9  98   PRO n 
9  99   PHE n 
9  100  SER n 
9  101  LEU n 
9  102  PHE n 
9  103  GLN n 
9  104  GLU n 
9  105  LEU n 
9  106  GLU n 
9  107  ALA n 
9  108  SER n 
9  109  LYS n 
9  110  THR n 
9  111  PRO n 
9  112  ALA n 
9  113  PRO n 
9  114  ILE n 
9  115  GLY n 
9  116  ALA n 
9  117  GLY n 
9  118  GLU n 
9  119  VAL n 
9  120  ALA n 
9  121  PRO n 
9  122  ASN n 
9  123  ASP n 
9  124  ILE n 
9  125  VAL n 
9  126  ILE n 
9  127  PRO n 
9  128  GLU n 
9  129  GLY n 
9  130  ASP n 
9  131  THR n 
9  132  GLY n 
9  133  VAL n 
9  134  ASP n 
9  135  PRO n 
9  136  GLY n 
9  137  PRO n 
9  138  PHE n 
9  139  VAL n 
9  140  GLY n 
9  141  GLU n 
9  142  LEU n 
9  143  GLN n 
9  144  SER n 
9  145  VAL n 
9  146  GLY n 
9  147  ALA n 
9  148  ASP n 
9  149  ALA n 
9  150  ARG n 
9  151  ILE n 
9  152  GLN n 
9  153  GLU n 
9  154  GLY n 
9  155  SER n 
9  156  ILE n 
9  157  GLN n 
9  158  VAL n 
9  159  LEU n 
9  160  SER n 
9  161  ASP n 
9  162  SER n 
9  163  THR n 
9  164  VAL n 
9  165  LEU n 
9  166  ASP n 
9  167  THR n 
9  168  GLY n 
9  169  GLU n 
9  170  GLU n 
9  171  VAL n 
9  172  SER n 
9  173  GLN n 
9  174  GLU n 
9  175  LEU n 
9  176  SER n 
9  177  ASN n 
9  178  VAL n 
9  179  LEU n 
9  180  ASN n 
9  181  GLU n 
9  182  LEU n 
9  183  GLY n 
9  184  ILE n 
9  185  GLU n 
9  186  PRO n 
9  187  LYS n 
9  188  GLU n 
9  189  VAL n 
9  190  GLY n 
9  191  LEU n 
9  192  ASP n 
9  193  LEU n 
9  194  ARG n 
9  195  ALA n 
9  196  VAL n 
9  197  PHE n 
9  198  ALA n 
9  199  ASP n 
9  200  GLY n 
9  201  VAL n 
9  202  LEU n 
9  203  PHE n 
9  204  GLU n 
9  205  PRO n 
9  206  GLU n 
9  207  GLU n 
9  208  LEU n 
9  209  GLU n 
9  210  LEU n 
9  211  ASP n 
9  212  ILE n 
9  213  ASP n 
9  214  GLU n 
9  215  TYR n 
9  216  ARG n 
9  217  SER n 
9  218  ASP n 
9  219  ILE n 
9  220  GLN n 
9  221  ALA n 
9  222  ALA n 
9  223  ALA n 
9  224  GLY n 
9  225  ARG n 
9  226  ALA n 
9  227  PHE n 
9  228  ASN n 
9  229  LEU n 
9  230  SER n 
9  231  VAL n 
9  232  ASN n 
9  233  ALA n 
9  234  ASP n 
9  235  TYR n 
9  236  PRO n 
9  237  THR n 
9  238  ALA n 
9  239  THR n 
9  240  THR n 
9  241  ALA n 
9  242  PRO n 
9  243  THR n 
9  244  MET n 
9  245  LEU n 
9  246  GLN n 
9  247  SER n 
9  248  ASP n 
9  249  ARG n 
9  250  GLY n 
9  251  ASN n 
9  252  ALA n 
9  253  LYS n 
9  254  SER n 
9  255  LEU n 
9  256  ALA n 
9  257  LEU n 
9  258  GLN n 
9  259  ALA n 
9  260  ALA n 
9  261  ILE n 
9  262  GLU n 
9  263  ASP n 
9  264  PRO n 
9  265  GLU n 
9  266  VAL n 
9  267  VAL n 
9  268  PRO n 
9  269  ASP n 
9  270  LEU n 
9  271  VAL n 
9  272  SER n 
9  273  LYS n 
9  274  ALA n 
9  275  ASP n 
9  276  ALA n 
9  277  GLN n 
9  278  VAL n 
9  279  ARG n 
9  280  ALA n 
9  281  LEU n 
9  282  ALA n 
9  283  SER n 
9  284  GLN n 
9  285  ILE n 
9  286  ASP n 
9  287  ASP n 
9  288  GLU n 
9  289  GLU n 
9  290  ALA n 
9  291  LEU n 
9  292  PRO n 
9  293  GLU n 
9  294  GLU n 
9  295  LEU n 
9  296  GLN n 
9  297  GLY n 
9  298  VAL n 
9  299  GLU n 
9  300  ALA n 
9  301  ASP n 
9  302  VAL n 
9  303  ALA n 
9  304  THR n 
9  305  GLU n 
9  306  GLU n 
9  307  PRO n 
9  308  THR n 
9  309  ASP n 
9  310  ASP n 
9  311  GLN n 
9  312  ASP n 
9  313  ASP n 
9  314  ASP n 
9  315  THR n 
9  316  ALA n 
9  317  SER n 
9  318  GLU n 
9  319  ASP n 
9  320  ASP n 
9  321  ALA n 
9  322  ASP n 
9  323  ALA n 
9  324  ASP n 
9  325  ASP n 
9  326  ALA n 
9  327  ALA n 
9  328  GLU n 
9  329  GLU n 
9  330  ALA n 
9  331  ASP n 
9  332  ASP n 
9  333  ASP n 
9  334  ASP n 
9  335  ASP n 
9  336  ASP n 
9  337  ASP n 
9  338  GLU n 
9  339  ASP n 
9  340  ALA n 
9  341  GLY n 
9  342  ASP n 
9  343  ALA n 
9  344  LEU n 
9  345  GLY n 
9  346  ALA n 
9  347  MET n 
9  348  PHE n 
10 1    LYS n 
10 2    PRO n 
10 3    ALA n 
10 4    SER n 
10 5    MET n 
10 6    TYR n 
10 7    ARG n 
10 8    ASP n 
10 9    ILE n 
10 10   ASP n 
10 11   LYS n 
10 12   PRO n 
10 13   ALA n 
10 14   TYR n 
10 15   THR n 
10 16   ARG n 
10 17   ARG n 
10 18   GLU n 
10 19   TYR n 
10 20   ILE n 
10 21   THR n 
10 22   GLY n 
10 23   ILE n 
10 24   PRO n 
10 25   GLY n 
10 26   SER n 
10 27   LYS n 
10 28   ILE n 
10 29   ALA n 
10 30   GLN n 
10 31   HIS n 
10 32   LYS n 
10 33   MET n 
10 34   GLY n 
10 35   ARG n 
10 36   LYS n 
10 37   GLN n 
10 38   LYS n 
10 39   ASP n 
10 40   ALA n 
10 41   ASP n 
10 42   ASP n 
10 43   TYR n 
10 44   PRO n 
10 45   VAL n 
10 46   GLN n 
10 47   ILE n 
10 48   SER n 
10 49   LEU n 
10 50   ILE n 
10 51   VAL n 
10 52   GLU n 
10 53   GLU n 
10 54   THR n 
10 55   VAL n 
10 56   GLN n 
10 57   LEU n 
10 58   ARG n 
10 59   HIS n 
10 60   GLY n 
10 61   SER n 
10 62   LEU n 
10 63   GLU n 
10 64   ALA n 
10 65   SER n 
10 66   ARG n 
10 67   LEU n 
10 68   SER n 
10 69   ALA n 
10 70   ASN n 
10 71   ARG n 
10 72   HIS n 
10 73   LEU n 
10 74   ILE n 
10 75   LYS n 
10 76   GLU n 
10 77   LEU n 
10 78   GLY n 
10 79   GLU n 
10 80   GLU n 
10 81   GLY n 
10 82   ASP n 
10 83   TYR n 
10 84   LYS n 
10 85   MET n 
10 86   THR n 
10 87   LEU n 
10 88   ARG n 
10 89   LYS n 
10 90   PHE n 
10 91   PRO n 
10 92   HIS n 
10 93   GLN n 
10 94   VAL n 
10 95   LEU n 
10 96   ARG n 
10 97   GLU n 
10 98   ASN n 
10 99   LYS n 
10 100  GLN n 
10 101  ALA n 
10 102  THR n 
10 103  GLY n 
10 104  ALA n 
10 105  GLY n 
10 106  ALA n 
10 107  ASP n 
10 108  ARG n 
10 109  VAL n 
10 110  SER n 
10 111  ASP n 
10 112  GLY n 
10 113  MET n 
10 114  ARG n 
10 115  ALA n 
10 116  ALA n 
10 117  PHE n 
10 118  GLY n 
10 119  LYS n 
10 120  ILE n 
10 121  VAL n 
10 122  GLY n 
10 123  THR n 
10 124  ALA n 
10 125  ALA n 
10 126  ARG n 
10 127  VAL n 
10 128  GLN n 
10 129  ALA n 
10 130  GLY n 
10 131  GLU n 
10 132  GLN n 
10 133  LEU n 
10 134  PHE n 
10 135  THR n 
10 136  ALA n 
10 137  TYR n 
10 138  CYS n 
10 139  ASN n 
10 140  VAL n 
10 141  GLU n 
10 142  ASP n 
10 143  ALA n 
10 144  GLU n 
10 145  HIS n 
10 146  VAL n 
10 147  LYS n 
10 148  GLU n 
10 149  ALA n 
10 150  PHE n 
10 151  ARG n 
10 152  ARG n 
10 153  ALA n 
10 154  TYR n 
10 155  ASN n 
10 156  LYS n 
10 157  ILE n 
10 158  THR n 
10 159  PRO n 
10 160  SER n 
10 161  CYS n 
10 162  ARG n 
10 163  ILE n 
10 164  ASP n 
10 165  SER n 
10 166  SER n 
10 167  PRO n 
10 168  ALA n 
10 169  GLY n 
10 170  ASN n 
10 171  ALA n 
11 1    MET n 
11 2    ALA n 
11 3    GLY n 
11 4    THR n 
11 5    ILE n 
11 6    GLU n 
11 7    VAL n 
11 8    LEU n 
11 9    VAL n 
11 10   PRO n 
11 11   GLY n 
11 12   GLY n 
11 13   GLU n 
11 14   ALA n 
11 15   ASN n 
11 16   PRO n 
11 17   GLY n 
11 18   PRO n 
11 19   PRO n 
11 20   LEU n 
11 21   GLY n 
11 22   PRO n 
11 23   GLU n 
11 24   LEU n 
11 25   GLY n 
11 26   PRO n 
11 27   THR n 
11 28   PRO n 
11 29   VAL n 
11 30   ASP n 
11 31   VAL n 
11 32   GLN n 
11 33   ALA n 
11 34   VAL n 
11 35   VAL n 
11 36   GLN n 
11 37   GLU n 
11 38   ILE n 
11 39   ASN n 
11 40   ASP n 
11 41   GLN n 
11 42   THR n 
11 43   ALA n 
11 44   ALA n 
11 45   PHE n 
11 46   ASP n 
11 47   GLY n 
11 48   THR n 
11 49   GLU n 
11 50   VAL n 
11 51   PRO n 
11 52   VAL n 
11 53   THR n 
11 54   VAL n 
11 55   LYS n 
11 56   TYR n 
11 57   ASP n 
11 58   ASP n 
11 59   ASP n 
11 60   GLY n 
11 61   SER n 
11 62   PHE n 
11 63   GLU n 
11 64   ILE n 
11 65   GLU n 
11 66   VAL n 
11 67   GLY n 
11 68   VAL n 
11 69   PRO n 
11 70   PRO n 
11 71   THR n 
11 72   ALA n 
11 73   GLU n 
11 74   LEU n 
11 75   ILE n 
11 76   LYS n 
11 77   ASP n 
11 78   GLU n 
11 79   ALA n 
11 80   GLY n 
11 81   PHE n 
11 82   GLU n 
11 83   THR n 
11 84   GLY n 
11 85   SER n 
11 86   GLY n 
11 87   GLU n 
11 88   PRO n 
11 89   GLN n 
11 90   GLU n 
11 91   ASP n 
11 92   PHE n 
11 93   VAL n 
11 94   ALA n 
11 95   ASP n 
11 96   LEU n 
11 97   SER n 
11 98   VAL n 
11 99   ASP n 
11 100  GLN n 
11 101  VAL n 
11 102  LYS n 
11 103  GLN n 
11 104  ILE n 
11 105  ALA n 
11 106  GLU n 
11 107  GLN n 
11 108  LYS n 
11 109  HIS n 
11 110  PRO n 
11 111  ASP n 
11 112  LEU n 
11 113  LEU n 
11 114  SER n 
11 115  TYR n 
11 116  ASP n 
11 117  LEU n 
11 118  THR n 
11 119  ASN n 
11 120  ALA n 
11 121  ALA n 
11 122  LYS n 
11 123  GLU n 
11 124  VAL n 
11 125  VAL n 
11 126  GLY n 
11 127  THR n 
11 128  CYS n 
11 129  THR n 
11 130  SER n 
11 131  LEU n 
11 132  GLY n 
11 133  VAL n 
11 134  THR n 
11 135  ILE n 
11 136  GLU n 
11 137  GLY n 
11 138  GLU n 
11 139  ASN n 
11 140  PRO n 
11 141  ARG n 
11 142  GLU n 
11 143  PHE n 
11 144  LYS n 
11 145  GLU n 
11 146  ARG n 
11 147  ILE n 
11 148  ASP n 
11 149  ALA n 
11 150  GLY n 
11 151  GLU n 
11 152  TYR n 
11 153  ASP n 
11 154  ASP n 
11 155  VAL n 
11 156  PHE n 
11 157  ALA n 
11 158  ALA n 
11 159  GLU n 
11 160  ALA n 
11 161  GLN n 
11 162  ALA n 
12 1    MET n 
12 2    SER n 
12 3    VAL n 
12 4    ALA n 
12 5    GLU n 
12 6    PHE n 
12 7    ASP n 
12 8    ALA n 
12 9    ASP n 
12 10   VAL n 
12 11   ILE n 
12 12   VAL n 
12 13   ASP n 
12 14   ALA n 
12 15   ARG n 
12 16   ASP n 
12 17   CYS n 
12 18   ILE n 
12 19   MET n 
12 20   GLY n 
12 21   ARG n 
12 22   VAL n 
12 23   ALA n 
12 24   SER n 
12 25   GLN n 
12 26   VAL n 
12 27   ALA n 
12 28   GLU n 
12 29   GLN n 
12 30   ALA n 
12 31   LEU n 
12 32   ASP n 
12 33   GLY n 
12 34   GLU n 
12 35   THR n 
12 36   VAL n 
12 37   ALA n 
12 38   VAL n 
12 39   VAL n 
12 40   ASN n 
12 41   ALA n 
12 42   GLU n 
12 43   ARG n 
12 44   ALA n 
12 45   VAL n 
12 46   ILE n 
12 47   THR n 
12 48   GLY n 
12 49   ARG n 
12 50   GLU n 
12 51   GLU n 
12 52   GLN n 
12 53   ILE n 
12 54   VAL n 
12 55   GLU n 
12 56   LYS n 
12 57   TYR n 
12 58   GLU n 
12 59   LYS n 
12 60   ARG n 
12 61   VAL n 
12 62   ASP n 
12 63   ILE n 
12 64   GLY n 
12 65   ASN n 
12 66   ASP n 
12 67   ASN n 
12 68   GLY n 
12 69   TYR n 
12 70   PHE n 
12 71   TYR n 
12 72   PRO n 
12 73   LYS n 
12 74   ARG n 
12 75   PRO n 
12 76   ASP n 
12 77   GLY n 
12 78   ILE n 
12 79   PHE n 
12 80   LYS n 
12 81   ARG n 
12 82   THR n 
12 83   ILE n 
12 84   ARG n 
12 85   GLY n 
12 86   MET n 
12 87   LEU n 
12 88   PRO n 
12 89   HIS n 
12 90   LYS n 
12 91   LYS n 
12 92   GLN n 
12 93   ARG n 
12 94   GLY n 
12 95   ARG n 
12 96   GLU n 
12 97   ALA n 
12 98   PHE n 
12 99   GLU n 
12 100  SER n 
12 101  VAL n 
12 102  ARG n 
12 103  VAL n 
12 104  TYR n 
12 105  LEU n 
12 106  GLY n 
12 107  ASN n 
12 108  PRO n 
12 109  TYR n 
12 110  ASP n 
12 111  GLU n 
12 112  ASP n 
12 113  GLY n 
12 114  GLU n 
12 115  VAL n 
12 116  LEU n 
12 117  ASP n 
12 118  GLY n 
12 119  THR n 
12 120  SER n 
12 121  LEU n 
12 122  ASP n 
12 123  ARG n 
12 124  LEU n 
12 125  SER n 
12 126  ASN n 
12 127  ILE n 
12 128  LYS n 
12 129  PHE n 
12 130  VAL n 
12 131  THR n 
12 132  LEU n 
12 133  GLY n 
12 134  GLU n 
12 135  ILE n 
12 136  SER n 
12 137  GLU n 
12 138  THR n 
12 139  LEU n 
12 140  GLY n 
12 141  ALA n 
12 142  ASN n 
12 143  LYS n 
12 144  THR n 
12 145  TRP n 
13 1    MET n 
13 2    GLU n 
13 3    ALA n 
13 4    LEU n 
13 5    GLY n 
13 6    ALA n 
13 7    ASP n 
13 8    VAL n 
13 9    THR n 
13 10   GLN n 
13 11   GLY n 
13 12   LEU n 
13 13   GLU n 
13 14   LYS n 
13 15   GLY n 
13 16   SER n 
13 17   LEU n 
13 18   ILE n 
13 19   THR n 
13 20   CYS n 
13 21   ALA n 
13 22   ASP n 
13 23   ASN n 
13 24   THR n 
13 25   GLY n 
13 26   ALA n 
13 27   ARG n 
13 28   GLU n 
13 29   LEU n 
13 30   LYS n 
13 31   VAL n 
13 32   ILE n 
13 33   SER n 
13 34   VAL n 
13 35   HIS n 
13 36   GLY n 
13 37   TYR n 
13 38   SER n 
13 39   GLY n 
13 40   THR n 
13 41   LYS n 
13 42   ASN n 
13 43   ARG n 
13 44   LEU n 
13 45   PRO n 
13 46   LYS n 
13 47   ALA n 
13 48   GLY n 
13 49   LEU n 
13 50   GLY n 
13 51   ASP n 
13 52   LYS n 
13 53   ILE n 
13 54   THR n 
13 55   VAL n 
13 56   SER n 
13 57   VAL n 
13 58   THR n 
13 59   LYS n 
13 60   GLY n 
13 61   THR n 
13 62   PRO n 
13 63   GLU n 
13 64   MET n 
13 65   ARG n 
13 66   ARG n 
13 67   GLN n 
13 68   VAL n 
13 69   LEU n 
13 70   GLU n 
13 71   ALA n 
13 72   VAL n 
13 73   VAL n 
13 74   VAL n 
13 75   ARG n 
13 76   GLN n 
13 77   ARG n 
13 78   LYS n 
13 79   PRO n 
13 80   ILE n 
13 81   ARG n 
13 82   ARG n 
13 83   PRO n 
13 84   ASP n 
13 85   GLY n 
13 86   THR n 
13 87   ARG n 
13 88   VAL n 
13 89   LYS n 
13 90   PHE n 
13 91   GLU n 
13 92   ASP n 
13 93   ASN n 
13 94   ALA n 
13 95   ALA n 
13 96   VAL n 
13 97   ILE n 
13 98   VAL n 
13 99   ASP n 
13 100  GLU n 
13 101  ASN n 
13 102  GLU n 
13 103  ASP n 
13 104  PRO n 
13 105  ARG n 
13 106  GLY n 
13 107  THR n 
13 108  GLU n 
13 109  LEU n 
13 110  LYS n 
13 111  GLY n 
13 112  PRO n 
13 113  ILE n 
13 114  ALA n 
13 115  ARG n 
13 116  GLU n 
13 117  VAL n 
13 118  ALA n 
13 119  GLN n 
13 120  ARG n 
13 121  PHE n 
13 122  GLY n 
13 123  SER n 
13 124  VAL n 
13 125  ALA n 
13 126  SER n 
13 127  ALA n 
13 128  ALA n 
13 129  THR n 
13 130  MET n 
13 131  ILE n 
13 132  VAL n 
14 1    MET n 
14 2    THR n 
14 3    SER n 
14 4    LYS n 
14 5    LYS n 
14 6    LYS n 
14 7    ARG n 
14 8    GLN n 
14 9    ARG n 
14 10   GLY n 
14 11   SER n 
14 12   ARG n 
14 13   THR n 
14 14   HIS n 
14 15   GLY n 
14 16   GLY n 
14 17   GLY n 
14 18   SER n 
14 19   HIS n 
14 20   LYS n 
14 21   ASN n 
14 22   ARG n 
14 23   ARG n 
14 24   GLY n 
14 25   ALA n 
14 26   GLY n 
14 27   HIS n 
14 28   ARG n 
14 29   GLY n 
14 30   GLY n 
14 31   ARG n 
14 32   GLY n 
14 33   ASP n 
14 34   ALA n 
14 35   GLY n 
14 36   ARG n 
14 37   ASP n 
14 38   LYS n 
14 39   HIS n 
14 40   GLU n 
14 41   PHE n 
14 42   HIS n 
14 43   ASN n 
14 44   HIS n 
14 45   GLU n 
14 46   PRO n 
14 47   LEU n 
14 48   GLY n 
14 49   LYS n 
14 50   SER n 
14 51   GLY n 
14 52   PHE n 
14 53   LYS n 
14 54   ARG n 
14 55   PRO n 
14 56   GLN n 
14 57   LYS n 
14 58   VAL n 
14 59   GLN n 
14 60   GLU n 
14 61   GLU n 
14 62   ALA n 
14 63   ALA n 
14 64   THR n 
14 65   ILE n 
14 66   ASP n 
14 67   VAL n 
14 68   ARG n 
14 69   GLU n 
14 70   ILE n 
14 71   ASP n 
14 72   GLU n 
14 73   ASN n 
14 74   VAL n 
14 75   THR n 
14 76   LEU n 
14 77   LEU n 
14 78   ALA n 
14 79   ALA n 
14 80   ASP n 
14 81   ASP n 
14 82   VAL n 
14 83   ALA n 
14 84   GLU n 
14 85   VAL n 
14 86   GLU n 
14 87   ASP n 
14 88   GLY n 
14 89   GLY n 
14 90   PHE n 
14 91   ARG n 
14 92   VAL n 
14 93   ASP n 
14 94   VAL n 
14 95   ARG n 
14 96   ASP n 
14 97   VAL n 
14 98   VAL n 
14 99   GLU n 
14 100  GLU n 
14 101  ALA n 
14 102  ASP n 
14 103  ASP n 
14 104  ALA n 
14 105  ASP n 
14 106  TYR n 
14 107  VAL n 
14 108  LYS n 
14 109  VAL n 
14 110  LEU n 
14 111  GLY n 
14 112  ALA n 
14 113  GLY n 
14 114  GLN n 
14 115  VAL n 
14 116  ARG n 
14 117  HIS n 
14 118  GLU n 
14 119  LEU n 
14 120  THR n 
14 121  LEU n 
14 122  ILE n 
14 123  ALA n 
14 124  ASP n 
14 125  ASP n 
14 126  PHE n 
14 127  SER n 
14 128  GLU n 
14 129  GLY n 
14 130  ALA n 
14 131  ARG n 
14 132  GLU n 
14 133  LYS n 
14 134  VAL n 
14 135  GLU n 
14 136  GLY n 
14 137  ALA n 
14 138  GLY n 
14 139  GLY n 
14 140  SER n 
14 141  VAL n 
14 142  GLU n 
14 143  LEU n 
14 144  THR n 
14 145  ASP n 
14 146  LEU n 
14 147  GLY n 
14 148  GLU n 
14 149  GLU n 
14 150  ARG n 
14 151  GLN n 
14 152  ALA n 
14 153  GLU n 
14 154  ALA n 
14 155  GLU n 
14 156  GLU n 
14 157  THR n 
14 158  GLU n 
14 159  ASP n 
14 160  ALA n 
14 161  ASP n 
14 162  ALA n 
14 163  ASP n 
14 164  GLU n 
14 165  GLU n 
15 1    ALA n 
15 2    ARG n 
15 3    SER n 
15 4    ALA n 
15 5    TYR n 
15 6    SER n 
15 7    TYR n 
15 8    ILE n 
15 9    ARG n 
15 10   ASP n 
15 11   ALA n 
15 12   TRP n 
15 13   GLU n 
15 14   ASN n 
15 15   PRO n 
15 16   GLY n 
15 17   ASP n 
15 18   GLY n 
15 19   GLN n 
15 20   LEU n 
15 21   ALA n 
15 22   GLU n 
15 23   LEU n 
15 24   GLN n 
15 25   TRP n 
15 26   GLN n 
15 27   ARG n 
15 28   GLN n 
15 29   GLN n 
15 30   GLU n 
15 31   TRP n 
15 32   ARG n 
15 33   ASN n 
15 34   GLU n 
15 35   GLY n 
15 36   ALA n 
15 37   VAL n 
15 38   GLU n 
15 39   ARG n 
15 40   ILE n 
15 41   GLU n 
15 42   ARG n 
15 43   PRO n 
15 44   THR n 
15 45   ARG n 
15 46   LEU n 
15 47   ASP n 
15 48   LYS n 
15 49   ALA n 
15 50   ARG n 
15 51   SER n 
15 52   GLN n 
15 53   GLY n 
15 54   TYR n 
15 55   LYS n 
15 56   ALA n 
15 57   LYS n 
15 58   GLN n 
15 59   GLY n 
15 60   VAL n 
15 61   ILE n 
15 62   VAL n 
15 63   ALA n 
15 64   ARG n 
15 65   VAL n 
15 66   SER n 
15 67   VAL n 
15 68   ARG n 
15 69   LYS n 
15 70   GLY n 
15 71   SER n 
15 72   ALA n 
15 73   ARG n 
15 74   LYS n 
15 75   ARG n 
15 76   ARG n 
15 77   HIS n 
15 78   LYS n 
15 79   ALA n 
15 80   GLY n 
15 81   ARG n 
15 82   ARG n 
15 83   SER n 
15 84   LYS n 
15 85   ARG n 
15 86   GLN n 
15 87   GLY n 
15 88   VAL n 
15 89   THR n 
15 90   ARG n 
15 91   ILE n 
15 92   THR n 
15 93   ARG n 
15 94   ARG n 
15 95   LYS n 
15 96   ASP n 
15 97   ILE n 
15 98   GLN n 
15 99   ARG n 
15 100  VAL n 
15 101  ALA n 
15 102  GLU n 
15 103  GLU n 
15 104  ARG n 
15 105  ALA n 
15 106  SER n 
15 107  ARG n 
15 108  THR n 
15 109  PHE n 
15 110  PRO n 
15 111  ASN n 
15 112  LEU n 
15 113  ARG n 
15 114  VAL n 
15 115  LEU n 
15 116  ASN n 
15 117  SER n 
15 118  TYR n 
15 119  SER n 
15 120  VAL n 
15 121  GLY n 
15 122  GLN n 
15 123  ASP n 
15 124  GLY n 
15 125  ARG n 
15 126  GLN n 
15 127  LYS n 
15 128  TRP n 
15 129  HIS n 
15 130  GLU n 
15 131  VAL n 
15 132  ILE n 
15 133  LEU n 
15 134  ILE n 
15 135  ASP n 
15 136  PRO n 
15 137  ASN n 
15 138  HIS n 
15 139  PRO n 
15 140  ALA n 
15 141  ILE n 
15 142  GLN n 
15 143  ASN n 
15 144  ASP n 
15 145  ASP n 
15 146  ASP n 
15 147  LEU n 
15 148  SER n 
15 149  TRP n 
15 150  ILE n 
15 151  CYS n 
15 152  ALA n 
15 153  ASP n 
15 154  ASP n 
15 155  GLN n 
15 156  ALA n 
15 157  ASP n 
15 158  ARG n 
15 159  VAL n 
15 160  PHE n 
15 161  ARG n 
15 162  GLY n 
15 163  LEU n 
15 164  THR n 
15 165  GLY n 
15 166  ALA n 
15 167  GLY n 
15 168  ARG n 
15 169  ARG n 
15 170  ASN n 
15 171  ARG n 
15 172  GLY n 
15 173  LEU n 
15 174  SER n 
15 175  GLY n 
15 176  LYS n 
15 177  GLY n 
15 178  LYS n 
15 179  GLY n 
15 180  SER n 
15 181  GLU n 
15 182  LYS n 
15 183  THR n 
15 184  ARG n 
15 185  PRO n 
15 186  SER n 
15 187  LEU n 
15 188  ARG n 
15 189  SER n 
15 190  ASN n 
15 191  GLY n 
15 192  GLY n 
15 193  LYS n 
15 194  ALA n 
16 1    MET n 
16 2    ALA n 
16 3    THR n 
16 4    GLY n 
16 5    PRO n 
16 6    ARG n 
16 7    TYR n 
16 8    LYS n 
16 9    VAL n 
16 10   PRO n 
16 11   MET n 
16 12   ARG n 
16 13   ARG n 
16 14   ARG n 
16 15   ARG n 
16 16   GLU n 
16 17   ALA n 
16 18   ARG n 
16 19   THR n 
16 20   ASP n 
16 21   TYR n 
16 22   HIS n 
16 23   GLN n 
16 24   ARG n 
16 25   LEU n 
16 26   ARG n 
16 27   LEU n 
16 28   LEU n 
16 29   LYS n 
16 30   SER n 
16 31   GLY n 
16 32   LYS n 
16 33   PRO n 
16 34   ARG n 
16 35   LEU n 
16 36   VAL n 
16 37   ALA n 
16 38   ARG n 
16 39   LYS n 
16 40   SER n 
16 41   ASN n 
16 42   LYS n 
16 43   HIS n 
16 44   VAL n 
16 45   ARG n 
16 46   ALA n 
16 47   GLN n 
16 48   LEU n 
16 49   VAL n 
16 50   THR n 
16 51   LEU n 
16 52   GLY n 
16 53   PRO n 
16 54   ASN n 
16 55   GLY n 
16 56   ASP n 
16 57   ASP n 
16 58   THR n 
16 59   LEU n 
16 60   ALA n 
16 61   SER n 
16 62   ALA n 
16 63   HIS n 
16 64   SER n 
16 65   SER n 
16 66   ASP n 
16 67   LEU n 
16 68   ALA n 
16 69   GLU n 
16 70   TYR n 
16 71   GLY n 
16 72   TRP n 
16 73   GLU n 
16 74   ALA n 
16 75   PRO n 
16 76   THR n 
16 77   GLY n 
16 78   ASN n 
16 79   MET n 
16 80   PRO n 
16 81   SER n 
16 82   ALA n 
16 83   TYR n 
16 84   LEU n 
16 85   THR n 
16 86   GLY n 
16 87   LEU n 
16 88   LEU n 
16 89   ALA n 
16 90   GLY n 
16 91   LEU n 
16 92   ARG n 
16 93   ALA n 
16 94   GLN n 
16 95   GLU n 
16 96   ALA n 
16 97   GLY n 
16 98   VAL n 
16 99   GLU n 
16 100  GLU n 
16 101  ALA n 
16 102  VAL n 
16 103  LEU n 
16 104  ASP n 
16 105  ILE n 
16 106  GLY n 
16 107  LEU n 
16 108  ASN n 
16 109  SER n 
16 110  PRO n 
16 111  THR n 
16 112  PRO n 
16 113  GLY n 
16 114  SER n 
16 115  LYS n 
16 116  VAL n 
16 117  PHE n 
16 118  ALA n 
16 119  ILE n 
16 120  GLN n 
16 121  GLU n 
16 122  GLY n 
16 123  ALA n 
16 124  ILE n 
16 125  ASP n 
16 126  ALA n 
16 127  GLY n 
16 128  LEU n 
16 129  ASP n 
16 130  ILE n 
16 131  PRO n 
16 132  HIS n 
16 133  ASN n 
16 134  ASP n 
16 135  ASP n 
16 136  VAL n 
16 137  LEU n 
16 138  ALA n 
16 139  ASP n 
16 140  TRP n 
16 141  GLN n 
16 142  ARG n 
16 143  THR n 
16 144  ARG n 
16 145  GLY n 
16 146  ALA n 
16 147  HIS n 
16 148  ILE n 
16 149  ALA n 
16 150  GLU n 
16 151  TYR n 
16 152  ASP n 
16 153  GLU n 
16 154  GLN n 
16 155  LEU n 
16 156  GLU n 
16 157  GLU n 
16 158  PRO n 
16 159  LEU n 
16 160  TYR n 
16 161  SER n 
16 162  GLY n 
16 163  ASP n 
16 164  PHE n 
16 165  ASP n 
16 166  ALA n 
16 167  ALA n 
16 168  ASP n 
16 169  LEU n 
16 170  PRO n 
16 171  GLU n 
16 172  HIS n 
16 173  PHE n 
16 174  ASP n 
16 175  GLU n 
16 176  LEU n 
16 177  ARG n 
16 178  GLU n 
16 179  THR n 
16 180  LEU n 
16 181  LEU n 
16 182  ASP n 
16 183  GLY n 
16 184  ASP n 
16 185  ILE n 
16 186  GLU n 
16 187  LEU n 
17 1    MET n 
17 2    SER n 
17 3    LYS n 
17 4    THR n 
17 5    ASN n 
17 6    PRO n 
17 7    ARG n 
17 8    LEU n 
17 9    SER n 
17 10   SER n 
17 11   LEU n 
17 12   ILE n 
17 13   ALA n 
17 14   ASP n 
17 15   LEU n 
17 16   LYS n 
17 17   SER n 
17 18   ALA n 
17 19   ALA n 
17 20   ARG n 
17 21   SER n 
17 22   SER n 
17 23   GLY n 
17 24   GLY n 
17 25   ALA n 
17 26   VAL n 
17 27   TRP n 
17 28   GLY n 
17 29   ASP n 
17 30   VAL n 
17 31   ALA n 
17 32   GLU n 
17 33   ARG n 
17 34   LEU n 
17 35   GLU n 
17 36   LYS n 
17 37   PRO n 
17 38   ARG n 
17 39   ARG n 
17 40   THR n 
17 41   HIS n 
17 42   ALA n 
17 43   GLU n 
17 44   VAL n 
17 45   ASN n 
17 46   LEU n 
17 47   GLY n 
17 48   ARG n 
17 49   ILE n 
17 50   GLU n 
17 51   ARG n 
17 52   TYR n 
17 53   ALA n 
17 54   GLN n 
17 55   GLU n 
17 56   ASP n 
17 57   GLU n 
17 58   THR n 
17 59   VAL n 
17 60   VAL n 
17 61   VAL n 
17 62   PRO n 
17 63   GLY n 
17 64   LYS n 
17 65   VAL n 
17 66   LEU n 
17 67   GLY n 
17 68   SER n 
17 69   GLY n 
17 70   VAL n 
17 71   LEU n 
17 72   GLN n 
17 73   LYS n 
17 74   ASP n 
17 75   VAL n 
17 76   THR n 
17 77   VAL n 
17 78   ALA n 
17 79   ALA n 
17 80   VAL n 
17 81   ASP n 
17 82   PHE n 
17 83   SER n 
17 84   GLY n 
17 85   THR n 
17 86   ALA n 
17 87   GLU n 
17 88   THR n 
17 89   LYS n 
17 90   ILE n 
17 91   ASP n 
17 92   GLN n 
17 93   VAL n 
17 94   GLY n 
17 95   GLU n 
17 96   ALA n 
17 97   VAL n 
17 98   SER n 
17 99   LEU n 
17 100  GLU n 
17 101  GLN n 
17 102  ALA n 
17 103  ILE n 
17 104  GLU n 
17 105  ASN n 
17 106  ASN n 
17 107  PRO n 
17 108  GLU n 
17 109  GLY n 
17 110  SER n 
17 111  HIS n 
17 112  VAL n 
17 113  ARG n 
17 114  VAL n 
17 115  ILE n 
17 116  ARG n 
18 1    MET n 
18 2    THR n 
18 3    ASP n 
18 4    LEU n 
18 5    SER n 
18 6    ALA n 
18 7    GLN n 
18 8    LYS n 
18 9    ARG n 
18 10   LEU n 
18 11   ALA n 
18 12   ALA n 
18 13   ASP n 
18 14   VAL n 
18 15   LEU n 
18 16   ASP n 
18 17   VAL n 
18 18   GLY n 
18 19   LYS n 
18 20   ASN n 
18 21   ARG n 
18 22   VAL n 
18 23   TRP n 
18 24   PHE n 
18 25   ASN n 
18 26   PRO n 
18 27   GLU n 
18 28   ARG n 
18 29   GLN n 
18 30   GLY n 
18 31   ASP n 
18 32   ILE n 
18 33   ALA n 
18 34   ASP n 
18 35   ALA n 
18 36   ILE n 
18 37   THR n 
18 38   ARG n 
18 39   GLU n 
18 40   ASP n 
18 41   VAL n 
18 42   ARG n 
18 43   GLU n 
18 44   LEU n 
18 45   VAL n 
18 46   ASP n 
18 47   GLU n 
18 48   GLY n 
18 49   ALA n 
18 50   ILE n 
18 51   GLN n 
18 52   ALA n 
18 53   LYS n 
18 54   ASP n 
18 55   LYS n 
18 56   LYS n 
18 57   GLY n 
18 58   ASN n 
18 59   SER n 
18 60   ARG n 
18 61   GLY n 
18 62   ARG n 
18 63   ALA n 
18 64   ARG n 
18 65   GLU n 
18 66   ARG n 
18 67   GLN n 
18 68   LYS n 
18 69   LYS n 
18 70   ARG n 
18 71   ALA n 
18 72   TYR n 
18 73   GLY n 
18 74   HIS n 
18 75   GLN n 
18 76   LYS n 
18 77   GLY n 
18 78   ALA n 
18 79   GLY n 
18 80   SER n 
18 81   ARG n 
18 82   LYS n 
18 83   GLY n 
18 84   LYS n 
18 85   ALA n 
18 86   GLY n 
18 87   ALA n 
18 88   ARG n 
18 89   GLN n 
18 90   ASN n 
18 91   SER n 
18 92   LYS n 
18 93   GLU n 
18 94   ASP n 
18 95   TRP n 
18 96   GLU n 
18 97   SER n 
18 98   ARG n 
18 99   ILE n 
18 100  ARG n 
18 101  ALA n 
18 102  GLN n 
18 103  ARG n 
18 104  THR n 
18 105  LYS n 
18 106  LEU n 
18 107  ARG n 
18 108  GLU n 
18 109  LEU n 
18 110  ARG n 
18 111  ASP n 
18 112  GLU n 
18 113  GLY n 
18 114  THR n 
18 115  LEU n 
18 116  SER n 
18 117  SER n 
18 118  SER n 
18 119  GLN n 
18 120  TYR n 
18 121  ARG n 
18 122  ASP n 
18 123  LEU n 
18 124  TYR n 
18 125  ASP n 
18 126  LYS n 
18 127  ALA n 
18 128  GLY n 
18 129  GLY n 
18 130  GLY n 
18 131  GLU n 
18 132  PHE n 
18 133  ASP n 
18 134  SER n 
18 135  VAL n 
18 136  ALA n 
18 137  ASP n 
18 138  LEU n 
18 139  GLU n 
18 140  ARG n 
18 141  TYR n 
18 142  ILE n 
18 143  ASP n 
18 144  ALA n 
18 145  ASN n 
18 146  HIS n 
18 147  GLY n 
18 148  ASP n 
18 149  ALA n 
19 1    MET n 
19 2    PRO n 
19 3    SER n 
19 4    SER n 
19 5    ASN n 
19 6    GLY n 
19 7    PRO n 
19 8    LEU n 
19 9    GLU n 
19 10   GLY n 
19 11   THR n 
19 12   ARG n 
19 13   GLY n 
19 14   LYS n 
19 15   LEU n 
19 16   LYS n 
19 17   ASN n 
19 18   LYS n 
19 19   PRO n 
19 20   ARG n 
19 21   ASP n 
19 22   ARG n 
19 23   GLY n 
19 24   THR n 
19 25   SER n 
19 26   PRO n 
19 27   PRO n 
19 28   GLN n 
19 29   ARG n 
19 30   ALA n 
19 31   VAL n 
19 32   GLU n 
19 33   GLU n 
19 34   PHE n 
19 35   ASP n 
19 36   ASP n 
19 37   GLY n 
19 38   GLU n 
19 39   LYS n 
19 40   VAL n 
19 41   HIS n 
19 42   LEU n 
19 43   LYS n 
19 44   ILE n 
19 45   ASP n 
19 46   PRO n 
19 47   SER n 
19 48   VAL n 
19 49   PRO n 
19 50   ASN n 
19 51   GLY n 
19 52   ARG n 
19 53   PHE n 
19 54   HIS n 
19 55   PRO n 
19 56   ARG n 
19 57   PHE n 
19 58   ASP n 
19 59   GLY n 
19 60   GLN n 
19 61   THR n 
19 62   GLY n 
19 63   THR n 
19 64   VAL n 
19 65   GLU n 
19 66   GLY n 
19 67   LYS n 
19 68   GLN n 
19 69   GLY n 
19 70   ASP n 
19 71   ALA n 
19 72   TYR n 
19 73   LYS n 
19 74   VAL n 
19 75   ASP n 
19 76   ILE n 
19 77   VAL n 
19 78   ASP n 
19 79   GLY n 
19 80   GLY n 
19 81   LYS n 
19 82   GLU n 
19 83   LYS n 
19 84   THR n 
19 85   ILE n 
19 86   ILE n 
19 87   VAL n 
19 88   THR n 
19 89   ALA n 
19 90   ALA n 
19 91   HIS n 
19 92   LEU n 
19 93   ARG n 
19 94   ARG n 
19 95   GLN n 
19 96   GLU n 
20 1    MET n 
20 2    GLY n 
20 3    ILE n 
20 4    SER n 
20 5    TYR n 
20 6    SER n 
20 7    VAL n 
20 8    GLU n 
20 9    ALA n 
20 10   ASP n 
20 11   PRO n 
20 12   ASP n 
20 13   THR n 
20 14   THR n 
20 15   ALA n 
20 16   LYS n 
20 17   ALA n 
20 18   MET n 
20 19   LEU n 
20 20   ARG n 
20 21   GLU n 
20 22   ARG n 
20 23   GLN n 
20 24   MET n 
20 25   SER n 
20 26   PHE n 
20 27   LYS n 
20 28   HIS n 
20 29   SER n 
20 30   LYS n 
20 31   ALA n 
20 32   ILE n 
20 33   ALA n 
20 34   ARG n 
20 35   GLU n 
20 36   ILE n 
20 37   LYS n 
20 38   GLY n 
20 39   LYS n 
20 40   THR n 
20 41   ALA n 
20 42   GLY n 
20 43   GLU n 
20 44   ALA n 
20 45   VAL n 
20 46   ASP n 
20 47   TYR n 
20 48   LEU n 
20 49   GLU n 
20 50   ALA n 
20 51   VAL n 
20 52   ILE n 
20 53   GLU n 
20 54   GLY n 
20 55   ASP n 
20 56   GLN n 
20 57   PRO n 
20 58   VAL n 
20 59   PRO n 
20 60   PHE n 
20 61   LYS n 
20 62   GLN n 
20 63   HIS n 
20 64   ASN n 
20 65   SER n 
20 66   GLY n 
20 67   VAL n 
20 68   GLY n 
20 69   HIS n 
20 70   LYS n 
20 71   SER n 
20 72   LYS n 
20 73   VAL n 
20 74   ASP n 
20 75   GLY n 
20 76   TRP n 
20 77   ASP n 
20 78   ALA n 
20 79   GLY n 
20 80   ARG n 
20 81   TYR n 
20 82   PRO n 
20 83   GLU n 
20 84   LYS n 
20 85   ALA n 
20 86   SER n 
20 87   LYS n 
20 88   ALA n 
20 89   PHE n 
20 90   LEU n 
20 91   ASP n 
20 92   LEU n 
20 93   LEU n 
20 94   GLU n 
20 95   ASN n 
20 96   ALA n 
20 97   VAL n 
20 98   GLY n 
20 99   ASN n 
20 100  ALA n 
20 101  ASP n 
20 102  HIS n 
20 103  GLN n 
20 104  GLY n 
20 105  PHE n 
20 106  ASP n 
20 107  GLY n 
20 108  GLU n 
20 109  ALA n 
20 110  MET n 
20 111  THR n 
20 112  ILE n 
20 113  LYS n 
20 114  HIS n 
20 115  VAL n 
20 116  ALA n 
20 117  ALA n 
20 118  HIS n 
20 119  LYS n 
20 120  VAL n 
20 121  GLY n 
20 122  GLU n 
20 123  GLN n 
20 124  GLN n 
20 125  GLY n 
20 126  ARG n 
20 127  LYS n 
20 128  PRO n 
20 129  ARG n 
20 130  ALA n 
20 131  MET n 
20 132  GLY n 
20 133  ARG n 
20 134  ALA n 
20 135  SER n 
20 136  ALA n 
20 137  TRP n 
20 138  ASN n 
20 139  SER n 
20 140  PRO n 
20 141  GLN n 
20 142  VAL n 
20 143  ASP n 
20 144  VAL n 
20 145  GLU n 
20 146  LEU n 
20 147  ILE n 
20 148  LEU n 
20 149  GLU n 
20 150  GLU n 
20 151  PRO n 
20 152  GLU n 
20 153  VAL n 
20 154  GLU n 
20 155  ASP n 
21 1    MET n 
21 2    SER n 
21 3    TRP n 
21 4    ASP n 
21 5    VAL n 
21 6    ILE n 
21 7    LYS n 
21 8    HIS n 
21 9    PRO n 
21 10   HIS n 
21 11   VAL n 
21 12   THR n 
21 13   GLU n 
21 14   LYS n 
21 15   ALA n 
21 16   MET n 
21 17   ASN n 
21 18   ASP n 
21 19   MET n 
21 20   ASP n 
21 21   PHE n 
21 22   GLN n 
21 23   ASN n 
21 24   LYS n 
21 25   LEU n 
21 26   GLN n 
21 27   PHE n 
21 28   ALA n 
21 29   VAL n 
21 30   ASP n 
21 31   ASP n 
21 32   ARG n 
21 33   ALA n 
21 34   SER n 
21 35   LYS n 
21 36   GLY n 
21 37   GLU n 
21 38   VAL n 
21 39   ALA n 
21 40   ASP n 
21 41   ALA n 
21 42   VAL n 
21 43   GLU n 
21 44   GLU n 
21 45   GLN n 
21 46   TYR n 
21 47   ASP n 
21 48   VAL n 
21 49   THR n 
21 50   VAL n 
21 51   GLU n 
21 52   GLN n 
21 53   VAL n 
21 54   ASN n 
21 55   THR n 
21 56   GLN n 
21 57   ASN n 
21 58   THR n 
21 59   MET n 
21 60   ASP n 
21 61   GLY n 
21 62   GLU n 
21 63   LYS n 
21 64   LYS n 
21 65   ALA n 
21 66   VAL n 
21 67   VAL n 
21 68   ARG n 
21 69   LEU n 
21 70   SER n 
21 71   GLU n 
21 72   ASP n 
21 73   ASP n 
21 74   ASP n 
21 75   ALA n 
21 76   GLN n 
21 77   GLU n 
21 78   VAL n 
21 79   ALA n 
21 80   SER n 
21 81   ARG n 
21 82   ILE n 
21 83   GLY n 
21 84   VAL n 
21 85   PHE n 
22 1    MET n 
22 2    SER n 
22 3    LYS n 
22 4    GLN n 
22 5    PRO n 
22 6    ASP n 
22 7    LYS n 
22 8    GLN n 
22 9    ARG n 
22 10   LYS n 
22 11   SER n 
22 12   GLN n 
22 13   ARG n 
22 14   ARG n 
22 15   ALA n 
22 16   PRO n 
22 17   LEU n 
22 18   HIS n 
22 19   GLU n 
22 20   ARG n 
22 21   HIS n 
22 22   LYS n 
22 23   GLN n 
22 24   VAL n 
22 25   ARG n 
22 26   ALA n 
22 27   THR n 
22 28   LEU n 
22 29   SER n 
22 30   ALA n 
22 31   ASP n 
22 32   LEU n 
22 33   ARG n 
22 34   GLU n 
22 35   GLU n 
22 36   TYR n 
22 37   GLY n 
22 38   GLN n 
22 39   ARG n 
22 40   ASN n 
22 41   VAL n 
22 42   ARG n 
22 43   VAL n 
22 44   ASN n 
22 45   ALA n 
22 46   GLY n 
22 47   ASP n 
22 48   THR n 
22 49   VAL n 
22 50   GLU n 
22 51   VAL n 
22 52   LEU n 
22 53   ARG n 
22 54   GLY n 
22 55   ASP n 
22 56   PHE n 
22 57   ALA n 
22 58   GLY n 
22 59   GLU n 
22 60   GLU n 
22 61   GLY n 
22 62   GLU n 
22 63   VAL n 
22 64   ILE n 
22 65   ASN n 
22 66   VAL n 
22 67   ASP n 
22 68   LEU n 
22 69   ASP n 
22 70   LYS n 
22 71   ALA n 
22 72   VAL n 
22 73   ILE n 
22 74   HIS n 
22 75   VAL n 
22 76   GLU n 
22 77   ASP n 
22 78   VAL n 
22 79   THR n 
22 80   LEU n 
22 81   GLU n 
22 82   LYS n 
22 83   THR n 
22 84   ASP n 
22 85   GLY n 
22 86   GLU n 
22 87   GLU n 
22 88   VAL n 
22 89   PRO n 
22 90   ARG n 
22 91   PRO n 
22 92   LEU n 
22 93   ASP n 
22 94   THR n 
22 95   SER n 
22 96   ASN n 
22 97   VAL n 
22 98   ARG n 
22 99   VAL n 
22 100  THR n 
22 101  ASP n 
22 102  LEU n 
22 103  ASP n 
22 104  LEU n 
22 105  GLU n 
22 106  ASP n 
22 107  GLU n 
22 108  LYS n 
22 109  ARG n 
22 110  GLU n 
22 111  ALA n 
22 112  ARG n 
22 113  LEU n 
22 114  GLU n 
22 115  SER n 
22 116  GLU n 
22 117  ASP n 
22 118  ASP n 
22 119  SER n 
22 120  ALA n 
23 1    PRO n 
23 2    ARG n 
23 3    THR n 
23 4    ARG n 
23 5    GLU n 
23 6    CYS n 
23 7    ASP n 
23 8    TYR n 
23 9    CYS n 
23 10   GLY n 
23 11   THR n 
23 12   ASP n 
23 13   ILE n 
23 14   GLU n 
23 15   PRO n 
23 16   GLY n 
23 17   THR n 
23 18   GLY n 
23 19   THR n 
23 20   MET n 
23 21   PHE n 
23 22   VAL n 
23 23   HIS n 
23 24   LYS n 
23 25   ASP n 
23 26   GLY n 
23 27   ALA n 
23 28   THR n 
23 29   THR n 
23 30   HIS n 
23 31   PHE n 
23 32   CYS n 
23 33   SER n 
23 34   SER n 
23 35   LYS n 
23 36   CYS n 
23 37   GLU n 
23 38   ASN n 
23 39   ASN n 
23 40   ALA n 
23 41   ASP n 
23 42   LEU n 
23 43   GLY n 
23 44   ARG n 
23 45   GLU n 
23 46   ALA n 
23 47   ARG n 
23 48   ASN n 
23 49   LEU n 
23 50   GLU n 
23 51   TRP n 
23 52   THR n 
23 53   ASP n 
23 54   THR n 
23 55   ALA n 
23 56   ARG n 
23 57   GLY n 
23 58   GLU n 
23 59   ALA n 
23 60   GLY n 
23 61   GLU n 
23 62   ALA n 
23 63   GLU n 
23 64   ASP n 
23 65   GLU n 
23 66   ALA n 
24 1    MET n 
24 2    THR n 
24 3    VAL n 
24 4    LEU n 
24 5    HIS n 
24 6    VAL n 
24 7    GLN n 
24 8    GLU n 
24 9    ILE n 
24 10   ARG n 
24 11   ASP n 
24 12   MET n 
24 13   THR n 
24 14   PRO n 
24 15   ALA n 
24 16   GLU n 
24 17   ARG n 
24 18   GLU n 
24 19   ALA n 
24 20   GLU n 
24 21   LEU n 
24 22   ASP n 
24 23   ASP n 
24 24   LEU n 
24 25   LYS n 
24 26   THR n 
24 27   GLU n 
24 28   LEU n 
24 29   LEU n 
24 30   ASN n 
24 31   ALA n 
24 32   ARG n 
24 33   ALA n 
24 34   VAL n 
24 35   GLN n 
24 36   ALA n 
24 37   ALA n 
24 38   GLY n 
24 39   GLY n 
24 40   ALA n 
24 41   PRO n 
24 42   GLU n 
24 43   ASN n 
24 44   PRO n 
24 45   GLY n 
24 46   ARG n 
24 47   ILE n 
24 48   LYS n 
24 49   GLU n 
24 50   LEU n 
24 51   ARG n 
24 52   LYS n 
24 53   ALA n 
24 54   ILE n 
24 55   ALA n 
24 56   ARG n 
24 57   ILE n 
24 58   LYS n 
24 59   THR n 
24 60   ILE n 
24 61   GLN n 
24 62   GLY n 
24 63   GLU n 
24 64   GLU n 
24 65   GLY n 
24 66   ASP n 
24 67   LEU n 
24 68   GLN n 
24 69   GLU n 
24 70   ASN n 
24 71   GLU n 
25 1    MET n 
25 2    HIS n 
25 3    ALA n 
25 4    LEU n 
25 5    VAL n 
25 6    GLN n 
25 7    LEU n 
25 8    ARG n 
25 9    GLY n 
25 10   GLU n 
25 11   VAL n 
25 12   ASN n 
25 13   MET n 
25 14   HIS n 
25 15   THR n 
25 16   ASP n 
25 17   ILE n 
25 18   GLN n 
25 19   ASP n 
25 20   THR n 
25 21   LEU n 
25 22   GLU n 
25 23   MET n 
25 24   LEU n 
25 25   ASN n 
25 26   ILE n 
25 27   HIS n 
25 28   HIS n 
25 29   VAL n 
25 30   ASN n 
25 31   HIS n 
25 32   CYS n 
25 33   THR n 
25 34   LEU n 
25 35   VAL n 
25 36   PRO n 
25 37   GLU n 
25 38   THR n 
25 39   ASP n 
25 40   ALA n 
25 41   TYR n 
25 42   ARG n 
25 43   GLY n 
25 44   MET n 
25 45   VAL n 
25 46   ALA n 
25 47   LYS n 
25 48   VAL n 
25 49   ASN n 
25 50   ASP n 
25 51   PHE n 
25 52   VAL n 
25 53   ALA n 
25 54   PHE n 
25 55   GLY n 
25 56   GLU n 
25 57   PRO n 
25 58   SER n 
25 59   GLN n 
25 60   GLU n 
25 61   THR n 
25 62   LEU n 
25 63   GLU n 
25 64   THR n 
25 65   VAL n 
25 66   LEU n 
25 67   ALA n 
25 68   THR n 
25 69   ARG n 
25 70   ALA n 
25 71   GLU n 
25 72   PRO n 
25 73   LEU n 
25 74   GLU n 
25 75   GLY n 
25 76   ASP n 
25 77   ALA n 
25 78   ASP n 
25 79   VAL n 
25 80   ASP n 
25 81   ASP n 
25 82   GLU n 
25 83   TRP n 
25 84   VAL n 
25 85   ALA n 
25 86   GLU n 
25 87   HIS n 
25 88   THR n 
25 89   ASP n 
25 90   TYR n 
25 91   ASP n 
25 92   ASP n 
25 93   ILE n 
25 94   SER n 
25 95   GLY n 
25 96   LEU n 
25 97   ALA n 
25 98   PHE n 
25 99   ALA n 
25 100  LEU n 
25 101  LEU n 
25 102  SER n 
25 103  GLU n 
25 104  GLU n 
25 105  THR n 
25 106  THR n 
25 107  LEU n 
25 108  ARG n 
25 109  GLU n 
25 110  GLN n 
25 111  GLY n 
25 112  LEU n 
25 113  SER n 
25 114  PRO n 
25 115  THR n 
25 116  LEU n 
25 117  ARG n 
25 118  LEU n 
25 119  HIS n 
25 120  PRO n 
25 121  PRO n 
25 122  ARG n 
25 123  GLY n 
25 124  GLY n 
25 125  HIS n 
25 126  ASP n 
25 127  GLY n 
25 128  VAL n 
25 129  LYS n 
25 130  HIS n 
25 131  PRO n 
25 132  VAL n 
25 133  LYS n 
25 134  GLU n 
25 135  GLY n 
25 136  GLY n 
25 137  GLN n 
25 138  LEU n 
25 139  GLY n 
25 140  LYS n 
25 141  HIS n 
25 142  ASP n 
25 143  THR n 
25 144  GLU n 
25 145  GLY n 
25 146  ILE n 
25 147  ASP n 
25 148  ASP n 
25 149  LEU n 
25 150  LEU n 
25 151  GLU n 
25 152  ALA n 
25 153  MET n 
25 154  ARG n 
26 1    MET n 
26 2    SER n 
26 3    ALA n 
26 4    SER n 
26 5    ASP n 
26 6    PHE n 
26 7    GLU n 
26 8    GLU n 
26 9    ARG n 
26 10   VAL n 
26 11   VAL n 
26 12   THR n 
26 13   ILE n 
26 14   PRO n 
26 15   LEU n 
26 16   ARG n 
26 17   ASP n 
26 18   ALA n 
26 19   ARG n 
26 20   ALA n 
26 21   GLU n 
26 22   PRO n 
26 23   ASN n 
26 24   HIS n 
26 25   LYS n 
26 26   ARG n 
26 27   ALA n 
26 28   ASP n 
26 29   LYS n 
26 30   ALA n 
26 31   MET n 
26 32   ILE n 
26 33   LEU n 
26 34   ILE n 
26 35   ARG n 
26 36   GLU n 
26 37   HIS n 
26 38   LEU n 
26 39   ALA n 
26 40   LYS n 
26 41   HIS n 
26 42   PHE n 
26 43   SER n 
26 44   VAL n 
26 45   ASP n 
26 46   GLU n 
26 47   ASP n 
26 48   ALA n 
26 49   VAL n 
26 50   ARG n 
26 51   LEU n 
26 52   ASP n 
26 53   PRO n 
26 54   SER n 
26 55   ILE n 
26 56   ASN n 
26 57   GLU n 
26 58   ALA n 
26 59   ALA n 
26 60   TRP n 
26 61   ALA n 
26 62   ARG n 
26 63   GLY n 
26 64   ARG n 
26 65   ALA n 
26 66   ASN n 
26 67   THR n 
26 68   PRO n 
26 69   SER n 
26 70   LYS n 
26 71   ILE n 
26 72   ARG n 
26 73   VAL n 
26 74   ARG n 
26 75   ALA n 
26 76   ALA n 
26 77   ARG n 
26 78   PHE n 
26 79   GLU n 
26 80   GLU n 
26 81   GLU n 
26 82   GLY n 
26 83   GLU n 
26 84   ALA n 
26 85   ILE n 
26 86   VAL n 
26 87   GLU n 
26 88   ALA n 
26 89   GLU n 
26 90   THR n 
26 91   ALA n 
26 92   GLU n 
27 1    MET n 
27 2    ALA n 
27 3    ASP n 
27 4    ASN n 
27 5    GLU n 
27 6    GLU n 
27 7    ASP n 
27 8    VAL n 
27 9    GLU n 
27 10   ALA n 
27 11   GLU n 
27 12   GLU n 
27 13   GLU n 
27 14   TYR n 
27 15   THR n 
27 16   GLU n 
27 17   LEU n 
27 18   THR n 
27 19   ASP n 
27 20   ILE n 
27 21   SER n 
27 22   GLY n 
27 23   VAL n 
27 24   GLY n 
27 25   PRO n 
27 26   SER n 
27 27   LYS n 
27 28   ALA n 
27 29   GLU n 
27 30   SER n 
27 31   LEU n 
27 32   ARG n 
27 33   GLU n 
27 34   ALA n 
27 35   GLY n 
27 36   PHE n 
27 37   GLU n 
27 38   SER n 
27 39   VAL n 
27 40   GLU n 
27 41   ASP n 
27 42   VAL n 
27 43   ARG n 
27 44   GLY n 
27 45   ALA n 
27 46   ASP n 
27 47   GLN n 
27 48   SER n 
27 49   ALA n 
27 50   LEU n 
27 51   ALA n 
27 52   ASP n 
27 53   VAL n 
27 54   SER n 
27 55   GLY n 
27 56   ILE n 
27 57   GLY n 
27 58   ASN n 
27 59   ALA n 
27 60   LEU n 
27 61   ALA n 
27 62   ALA n 
27 63   ARG n 
27 64   ILE n 
27 65   LYS n 
27 66   ALA n 
27 67   ASP n 
27 68   VAL n 
27 69   GLY n 
27 70   GLY n 
27 71   LEU n 
27 72   GLU n 
27 73   VAL n 
27 74   GLU n 
27 75   SER n 
27 76   GLU n 
27 77   THR n 
27 78   GLU n 
27 79   ALA n 
27 80   GLU n 
27 81   VAL n 
27 82   GLU n 
27 83   GLU n 
27 84   GLU n 
27 85   GLY n 
27 86   GLY n 
27 87   GLU n 
27 88   GLU n 
27 89   ALA n 
27 90   PRO n 
27 91   ASP n 
27 92   GLU n 
27 93   ASP n 
27 94   VAL n 
27 95   GLU n 
27 96   THR n 
27 97   GLU n 
27 98   LEU n 
27 99   GLN n 
27 100  ALA n 
27 101  ARG n 
27 102  GLY n 
27 103  LEU n 
27 104  THR n 
27 105  GLU n 
27 106  LYS n 
27 107  THR n 
27 108  PRO n 
27 109  ASP n 
27 110  LEU n 
27 111  SER n 
27 112  ASP n 
27 113  GLU n 
27 114  ASP n 
27 115  ALA n 
27 116  ARG n 
27 117  LEU n 
27 118  LEU n 
27 119  THR n 
27 120  GLN n 
27 121  ARG n 
27 122  HIS n 
27 123  ARG n 
27 124  VAL n 
27 125  GLY n 
27 126  LYS n 
27 127  PRO n 
27 128  GLN n 
27 129  PHE n 
27 130  ASN n 
27 131  ARG n 
27 132  GLN n 
27 133  ASP n 
27 134  HIS n 
27 135  HIS n 
27 136  LYS n 
27 137  LYS n 
27 138  LYS n 
27 139  ARG n 
27 140  VAL n 
27 141  SER n 
27 142  THR n 
27 143  SER n 
27 144  TRP n 
27 145  ARG n 
27 146  LYS n 
27 147  PRO n 
27 148  ARG n 
27 149  GLY n 
27 150  GLN n 
27 151  LEU n 
27 152  SER n 
27 153  LYS n 
27 154  GLN n 
27 155  ARG n 
27 156  ARG n 
27 157  GLY n 
27 158  ILE n 
27 159  LYS n 
27 160  GLY n 
27 161  LYS n 
27 162  GLY n 
27 163  ASP n 
27 164  THR n 
27 165  VAL n 
27 166  GLU n 
27 167  ALA n 
27 168  GLY n 
27 169  PHE n 
27 170  ARG n 
27 171  SER n 
27 172  PRO n 
27 173  THR n 
27 174  ALA n 
27 175  VAL n 
27 176  ARG n 
27 177  GLY n 
27 178  LYS n 
27 179  HIS n 
27 180  PRO n 
27 181  SER n 
27 182  GLY n 
27 183  PHE n 
27 184  GLU n 
27 185  GLU n 
27 186  VAL n 
27 187  ARG n 
27 188  VAL n 
27 189  HIS n 
27 190  ASN n 
27 191  VAL n 
27 192  ASP n 
27 193  ASP n 
27 194  LEU n 
27 195  GLU n 
27 196  GLY n 
27 197  VAL n 
27 198  ASP n 
27 199  GLY n 
27 200  ASP n 
27 201  THR n 
27 202  GLU n 
27 203  ALA n 
27 204  VAL n 
27 205  ARG n 
27 206  ILE n 
27 207  ALA n 
27 208  SER n 
27 209  LYS n 
27 210  VAL n 
27 211  GLY n 
27 212  ALA n 
27 213  ARG n 
27 214  LYS n 
27 215  ARG n 
27 216  GLU n 
27 217  ARG n 
27 218  ILE n 
27 219  GLU n 
27 220  GLU n 
27 221  GLU n 
27 222  ALA n 
27 223  GLU n 
27 224  ASP n 
27 225  ALA n 
27 226  GLY n 
27 227  ILE n 
27 228  ARG n 
27 229  VAL n 
27 230  LEU n 
27 231  ASN n 
27 232  PRO n 
27 233  THR n 
27 234  TYR n 
27 235  VAL n 
27 236  GLU n 
27 237  VAL n 
27 238  GLU n 
27 239  VAL n 
27 240  SER n 
27 241  GLU n 
28 1    ARG n 
28 2    SER n 
28 3    GLY n 
28 4    ARG n 
28 5    PHE n 
28 6    GLY n 
28 7    ALA n 
28 8    ARG n 
28 9    TYR n 
28 10   GLY n 
28 11   ARG n 
28 12   VAL n 
28 13   SER n 
28 14   ARG n 
28 15   ARG n 
28 16   ARG n 
28 17   VAL n 
28 18   ALA n 
28 19   GLU n 
28 20   ILE n 
28 21   GLU n 
28 22   SER n 
28 23   GLU n 
28 24   MET n 
28 25   ASN n 
28 26   GLU n 
28 27   ASP n 
28 28   HIS n 
28 29   ALA n 
28 30   CYS n 
28 31   PRO n 
28 32   ASN n 
28 33   CYS n 
28 34   GLY n 
28 35   GLU n 
28 36   ASP n 
28 37   ARG n 
28 38   VAL n 
28 39   ASP n 
28 40   ARG n 
28 41   GLN n 
28 42   GLY n 
28 43   THR n 
28 44   GLY n 
28 45   ILE n 
28 46   TRP n 
28 47   GLN n 
28 48   CYS n 
28 49   SER n 
28 50   TYR n 
28 51   CYS n 
28 52   ASP n 
28 53   TYR n 
28 54   LYS n 
28 55   PHE n 
28 56   THR n 
28 57   GLY n 
28 58   GLY n 
28 59   SER n 
28 60   TYR n 
28 61   LYS n 
28 62   PRO n 
28 63   GLU n 
28 64   THR n 
28 65   PRO n 
28 66   GLY n 
28 67   GLY n 
28 68   LYS n 
28 69   THR n 
28 70   VAL n 
28 71   ARG n 
28 72   ARG n 
28 73   SER n 
29 1    MET n 
29 2    THR n 
29 3    GLY n 
29 4    ALA n 
29 5    GLY n 
29 6    THR n 
29 7    PRO n 
29 8    SER n 
29 9    GLN n 
29 10   GLY n 
29 11   LYS n 
29 12   LYS n 
29 13   ASN n 
29 14   THR n 
29 15   THR n 
29 16   THR n 
29 17   HIS n 
29 18   THR n 
29 19   LYS n 
29 20   CYS n 
29 21   ARG n 
29 22   ARG n 
29 23   CYS n 
29 24   GLY n 
29 25   GLU n 
29 26   LYS n 
29 27   SER n 
29 28   TYR n 
29 29   HIS n 
29 30   THR n 
29 31   LYS n 
29 32   LYS n 
29 33   LYS n 
29 34   VAL n 
29 35   CYS n 
29 36   SER n 
29 37   SER n 
29 38   CYS n 
29 39   GLY n 
29 40   PHE n 
29 41   GLY n 
29 42   LYS n 
29 43   SER n 
29 44   ALA n 
29 45   LYS n 
29 46   ARG n 
29 47   ARG n 
29 48   ASP n 
29 49   TYR n 
29 50   GLU n 
29 51   TRP n 
29 52   GLN n 
29 53   SER n 
29 54   LYS n 
29 55   ALA n 
29 56   GLY n 
29 57   GLU n 
30 1    MET n 
30 2    GLY n 
30 3    LYS n 
30 4    LYS n 
30 5    SER n 
30 6    LYS n 
30 7    ALA n 
30 8    THR n 
30 9    LYS n 
30 10   LYS n 
30 11   ARG n 
30 12   LEU n 
30 13   ALA n 
30 14   LYS n 
30 15   LEU n 
30 16   ASP n 
30 17   ASN n 
30 18   GLN n 
30 19   ASN n 
30 20   SER n 
30 21   ARG n 
30 22   VAL n 
30 23   PRO n 
30 24   ALA n 
30 25   TRP n 
30 26   VAL n 
30 27   MET n 
30 28   LEU n 
30 29   LYS n 
30 30   THR n 
30 31   ASP n 
30 32   ARG n 
30 33   GLU n 
30 34   VAL n 
30 35   GLN n 
30 36   ARG n 
30 37   ASN n 
30 38   HIS n 
30 39   LYS n 
30 40   ARG n 
30 41   ARG n 
30 42   HIS n 
30 43   TRP n 
30 44   ARG n 
30 45   ARG n 
30 46   ASN n 
30 47   ASP n 
30 48   THR n 
30 49   ASP n 
30 50   GLU n 
31 1    MET n 
31 2    GLN n 
31 3    MET n 
31 4    PRO n 
31 5    ARG n 
31 6    ARG n 
31 7    PHE n 
31 8    ASN n 
31 9    THR n 
31 10   TYR n 
31 11   CYS n 
31 12   PRO n 
31 13   HIS n 
31 14   CYS n 
31 15   ASN n 
31 16   GLU n 
31 17   HIS n 
31 18   GLN n 
31 19   GLU n 
31 20   HIS n 
31 21   GLU n 
31 22   VAL n 
31 23   GLU n 
31 24   LYS n 
31 25   VAL n 
31 26   ARG n 
31 27   SER n 
31 28   GLY n 
31 29   ARG n 
31 30   GLN n 
31 31   THR n 
31 32   GLY n 
31 33   MET n 
31 34   LYS n 
31 35   TRP n 
31 36   ILE n 
31 37   ASP n 
31 38   ARG n 
31 39   GLN n 
31 40   ARG n 
31 41   GLU n 
31 42   ARG n 
31 43   ASN n 
31 44   SER n 
31 45   GLY n 
31 46   ILE n 
31 47   GLY n 
31 48   ASN n 
31 49   ASP n 
31 50   GLY n 
31 51   LYS n 
31 52   PHE n 
31 53   SER n 
31 54   LYS n 
31 55   VAL n 
31 56   PRO n 
31 57   GLY n 
31 58   GLY n 
31 59   ASP n 
31 60   LYS n 
31 61   PRO n 
31 62   THR n 
31 63   LYS n 
31 64   LYS n 
31 65   THR n 
31 66   ASP n 
31 67   LEU n 
31 68   LYS n 
31 69   TYR n 
31 70   ARG n 
31 71   CYS n 
31 72   GLY n 
31 73   GLU n 
31 74   CYS n 
31 75   GLY n 
31 76   LYS n 
31 77   ALA n 
31 78   HIS n 
31 79   LEU n 
31 80   ARG n 
31 81   GLU n 
31 82   GLY n 
31 83   TRP n 
31 84   ARG n 
31 85   ALA n 
31 86   GLY n 
31 87   ARG n 
31 88   LEU n 
31 89   GLU n 
31 90   PHE n 
31 91   GLN n 
31 92   GLU n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
10 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
11 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
12 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
13 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
14 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
15 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
16 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
17 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
18 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
19 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
20 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
21 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
22 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
23 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
24 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
25 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
26 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
27 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
28 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
29 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
30 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
31 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1  GB  AF034620   3377779 1  
;UUGGCUACUAUGCCAGCUGGUGGAUUGCUCGGCUCAGGCGCUGAUGAAGGACGUGCCAAGCUGCGAUAAGCCAUGGGGAG
CCGCACGGAGGCGAAGAACCAUGGAUUUCCGAAUGAGAAUCUCUCUAACAAUUGCUUCGCGCAAUGAGGAACCCCGAGAA
CUGAAACAUCUCAGUAUCGGGAGGAACAGAAAACGCAAUGUGAUGUCGUUAGUAACCGCGAGUGAACGCGAUACAGCCCA
AACCGAAGCCCUCACGGGCAAUGUGGUGUCAGGGCUACCUCUCAUCAGCCGACCGUCUCGACGAAGUCUCUUGGAACAGA
GCGUGAUACAGGGUGACAACCCCGUACUCGAGACCAGUACGACGUGCGGUAGUGCCAGAGUAGCGGGGGUUGGAUAUCCC
UCGCGAAUAACGCAGGCAUCGACUGCGAAGGCUAAACACAACCUGAGACCGAUAGUGAACAAGUAGUGUGAACGAACGCU
GCAAAGUACCCUCAGAAGGGAGGCGAAAUAGAGCAUGAAAUCAGUUGGCGAUCGAGCGACAGGGCAUACAAGGUCCCUUG
ACGAAUGACCGACGCGCGAGCGUCCAGUAAGACUCACGGGAAGCCGAUGUUCUGUCGUACGUUUUGAAAAACGAGCCAGG
GAGUGUGUCUGCAUGGCAAGUCUAACCGGAGUAUCCGGGGAGGCACAGGGAAACCGACAUGGCCGCAGGGCUUUGCCCGA
GGGCCGCCGUCUUCAAGGGCGGGGAGCCAUGUGGACACGACCCGAAUCCGGACGAUCUACGCAUGGACAAGAUGAAGCGU
GCCGAAAGGCACGUGGAAGUCUGUUAGAGUUGGUGUCCUACAAUACCCUCUCGUGAUCUAUGUGUAGGGGUGAAAGGCCC
AUCGAGUCCGGCAACAGCUGGUUCCAAUCGAAACAUGUCGAAGCAUGACCUCCGCCGAGGUAGUCUGUGAGGUAGAGCGA
CCGAUUGGUGUGUCCGCCUCCGAGAGGAGUCGGCACACCUGUCAAACUCCAAACUUACAGACGCCGUUUGACGCGGGGAU
UCCGGUGCGCGGGGUAAGCCUGUGUACCAGGAGGGGAACAACCCAGAGAUAGGUUAAGGUCCCCAAGUGUGGAUUAAGUG
UAAUCCUCUGAAGGUGGUCUCGAGCCCUAGACAGCCGGGAGGUGAGCUUAGAAGCAGCUACCCUCUAAGAAAAGCGUAAC
AGCUUACCGGCCGAGGUUUGAGGCGCCCAAAAUGAUCGGGACUCAAAUCCACCACCGAGACCUGUCCGUACCACUCAUAC
UGGUAAUCGAGUAGAUUGGCGCUCUAAUUGGAUGGAAGUAGGGGUGAAAACUCCUAUGGACCGAUUAGUGACGAAAAUCC
UGGCCAUAGUAGCAGCGAUAGUCGGGUGAGAACCCCGACGGCCUAAUGGAUAAGGGUUCCUCAGCACUGCUGAUCAGCUG
AGGGUUAGCCGGUCCUAAGUCAUACCGCAACUCGACUAUGACGAAAUGGGAAACGGGUUAAUAUUCCCGUGCCACUAUGC
AGUGAAAGUUGACGCCCUGGGGUCGAUCACGCUGGGCAUUCGCCCAGUCGAACCGUCCAACUCCGUGGAAGCCGUAAUGG
CAGGAAGCGGACGAACGGCGGCAUAGGGAAACGUGAUUCAACCUGGGGCCCAUGAAAAGACGAGCAUAGUGUCCGUACCG
AGAACCGACACAGGUGUCCAUGGCGGCGAAAGCCAAGGCCUGUCGGGAGCAACCAACGUUAGGGAAUUCGGCAAGUUAGU
CCCGUACCUUCGGAAGAAGGGAUGCCUGCUCCGGAACGGAGCAGGUCGCAGUGACUCGGAAGCUCGGACUGUCUAGUAAC
AACAUAGGUGACCGCAAAUCCGCAAGGACUCGUACGGUCACUGAAUCCUGCCCAGUGCAGGUAUCUGAACACCUCGUACA
AGAGGACGAAGGACCUGUCAACGGCGGGGGUAACUAUGACCCUCUUAAGGUAGCGUAGUACCUUGCCGCAUCAGUAGCGG
CUUGCAUGAAUGGAUUAACCAGAGCUUCACUGUCCCAACGUUGGGCCCGGUGAACUGUACAUUCCAGUGCGGAGUCUGGA
GACACCCAGGGGGAAGCGAAGACCCUAUGGAGCUUUACUGCAGGCUGUCGCUGAGACGUGGUCGCCGAUGUGCAGCAUAG
GUAGGAGACACUACACAGGUACCCGCGCUAGCGGGCCACCGAGUCAACAGUGAAAUACUACCCGUCGGUGACUGCGACUC
UCACUCCGGGAGGAGGACACCGAUAGCCGGGCAGUUUGACUGGGGCGGUACGCGCUCGAAAAGAUAUCGAGCGCGCCCUA
UGGCUAUCUCAGCCGGGACAGAGACCCGGCGAAGAGUGCAAGAGCAAAAGAUAGCUUGACAGUGUUCUUCCCAACGAGGA
ACGCUGACGCGAAAGCGUGGUCUAGCGAACCAAUUAGCCUGCUUGAUGCGGGCAAUUGAUGACAGAAAAGCUACCCUAGG
GAUAACAGAGUCGUCACUCGCAAGAGCACAUAUCGACCGAGUGGCUUGCUACCUCGAUGUCGGUUCCCUCCAUCCUGCCC
GUGCAGAAGCGGGCAAGGGUGAGGUUGUUCGCCUAUUAAAGGAGGUCGUGAGCUGGGUUUAGACCGUCGUGAGACAGGUC
GGCUGCUAUCUACUGGGUGUGUAAUGGUGUCUGACAAGAACGACCGUAUAGUACGAGAGGAACUACGGUUGGUGGCCACU
GGUGUACCGGUUGUUCGAGAGAGCACGUGCCGGGUAGCCACGCCACACGGGGUAAGAGCUGAACGCAUCUAAGCUCGAAA
CCCACUUGGAAAAGAGACACCGCCGAGGUCCCGCGUACAAGACGCGGUCGAUAGACUCGGGGUGUGCGCGUCGAGGUAAC
GAGACGUUAAGCCCACGAGCACUAACAGACCAAAGCCAUCAU
;
2597 ? 
2  GB  AF034620   3377779 2  
;UUAGGCGGCCACAGCGGUGGGGUUGCCUCCCGUACCCAUCCCGAACACGGAAGAUAAGCCCACCAGCGUUCCGGGGAGUA
CUGGAGUGCGCGAGCCUCUGGGAAACCCGGUUCGCCGCCACC
;
5658 ? 
3  UNP RL2_HALMA  P20276  3  
;MGRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDE
LQVGVDAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVV
GGGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGGNE

;
0    ? 
4  UNP RL3_HALMA  P20279  4  
;MPQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPM
RAVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKP
DVMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNL
GPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVPFRPAVRPND
QPRLDPEVRYVSNESNQG
;
0    ? 
5  UNP RL4_HALMA  P12735  5  
;MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKLDGRARRV
PQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEAL
DVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESAL
AEVAER
;
1    ? 
6  UNP RL5_HALMA  P14124  6  
;MSSESESGGDFHEMREPRIEKVVVHMGIGHGGRDLANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEM
AEEFLQTALPLAELATSQFDDTGNFSFGVEEHTEFPSQEYDPSIGIYGLDVTVNLVRPGYRVAKRDKASRSIPTKHRLNP
ADAVAFIESTYDVEVSE
;
0    ? 
7  UNP RL6_HALMA  P14135  7  
;MPRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEG
WEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDV
RVFQDGVYITRKPNRGDA
;
0    ? 
8  UNP RL7A_HALMA P12743  8  
;MPVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQ
QDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR
;
0    ? 
9  UNP RLA0_HALMA P15825  9  
;MSAESERKTETIPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGTAELRVSRNTLLERALDDVDDGLED
LNGYITGQVGLIGTDDNPFSLFQELEASKTPAPIGAGEVAPNDIVIPEGDTGVDPGPFVGELQSVGADARIQEGSIQVLS
DSTVLDTGEEVSQELSNVLNELGIEPKEVGLDLRAVFADGVLFEPEELELDIDEYRSDIQAAAGRAFNLSVNADYPTATT
APTMLQSDRGNAKSLALQAAIEDPEVVPDLVSKADAQVRALASQIDDEEALPEELQGVEADVATEEPTDDQDDDTASEDD
ADADDAAEEADDDDDDDEDAGDALGAMF
;
1    ? 
10 UNP RL11_HALMA P14122  11 
;MAGTIEVLVPGGEANPGPPLGPELGPTPVDVQAVVQEINDQTAAFDGTEVPVTVKYDDDGSFEIEVGVPPTAELIKDEAG
FETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIEGENPREFKERIDAGEYDDVFAAEA
QA
;
0    ? 
11 UNP RL13_HALMA P29198  12 
;MSVAEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFK
RTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW
;
1    ? 
12 UNP RL14_HALMA P22450  13 
;MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRHPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPI
RRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV
;
1    ? 
13 UNP RL15_HALMA P12737  14 
;MTSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAAD
DVAEVEDGGFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQAEAEETEDA
DADEE
;
0    ? 
14 UNP RL18_HALMA P14123  16 
;MATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMP
SAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLY
SGDFDAADLPEHFDELRETLLDGDIEL
;
0    ? 
15 UNP R18E_HALMA P12733  17 
;MSKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAV
DFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR
;
0    ? 
16 UNP RL19_HALMA P14119  18 
;MTDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGS
RKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDANHGDA
;
0    ? 
17 UNP RL21_HALMA P12734  19 
;MPSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGG
KEKTIIVTAAHLRRQE
;
0    ? 
18 UNP RL22_HALMA P10970  20 
;MGISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGR
YPEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEPEVED
;
0    ? 
19 UNP RL23_HALMA P12732  21 
;MSWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVAS
RIGVF
;
0    ? 
20 UNP RL24_HALMA P10972  22 
;MSKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTL
EKTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA
;
0    ? 
21 UNP R24E_HALMA P14116  23 PRTRECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTARGEAGEAEDEA 1    ? 
22 UNP RL29_HALMA P10971  24 MTVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGDLQENE 0    ? 
23 UNP RL30_HALMA P14121  25 
;MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVD
DEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR
;
1    ? 
24 UNP RL31_HALMA P18138  26 
;MSASDFEERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEE
EGEAIVEAETAE
;
0    ? 
25 UNP RL32_HALMA P12736  27 
;MADNEEDVEAEEEYTELTDISGVGPSKAESLREAGFESVEDVRGADQSALADVSGIGNALAARIKADVGGLEVESETEAE
VEEEGGEEAPDEDVETELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKG
KGDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEVEVS
E
;
0    ? 
26 UNP RL37_HALMA P32410  29 MTGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE 0    ? 
27 UNP RL39_HALMA P22452  30 MGKKSKATKKRLAKLDNQNSRVPAWVMLKTDREVQRNHKRRHWRRNDTDE 0    ? 
28 UNP RL44_HALMA P32411  31 
;MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLR
EGWRAGRLEFQE
;
1    ? 
29 PDB 1S72       1S72    10 ? ?    ? 
30 PDB 1S72       1S72    15 ? ?    ? 
31 PDB 1S72       1S72    28 ? ?    ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  1S72 0 1 ? 2922 ? 3377779 2597 ? 5518 ? 2  2923 
2  2  1S72 9 1 ? 122  ? 3377779 5658 ? 5779 ? 1  122  
3  3  1S72 A 1 ? 240  ? P20276  0    ? 239  ? 0  239  
4  4  1S72 B 1 ? 338  ? P20279  0    ? 337  ? 0  337  
5  5  1S72 C 1 ? 246  ? P12735  1    ? 246  ? 1  246  
6  6  1S72 D 1 ? 177  ? P14124  0    ? 176  ? 0  176  
7  7  1S72 E 1 ? 178  ? P14135  0    ? 177  ? 0  177  
8  8  1S72 F 1 ? 120  ? P12743  0    ? 119  ? 0  119  
9  9  1S72 G 1 ? 348  ? P15825  1    ? 348  ? 1  348  
10 10 1S72 I 1 ? 162  ? P14122  0    ? 161  ? 5  166  
11 11 1S72 J 1 ? 145  ? P29198  1    ? 145  ? 1  145  
12 12 1S72 K 1 ? 132  ? P22450  1    ? 132  ? 1  132  
13 13 1S72 L 1 ? 165  ? P12737  0    ? 164  ? 0  164  
14 14 1S72 N 1 ? 187  ? P14123  0    ? 186  ? 0  186  
15 15 1S72 O 1 ? 116  ? P12733  0    ? 115  ? 0  115  
16 16 1S72 P 1 ? 149  ? P14119  0    ? 148  ? 0  148  
17 17 1S72 Q 1 ? 96   ? P12734  0    ? 95   ? 0  95   
18 18 1S72 R 1 ? 155  ? P10970  0    ? 154  ? 0  154  
19 19 1S72 S 1 ? 85   ? P12732  0    ? 84   ? 0  84   
20 20 1S72 T 1 ? 120  ? P10972  0    ? 119  ? 0  119  
21 21 1S72 U 1 ? 66   ? P14116  1    ? 66   ? 1  66   
22 22 1S72 V 1 ? 71   ? P10971  0    ? 70   ? 0  70   
23 23 1S72 W 1 ? 154  ? P14121  1    ? 154  ? 1  154  
24 24 1S72 X 1 ? 92   ? P18138  0    ? 91   ? 0  91   
25 25 1S72 Y 1 ? 241  ? P12736  0    ? 240  ? 0  240  
26 26 1S72 1 1 ? 57   ? P32410  0    ? 56   ? 0  56   
27 27 1S72 2 1 ? 50   ? P22452  0    ? 49   ? 0  49   
28 28 1S72 3 1 ? 92   ? P32411  1    ? 92   ? 1  92   
29 29 1S72 H 1 ? 171  ? 1S72    1    ? 171  ? 1  171  
30 30 1S72 M 1 ? 194  ? 1S72    1    ? 194  ? 1  194  
31 31 1S72 Z 1 ? 73   ? 1S72    10   ? 82   ? 10 82   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  1S72 C   0 559  ? GB  3377779 U   3155 CONFLICT           560  1  
1  1S72 1MA 0 627  ? GB  3377779 A   3223 'MODIFIED RESIDUE' 628  2  
1  1S72 OMU 0 2586 ? GB  3377779 U   5182 'MODIFIED RESIDUE' 2587 3  
1  1S72 OMG 0 2587 ? GB  3377779 G   5183 'MODIFIED RESIDUE' 2588 4  
1  1S72 UR3 0 2618 ? GB  3377779 U   5214 'MODIFIED RESIDUE' 2619 5  
1  1S72 PSU 0 2620 ? GB  3377779 U   5216 'MODIFIED RESIDUE' 2621 6  
3  1S72 SER A 86   ? UNP P20276  ASP 85   CONFLICT           85   7  
3  1S72 ALA A 161  ? UNP P20276  GLY 160  CONFLICT           160  8  
4  1S72 ARG B 311  ? UNP P20279  PRO 310  CONFLICT           310  9  
8  1S72 GLU F 104  ? UNP P12743  ALA 103  CONFLICT           103  10 
8  1S72 ASP F 106  ? UNP P12743  ALA 105  CONFLICT           105  11 
8  1S72 ALA F 107  ? UNP P12743  THR 106  CONFLICT           106  12 
8  1S72 ASP F 108  ? UNP P12743  VAL 107  CONFLICT           107  13 
8  1S72 VAL F 109  ? UNP P12743  LEU 108  CONFLICT           108  14 
8  1S72 ASP F 111  ? UNP P12743  GLU 110  CONFLICT           110  15 
12 1S72 LEU K 44   ? UNP P22450  HIS 44   CONFLICT           44   16 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
1MA 'RNA linking'       n "6-HYDRO-1-METHYLADENOSINE-5'-MONOPHOSPHATE" ? 'C11 H16 N5 O7 P' 361.248 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE"                 ? 'C10 H14 N5 O7 P' 347.221 
ALA 'L-peptide linking' y ALANINE                                      ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                     ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                   ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                              ? 'C4 H7 N O4'      133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"                  ? 'C9 H14 N3 O8 P'  323.197 
CD  non-polymer         . 'CADMIUM ION'                                ? 'Cd 2'            112.411 
CL  non-polymer         . 'CHLORIDE ION'                               ? 'Cl -1'           35.453  
CYS 'L-peptide linking' y CYSTEINE                                     ? 'C3 H7 N O2 S'    121.158 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"                 ? 'C10 H14 N5 O8 P' 363.221 
GLN 'L-peptide linking' y GLUTAMINE                                    ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                              ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                      ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                                    ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                        ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                   ? 'C6 H13 N O2'     131.173 
K   non-polymer         . 'POTASSIUM ION'                              ? 'K 1'             39.098  
LEU 'L-peptide linking' y LEUCINE                                      ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                       ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                                   ? 'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'                              ? 'Mg 2'            24.305  
NA  non-polymer         . 'SODIUM ION'                                 ? 'Na 1'            22.990  
OMG 'RNA linking'       n "O2'-METHYLGUANOSINE-5'-MONOPHOSPHATE"       ? 'C11 H16 N5 O8 P' 377.247 
OMU 'RNA linking'       n 
;O2'-METHYLURIDINE 5'-MONOPHOSPHATE
;
? 'C10 H15 N2 O9 P' 338.208 
PHE 'L-peptide linking' y PHENYLALANINE                                ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                      ? 'C5 H9 N O2'      115.130 
PSU 'RNA linking'       n "PSEUDOURIDINE-5'-MONOPHOSPHATE"             ? 'C9 H13 N2 O9 P'  324.181 
SER 'L-peptide linking' y SERINE                                       ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                                    ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                   ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                     ? 'C9 H11 N O3'     181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"                   ? 'C9 H13 N2 O9 P'  324.181 
UR3 'RNA linking'       n "3-METHYLURIDINE-5'-MONOPHOSHATE"            ? 'C10 H15 N2 O9 P' 338.208 
VAL 'L-peptide linking' y VALINE                                       ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1S72 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   2 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   60.19 
_exptl_crystal.description           ? 
_exptl_crystal.density_Matthews      3.09 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            292 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.80 
_exptl_crystal_grow.pdbx_details    'PEG 6000, KCL, NH4Cl, MGCL2, pH 5.80, VAPOR DIFFUSION, SITTING DROP, temperature 292K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1  1 'PEG 6000' ? ? ? 
1 2  1 KCL        ? ? ? 
1 3  1 NH4Cl      ? ? ? 
1 4  1 MGCL2      ? ? ? 
1 5  1 H2O        ? ? ? 
1 6  2 'PEG 6000' ? ? ? 
1 7  2 KCL        ? ? ? 
1 8  2 NH4Cl      ? ? ? 
1 9  2 MGCL2      ? ? ? 
1 10 2 H2O        ? ? ? 
# 
loop_
_diffrn.id 
_diffrn.ambient_temp 
_diffrn.ambient_temp_details 
_diffrn.crystal_id 
1 100 ? 1 
2 100 ? 1 
# 
loop_
_diffrn_detector.diffrn_id 
_diffrn_detector.detector 
_diffrn_detector.type 
_diffrn_detector.pdbx_collection_date 
_diffrn_detector.details 
1 'IMAGE PLATE' MARRESEARCH 2000-02-25 ? 
2 CCD           CUSTOM-MADE 2000-04-01 ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.9 1.0 
2 1.0 1.0 
# 
loop_
_diffrn_source.diffrn_id 
_diffrn_source.source 
_diffrn_source.type 
_diffrn_source.pdbx_synchrotron_site 
_diffrn_source.pdbx_synchrotron_beamline 
_diffrn_source.pdbx_wavelength 
_diffrn_source.pdbx_wavelength_list 
1 SYNCHROTRON 'NSLS BEAMLINE X25'  NSLS X25   0.9 0.9 
2 SYNCHROTRON 'APS BEAMLINE 19-ID' APS  19-ID ?   1.0 
# 
_reflns.entry_id                     1S72 
_reflns.observed_criterion_sigma_I   -3.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             90.000 
_reflns.d_resolution_high            2.400 
_reflns.number_obs                   666819 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         95.6 
_reflns.pdbx_Rmerge_I_obs            0.086 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        26.6000 
_reflns.B_iso_Wilson_estimate        47.70 
_reflns.pdbx_redundancy              9.100 
_reflns.R_free_details               ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.40 
_reflns_shell.d_res_low              2.50 
_reflns_shell.percent_possible_all   73.5 
_reflns_shell.Rmerge_I_obs           0.691 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        6.00 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1S72 
_refine.ls_number_reflns_obs                     629712 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             15.00 
_refine.ls_d_res_high                            2.40 
_refine.ls_percent_reflns_obs                    90.2 
_refine.ls_R_factor_obs                          0.188 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.188 
_refine.ls_R_factor_R_free                       0.222 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  6187 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MIR 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'ENGH & HUBER' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        29364 
_refine_hist.pdbx_number_atoms_nucleic_acid   61621 
_refine_hist.pdbx_number_atoms_ligand         231 
_refine_hist.number_atoms_solvent             7823 
_refine_hist.number_atoms_total               99039 
_refine_hist.d_res_high                       2.40 
_refine_hist.d_res_low                        15.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.005 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.08  ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 15.60 ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 1.37  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1S72 
_struct.title                     
'REFINED CRYSTAL STRUCTURE OF THE HALOARCULA MARISMORTUI LARGE RIBOSOMAL SUBUNIT AT 2.4 ANGSTROM RESOLUTION' 
_struct.pdbx_descriptor           '50S RIBOSOMAL SUBUNIT' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1S72 
_struct_keywords.pdbx_keywords   RIBOSOME 
_struct_keywords.text            'RIBOSOME ASSEMBLY, RNA-RNA, PROTEIN-RNA, PROTEIN-PROTEIN, RIBOSOME' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 3  ? 
D  N N 4  ? 
E  N N 5  ? 
F  N N 6  ? 
G  N N 7  ? 
H  N N 8  ? 
I  N N 9  ? 
J  N N 10 ? 
K  N N 11 ? 
L  N N 12 ? 
M  N N 13 ? 
N  N N 14 ? 
O  N N 15 ? 
P  N N 16 ? 
Q  N N 17 ? 
R  N N 18 ? 
S  N N 19 ? 
T  N N 20 ? 
U  N N 21 ? 
V  N N 22 ? 
W  N N 23 ? 
X  N N 24 ? 
Y  N N 25 ? 
Z  N N 26 ? 
AA N N 27 ? 
BA N N 28 ? 
CA N N 29 ? 
DA N N 30 ? 
EA N N 31 ? 
FA N N 32 ? 
GA N N 32 ? 
HA N N 32 ? 
IA N N 32 ? 
JA N N 32 ? 
KA N N 32 ? 
LA N N 32 ? 
MA N N 32 ? 
NA N N 32 ? 
OA N N 32 ? 
PA N N 32 ? 
QA N N 32 ? 
RA N N 32 ? 
SA N N 32 ? 
TA N N 32 ? 
UA N N 32 ? 
VA N N 32 ? 
WA N N 32 ? 
XA N N 32 ? 
YA N N 32 ? 
ZA N N 32 ? 
AB N N 32 ? 
BB N N 32 ? 
CB N N 32 ? 
DB N N 32 ? 
EB N N 32 ? 
FB N N 32 ? 
GB N N 32 ? 
HB N N 32 ? 
IB N N 32 ? 
JB N N 32 ? 
KB N N 32 ? 
LB N N 32 ? 
MB N N 32 ? 
NB N N 32 ? 
OB N N 32 ? 
PB N N 32 ? 
QB N N 32 ? 
RB N N 32 ? 
SB N N 32 ? 
TB N N 32 ? 
UB N N 32 ? 
VB N N 32 ? 
WB N N 32 ? 
XB N N 32 ? 
YB N N 32 ? 
ZB N N 32 ? 
AC N N 32 ? 
BC N N 32 ? 
CC N N 32 ? 
DC N N 32 ? 
EC N N 32 ? 
FC N N 32 ? 
GC N N 32 ? 
HC N N 32 ? 
IC N N 32 ? 
JC N N 32 ? 
KC N N 32 ? 
LC N N 32 ? 
MC N N 32 ? 
NC N N 32 ? 
OC N N 32 ? 
PC N N 32 ? 
QC N N 32 ? 
RC N N 32 ? 
SC N N 32 ? 
TC N N 32 ? 
UC N N 32 ? 
VC N N 32 ? 
WC N N 32 ? 
XC N N 32 ? 
YC N N 32 ? 
ZC N N 32 ? 
AD N N 32 ? 
BD N N 32 ? 
CD N N 32 ? 
DD N N 32 ? 
ED N N 32 ? 
FD N N 32 ? 
GD N N 32 ? 
HD N N 32 ? 
ID N N 32 ? 
JD N N 32 ? 
KD N N 32 ? 
LD N N 32 ? 
MD N N 32 ? 
ND N N 32 ? 
OD N N 32 ? 
PD N N 32 ? 
QD N N 32 ? 
RD N N 32 ? 
SD N N 32 ? 
TD N N 32 ? 
UD N N 32 ? 
VD N N 32 ? 
WD N N 32 ? 
XD N N 32 ? 
YD N N 32 ? 
ZD N N 32 ? 
AE N N 32 ? 
BE N N 32 ? 
CE N N 32 ? 
DE N N 32 ? 
EE N N 32 ? 
FE N N 32 ? 
GE N N 32 ? 
HE N N 32 ? 
IE N N 32 ? 
JE N N 32 ? 
KE N N 33 ? 
LE N N 33 ? 
ME N N 34 ? 
NE N N 34 ? 
OE N N 34 ? 
PE N N 34 ? 
QE N N 34 ? 
RE N N 34 ? 
SE N N 34 ? 
TE N N 34 ? 
UE N N 34 ? 
VE N N 34 ? 
WE N N 34 ? 
XE N N 34 ? 
YE N N 34 ? 
ZE N N 34 ? 
AF N N 34 ? 
BF N N 34 ? 
CF N N 34 ? 
DF N N 34 ? 
EF N N 34 ? 
FF N N 34 ? 
GF N N 34 ? 
HF N N 34 ? 
IF N N 34 ? 
JF N N 34 ? 
KF N N 34 ? 
LF N N 34 ? 
MF N N 34 ? 
NF N N 34 ? 
OF N N 34 ? 
PF N N 34 ? 
QF N N 34 ? 
RF N N 34 ? 
SF N N 34 ? 
TF N N 34 ? 
UF N N 34 ? 
VF N N 34 ? 
WF N N 34 ? 
XF N N 34 ? 
YF N N 34 ? 
ZF N N 34 ? 
AG N N 34 ? 
BG N N 34 ? 
CG N N 34 ? 
DG N N 34 ? 
EG N N 34 ? 
FG N N 34 ? 
GG N N 34 ? 
HG N N 34 ? 
IG N N 34 ? 
JG N N 34 ? 
KG N N 34 ? 
LG N N 34 ? 
MG N N 34 ? 
NG N N 34 ? 
OG N N 34 ? 
PG N N 34 ? 
QG N N 34 ? 
RG N N 34 ? 
SG N N 34 ? 
TG N N 34 ? 
UG N N 34 ? 
VG N N 34 ? 
WG N N 34 ? 
XG N N 34 ? 
YG N N 34 ? 
ZG N N 34 ? 
AH N N 34 ? 
BH N N 34 ? 
CH N N 34 ? 
DH N N 34 ? 
EH N N 34 ? 
FH N N 34 ? 
GH N N 35 ? 
HH N N 35 ? 
IH N N 35 ? 
JH N N 35 ? 
KH N N 35 ? 
LH N N 35 ? 
MH N N 35 ? 
NH N N 35 ? 
OH N N 35 ? 
PH N N 35 ? 
QH N N 32 ? 
RH N N 34 ? 
SH N N 34 ? 
TH N N 32 ? 
UH N N 34 ? 
VH N N 35 ? 
WH N N 32 ? 
XH N N 35 ? 
YH N N 34 ? 
ZH N N 34 ? 
AI N N 34 ? 
BI N N 34 ? 
CI N N 35 ? 
DI N N 35 ? 
EI N N 35 ? 
FI N N 32 ? 
GI N N 34 ? 
HI N N 35 ? 
II N N 34 ? 
JI N N 35 ? 
KI N N 35 ? 
LI N N 36 ? 
MI N N 35 ? 
NI N N 34 ? 
OI N N 34 ? 
PI N N 34 ? 
QI N N 35 ? 
RI N N 34 ? 
SI N N 32 ? 
TI N N 34 ? 
UI N N 36 ? 
VI N N 32 ? 
WI N N 35 ? 
XI N N 36 ? 
YI N N 36 ? 
ZI N N 32 ? 
AJ N N 36 ? 
BJ N N 35 ? 
CJ N N 37 ? 
DJ N N 37 ? 
EJ N N 37 ? 
FJ N N 37 ? 
GJ N N 37 ? 
HJ N N 37 ? 
IJ N N 37 ? 
JJ N N 37 ? 
KJ N N 37 ? 
LJ N N 37 ? 
MJ N N 37 ? 
NJ N N 37 ? 
OJ N N 37 ? 
PJ N N 37 ? 
QJ N N 37 ? 
RJ N N 37 ? 
SJ N N 37 ? 
TJ N N 37 ? 
UJ N N 37 ? 
VJ N N 37 ? 
WJ N N 37 ? 
XJ N N 37 ? 
YJ N N 37 ? 
ZJ N N 37 ? 
AK N N 37 ? 
BK N N 37 ? 
CK N N 37 ? 
DK N N 37 ? 
EK N N 37 ? 
FK N N 37 ? 
GK N N 37 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   ILE C  5   ? ARG C  12  ? ILE A 4   ARG A 11  1 ? 8  
HELX_P HELX_P2   2   GLY C  13  ? GLY C  13  ? GLY A 12  GLY A 12  5 ? 1  
HELX_P HELX_P3   3   THR C  14  ? ARG C  18  ? THR A 13  ARG A 17  5 ? 5  
HELX_P HELX_P4   4   PRO C  20  ? TYR C  24  ? PRO A 19  TYR A 23  5 ? 5  
HELX_P HELX_P5   5   GLY C  164 ? LYS C  168 ? GLY A 163 LYS A 167 5 ? 5  
HELX_P HELX_P6   6   LYS C  172 ? LYS C  181 ? LYS A 171 LYS A 180 1 ? 10 
HELX_P HELX_P7   7   ARG C  191 ? MET C  195 ? ARG A 190 MET A 194 5 ? 5  
HELX_P HELX_P8   8   ASN C  196 ? HIS C  200 ? ASN A 195 HIS A 199 5 ? 5  
HELX_P HELX_P9   9   GLU D  109 ? THR D  113 ? GLU B 108 THR B 112 5 ? 5  
HELX_P HELX_P10  10  ASP D  121 ? GLY D  136 ? ASP B 120 GLY B 135 1 ? 16 
HELX_P HELX_P11  11  VAL D  148 ? VAL D  152 ? VAL B 147 VAL B 151 5 ? 5  
HELX_P HELX_P12  12  SER D  171 ? GLY D  186 ? SER B 170 GLY B 185 1 ? 16 
HELX_P HELX_P13  13  ALA D  190 ? PHE D  195 ? ALA B 189 PHE B 194 1 ? 6  
HELX_P HELX_P14  14  GLY D  214 ? GLY D  220 ? GLY B 213 GLY B 219 1 ? 7  
HELX_P HELX_P15  15  LYS D  225 ? GLN D  231 ? LYS B 224 GLN B 230 5 ? 7  
HELX_P HELX_P16  16  PRO E  19  ? THR E  24  ? PRO C 19  THR C 24  5 ? 6  
HELX_P HELX_P17  17  ARG E  27  ? ASN E  41  ? ARG C 27  ASN C 41  1 ? 15 
HELX_P HELX_P18  18  ASN E  103 ? THR E  118 ? ASN C 103 THR C 118 1 ? 16 
HELX_P HELX_P19  19  ASP E  120 ? GLY E  128 ? ASP C 120 GLY C 128 1 ? 9  
HELX_P HELX_P20  20  ASP E  142 ? LEU E  147 ? ASP C 142 LEU C 147 5 ? 6  
HELX_P HELX_P21  21  LYS E  149 ? LEU E  160 ? LYS C 149 LEU C 160 1 ? 12 
HELX_P HELX_P22  22  VAL E  162 ? ASP E  170 ? VAL C 162 ASP C 170 1 ? 9  
HELX_P HELX_P23  23  GLY E  177 ? GLY E  183 ? GLY C 177 GLY C 183 5 ? 7  
HELX_P HELX_P24  24  ASN E  219 ? ALA E  224 ? ASN C 219 ALA C 224 1 ? 6  
HELX_P HELX_P25  25  PRO E  225 ? ALA E  228 ? PRO C 225 ALA C 228 5 ? 4  
HELX_P HELX_P26  26  GLU E  237 ? ALA E  244 ? GLU C 237 ALA C 244 1 ? 8  
HELX_P HELX_P27  27  GLU E  245 ? ARG E  246 ? GLU C 245 ARG C 246 5 ? 2  
HELX_P HELX_P28  28  PHE F  11  ? ARG F  15  ? PHE D 10  ARG D 14  5 ? 5  
HELX_P HELX_P29  29  ALA F  38  ? GLY F  47  ? ALA D 37  GLY D 46  1 ? 10 
HELX_P HELX_P30  30  ASP F  78  ? LEU F  89  ? ASP D 77  LEU D 88  1 ? 12 
HELX_P HELX_P31  31  PRO F  90  ? ALA F  92  ? PRO D 89  ALA D 91  5 ? 3  
HELX_P HELX_P32  32  GLY F  139 ? LYS F  144 ? GLY D 138 LYS D 143 5 ? 6  
HELX_P HELX_P33  33  ASN F  159 ? SER F  169 ? ASN D 158 SER D 168 1 ? 11 
HELX_P HELX_P34  34  ASN G  56  ? THR G  78  ? ASN E 55  THR E 77  1 ? 23 
HELX_P HELX_P35  35  ASN G  107 ? GLU G  111 ? ASN E 106 GLU E 110 5 ? 5  
HELX_P HELX_P36  36  ASP G  138 ? LEU G  152 ? ASP E 137 LEU E 151 1 ? 15 
HELX_P HELX_P37  37  PRO H  10  ? GLY H  28  ? PRO F 9   GLY F 27  1 ? 19 
HELX_P HELX_P38  38  GLY H  33  ? GLY H  44  ? GLY F 32  GLY F 43  1 ? 12 
HELX_P HELX_P39  39  PRO H  57  ? VAL H  61  ? PRO F 56  VAL F 60  5 ? 5  
HELX_P HELX_P40  40  HIS H  63  ? GLU H  70  ? HIS F 62  GLU F 69  1 ? 8  
HELX_P HELX_P41  41  GLN H  80  ? ALA H  88  ? GLN F 79  ALA F 87  1 ? 9  
HELX_P HELX_P42  42  ALA H  105 ? LEU H  119 ? ALA F 104 LEU F 118 1 ? 15 
HELX_P HELX_P43  43  PRO I  13  ? SER I  29  ? PRO G 13  SER G 29  1 ? 17 
HELX_P HELX_P44  44  ARG I  63  ? ASP I  72  ? ARG G 63  ASP G 72  1 ? 10 
HELX_P HELX_P45  45  PRO J  2   ? TYR J  6   ? PRO H 2   TYR H 6   5 ? 5  
HELX_P HELX_P46  46  ASP J  39  ? TYR J  43  ? ASP H 39  TYR H 43  5 ? 5  
HELX_P HELX_P47  47  HIS J  59  ? GLY J  78  ? HIS H 59  GLY H 78  1 ? 20 
HELX_P HELX_P48  48  ASP J  142 ? TYR J  154 ? ASP H 142 TYR H 154 1 ? 13 
HELX_P HELX_P49  49  PRO K  70  ? GLY K  80  ? PRO I 74  GLY I 84  1 ? 11 
HELX_P HELX_P50  50  VAL K  98  ? LYS K  108 ? VAL I 102 LYS I 112 1 ? 11 
HELX_P HELX_P51  51  ASP K  116 ? THR K  129 ? ASP I 120 THR I 133 1 ? 14 
HELX_P HELX_P52  52  ILE L  18  ? LEU L  31  ? ILE J 18  LEU J 31  1 ? 14 
HELX_P HELX_P53  53  ASN L  40  ? ARG L  43  ? ASN J 40  ARG J 43  5 ? 4  
HELX_P HELX_P54  54  ARG L  49  ? ILE L  63  ? ARG J 49  ILE J 63  1 ? 15 
HELX_P HELX_P55  55  ARG L  74  ? GLY L  85  ? ARG J 74  GLY J 85  1 ? 12 
HELX_P HELX_P56  56  LYS L  91  ? SER L  100 ? LYS J 91  SER J 100 1 ? 10 
HELX_P HELX_P57  57  ASP L  122 ? ASN L  126 ? ASP J 122 ASN J 126 5 ? 5  
HELX_P HELX_P58  58  LEU L  132 ? GLY L  140 ? LEU J 132 GLY J 140 1 ? 9  
HELX_P HELX_P59  59  GLU M  116 ? ALA M  118 ? GLU K 116 ALA K 118 5 ? 3  
HELX_P HELX_P60  60  PHE M  121 ? SER M  126 ? PHE K 121 SER K 126 1 ? 6  
HELX_P HELX_P61  61  LYS N  4   ? GLN N  8   ? LYS L 3   GLN L 7   5 ? 5  
HELX_P HELX_P62  62  GLY N  24  ? GLY N  29  ? GLY L 23  GLY L 28  5 ? 6  
HELX_P HELX_P63  63  PRO N  55  ? GLN N  59  ? PRO L 54  GLN L 58  5 ? 5  
HELX_P HELX_P64  64  VAL N  67  ? ASN N  73  ? VAL L 66  ASN L 72  1 ? 7  
HELX_P HELX_P65  65  ARG N  95  ? VAL N  97  ? ARG L 94  VAL L 96  5 ? 3  
HELX_P HELX_P66  66  SER N  127 ? ALA N  137 ? SER L 126 ALA L 136 1 ? 11 
HELX_P HELX_P67  67  ALA O  4   ? TRP O  12  ? ALA M 4   TRP M 12  1 ? 9  
HELX_P HELX_P68  68  ASP O  17  ? ARG O  32  ? ASP M 17  ARG M 32  1 ? 16 
HELX_P HELX_P69  69  ARG O  45  ? GLY O  53  ? ARG M 45  GLY M 53  1 ? 9  
HELX_P HELX_P70  70  ARG O  82  ? GLN O  86  ? ARG M 82  GLN M 86  5 ? 5  
HELX_P HELX_P71  71  ASP O  96  ? PHE O  109 ? ASP M 96  PHE M 109 1 ? 14 
HELX_P HELX_P72  72  HIS O  138 ? ASN O  143 ? HIS M 138 ASN M 143 1 ? 6  
HELX_P HELX_P73  73  LEU O  147 ? ALA O  156 ? LEU M 147 ALA M 156 5 ? 10 
HELX_P HELX_P74  74  ASP O  157 ? GLY O  162 ? ASP M 157 GLY M 162 5 ? 6  
HELX_P HELX_P75  75  THR O  164 ? ARG O  171 ? THR M 164 ARG M 171 1 ? 8  
HELX_P HELX_P76  76  MET P  11  ? GLU P  16  ? MET N 10  GLU N 15  1 ? 6  
HELX_P HELX_P77  77  ASP P  20  ? LYS P  29  ? ASP N 19  LYS N 28  1 ? 10 
HELX_P HELX_P78  78  SER P  65  ? GLY P  71  ? SER N 64  GLY N 70  5 ? 7  
HELX_P HELX_P79  79  ASN P  78  ? ALA P  96  ? ASN N 77  ALA N 95  1 ? 19 
HELX_P HELX_P80  80  SER P  114 ? ALA P  126 ? SER N 113 ALA N 125 1 ? 13 
HELX_P HELX_P81  81  ASN P  133 ? LEU P  137 ? ASN N 132 LEU N 136 5 ? 5  
HELX_P HELX_P82  82  ASP P  139 ? GLY P  145 ? ASP N 138 GLY N 144 1 ? 7  
HELX_P HELX_P83  83  GLY P  145 ? GLN P  154 ? GLY N 144 GLN N 153 1 ? 10 
HELX_P HELX_P84  84  PRO P  170 ? ASP P  182 ? PRO N 169 ASP N 181 1 ? 13 
HELX_P HELX_P85  85  ASN Q  5   ? SER Q  22  ? ASN O 4   SER O 21  1 ? 18 
HELX_P HELX_P86  86  ALA Q  25  ? LYS Q  36  ? ALA O 24  LYS O 35  1 ? 12 
HELX_P HELX_P87  87  PRO Q  37  ? HIS Q  41  ? PRO O 36  HIS O 40  5 ? 5  
HELX_P HELX_P88  88  LEU Q  46  ? ALA Q  53  ? LEU O 45  ALA O 52  1 ? 8  
HELX_P HELX_P89  89  SER Q  83  ? GLY Q  94  ? SER O 82  GLY O 93  1 ? 12 
HELX_P HELX_P90  90  LEU Q  99  ? ASN Q  106 ? LEU O 98  ASN O 105 1 ? 8  
HELX_P HELX_P91  91  LEU R  4   ? LEU R  15  ? LEU P 3   LEU P 14  1 ? 12 
HELX_P HELX_P92  92  GLY R  18  ? ASN R  20  ? GLY P 17  ASN P 19  5 ? 3  
HELX_P HELX_P93  93  ARG R  28  ? ALA R  35  ? ARG P 27  ALA P 34  1 ? 8  
HELX_P HELX_P94  94  THR R  37  ? GLU R  47  ? THR P 36  GLU P 46  1 ? 11 
HELX_P HELX_P95  95  ARG R  60  ? TYR R  72  ? ARG P 59  TYR P 71  1 ? 13 
HELX_P HELX_P96  96  GLY R  77  ? ARG R  81  ? GLY P 76  ARG P 80  5 ? 5  
HELX_P HELX_P97  97  LYS R  84  ? GLN R  89  ? LYS P 83  GLN P 88  1 ? 6  
HELX_P HELX_P98  98  ASN R  90  ? GLU R  112 ? ASN P 89  GLU P 111 1 ? 23 
HELX_P HELX_P99  99  SER R  116 ? GLY R  129 ? SER P 115 GLY P 128 1 ? 14 
HELX_P HELX_P100 100 SER R  134 ? ASP R  143 ? SER P 133 ASP P 142 1 ? 10 
HELX_P HELX_P101 101 LYS S  18  ? ARG S  22  ? LYS Q 17  ARG Q 21  5 ? 5  
HELX_P HELX_P102 102 PRO S  26  ? VAL S  31  ? PRO Q 25  VAL Q 30  5 ? 6  
HELX_P HELX_P103 103 HIS S  54  ? ASP S  58  ? HIS Q 53  ASP Q 57  5 ? 5  
HELX_P HELX_P104 104 THR S  88  ? ALA S  90  ? THR Q 87  ALA Q 89  5 ? 3  
HELX_P HELX_P105 105 ASP T  10  ? ASP T  12  ? ASP R 9   ASP R 11  5 ? 3  
HELX_P HELX_P106 106 SER T  25  ? LYS T  37  ? SER R 24  LYS R 36  1 ? 13 
HELX_P HELX_P107 107 THR T  40  ? GLU T  53  ? THR R 39  GLU R 52  1 ? 14 
HELX_P HELX_P108 108 PRO T  82  ? HIS T  102 ? PRO R 81  HIS R 101 1 ? 21 
HELX_P HELX_P109 109 ALA T  130 ? GLY T  132 ? ALA R 129 GLY R 131 5 ? 3  
HELX_P HELX_P110 110 THR U  12  ? ASN U  23  ? THR S 11  ASN S 22  1 ? 12 
HELX_P HELX_P111 111 SER U  34  ? ASP U  47  ? SER S 33  ASP S 46  1 ? 14 
HELX_P HELX_P112 112 ASP U  74  ? ARG U  81  ? ASP S 73  ARG S 80  1 ? 8  
HELX_P HELX_P113 113 GLN V  4   ? ARG V  14  ? GLN T 3   ARG T 13  1 ? 11 
HELX_P HELX_P114 114 PRO V  16  ? GLN V  23  ? PRO T 15  GLN T 22  5 ? 8  
HELX_P HELX_P115 115 SER V  29  ? GLY V  37  ? SER T 28  GLY T 36  1 ? 9  
HELX_P HELX_P116 116 ASP V  93  ? SER V  95  ? ASP T 92  SER T 94  5 ? 3  
HELX_P HELX_P117 117 ASP V  106 ? SER V  115 ? ASP T 105 SER T 114 1 ? 10 
HELX_P HELX_P118 118 SER W  33  ? LEU W  42  ? SER U 33  LEU U 42  1 ? 10 
HELX_P HELX_P119 119 GLU W  45  ? LEU W  49  ? GLU U 45  LEU U 49  5 ? 5  
HELX_P HELX_P120 120 HIS X  5   ? ASP X  11  ? HIS V 4   ASP V 10  1 ? 7  
HELX_P HELX_P121 121 THR X  13  ? ALA X  37  ? THR V 12  ALA V 36  1 ? 25 
HELX_P HELX_P122 122 PRO X  44  ? GLY X  65  ? PRO V 43  GLY V 64  1 ? 22 
HELX_P HELX_P123 123 HIS Y  14  ? LEU Y  24  ? HIS W 14  LEU W 24  1 ? 11 
HELX_P HELX_P124 124 THR Y  38  ? ASN Y  49  ? THR W 38  ASN W 49  1 ? 12 
HELX_P HELX_P125 125 SER Y  58  ? ALA Y  70  ? SER W 58  ALA W 70  1 ? 13 
HELX_P HELX_P126 126 ASP Y  80  ? THR Y  88  ? ASP W 80  THR W 88  1 ? 9  
HELX_P HELX_P127 127 ASP Y  92  ? SER Y  102 ? ASP W 92  SER W 102 1 ? 11 
HELX_P HELX_P128 128 PRO Y  131 ? GLY Y  135 ? PRO W 131 GLY W 135 5 ? 5  
HELX_P HELX_P129 129 ASP Y  142 ? MET Y  153 ? ASP W 142 MET W 153 1 ? 12 
HELX_P HELX_P130 130 ARG Z  16  ? GLU Z  21  ? ARG X 15  GLU X 20  5 ? 6  
HELX_P HELX_P131 131 PRO Z  22  ? HIS Z  24  ? PRO X 21  HIS X 23  5 ? 3  
HELX_P HELX_P132 132 LYS Z  25  ? PHE Z  42  ? LYS X 24  PHE X 41  1 ? 18 
HELX_P HELX_P133 133 ASP Z  45  ? ASP Z  47  ? ASP X 44  ASP X 46  5 ? 3  
HELX_P HELX_P134 134 ASP Z  52  ? TRP Z  60  ? ASP X 51  TRP X 59  1 ? 9  
HELX_P HELX_P135 135 SER AA 111 ? GLY AA 125 ? SER Y 110 GLY Y 124 1 ? 15 
HELX_P HELX_P136 136 GLU AA 166 ? ARG AA 170 ? GLU Y 165 ARG Y 169 5 ? 5  
HELX_P HELX_P137 137 VAL AA 191 ? GLU AA 195 ? VAL Y 190 GLU Y 194 5 ? 5  
HELX_P HELX_P138 138 GLY AA 211 ? ALA AA 225 ? GLY Y 210 ALA Y 224 1 ? 15 
HELX_P HELX_P139 139 ARG BA 1   ? GLY BA 6   ? ARG Z 10  GLY Z 15  5 ? 6  
HELX_P HELX_P140 140 GLY BA 10  ? GLU BA 26  ? GLY Z 19  GLU Z 35  1 ? 17 
HELX_P HELX_P141 141 THR BA 64  ? SER BA 73  ? THR Z 73  SER Z 82  1 ? 10 
HELX_P HELX_P142 142 GLY CA 5   ? GLY CA 10  ? GLY 1 4   GLY 1 9   5 ? 6  
HELX_P HELX_P143 143 TYR CA 49  ? SER CA 53  ? TYR 1 48  SER 1 52  5 ? 5  
HELX_P HELX_P144 144 SER DA 5   ? ASN DA 19  ? SER 2 4   ASN 2 18  1 ? 15 
HELX_P HELX_P145 145 PRO DA 23  ? ASP DA 31  ? PRO 2 22  ASP 2 30  1 ? 9  
HELX_P HELX_P146 146 LYS EA 34  ? SER EA 44  ? LYS 3 34  SER 3 44  1 ? 11 
HELX_P HELX_P147 147 ASP EA 49  ? LYS EA 54  ? ASP 3 49  LYS 3 54  5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1    covale ? ? A  G   626  "O3'" ? ? ? 1_555 A  1MA 627  P     ? ? 0 G   627  0 1MA 628  1_555 ? ? ? ? ? ? ? 1.613 ? 
covale2    covale ? ? A  1MA 627  "O3'" ? ? ? 1_555 A  A   628  P     ? ? 0 1MA 628  0 A   629  1_555 ? ? ? ? ? ? ? 1.610 ? 
covale3    covale ? ? A  U   2585 "O3'" ? ? ? 1_555 A  OMU 2586 P     ? ? 0 U   2586 0 OMU 2587 1_555 ? ? ? ? ? ? ? 1.610 ? 
covale4    covale ? ? A  OMU 2586 "O3'" ? ? ? 1_555 A  OMG 2587 P     ? ? 0 OMU 2587 0 OMG 2588 1_555 ? ? ? ? ? ? ? 1.609 ? 
covale5    covale ? ? A  OMG 2587 "O3'" ? ? ? 1_555 A  U   2588 P     ? ? 0 OMG 2588 0 U   2589 1_555 ? ? ? ? ? ? ? 1.618 ? 
covale6    covale ? ? A  U   2619 "O3'" ? ? ? 1_555 A  PSU 2620 P     ? ? 0 U   2620 0 PSU 2621 1_555 ? ? ? ? ? ? ? 1.600 ? 
covale7    covale ? ? A  PSU 2620 "O3'" ? ? ? 1_555 A  A   2621 P     ? ? 0 PSU 2621 0 A   2622 1_555 ? ? ? ? ? ? ? 1.607 ? 
covale8    covale ? ? A  G   2617 "O3'" ? ? ? 1_555 A  UR3 2618 P     ? ? 0 G   2618 0 UR3 2619 1_555 ? ? ? ? ? ? ? 1.603 ? 
covale9    covale ? ? A  UR3 2618 "O3'" ? ? ? 1_555 A  U   2619 P     ? ? 0 UR3 2619 0 U   2620 1_555 ? ? ? ? ? ? ? 1.593 ? 
metalc1    metalc ? ? FA MG  .    MG    ? ? ? 1_555 A  A   2482 OP2   ? ? 0 MG  8001 0 A   2483 1_555 ? ? ? ? ? ? ? 2.058 ? 
metalc2    metalc ? ? FA MG  .    MG    ? ? ? 1_555 A  C   2532 OP2   ? ? 0 MG  8001 0 C   2533 1_555 ? ? ? ? ? ? ? 2.060 ? 
metalc3    metalc ? ? FA MG  .    MG    ? ? ? 1_555 A  C   2533 OP2   ? ? 0 MG  8001 0 C   2534 1_555 ? ? ? ? ? ? ? 1.903 ? 
metalc4    metalc ? ? FA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8001 0 HOH 8694 1_555 ? ? ? ? ? ? ? 2.070 ? 
metalc5    metalc ? ? GA MG  .    MG    ? ? ? 1_555 A  G   626  O6    ? ? 0 MG  8002 0 G   627  1_555 ? ? ? ? ? ? ? 2.100 ? 
metalc6    metalc ? ? GA MG  .    MG    ? ? ? 1_555 A  A   2482 OP1   ? ? 0 MG  8002 0 A   2483 1_555 ? ? ? ? ? ? ? 1.904 ? 
metalc7    metalc ? ? GA MG  .    MG    ? ? ? 1_555 A  C   2533 OP1   ? ? 0 MG  8002 0 C   2534 1_555 ? ? ? ? ? ? ? 2.164 ? 
metalc8    metalc ? ? HA MG  .    MG    ? ? ? 1_555 EJ HOH .    O     ? ? 0 MG  8003 A HOH 8535 1_555 ? ? ? ? ? ? ? 2.359 ? 
metalc9    metalc ? ? HA MG  .    MG    ? ? ? 1_555 EJ HOH .    O     ? ? 0 MG  8003 A HOH 8512 1_555 ? ? ? ? ? ? ? 2.115 ? 
metalc10   metalc ? ? HA MG  .    MG    ? ? ? 1_555 A  A   875  OP2   ? ? 0 MG  8003 0 A   876  1_555 ? ? ? ? ? ? ? 2.071 ? 
metalc11   metalc ? ? HA MG  .    MG    ? ? ? 1_555 A  G   876  OP2   ? ? 0 MG  8003 0 G   877  1_555 ? ? ? ? ? ? ? 2.122 ? 
metalc12   metalc ? ? HA MG  .    MG    ? ? ? 1_555 A  A   2623 OP1   ? ? 0 MG  8003 0 A   2624 1_555 ? ? ? ? ? ? ? 2.007 ? 
metalc13   metalc ? ? IA MG  .    MG    ? ? ? 1_555 A  G   455  O6    ? ? 0 MG  8004 0 G   456  1_555 ? ? ? ? ? ? ? 2.077 ? 
metalc14   metalc ? ? IA MG  .    MG    ? ? ? 1_555 A  A   458  OP1   ? ? 0 MG  8004 0 A   459  1_555 ? ? ? ? ? ? ? 1.929 ? 
metalc15   metalc ? ? IA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8004 0 HOH 8567 1_555 ? ? ? ? ? ? ? 1.958 ? 
metalc16   metalc ? ? IA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8004 0 HOH 9300 1_555 ? ? ? ? ? ? ? 2.050 ? 
metalc17   metalc ? ? JA MG  .    MG    ? ? ? 1_555 A  U   1837 OP1   ? ? 0 MG  8005 0 U   1838 1_555 ? ? ? ? ? ? ? 1.948 ? 
metalc18   metalc ? ? JA MG  .    MG    ? ? ? 1_555 A  A   1835 OP1   ? ? 0 MG  8005 0 A   1836 1_555 ? ? ? ? ? ? ? 1.998 ? 
metalc19   metalc ? ? JA MG  .    MG    ? ? ? 1_555 A  A   1838 OP2   ? ? 0 MG  8005 0 A   1839 1_555 ? ? ? ? ? ? ? 2.120 ? 
metalc20   metalc ? ? KA MG  .    MG    ? ? ? 1_555 A  U   820  OP2   ? ? 0 MG  8006 0 U   821  1_555 ? ? ? ? ? ? ? 1.999 ? 
metalc21   metalc ? ? KA MG  .    MG    ? ? ? 1_555 A  C   821  OP2   ? ? 0 MG  8006 0 C   822  1_555 ? ? ? ? ? ? ? 1.876 ? 
metalc22   metalc ? ? KA MG  .    MG    ? ? ? 1_555 A  G   853  OP1   ? ? 0 MG  8006 0 G   854  1_555 ? ? ? ? ? ? ? 1.949 ? 
metalc23   metalc ? ? KA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8006 0 HOH 9332 1_555 ? ? ? ? ? ? ? 1.936 ? 
metalc24   metalc ? ? LA MG  .    MG    ? ? ? 1_555 A  U   831  OP2   ? ? 0 MG  8007 0 U   832  1_555 ? ? ? ? ? ? ? 1.995 ? 
metalc25   metalc ? ? LA MG  .    MG    ? ? ? 1_555 A  A   1838 OP1   ? ? 0 MG  8007 0 A   1839 1_555 ? ? ? ? ? ? ? 2.021 ? 
metalc26   metalc ? ? LA MG  .    MG    ? ? ? 1_555 A  A   1839 OP2   ? ? 0 MG  8007 0 A   1840 1_555 ? ? ? ? ? ? ? 2.225 ? 
metalc27   metalc ? ? LA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8007 0 HOH 8528 1_555 ? ? ? ? ? ? ? 2.175 ? 
metalc28   metalc ? ? LA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8007 0 HOH 9879 1_555 ? ? ? ? ? ? ? 2.152 ? 
metalc29   metalc ? ? MA MG  .    MG    ? ? ? 1_555 A  U   918  OP1   ? ? 0 MG  8008 0 U   919  1_555 ? ? ? ? ? ? ? 2.162 ? 
metalc30   metalc ? ? MA MG  .    MG    ? ? ? 1_555 A  C   2463 OP1   ? ? 0 MG  8008 0 C   2464 1_555 ? ? ? ? ? ? ? 2.012 ? 
metalc31   metalc ? ? MA MG  .    MG    ? ? ? 1_555 A  A   2464 OP1   ? ? 0 MG  8008 0 A   2465 1_555 ? ? ? ? ? ? ? 2.195 ? 
metalc32   metalc ? ? NA MG  .    MG    ? ? ? 1_555 A  A   2611 OP1   ? ? 0 MG  8009 0 A   2612 1_555 ? ? ? ? ? ? ? 1.995 ? 
metalc33   metalc ? ? NA MG  .    MG    ? ? ? 1_555 A  G   2610 OP1   ? ? 0 MG  8009 0 G   2611 1_555 ? ? ? ? ? ? ? 1.894 ? 
metalc34   metalc ? ? OA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? 0 MG  8010 B HOH 8526 1_555 ? ? ? ? ? ? ? 2.038 ? 
metalc35   metalc ? ? OA MG  .    MG    ? ? ? 1_555 A  U   2614 OP1   ? ? 0 MG  8010 0 U   2615 1_555 ? ? ? ? ? ? ? 2.073 ? 
metalc36   metalc ? ? OA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8010 0 HOH 8881 1_555 ? ? ? ? ? ? ? 2.212 ? 
metalc37   metalc ? ? OA MG  .    MG    ? ? ? 1_555 A  G   835  OP1   ? ? 0 MG  8010 0 G   836  1_555 ? ? ? ? ? ? ? 1.954 ? 
metalc38   metalc ? ? OA MG  .    MG    ? ? ? 1_555 D  GLN 231  OE1   ? ? 0 MG  8010 B GLN 230  1_555 ? ? ? ? ? ? ? 2.166 ? 
metalc39   metalc ? ? PA MG  .    MG    ? ? ? 1_555 A  G   823  N7    ? ? 0 MG  8011 0 G   824  1_555 ? ? ? ? ? ? ? 2.126 ? 
metalc40   metalc ? ? PA MG  .    MG    ? ? ? 1_555 A  G   853  N7    ? ? 0 MG  8011 0 G   854  1_555 ? ? ? ? ? ? ? 2.219 ? 
metalc41   metalc ? ? QA MG  .    MG    ? ? ? 1_555 A  G   27   OP1   ? ? 0 MG  8012 0 G   28   1_555 ? ? ? ? ? ? ? 2.068 ? 
metalc42   metalc ? ? QA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8012 0 HOH 8559 1_555 ? ? ? ? ? ? ? 2.019 ? 
metalc43   metalc ? ? QA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8012 0 HOH 9156 1_555 ? ? ? ? ? ? ? 2.021 ? 
metalc44   metalc ? ? QA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8012 0 HOH 9747 1_555 ? ? ? ? ? ? ? 2.527 ? 
metalc45   metalc ? ? RA MG  .    MG    ? ? ? 1_555 A  G   2622 OP1   ? ? 0 MG  8013 0 G   2623 1_555 ? ? ? ? ? ? ? 1.978 ? 
metalc46   metalc ? ? RA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8013 0 HOH 8541 1_555 ? ? ? ? ? ? ? 2.182 ? 
metalc47   metalc ? ? RA MG  .    MG    ? ? ? 1_555 EJ HOH .    O     ? ? 0 MG  8013 A HOH 8631 1_555 ? ? ? ? ? ? ? 2.150 ? 
metalc48   metalc ? ? RA MG  .    MG    ? ? ? 1_555 A  G   876  OP1   ? ? 0 MG  8013 0 G   877  1_555 ? ? ? ? ? ? ? 1.947 ? 
metalc49   metalc ? ? SA MG  .    MG    ? ? ? 1_555 A  G   2536 OP2   ? ? 0 MG  8014 0 G   2537 1_555 ? ? ? ? ? ? ? 1.870 ? 
metalc50   metalc ? ? SA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8014 0 HOH 8553 1_555 ? ? ? ? ? ? ? 2.225 ? 
metalc51   metalc ? ? SA MG  .    MG    ? ? ? 1_555 A  G   2101 OP2   ? ? 0 MG  8014 0 G   2102 1_555 ? ? ? ? ? ? ? 2.054 ? 
metalc52   metalc ? ? SA MG  .    MG    ? ? ? 1_555 A  G   2101 "O5'" ? ? 0 MG  8014 0 G   2102 1_555 ? ? ? ? ? ? ? 3.021 ? 
metalc53   metalc ? ? TA MG  .    MG    ? ? ? 1_555 A  A   843  OP1   ? ? 0 MG  8015 0 A   844  1_555 ? ? ? ? ? ? ? 1.927 ? 
metalc54   metalc ? ? TA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8015 0 HOH 8526 1_555 ? ? ? ? ? ? ? 1.934 ? 
metalc55   metalc ? ? TA MG  .    MG    ? ? ? 1_555 A  A   1688 OP1   ? ? 0 MG  8015 0 A   1689 1_555 ? ? ? ? ? ? ? 2.162 ? 
metalc56   metalc ? ? TA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8015 0 HOH 8544 1_555 ? ? ? ? ? ? ? 2.140 ? 
metalc57   metalc ? ? UA MG  .    MG    ? ? ? 1_555 A  A   1503 OP1   ? ? 0 MG  8016 0 A   1504 1_555 ? ? ? ? ? ? ? 2.162 ? 
metalc58   metalc ? ? UA MG  .    MG    ? ? ? 1_555 A  A   1677 OP1   ? ? 0 MG  8016 0 A   1678 1_555 ? ? ? ? ? ? ? 1.964 ? 
metalc59   metalc ? ? UA MG  .    MG    ? ? ? 1_555 A  C   1678 OP2   ? ? 0 MG  8016 0 C   1679 1_555 ? ? ? ? ? ? ? 1.880 ? 
metalc60   metalc ? ? VA MG  .    MG    ? ? ? 1_555 A  G   455  OP2   ? ? 0 MG  8017 0 G   456  1_555 ? ? ? ? ? ? ? 2.075 ? 
metalc61   metalc ? ? VA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8017 0 HOH 8933 1_555 ? ? ? ? ? ? ? 2.087 ? 
metalc62   metalc ? ? VA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8017 C HOH 8356 1_555 ? ? ? ? ? ? ? 2.100 ? 
metalc63   metalc ? ? VA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8017 C HOH 8466 1_555 ? ? ? ? ? ? ? 2.144 ? 
metalc64   metalc ? ? WA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8018 0 HOH 9740 1_555 ? ? ? ? ? ? ? 2.185 ? 
metalc65   metalc ? ? WA MG  .    MG    ? ? ? 1_555 A  A   1290 OP1   ? ? 0 MG  8018 0 A   1291 1_555 ? ? ? ? ? ? ? 2.027 ? 
metalc66   metalc ? ? WA MG  .    MG    ? ? ? 1_555 A  G   1291 OP2   ? ? 0 MG  8018 0 G   1292 1_555 ? ? ? ? ? ? ? 2.032 ? 
metalc67   metalc ? ? XA MG  .    MG    ? ? ? 1_555 A  A   2010 OP1   ? ? 0 MG  8019 0 A   2011 1_555 ? ? ? ? ? ? ? 2.994 ? 
metalc68   metalc ? ? XA MG  .    MG    ? ? ? 1_555 A  A   2010 OP2   ? ? 0 MG  8019 0 A   2011 1_555 ? ? ? ? ? ? ? 2.198 ? 
metalc69   metalc ? ? YA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8020 0 HOH 8641 1_555 ? ? ? ? ? ? ? 2.030 ? 
metalc70   metalc ? ? YA MG  .    MG    ? ? ? 1_555 A  C   1829 OP1   ? ? 0 MG  8020 0 C   1830 1_555 ? ? ? ? ? ? ? 1.976 ? 
metalc71   metalc ? ? YA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8020 0 HOH 8644 1_555 ? ? ? ? ? ? ? 2.111 ? 
metalc72   metalc ? ? YA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8020 0 HOH 8714 1_555 ? ? ? ? ? ? ? 2.105 ? 
metalc73   metalc ? ? ZA MG  .    MG    ? ? ? 1_555 A  G   2303 OP2   ? ? 0 MG  8021 0 G   2304 1_555 ? ? ? ? ? ? ? 2.096 ? 
metalc74   metalc ? ? ZA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8021 0 HOH 9486 1_555 ? ? ? ? ? ? ? 2.355 ? 
metalc75   metalc ? ? AB MG  .    MG    ? ? ? 1_555 A  G   2096 OP2   ? ? 0 MG  8022 0 G   2097 1_555 ? ? ? ? ? ? ? 2.001 ? 
metalc76   metalc ? ? AB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8022 0 HOH 8630 1_555 ? ? ? ? ? ? ? 2.094 ? 
metalc77   metalc ? ? AB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8022 0 HOH 8976 1_555 ? ? ? ? ? ? ? 2.106 ? 
metalc78   metalc ? ? AB MG  .    MG    ? ? ? 1_555 A  G   2539 OP1   ? ? 0 MG  8022 0 G   2540 1_555 ? ? ? ? ? ? ? 2.072 ? 
metalc79   metalc ? ? BB MG  .    MG    ? ? ? 1_555 A  G   2617 OP2   ? ? 0 MG  8023 0 G   2618 1_555 ? ? ? ? ? ? ? 1.988 ? 
metalc80   metalc ? ? BB MG  .    MG    ? ? ? 1_555 A  G   2616 OP2   ? ? 0 MG  8023 0 G   2617 1_555 ? ? ? ? ? ? ? 2.064 ? 
metalc81   metalc ? ? CB MG  .    MG    ? ? ? 1_555 A  A   1380 N7    ? ? 0 MG  8024 0 A   1381 1_555 ? ? ? ? ? ? ? 2.300 ? 
metalc82   metalc ? ? CB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8024 0 HOH 9459 1_555 ? ? ? ? ? ? ? 2.540 ? 
metalc83   metalc ? ? DB MG  .    MG    ? ? ? 1_555 A  G   1120 OP2   ? ? 0 MG  8025 0 G   1121 1_555 ? ? ? ? ? ? ? 2.123 ? 
metalc84   metalc ? ? DB MG  .    MG    ? ? ? 1_555 A  U   1119 OP2   ? ? 0 MG  8025 0 U   1120 1_555 ? ? ? ? ? ? ? 2.246 ? 
metalc85   metalc ? ? EB MG  .    MG    ? ? ? 1_555 A  C   2607 OP1   ? ? 0 MG  8026 0 C   2608 1_555 ? ? ? ? ? ? ? 2.038 ? 
metalc86   metalc ? ? EB MG  .    MG    ? ? ? 1_555 A  U   2609 OP2   ? ? 0 MG  8026 0 U   2610 1_555 ? ? ? ? ? ? ? 1.923 ? 
metalc87   metalc ? ? EB MG  .    MG    ? ? ? 1_555 A  G   2608 OP1   ? ? 0 MG  8026 0 G   2609 1_555 ? ? ? ? ? ? ? 1.959 ? 
metalc88   metalc ? ? EB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8026 0 HOH 8912 1_555 ? ? ? ? ? ? ? 2.308 ? 
metalc89   metalc ? ? FB MG  .    MG    ? ? ? 1_555 A  G   268  O6    ? ? 0 MG  8027 0 G   269  1_555 ? ? ? ? ? ? ? 2.046 ? 
metalc90   metalc ? ? FB MG  .    MG    ? ? ? 1_555 A  C   239  OP1   ? ? 0 MG  8027 0 C   240  1_555 ? ? ? ? ? ? ? 1.975 ? 
metalc91   metalc ? ? GB MG  .    MG    ? ? ? 1_555 WJ HOH .    O     ? ? 0 MG  8028 S HOH 8345 1_555 ? ? ? ? ? ? ? 2.196 ? 
metalc92   metalc ? ? GB MG  .    MG    ? ? ? 1_555 A  A   1447 OP2   ? ? 0 MG  8028 0 A   1448 1_555 ? ? ? ? ? ? ? 2.037 ? 
metalc93   metalc ? ? GB MG  .    MG    ? ? ? 1_555 A  U   1676 O4    ? ? 0 MG  8028 0 U   1677 1_555 ? ? ? ? ? ? ? 2.056 ? 
metalc94   metalc ? ? HB MG  .    MG    ? ? ? 1_555 A  C   1678 OP1   ? ? 0 MG  8029 0 C   1679 1_555 ? ? ? ? ? ? ? 2.042 ? 
metalc95   metalc ? ? HB MG  .    MG    ? ? ? 1_555 A  U   1502 OP1   ? ? 0 MG  8029 0 U   1503 1_555 ? ? ? ? ? ? ? 1.905 ? 
metalc96   metalc ? ? IB MG  .    MG    ? ? ? 1_555 A  U   1747 OP1   ? ? 0 MG  8030 0 U   1748 1_555 ? ? ? ? ? ? ? 2.218 ? 
metalc97   metalc ? ? IB MG  .    MG    ? ? ? 1_555 A  U   1748 OP2   ? ? 0 MG  8030 0 U   1749 1_555 ? ? ? ? ? ? ? 1.941 ? 
metalc98   metalc ? ? JB MG  .    MG    ? ? ? 1_555 A  U   776  OP2   ? ? 0 MG  8031 0 U   777  1_555 ? ? ? ? ? ? ? 1.944 ? 
metalc99   metalc ? ? JB MG  .    MG    ? ? ? 1_555 A  C   777  OP2   ? ? 0 MG  8031 0 C   778  1_555 ? ? ? ? ? ? ? 2.219 ? 
metalc100  metalc ? ? JB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8031 0 HOH 9796 1_555 ? ? ? ? ? ? ? 2.114 ? 
metalc101  metalc ? ? KB MG  .    MG    ? ? ? 1_555 A  U   2114 OP1   ? ? 0 MG  8032 0 U   2115 1_555 ? ? ? ? ? ? ? 1.923 ? 
metalc102  metalc ? ? KB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8032 0 HOH 9512 1_555 ? ? ? ? ? ? ? 2.092 ? 
metalc103  metalc ? ? KB MG  .    MG    ? ? ? 1_555 EJ HOH .    O     ? ? 0 MG  8032 A HOH 8632 1_555 ? ? ? ? ? ? ? 2.128 ? 
metalc104  metalc ? ? KB MG  .    MG    ? ? ? 1_555 EJ HOH .    O     ? ? 0 MG  8032 A HOH 8551 1_555 ? ? ? ? ? ? ? 2.256 ? 
metalc105  metalc ? ? LB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8033 0 HOH 9198 1_555 ? ? ? ? ? ? ? 2.248 ? 
metalc106  metalc ? ? LB MG  .    MG    ? ? ? 1_555 A  A   1746 OP2   ? ? 0 MG  8033 0 A   1747 1_555 ? ? ? ? ? ? ? 2.057 ? 
metalc107  metalc ? ? LB MG  .    MG    ? ? ? 1_555 A  U   1747 OP2   ? ? 0 MG  8033 0 U   1748 1_555 ? ? ? ? ? ? ? 2.021 ? 
metalc108  metalc ? ? LB MG  .    MG    ? ? ? 1_555 A  U   1748 O4    ? ? 0 MG  8033 0 U   1749 1_555 ? ? ? ? ? ? ? 2.146 ? 
metalc109  metalc ? ? LB MG  .    MG    ? ? ? 1_555 A  G   2584 OP1   ? ? 0 MG  8033 0 G   2585 1_555 ? ? ? ? ? ? ? 2.152 ? 
metalc110  metalc ? ? MB MG  .    MG    ? ? ? 1_555 A  A   2302 OP1   ? ? 0 MG  8034 0 A   2303 1_555 ? ? ? ? ? ? ? 2.022 ? 
metalc111  metalc ? ? MB MG  .    MG    ? ? ? 1_555 A  A   2301 OP1   ? ? 0 MG  8034 0 A   2302 1_555 ? ? ? ? ? ? ? 1.960 ? 
metalc112  metalc ? ? NB MG  .    MG    ? ? ? 1_555 A  G   1483 OP2   ? ? 0 MG  8035 0 G   1484 1_555 ? ? ? ? ? ? ? 2.052 ? 
metalc113  metalc ? ? OB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8036 0 HOH 8886 1_555 ? ? ? ? ? ? ? 2.094 ? 
metalc114  metalc ? ? OB MG  .    MG    ? ? ? 1_555 A  G   955  OP2   ? ? 0 MG  8036 0 G   956  1_555 ? ? ? ? ? ? ? 2.014 ? 
metalc115  metalc ? ? PB MG  .    MG    ? ? ? 1_555 A  A   2552 OP2   ? ? 0 MG  8037 0 A   2553 1_555 ? ? ? ? ? ? ? 2.168 ? 
metalc116  metalc ? ? PB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8037 0 HOH 9655 1_555 ? ? ? ? ? ? ? 2.083 ? 
metalc117  metalc ? ? PB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8037 0 HOH 9730 1_555 ? ? ? ? ? ? ? 2.177 ? 
metalc118  metalc ? ? PB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8037 0 HOH 8598 1_555 ? ? ? ? ? ? ? 2.452 ? 
metalc119  metalc ? ? QB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8038 0 HOH 8802 1_555 ? ? ? ? ? ? ? 2.061 ? 
metalc120  metalc ? ? RB MG  .    MG    ? ? ? 1_555 A  U   114  OP2   ? ? 0 MG  8039 0 U   115  1_555 ? ? ? ? ? ? ? 1.968 ? 
metalc121  metalc ? ? RB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8039 0 HOH 9431 1_555 ? ? ? ? ? ? ? 2.270 ? 
metalc122  metalc ? ? SB MG  .    MG    ? ? ? 1_555 A  U   391  OP2   ? ? 0 MG  8040 0 U   392  1_555 ? ? ? ? ? ? ? 2.220 ? 
metalc123  metalc ? ? SB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8040 0 HOH 9213 1_555 ? ? ? ? ? ? ? 2.317 ? 
metalc124  metalc ? ? TB MG  .    MG    ? ? ? 1_555 A  G   195  OP1   ? ? 0 MG  8041 0 G   196  1_555 ? ? ? ? ? ? ? 2.366 ? 
metalc125  metalc ? ? TB MG  .    MG    ? ? ? 1_555 A  A   226  "O2'" ? ? 0 MG  8041 0 A   227  1_555 ? ? ? ? ? ? ? 2.524 ? 
metalc126  metalc ? ? TB MG  .    MG    ? ? ? 1_555 A  C   227  "O4'" ? ? 0 MG  8041 0 C   228  1_555 ? ? ? ? ? ? ? 2.560 ? 
metalc127  metalc ? ? UB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8042 0 HOH 8955 1_555 ? ? ? ? ? ? ? 2.695 ? 
metalc128  metalc ? ? UB MG  .    MG    ? ? ? 1_555 A  U   1345 O2    ? ? 0 MG  8042 0 U   1346 1_555 ? ? ? ? ? ? ? 2.478 ? 
metalc129  metalc ? ? UB MG  .    MG    ? ? ? 1_555 A  U   1308 O2    ? ? 0 MG  8042 0 U   1309 1_555 ? ? ? ? ? ? ? 2.414 ? 
metalc130  metalc ? ? VB MG  .    MG    ? ? ? 1_555 A  G   816  O6    ? ? 0 MG  8043 0 G   817  1_555 ? ? ? ? ? ? ? 2.539 ? 
metalc131  metalc ? ? VB MG  .    MG    ? ? ? 1_555 A  G   815  O6    ? ? 0 MG  8043 0 G   816  1_555 ? ? ? ? ? ? ? 2.279 ? 
metalc132  metalc ? ? VB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8043 0 HOH 9336 1_555 ? ? ? ? ? ? ? 2.288 ? 
metalc133  metalc ? ? WB MG  .    MG    ? ? ? 1_555 VJ HOH .    O     ? ? 0 MG  8044 R HOH 8589 1_555 ? ? ? ? ? ? ? 2.378 ? 
metalc134  metalc ? ? WB MG  .    MG    ? ? ? 1_555 A  A   2088 OP1   ? ? 0 MG  8044 0 A   2089 1_555 ? ? ? ? ? ? ? 2.447 ? 
metalc135  metalc ? ? WB MG  .    MG    ? ? ? 1_555 T  GLY 66   O     ? ? 0 MG  8044 R GLY 65   1_555 ? ? ? ? ? ? ? 2.362 ? 
metalc136  metalc ? ? WB MG  .    MG    ? ? ? 1_555 A  C   2047 OP1   ? ? 0 MG  8044 0 C   2048 1_555 ? ? ? ? ? ? ? 2.388 ? 
metalc137  metalc ? ? WB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8044 0 HOH 9816 1_555 ? ? ? ? ? ? ? 2.513 ? 
metalc138  metalc ? ? XB MG  .    MG    ? ? ? 1_555 A  G   1978 OP2   ? ? 0 MG  8045 0 G   1979 1_555 ? ? ? ? ? ? ? 1.984 ? 
metalc139  metalc ? ? YB MG  .    MG    ? ? ? 1_555 A  G   1793 N7    ? ? 0 MG  8046 0 G   1794 1_555 ? ? ? ? ? ? ? 2.634 ? 
metalc140  metalc ? ? ZB MG  .    MG    ? ? ? 1_555 A  A   1097 OP2   ? ? 0 MG  8047 0 A   1098 1_555 ? ? ? ? ? ? ? 1.933 ? 
metalc141  metalc ? ? ZB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8047 0 HOH 9649 1_555 ? ? ? ? ? ? ? 2.490 ? 
metalc142  metalc ? ? AC MG  .    MG    ? ? ? 1_555 A  A   2745 OP2   ? ? 0 MG  8048 0 A   2746 1_555 ? ? ? ? ? ? ? 2.372 ? 
metalc143  metalc ? ? AC MG  .    MG    ? ? ? 1_555 A  G   2749 OP2   ? ? 0 MG  8048 0 G   2750 1_555 ? ? ? ? ? ? ? 2.087 ? 
metalc144  metalc ? ? BC MG  .    MG    ? ? ? 1_555 A  G   2420 OP1   ? ? 0 MG  8049 0 G   2421 1_555 ? ? ? ? ? ? ? 2.258 ? 
metalc145  metalc ? ? BC MG  .    MG    ? ? ? 1_555 A  U   2421 "O3'" ? ? 0 MG  8049 0 U   2422 1_555 ? ? ? ? ? ? ? 2.968 ? 
metalc146  metalc ? ? BC MG  .    MG    ? ? ? 1_555 A  C   2422 OP1   ? ? 0 MG  8049 0 C   2423 1_555 ? ? ? ? ? ? ? 2.544 ? 
metalc147  metalc ? ? CC MG  .    MG    ? ? ? 1_555 A  C   2247 OP2   ? ? 0 MG  8050 0 C   2248 1_555 ? ? ? ? ? ? ? 2.316 ? 
metalc148  metalc ? ? DC MG  .    MG    ? ? ? 1_555 A  G   640  OP2   ? ? 0 MG  8051 0 G   641  1_555 ? ? ? ? ? ? ? 2.043 ? 
metalc149  metalc ? ? EC MG  .    MG    ? ? ? 1_555 A  U   1124 OP1   ? ? 0 MG  8052 0 U   1125 1_555 ? ? ? ? ? ? ? 2.187 ? 
metalc150  metalc ? ? EC MG  .    MG    ? ? ? 1_555 B  G   92   OP1   ? ? 0 MG  8052 9 G   92   1_555 ? ? ? ? ? ? ? 2.728 ? 
metalc151  metalc ? ? EC MG  .    MG    ? ? ? 1_555 DJ HOH .    O     ? ? 0 MG  8052 9 HOH 8389 1_555 ? ? ? ? ? ? ? 2.514 ? 
metalc152  metalc ? ? EC MG  .    MG    ? ? ? 1_555 DJ HOH .    O     ? ? 0 MG  8052 9 HOH 8415 1_555 ? ? ? ? ? ? ? 2.175 ? 
metalc153  metalc ? ? FC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8053 0 HOH 9561 1_555 ? ? ? ? ? ? ? 2.470 ? 
metalc154  metalc ? ? FC MG  .    MG    ? ? ? 1_555 A  G   470  O6    ? ? 0 MG  8053 0 G   471  1_555 ? ? ? ? ? ? ? 2.209 ? 
metalc155  metalc ? ? FC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8053 0 HOH 8722 1_555 ? ? ? ? ? ? ? 2.478 ? 
metalc156  metalc ? ? FC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8053 0 HOH 8761 1_555 ? ? ? ? ? ? ? 2.261 ? 
metalc157  metalc ? ? GC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8054 0 HOH 8951 1_555 ? ? ? ? ? ? ? 2.152 ? 
metalc158  metalc ? ? GC MG  .    MG    ? ? ? 1_555 A  C   161  OP1   ? ? 0 MG  8054 0 C   162  1_555 ? ? ? ? ? ? ? 2.025 ? 
metalc159  metalc ? ? GC MG  .    MG    ? ? ? 1_555 A  U   2275 OP1   ? ? 0 MG  8054 0 U   2276 1_555 ? ? ? ? ? ? ? 1.988 ? 
metalc160  metalc ? ? HC MG  .    MG    ? ? ? 1_555 A  A   2756 OP1   ? ? 0 MG  8056 0 A   2757 1_555 ? ? ? ? ? ? ? 2.031 ? 
metalc161  metalc ? ? HC MG  .    MG    ? ? ? 1_555 D  ASN 336  O     ? ? 0 MG  8056 B ASN 335  1_555 ? ? ? ? ? ? ? 2.097 ? 
metalc162  metalc ? ? HC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? 0 MG  8056 B HOH 8543 1_555 ? ? ? ? ? ? ? 2.098 ? 
metalc163  metalc ? ? IC MG  .    MG    ? ? ? 1_555 A  U   1882 OP1   ? ? 0 MG  8057 0 U   1883 1_555 ? ? ? ? ? ? ? 2.493 ? 
metalc164  metalc ? ? IC MG  .    MG    ? ? ? 1_555 C  GLN 208  O     ? ? 0 MG  8057 A GLN 207  1_555 ? ? ? ? ? ? ? 2.724 ? 
metalc165  metalc ? ? IC MG  .    MG    ? ? ? 1_555 A  U   2011 "O2'" ? ? 0 MG  8057 0 U   2012 1_555 ? ? ? ? ? ? ? 2.313 ? 
metalc166  metalc ? ? IC MG  .    MG    ? ? ? 1_555 A  G   2012 OP2   ? ? 0 MG  8057 0 G   2013 1_555 ? ? ? ? ? ? ? 3.090 ? 
metalc167  metalc ? ? IC MG  .    MG    ? ? ? 1_555 EJ HOH .    O     ? ? 0 MG  8057 A HOH 8635 1_555 ? ? ? ? ? ? ? 2.612 ? 
metalc168  metalc ? ? IC MG  .    MG    ? ? ? 1_555 A  U   2011 "O3'" ? ? 0 MG  8057 0 U   2012 1_555 ? ? ? ? ? ? ? 3.032 ? 
metalc169  metalc ? ? JC MG  .    MG    ? ? ? 1_555 A  G   2012 OP2   ? ? 0 MG  8058 0 G   2013 1_555 ? ? ? ? ? ? ? 2.215 ? 
metalc170  metalc ? ? JC MG  .    MG    ? ? ? 1_555 EJ HOH .    O     ? ? 0 MG  8058 A HOH 8633 1_555 ? ? ? ? ? ? ? 2.031 ? 
metalc171  metalc ? ? JC MG  .    MG    ? ? ? 1_555 EJ HOH .    O     ? ? 0 MG  8058 A HOH 8635 1_555 ? ? ? ? ? ? ? 2.130 ? 
metalc172  metalc ? ? KC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8059 0 HOH 8562 1_555 ? ? ? ? ? ? ? 2.310 ? 
metalc173  metalc ? ? KC MG  .    MG    ? ? ? 1_555 A  G   2617 OP1   ? ? 0 MG  8059 0 G   2618 1_555 ? ? ? ? ? ? ? 2.153 ? 
metalc174  metalc ? ? KC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8059 0 HOH 8558 1_555 ? ? ? ? ? ? ? 2.411 ? 
metalc175  metalc ? ? LC MG  .    MG    ? ? ? 1_555 A  G   174  OP2   ? ? 0 MG  8060 0 G   175  1_555 ? ? ? ? ? ? ? 2.190 ? 
metalc176  metalc ? ? LC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8060 0 HOH 8687 1_555 ? ? ? ? ? ? ? 1.995 ? 
metalc177  metalc ? ? MC MG  .    MG    ? ? ? 1_555 A  A   1368 OP2   ? ? 0 MG  8061 0 A   1369 1_555 ? ? ? ? ? ? ? 2.184 ? 
metalc178  metalc ? ? MC MG  .    MG    ? ? ? 1_555 A  U   2649 OP1   ? ? 0 MG  8061 0 U   2650 1_555 ? ? ? ? ? ? ? 2.018 ? 
metalc179  metalc ? ? MC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8061 0 HOH 9341 1_555 ? ? ? ? ? ? ? 2.248 ? 
metalc180  metalc ? ? NC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8062 0 HOH 8915 1_555 ? ? ? ? ? ? ? 2.231 ? 
metalc181  metalc ? ? NC MG  .    MG    ? ? ? 1_555 A  G   1488 OP2   ? ? 0 MG  8062 0 G   1489 1_555 ? ? ? ? ? ? ? 2.459 ? 
metalc182  metalc ? ? NC MG  .    MG    ? ? ? 1_555 A  G   1490 O6    ? ? 0 MG  8062 0 G   1491 1_555 ? ? ? ? ? ? ? 2.023 ? 
metalc183  metalc ? ? PC MG  .    MG    ? ? ? 1_555 A  U   2276 O4    ? ? 0 MG  8064 0 U   2277 1_555 ? ? ? ? ? ? ? 2.709 ? 
metalc184  metalc ? ? PC MG  .    MG    ? ? ? 1_555 A  U   2277 O4    ? ? 0 MG  8064 0 U   2278 1_555 ? ? ? ? ? ? ? 2.688 ? 
metalc185  metalc ? ? PC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8064 0 HOH 9109 1_555 ? ? ? ? ? ? ? 2.726 ? 
metalc186  metalc ? ? PC MG  .    MG    ? ? ? 1_555 A  G   2470 O6    ? ? 0 MG  8064 0 G   2471 1_555 ? ? ? ? ? ? ? 2.712 ? 
metalc187  metalc ? ? QC MG  .    MG    ? ? ? 1_555 C  ASP 27   OD1   ? ? 0 MG  8066 A ASP 26   1_555 ? ? ? ? ? ? ? 2.936 ? 
metalc188  metalc ? ? QC MG  .    MG    ? ? ? 1_555 C  ASP 27   OD2   ? ? 0 MG  8066 A ASP 26   1_555 ? ? ? ? ? ? ? 2.402 ? 
metalc189  metalc ? ? QC MG  .    MG    ? ? ? 1_555 A  C   1871 "O4'" ? ? 0 MG  8066 0 C   1872 1_555 ? ? ? ? ? ? ? 2.997 ? 
metalc190  metalc ? ? QC MG  .    MG    ? ? ? 1_555 A  C   1871 "O3'" ? ? 0 MG  8066 0 C   1872 1_555 ? ? ? ? ? ? ? 2.068 ? 
metalc191  metalc ? ? QC MG  .    MG    ? ? ? 1_555 A  G   1872 OP2   ? ? 0 MG  8066 0 G   1873 1_555 ? ? ? ? ? ? ? 1.935 ? 
metalc192  metalc ? ? RC MG  .    MG    ? ? ? 1_555 A  A   1844 OP1   ? ? 0 MG  8067 0 A   1845 1_555 ? ? ? ? ? ? ? 2.303 ? 
metalc193  metalc ? ? RC MG  .    MG    ? ? ? 1_555 A  G   1883 O6    ? ? 0 MG  8067 0 G   1884 1_555 ? ? ? ? ? ? ? 2.313 ? 
metalc194  metalc ? ? RC MG  .    MG    ? ? ? 1_555 A  U   1845 OP2   ? ? 0 MG  8067 0 U   1846 1_555 ? ? ? ? ? ? ? 2.415 ? 
metalc195  metalc ? ? RC MG  .    MG    ? ? ? 1_555 C  ASN 189  O     ? ? 0 MG  8067 A ASN 188  1_555 ? ? ? ? ? ? ? 2.385 ? 
metalc196  metalc ? ? SC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8068 0 HOH 9257 1_555 ? ? ? ? ? ? ? 2.199 ? 
metalc197  metalc ? ? SC MG  .    MG    ? ? ? 1_555 A  A   2567 OP2   ? ? 0 MG  8068 0 A   2568 1_555 ? ? ? ? ? ? ? 2.189 ? 
metalc198  metalc ? ? TC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8070 0 HOH 8642 1_555 ? ? ? ? ? ? ? 2.520 ? 
metalc199  metalc ? ? TC MG  .    MG    ? ? ? 1_555 A  A   165  OP1   ? ? 0 MG  8070 0 A   166  1_555 ? ? ? ? ? ? ? 2.063 ? 
metalc200  metalc ? ? TC MG  .    MG    ? ? ? 1_555 A  G   218  O6    ? ? 0 MG  8070 0 G   219  1_555 ? ? ? ? ? ? ? 2.520 ? 
metalc201  metalc ? ? VC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8072 0 HOH 9752 1_555 ? ? ? ? ? ? ? 1.933 ? 
metalc202  metalc ? ? VC MG  .    MG    ? ? ? 1_555 A  U   953  OP1   ? ? 0 MG  8072 0 U   954  1_555 ? ? ? ? ? ? ? 2.262 ? 
metalc203  metalc ? ? WC MG  .    MG    ? ? ? 1_555 A  A   1286 OP1   ? ? 0 MG  8074 0 A   1287 1_555 ? ? ? ? ? ? ? 2.188 ? 
metalc204  metalc ? ? WC MG  .    MG    ? ? ? 1_555 A  A   1285 OP1   ? ? 0 MG  8074 0 A   1286 1_555 ? ? ? ? ? ? ? 1.898 ? 
metalc205  metalc ? ? XC MG  .    MG    ? ? ? 1_555 A  A   906  "O2'" ? ? 0 MG  8075 0 A   907  1_555 ? ? ? ? ? ? ? 2.709 ? 
metalc206  metalc ? ? XC MG  .    MG    ? ? ? 1_555 A  A   907  "O4'" ? ? 0 MG  8075 0 A   908  1_555 ? ? ? ? ? ? ? 2.602 ? 
metalc207  metalc ? ? YC MG  .    MG    ? ? ? 1_555 FK HOH .    O     ? ? 0 MG  8076 2 HOH 7875 1_555 ? ? ? ? ? ? ? 2.457 ? 
metalc208  metalc ? ? ZC MG  .    MG    ? ? ? 1_555 A  C   879  OP1   ? ? 0 MG  8077 0 C   880  1_555 ? ? ? ? ? ? ? 2.043 ? 
metalc209  metalc ? ? ZC MG  .    MG    ? ? ? 1_555 A  U   882  OP2   ? ? 0 MG  8077 0 U   883  1_555 ? ? ? ? ? ? ? 2.028 ? 
metalc210  metalc ? ? ZC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8077 0 HOH 8760 1_555 ? ? ? ? ? ? ? 2.150 ? 
metalc211  metalc ? ? AD MG  .    MG    ? ? ? 1_555 A  A   166  OP1   ? ? 0 MG  8079 0 A   167  1_555 ? ? ? ? ? ? ? 1.804 ? 
metalc212  metalc ? ? AD MG  .    MG    ? ? ? 1_555 A  C   167  OP2   ? ? 0 MG  8079 0 C   168  1_555 ? ? ? ? ? ? ? 2.071 ? 
metalc213  metalc ? ? AD MG  .    MG    ? ? ? 1_555 A  A   164  N7    ? ? 0 MG  8079 0 A   165  1_555 ? ? ? ? ? ? ? 2.173 ? 
metalc214  metalc ? ? BD MG  .    MG    ? ? ? 1_555 A  U   1723 OP2   ? ? 0 MG  8080 0 U   1724 1_555 ? ? ? ? ? ? ? 2.153 ? 
metalc215  metalc ? ? BD MG  .    MG    ? ? ? 1_555 A  A   1683 OP2   ? ? 0 MG  8080 0 A   1684 1_555 ? ? ? ? ? ? ? 2.065 ? 
metalc216  metalc ? ? CD MG  .    MG    ? ? ? 1_555 A  C   1420 OP2   ? ? 0 MG  8081 0 C   1421 1_555 ? ? ? ? ? ? ? 2.092 ? 
metalc217  metalc ? ? CD MG  .    MG    ? ? ? 1_555 A  G   1437 OP1   ? ? 0 MG  8081 0 G   1438 1_555 ? ? ? ? ? ? ? 2.138 ? 
metalc218  metalc ? ? CD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8081 0 HOH 9131 1_555 ? ? ? ? ? ? ? 2.796 ? 
metalc219  metalc ? ? CD MG  .    MG    ? ? ? 1_555 A  C   1419 OP1   ? ? 0 MG  8081 0 C   1420 1_555 ? ? ? ? ? ? ? 2.223 ? 
metalc220  metalc ? ? DD MG  .    MG    ? ? ? 1_555 A  A   1436 OP2   ? ? 0 MG  8082 0 A   1437 1_555 ? ? ? ? ? ? ? 3.002 ? 
metalc221  metalc ? ? DD MG  .    MG    ? ? ? 1_555 TJ HOH .    O     ? ? 0 MG  8082 P HOH 213  1_555 ? ? ? ? ? ? ? 2.788 ? 
metalc222  metalc ? ? ED MG  .    MG    ? ? ? 1_555 A  A   1753 OP2   ? ? 0 MG  8083 0 A   1754 1_555 ? ? ? ? ? ? ? 2.215 ? 
metalc223  metalc ? ? FD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8084 0 HOH 9274 1_555 ? ? ? ? ? ? ? 2.092 ? 
metalc224  metalc ? ? FD MG  .    MG    ? ? ? 1_555 A  A   1741 OP2   ? ? 0 MG  8084 0 A   1742 1_555 ? ? ? ? ? ? ? 1.921 ? 
metalc225  metalc ? ? FD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8084 0 HOH 8769 1_555 ? ? ? ? ? ? ? 2.224 ? 
metalc226  metalc ? ? FD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8084 0 HOH 8893 1_555 ? ? ? ? ? ? ? 2.111 ? 
metalc227  metalc ? ? GD MG  .    MG    ? ? ? 1_555 A  G   2617 OP1   ? ? 0 MG  8085 0 G   2618 1_555 ? ? ? ? ? ? ? 2.466 ? 
metalc228  metalc ? ? GD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8085 0 HOH 8558 1_555 ? ? ? ? ? ? ? 2.556 ? 
metalc229  metalc ? ? GD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8085 0 HOH 9121 1_555 ? ? ? ? ? ? ? 2.502 ? 
metalc230  metalc ? ? GD MG  .    MG    ? ? ? 1_555 A  G   2616 "O3'" ? ? 0 MG  8085 0 G   2617 1_555 ? ? ? ? ? ? ? 3.107 ? 
metalc231  metalc ? ? HD MG  .    MG    ? ? ? 1_555 A  U   532  OP1   ? ? 0 MG  8086 0 U   533  1_555 ? ? ? ? ? ? ? 2.085 ? 
metalc232  metalc ? ? HD MG  .    MG    ? ? ? 1_555 A  A   531  OP1   ? ? 0 MG  8086 0 A   532  1_555 ? ? ? ? ? ? ? 2.382 ? 
metalc233  metalc ? ? ID MG  .    MG    ? ? ? 1_555 A  G   682  OP2   ? ? 0 MG  8087 0 G   683  1_555 ? ? ? ? ? ? ? 2.060 ? 
metalc234  metalc ? ? ID MG  .    MG    ? ? ? 1_555 A  A   681  OP2   ? ? 0 MG  8087 0 A   682  1_555 ? ? ? ? ? ? ? 2.075 ? 
metalc235  metalc ? ? JD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8088 0 HOH 8584 1_555 ? ? ? ? ? ? ? 2.344 ? 
metalc236  metalc ? ? JD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8088 0 HOH 8816 1_555 ? ? ? ? ? ? ? 2.349 ? 
metalc237  metalc ? ? JD MG  .    MG    ? ? ? 1_555 A  G   2539 O6    ? ? 0 MG  8088 0 G   2540 1_555 ? ? ? ? ? ? ? 2.688 ? 
metalc238  metalc ? ? JD MG  .    MG    ? ? ? 1_555 A  G   2610 "O2'" ? ? 0 MG  8088 0 G   2611 1_555 ? ? ? ? ? ? ? 2.478 ? 
metalc239  metalc ? ? JD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8088 0 HOH 9565 1_555 ? ? ? ? ? ? ? 2.572 ? 
metalc240  metalc ? ? KD MG  .    MG    ? ? ? 1_555 A  U   516  OP2   ? ? 0 MG  8089 0 U   517  1_555 ? ? ? ? ? ? ? 2.162 ? 
metalc241  metalc ? ? KD MG  .    MG    ? ? ? 1_555 A  G   517  N7    ? ? 0 MG  8089 0 G   518  1_555 ? ? ? ? ? ? ? 2.617 ? 
metalc242  metalc ? ? KD MG  .    MG    ? ? ? 1_555 A  A   515  OP1   ? ? 0 MG  8089 0 A   516  1_555 ? ? ? ? ? ? ? 2.044 ? 
metalc243  metalc ? ? LD MG  .    MG    ? ? ? 1_555 A  A   2102 OP2   ? ? 0 MG  8090 0 A   2103 1_555 ? ? ? ? ? ? ? 2.521 ? 
metalc244  metalc ? ? MD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8091 0 HOH 8612 1_555 ? ? ? ? ? ? ? 2.421 ? 
metalc245  metalc ? ? MD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8091 0 HOH 9065 1_555 ? ? ? ? ? ? ? 2.474 ? 
metalc246  metalc ? ? MD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8091 0 HOH 9845 1_555 ? ? ? ? ? ? ? 2.379 ? 
metalc247  metalc ? ? MD MG  .    MG    ? ? ? 1_555 A  G   917  OP1   ? ? 0 MG  8091 0 G   918  1_555 ? ? ? ? ? ? ? 2.127 ? 
metalc248  metalc ? ? ND MG  .    MG    ? ? ? 1_555 A  C   1843 OP2   ? ? 0 MG  8092 0 C   1844 1_555 ? ? ? ? ? ? ? 2.125 ? 
metalc249  metalc ? ? OD MG  .    MG    ? ? ? 1_555 A  A   1069 "O2'" ? ? 0 MG  8093 0 A   1070 1_555 ? ? ? ? ? ? ? 2.895 ? 
metalc250  metalc ? ? OD MG  .    MG    ? ? ? 1_555 A  G   1070 OP1   ? ? 0 MG  8093 0 G   1071 1_555 ? ? ? ? ? ? ? 2.567 ? 
metalc251  metalc ? ? OD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8093 0 HOH 9204 1_555 ? ? ? ? ? ? ? 2.695 ? 
metalc252  metalc ? ? PD MG  .    MG    ? ? ? 1_555 A  C   1256 OP2   ? ? 0 MG  8094 0 C   1257 1_555 ? ? ? ? ? ? ? 2.194 ? 
metalc253  metalc ? ? PD MG  .    MG    ? ? ? 1_555 A  U   1095 OP2   ? ? 0 MG  8094 0 U   1096 1_555 ? ? ? ? ? ? ? 2.289 ? 
metalc254  metalc ? ? QD MG  .    MG    ? ? ? 1_555 A  G   1847 O6    ? ? 0 MG  8096 0 G   1848 1_555 ? ? ? ? ? ? ? 2.503 ? 
metalc255  metalc ? ? QD MG  .    MG    ? ? ? 1_555 A  G   1848 O6    ? ? 0 MG  8096 0 G   1849 1_555 ? ? ? ? ? ? ? 2.248 ? 
metalc256  metalc ? ? RD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8097 0 HOH 9860 1_555 ? ? ? ? ? ? ? 2.521 ? 
metalc257  metalc ? ? RD MG  .    MG    ? ? ? 1_555 A  G   862  O6    ? ? 0 MG  8097 0 G   863  1_555 ? ? ? ? ? ? ? 2.366 ? 
metalc258  metalc ? ? RD MG  .    MG    ? ? ? 1_555 A  U   863  O4    ? ? 0 MG  8097 0 U   864  1_555 ? ? ? ? ? ? ? 2.555 ? 
metalc259  metalc ? ? SD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8098 0 HOH 9465 1_555 ? ? ? ? ? ? ? 2.385 ? 
metalc260  metalc ? ? SD MG  .    MG    ? ? ? 1_555 CK HOH .    O     ? ? 0 MG  8098 Y HOH 8568 1_555 ? ? ? ? ? ? ? 2.644 ? 
metalc261  metalc ? ? SD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8098 0 HOH 9892 1_555 ? ? ? ? ? ? ? 2.607 ? 
metalc262  metalc ? ? SD MG  .    MG    ? ? ? 1_555 A  A   906  N7    ? ? 0 MG  8098 0 A   907  1_555 ? ? ? ? ? ? ? 2.548 ? 
metalc263  metalc ? ? TD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8099 0 HOH 9536 1_555 ? ? ? ? ? ? ? 2.558 ? 
metalc264  metalc ? ? TD MG  .    MG    ? ? ? 1_555 A  A   2611 "O3'" ? ? 0 MG  8099 0 A   2612 1_555 ? ? ? ? ? ? ? 3.133 ? 
metalc265  metalc ? ? TD MG  .    MG    ? ? ? 1_555 A  A   2611 "O2'" ? ? 0 MG  8099 0 A   2612 1_555 ? ? ? ? ? ? ? 2.638 ? 
metalc266  metalc ? ? VD MG  .    MG    ? ? ? 1_555 A  U   2281 O4    ? ? 0 MG  8101 0 U   2282 1_555 ? ? ? ? ? ? ? 2.462 ? 
metalc267  metalc ? ? VD MG  .    MG    ? ? ? 1_555 A  C   2280 OP2   ? ? 0 MG  8101 0 C   2281 1_555 ? ? ? ? ? ? ? 2.290 ? 
metalc268  metalc ? ? WD MG  .    MG    ? ? ? 1_555 GK HOH .    O     ? ? 0 MG  8102 3 HOH 8523 1_555 ? ? ? ? ? ? ? 2.612 ? 
metalc269  metalc ? ? WD MG  .    MG    ? ? ? 1_555 A  A   2433 N3    ? ? 0 MG  8102 0 A   2434 1_555 ? ? ? ? ? ? ? 2.640 ? 
metalc270  metalc ? ? WD MG  .    MG    ? ? ? 1_555 A  U   2457 O2    ? ? 0 MG  8102 0 U   2458 1_555 ? ? ? ? ? ? ? 2.623 ? 
metalc271  metalc ? ? WD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8102 0 HOH 9413 1_555 ? ? ? ? ? ? ? 2.813 ? 
metalc272  metalc ? ? WD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8102 0 HOH 8772 1_555 ? ? ? ? ? ? ? 2.505 ? 
metalc273  metalc ? ? XD MG  .    MG    ? ? ? 1_555 A  G   2578 OP2   ? ? 0 MG  8103 0 G   2579 1_555 ? ? ? ? ? ? ? 2.867 ? 
metalc274  metalc ? ? XD MG  .    MG    ? ? ? 1_555 A  G   2577 OP2   ? ? 0 MG  8103 0 G   2578 1_555 ? ? ? ? ? ? ? 2.313 ? 
metalc275  metalc ? ? YD MG  .    MG    ? ? ? 1_555 A  C   2104 OP2   ? ? 0 MG  8104 0 C   2105 1_555 ? ? ? ? ? ? ? 2.622 ? 
metalc276  metalc ? ? YD MG  .    MG    ? ? ? 1_555 A  C   2103 OP1   ? ? 0 MG  8104 0 C   2104 1_555 ? ? ? ? ? ? ? 2.288 ? 
metalc277  metalc ? ? ZD MG  .    MG    ? ? ? 1_555 TJ HOH .    O     ? ? 0 MG  8105 P HOH 186  1_555 ? ? ? ? ? ? ? 2.822 ? 
metalc278  metalc ? ? ZD MG  .    MG    ? ? ? 1_555 TJ HOH .    O     ? ? 0 MG  8105 P HOH 207  1_555 ? ? ? ? ? ? ? 2.537 ? 
metalc279  metalc ? ? ZD MG  .    MG    ? ? ? 1_555 A  G   816  O6    ? ? 0 MG  8105 0 G   817  1_555 ? ? ? ? ? ? ? 2.287 ? 
metalc280  metalc ? ? AE MG  .    MG    ? ? ? 1_555 A  A   1106 OP2   ? ? 0 MG  8106 0 A   1107 1_555 ? ? ? ? ? ? ? 1.848 ? 
metalc281  metalc ? ? AE MG  .    MG    ? ? ? 1_555 A  A   1105 OP2   ? ? 0 MG  8106 0 A   1106 1_555 ? ? ? ? ? ? ? 2.097 ? 
metalc282  metalc ? ? CE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8109 0 HOH 9027 1_555 ? ? ? ? ? ? ? 2.579 ? 
metalc283  metalc ? ? CE MG  .    MG    ? ? ? 1_555 A  U   902  OP1   ? ? 0 MG  8109 0 U   903  1_555 ? ? ? ? ? ? ? 2.405 ? 
metalc284  metalc ? ? CE MG  .    MG    ? ? ? 1_555 A  A   1356 N7    ? ? 0 MG  8109 0 A   1357 1_555 ? ? ? ? ? ? ? 2.566 ? 
metalc285  metalc ? ? DE MG  .    MG    ? ? ? 1_555 A  G   2608 N7    ? ? 0 MG  8110 0 G   2609 1_555 ? ? ? ? ? ? ? 2.411 ? 
metalc286  metalc ? ? DE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8110 0 HOH 9820 1_555 ? ? ? ? ? ? ? 2.271 ? 
metalc287  metalc ? ? EE MG  .    MG    ? ? ? 1_555 A  A   186  N1    ? ? 0 MG  8111 0 A   187  1_555 ? ? ? ? ? ? ? 2.730 ? 
metalc288  metalc ? ? EE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8111 0 HOH 8851 1_555 ? ? ? ? ? ? ? 2.326 ? 
metalc289  metalc ? ? EE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8111 0 HOH 9087 1_555 ? ? ? ? ? ? ? 2.397 ? 
metalc290  metalc ? ? EE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8111 0 HOH 8648 1_555 ? ? ? ? ? ? ? 2.475 ? 
metalc291  metalc ? ? FE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8112 0 HOH 9109 1_555 ? ? ? ? ? ? ? 2.600 ? 
metalc292  metalc ? ? FE MG  .    MG    ? ? ? 1_555 A  A   2111 N7    ? ? 0 MG  8112 0 A   2112 1_555 ? ? ? ? ? ? ? 2.529 ? 
metalc293  metalc ? ? GE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8113 0 HOH 8969 1_555 ? ? ? ? ? ? ? 2.385 ? 
metalc294  metalc ? ? GE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8113 0 HOH 8869 1_555 ? ? ? ? ? ? ? 2.649 ? 
metalc295  metalc ? ? GE MG  .    MG    ? ? ? 1_555 A  A   2429 N1    ? ? 0 MG  8113 0 A   2430 1_555 ? ? ? ? ? ? ? 2.663 ? 
metalc296  metalc ? ? HE MG  .    MG    ? ? ? 1_555 EJ HOH .    O     ? ? 0 MG  8114 A HOH 8636 1_555 ? ? ? ? ? ? ? 2.834 ? 
metalc297  metalc ? ? HE MG  .    MG    ? ? ? 1_555 EJ HOH .    O     ? ? 0 MG  8114 A HOH 8555 1_555 ? ? ? ? ? ? ? 2.623 ? 
metalc298  metalc ? ? IE MG  .    MG    ? ? ? 1_555 A  U   1849 O4    ? ? 0 MG  8115 0 U   1850 1_555 ? ? ? ? ? ? ? 2.501 ? 
metalc299  metalc ? ? IE MG  .    MG    ? ? ? 1_555 EJ HOH .    O     ? ? 0 MG  8115 A HOH 8555 1_555 ? ? ? ? ? ? ? 2.470 ? 
metalc300  metalc ? ? JE MG  .    MG    ? ? ? 1_555 A  A   1839 "O2'" ? ? 0 MG  8116 0 A   1840 1_555 ? ? ? ? ? ? ? 2.508 ? 
metalc301  metalc ? ? JE MG  .    MG    ? ? ? 1_555 A  C   1840 OP2   ? ? 0 MG  8116 0 C   1841 1_555 ? ? ? ? ? ? ? 3.017 ? 
metalc302  metalc ? ? JE MG  .    MG    ? ? ? 1_555 A  A   2021 N7    ? ? 0 MG  8116 0 A   2022 1_555 ? ? ? ? ? ? ? 2.519 ? 
metalc303  metalc ? ? JE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8116 0 HOH 8743 1_555 ? ? ? ? ? ? ? 2.624 ? 
metalc304  metalc ? ? JE MG  .    MG    ? ? ? 1_555 A  A   1839 "O3'" ? ? 0 MG  8116 0 A   1840 1_555 ? ? ? ? ? ? ? 2.289 ? 
metalc305  metalc ? ? KE K   .    K     ? ? ? 1_555 A  G   2101 N7    ? ? 0 K   8201 0 G   2102 1_555 ? ? ? ? ? ? ? 3.362 ? 
metalc306  metalc ? ? KE K   .    K     ? ? ? 1_555 A  C   2535 O2    ? ? 0 K   8201 0 C   2536 1_555 ? ? ? ? ? ? ? 3.226 ? 
metalc307  metalc ? ? KE K   .    K     ? ? ? 1_555 A  G   2101 O6    ? ? 0 K   8201 0 G   2102 1_555 ? ? ? ? ? ? ? 2.761 ? 
metalc308  metalc ? ? KE K   .    K     ? ? ? 1_555 A  G   2481 N7    ? ? 0 K   8201 0 G   2482 1_555 ? ? ? ? ? ? ? 3.005 ? 
metalc309  metalc ? ? KE K   .    K     ? ? ? 1_555 A  G   2481 O6    ? ? 0 K   8201 0 G   2482 1_555 ? ? ? ? ? ? ? 2.906 ? 
metalc310  metalc ? ? KE K   .    K     ? ? ? 1_555 A  C   2535 "O4'" ? ? 0 K   8201 0 C   2536 1_555 ? ? ? ? ? ? ? 3.313 ? 
metalc311  metalc ? ? LE K   .    K     ? ? ? 1_555 A  C   161  OP2   ? ? 0 K   8202 0 C   162  1_555 ? ? ? ? ? ? ? 3.132 ? 
metalc312  metalc ? ? LE K   .    K     ? ? ? 1_555 A  U   171  O4    ? ? 0 K   8202 0 U   172  1_555 ? ? ? ? ? ? ? 2.968 ? 
metalc313  metalc ? ? LE K   .    K     ? ? ? 1_555 CJ HOH .    O     ? ? 0 K   8202 0 HOH 8535 1_555 ? ? ? ? ? ? ? 2.776 ? 
metalc314  metalc ? ? LE K   .    K     ? ? ? 1_555 CJ HOH .    O     ? ? 0 K   8202 0 HOH 8665 1_555 ? ? ? ? ? ? ? 2.988 ? 
metalc315  metalc ? ? LE K   .    K     ? ? ? 1_555 A  U   162  O4    ? ? 0 K   8202 0 U   163  1_555 ? ? ? ? ? ? ? 2.859 ? 
metalc316  metalc ? ? LE K   .    K     ? ? ? 1_555 CJ HOH .    O     ? ? 0 K   8202 0 HOH 8631 1_555 ? ? ? ? ? ? ? 2.932 ? 
metalc317  metalc ? ? ME NA  .    NA    ? ? ? 1_555 A  G   1071 N7    ? ? 0 NA  8301 0 G   1072 1_555 ? ? ? ? ? ? ? 2.374 ? 
metalc318  metalc ? ? ME NA  .    NA    ? ? ? 1_555 A  C   1068 OP2   ? ? 0 NA  8301 0 C   1069 1_555 ? ? ? ? ? ? ? 2.121 ? 
metalc319  metalc ? ? SE NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8308 0 HOH 9933 1_555 ? ? ? ? ? ? ? 2.487 ? 
metalc320  metalc ? ? SE NA  .    NA    ? ? ? 1_555 A  U   1723 O2    ? ? 0 NA  8308 0 U   1724 1_555 ? ? ? ? ? ? ? 2.356 ? 
metalc321  metalc ? ? SE NA  .    NA    ? ? ? 1_555 A  U   1431 O4    ? ? 0 NA  8308 0 U   1432 1_555 ? ? ? ? ? ? ? 2.527 ? 
metalc322  metalc ? ? SE NA  .    NA    ? ? ? 1_555 A  C   1393 O2    ? ? 0 NA  8308 0 C   1394 1_555 ? ? ? ? ? ? ? 2.185 ? 
metalc323  metalc ? ? UE NA  .    NA    ? ? ? 1_555 A  G   2524 O6    ? ? 0 NA  8311 0 G   2525 1_555 ? ? ? ? ? ? ? 2.203 ? 
metalc324  metalc ? ? VE NA  .    NA    ? ? ? 1_555 A  G   2398 O6    ? ? 0 NA  8313 0 G   2399 1_555 ? ? ? ? ? ? ? 2.521 ? 
metalc325  metalc ? ? VE NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8313 0 HOH 9475 1_555 ? ? ? ? ? ? ? 2.534 ? 
metalc326  metalc ? ? WE NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8314 0 HOH 9650 1_555 ? ? ? ? ? ? ? 2.521 ? 
metalc327  metalc ? ? WE NA  .    NA    ? ? ? 1_555 A  U   2606 "O2'" ? ? 0 NA  8314 0 U   2607 1_555 ? ? ? ? ? ? ? 2.490 ? 
metalc328  metalc ? ? WE NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8314 0 HOH 8852 1_555 ? ? ? ? ? ? ? 2.312 ? 
metalc329  metalc ? ? ZE NA  .    NA    ? ? ? 1_555 A  G   1415 "O3'" ? ? 0 NA  8317 0 G   1416 1_555 ? ? ? ? ? ? ? 2.370 ? 
metalc330  metalc ? ? ZE NA  .    NA    ? ? ? 1_555 FK HOH .    O     ? ? 0 NA  8317 2 HOH 4135 1_555 ? ? ? ? ? ? ? 2.462 ? 
metalc331  metalc ? ? ZE NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8317 0 HOH 8797 1_555 ? ? ? ? ? ? ? 2.369 ? 
metalc332  metalc ? ? BF NA  .    NA    ? ? ? 1_555 N  ASP 37   O     ? ? 0 NA  8319 L ASP 36   1_555 ? ? ? ? ? ? ? 2.313 ? 
metalc333  metalc ? ? BF NA  .    NA    ? ? ? 1_555 A  G   2465 OP2   ? ? 0 NA  8319 0 G   2466 1_555 ? ? ? ? ? ? ? 2.473 ? 
metalc334  metalc ? ? CF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8320 0 HOH 9265 1_555 ? ? ? ? ? ? ? 2.529 ? 
metalc335  metalc ? ? DF NA  .    NA    ? ? ? 1_555 D  ARG 230  O     ? ? 0 NA  8321 B ARG 229  1_555 ? ? ? ? ? ? ? 2.546 ? 
metalc336  metalc ? ? GF NA  .    NA    ? ? ? 1_555 A  A   775  "O3'" ? ? 0 NA  8325 0 A   776  1_555 ? ? ? ? ? ? ? 2.553 ? 
metalc337  metalc ? ? GF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8325 0 HOH 9796 1_555 ? ? ? ? ? ? ? 2.487 ? 
metalc338  metalc ? ? GF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8325 0 HOH 9144 1_555 ? ? ? ? ? ? ? 2.281 ? 
metalc339  metalc ? ? HF NA  .    NA    ? ? ? 1_555 A  U   2011 O4    ? ? 0 NA  8326 0 U   2012 1_555 ? ? ? ? ? ? ? 2.444 ? 
metalc340  metalc ? ? IF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8327 0 HOH 8557 1_555 ? ? ? ? ? ? ? 2.549 ? 
metalc341  metalc ? ? IF NA  .    NA    ? ? ? 1_555 A  U   1830 "O2'" ? ? 0 NA  8327 0 U   1831 1_555 ? ? ? ? ? ? ? 2.592 ? 
metalc342  metalc ? ? NF NA  .    NA    ? ? ? 1_555 A  G   386  O6    ? ? 0 NA  8332 0 G   387  1_555 ? ? ? ? ? ? ? 2.424 ? 
metalc343  metalc ? ? OF NA  .    NA    ? ? ? 1_555 A  C   1893 O2    ? ? 0 NA  8333 0 C   1894 1_555 ? ? ? ? ? ? ? 2.535 ? 
metalc344  metalc ? ? RF NA  .    NA    ? ? ? 1_555 A  G   1706 O6    ? ? 0 NA  8336 0 G   1707 1_555 ? ? ? ? ? ? ? 2.535 ? 
metalc345  metalc ? ? RF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8336 0 HOH 9446 1_555 ? ? ? ? ? ? ? 2.400 ? 
metalc346  metalc ? ? RF NA  .    NA    ? ? ? 1_555 A  G   1705 O6    ? ? 0 NA  8336 0 G   1706 1_555 ? ? ? ? ? ? ? 2.405 ? 
metalc347  metalc ? ? SF NA  .    NA    ? ? ? 1_555 A  G   2659 OP1   ? ? 0 NA  8338 0 G   2660 1_555 ? ? ? ? ? ? ? 2.581 ? 
metalc348  metalc ? ? SF NA  .    NA    ? ? ? 1_555 A  U   2658 "O3'" ? ? 0 NA  8338 0 U   2659 1_555 ? ? ? ? ? ? ? 2.409 ? 
metalc349  metalc ? ? SF NA  .    NA    ? ? ? 1_555 T  VAL 73   O     ? ? 0 NA  8338 R VAL 72   1_555 ? ? ? ? ? ? ? 2.306 ? 
metalc350  metalc ? ? SF NA  .    NA    ? ? ? 1_555 T  TRP 76   O     ? ? 0 NA  8338 R TRP 75   1_555 ? ? ? ? ? ? ? 2.373 ? 
metalc351  metalc ? ? SF NA  .    NA    ? ? ? 1_555 VJ HOH .    O     ? ? 0 NA  8338 R HOH 8514 1_555 ? ? ? ? ? ? ? 2.459 ? 
metalc352  metalc ? ? SF NA  .    NA    ? ? ? 1_555 VJ HOH .    O     ? ? 0 NA  8338 R HOH 8526 1_555 ? ? ? ? ? ? ? 2.316 ? 
metalc353  metalc ? ? XF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8344 0 HOH 8742 1_555 ? ? ? ? ? ? ? 2.460 ? 
metalc354  metalc ? ? YF NA  .    NA    ? ? ? 1_555 A  G   1044 OP2   ? ? 0 NA  8349 0 G   1045 1_555 ? ? ? ? ? ? ? 2.247 ? 
metalc355  metalc ? ? FG NA  .    NA    ? ? ? 1_555 A  U   941  O4    ? ? 0 NA  8357 0 U   942  1_555 ? ? ? ? ? ? ? 2.489 ? 
metalc356  metalc ? ? FG NA  .    NA    ? ? ? 1_555 A  G   1023 O6    ? ? 0 NA  8357 0 G   1024 1_555 ? ? ? ? ? ? ? 2.480 ? 
metalc357  metalc ? ? LG NA  .    NA    ? ? ? 1_555 A  C   1359 OP1   ? ? 0 NA  8363 0 C   1360 1_555 ? ? ? ? ? ? ? 2.515 ? 
metalc358  metalc ? ? MG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8364 0 HOH 9113 1_555 ? ? ? ? ? ? ? 2.588 ? 
metalc359  metalc ? ? OG NA  .    NA    ? ? ? 1_555 A  G   544  O6    ? ? 0 NA  8366 0 G   545  1_555 ? ? ? ? ? ? ? 2.456 ? 
metalc360  metalc ? ? PG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8367 0 HOH 9350 1_555 ? ? ? ? ? ? ? 2.568 ? 
metalc361  metalc ? ? YG NA  .    NA    ? ? ? 1_555 A  C   632  OP1   ? ? 0 NA  8376 0 C   633  1_555 ? ? ? ? ? ? ? 2.569 ? 
metalc362  metalc ? ? CH NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8381 0 HOH 8850 1_555 ? ? ? ? ? ? ? 2.494 ? 
metalc363  metalc ? ? CH NA  .    NA    ? ? ? 1_555 A  U   2585 O4    ? ? 0 NA  8381 0 U   2586 1_555 ? ? ? ? ? ? ? 2.269 ? 
metalc364  metalc ? ? CH NA  .    NA    ? ? ? 1_555 A  G   2591 O6    ? ? 0 NA  8381 0 G   2592 1_555 ? ? ? ? ? ? ? 2.563 ? 
metalc365  metalc ? ? DH NA  .    NA    ? ? ? 1_555 A  G   2772 O6    ? ? 0 NA  8382 0 G   2773 1_555 ? ? ? ? ? ? ? 2.255 ? 
metalc366  metalc ? ? FH NA  .    NA    ? ? ? 1_555 A  G   1076 N7    ? ? 0 NA  8385 0 G   1077 1_555 ? ? ? ? ? ? ? 2.374 ? 
metalc367  metalc ? ? FH NA  .    NA    ? ? ? 1_555 A  A   1078 OP1   ? ? 0 NA  8385 0 A   1079 1_555 ? ? ? ? ? ? ? 2.575 ? 
metalc368  metalc ? ? YI CD  .    CD    ? ? ? 1_555 CA CYS 23   SG    ? ? 1 CD  8402 1 CYS 22   1_555 ? ? ? ? ? ? ? 2.470 ? 
metalc369  metalc ? ? YI CD  .    CD    ? ? ? 1_555 CA CYS 38   SG    ? ? 1 CD  8402 1 CYS 37   1_555 ? ? ? ? ? ? ? 2.407 ? 
metalc370  metalc ? ? YI CD  .    CD    ? ? ? 1_555 CA CYS 20   SG    ? ? 1 CD  8402 1 CYS 19   1_555 ? ? ? ? ? ? ? 2.526 ? 
metalc371  metalc ? ? YI CD  .    CD    ? ? ? 1_555 CA CYS 35   SG    ? ? 1 CD  8402 1 CYS 34   1_555 ? ? ? ? ? ? ? 2.507 ? 
metalc372  metalc ? ? ZI MG  .    MG    ? ? ? 1_555 GK HOH .    O     ? ? 3 MG  8078 3 HOH 8575 1_555 ? ? ? ? ? ? ? 2.196 ? 
metalc373  metalc ? ? ZI MG  .    MG    ? ? ? 1_555 GK HOH .    O     ? ? 3 MG  8078 3 HOH 8574 1_555 ? ? ? ? ? ? ? 2.309 ? 
metalc374  metalc ? ? ZI MG  .    MG    ? ? ? 1_555 EA ASP 49   OD2   ? ? 3 MG  8078 3 ASP 49   1_555 ? ? ? ? ? ? ? 3.054 ? 
metalc375  metalc ? ? ZI MG  .    MG    ? ? ? 1_555 EA ASP 49   OD1   ? ? 3 MG  8078 3 ASP 49   1_555 ? ? ? ? ? ? ? 2.602 ? 
metalc376  metalc ? ? ZI MG  .    MG    ? ? ? 1_555 EA GLY 47   O     ? ? 3 MG  8078 3 GLY 47   1_555 ? ? ? ? ? ? ? 2.480 ? 
metalc377  metalc ? ? ZI MG  .    MG    ? ? ? 1_555 EA GLY 45   O     ? ? 3 MG  8078 3 GLY 45   1_555 ? ? ? ? ? ? ? 2.325 ? 
metalc378  metalc ? ? AJ CD  .    CD    ? ? ? 1_555 EA CYS 14   SG    ? ? 3 CD  8404 3 CYS 14   1_555 ? ? ? ? ? ? ? 2.899 ? 
metalc379  metalc ? ? AJ CD  .    CD    ? ? ? 1_555 EA CYS 11   SG    ? ? 3 CD  8404 3 CYS 11   1_555 ? ? ? ? ? ? ? 2.522 ? 
metalc380  metalc ? ? AJ CD  .    CD    ? ? ? 1_555 EA CYS 74   SG    ? ? 3 CD  8404 3 CYS 74   1_555 ? ? ? ? ? ? ? 2.636 ? 
metalc381  metalc ? ? AJ CD  .    CD    ? ? ? 1_555 EA CYS 71   SG    ? ? 3 CD  8404 3 CYS 71   1_555 ? ? ? ? ? ? ? 2.424 ? 
metalc382  metalc ? ? QH MG  .    MG    ? ? ? 1_555 DJ HOH .    O     ? ? 9 MG  8095 9 HOH 8510 1_555 ? ? ? ? ? ? ? 2.337 ? 
metalc383  metalc ? ? QH MG  .    MG    ? ? ? 1_555 B  A   57   OP2   ? ? 9 MG  8095 9 A   57   1_555 ? ? ? ? ? ? ? 2.607 ? 
metalc384  metalc ? ? QH MG  .    MG    ? ? ? 1_555 B  A   56   OP2   ? ? 9 MG  8095 9 A   56   1_555 ? ? ? ? ? ? ? 2.253 ? 
metalc385  metalc ? ? RH NA  .    NA    ? ? ? 1_555 B  C   40   N3    ? ? 9 NA  8351 9 C   40   1_555 ? ? ? ? ? ? ? 2.482 ? 
metalc386  metalc ? ? TH MG  .    MG    ? ? ? 1_555 EJ HOH .    O     ? ? A MG  8065 A HOH 8634 1_555 ? ? ? ? ? ? ? 2.121 ? 
metalc387  metalc ? ? TH MG  .    MG    ? ? ? 1_555 EJ HOH .    O     ? ? A MG  8065 A HOH 8604 1_555 ? ? ? ? ? ? ? 2.297 ? 
metalc388  metalc ? ? TH MG  .    MG    ? ? ? 1_555 EJ HOH .    O     ? ? A MG  8065 A HOH 8552 1_555 ? ? ? ? ? ? ? 2.192 ? 
metalc389  metalc ? ? TH MG  .    MG    ? ? ? 1_555 EJ HOH .    O     ? ? A MG  8065 A HOH 8523 1_555 ? ? ? ? ? ? ? 2.244 ? 
metalc390  metalc ? ? TH MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8065 0 HOH 9447 1_555 ? ? ? ? ? ? ? 2.161 ? 
metalc391  metalc ? ? UH NA  .    NA    ? ? ? 1_555 C  PHE 202  O     ? ? A NA  8345 A PHE 201  1_555 ? ? ? ? ? ? ? 2.426 ? 
metalc392  metalc ? ? UH NA  .    NA    ? ? ? 1_555 EJ HOH .    O     ? ? A NA  8345 A HOH 8603 1_555 ? ? ? ? ? ? ? 2.207 ? 
metalc393  metalc ? ? UH NA  .    NA    ? ? ? 1_555 C  HIS 209  O     ? ? A NA  8345 A HIS 208  1_555 ? ? ? ? ? ? ? 2.549 ? 
metalc394  metalc ? ? WH MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? B MG  8055 B HOH 8671 1_555 ? ? ? ? ? ? ? 3.011 ? 
metalc395  metalc ? ? WH MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? B MG  8055 B HOH 8670 1_555 ? ? ? ? ? ? ? 2.076 ? 
metalc396  metalc ? ? WH MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? B MG  8055 B HOH 8556 1_555 ? ? ? ? ? ? ? 2.247 ? 
metalc397  metalc ? ? YH NA  .    NA    ? ? ? 1_555 E  ASP 45   OD1   ? ? C NA  8304 C ASP 45   1_555 ? ? ? ? ? ? ? 2.576 ? 
metalc398  metalc ? ? BI NA  .    NA    ? ? ? 1_555 L  ILE 63   O     ? ? J NA  8346 J ILE 63   1_555 ? ? ? ? ? ? ? 2.512 ? 
metalc399  metalc ? ? BI NA  .    NA    ? ? ? 1_555 L  TYR 69   O     ? ? J NA  8346 J TYR 69   1_555 ? ? ? ? ? ? ? 2.370 ? 
metalc400  metalc ? ? FI MG  .    MG    ? ? ? 1_555 OJ HOH .    O     ? ? K MG  8069 K HOH 2121 1_555 ? ? ? ? ? ? ? 1.937 ? 
metalc401  metalc ? ? FI MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? K MG  8069 0 HOH 9943 1_555 ? ? ? ? ? ? ? 2.600 ? 
metalc402  metalc ? ? FI MG  .    MG    ? ? ? 1_555 M  ASN 42   OD1   ? ? K MG  8069 K ASN 42   1_555 ? ? ? ? ? ? ? 2.461 ? 
metalc403  metalc ? ? FI MG  .    MG    ? ? ? 1_555 OJ HOH .    O     ? ? K MG  8069 K HOH 7871 1_555 ? ? ? ? ? ? ? 2.054 ? 
metalc404  metalc ? ? GI NA  .    NA    ? ? ? 1_555 PJ HOH .    O     ? ? L NA  8380 L HOH 8593 1_555 ? ? ? ? ? ? ? 2.443 ? 
metalc405  metalc ? ? II NA  .    NA    ? ? ? 1_555 QJ HOH .    O     ? ? M NA  8347 M HOH 8623 1_555 ? ? ? ? ? ? ? 2.476 ? 
metalc406  metalc ? ? II NA  .    NA    ? ? ? 1_555 O  LEU 112  O     ? ? M NA  8347 M LEU 112  1_555 ? ? ? ? ? ? ? 2.572 ? 
metalc407  metalc ? ? LI CD  .    CD    ? ? ? 1_555 SJ HOH .    O     ? ? O CD  8405 O HOH 5650 1_555 ? ? ? ? ? ? ? 2.632 ? 
metalc408  metalc ? ? LI CD  .    CD    ? ? ? 1_555 Q  HIS 41   ND1   ? ? O CD  8405 O HIS 40   1_555 ? ? ? ? ? ? ? 2.585 ? 
metalc409  metalc ? ? NI NA  .    NA    ? ? ? 1_555 S  GLY 23   O     ? ? Q NA  8348 Q GLY 22   1_555 ? ? ? ? ? ? ? 2.428 ? 
metalc410  metalc ? ? NI NA  .    NA    ? ? ? 1_555 S  ASP 21   O     ? ? Q NA  8348 Q ASP 20   1_555 ? ? ? ? ? ? ? 2.531 ? 
metalc411  metalc ? ? NI NA  .    NA    ? ? ? 1_555 S  SER 47   OG    ? ? Q NA  8348 Q SER 46   1_555 ? ? ? ? ? ? ? 2.599 ? 
metalc412  metalc ? ? NI NA  .    NA    ? ? ? 1_555 UJ HOH .    O     ? ? Q NA  8348 Q HOH 1795 1_555 ? ? ? ? ? ? ? 2.571 ? 
metalc413  metalc ? ? OI NA  .    NA    ? ? ? 1_555 VJ HOH .    O     ? ? R NA  8337 R HOH 8524 1_555 ? ? ? ? ? ? ? 2.515 ? 
metalc414  metalc ? ? OI NA  .    NA    ? ? ? 1_555 T  SER 71   O     ? ? R NA  8337 R SER 70   1_555 ? ? ? ? ? ? ? 2.578 ? 
metalc415  metalc ? ? RI NA  .    NA    ? ? ? 1_555 WJ HOH .    O     ? ? S NA  8312 S HOH 8324 1_555 ? ? ? ? ? ? ? 2.347 ? 
metalc416  metalc ? ? RI NA  .    NA    ? ? ? 1_555 U  GLU 62   OE2   ? ? S NA  8312 S GLU 61   1_555 ? ? ? ? ? ? ? 2.278 ? 
metalc417  metalc ? ? RI NA  .    NA    ? ? ? 1_555 U  HIS 8    NE2   ? ? S NA  8312 S HIS 7    1_555 ? ? ? ? ? ? ? 2.481 ? 
metalc418  metalc ? ? SI MG  .    MG    ? ? ? 1_555 V  LEU 113  O     ? ? T MG  8073 T LEU 112  1_555 ? ? ? ? ? ? ? 2.601 ? 
metalc419  metalc ? ? SI MG  .    MG    ? ? ? 1_555 V  ARG 112  O     ? ? T MG  8073 T ARG 111  1_555 ? ? ? ? ? ? ? 2.840 ? 
metalc420  metalc ? ? SI MG  .    MG    ? ? ? 1_555 V  GLN 38   OE1   ? ? T MG  8073 T GLN 37   1_555 ? ? ? ? ? ? ? 2.843 ? 
metalc421  metalc ? ? SI MG  .    MG    ? ? ? 1_555 XJ HOH .    O     ? ? T MG  8073 T HOH 2868 1_555 ? ? ? ? ? ? ? 2.759 ? 
metalc422  metalc ? ? SI MG  .    MG    ? ? ? 1_555 V  ASP 118  O     ? ? T MG  8073 T ASP 117  1_555 ? ? ? ? ? ? ? 2.461 ? 
metalc423  metalc ? ? SI MG  .    MG    ? ? ? 1_555 V  SER 115  O     ? ? T MG  8073 T SER 114  1_555 ? ? ? ? ? ? ? 2.273 ? 
metalc424  metalc ? ? TI NA  .    NA    ? ? ? 1_555 V  SER 95   OG    ? ? T NA  8343 T SER 94   1_555 ? ? ? ? ? ? ? 2.267 ? 
metalc425  metalc ? ? TI NA  .    NA    ? ? ? 1_555 XJ HOH .    O     ? ? T NA  8343 T HOH 1124 1_555 ? ? ? ? ? ? ? 2.506 ? 
metalc426  metalc ? ? TI NA  .    NA    ? ? ? 1_555 V  ASN 96   OD1   ? ? T NA  8343 T ASN 95   1_555 ? ? ? ? ? ? ? 2.546 ? 
metalc427  metalc ? ? UI CD  .    CD    ? ? ? 1_555 W  CYS 9    SG    ? ? U CD  8401 U CYS 9    1_555 ? ? ? ? ? ? ? 2.657 ? 
metalc428  metalc ? ? UI CD  .    CD    ? ? ? 1_555 W  CYS 6    SG    ? ? U CD  8401 U CYS 6    1_555 ? ? ? ? ? ? ? 2.587 ? 
metalc429  metalc ? ? UI CD  .    CD    ? ? ? 1_555 W  CYS 36   SG    ? ? U CD  8401 U CYS 36   1_555 ? ? ? ? ? ? ? 2.498 ? 
metalc430  metalc ? ? UI CD  .    CD    ? ? ? 1_555 W  CYS 32   SG    ? ? U CD  8401 U CYS 32   1_555 ? ? ? ? ? ? ? 2.490 ? 
metalc431  metalc ? ? VI MG  .    MG    ? ? ? 1_555 AA LYS 137  O     ? ? Y MG  8108 Y LYS 136  1_555 ? ? ? ? ? ? ? 2.585 ? 
metalc432  metalc ? ? VI MG  .    MG    ? ? ? 1_555 CK HOH .    O     ? ? Y MG  8108 Y HOH 8582 1_555 ? ? ? ? ? ? ? 2.508 ? 
metalc433  metalc ? ? VI MG  .    MG    ? ? ? 1_555 CK HOH .    O     ? ? Y MG  8108 Y HOH 8560 1_555 ? ? ? ? ? ? ? 2.622 ? 
metalc434  metalc ? ? VI MG  .    MG    ? ? ? 1_555 CK HOH .    O     ? ? Y MG  8108 Y HOH 8616 1_555 ? ? ? ? ? ? ? 2.391 ? 
metalc435  metalc ? ? VI MG  .    MG    ? ? ? 1_555 AA HIS 134  O     ? ? Y MG  8108 Y HIS 133  1_555 ? ? ? ? ? ? ? 2.250 ? 
metalc436  metalc ? ? VI MG  .    MG    ? ? ? 1_555 AA VAL 140  O     ? ? Y MG  8108 Y VAL 139  1_555 ? ? ? ? ? ? ? 2.378 ? 
metalc437  metalc ? ? XI CD  .    CD    ? ? ? 1_555 BA CYS 51   SG    ? ? Z CD  8403 Z CYS 60   1_555 ? ? ? ? ? ? ? 2.335 ? 
metalc438  metalc ? ? XI CD  .    CD    ? ? ? 1_555 BA CYS 33   SG    ? ? Z CD  8403 Z CYS 42   1_555 ? ? ? ? ? ? ? 2.771 ? 
metalc439  metalc ? ? XI CD  .    CD    ? ? ? 1_555 BA CYS 30   SG    ? ? Z CD  8403 Z CYS 39   1_555 ? ? ? ? ? ? ? 2.511 ? 
metalc440  metalc ? ? XI CD  .    CD    ? ? ? 1_555 BA CYS 48   SG    ? ? Z CD  8403 Z CYS 57   1_555 ? ? ? ? ? ? ? 2.492 ? 
metalc441  metalc ? ? A  C   39   "O2'" ? ? ? 1_555 RE NA  .    NA    ? ? 0 C   40   0 NA  8307 1_555 ? ? ? ? ? ? ? 2.881 ? 
metalc442  metalc ? ? A  C   39   O2    ? ? ? 1_555 RE NA  .    NA    ? ? 0 C   40   0 NA  8307 1_555 ? ? ? ? ? ? ? 2.683 ? 
metalc443  metalc ? ? A  G   55   O6    ? ? ? 1_555 JF NA  .    NA    ? ? 0 G   56   0 NA  8328 1_555 ? ? ? ? ? ? ? 2.698 ? 
metalc444  metalc ? ? A  A   58   N3    ? ? ? 1_555 JF NA  .    NA    ? ? 0 A   59   0 NA  8328 1_555 ? ? ? ? ? ? ? 2.925 ? 
metalc445  metalc ? ? A  G   60   N7    ? ? ? 1_555 JF NA  .    NA    ? ? 0 G   61   0 NA  8328 1_555 ? ? ? ? ? ? ? 2.843 ? 
metalc446  metalc ? ? A  U   107  O2    ? ? ? 1_555 KF NA  .    NA    ? ? 0 U   108  0 NA  8329 1_555 ? ? ? ? ? ? ? 2.708 ? 
metalc447  metalc ? ? A  C   140  "O4'" ? ? ? 1_555 LF NA  .    NA    ? ? 0 C   141  0 NA  8330 1_555 ? ? ? ? ? ? ? 2.697 ? 
metalc448  metalc ? ? A  C   140  O2    ? ? ? 1_555 LF NA  .    NA    ? ? 0 C   141  0 NA  8330 1_555 ? ? ? ? ? ? ? 2.691 ? 
metalc449  metalc ? ? A  G   141  O6    ? ? ? 1_555 LF NA  .    NA    ? ? 0 G   142  0 NA  8330 1_555 ? ? ? ? ? ? ? 2.971 ? 
metalc450  metalc ? ? A  U   145  O4    ? ? ? 1_555 FF NA  .    NA    ? ? 0 U   146  0 NA  8324 1_555 ? ? ? ? ? ? ? 2.797 ? 
metalc451  metalc ? ? A  A   164  OP2   ? ? ? 1_555 XE NA  .    NA    ? ? 0 A   165  0 NA  8315 1_555 ? ? ? ? ? ? ? 2.658 ? 
metalc452  metalc ? ? A  A   165  "O3'" ? ? ? 1_555 XE NA  .    NA    ? ? 0 A   166  0 NA  8315 1_555 ? ? ? ? ? ? ? 2.679 ? 
metalc453  metalc ? ? A  A   165  "O2'" ? ? ? 1_555 XE NA  .    NA    ? ? 0 A   166  0 NA  8315 1_555 ? ? ? ? ? ? ? 2.899 ? 
metalc454  metalc ? ? A  A   166  OP1   ? ? ? 1_555 XE NA  .    NA    ? ? 0 A   167  0 NA  8315 1_555 ? ? ? ? ? ? ? 2.883 ? 
metalc455  metalc ? ? A  U   169  O2    ? ? ? 1_555 MF NA  .    NA    ? ? 0 U   170  0 NA  8331 1_555 ? ? ? ? ? ? ? 2.646 ? 
metalc456  metalc ? ? A  G   195  N7    ? ? ? 1_555 WG NA  .    NA    ? ? 0 G   196  0 NA  8374 1_555 ? ? ? ? ? ? ? 2.979 ? 
metalc457  metalc ? ? A  C   196  N3    ? ? ? 1_555 EH NA  .    NA    ? ? 0 C   197  0 NA  8384 1_555 ? ? ? ? ? ? ? 2.602 ? 
metalc458  metalc ? ? A  C   217  "O2'" ? ? ? 1_555 MF NA  .    NA    ? ? 0 C   218  0 NA  8331 1_555 ? ? ? ? ? ? ? 2.870 ? 
metalc459  metalc ? ? A  G   220  O6    ? ? ? 1_555 MF NA  .    NA    ? ? 0 G   221  0 NA  8331 1_555 ? ? ? ? ? ? ? 2.941 ? 
metalc460  metalc ? ? A  U   307  O4    ? ? ? 1_555 TI NA  .    NA    ? ? 0 U   308  T NA  8343 1_555 ? ? ? ? ? ? ? 2.889 ? 
metalc461  metalc ? ? A  U   334  O2    ? ? ? 1_555 TI NA  .    NA    ? ? 0 U   335  T NA  8343 1_555 ? ? ? ? ? ? ? 2.953 ? 
metalc462  metalc ? ? A  C   341  O2    ? ? ? 1_555 TI NA  .    NA    ? ? 0 C   342  T NA  8343 1_555 ? ? ? ? ? ? ? 2.820 ? 
metalc463  metalc ? ? A  G   385  O6    ? ? ? 1_555 NF NA  .    NA    ? ? 0 G   386  0 NA  8332 1_555 ? ? ? ? ? ? ? 2.991 ? 
metalc464  metalc ? ? A  C   398  O2    ? ? ? 1_555 NG NA  .    NA    ? ? 0 C   399  0 NA  8365 1_555 ? ? ? ? ? ? ? 2.874 ? 
metalc465  metalc ? ? A  U   401  O4    ? ? ? 1_555 NF NA  .    NA    ? ? 0 U   402  0 NA  8332 1_555 ? ? ? ? ? ? ? 2.744 ? 
metalc466  metalc ? ? A  A   414  "O2'" ? ? ? 1_555 WG NA  .    NA    ? ? 0 A   415  0 NA  8374 1_555 ? ? ? ? ? ? ? 2.945 ? 
metalc467  metalc ? ? A  A   441  N1    ? ? ? 1_555 RE NA  .    NA    ? ? 0 A   442  0 NA  8307 1_555 ? ? ? ? ? ? ? 2.958 ? 
metalc468  metalc ? ? A  C   442  O2    ? ? ? 1_555 RE NA  .    NA    ? ? 0 C   443  0 NA  8307 1_555 ? ? ? ? ? ? ? 2.798 ? 
metalc469  metalc ? ? A  A   452  "O2'" ? ? ? 1_555 IG NA  .    NA    ? ? 0 A   453  0 NA  8360 1_555 ? ? ? ? ? ? ? 2.994 ? 
metalc470  metalc ? ? A  G   463  O6    ? ? ? 1_555 PG NA  .    NA    ? ? 0 G   464  0 NA  8367 1_555 ? ? ? ? ? ? ? 2.864 ? 
metalc471  metalc ? ? A  G   474  OP2   ? ? ? 1_555 PG NA  .    NA    ? ? 0 G   475  0 NA  8367 1_555 ? ? ? ? ? ? ? 2.844 ? 
metalc472  metalc ? ? A  C   477  OP1   ? ? ? 1_555 IG NA  .    NA    ? ? 0 C   478  0 NA  8360 1_555 ? ? ? ? ? ? ? 2.937 ? 
metalc473  metalc ? ? A  G   478  OP2   ? ? ? 1_555 IG NA  .    NA    ? ? 0 G   479  0 NA  8360 1_555 ? ? ? ? ? ? ? 2.884 ? 
metalc474  metalc ? ? A  G   543  O6    ? ? ? 1_555 OG NA  .    NA    ? ? 0 G   544  0 NA  8366 1_555 ? ? ? ? ? ? ? 2.974 ? 
metalc475  metalc ? ? A  G   621  O6    ? ? ? 1_555 QF NA  .    NA    ? ? 0 G   622  0 NA  8335 1_555 ? ? ? ? ? ? ? 2.979 ? 
metalc476  metalc ? ? A  U   622  "O2'" ? ? ? 1_555 ZF NA  .    NA    ? ? 0 U   623  0 NA  8350 1_555 ? ? ? ? ? ? ? 2.768 ? 
metalc477  metalc ? ? A  U   622  O4    ? ? ? 1_555 QF NA  .    NA    ? ? 0 U   623  0 NA  8335 1_555 ? ? ? ? ? ? ? 2.781 ? 
metalc478  metalc ? ? A  A   629  "O2'" ? ? ? 1_555 PE NA  .    NA    ? ? 0 A   630  0 NA  8305 1_555 ? ? ? ? ? ? ? 2.649 ? 
metalc479  metalc ? ? A  A   629  N3    ? ? ? 1_555 PE NA  .    NA    ? ? 0 A   630  0 NA  8305 1_555 ? ? ? ? ? ? ? 2.680 ? 
metalc480  metalc ? ? A  A   630  "O2'" ? ? ? 1_555 PE NA  .    NA    ? ? 0 A   631  0 NA  8305 1_555 ? ? ? ? ? ? ? 2.946 ? 
metalc481  metalc ? ? A  A   642  OP2   ? ? ? 1_555 OE NA  .    NA    ? ? 0 A   643  0 NA  8303 1_555 ? ? ? ? ? ? ? 2.874 ? 
metalc482  metalc ? ? A  G   680  "O3'" ? ? ? 1_555 VF NA  .    NA    ? ? 0 G   681  0 NA  8341 1_555 ? ? ? ? ? ? ? 2.898 ? 
metalc483  metalc ? ? A  G   682  N7    ? ? ? 1_555 VF NA  .    NA    ? ? 0 G   683  0 NA  8341 1_555 ? ? ? ? ? ? ? 2.818 ? 
metalc484  metalc ? ? A  G   682  O6    ? ? ? 1_555 VF NA  .    NA    ? ? 0 G   683  0 NA  8341 1_555 ? ? ? ? ? ? ? 2.729 ? 
metalc485  metalc ? ? A  C   768  "O4'" ? ? ? 1_555 CG NA  .    NA    ? ? 0 C   769  0 NA  8354 1_555 ? ? ? ? ? ? ? 2.992 ? 
metalc486  metalc ? ? A  A   775  "O2'" ? ? ? 1_555 GF NA  .    NA    ? ? 0 A   776  0 NA  8325 1_555 ? ? ? ? ? ? ? 2.749 ? 
metalc487  metalc ? ? A  U   776  OP2   ? ? ? 1_555 GF NA  .    NA    ? ? 0 U   777  0 NA  8325 1_555 ? ? ? ? ? ? ? 2.833 ? 
metalc488  metalc ? ? A  U   778  O4    ? ? ? 1_555 GF NA  .    NA    ? ? 0 U   779  0 NA  8325 1_555 ? ? ? ? ? ? ? 2.730 ? 
metalc489  metalc ? ? A  U   814  O4    ? ? ? 1_555 QG NA  .    NA    ? ? 0 U   815  0 NA  8368 1_555 ? ? ? ? ? ? ? 2.834 ? 
metalc490  metalc ? ? A  G   835  "O3'" ? ? ? 1_555 DF NA  .    NA    ? ? 0 G   836  0 NA  8321 1_555 ? ? ? ? ? ? ? 2.656 ? 
metalc491  metalc ? ? A  U   836  OP1   ? ? ? 1_555 DF NA  .    NA    ? ? 0 U   837  0 NA  8321 1_555 ? ? ? ? ? ? ? 2.928 ? 
metalc492  metalc ? ? A  G   853  OP1   ? ? ? 1_555 IF NA  .    NA    ? ? 0 G   854  0 NA  8327 1_555 ? ? ? ? ? ? ? 2.744 ? 
metalc493  metalc ? ? A  G   891  N7    ? ? ? 1_555 WF NA  .    NA    ? ? 0 G   892  0 NA  8342 1_555 ? ? ? ? ? ? ? 2.848 ? 
metalc494  metalc ? ? A  C   895  "O2'" ? ? ? 1_555 YE NA  .    NA    ? ? 0 C   896  0 NA  8316 1_555 ? ? ? ? ? ? ? 2.923 ? 
metalc495  metalc ? ? A  C   895  O2    ? ? ? 1_555 YE NA  .    NA    ? ? 0 C   896  0 NA  8316 1_555 ? ? ? ? ? ? ? 2.973 ? 
metalc496  metalc ? ? A  A   896  "O4'" ? ? ? 1_555 YE NA  .    NA    ? ? 0 A   897  0 NA  8316 1_555 ? ? ? ? ? ? ? 2.910 ? 
metalc497  metalc ? ? A  G   900  OP1   ? ? ? 1_555 ZF NA  .    NA    ? ? 0 G   901  0 NA  8350 1_555 ? ? ? ? ? ? ? 2.745 ? 
metalc498  metalc ? ? A  U   902  O4    ? ? ? 1_555 AH NA  .    NA    ? ? 0 U   903  0 NA  8378 1_555 ? ? ? ? ? ? ? 2.683 ? 
metalc499  metalc ? ? A  U   903  O4    ? ? ? 1_555 OE NA  .    NA    ? ? 0 U   904  0 NA  8303 1_555 ? ? ? ? ? ? ? 2.893 ? 
metalc500  metalc ? ? A  A   913  "O3'" ? ? ? 1_555 YF NA  .    NA    ? ? 0 A   914  0 NA  8349 1_555 ? ? ? ? ? ? ? 2.816 ? 
metalc501  metalc ? ? A  C   914  OP2   ? ? ? 1_555 YF NA  .    NA    ? ? 0 C   915  0 NA  8349 1_555 ? ? ? ? ? ? ? 2.952 ? 
metalc502  metalc ? ? A  C   919  N3    ? ? ? 1_555 EG NA  .    NA    ? ? 0 C   920  0 NA  8356 1_555 ? ? ? ? ? ? ? 2.858 ? 
metalc503  metalc ? ? A  A   921  OP1   ? ? ? 1_555 HG NA  .    NA    ? ? 0 A   922  0 NA  8359 1_555 ? ? ? ? ? ? ? 2.797 ? 
metalc504  metalc ? ? A  G   923  O6    ? ? ? 1_555 UG NA  .    NA    ? ? 0 G   924  0 NA  8372 1_555 ? ? ? ? ? ? ? 2.991 ? 
metalc505  metalc ? ? A  G   940  O6    ? ? ? 1_555 FG NA  .    NA    ? ? 0 G   941  0 NA  8357 1_555 ? ? ? ? ? ? ? 2.808 ? 
metalc506  metalc ? ? A  A   1039 "O2'" ? ? ? 1_555 BG NA  .    NA    ? ? 0 A   1040 0 NA  8353 1_555 ? ? ? ? ? ? ? 2.815 ? 
metalc507  metalc ? ? A  G   1118 "O2'" ? ? ? 1_555 NE NA  .    NA    ? ? 0 G   1119 0 NA  8302 1_555 ? ? ? ? ? ? ? 2.797 ? 
metalc508  metalc ? ? A  G   1118 O6    ? ? ? 1_555 DG NA  .    NA    ? ? 0 G   1119 0 NA  8355 1_555 ? ? ? ? ? ? ? 2.815 ? 
metalc509  metalc ? ? A  U   1119 OP2   ? ? ? 1_555 NE NA  .    NA    ? ? 0 U   1120 0 NA  8302 1_555 ? ? ? ? ? ? ? 2.994 ? 
metalc510  metalc ? ? A  G   1120 O6    ? ? ? 1_555 NE NA  .    NA    ? ? 0 G   1121 0 NA  8302 1_555 ? ? ? ? ? ? ? 2.831 ? 
metalc511  metalc ? ? A  A   1132 "O3'" ? ? ? 1_555 ZH NA  .    NA    ? ? 0 A   1133 H NA  8309 1_555 ? ? ? ? ? ? ? 2.824 ? 
metalc512  metalc ? ? A  G   1133 OP1   ? ? ? 1_555 ZH NA  .    NA    ? ? 0 G   1134 H NA  8309 1_555 ? ? ? ? ? ? ? 2.997 ? 
metalc513  metalc ? ? A  U   1292 OP2   ? ? ? 1_555 ZG NA  .    NA    ? ? 0 U   1293 0 NA  8377 1_555 ? ? ? ? ? ? ? 2.695 ? 
metalc514  metalc ? ? A  G   1294 O6    ? ? ? 1_555 ZG NA  .    NA    ? ? 0 G   1295 0 NA  8377 1_555 ? ? ? ? ? ? ? 2.718 ? 
metalc515  metalc ? ? A  A   1295 OP1   ? ? ? 1_555 BG NA  .    NA    ? ? 0 A   1296 0 NA  8353 1_555 ? ? ? ? ? ? ? 2.778 ? 
metalc516  metalc ? ? A  G   1416 OP1   ? ? ? 1_555 ZE NA  .    NA    ? ? 0 G   1417 0 NA  8317 1_555 ? ? ? ? ? ? ? 2.724 ? 
metalc517  metalc ? ? A  G   1575 O6    ? ? ? 1_555 VG NA  .    NA    ? ? 0 G   1576 0 NA  8373 1_555 ? ? ? ? ? ? ? 2.737 ? 
metalc518  metalc ? ? A  G   1618 O6    ? ? ? 1_555 VG NA  .    NA    ? ? 0 G   1619 0 NA  8373 1_555 ? ? ? ? ? ? ? 2.837 ? 
metalc519  metalc ? ? A  U   1739 O4    ? ? ? 1_555 UF NA  .    NA    ? ? 0 U   1740 0 NA  8340 1_555 ? ? ? ? ? ? ? 2.760 ? 
metalc520  metalc ? ? A  U   1740 O4    ? ? ? 1_555 UF NA  .    NA    ? ? 0 U   1741 0 NA  8340 1_555 ? ? ? ? ? ? ? 2.980 ? 
metalc521  metalc ? ? A  G   1831 OP2   ? ? ? 1_555 SG NA  .    NA    ? ? 0 G   1832 0 NA  8370 1_555 ? ? ? ? ? ? ? 2.679 ? 
metalc522  metalc ? ? A  C   1893 O2    ? ? ? 1_555 PF NA  .    NA    ? ? 0 C   1894 0 NA  8334 1_555 ? ? ? ? ? ? ? 2.730 ? 
metalc523  metalc ? ? A  G   1895 N7    ? ? ? 1_555 PF NA  .    NA    ? ? 0 G   1896 0 NA  8334 1_555 ? ? ? ? ? ? ? 2.830 ? 
metalc524  metalc ? ? A  G   1895 O6    ? ? ? 1_555 PF NA  .    NA    ? ? 0 G   1896 0 NA  8334 1_555 ? ? ? ? ? ? ? 2.771 ? 
metalc525  metalc ? ? A  U   1896 O4    ? ? ? 1_555 OF NA  .    NA    ? ? 0 U   1897 0 NA  8333 1_555 ? ? ? ? ? ? ? 2.618 ? 
metalc526  metalc ? ? A  G   1897 O6    ? ? ? 1_555 OF NA  .    NA    ? ? 0 G   1898 0 NA  8333 1_555 ? ? ? ? ? ? ? 2.766 ? 
metalc527  metalc ? ? A  U   1938 O4    ? ? ? 1_555 OF NA  .    NA    ? ? 0 U   1939 0 NA  8333 1_555 ? ? ? ? ? ? ? 2.841 ? 
metalc528  metalc ? ? A  A   2009 OP2   ? ? ? 1_555 HF NA  .    NA    ? ? 0 A   2010 0 NA  8326 1_555 ? ? ? ? ? ? ? 2.770 ? 
metalc529  metalc ? ? A  U   2056 O4    ? ? ? 1_555 MG NA  .    NA    ? ? 0 U   2057 0 NA  8364 1_555 ? ? ? ? ? ? ? 2.801 ? 
metalc530  metalc ? ? A  G   2057 O6    ? ? ? 1_555 MG NA  .    NA    ? ? 0 G   2058 0 NA  8364 1_555 ? ? ? ? ? ? ? 2.781 ? 
metalc531  metalc ? ? A  G   2093 N7    ? ? ? 1_555 QE NA  .    NA    ? ? 0 G   2094 0 NA  8306 1_555 ? ? ? ? ? ? ? 2.781 ? 
metalc532  metalc ? ? A  U   2108 OP2   ? ? ? 1_555 HG NA  .    NA    ? ? 0 U   2109 0 NA  8359 1_555 ? ? ? ? ? ? ? 2.649 ? 
metalc533  metalc ? ? A  G   2109 OP2   ? ? ? 1_555 KG NA  .    NA    ? ? 0 G   2110 0 NA  8362 1_555 ? ? ? ? ? ? ? 2.781 ? 
metalc534  metalc ? ? A  G   2110 OP1   ? ? ? 1_555 KG NA  .    NA    ? ? 0 G   2111 0 NA  8362 1_555 ? ? ? ? ? ? ? 2.907 ? 
metalc535  metalc ? ? A  A   2111 N3    ? ? ? 1_555 EF NA  .    NA    ? ? 0 A   2112 0 NA  8323 1_555 ? ? ? ? ? ? ? 2.748 ? 
metalc536  metalc ? ? A  U   2277 OP1   ? ? ? 1_555 EG NA  .    NA    ? ? 0 U   2278 0 NA  8356 1_555 ? ? ? ? ? ? ? 2.825 ? 
metalc537  metalc ? ? A  C   2474 N4    ? ? ? 1_555 EF NA  .    NA    ? ? 0 C   2475 0 NA  8323 1_555 ? ? ? ? ? ? ? 2.791 ? 
metalc538  metalc ? ? A  U   2491 O4    ? ? ? 1_555 TG NA  .    NA    ? ? 0 U   2492 0 NA  8371 1_555 ? ? ? ? ? ? ? 2.873 ? 
metalc539  metalc ? ? A  G   2523 N7    ? ? ? 1_555 UE NA  .    NA    ? ? 0 G   2524 0 NA  8311 1_555 ? ? ? ? ? ? ? 2.735 ? 
metalc540  metalc ? ? A  G   2528 O6    ? ? ? 1_555 TG NA  .    NA    ? ? 0 G   2529 0 NA  8371 1_555 ? ? ? ? ? ? ? 2.646 ? 
metalc541  metalc ? ? A  A   2537 OP1   ? ? ? 1_555 YG NA  .    NA    ? ? 0 A   2538 0 NA  8376 1_555 ? ? ? ? ? ? ? 2.887 ? 
metalc542  metalc ? ? A  A   2537 "O5'" ? ? ? 1_555 YG NA  .    NA    ? ? 0 A   2538 0 NA  8376 1_555 ? ? ? ? ? ? ? 2.970 ? 
metalc543  metalc ? ? A  U   2538 OP2   ? ? ? 1_555 YG NA  .    NA    ? ? 0 U   2539 0 NA  8376 1_555 ? ? ? ? ? ? ? 2.929 ? 
metalc544  metalc ? ? A  G   2539 O6    ? ? ? 1_555 TF NA  .    NA    ? ? 0 G   2540 0 NA  8339 1_555 ? ? ? ? ? ? ? 2.625 ? 
metalc545  metalc ? ? A  G   2542 O6    ? ? ? 1_555 CF NA  .    NA    ? ? 0 G   2543 0 NA  8320 1_555 ? ? ? ? ? ? ? 2.871 ? 
metalc546  metalc ? ? A  G   2578 O6    ? ? ? 1_555 TE NA  .    NA    ? ? 0 G   2579 0 NA  8310 1_555 ? ? ? ? ? ? ? 2.673 ? 
metalc547  metalc ? ? A  G   2584 O6    ? ? ? 1_555 CH NA  .    NA    ? ? 0 G   2585 0 NA  8381 1_555 ? ? ? ? ? ? ? 2.949 ? 
metalc548  metalc ? ? A  U   2606 O2    ? ? ? 1_555 WE NA  .    NA    ? ? 0 U   2607 0 NA  8314 1_555 ? ? ? ? ? ? ? 2.630 ? 
metalc549  metalc ? ? A  G   2610 OP1   ? ? ? 1_555 GG NA  .    NA    ? ? 0 G   2611 0 NA  8358 1_555 ? ? ? ? ? ? ? 2.869 ? 
metalc550  metalc ? ? A  U   2614 O4    ? ? ? 1_555 CF NA  .    NA    ? ? 0 U   2615 0 NA  8320 1_555 ? ? ? ? ? ? ? 2.913 ? 
metalc551  metalc ? ? A  U   2644 "O2'" ? ? ? 1_555 TF NA  .    NA    ? ? 0 U   2645 0 NA  8339 1_555 ? ? ? ? ? ? ? 2.922 ? 
metalc552  metalc ? ? A  U   2644 O2    ? ? ? 1_555 TF NA  .    NA    ? ? 0 U   2645 0 NA  8339 1_555 ? ? ? ? ? ? ? 2.944 ? 
metalc553  metalc ? ? A  A   2648 N1    ? ? ? 1_555 QE NA  .    NA    ? ? 0 A   2649 0 NA  8306 1_555 ? ? ? ? ? ? ? 2.856 ? 
metalc554  metalc ? ? A  U   2662 O2    ? ? ? 1_555 XF NA  .    NA    ? ? 0 U   2663 0 NA  8344 1_555 ? ? ? ? ? ? ? 2.601 ? 
metalc555  metalc ? ? A  G   2771 O6    ? ? ? 1_555 DH NA  .    NA    ? ? 0 G   2772 0 NA  8382 1_555 ? ? ? ? ? ? ? 2.734 ? 
metalc556  metalc ? ? A  A   2810 "O3'" ? ? ? 1_555 XF NA  .    NA    ? ? 0 A   2811 0 NA  8344 1_555 ? ? ? ? ? ? ? 2.722 ? 
metalc557  metalc ? ? A  A   2810 "O2'" ? ? ? 1_555 XF NA  .    NA    ? ? 0 A   2811 0 NA  8344 1_555 ? ? ? ? ? ? ? 2.691 ? 
metalc558  metalc ? ? A  A   2815 "O2'" ? ? ? 1_555 XF NA  .    NA    ? ? 0 A   2816 0 NA  8344 1_555 ? ? ? ? ? ? ? 2.774 ? 
metalc559  metalc ? ? A  G   2816 OP2   ? ? ? 1_555 XF NA  .    NA    ? ? 0 G   2817 0 NA  8344 1_555 ? ? ? ? ? ? ? 2.877 ? 
metalc560  metalc ? ? B  C   40   O2    ? ? ? 1_555 RH NA  .    NA    ? ? 9 C   40   9 NA  8351 1_555 ? ? ? ? ? ? ? 2.958 ? 
metalc561  metalc ? ? B  U   82   OP1   ? ? ? 1_555 AG NA  .    NA    ? ? 9 U   82   0 NA  8352 1_555 ? ? ? ? ? ? ? 2.930 ? 
metalc562  metalc ? ? D  GLN 231  O     ? ? ? 1_555 JG NA  .    NA    ? ? B GLN 230  0 NA  8361 1_555 ? ? ? ? ? ? ? 2.768 ? 
metalc563  metalc ? ? E  ARG 55   O     ? ? ? 1_555 PG NA  .    NA    ? ? C ARG 55   0 NA  8367 1_555 ? ? ? ? ? ? ? 2.905 ? 
metalc564  metalc ? ? E  THR 94   O     ? ? ? 1_555 YH NA  .    NA    ? ? C THR 94   C NA  8304 1_555 ? ? ? ? ? ? ? 2.962 ? 
metalc565  metalc ? ? E  LYS 96   O     ? ? ? 1_555 YH NA  .    NA    ? ? C LYS 96   C NA  8304 1_555 ? ? ? ? ? ? ? 2.630 ? 
metalc566  metalc ? ? J  TYR 154  O     ? ? ? 1_555 ZH NA  .    NA    ? ? H TYR 154  H NA  8309 1_555 ? ? ? ? ? ? ? 2.733 ? 
metalc567  metalc ? ? J  ILE 157  O     ? ? ? 1_555 ZH NA  .    NA    ? ? H ILE 157  H NA  8309 1_555 ? ? ? ? ? ? ? 2.738 ? 
metalc568  metalc ? ? J  PRO 159  O     ? ? ? 1_555 ZH NA  .    NA    ? ? H PRO 159  H NA  8309 1_555 ? ? ? ? ? ? ? 2.619 ? 
metalc569  metalc ? ? L  ARG 60   O     ? ? ? 1_555 BI NA  .    NA    ? ? J ARG 60   J NA  8346 1_555 ? ? ? ? ? ? ? 2.771 ? 
metalc570  metalc ? ? L  VAL 61   O     ? ? ? 1_555 BI NA  .    NA    ? ? J VAL 61   J NA  8346 1_555 ? ? ? ? ? ? ? 2.772 ? 
metalc571  metalc ? ? N  GLY 15   O     ? ? ? 1_555 BG NA  .    NA    ? ? L GLY 14   0 NA  8353 1_555 ? ? ? ? ? ? ? 2.869 ? 
metalc572  metalc ? ? N  GLY 30   O     ? ? ? 1_555 GI NA  .    NA    ? ? L GLY 29   L NA  8380 1_555 ? ? ? ? ? ? ? 2.935 ? 
metalc573  metalc ? ? N  ALA 34   O     ? ? ? 1_555 GI NA  .    NA    ? ? L ALA 33   L NA  8380 1_555 ? ? ? ? ? ? ? 2.715 ? 
metalc574  metalc ? ? O  SER 106  O     ? ? ? 1_555 II NA  .    NA    ? ? M SER 106  M NA  8347 1_555 ? ? ? ? ? ? ? 2.657 ? 
metalc575  metalc ? ? O  SER 106  OG    ? ? ? 1_555 II NA  .    NA    ? ? M SER 106  M NA  8347 1_555 ? ? ? ? ? ? ? 2.639 ? 
metalc576  metalc ? ? O  PHE 109  O     ? ? ? 1_555 II NA  .    NA    ? ? M PHE 109  M NA  8347 1_555 ? ? ? ? ? ? ? 2.722 ? 
metalc577  metalc ? ? O  LYS 193  O     ? ? ? 1_555 NG NA  .    NA    ? ? M LYS 193  0 NA  8365 1_555 ? ? ? ? ? ? ? 2.824 ? 
metalc578  metalc ? ? S  SER 25   OG    ? ? ? 1_555 NI NA  .    NA    ? ? Q SER 24   Q NA  8348 1_555 ? ? ? ? ? ? ? 2.913 ? 
metalc579  metalc ? ? T  VAL 73   O     ? ? ? 1_555 OI NA  .    NA    ? ? R VAL 72   R NA  8337 1_555 ? ? ? ? ? ? ? 2.853 ? 
metalc580  metalc ? ? U  GLU 62   OE1   ? ? ? 1_555 RI NA  .    NA    ? ? S GLU 61   S NA  8312 1_555 ? ? ? ? ? ? ? 2.634 ? 
metalc581  metalc ? ? DA TRP 43   O     ? ? ? 1_555 ZE NA  .    NA    ? ? 2 TRP 42   0 NA  8317 1_555 ? ? ? ? ? ? ? 2.614 ? 
metalc582  metalc ? ? ME NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8301 0 HOH 9688 1_555 ? ? ? ? ? ? ? 2.745 ? 
metalc583  metalc ? ? QE NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8306 0 HOH 8646 1_555 ? ? ? ? ? ? ? 2.968 ? 
metalc584  metalc ? ? UE NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8311 0 HOH 8701 1_555 ? ? ? ? ? ? ? 2.746 ? 
metalc585  metalc ? ? XE NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8315 0 HOH 9207 1_555 ? ? ? ? ? ? ? 2.885 ? 
metalc586  metalc ? ? AF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8318 0 HOH 8730 1_555 ? ? ? ? ? ? ? 2.899 ? 
metalc587  metalc ? ? AF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8318 0 HOH 9986 1_555 ? ? ? ? ? ? ? 2.835 ? 
metalc588  metalc ? ? BF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8319 0 HOH 8580 1_555 ? ? ? ? ? ? ? 2.826 ? 
metalc589  metalc ? ? BF NA  .    NA    ? ? ? 1_555 PJ HOH .    O     ? ? 0 NA  8319 L HOH 8535 1_555 ? ? ? ? ? ? ? 2.704 ? 
metalc590  metalc ? ? CF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8320 0 HOH 8607 1_555 ? ? ? ? ? ? ? 2.812 ? 
metalc591  metalc ? ? FF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8324 0 HOH 9012 1_555 ? ? ? ? ? ? ? 2.838 ? 
metalc592  metalc ? ? IF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8327 0 HOH 9724 1_555 ? ? ? ? ? ? ? 2.793 ? 
metalc593  metalc ? ? IF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8327 0 HOH 9253 1_555 ? ? ? ? ? ? ? 2.863 ? 
metalc594  metalc ? ? LF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8330 0 HOH 8753 1_555 ? ? ? ? ? ? ? 2.729 ? 
metalc595  metalc ? ? MF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8331 0 HOH 8821 1_555 ? ? ? ? ? ? ? 2.859 ? 
metalc596  metalc ? ? QF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8335 0 HOH 9394 1_555 ? ? ? ? ? ? ? 2.723 ? 
metalc597  metalc ? ? OI NA  .    NA    ? ? ? 1_555 VJ HOH .    O     ? ? R NA  8337 R HOH 8526 1_555 ? ? ? ? ? ? ? 2.713 ? 
metalc598  metalc ? ? TF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8339 0 HOH 9549 1_555 ? ? ? ? ? ? ? 2.874 ? 
metalc599  metalc ? ? UH NA  .    NA    ? ? ? 1_555 EJ HOH .    O     ? ? A NA  8345 A HOH 8558 1_555 ? ? ? ? ? ? ? 2.735 ? 
metalc600  metalc ? ? BI NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? J NA  8346 0 HOH 9003 1_555 ? ? ? ? ? ? ? 2.738 ? 
metalc601  metalc ? ? NI NA  .    NA    ? ? ? 1_555 UJ HOH .    O     ? ? Q NA  8348 Q HOH 5427 1_555 ? ? ? ? ? ? ? 2.873 ? 
metalc602  metalc ? ? BG NA  .    NA    ? ? ? 1_555 PJ HOH .    O     ? ? 0 NA  8353 L HOH 8514 1_555 ? ? ? ? ? ? ? 2.751 ? 
metalc603  metalc ? ? EG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8356 0 HOH 8973 1_555 ? ? ? ? ? ? ? 2.960 ? 
metalc604  metalc ? ? GG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8358 0 HOH 9004 1_555 ? ? ? ? ? ? ? 2.611 ? 
metalc605  metalc ? ? LG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8363 0 HOH 9999 1_555 ? ? ? ? ? ? ? 2.736 ? 
metalc606  metalc ? ? MG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8364 0 HOH 9339 1_555 ? ? ? ? ? ? ? 2.740 ? 
metalc607  metalc ? ? OG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8366 0 HOH 9406 1_555 ? ? ? ? ? ? ? 2.609 ? 
metalc608  metalc ? ? PG NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  8367 C HOH 8383 1_555 ? ? ? ? ? ? ? 2.718 ? 
metalc609  metalc ? ? RG NA  .    NA    ? ? ? 1_555 GK HOH .    O     ? ? 0 NA  8369 3 HOH 8542 1_555 ? ? ? ? ? ? ? 2.778 ? 
metalc610  metalc ? ? SG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8370 0 HOH 8624 1_555 ? ? ? ? ? ? ? 2.778 ? 
metalc611  metalc ? ? TG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8371 0 HOH 9145 1_555 ? ? ? ? ? ? ? 2.999 ? 
metalc612  metalc ? ? XG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8375 0 HOH 8783 1_555 ? ? ? ? ? ? ? 2.975 ? 
metalc613  metalc ? ? AH NA  .    NA    ? ? ? 1_555 PJ HOH .    O     ? ? 0 NA  8378 L HOH 8550 1_555 ? ? ? ? ? ? ? 2.653 ? 
metalc614  metalc ? ? AH NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8378 0 HOH 9728 1_555 ? ? ? ? ? ? ? 2.860 ? 
metalc615  metalc ? ? AH NA  .    NA    ? ? ? 1_555 PJ HOH .    O     ? ? 0 NA  8378 L HOH 8530 1_555 ? ? ? ? ? ? ? 2.608 ? 
metalc616  metalc ? ? SH NA  .    NA    ? ? ? 1_555 DJ HOH .    O     ? ? 9 NA  8383 9 HOH 8510 1_555 ? ? ? ? ? ? ? 2.909 ? 
metalc617  metalc ? ? FA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8001 0 HOH 7282 1_555 ? ? ? ? ? ? ? 2.016 ? 
metalc618  metalc ? ? FA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8001 0 HOH 3137 1_555 ? ? ? ? ? ? ? 2.213 ? 
metalc619  metalc ? ? GA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8002 0 HOH 3851 1_555 ? ? ? ? ? ? ? 1.911 ? 
metalc620  metalc ? ? GA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8002 0 HOH 7260 1_555 ? ? ? ? ? ? ? 2.043 ? 
metalc621  metalc ? ? GA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8002 0 HOH 7261 1_555 ? ? ? ? ? ? ? 2.237 ? 
metalc622  metalc ? ? HA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8003 0 HOH 3188 1_555 ? ? ? ? ? ? ? 2.215 ? 
metalc623  metalc ? ? IA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8004 0 HOH 7267 1_555 ? ? ? ? ? ? ? 2.058 ? 
metalc624  metalc ? ? IA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8004 0 HOH 3305 1_555 ? ? ? ? ? ? ? 1.930 ? 
metalc625  metalc ? ? JA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8005 0 HOH 3134 1_555 ? ? ? ? ? ? ? 2.019 ? 
metalc626  metalc ? ? JA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8005 0 HOH 7283 1_555 ? ? ? ? ? ? ? 2.029 ? 
metalc627  metalc ? ? JA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8005 0 HOH 7284 1_555 ? ? ? ? ? ? ? 2.044 ? 
metalc628  metalc ? ? KA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8006 0 HOH 3139 1_555 ? ? ? ? ? ? ? 2.126 ? 
metalc629  metalc ? ? KA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8006 0 HOH 3276 1_555 ? ? ? ? ? ? ? 2.333 ? 
metalc630  metalc ? ? LA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8007 0 HOH 7272 1_555 ? ? ? ? ? ? ? 2.121 ? 
metalc631  metalc ? ? MA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8008 0 HOH 3151 1_555 ? ? ? ? ? ? ? 2.057 ? 
metalc632  metalc ? ? MA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8008 0 HOH 7359 1_555 ? ? ? ? ? ? ? 2.033 ? 
metalc633  metalc ? ? MA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8008 0 HOH 7276 1_555 ? ? ? ? ? ? ? 1.966 ? 
metalc634  metalc ? ? NA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8009 0 HOH 3261 1_555 ? ? ? ? ? ? ? 1.974 ? 
metalc635  metalc ? ? NA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8009 0 HOH 6939 1_555 ? ? ? ? ? ? ? 2.001 ? 
metalc636  metalc ? ? NA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8009 0 HOH 7278 1_555 ? ? ? ? ? ? ? 1.901 ? 
metalc637  metalc ? ? NA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8009 0 HOH 7277 1_555 ? ? ? ? ? ? ? 2.355 ? 
metalc638  metalc ? ? OA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8010 0 HOH 3360 1_555 ? ? ? ? ? ? ? 1.988 ? 
metalc639  metalc ? ? PA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8011 0 HOH 4055 1_555 ? ? ? ? ? ? ? 2.163 ? 
metalc640  metalc ? ? PA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8011 0 HOH 3481 1_555 ? ? ? ? ? ? ? 1.897 ? 
metalc641  metalc ? ? PA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8011 0 HOH 3815 1_555 ? ? ? ? ? ? ? 1.936 ? 
metalc642  metalc ? ? PA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8011 0 HOH 3951 1_555 ? ? ? ? ? ? ? 1.993 ? 
metalc643  metalc ? ? QA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8012 0 HOH 7360 1_555 ? ? ? ? ? ? ? 2.182 ? 
metalc644  metalc ? ? RA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8013 0 HOH 3163 1_555 ? ? ? ? ? ? ? 2.270 ? 
metalc645  metalc ? ? RA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8013 0 HOH 3176 1_555 ? ? ? ? ? ? ? 1.990 ? 
metalc646  metalc ? ? SA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8014 0 HOH 3688 1_555 ? ? ? ? ? ? ? 2.169 ? 
metalc647  metalc ? ? SA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8014 0 HOH 3181 1_555 ? ? ? ? ? ? ? 2.161 ? 
metalc648  metalc ? ? SA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8014 0 HOH 7258 1_555 ? ? ? ? ? ? ? 2.085 ? 
metalc649  metalc ? ? TA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8015 0 HOH 3143 1_555 ? ? ? ? ? ? ? 2.048 ? 
metalc650  metalc ? ? TA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8015 0 HOH 7292 1_555 ? ? ? ? ? ? ? 2.010 ? 
metalc651  metalc ? ? UA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8016 0 HOH 7285 1_555 ? ? ? ? ? ? ? 2.112 ? 
metalc652  metalc ? ? UA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8016 0 HOH 3268 1_555 ? ? ? ? ? ? ? 2.148 ? 
metalc653  metalc ? ? UA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8016 0 HOH 7286 1_555 ? ? ? ? ? ? ? 1.940 ? 
metalc654  metalc ? ? VA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8017 0 HOH 3465 1_555 ? ? ? ? ? ? ? 1.931 ? 
metalc655  metalc ? ? VA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8017 0 HOH 7268 1_555 ? ? ? ? ? ? ? 2.081 ? 
metalc656  metalc ? ? WA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8018 0 HOH 6975 1_555 ? ? ? ? ? ? ? 1.919 ? 
metalc657  metalc ? ? WA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8018 0 HOH 3135 1_555 ? ? ? ? ? ? ? 2.178 ? 
metalc658  metalc ? ? WA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8018 0 HOH 7361 1_555 ? ? ? ? ? ? ? 2.047 ? 
metalc659  metalc ? ? XA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8019 0 HOH 3675 1_555 ? ? ? ? ? ? ? 2.213 ? 
metalc660  metalc ? ? XA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8019 0 HOH 6750 1_555 ? ? ? ? ? ? ? 1.980 ? 
metalc661  metalc ? ? XA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8019 0 HOH 7288 1_555 ? ? ? ? ? ? ? 2.200 ? 
metalc662  metalc ? ? XA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8019 0 HOH 7289 1_555 ? ? ? ? ? ? ? 1.976 ? 
metalc663  metalc ? ? XA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8019 0 HOH 7287 1_555 ? ? ? ? ? ? ? 2.145 ? 
metalc664  metalc ? ? YA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8020 0 HOH 7290 1_555 ? ? ? ? ? ? ? 1.832 ? 
metalc665  metalc ? ? YA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8020 0 HOH 7271 1_555 ? ? ? ? ? ? ? 2.002 ? 
metalc666  metalc ? ? ZA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8021 0 HOH 7274 1_555 ? ? ? ? ? ? ? 1.784 ? 
metalc667  metalc ? ? ZA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8021 0 HOH 3159 1_555 ? ? ? ? ? ? ? 2.021 ? 
metalc668  metalc ? ? ZA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8021 0 HOH 3160 1_555 ? ? ? ? ? ? ? 2.172 ? 
metalc669  metalc ? ? ZA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8021 0 HOH 7275 1_555 ? ? ? ? ? ? ? 1.888 ? 
metalc670  metalc ? ? AB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8022 0 HOH 3390 1_555 ? ? ? ? ? ? ? 2.211 ? 
metalc671  metalc ? ? AB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8022 0 HOH 7279 1_555 ? ? ? ? ? ? ? 2.101 ? 
metalc672  metalc ? ? BB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8023 0 HOH 3149 1_555 ? ? ? ? ? ? ? 2.234 ? 
metalc673  metalc ? ? BB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8023 0 HOH 3342 1_555 ? ? ? ? ? ? ? 2.218 ? 
metalc674  metalc ? ? BB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8023 0 HOH 7295 1_555 ? ? ? ? ? ? ? 1.939 ? 
metalc675  metalc ? ? BB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8023 0 HOH 7294 1_555 ? ? ? ? ? ? ? 2.008 ? 
metalc676  metalc ? ? CB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8024 0 HOH 7362 1_555 ? ? ? ? ? ? ? 1.899 ? 
metalc677  metalc ? ? DB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8025 0 HOH 7364 1_555 ? ? ? ? ? ? ? 2.019 ? 
metalc678  metalc ? ? DB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8025 0 HOH 7297 1_555 ? ? ? ? ? ? ? 1.953 ? 
metalc679  metalc ? ? DB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8025 0 HOH 3693 1_555 ? ? ? ? ? ? ? 2.331 ? 
metalc680  metalc ? ? DB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8025 0 HOH 7296 1_555 ? ? ? ? ? ? ? 1.936 ? 
metalc681  metalc ? ? EB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8026 0 HOH 7298 1_555 ? ? ? ? ? ? ? 2.170 ? 
metalc682  metalc ? ? EB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8026 0 HOH 7299 1_555 ? ? ? ? ? ? ? 1.978 ? 
metalc683  metalc ? ? FB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8027 0 HOH 3680 1_555 ? ? ? ? ? ? ? 2.435 ? 
metalc684  metalc ? ? FB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8027 0 HOH 3393 1_555 ? ? ? ? ? ? ? 2.289 ? 
metalc685  metalc ? ? FB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8027 0 HOH 3538 1_555 ? ? ? ? ? ? ? 1.996 ? 
metalc686  metalc ? ? FB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8027 0 HOH 7365 1_555 ? ? ? ? ? ? ? 2.124 ? 
metalc687  metalc ? ? GB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8028 0 HOH 3233 1_555 ? ? ? ? ? ? ? 2.066 ? 
metalc688  metalc ? ? GB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8028 0 HOH 3200 1_555 ? ? ? ? ? ? ? 2.058 ? 
metalc689  metalc ? ? GB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8028 0 HOH 3221 1_555 ? ? ? ? ? ? ? 2.163 ? 
metalc690  metalc ? ? HB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8029 0 HOH 7302 1_555 ? ? ? ? ? ? ? 1.937 ? 
metalc691  metalc ? ? HB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8029 0 HOH 7304 1_555 ? ? ? ? ? ? ? 2.040 ? 
metalc692  metalc ? ? HB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8029 0 HOH 7305 1_555 ? ? ? ? ? ? ? 1.950 ? 
metalc693  metalc ? ? HB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8029 0 HOH 7303 1_555 ? ? ? ? ? ? ? 2.167 ? 
metalc694  metalc ? ? IB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8030 0 HOH 7280 1_555 ? ? ? ? ? ? ? 2.158 ? 
metalc695  metalc ? ? IB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8030 0 HOH 3161 1_555 ? ? ? ? ? ? ? 2.145 ? 
metalc696  metalc ? ? IB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8030 0 HOH 7269 1_555 ? ? ? ? ? ? ? 1.968 ? 
metalc697  metalc ? ? IB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8030 0 HOH 7270 1_555 ? ? ? ? ? ? ? 2.083 ? 
metalc698  metalc ? ? JB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8031 0 HOH 7307 1_555 ? ? ? ? ? ? ? 2.024 ? 
metalc699  metalc ? ? JB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8031 0 HOH 7308 1_555 ? ? ? ? ? ? ? 2.091 ? 
metalc700  metalc ? ? JB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8031 0 HOH 7309 1_555 ? ? ? ? ? ? ? 1.915 ? 
metalc701  metalc ? ? KB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8032 0 HOH 3311 1_555 ? ? ? ? ? ? ? 2.216 ? 
metalc702  metalc ? ? KB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8032 0 HOH 3714 1_555 ? ? ? ? ? ? ? 2.151 ? 
metalc703  metalc ? ? LB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8033 0 HOH 3337 1_555 ? ? ? ? ? ? ? 2.146 ? 
metalc704  metalc ? ? MB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8034 0 HOH 4392 1_555 ? ? ? ? ? ? ? 2.012 ? 
metalc705  metalc ? ? MB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8034 0 HOH 3164 1_555 ? ? ? ? ? ? ? 2.091 ? 
metalc706  metalc ? ? MB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8034 0 HOH 7310 1_555 ? ? ? ? ? ? ? 1.860 ? 
metalc707  metalc ? ? MB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8034 0 HOH 3292 1_555 ? ? ? ? ? ? ? 2.322 ? 
metalc708  metalc ? ? NB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8035 0 HOH 3238 1_555 ? ? ? ? ? ? ? 2.241 ? 
metalc709  metalc ? ? NB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8035 0 HOH 7312 1_555 ? ? ? ? ? ? ? 2.112 ? 
metalc710  metalc ? ? NB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8035 0 HOH 7368 1_555 ? ? ? ? ? ? ? 2.352 ? 
metalc711  metalc ? ? NB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8035 0 HOH 7311 1_555 ? ? ? ? ? ? ? 2.416 ? 
metalc712  metalc ? ? NB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8035 0 HOH 7367 1_555 ? ? ? ? ? ? ? 1.933 ? 
metalc713  metalc ? ? OB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8036 0 HOH 7313 1_555 ? ? ? ? ? ? ? 2.223 ? 
metalc714  metalc ? ? OB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8036 0 HOH 3192 1_555 ? ? ? ? ? ? ? 2.116 ? 
metalc715  metalc ? ? OB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8036 0 HOH 7314 1_555 ? ? ? ? ? ? ? 1.908 ? 
metalc716  metalc ? ? OB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8036 0 HOH 7315 1_555 ? ? ? ? ? ? ? 1.980 ? 
metalc717  metalc ? ? PB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8037 0 HOH 7369 1_555 ? ? ? ? ? ? ? 2.157 ? 
metalc718  metalc ? ? PB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8037 0 HOH 3170 1_555 ? ? ? ? ? ? ? 2.105 ? 
metalc719  metalc ? ? QB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8038 0 HOH 3147 1_555 ? ? ? ? ? ? ? 1.961 ? 
metalc720  metalc ? ? QB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8038 0 HOH 7317 1_555 ? ? ? ? ? ? ? 1.971 ? 
metalc721  metalc ? ? QB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8038 0 HOH 3171 1_555 ? ? ? ? ? ? ? 2.006 ? 
metalc722  metalc ? ? QB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8038 0 HOH 3193 1_555 ? ? ? ? ? ? ? 2.110 ? 
metalc723  metalc ? ? QB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8038 0 HOH 3195 1_555 ? ? ? ? ? ? ? 2.093 ? 
metalc724  metalc ? ? RB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8039 0 HOH 3488 1_555 ? ? ? ? ? ? ? 2.180 ? 
metalc725  metalc ? ? RB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8039 0 HOH 7319 1_555 ? ? ? ? ? ? ? 2.353 ? 
metalc726  metalc ? ? RB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8039 0 HOH 7318 1_555 ? ? ? ? ? ? ? 1.988 ? 
metalc727  metalc ? ? SB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8040 0 HOH 3312 1_555 ? ? ? ? ? ? ? 2.298 ? 
metalc728  metalc ? ? SB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8040 0 HOH 4168 1_555 ? ? ? ? ? ? ? 2.459 ? 
metalc729  metalc ? ? SB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8040 0 HOH 7372 1_555 ? ? ? ? ? ? ? 2.115 ? 
metalc730  metalc ? ? SB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8040 0 HOH 7371 1_555 ? ? ? ? ? ? ? 1.982 ? 
metalc731  metalc ? ? TB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8041 0 HOH 3632 1_555 ? ? ? ? ? ? ? 2.268 ? 
metalc732  metalc ? ? TB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8041 0 HOH 3725 1_555 ? ? ? ? ? ? ? 2.300 ? 
metalc733  metalc ? ? UB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8042 0 HOH 7320 1_555 ? ? ? ? ? ? ? 2.326 ? 
metalc734  metalc ? ? UB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8042 0 HOH 3179 1_555 ? ? ? ? ? ? ? 2.455 ? 
metalc735  metalc ? ? VB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8043 0 HOH 7373 1_555 ? ? ? ? ? ? ? 2.485 ? 
metalc736  metalc ? ? VB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8043 0 HOH 6929 1_555 ? ? ? ? ? ? ? 2.354 ? 
metalc737  metalc ? ? XB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8045 0 HOH 7376 1_555 ? ? ? ? ? ? ? 2.331 ? 
metalc738  metalc ? ? XB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8045 0 HOH 7321 1_555 ? ? ? ? ? ? ? 2.111 ? 
metalc739  metalc ? ? YB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8046 0 HOH 7377 1_555 ? ? ? ? ? ? ? 2.060 ? 
metalc740  metalc ? ? YB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8046 0 HOH 7378 1_555 ? ? ? ? ? ? ? 2.368 ? 
metalc741  metalc ? ? ZB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8047 0 HOH 5796 1_555 ? ? ? ? ? ? ? 2.203 ? 
metalc742  metalc ? ? ZB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8047 0 HOH 7392 1_555 ? ? ? ? ? ? ? 1.871 ? 
metalc743  metalc ? ? AC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8048 0 HOH 7414 1_555 ? ? ? ? ? ? ? 2.050 ? 
metalc744  metalc ? ? AC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8048 0 HOH 5787 1_555 ? ? ? ? ? ? ? 2.226 ? 
metalc745  metalc ? ? AC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8048 0 HOH 5403 1_555 ? ? ? ? ? ? ? 2.133 ? 
metalc746  metalc ? ? BC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8049 0 HOH 7380 1_555 ? ? ? ? ? ? ? 2.422 ? 
metalc747  metalc ? ? CC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8050 0 HOH 6835 1_555 ? ? ? ? ? ? ? 2.479 ? 
metalc748  metalc ? ? DC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8051 0 HOH 3627 1_555 ? ? ? ? ? ? ? 2.466 ? 
metalc749  metalc ? ? DC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8051 0 HOH 7322 1_555 ? ? ? ? ? ? ? 2.032 ? 
metalc750  metalc ? ? DC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8051 0 HOH 7323 1_555 ? ? ? ? ? ? ? 2.276 ? 
metalc751  metalc ? ? EC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8052 0 HOH 7394 1_555 ? ? ? ? ? ? ? 2.384 ? 
metalc752  metalc ? ? EC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8052 0 HOH 3145 1_555 ? ? ? ? ? ? ? 2.063 ? 
metalc753  metalc ? ? FC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8053 0 HOH 5142 1_555 ? ? ? ? ? ? ? 2.224 ? 
metalc754  metalc ? ? GC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8054 0 HOH 7273 1_555 ? ? ? ? ? ? ? 1.967 ? 
metalc755  metalc ? ? GC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8054 0 HOH 7324 1_555 ? ? ? ? ? ? ? 2.176 ? 
metalc756  metalc ? ? GC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8054 0 HOH 7325 1_555 ? ? ? ? ? ? ? 2.058 ? 
metalc757  metalc ? ? WH MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? B MG  8055 0 HOH 5942 1_555 ? ? ? ? ? ? ? 2.456 ? 
metalc758  metalc ? ? WH MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? B MG  8055 0 HOH 7225 1_555 ? ? ? ? ? ? ? 2.174 ? 
metalc759  metalc ? ? WH MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? B MG  8055 0 HOH 3280 1_555 ? ? ? ? ? ? ? 2.050 ? 
metalc760  metalc ? ? HC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8056 0 HOH 3497 1_555 ? ? ? ? ? ? ? 2.187 ? 
metalc761  metalc ? ? HC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8056 0 HOH 3190 1_555 ? ? ? ? ? ? ? 2.042 ? 
metalc762  metalc ? ? HC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8056 0 HOH 7343 1_555 ? ? ? ? ? ? ? 2.083 ? 
metalc763  metalc ? ? JC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8058 0 HOH 7326 1_555 ? ? ? ? ? ? ? 2.007 ? 
metalc764  metalc ? ? JC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8058 0 HOH 7327 1_555 ? ? ? ? ? ? ? 2.086 ? 
metalc765  metalc ? ? JC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8058 0 HOH 3286 1_555 ? ? ? ? ? ? ? 2.124 ? 
metalc766  metalc ? ? KC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8059 0 HOH 7281 1_555 ? ? ? ? ? ? ? 2.358 ? 
metalc767  metalc ? ? KC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8059 0 HOH 3574 1_555 ? ? ? ? ? ? ? 2.245 ? 
metalc768  metalc ? ? KC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8059 0 HOH 3244 1_555 ? ? ? ? ? ? ? 2.143 ? 
metalc769  metalc ? ? LC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8060 0 HOH 7328 1_555 ? ? ? ? ? ? ? 2.431 ? 
metalc770  metalc ? ? LC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8060 0 HOH 7330 1_555 ? ? ? ? ? ? ? 2.189 ? 
metalc771  metalc ? ? LC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8060 0 HOH 7329 1_555 ? ? ? ? ? ? ? 1.902 ? 
metalc772  metalc ? ? MC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8061 0 HOH 7331 1_555 ? ? ? ? ? ? ? 2.137 ? 
metalc773  metalc ? ? MC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8061 0 HOH 7332 1_555 ? ? ? ? ? ? ? 2.271 ? 
metalc774  metalc ? ? MC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8061 0 HOH 7333 1_555 ? ? ? ? ? ? ? 2.124 ? 
metalc775  metalc ? ? NC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8062 0 HOH 3479 1_555 ? ? ? ? ? ? ? 2.236 ? 
metalc776  metalc ? ? NC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8062 0 HOH 3154 1_555 ? ? ? ? ? ? ? 2.135 ? 
metalc777  metalc ? ? OC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8063 0 HOH 6522 1_555 ? ? ? ? ? ? ? 1.966 ? 
metalc778  metalc ? ? OC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8063 0 HOH 7342 1_555 ? ? ? ? ? ? ? 2.045 ? 
metalc779  metalc ? ? OC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8063 0 HOH 6946 1_555 ? ? ? ? ? ? ? 2.025 ? 
metalc780  metalc ? ? OC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8063 0 HOH 7266 1_555 ? ? ? ? ? ? ? 2.273 ? 
metalc781  metalc ? ? OC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8063 0 HOH 3705 1_555 ? ? ? ? ? ? ? 2.006 ? 
metalc782  metalc ? ? OC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8063 0 HOH 7395 1_555 ? ? ? ? ? ? ? 2.331 ? 
metalc783  metalc ? ? TH MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8065 0 HOH 3492 1_555 ? ? ? ? ? ? ? 1.957 ? 
metalc784  metalc ? ? RC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8067 0 HOH 7335 1_555 ? ? ? ? ? ? ? 2.477 ? 
metalc785  metalc ? ? SC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8068 0 HOH 3274 1_555 ? ? ? ? ? ? ? 2.309 ? 
metalc786  metalc ? ? SC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8068 0 HOH 5748 1_555 ? ? ? ? ? ? ? 2.498 ? 
metalc787  metalc ? ? SC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8068 0 HOH 4347 1_555 ? ? ? ? ? ? ? 2.080 ? 
metalc788  metalc ? ? SC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8068 0 HOH 7396 1_555 ? ? ? ? ? ? ? 2.349 ? 
metalc789  metalc ? ? FI MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? K MG  8069 0 HOH 3764 1_555 ? ? ? ? ? ? ? 2.410 ? 
metalc790  metalc ? ? FI MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? K MG  8069 0 HOH 5571 1_555 ? ? ? ? ? ? ? 2.482 ? 
metalc791  metalc ? ? UC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8071 0 HOH 7068 1_555 ? ? ? ? ? ? ? 2.018 ? 
metalc792  metalc ? ? UC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8071 0 HOH 6933 1_555 ? ? ? ? ? ? ? 2.037 ? 
metalc793  metalc ? ? UC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8071 0 HOH 7340 1_555 ? ? ? ? ? ? ? 2.003 ? 
metalc794  metalc ? ? UC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8071 0 HOH 7341 1_555 ? ? ? ? ? ? ? 2.499 ? 
metalc795  metalc ? ? UC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8071 0 HOH 5579 1_555 ? ? ? ? ? ? ? 2.188 ? 
metalc796  metalc ? ? UC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8071 0 HOH 3636 1_555 ? ? ? ? ? ? ? 2.030 ? 
metalc797  metalc ? ? VC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8072 0 HOH 7397 1_555 ? ? ? ? ? ? ? 2.222 ? 
metalc798  metalc ? ? VC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8072 0 HOH 7339 1_555 ? ? ? ? ? ? ? 2.213 ? 
metalc799  metalc ? ? VC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8072 0 HOH 3519 1_555 ? ? ? ? ? ? ? 2.432 ? 
metalc800  metalc ? ? WC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8074 0 HOH 7399 1_555 ? ? ? ? ? ? ? 2.073 ? 
metalc801  metalc ? ? WC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8074 0 HOH 7337 1_555 ? ? ? ? ? ? ? 1.870 ? 
metalc802  metalc ? ? WC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8074 0 HOH 7398 1_555 ? ? ? ? ? ? ? 2.112 ? 
metalc803  metalc ? ? WC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8074 0 HOH 7336 1_555 ? ? ? ? ? ? ? 2.094 ? 
metalc804  metalc ? ? XC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8075 0 HOH 3158 1_555 ? ? ? ? ? ? ? 2.144 ? 
metalc805  metalc ? ? XC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8075 0 HOH 3437 1_555 ? ? ? ? ? ? ? 2.292 ? 
metalc806  metalc ? ? XC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8075 0 HOH 4462 1_555 ? ? ? ? ? ? ? 2.433 ? 
metalc807  metalc ? ? YC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8076 0 HOH 7400 1_555 ? ? ? ? ? ? ? 2.434 ? 
metalc808  metalc ? ? YC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8076 0 HOH 7345 1_555 ? ? ? ? ? ? ? 2.216 ? 
metalc809  metalc ? ? YC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8076 0 HOH 7401 1_555 ? ? ? ? ? ? ? 2.163 ? 
metalc810  metalc ? ? ZC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8077 0 HOH 3144 1_555 ? ? ? ? ? ? ? 2.132 ? 
metalc811  metalc ? ? ZC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8077 0 HOH 7347 1_555 ? ? ? ? ? ? ? 2.025 ? 
metalc812  metalc ? ? ZC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8077 0 HOH 7346 1_555 ? ? ? ? ? ? ? 2.016 ? 
metalc813  metalc ? ? ZI MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 3 MG  8078 0 HOH 3480 1_555 ? ? ? ? ? ? ? 2.315 ? 
metalc814  metalc ? ? AD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8079 0 HOH 3150 1_555 ? ? ? ? ? ? ? 2.139 ? 
metalc815  metalc ? ? AD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8079 0 HOH 3133 1_555 ? ? ? ? ? ? ? 2.226 ? 
metalc816  metalc ? ? AD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8079 0 HOH 3138 1_555 ? ? ? ? ? ? ? 2.209 ? 
metalc817  metalc ? ? BD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8080 0 HOH 7348 1_555 ? ? ? ? ? ? ? 2.084 ? 
metalc818  metalc ? ? BD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8080 0 HOH 7402 1_555 ? ? ? ? ? ? ? 2.180 ? 
metalc819  metalc ? ? CD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8081 0 HOH 3622 1_555 ? ? ? ? ? ? ? 1.992 ? 
metalc820  metalc ? ? DD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8082 0 HOH 7410 1_555 ? ? ? ? ? ? ? 2.211 ? 
metalc821  metalc ? ? ED MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8083 0 HOH 3229 1_555 ? ? ? ? ? ? ? 2.076 ? 
metalc822  metalc ? ? ED MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8083 0 HOH 3676 1_555 ? ? ? ? ? ? ? 2.076 ? 
metalc823  metalc ? ? ED MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8083 0 HOH 5881 1_555 ? ? ? ? ? ? ? 2.057 ? 
metalc824  metalc ? ? ED MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8083 0 HOH 7349 1_555 ? ? ? ? ? ? ? 2.058 ? 
metalc825  metalc ? ? ED MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8083 0 HOH 7403 1_555 ? ? ? ? ? ? ? 2.346 ? 
metalc826  metalc ? ? FD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8084 0 HOH 3156 1_555 ? ? ? ? ? ? ? 1.917 ? 
metalc827  metalc ? ? FD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8084 0 HOH 7350 1_555 ? ? ? ? ? ? ? 1.877 ? 
metalc828  metalc ? ? GD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8085 0 HOH 3310 1_555 ? ? ? ? ? ? ? 2.288 ? 
metalc829  metalc ? ? HD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8086 0 HOH 3255 1_555 ? ? ? ? ? ? ? 2.444 ? 
metalc830  metalc ? ? HD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8086 0 HOH 3498 1_555 ? ? ? ? ? ? ? 2.259 ? 
metalc831  metalc ? ? HD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8086 0 HOH 7352 1_555 ? ? ? ? ? ? ? 2.246 ? 
metalc832  metalc ? ? HD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8086 0 HOH 7351 1_555 ? ? ? ? ? ? ? 2.162 ? 
metalc833  metalc ? ? ID MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8087 0 HOH 3199 1_555 ? ? ? ? ? ? ? 2.193 ? 
metalc834  metalc ? ? JD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8088 0 HOH 3818 1_555 ? ? ? ? ? ? ? 2.494 ? 
metalc835  metalc ? ? KD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8089 0 HOH 7404 1_555 ? ? ? ? ? ? ? 2.353 ? 
metalc836  metalc ? ? KD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8089 0 HOH 7405 1_555 ? ? ? ? ? ? ? 2.173 ? 
metalc837  metalc ? ? LD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8090 0 HOH 3136 1_555 ? ? ? ? ? ? ? 2.434 ? 
metalc838  metalc ? ? MD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8091 0 HOH 7354 1_555 ? ? ? ? ? ? ? 2.400 ? 
metalc839  metalc ? ? ND MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8092 0 HOH 3166 1_555 ? ? ? ? ? ? ? 2.174 ? 
metalc840  metalc ? ? ND MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8092 0 HOH 7406 1_555 ? ? ? ? ? ? ? 2.236 ? 
metalc841  metalc ? ? ND MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8092 0 HOH 3182 1_555 ? ? ? ? ? ? ? 2.405 ? 
metalc842  metalc ? ? OD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8093 0 HOH 3204 1_555 ? ? ? ? ? ? ? 2.265 ? 
metalc843  metalc ? ? OD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8093 0 HOH 3172 1_555 ? ? ? ? ? ? ? 2.249 ? 
metalc844  metalc ? ? OD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8093 0 HOH 3245 1_555 ? ? ? ? ? ? ? 2.261 ? 
metalc845  metalc ? ? PD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8094 0 HOH 7407 1_555 ? ? ? ? ? ? ? 2.154 ? 
metalc846  metalc ? ? PD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8094 0 HOH 7355 1_555 ? ? ? ? ? ? ? 2.431 ? 
metalc847  metalc ? ? QD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8096 0 HOH 3185 1_555 ? ? ? ? ? ? ? 2.378 ? 
metalc848  metalc ? ? QD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8096 0 HOH 3356 1_555 ? ? ? ? ? ? ? 2.374 ? 
metalc849  metalc ? ? QD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8096 0 HOH 3222 1_555 ? ? ? ? ? ? ? 2.329 ? 
metalc850  metalc ? ? RD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8097 0 HOH 3194 1_555 ? ? ? ? ? ? ? 2.026 ? 
metalc851  metalc ? ? RD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8097 0 HOH 5081 1_555 ? ? ? ? ? ? ? 2.381 ? 
metalc852  metalc ? ? SD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8098 0 HOH 3270 1_555 ? ? ? ? ? ? ? 2.242 ? 
metalc853  metalc ? ? TD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8099 0 HOH 3201 1_555 ? ? ? ? ? ? ? 2.101 ? 
metalc854  metalc ? ? TD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8099 0 HOH 3189 1_555 ? ? ? ? ? ? ? 2.268 ? 
metalc855  metalc ? ? UD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8100 0 HOH 3774 1_555 ? ? ? ? ? ? ? 2.260 ? 
metalc856  metalc ? ? UD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8100 0 HOH 5034 1_555 ? ? ? ? ? ? ? 2.204 ? 
metalc857  metalc ? ? VD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8101 0 HOH 4146 1_555 ? ? ? ? ? ? ? 2.444 ? 
metalc858  metalc ? ? WD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8102 0 HOH 7415 1_555 ? ? ? ? ? ? ? 2.414 ? 
metalc859  metalc ? ? XD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8103 0 HOH 7408 1_555 ? ? ? ? ? ? ? 2.025 ? 
metalc860  metalc ? ? YD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8104 0 HOH 7263 1_555 ? ? ? ? ? ? ? 2.454 ? 
metalc861  metalc ? ? ZD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8105 0 HOH 3123 1_555 ? ? ? ? ? ? ? 2.411 ? 
metalc862  metalc ? ? ZD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8105 0 HOH 6929 1_555 ? ? ? ? ? ? ? 2.499 ? 
metalc863  metalc ? ? AE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8106 0 HOH 7385 1_555 ? ? ? ? ? ? ? 2.303 ? 
metalc864  metalc ? ? AE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8106 0 HOH 7382 1_555 ? ? ? ? ? ? ? 2.146 ? 
metalc865  metalc ? ? AE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8106 0 HOH 7384 1_555 ? ? ? ? ? ? ? 1.930 ? 
metalc866  metalc ? ? AE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8106 0 HOH 7383 1_555 ? ? ? ? ? ? ? 2.089 ? 
metalc867  metalc ? ? BE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8107 0 HOH 7389 1_555 ? ? ? ? ? ? ? 2.324 ? 
metalc868  metalc ? ? BE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8107 0 HOH 7004 1_555 ? ? ? ? ? ? ? 2.382 ? 
metalc869  metalc ? ? BE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8107 0 HOH 7387 1_555 ? ? ? ? ? ? ? 2.311 ? 
metalc870  metalc ? ? CE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8109 0 HOH 4927 1_555 ? ? ? ? ? ? ? 2.138 ? 
metalc871  metalc ? ? CE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8109 0 HOH 5558 1_555 ? ? ? ? ? ? ? 2.296 ? 
metalc872  metalc ? ? CE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8109 0 HOH 3447 1_555 ? ? ? ? ? ? ? 2.203 ? 
metalc873  metalc ? ? DE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8110 0 HOH 3219 1_555 ? ? ? ? ? ? ? 2.372 ? 
metalc874  metalc ? ? DE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8110 0 HOH 5273 1_555 ? ? ? ? ? ? ? 2.370 ? 
metalc875  metalc ? ? DE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8110 0 HOH 3243 1_555 ? ? ? ? ? ? ? 2.232 ? 
metalc876  metalc ? ? DE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8110 0 HOH 5128 1_555 ? ? ? ? ? ? ? 2.287 ? 
metalc877  metalc ? ? EE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8111 0 HOH 3249 1_555 ? ? ? ? ? ? ? 2.224 ? 
metalc878  metalc ? ? EE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8111 0 HOH 3290 1_555 ? ? ? ? ? ? ? 2.228 ? 
metalc879  metalc ? ? FE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8112 0 HOH 3275 1_555 ? ? ? ? ? ? ? 2.473 ? 
metalc880  metalc ? ? FE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8112 0 HOH 5657 1_555 ? ? ? ? ? ? ? 2.180 ? 
metalc881  metalc ? ? FE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8112 0 HOH 3445 1_555 ? ? ? ? ? ? ? 2.439 ? 
metalc882  metalc ? ? HE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8114 0 HOH 3810 1_555 ? ? ? ? ? ? ? 1.859 ? 
metalc883  metalc ? ? HE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8114 0 HOH 6124 1_555 ? ? ? ? ? ? ? 2.321 ? 
metalc884  metalc ? ? IE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8115 0 HOH 3185 1_555 ? ? ? ? ? ? ? 2.431 ? 
metalc885  metalc ? ? IE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? 0 MG  8115 0 HOH 3385 1_555 ? ? ? ? ? ? ? 2.376 ? 
metalc886  metalc ? ? ME NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8301 0 HOH 4495 1_555 ? ? ? ? ? ? ? 2.455 ? 
metalc887  metalc ? ? PE NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8305 0 HOH 3612 1_555 ? ? ? ? ? ? ? 2.737 ? 
metalc888  metalc ? ? PE NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8305 0 HOH 4225 1_555 ? ? ? ? ? ? ? 2.510 ? 
metalc889  metalc ? ? PE NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8305 0 HOH 5310 1_555 ? ? ? ? ? ? ? 2.457 ? 
metalc890  metalc ? ? TE NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8310 0 HOH 4031 1_555 ? ? ? ? ? ? ? 2.900 ? 
metalc891  metalc ? ? UE NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8311 0 HOH 3097 1_555 ? ? ? ? ? ? ? 2.341 ? 
metalc892  metalc ? ? UE NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8311 0 HOH 4178 1_555 ? ? ? ? ? ? ? 2.598 ? 
metalc893  metalc ? ? VE NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8313 0 HOH 4642 1_555 ? ? ? ? ? ? ? 2.255 ? 
metalc894  metalc ? ? VE NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8313 0 HOH 3357 1_555 ? ? ? ? ? ? ? 2.276 ? 
metalc895  metalc ? ? YE NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8316 0 HOH 5839 1_555 ? ? ? ? ? ? ? 2.108 ? 
metalc896  metalc ? ? AF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8318 0 HOH 3451 1_555 ? ? ? ? ? ? ? 2.309 ? 
metalc897  metalc ? ? BF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8319 0 HOH 3784 1_555 ? ? ? ? ? ? ? 2.491 ? 
metalc898  metalc ? ? BF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8319 0 HOH 5573 1_555 ? ? ? ? ? ? ? 2.381 ? 
metalc899  metalc ? ? EF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8323 0 HOH 4006 1_555 ? ? ? ? ? ? ? 2.189 ? 
metalc900  metalc ? ? FF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8324 0 HOH 3653 1_555 ? ? ? ? ? ? ? 2.767 ? 
metalc901  metalc ? ? GF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8325 0 HOH 7174 1_555 ? ? ? ? ? ? ? 2.242 ? 
metalc902  metalc ? ? JF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8328 0 HOH 4738 1_555 ? ? ? ? ? ? ? 2.707 ? 
metalc903  metalc ? ? JF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8328 0 HOH 6001 1_555 ? ? ? ? ? ? ? 2.716 ? 
metalc904  metalc ? ? KF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8329 0 HOH 6100 1_555 ? ? ? ? ? ? ? 2.877 ? 
metalc905  metalc ? ? NF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8332 0 HOH 6589 1_555 ? ? ? ? ? ? ? 2.880 ? 
metalc906  metalc ? ? PF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8334 0 HOH 4773 1_555 ? ? ? ? ? ? ? 2.343 ? 
metalc907  metalc ? ? RF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8336 0 HOH 6864 1_555 ? ? ? ? ? ? ? 2.719 ? 
metalc908  metalc ? ? RF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8336 0 HOH 7201 1_555 ? ? ? ? ? ? ? 2.578 ? 
metalc909  metalc ? ? RF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8336 0 HOH 4864 1_555 ? ? ? ? ? ? ? 2.261 ? 
metalc910  metalc ? ? OI NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? R NA  8337 0 HOH 5445 1_555 ? ? ? ? ? ? ? 2.551 ? 
metalc911  metalc ? ? TF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8339 0 HOH 3818 1_555 ? ? ? ? ? ? ? 2.973 ? 
metalc912  metalc ? ? VF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8341 0 HOH 7411 1_555 ? ? ? ? ? ? ? 2.791 ? 
metalc913  metalc ? ? WF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8342 0 HOH 5152 1_555 ? ? ? ? ? ? ? 2.671 ? 
metalc914  metalc ? ? WF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8342 0 HOH 5793 1_555 ? ? ? ? ? ? ? 2.934 ? 
metalc915  metalc ? ? BI NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? J NA  8346 0 HOH 5282 1_555 ? ? ? ? ? ? ? 2.795 ? 
metalc916  metalc ? ? ZF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8350 0 HOH 6475 1_555 ? ? ? ? ? ? ? 2.969 ? 
metalc917  metalc ? ? AG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8352 0 HOH 6128 1_555 ? ? ? ? ? ? ? 2.809 ? 
metalc918  metalc ? ? AG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8352 0 HOH 4781 1_555 ? ? ? ? ? ? ? 2.969 ? 
metalc919  metalc ? ? BG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8353 0 HOH 4400 1_555 ? ? ? ? ? ? ? 2.520 ? 
metalc920  metalc ? ? CG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8354 0 HOH 7105 1_555 ? ? ? ? ? ? ? 2.976 ? 
metalc921  metalc ? ? CG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8354 0 HOH 4344 1_555 ? ? ? ? ? ? ? 2.393 ? 
metalc922  metalc ? ? DG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8355 0 HOH 4336 1_555 ? ? ? ? ? ? ? 2.181 ? 
metalc923  metalc ? ? FG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8357 0 HOH 5800 1_555 ? ? ? ? ? ? ? 2.426 ? 
metalc924  metalc ? ? GG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8358 0 HOH 7293 1_555 ? ? ? ? ? ? ? 2.662 ? 
metalc925  metalc ? ? GG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8358 0 HOH 6939 1_555 ? ? ? ? ? ? ? 2.684 ? 
metalc926  metalc ? ? IG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8360 0 HOH 5484 1_555 ? ? ? ? ? ? ? 2.788 ? 
metalc927  metalc ? ? JG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8361 0 HOH 6852 1_555 ? ? ? ? ? ? ? 2.637 ? 
metalc928  metalc ? ? JG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8361 0 HOH 4430 1_555 ? ? ? ? ? ? ? 2.559 ? 
metalc929  metalc ? ? OG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8366 0 HOH 3343 1_555 ? ? ? ? ? ? ? 2.812 ? 
metalc930  metalc ? ? PG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8367 0 HOH 4127 1_555 ? ? ? ? ? ? ? 2.888 ? 
metalc931  metalc ? ? QG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8368 0 HOH 3405 1_555 ? ? ? ? ? ? ? 2.732 ? 
metalc932  metalc ? ? RG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8369 0 HOH 6095 1_555 ? ? ? ? ? ? ? 2.808 ? 
metalc933  metalc ? ? SG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8370 0 HOH 3626 1_555 ? ? ? ? ? ? ? 2.459 ? 
metalc934  metalc ? ? VG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8373 0 HOH 6816 1_555 ? ? ? ? ? ? ? 2.763 ? 
metalc935  metalc ? ? VG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8373 0 HOH 3202 1_555 ? ? ? ? ? ? ? 2.332 ? 
metalc936  metalc ? ? YG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8376 0 HOH 3168 1_555 ? ? ? ? ? ? ? 2.807 ? 
metalc937  metalc ? ? YG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8376 0 HOH 4382 1_555 ? ? ? ? ? ? ? 2.585 ? 
metalc938  metalc ? ? ZG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8377 0 HOH 5868 1_555 ? ? ? ? ? ? ? 2.411 ? 
metalc939  metalc ? ? BH NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8379 0 HOH 3236 1_555 ? ? ? ? ? ? ? 2.345 ? 
metalc940  metalc ? ? BH NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8379 0 HOH 3955 1_555 ? ? ? ? ? ? ? 2.669 ? 
metalc941  metalc ? ? CH NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8381 0 HOH 3213 1_555 ? ? ? ? ? ? ? 2.376 ? 
metalc942  metalc ? ? CH NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8381 0 HOH 6591 1_555 ? ? ? ? ? ? ? 2.811 ? 
metalc943  metalc ? ? DH NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8382 0 HOH 3897 1_555 ? ? ? ? ? ? ? 2.960 ? 
metalc944  metalc ? ? EH NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8384 0 HOH 4542 1_555 ? ? ? ? ? ? ? 2.723 ? 
metalc945  metalc ? ? FH NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 0 NA  8385 0 HOH 7194 1_555 ? ? ? ? ? ? ? 2.614 ? 
hydrog1    hydrog ? ? A  U   11   O4    ? ? ? 1_555 A  G   530  N2    ? ? 0 U   12   0 G   531  1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog2    hydrog ? ? A  G   12   N1    ? ? ? 1_555 A  C   529  N3    ? ? 0 G   13   0 C   530  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3    hydrog ? ? A  G   12   N2    ? ? ? 1_555 A  C   529  O2    ? ? 0 G   13   0 C   530  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4    hydrog ? ? A  G   12   O6    ? ? ? 1_555 A  C   529  N4    ? ? 0 G   13   0 C   530  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5    hydrog ? ? A  C   13   N3    ? ? ? 1_555 A  G   528  N1    ? ? 0 C   14   0 G   529  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6    hydrog ? ? A  C   13   N4    ? ? ? 1_555 A  G   528  O6    ? ? 0 C   14   0 G   529  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7    hydrog ? ? A  C   13   O2    ? ? ? 1_555 A  G   528  N2    ? ? 0 C   14   0 G   529  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8    hydrog ? ? A  C   14   N3    ? ? ? 1_555 A  G   527  N1    ? ? 0 C   15   0 G   528  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9    hydrog ? ? A  C   14   N4    ? ? ? 1_555 A  G   527  O6    ? ? 0 C   15   0 G   528  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10   hydrog ? ? A  C   14   O2    ? ? ? 1_555 A  G   527  N2    ? ? 0 C   15   0 G   528  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11   hydrog ? ? A  A   15   N1    ? ? ? 1_555 A  U   526  N3    ? ? 0 A   16   0 U   527  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12   hydrog ? ? A  A   15   N6    ? ? ? 1_555 A  U   526  O4    ? ? 0 A   16   0 U   527  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13   hydrog ? ? A  G   16   N1    ? ? ? 1_555 A  U   525  O2    ? ? 0 G   17   0 U   526  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog14   hydrog ? ? A  G   16   O6    ? ? ? 1_555 A  U   525  N3    ? ? 0 G   17   0 U   526  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog15   hydrog ? ? A  C   17   N3    ? ? ? 1_555 A  G   524  N1    ? ? 0 C   18   0 G   525  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16   hydrog ? ? A  C   17   N4    ? ? ? 1_555 A  G   524  O6    ? ? 0 C   18   0 G   525  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17   hydrog ? ? A  C   17   O2    ? ? ? 1_555 A  G   524  N2    ? ? 0 C   18   0 G   525  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18   hydrog ? ? A  U   18   N3    ? ? ? 1_555 A  A   523  N1    ? ? 0 U   19   0 A   524  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19   hydrog ? ? A  U   18   O4    ? ? ? 1_555 A  A   523  N6    ? ? 0 U   19   0 A   524  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20   hydrog ? ? A  G   19   N1    ? ? ? 1_555 A  C   522  N3    ? ? 0 G   20   0 C   523  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21   hydrog ? ? A  G   19   N2    ? ? ? 1_555 A  C   522  O2    ? ? 0 G   20   0 C   523  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22   hydrog ? ? A  G   19   O6    ? ? ? 1_555 A  C   522  N4    ? ? 0 G   20   0 C   523  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23   hydrog ? ? A  G   20   N1    ? ? ? 1_555 A  U   521  O2    ? ? 0 G   21   0 U   522  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog24   hydrog ? ? A  G   20   O6    ? ? ? 1_555 A  U   521  N3    ? ? 0 G   21   0 U   522  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog25   hydrog ? ? A  U   21   O2    ? ? ? 1_555 A  A   520  N6    ? ? 0 U   22   0 A   521  1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog26   hydrog ? ? A  G   22   N2    ? ? ? 1_555 A  A   519  N7    ? ? 0 G   23   0 A   520  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog27   hydrog ? ? A  G   22   N3    ? ? ? 1_555 A  A   519  N6    ? ? 0 G   23   0 A   520  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog28   hydrog ? ? A  G   23   N2    ? ? ? 1_555 A  A   518  N7    ? ? 0 G   24   0 A   519  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog29   hydrog ? ? A  G   23   N3    ? ? ? 1_555 A  A   518  N6    ? ? 0 G   24   0 A   519  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog30   hydrog ? ? A  A   24   N6    ? ? ? 1_555 A  G   517  N3    ? ? 0 A   25   0 G   518  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog31   hydrog ? ? A  A   24   N7    ? ? ? 1_555 A  G   517  N2    ? ? 0 A   25   0 G   518  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog32   hydrog ? ? A  U   25   N3    ? ? ? 1_555 A  U   516  O2    ? ? 0 U   26   0 U   517  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog33   hydrog ? ? A  U   25   O4    ? ? ? 1_555 A  U   516  N3    ? ? 0 U   26   0 U   517  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog34   hydrog ? ? A  U   26   N3    ? ? ? 1_555 A  A   515  N1    ? ? 0 U   27   0 A   516  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog35   hydrog ? ? A  U   26   O4    ? ? ? 1_555 A  A   515  N6    ? ? 0 U   27   0 A   516  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog36   hydrog ? ? A  G   27   N1    ? ? ? 1_555 A  C   479  N3    ? ? 0 G   28   0 C   480  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog37   hydrog ? ? A  G   27   N2    ? ? ? 1_555 A  C   479  O2    ? ? 0 G   28   0 C   480  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog38   hydrog ? ? A  G   27   O6    ? ? ? 1_555 A  C   479  N4    ? ? 0 G   28   0 C   480  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog39   hydrog ? ? A  C   28   N3    ? ? ? 1_555 A  G   478  N1    ? ? 0 C   29   0 G   479  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog40   hydrog ? ? A  C   28   N4    ? ? ? 1_555 A  G   478  O6    ? ? 0 C   29   0 G   479  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog41   hydrog ? ? A  C   28   O2    ? ? ? 1_555 A  G   478  N2    ? ? 0 C   29   0 G   479  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog42   hydrog ? ? A  U   29   N3    ? ? ? 1_555 A  A   452  N7    ? ? 0 U   30   0 A   453  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog43   hydrog ? ? A  U   29   O2    ? ? ? 1_555 A  A   452  N6    ? ? 0 U   30   0 A   453  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog44   hydrog ? ? A  G   31   N1    ? ? ? 1_555 A  C   450  N3    ? ? 0 G   32   0 C   451  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog45   hydrog ? ? A  G   31   N2    ? ? ? 1_555 A  C   450  O2    ? ? 0 G   32   0 C   451  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog46   hydrog ? ? A  G   31   O6    ? ? ? 1_555 A  C   450  N4    ? ? 0 G   32   0 C   451  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog47   hydrog ? ? A  G   31   N2    ? ? ? 1_555 A  A   454  N1    ? ? 0 G   32   0 A   455  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog48   hydrog ? ? A  G   31   N2    ? ? ? 1_555 A  G   455  N3    ? ? 0 G   32   0 G   456  1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog49   hydrog ? ? A  G   31   N3    ? ? ? 1_555 A  G   455  N2    ? ? 0 G   32   0 G   456  1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog50   hydrog ? ? A  G   32   N1    ? ? ? 1_555 A  C   449  N3    ? ? 0 G   33   0 C   450  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog51   hydrog ? ? A  G   32   N2    ? ? ? 1_555 A  C   449  O2    ? ? 0 G   33   0 C   450  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog52   hydrog ? ? A  G   32   O6    ? ? ? 1_555 A  C   449  N4    ? ? 0 G   33   0 C   450  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog53   hydrog ? ? A  C   33   N3    ? ? ? 1_555 A  G   447  N1    ? ? 0 C   34   0 G   448  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog54   hydrog ? ? A  C   33   N4    ? ? ? 1_555 A  G   447  O6    ? ? 0 C   34   0 G   448  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog55   hydrog ? ? A  C   33   O2    ? ? ? 1_555 A  G   447  N2    ? ? 0 C   34   0 G   448  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog56   hydrog ? ? A  U   34   N3    ? ? ? 1_555 A  A   446  N1    ? ? 0 U   35   0 A   447  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog57   hydrog ? ? A  U   34   O4    ? ? ? 1_555 A  A   446  N6    ? ? 0 U   35   0 A   447  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog58   hydrog ? ? A  C   35   N3    ? ? ? 1_555 A  G   445  N1    ? ? 0 C   36   0 G   446  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog59   hydrog ? ? A  C   35   N4    ? ? ? 1_555 A  G   445  O6    ? ? 0 C   36   0 G   446  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog60   hydrog ? ? A  C   35   O2    ? ? ? 1_555 A  G   445  N2    ? ? 0 C   36   0 G   446  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog61   hydrog ? ? A  C   35   O2    ? ? ? 1_555 A  A   673  N6    ? ? 0 C   36   0 A   674  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog62   hydrog ? ? A  A   36   N1    ? ? ? 1_555 A  U   444  N3    ? ? 0 A   37   0 U   445  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog63   hydrog ? ? A  A   36   N6    ? ? ? 1_555 A  U   444  O4    ? ? 0 A   37   0 U   445  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog64   hydrog ? ? A  G   37   N1    ? ? ? 1_555 A  C   443  N3    ? ? 0 G   38   0 C   444  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog65   hydrog ? ? A  G   37   N2    ? ? ? 1_555 A  C   443  O2    ? ? 0 G   38   0 C   444  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog66   hydrog ? ? A  G   37   O6    ? ? ? 1_555 A  C   443  N4    ? ? 0 G   38   0 C   444  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog67   hydrog ? ? A  G   38   N1    ? ? ? 1_555 A  C   442  N3    ? ? 0 G   39   0 C   443  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog68   hydrog ? ? A  G   38   N2    ? ? ? 1_555 A  C   442  O2    ? ? 0 G   39   0 C   443  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog69   hydrog ? ? A  G   38   O6    ? ? ? 1_555 A  C   442  N4    ? ? 0 G   39   0 C   443  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog70   hydrog ? ? A  C   39   N4    ? ? ? 1_555 A  A   440  N1    ? ? 0 C   40   0 A   441  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog71   hydrog ? ? A  C   39   O2    ? ? ? 1_555 A  A   441  N6    ? ? 0 C   40   0 A   442  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog72   hydrog ? ? A  G   40   N2    ? ? ? 1_555 A  A   150  N1    ? ? 0 G   41   0 A   151  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog73   hydrog ? ? A  G   40   N1    ? ? ? 1_555 A  C   439  N3    ? ? 0 G   41   0 C   440  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog74   hydrog ? ? A  G   40   N2    ? ? ? 1_555 A  C   439  O2    ? ? 0 G   41   0 C   440  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog75   hydrog ? ? A  G   40   O6    ? ? ? 1_555 A  C   439  N4    ? ? 0 G   41   0 C   440  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog76   hydrog ? ? A  C   41   N3    ? ? ? 1_555 A  G   148  N1    ? ? 0 C   42   0 G   149  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog77   hydrog ? ? A  C   41   N4    ? ? ? 1_555 A  G   148  O6    ? ? 0 C   42   0 G   149  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog78   hydrog ? ? A  C   41   O2    ? ? ? 1_555 A  G   148  N2    ? ? 0 C   42   0 G   149  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog79   hydrog ? ? A  U   42   N3    ? ? ? 1_555 A  A   147  N1    ? ? 0 U   43   0 A   148  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog80   hydrog ? ? A  U   42   O4    ? ? ? 1_555 A  A   147  N6    ? ? 0 U   43   0 A   148  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog81   hydrog ? ? A  G   43   N2    ? ? ? 1_555 A  A   44   N1    ? ? 0 G   44   0 A   45   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog82   hydrog ? ? A  A   44   N6    ? ? ? 1_555 A  U   114  O4    ? ? 0 A   45   0 U   115  1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog83   hydrog ? ? A  A   44   N7    ? ? ? 1_555 A  U   114  N3    ? ? 0 A   45   0 U   115  1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog84   hydrog ? ? A  G   46   N2    ? ? ? 1_555 A  A   112  N7    ? ? 0 G   47   0 A   113  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog85   hydrog ? ? A  G   46   N3    ? ? ? 1_555 A  A   112  N6    ? ? 0 G   47   0 A   113  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog86   hydrog ? ? A  A   47   N6    ? ? ? 1_555 A  A   113  N7    ? ? 0 A   48   0 A   114  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog87   hydrog ? ? A  A   47   N7    ? ? ? 1_555 A  A   113  N6    ? ? 0 A   48   0 A   114  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog88   hydrog ? ? A  A   48   N6    ? ? ? 1_555 A  G   111  N3    ? ? 0 A   49   0 G   112  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog89   hydrog ? ? A  A   48   N7    ? ? ? 1_555 A  G   111  N2    ? ? 0 A   49   0 G   112  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog90   hydrog ? ? A  G   49   N1    ? ? ? 1_555 A  C   110  N3    ? ? 0 G   50   0 C   111  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog91   hydrog ? ? A  G   49   N2    ? ? ? 1_555 A  C   110  O2    ? ? 0 G   50   0 C   111  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog92   hydrog ? ? A  G   49   O6    ? ? ? 1_555 A  C   110  N4    ? ? 0 G   50   0 C   111  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog93   hydrog ? ? A  G   50   N1    ? ? ? 1_555 A  C   109  N3    ? ? 0 G   51   0 C   110  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog94   hydrog ? ? A  G   50   N2    ? ? ? 1_555 A  C   109  O2    ? ? 0 G   51   0 C   110  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog95   hydrog ? ? A  G   50   O6    ? ? ? 1_555 A  C   109  N4    ? ? 0 G   51   0 C   110  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog96   hydrog ? ? A  G   50   N2    ? ? ? 1_555 A  U   120  O2    ? ? 0 G   51   0 U   121  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog97   hydrog ? ? A  A   51   N1    ? ? ? 1_555 A  U   108  N3    ? ? 0 A   52   0 U   109  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog98   hydrog ? ? A  A   51   N6    ? ? ? 1_555 A  U   108  O4    ? ? 0 A   52   0 U   109  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog99   hydrog ? ? A  C   52   N3    ? ? ? 1_555 A  G   65   N1    ? ? 0 C   53   0 G   66   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog100  hydrog ? ? A  C   52   N4    ? ? ? 1_555 A  G   65   O6    ? ? 0 C   53   0 G   66   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog101  hydrog ? ? A  C   52   O2    ? ? ? 1_555 A  G   65   N2    ? ? 0 C   53   0 G   66   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog102  hydrog ? ? A  G   53   N1    ? ? ? 1_555 A  C   64   N3    ? ? 0 G   54   0 C   65   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog103  hydrog ? ? A  G   53   N2    ? ? ? 1_555 A  C   64   O2    ? ? 0 G   54   0 C   65   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog104  hydrog ? ? A  G   53   O6    ? ? ? 1_555 A  C   64   N4    ? ? 0 G   54   0 C   65   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog105  hydrog ? ? A  G   53   N2    ? ? ? 1_555 A  A   68   N3    ? ? 0 G   54   0 A   69   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog106  hydrog ? ? A  U   54   N3    ? ? ? 1_555 A  G   63   O6    ? ? 0 U   55   0 G   64   1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog107  hydrog ? ? A  U   54   O2    ? ? ? 1_555 A  G   63   N1    ? ? 0 U   55   0 G   64   1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog108  hydrog ? ? A  G   55   O6    ? ? ? 1_555 A  C   61   N4    ? ? 0 G   56   0 C   62   1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog109  hydrog ? ? A  G   55   N1    ? ? ? 1_555 A  G   83   O6    ? ? 0 G   56   0 G   84   1_555 ? ? ? ? ? ? TYPE_6_PAIR ? ? 
hydrog110  hydrog ? ? A  G   55   N2    ? ? ? 1_555 A  G   83   N7    ? ? 0 G   56   0 G   84   1_555 ? ? ? ? ? ? TYPE_6_PAIR ? ? 
hydrog111  hydrog ? ? A  C   56   N3    ? ? ? 1_555 A  G   88   N1    ? ? 0 C   57   0 G   89   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog112  hydrog ? ? A  C   56   N4    ? ? ? 1_555 A  G   88   O6    ? ? 0 C   57   0 G   89   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog113  hydrog ? ? A  C   56   O2    ? ? ? 1_555 A  G   88   N2    ? ? 0 C   57   0 G   89   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog114  hydrog ? ? A  C   57   N3    ? ? ? 1_555 A  G   87   N1    ? ? 0 C   58   0 G   88   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog115  hydrog ? ? A  C   57   N4    ? ? ? 1_555 A  G   87   O6    ? ? 0 C   58   0 G   88   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog116  hydrog ? ? A  C   57   O2    ? ? ? 1_555 A  G   87   N2    ? ? 0 C   58   0 G   88   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog117  hydrog ? ? A  A   58   N3    ? ? ? 1_555 A  A   59   N6    ? ? 0 A   59   0 A   60   1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog118  hydrog ? ? A  A   58   N1    ? ? ? 1_555 A  C   84   N4    ? ? 0 A   59   0 C   85   1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog119  hydrog ? ? A  A   59   N1    ? ? ? 1_555 A  A   85   N6    ? ? 0 A   60   0 A   86   1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog120  hydrog ? ? A  A   59   N6    ? ? ? 1_555 A  A   85   N1    ? ? 0 A   60   0 A   86   1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog121  hydrog ? ? A  G   60   N1    ? ? ? 1_555 A  C   84   N3    ? ? 0 G   61   0 C   85   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog122  hydrog ? ? A  G   60   N2    ? ? ? 1_555 A  C   84   O2    ? ? 0 G   61   0 C   85   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog123  hydrog ? ? A  G   60   O6    ? ? ? 1_555 A  C   84   N4    ? ? 0 G   61   0 C   85   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog124  hydrog ? ? A  C   61   N3    ? ? ? 1_555 A  G   83   N1    ? ? 0 C   62   0 G   84   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog125  hydrog ? ? A  C   61   N4    ? ? ? 1_555 A  G   83   O6    ? ? 0 C   62   0 G   84   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog126  hydrog ? ? A  C   61   O2    ? ? ? 1_555 A  G   83   N2    ? ? 0 C   62   0 G   84   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog127  hydrog ? ? A  U   62   N3    ? ? ? 1_555 A  A   69   N7    ? ? 0 U   63   0 A   70   1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog128  hydrog ? ? A  U   62   O4    ? ? ? 1_555 A  A   69   N6    ? ? 0 U   63   0 A   70   1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog129  hydrog ? ? A  G   65   N2    ? ? ? 1_555 A  A   66   N1    ? ? 0 G   66   0 A   67   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog130  hydrog ? ? A  G   70   N1    ? ? ? 1_555 A  A   105  N1    ? ? 0 G   71   0 A   106  1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog131  hydrog ? ? A  G   70   O6    ? ? ? 1_555 A  A   105  N6    ? ? 0 G   71   0 A   106  1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog132  hydrog ? ? A  G   70   N1    ? ? ? 1_555 A  U   106  O2    ? ? 0 G   71   0 U   107  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog133  hydrog ? ? A  C   71   N3    ? ? ? 1_555 A  G   104  N1    ? ? 0 C   72   0 G   105  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog134  hydrog ? ? A  C   71   N4    ? ? ? 1_555 A  G   104  O6    ? ? 0 C   72   0 G   105  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog135  hydrog ? ? A  C   71   O2    ? ? ? 1_555 A  G   104  N2    ? ? 0 C   72   0 G   105  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog136  hydrog ? ? A  C   72   N3    ? ? ? 1_555 A  G   103  N1    ? ? 0 C   73   0 G   104  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog137  hydrog ? ? A  C   72   N4    ? ? ? 1_555 A  G   103  O6    ? ? 0 C   73   0 G   104  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog138  hydrog ? ? A  C   72   O2    ? ? ? 1_555 A  G   103  N2    ? ? 0 C   73   0 G   104  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog139  hydrog ? ? A  A   73   N1    ? ? ? 1_555 A  U   102  N3    ? ? 0 A   74   0 U   103  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog140  hydrog ? ? A  A   73   N6    ? ? ? 1_555 A  U   102  O4    ? ? 0 A   74   0 U   103  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog141  hydrog ? ? A  U   74   N3    ? ? ? 1_555 A  A   101  N1    ? ? 0 U   75   0 A   102  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog142  hydrog ? ? A  U   74   O4    ? ? ? 1_555 A  A   101  N6    ? ? 0 U   75   0 A   102  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog143  hydrog ? ? A  G   75   N1    ? ? ? 1_555 A  C   100  N3    ? ? 0 G   76   0 C   101  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog144  hydrog ? ? A  G   75   N2    ? ? ? 1_555 A  C   100  O2    ? ? 0 G   76   0 C   101  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog145  hydrog ? ? A  G   75   O6    ? ? ? 1_555 A  C   100  N4    ? ? 0 G   76   0 C   101  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog146  hydrog ? ? A  G   76   N1    ? ? ? 1_555 A  C   99   N3    ? ? 0 G   77   0 C   100  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog147  hydrog ? ? A  G   76   N2    ? ? ? 1_555 A  C   99   O2    ? ? 0 G   77   0 C   100  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog148  hydrog ? ? A  G   76   O6    ? ? ? 1_555 A  C   99   N4    ? ? 0 G   77   0 C   100  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog149  hydrog ? ? A  G   77   N2    ? ? ? 1_555 A  A   98   N7    ? ? 0 G   78   0 A   99   1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog150  hydrog ? ? A  G   77   N3    ? ? ? 1_555 A  A   98   N6    ? ? 0 G   78   0 A   99   1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog151  hydrog ? ? A  G   78   N2    ? ? ? 1_555 A  A   97   N7    ? ? 0 G   79   0 A   98   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog152  hydrog ? ? A  A   79   N3    ? ? ? 1_555 A  G   93   N2    ? ? 0 A   80   0 G   94   1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog153  hydrog ? ? A  A   79   N6    ? ? ? 1_555 A  G   96   N3    ? ? 0 A   80   0 G   97   1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog154  hydrog ? ? A  A   79   N7    ? ? ? 1_555 A  G   96   N2    ? ? 0 A   80   0 G   97   1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog155  hydrog ? ? A  G   80   N1    ? ? ? 1_555 A  C   92   N3    ? ? 0 G   81   0 C   93   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog156  hydrog ? ? A  G   80   N2    ? ? ? 1_555 A  C   92   O2    ? ? 0 G   81   0 C   93   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog157  hydrog ? ? A  G   80   O6    ? ? ? 1_555 A  C   92   N4    ? ? 0 G   81   0 C   93   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog158  hydrog ? ? A  G   80   N2    ? ? ? 1_555 A  A   97   N3    ? ? 0 G   81   0 A   98   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog159  hydrog ? ? A  C   81   N3    ? ? ? 1_555 A  G   91   N1    ? ? 0 C   82   0 G   92   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog160  hydrog ? ? A  C   81   N4    ? ? ? 1_555 A  G   91   O6    ? ? 0 C   82   0 G   92   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog161  hydrog ? ? A  C   81   O2    ? ? ? 1_555 A  G   91   N2    ? ? 0 C   82   0 G   92   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog162  hydrog ? ? A  C   82   N3    ? ? ? 1_555 A  G   90   N1    ? ? 0 C   83   0 G   91   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog163  hydrog ? ? A  C   82   N4    ? ? ? 1_555 A  G   90   O6    ? ? 0 C   83   0 G   91   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog164  hydrog ? ? A  C   82   O2    ? ? ? 1_555 A  G   90   N2    ? ? 0 C   83   0 G   91   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog165  hydrog ? ? A  G   115  N1    ? ? ? 1_555 A  C   123  N3    ? ? 0 G   116  0 C   124  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog166  hydrog ? ? A  G   115  N2    ? ? ? 1_555 A  C   123  O2    ? ? 0 G   116  0 C   124  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog167  hydrog ? ? A  G   115  O6    ? ? ? 1_555 A  C   123  N4    ? ? 0 G   116  0 C   124  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog168  hydrog ? ? A  A   116  N1    ? ? ? 1_555 A  U   122  N3    ? ? 0 A   117  0 U   123  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog169  hydrog ? ? A  A   116  N6    ? ? ? 1_555 A  U   122  O4    ? ? 0 A   117  0 U   123  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog170  hydrog ? ? A  G   117  N1    ? ? ? 1_555 A  C   121  N3    ? ? 0 G   118  0 C   122  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog171  hydrog ? ? A  G   117  N2    ? ? ? 1_555 A  C   121  O2    ? ? 0 G   118  0 C   122  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog172  hydrog ? ? A  G   117  O6    ? ? ? 1_555 A  C   121  N4    ? ? 0 G   118  0 C   122  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog173  hydrog ? ? A  U   124  N3    ? ? ? 1_555 A  A   128  N1    ? ? 0 U   125  0 A   129  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog174  hydrog ? ? A  U   124  O4    ? ? ? 1_555 A  A   128  N6    ? ? 0 U   125  0 A   129  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog175  hydrog ? ? A  C   129  N4    ? ? ? 1_555 A  A   143  N7    ? ? 0 C   130  0 A   144  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog176  hydrog ? ? A  A   130  N6    ? ? ? 1_555 A  G   146  N7    ? ? 0 A   131  0 G   147  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog177  hydrog ? ? A  A   131  N1    ? ? ? 1_555 A  U   145  N3    ? ? 0 A   132  0 U   146  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog178  hydrog ? ? A  A   131  N6    ? ? ? 1_555 A  U   145  O4    ? ? 0 A   132  0 U   146  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog179  hydrog ? ? A  U   132  N3    ? ? ? 1_555 A  A   144  N1    ? ? 0 U   133  0 A   145  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog180  hydrog ? ? A  U   132  O4    ? ? ? 1_555 A  A   144  N6    ? ? 0 U   133  0 A   145  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog181  hydrog ? ? A  U   133  O4    ? ? ? 1_555 A  C   140  N4    ? ? 0 U   134  0 C   141  1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog182  hydrog ? ? A  U   133  N3    ? ? ? 1_555 A  A   143  N1    ? ? 0 U   134  0 A   144  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog183  hydrog ? ? A  U   133  O4    ? ? ? 1_555 A  A   143  N6    ? ? 0 U   134  0 A   144  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog184  hydrog ? ? A  G   134  N1    ? ? ? 1_555 A  C   142  N3    ? ? 0 G   135  0 C   143  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog185  hydrog ? ? A  G   134  N2    ? ? ? 1_555 A  C   142  O2    ? ? 0 G   135  0 C   143  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog186  hydrog ? ? A  G   134  O6    ? ? ? 1_555 A  C   142  N4    ? ? 0 G   135  0 C   143  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog187  hydrog ? ? A  C   135  N3    ? ? ? 1_555 A  G   141  N1    ? ? 0 C   136  0 G   142  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog188  hydrog ? ? A  C   135  N4    ? ? ? 1_555 A  G   141  O6    ? ? 0 C   136  0 G   142  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog189  hydrog ? ? A  C   135  O2    ? ? ? 1_555 A  G   141  N2    ? ? 0 C   136  0 G   142  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog190  hydrog ? ? A  U   136  O2    ? ? ? 1_555 A  G   139  N1    ? ? 0 U   137  0 G   140  1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog191  hydrog ? ? A  C   140  O2    ? ? ? 1_555 A  C   142  N4    ? ? 0 C   141  0 C   143  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog192  hydrog ? ? A  C   140  N3    ? ? ? 1_555 A  A   143  N6    ? ? 0 C   141  0 A   144  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog193  hydrog ? ? A  A   151  N1    ? ? ? 1_555 A  G   184  N1    ? ? 0 A   152  0 G   185  1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog194  hydrog ? ? A  A   151  N6    ? ? ? 1_555 A  G   184  O6    ? ? 0 A   152  0 G   185  1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog195  hydrog ? ? A  C   152  N3    ? ? ? 1_555 A  G   183  N1    ? ? 0 C   153  0 G   184  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog196  hydrog ? ? A  C   152  N4    ? ? ? 1_555 A  G   183  O6    ? ? 0 C   153  0 G   184  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog197  hydrog ? ? A  C   152  O2    ? ? ? 1_555 A  G   183  N2    ? ? 0 C   153  0 G   184  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog198  hydrog ? ? A  C   153  N3    ? ? ? 1_555 A  G   181  N1    ? ? 0 C   154  0 G   182  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog199  hydrog ? ? A  C   153  N4    ? ? ? 1_555 A  G   181  O6    ? ? 0 C   154  0 G   182  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog200  hydrog ? ? A  C   153  O2    ? ? ? 1_555 A  G   181  N2    ? ? 0 C   154  0 G   182  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog201  hydrog ? ? A  C   154  N3    ? ? ? 1_555 A  G   180  N1    ? ? 0 C   155  0 G   181  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog202  hydrog ? ? A  C   154  N4    ? ? ? 1_555 A  G   180  O6    ? ? 0 C   155  0 G   181  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog203  hydrog ? ? A  C   154  O2    ? ? ? 1_555 A  G   180  N2    ? ? 0 C   155  0 G   181  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog204  hydrog ? ? A  C   155  N3    ? ? ? 1_555 A  G   179  N1    ? ? 0 C   156  0 G   180  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog205  hydrog ? ? A  C   155  N4    ? ? ? 1_555 A  G   179  O6    ? ? 0 C   156  0 G   180  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog206  hydrog ? ? A  C   155  O2    ? ? ? 1_555 A  G   179  N2    ? ? 0 C   156  0 G   180  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog207  hydrog ? ? A  G   156  N1    ? ? ? 1_555 A  C   178  N3    ? ? 0 G   157  0 C   179  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog208  hydrog ? ? A  G   156  N2    ? ? ? 1_555 A  C   178  O2    ? ? 0 G   157  0 C   179  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog209  hydrog ? ? A  G   156  O6    ? ? ? 1_555 A  C   178  N4    ? ? 0 G   157  0 C   179  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog210  hydrog ? ? A  G   156  N2    ? ? ? 1_555 A  A   1469 N1    ? ? 0 G   157  0 A   1470 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog211  hydrog ? ? A  A   157  N1    ? ? ? 1_555 A  U   177  N3    ? ? 0 A   158  0 U   178  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog212  hydrog ? ? A  A   157  N6    ? ? ? 1_555 A  U   177  O4    ? ? 0 A   158  0 U   178  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog213  hydrog ? ? A  G   158  N2    ? ? ? 1_555 A  A   176  N7    ? ? 0 G   159  0 A   177  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog214  hydrog ? ? A  G   158  N3    ? ? ? 1_555 A  A   176  N6    ? ? 0 G   159  0 A   177  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog215  hydrog ? ? A  A   159  N6    ? ? ? 1_555 A  U   175  O2    ? ? 0 A   160  0 U   176  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog216  hydrog ? ? A  A   159  N7    ? ? ? 1_555 A  U   175  N3    ? ? 0 A   160  0 U   176  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog217  hydrog ? ? A  A   160  N6    ? ? ? 1_555 A  A   173  N7    ? ? 0 A   161  0 A   174  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog218  hydrog ? ? A  A   160  N7    ? ? ? 1_555 A  A   173  N6    ? ? 0 A   161  0 A   174  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog219  hydrog ? ? A  A   160  N3    ? ? ? 1_555 A  G   891  N2    ? ? 0 A   161  0 G   892  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog220  hydrog ? ? A  C   161  N4    ? ? ? 1_555 A  C   172  O2    ? ? 0 C   162  0 C   173  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog221  hydrog ? ? A  C   161  O2    ? ? ? 1_555 A  C   892  N4    ? ? 0 C   162  0 C   893  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog222  hydrog ? ? A  U   162  N3    ? ? ? 1_555 A  U   171  O2    ? ? 0 U   163  0 U   172  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog223  hydrog ? ? A  U   162  O4    ? ? ? 1_555 A  U   171  N3    ? ? 0 U   163  0 U   172  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog224  hydrog ? ? A  G   163  N1    ? ? ? 1_555 A  C   170  N3    ? ? 0 G   164  0 C   171  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog225  hydrog ? ? A  G   163  N2    ? ? ? 1_555 A  C   170  O2    ? ? 0 G   164  0 C   171  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog226  hydrog ? ? A  G   163  O6    ? ? ? 1_555 A  C   170  N4    ? ? 0 G   164  0 C   171  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog227  hydrog ? ? A  G   163  N2    ? ? ? 1_555 A  A   221  N3    ? ? 0 G   164  0 A   222  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog228  hydrog ? ? A  A   164  N3    ? ? ? 1_555 A  G   220  N2    ? ? 0 A   165  0 G   221  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog229  hydrog ? ? A  A   165  N1    ? ? ? 1_555 A  G   923  N2    ? ? 0 A   166  0 G   924  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog230  hydrog ? ? A  A   165  N6    ? ? ? 1_555 A  G   923  N3    ? ? 0 A   166  0 G   924  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog231  hydrog ? ? A  C   167  N3    ? ? ? 1_555 A  G   218  N1    ? ? 0 C   168  0 G   219  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog232  hydrog ? ? A  C   167  N4    ? ? ? 1_555 A  G   218  O6    ? ? 0 C   168  0 G   219  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog233  hydrog ? ? A  C   167  O2    ? ? ? 1_555 A  G   218  N2    ? ? 0 C   168  0 G   219  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog234  hydrog ? ? A  U   169  N3    ? ? ? 1_555 A  G   220  O6    ? ? 0 U   170  0 G   221  1_555 ? ? ? ? ? ? TYPE_27_PAIR ? ? 
hydrog235  hydrog ? ? A  U   169  O4    ? ? ? 1_555 A  G   220  N1    ? ? 0 U   170  0 G   221  1_555 ? ? ? ? ? ? TYPE_27_PAIR ? ? 
hydrog236  hydrog ? ? A  C   170  O2    ? ? ? 1_555 A  G   220  N1    ? ? 0 C   171  0 G   221  1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog237  hydrog ? ? A  G   174  N2    ? ? ? 1_555 A  U   175  O4    ? ? 0 G   175  0 U   176  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog238  hydrog ? ? A  G   184  N2    ? ? ? 1_555 A  A   438  N1    ? ? 0 G   185  0 A   439  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog239  hydrog ? ? A  G   189  N2    ? ? ? 1_555 A  A   434  N7    ? ? 0 G   190  0 A   435  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog240  hydrog ? ? A  A   190  N6    ? ? ? 1_555 A  A   235  N3    ? ? 0 A   191  0 A   236  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog241  hydrog ? ? A  A   190  N6    ? ? ? 1_555 A  U   433  O2    ? ? 0 A   191  0 U   434  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog242  hydrog ? ? A  A   190  N7    ? ? ? 1_555 A  U   433  N3    ? ? 0 A   191  0 U   434  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog243  hydrog ? ? A  A   191  N6    ? ? ? 1_555 A  G   202  N3    ? ? 0 A   192  0 G   203  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog244  hydrog ? ? A  A   191  N7    ? ? ? 1_555 A  G   202  N2    ? ? 0 A   192  0 G   203  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog245  hydrog ? ? A  A   192  N3    ? ? ? 1_555 A  G   412  N2    ? ? 0 A   193  0 G   413  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog246  hydrog ? ? A  A   193  N1    ? ? ? 1_555 A  U   201  N3    ? ? 0 A   194  0 U   202  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog247  hydrog ? ? A  A   193  N6    ? ? ? 1_555 A  U   201  O4    ? ? 0 A   194  0 U   202  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog248  hydrog ? ? A  C   194  N3    ? ? ? 1_555 A  G   200  N1    ? ? 0 C   195  0 G   201  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog249  hydrog ? ? A  C   194  N4    ? ? ? 1_555 A  G   200  O6    ? ? 0 C   195  0 G   201  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog250  hydrog ? ? A  C   194  O2    ? ? ? 1_555 A  G   200  N2    ? ? 0 C   195  0 G   201  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog251  hydrog ? ? A  G   195  N2    ? ? ? 1_555 A  A   198  N7    ? ? 0 G   196  0 A   199  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog252  hydrog ? ? A  G   195  N3    ? ? ? 1_555 A  A   198  N6    ? ? 0 G   196  0 A   199  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog253  hydrog ? ? A  G   195  N1    ? ? ? 1_555 A  U   424  O2    ? ? 0 G   196  0 U   425  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog254  hydrog ? ? A  A   197  N1    ? ? ? 1_555 A  G   415  N2    ? ? 0 A   198  0 G   416  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog255  hydrog ? ? A  A   197  N6    ? ? ? 1_555 A  G   415  N3    ? ? 0 A   198  0 G   416  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog256  hydrog ? ? A  A   203  N1    ? ? ? 1_555 A  A   435  N6    ? ? 0 A   204  0 A   436  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog257  hydrog ? ? A  A   203  N6    ? ? ? 1_555 A  A   435  N1    ? ? 0 A   204  0 A   436  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog258  hydrog ? ? A  U   204  N3    ? ? ? 1_555 A  A   436  N1    ? ? 0 U   205  0 A   437  1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog259  hydrog ? ? A  U   204  O2    ? ? ? 1_555 A  A   436  N6    ? ? 0 U   205  0 A   437  1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog260  hydrog ? ? A  G   205  N1    ? ? ? 1_555 A  U   232  O2    ? ? 0 G   206  0 U   233  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog261  hydrog ? ? A  G   205  O6    ? ? ? 1_555 A  U   232  N3    ? ? 0 G   206  0 U   233  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog262  hydrog ? ? A  U   206  N3    ? ? ? 1_555 A  A   231  N1    ? ? 0 U   207  0 A   232  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog263  hydrog ? ? A  U   206  O4    ? ? ? 1_555 A  A   231  N6    ? ? 0 U   207  0 A   232  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog264  hydrog ? ? A  C   207  N3    ? ? ? 1_555 A  G   230  N1    ? ? 0 C   208  0 G   231  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog265  hydrog ? ? A  C   207  N4    ? ? ? 1_555 A  G   230  O6    ? ? 0 C   208  0 G   231  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog266  hydrog ? ? A  C   207  O2    ? ? ? 1_555 A  G   230  N2    ? ? 0 C   208  0 G   231  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog267  hydrog ? ? A  G   208  N1    ? ? ? 1_555 A  C   229  N3    ? ? 0 G   209  0 C   230  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog268  hydrog ? ? A  G   208  N2    ? ? ? 1_555 A  C   229  O2    ? ? 0 G   209  0 C   230  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog269  hydrog ? ? A  G   208  O6    ? ? ? 1_555 A  C   229  N4    ? ? 0 G   209  0 C   230  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog270  hydrog ? ? A  U   209  N3    ? ? ? 1_555 A  G   228  O6    ? ? 0 U   210  0 G   229  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog271  hydrog ? ? A  U   209  O2    ? ? ? 1_555 A  G   228  N1    ? ? 0 U   210  0 G   229  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog272  hydrog ? ? A  U   210  O2    ? ? ? 1_555 A  C   227  N4    ? ? 0 U   211  0 C   228  1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog273  hydrog ? ? A  A   211  N6    ? ? ? 1_555 A  A   226  N7    ? ? 0 A   212  0 A   227  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog274  hydrog ? ? A  A   211  N7    ? ? ? 1_555 A  A   226  N6    ? ? 0 A   212  0 A   227  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog275  hydrog ? ? A  G   212  N2    ? ? ? 1_555 A  U   213  O4    ? ? 0 G   213  0 U   214  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog276  hydrog ? ? A  U   213  N3    ? ? ? 1_555 A  A   225  N7    ? ? 0 U   214  0 A   226  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog277  hydrog ? ? A  U   213  O2    ? ? ? 1_555 A  A   225  N6    ? ? 0 U   214  0 A   226  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog278  hydrog ? ? A  A   214  N6    ? ? ? 1_555 A  G   224  N3    ? ? 0 A   215  0 G   225  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog279  hydrog ? ? A  A   214  N7    ? ? ? 1_555 A  G   224  N2    ? ? 0 A   215  0 G   225  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog280  hydrog ? ? A  A   215  N1    ? ? ? 1_555 A  U   223  N3    ? ? 0 A   216  0 U   224  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog281  hydrog ? ? A  A   215  N6    ? ? ? 1_555 A  U   223  O4    ? ? 0 A   216  0 U   224  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog282  hydrog ? ? A  C   216  N3    ? ? ? 1_555 A  G   222  N1    ? ? 0 C   217  0 G   223  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog283  hydrog ? ? A  C   216  N4    ? ? ? 1_555 A  G   222  O6    ? ? 0 C   217  0 G   223  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog284  hydrog ? ? A  C   216  O2    ? ? ? 1_555 A  G   222  N2    ? ? 0 C   217  0 G   223  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog285  hydrog ? ? A  C   217  O2    ? ? ? 1_555 A  A   221  N6    ? ? 0 C   218  0 A   222  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog286  hydrog ? ? A  G   230  N2    ? ? ? 1_555 A  A   665  N3    ? ? 0 G   231  0 A   666  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog287  hydrog ? ? A  G   236  N1    ? ? ? 1_555 A  C   432  N3    ? ? 0 G   237  0 C   433  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog288  hydrog ? ? A  G   236  N2    ? ? ? 1_555 A  C   432  O2    ? ? 0 G   237  0 C   433  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog289  hydrog ? ? A  G   236  O6    ? ? ? 1_555 A  C   432  N4    ? ? 0 G   237  0 C   433  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog290  hydrog ? ? A  C   237  N3    ? ? ? 1_555 A  G   431  N1    ? ? 0 C   238  0 G   432  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog291  hydrog ? ? A  C   237  N4    ? ? ? 1_555 A  G   431  O6    ? ? 0 C   238  0 G   432  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog292  hydrog ? ? A  C   237  O2    ? ? ? 1_555 A  G   431  N2    ? ? 0 C   238  0 G   432  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog293  hydrog ? ? A  C   238  N3    ? ? ? 1_555 A  G   430  N1    ? ? 0 C   239  0 G   431  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog294  hydrog ? ? A  C   238  N4    ? ? ? 1_555 A  G   430  O6    ? ? 0 C   239  0 G   431  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog295  hydrog ? ? A  C   238  O2    ? ? ? 1_555 A  G   430  N2    ? ? 0 C   239  0 G   431  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog296  hydrog ? ? A  C   239  N3    ? ? ? 1_555 A  G   378  N1    ? ? 0 C   240  0 G   379  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog297  hydrog ? ? A  C   239  N4    ? ? ? 1_555 A  G   378  O6    ? ? 0 C   240  0 G   379  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog298  hydrog ? ? A  C   239  O2    ? ? ? 1_555 A  G   378  N2    ? ? 0 C   240  0 G   379  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog299  hydrog ? ? A  A   240  N6    ? ? ? 1_555 A  U   269  O2    ? ? 0 A   241  0 U   270  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog300  hydrog ? ? A  A   240  N7    ? ? ? 1_555 A  U   269  N3    ? ? 0 A   241  0 U   270  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog301  hydrog ? ? A  A   241  N6    ? ? ? 1_555 A  G   268  N3    ? ? 0 A   242  0 G   269  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog302  hydrog ? ? A  A   241  N7    ? ? ? 1_555 A  G   268  N2    ? ? 0 A   242  0 G   269  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog303  hydrog ? ? A  A   242  N6    ? ? ? 1_555 A  U   267  O2    ? ? 0 A   243  0 U   268  1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog304  hydrog ? ? A  A   242  N3    ? ? ? 1_555 A  G   273  N2    ? ? 0 A   243  0 G   274  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog305  hydrog ? ? A  C   243  N3    ? ? ? 1_555 A  G   266  N1    ? ? 0 C   244  0 G   267  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog306  hydrog ? ? A  C   243  N4    ? ? ? 1_555 A  G   266  O6    ? ? 0 C   244  0 G   267  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog307  hydrog ? ? A  C   243  O2    ? ? ? 1_555 A  G   266  N2    ? ? 0 C   244  0 G   267  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog308  hydrog ? ? A  C   244  N3    ? ? ? 1_555 A  G   265  N1    ? ? 0 C   245  0 G   266  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog309  hydrog ? ? A  C   244  N4    ? ? ? 1_555 A  G   265  O6    ? ? 0 C   245  0 G   266  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog310  hydrog ? ? A  C   244  O2    ? ? ? 1_555 A  G   265  N2    ? ? 0 C   245  0 G   266  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog311  hydrog ? ? A  G   245  N2    ? ? ? 1_555 A  U   264  O4    ? ? 0 G   246  0 U   265  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog312  hydrog ? ? A  A   246  N6    ? ? ? 1_555 A  G   263  N3    ? ? 0 A   247  0 G   264  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog313  hydrog ? ? A  A   246  N7    ? ? ? 1_555 A  G   263  N2    ? ? 0 A   247  0 G   264  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog314  hydrog ? ? A  A   247  N1    ? ? ? 1_555 A  U   264  N3    ? ? 0 A   248  0 U   265  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog315  hydrog ? ? A  A   247  N6    ? ? ? 1_555 A  U   264  O4    ? ? 0 A   248  0 U   265  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog316  hydrog ? ? A  G   248  N1    ? ? ? 1_555 A  C   259  N3    ? ? 0 G   249  0 C   260  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog317  hydrog ? ? A  G   248  N2    ? ? ? 1_555 A  C   259  O2    ? ? 0 G   249  0 C   260  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog318  hydrog ? ? A  G   248  O6    ? ? ? 1_555 A  C   259  N4    ? ? 0 G   249  0 C   260  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog319  hydrog ? ? A  C   249  N3    ? ? ? 1_555 A  G   258  N1    ? ? 0 C   250  0 G   259  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog320  hydrog ? ? A  C   249  N4    ? ? ? 1_555 A  G   258  O6    ? ? 0 C   250  0 G   259  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog321  hydrog ? ? A  C   249  O2    ? ? ? 1_555 A  G   258  N2    ? ? 0 C   250  0 G   259  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog322  hydrog ? ? A  C   250  N3    ? ? ? 1_555 A  G   257  N1    ? ? 0 C   251  0 G   258  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog323  hydrog ? ? A  C   250  N4    ? ? ? 1_555 A  G   257  O6    ? ? 0 C   251  0 G   258  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog324  hydrog ? ? A  C   250  O2    ? ? ? 1_555 A  G   257  N2    ? ? 0 C   251  0 G   258  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog325  hydrog ? ? A  C   251  N3    ? ? ? 1_555 A  G   256  N1    ? ? 0 C   252  0 G   257  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog326  hydrog ? ? A  C   251  N4    ? ? ? 1_555 A  G   256  O6    ? ? 0 C   252  0 G   257  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog327  hydrog ? ? A  C   251  O2    ? ? ? 1_555 A  G   256  N2    ? ? 0 C   252  0 G   257  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog328  hydrog ? ? A  U   252  O2    ? ? ? 1_555 A  C   255  N4    ? ? 0 U   253  0 C   256  1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog329  hydrog ? ? A  C   270  N4    ? ? ? 1_555 A  A   377  N1    ? ? 0 C   271  0 A   378  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog330  hydrog ? ? A  G   272  N1    ? ? ? 1_555 A  C   376  N3    ? ? 0 G   273  0 C   377  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog331  hydrog ? ? A  G   272  N2    ? ? ? 1_555 A  C   376  O2    ? ? 0 G   273  0 C   377  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog332  hydrog ? ? A  G   272  O6    ? ? ? 1_555 A  C   376  N4    ? ? 0 G   273  0 C   377  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog333  hydrog ? ? A  G   273  N1    ? ? ? 1_555 A  C   375  N3    ? ? 0 G   274  0 C   376  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog334  hydrog ? ? A  G   273  N2    ? ? ? 1_555 A  C   375  O2    ? ? 0 G   274  0 C   376  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog335  hydrog ? ? A  G   273  O6    ? ? ? 1_555 A  C   375  N4    ? ? 0 G   274  0 C   376  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog336  hydrog ? ? A  G   274  N1    ? ? ? 1_555 A  U   373  O2    ? ? 0 G   275  0 U   374  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog337  hydrog ? ? A  G   274  O6    ? ? ? 1_555 A  U   373  N3    ? ? 0 G   275  0 U   374  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog338  hydrog ? ? A  C   275  N3    ? ? ? 1_555 A  G   372  N1    ? ? 0 C   276  0 G   373  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog339  hydrog ? ? A  C   275  N4    ? ? ? 1_555 A  G   372  O6    ? ? 0 C   276  0 G   373  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog340  hydrog ? ? A  C   275  O2    ? ? ? 1_555 A  G   372  N2    ? ? 0 C   276  0 G   373  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog341  hydrog ? ? A  U   276  N3    ? ? ? 1_555 A  A   371  N1    ? ? 0 U   277  0 A   372  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog342  hydrog ? ? A  U   276  O4    ? ? ? 1_555 A  A   371  N6    ? ? 0 U   277  0 A   372  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog343  hydrog ? ? A  A   277  N1    ? ? ? 1_555 A  U   370  N3    ? ? 0 A   278  0 U   371  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog344  hydrog ? ? A  A   277  N6    ? ? ? 1_555 A  U   370  O4    ? ? 0 A   278  0 U   371  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog345  hydrog ? ? A  C   278  N3    ? ? ? 1_555 A  G   369  N1    ? ? 0 C   279  0 G   370  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog346  hydrog ? ? A  C   278  N4    ? ? ? 1_555 A  G   369  O6    ? ? 0 C   279  0 G   370  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog347  hydrog ? ? A  C   278  O2    ? ? ? 1_555 A  G   369  N2    ? ? 0 C   279  0 G   370  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog348  hydrog ? ? A  C   279  N3    ? ? ? 1_555 A  G   368  N1    ? ? 0 C   280  0 G   369  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog349  hydrog ? ? A  C   279  N4    ? ? ? 1_555 A  G   368  O6    ? ? 0 C   280  0 G   369  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog350  hydrog ? ? A  C   279  O2    ? ? ? 1_555 A  G   368  N2    ? ? 0 C   280  0 G   369  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog351  hydrog ? ? A  U   280  O2    ? ? ? 1_555 A  C   367  N4    ? ? 0 U   281  0 C   368  1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog352  hydrog ? ? A  C   281  O2    ? ? ? 1_555 A  C   367  N4    ? ? 0 C   282  0 C   368  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog353  hydrog ? ? A  C   283  O2    ? ? ? 1_555 A  G   366  N1    ? ? 0 C   284  0 G   367  1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog354  hydrog ? ? A  A   284  N6    ? ? ? 1_555 A  G   366  N3    ? ? 0 A   285  0 G   367  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog355  hydrog ? ? A  A   284  N7    ? ? ? 1_555 A  G   366  N2    ? ? 0 A   285  0 G   367  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog356  hydrog ? ? A  U   285  N3    ? ? ? 1_555 A  U   365  O2    ? ? 0 U   286  0 U   366  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog357  hydrog ? ? A  U   285  O4    ? ? ? 1_555 A  U   365  N3    ? ? 0 U   286  0 U   366  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog358  hydrog ? ? A  C   286  N3    ? ? ? 1_555 A  G   364  N1    ? ? 0 C   287  0 G   365  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog359  hydrog ? ? A  C   286  N4    ? ? ? 1_555 A  G   364  O6    ? ? 0 C   287  0 G   365  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog360  hydrog ? ? A  C   286  O2    ? ? ? 1_555 A  G   364  N2    ? ? 0 C   287  0 G   365  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog361  hydrog ? ? A  G   288  N1    ? ? ? 1_555 A  A   362  N1    ? ? 0 G   289  0 A   363  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog362  hydrog ? ? A  C   289  N3    ? ? ? 1_555 A  G   361  N1    ? ? 0 C   290  0 G   362  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog363  hydrog ? ? A  C   289  N4    ? ? ? 1_555 A  G   361  O6    ? ? 0 C   290  0 G   362  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog364  hydrog ? ? A  C   289  O2    ? ? ? 1_555 A  G   361  N2    ? ? 0 C   290  0 G   362  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog365  hydrog ? ? A  C   290  N3    ? ? ? 1_555 A  C   360  N4    ? ? 0 C   291  0 C   361  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog366  hydrog ? ? A  G   291  N2    ? ? ? 1_555 A  A   359  N7    ? ? 0 G   292  0 A   360  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog367  hydrog ? ? A  G   291  N3    ? ? ? 1_555 A  A   359  N6    ? ? 0 G   292  0 A   360  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog368  hydrog ? ? A  A   292  N6    ? ? ? 1_555 A  U   358  O2    ? ? 0 A   293  0 U   359  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog369  hydrog ? ? A  A   292  N7    ? ? ? 1_555 A  U   358  N3    ? ? 0 A   293  0 U   359  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog370  hydrog ? ? A  C   294  N4    ? ? ? 1_555 A  C   355  O2    ? ? 0 C   295  0 C   356  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog371  hydrog ? ? A  G   295  N1    ? ? ? 1_555 A  C   354  N3    ? ? 0 G   296  0 C   355  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog372  hydrog ? ? A  G   295  N2    ? ? ? 1_555 A  C   354  O2    ? ? 0 G   296  0 C   355  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog373  hydrog ? ? A  G   295  O6    ? ? ? 1_555 A  C   354  N4    ? ? 0 G   296  0 C   355  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog374  hydrog ? ? A  U   296  N3    ? ? ? 1_555 A  A   353  N1    ? ? 0 U   297  0 A   354  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog375  hydrog ? ? A  U   296  O4    ? ? ? 1_555 A  A   353  N6    ? ? 0 U   297  0 A   354  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog376  hydrog ? ? A  C   297  N3    ? ? ? 1_555 A  G   352  N1    ? ? 0 C   298  0 G   353  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog377  hydrog ? ? A  C   297  N4    ? ? ? 1_555 A  G   352  O6    ? ? 0 C   298  0 G   353  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog378  hydrog ? ? A  C   297  O2    ? ? ? 1_555 A  G   352  N2    ? ? 0 C   298  0 G   353  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog379  hydrog ? ? A  U   298  N3    ? ? ? 1_555 A  A   351  N1    ? ? 0 U   299  0 A   352  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog380  hydrog ? ? A  U   298  O4    ? ? ? 1_555 A  A   351  N6    ? ? 0 U   299  0 A   352  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog381  hydrog ? ? A  C   299  N3    ? ? ? 1_555 A  G   350  N1    ? ? 0 C   300  0 G   351  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog382  hydrog ? ? A  C   299  N4    ? ? ? 1_555 A  G   350  O6    ? ? 0 C   300  0 G   351  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog383  hydrog ? ? A  C   299  O2    ? ? ? 1_555 A  G   350  N2    ? ? 0 C   300  0 G   351  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog384  hydrog ? ? A  G   300  N1    ? ? ? 1_555 A  C   349  N3    ? ? 0 G   301  0 C   350  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog385  hydrog ? ? A  G   300  N2    ? ? ? 1_555 A  C   349  O2    ? ? 0 G   301  0 C   350  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog386  hydrog ? ? A  G   300  O6    ? ? ? 1_555 A  C   349  N4    ? ? 0 G   301  0 C   350  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog387  hydrog ? ? A  A   301  N1    ? ? ? 1_555 A  U   348  N3    ? ? 0 A   302  0 U   349  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog388  hydrog ? ? A  A   301  N6    ? ? ? 1_555 A  U   348  O4    ? ? 0 A   302  0 U   349  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog389  hydrog ? ? A  C   302  N3    ? ? ? 1_555 A  C   347  N4    ? ? 0 C   303  0 C   348  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog390  hydrog ? ? A  G   303  N2    ? ? ? 1_555 A  A   346  N7    ? ? 0 G   304  0 A   347  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog391  hydrog ? ? A  G   303  N3    ? ? ? 1_555 A  A   346  N6    ? ? 0 G   304  0 A   347  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog392  hydrog ? ? A  A   304  N6    ? ? ? 1_555 A  G   344  O6    ? ? 0 A   305  0 G   345  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog393  hydrog ? ? A  A   305  N6    ? ? ? 1_555 A  G   344  O6    ? ? 0 A   306  0 G   345  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog394  hydrog ? ? A  G   306  N1    ? ? ? 1_555 A  C   322  N3    ? ? 0 G   307  0 C   323  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog395  hydrog ? ? A  G   306  N2    ? ? ? 1_555 A  C   322  O2    ? ? 0 G   307  0 C   323  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog396  hydrog ? ? A  G   306  O6    ? ? ? 1_555 A  C   322  N4    ? ? 0 G   307  0 C   323  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog397  hydrog ? ? A  U   307  N3    ? ? ? 1_555 A  A   338  N1    ? ? 0 U   308  0 A   339  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog398  hydrog ? ? A  U   307  O4    ? ? ? 1_555 A  A   338  N6    ? ? 0 U   308  0 A   339  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog399  hydrog ? ? A  C   308  N3    ? ? ? 1_555 A  G   321  N1    ? ? 0 C   309  0 G   322  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog400  hydrog ? ? A  C   308  N4    ? ? ? 1_555 A  G   321  O6    ? ? 0 C   309  0 G   322  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog401  hydrog ? ? A  C   308  O2    ? ? ? 1_555 A  G   321  N2    ? ? 0 C   309  0 G   322  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog402  hydrog ? ? A  U   309  N3    ? ? ? 1_555 A  A   320  N1    ? ? 0 U   310  0 A   321  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog403  hydrog ? ? A  U   309  O4    ? ? ? 1_555 A  A   320  N6    ? ? 0 U   310  0 A   321  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog404  hydrog ? ? A  C   310  N3    ? ? ? 1_555 A  G   319  N1    ? ? 0 C   311  0 G   320  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog405  hydrog ? ? A  C   310  N4    ? ? ? 1_555 A  G   319  O6    ? ? 0 C   311  0 G   320  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog406  hydrog ? ? A  C   310  O2    ? ? ? 1_555 A  G   319  N2    ? ? 0 C   311  0 G   320  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog407  hydrog ? ? A  U   311  N3    ? ? ? 1_555 A  A   318  N1    ? ? 0 U   312  0 A   319  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog408  hydrog ? ? A  U   311  O4    ? ? ? 1_555 A  A   318  N6    ? ? 0 U   312  0 A   319  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog409  hydrog ? ? A  U   312  N3    ? ? ? 1_555 A  A   316  N7    ? ? 0 U   313  0 A   317  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog410  hydrog ? ? A  U   312  O2    ? ? ? 1_555 A  A   316  N6    ? ? 0 U   313  0 A   317  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog411  hydrog ? ? A  G   313  N2    ? ? ? 1_555 A  A   336  N1    ? ? 0 G   314  0 A   337  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog412  hydrog ? ? A  G   313  N3    ? ? ? 1_555 A  A   336  N6    ? ? 0 G   314  0 A   337  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog413  hydrog ? ? A  G   314  N2    ? ? ? 1_555 A  G   335  N3    ? ? 0 G   315  0 G   336  1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog414  hydrog ? ? A  G   314  N3    ? ? ? 1_555 A  G   335  N2    ? ? 0 G   315  0 G   336  1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog415  hydrog ? ? A  A   315  N6    ? ? ? 1_555 A  U   1313 O2    ? ? 0 A   316  0 U   1314 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog416  hydrog ? ? A  G   323  N1    ? ? ? 1_555 A  C   340  N3    ? ? 0 G   324  0 C   341  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog417  hydrog ? ? A  G   323  N2    ? ? ? 1_555 A  C   340  O2    ? ? 0 G   324  0 C   341  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog418  hydrog ? ? A  G   323  O6    ? ? ? 1_555 A  C   340  N4    ? ? 0 G   324  0 C   341  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog419  hydrog ? ? A  U   324  N3    ? ? ? 1_555 A  A   339  N1    ? ? 0 U   325  0 A   340  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog420  hydrog ? ? A  U   324  O4    ? ? ? 1_555 A  A   339  N6    ? ? 0 U   325  0 A   340  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog421  hydrog ? ? A  G   325  N1    ? ? ? 1_555 A  C   329  N3    ? ? 0 G   326  0 C   330  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog422  hydrog ? ? A  G   325  N2    ? ? ? 1_555 A  C   329  O2    ? ? 0 G   326  0 C   330  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog423  hydrog ? ? A  G   325  O6    ? ? ? 1_555 A  C   329  N4    ? ? 0 G   326  0 C   330  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog424  hydrog ? ? A  A   328  N3    ? ? ? 1_555 A  U   345  N3    ? ? 0 A   329  0 U   346  1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog425  hydrog ? ? A  A   330  N6    ? ? ? 1_555 A  G   344  N3    ? ? 0 A   331  0 G   345  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog426  hydrog ? ? A  A   330  N7    ? ? ? 1_555 A  G   344  N2    ? ? 0 A   331  0 G   345  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog427  hydrog ? ? A  G   331  N1    ? ? ? 1_555 A  C   343  N3    ? ? 0 G   332  0 C   344  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog428  hydrog ? ? A  G   331  N2    ? ? ? 1_555 A  C   343  O2    ? ? 0 G   332  0 C   344  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog429  hydrog ? ? A  G   331  O6    ? ? ? 1_555 A  C   343  N4    ? ? 0 G   332  0 C   344  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog430  hydrog ? ? A  G   332  N1    ? ? ? 1_555 A  C   342  N3    ? ? 0 G   333  0 C   343  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog431  hydrog ? ? A  G   332  N2    ? ? ? 1_555 A  C   342  O2    ? ? 0 G   333  0 C   343  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog432  hydrog ? ? A  G   332  O6    ? ? ? 1_555 A  C   342  N4    ? ? 0 G   333  0 C   343  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog433  hydrog ? ? A  G   333  N1    ? ? ? 1_555 A  C   341  N3    ? ? 0 G   334  0 C   342  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog434  hydrog ? ? A  G   333  N2    ? ? ? 1_555 A  C   341  O2    ? ? 0 G   334  0 C   342  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog435  hydrog ? ? A  G   333  O6    ? ? ? 1_555 A  C   341  N4    ? ? 0 G   334  0 C   342  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog436  hydrog ? ? A  U   334  N3    ? ? ? 1_555 A  A   338  N7    ? ? 0 U   335  0 A   339  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog437  hydrog ? ? A  U   334  O2    ? ? ? 1_555 A  A   338  N6    ? ? 0 U   335  0 A   339  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog438  hydrog ? ? A  G   357  N2    ? ? ? 1_555 A  U   358  O4    ? ? 0 G   358  0 U   359  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog439  hydrog ? ? A  A   379  N6    ? ? ? 1_555 A  A   407  N7    ? ? 0 A   380  0 A   408  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog440  hydrog ? ? A  A   379  N7    ? ? ? 1_555 A  A   407  N6    ? ? 0 A   380  0 A   408  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog441  hydrog ? ? A  G   380  N2    ? ? ? 1_555 A  U   381  O4    ? ? 0 G   381  0 U   382  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog442  hydrog ? ? A  U   381  N3    ? ? ? 1_555 A  A   406  N7    ? ? 0 U   382  0 A   407  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog443  hydrog ? ? A  U   381  O2    ? ? ? 1_555 A  A   406  N6    ? ? 0 U   382  0 A   407  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog444  hydrog ? ? A  A   382  N6    ? ? ? 1_555 A  G   405  N3    ? ? 0 A   383  0 G   406  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog445  hydrog ? ? A  A   382  N7    ? ? ? 1_555 A  G   405  N2    ? ? 0 A   383  0 G   406  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog446  hydrog ? ? A  G   383  N1    ? ? ? 1_555 A  C   404  N3    ? ? 0 G   384  0 C   405  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog447  hydrog ? ? A  G   383  N2    ? ? ? 1_555 A  C   404  O2    ? ? 0 G   384  0 C   405  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog448  hydrog ? ? A  G   383  O6    ? ? ? 1_555 A  C   404  N4    ? ? 0 G   384  0 C   405  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog449  hydrog ? ? A  C   384  N3    ? ? ? 1_555 A  G   403  N1    ? ? 0 C   385  0 G   404  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog450  hydrog ? ? A  C   384  N4    ? ? ? 1_555 A  G   403  O6    ? ? 0 C   385  0 G   404  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog451  hydrog ? ? A  C   384  O2    ? ? ? 1_555 A  G   403  N2    ? ? 0 C   385  0 G   404  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog452  hydrog ? ? A  G   385  N1    ? ? ? 1_555 A  C   402  N3    ? ? 0 G   386  0 C   403  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog453  hydrog ? ? A  G   385  N2    ? ? ? 1_555 A  C   402  O2    ? ? 0 G   386  0 C   403  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog454  hydrog ? ? A  G   385  O6    ? ? ? 1_555 A  C   402  N4    ? ? 0 G   386  0 C   403  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog455  hydrog ? ? A  G   386  N1    ? ? ? 1_555 A  U   401  O2    ? ? 0 G   387  0 U   402  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog456  hydrog ? ? A  G   386  O6    ? ? ? 1_555 A  U   401  N3    ? ? 0 G   387  0 U   402  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog457  hydrog ? ? A  G   387  N1    ? ? ? 1_555 A  C   400  N3    ? ? 0 G   388  0 C   401  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog458  hydrog ? ? A  G   387  N2    ? ? ? 1_555 A  C   400  O2    ? ? 0 G   388  0 C   401  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog459  hydrog ? ? A  G   387  O6    ? ? ? 1_555 A  C   400  N4    ? ? 0 G   388  0 C   401  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog460  hydrog ? ? A  G   388  N1    ? ? ? 1_555 A  C   399  N3    ? ? 0 G   389  0 C   400  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog461  hydrog ? ? A  G   388  N2    ? ? ? 1_555 A  C   399  O2    ? ? 0 G   389  0 C   400  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog462  hydrog ? ? A  G   388  O6    ? ? ? 1_555 A  C   399  N4    ? ? 0 G   389  0 C   400  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog463  hydrog ? ? A  G   389  N1    ? ? ? 1_555 A  C   398  N3    ? ? 0 G   390  0 C   399  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog464  hydrog ? ? A  G   389  N2    ? ? ? 1_555 A  C   398  O2    ? ? 0 G   390  0 C   399  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog465  hydrog ? ? A  G   389  O6    ? ? ? 1_555 A  C   398  N4    ? ? 0 G   390  0 C   399  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog466  hydrog ? ? A  U   390  N3    ? ? ? 1_555 A  U   397  O4    ? ? 0 U   391  0 U   398  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog467  hydrog ? ? A  U   390  O2    ? ? ? 1_555 A  U   397  N3    ? ? 0 U   391  0 U   398  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog468  hydrog ? ? A  G   393  N3    ? ? ? 1_555 A  G   416  N2    ? ? 0 G   394  0 G   417  1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog469  hydrog ? ? A  A   394  N1    ? ? ? 1_555 A  C   2442 N4    ? ? 0 A   395  0 C   2443 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog470  hydrog ? ? A  U   395  O4    ? ? ? 1_555 A  G   2441 N2    ? ? 0 U   396  0 G   2442 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog471  hydrog ? ? A  A   406  N6    ? ? ? 1_555 A  A   428  N1    ? ? 0 A   407  0 A   429  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog472  hydrog ? ? A  A   407  N1    ? ? ? 1_555 A  A   428  N6    ? ? 0 A   408  0 A   429  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog473  hydrog ? ? A  A   407  N6    ? ? ? 1_555 A  A   429  N1    ? ? 0 A   408  0 A   430  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog474  hydrog ? ? A  C   411  N3    ? ? ? 1_555 A  G   427  N1    ? ? 0 C   412  0 G   428  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog475  hydrog ? ? A  C   411  N4    ? ? ? 1_555 A  G   427  O6    ? ? 0 C   412  0 G   428  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog476  hydrog ? ? A  C   411  O2    ? ? ? 1_555 A  G   427  N2    ? ? 0 C   412  0 G   428  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog477  hydrog ? ? A  G   412  N1    ? ? ? 1_555 A  C   426  N3    ? ? 0 G   413  0 C   427  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog478  hydrog ? ? A  G   412  N2    ? ? ? 1_555 A  C   426  O2    ? ? 0 G   413  0 C   427  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog479  hydrog ? ? A  G   412  O6    ? ? ? 1_555 A  C   426  N4    ? ? 0 G   413  0 C   427  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog480  hydrog ? ? A  C   413  N3    ? ? ? 1_555 A  G   425  N1    ? ? 0 C   414  0 G   426  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog481  hydrog ? ? A  C   413  N4    ? ? ? 1_555 A  G   425  O6    ? ? 0 C   414  0 G   426  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog482  hydrog ? ? A  C   413  O2    ? ? ? 1_555 A  G   425  N2    ? ? 0 C   414  0 G   426  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog483  hydrog ? ? A  A   414  N1    ? ? ? 1_555 A  U   424  N3    ? ? 0 A   415  0 U   425  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog484  hydrog ? ? A  A   414  N6    ? ? ? 1_555 A  U   424  O4    ? ? 0 A   415  0 U   425  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog485  hydrog ? ? A  G   415  N1    ? ? ? 1_555 A  C   423  N3    ? ? 0 G   416  0 C   424  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog486  hydrog ? ? A  G   415  N2    ? ? ? 1_555 A  C   423  O2    ? ? 0 G   416  0 C   424  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog487  hydrog ? ? A  G   415  O6    ? ? ? 1_555 A  C   423  N4    ? ? 0 G   416  0 C   424  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog488  hydrog ? ? A  C   417  N3    ? ? ? 1_555 A  G   2448 N1    ? ? 0 C   418  0 G   2449 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog489  hydrog ? ? A  C   417  N4    ? ? ? 1_555 A  G   2448 O6    ? ? 0 C   418  0 G   2449 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog490  hydrog ? ? A  C   417  O2    ? ? ? 1_555 A  G   2448 N2    ? ? 0 C   418  0 G   2449 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog491  hydrog ? ? A  A   418  N3    ? ? ? 1_555 A  C   1919 N4    ? ? 0 A   419  0 C   1920 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog492  hydrog ? ? A  A   418  N1    ? ? ? 1_555 A  U   2447 N3    ? ? 0 A   419  0 U   2448 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog493  hydrog ? ? A  A   418  N6    ? ? ? 1_555 A  U   2447 O4    ? ? 0 A   419  0 U   2448 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog494  hydrog ? ? A  U   419  N3    ? ? ? 1_555 A  A   2446 N1    ? ? 0 U   420  0 A   2447 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog495  hydrog ? ? A  U   419  O4    ? ? ? 1_555 A  A   2446 N6    ? ? 0 U   420  0 A   2447 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog496  hydrog ? ? A  C   420  N3    ? ? ? 1_555 A  G   2445 N1    ? ? 0 C   421  0 G   2446 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog497  hydrog ? ? A  C   420  N4    ? ? ? 1_555 A  G   2445 O6    ? ? 0 C   421  0 G   2446 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog498  hydrog ? ? A  C   420  O2    ? ? ? 1_555 A  G   2445 N2    ? ? 0 C   421  0 G   2446 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog499  hydrog ? ? A  G   421  N1    ? ? ? 1_555 A  U   2444 O2    ? ? 0 G   422  0 U   2445 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog500  hydrog ? ? A  G   421  O6    ? ? ? 1_555 A  U   2444 N3    ? ? 0 G   422  0 U   2445 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog501  hydrog ? ? A  A   422  N1    ? ? ? 1_555 A  U   2443 N3    ? ? 0 A   423  0 U   2444 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog502  hydrog ? ? A  A   422  N6    ? ? ? 1_555 A  U   2443 O4    ? ? 0 A   423  0 U   2444 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog503  hydrog ? ? A  A   440  N3    ? ? ? 1_555 A  A   441  N6    ? ? 0 A   441  0 A   442  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog504  hydrog ? ? A  A   440  N3    ? ? ? 1_555 A  C   442  N4    ? ? 0 A   441  0 C   443  1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog505  hydrog ? ? A  A   448  N3    ? ? ? 1_555 A  G   1348 N2    ? ? 0 A   449  0 G   1349 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog506  hydrog ? ? A  G   451  N2    ? ? ? 1_555 A  A   459  N1    ? ? 0 G   452  0 A   460  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog507  hydrog ? ? A  G   451  N3    ? ? ? 1_555 A  A   459  N6    ? ? 0 G   452  0 A   460  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog508  hydrog ? ? A  U   453  N3    ? ? ? 1_555 A  U   1361 O2    ? ? 0 U   454  0 U   1362 1_555 ? ? ? ? ? ? 'U-U MISPAIR' ? 
? 
hydrog509  hydrog ? ? A  A   454  N1    ? ? ? 1_555 A  A   459  N6    ? ? 0 A   455  0 A   460  1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog510  hydrog ? ? A  A   454  N6    ? ? ? 1_555 A  A   459  N7    ? ? 0 A   455  0 A   460  1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog511  hydrog ? ? A  G   457  N2    ? ? ? 1_555 A  A   462  N3    ? ? 0 G   458  0 A   463  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog512  hydrog ? ? A  A   462  N6    ? ? ? 1_555 A  A   476  N7    ? ? 0 A   463  0 A   477  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog513  hydrog ? ? A  A   462  N7    ? ? ? 1_555 A  A   476  N6    ? ? 0 A   463  0 A   477  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog514  hydrog ? ? A  G   463  N2    ? ? ? 1_555 A  U   464  O4    ? ? 0 G   464  0 U   465  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog515  hydrog ? ? A  U   464  N3    ? ? ? 1_555 A  A   475  N7    ? ? 0 U   465  0 A   476  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog516  hydrog ? ? A  U   464  O2    ? ? ? 1_555 A  A   475  N6    ? ? 0 U   465  0 A   476  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog517  hydrog ? ? A  A   465  N6    ? ? ? 1_555 A  G   474  N3    ? ? 0 A   466  0 G   475  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog518  hydrog ? ? A  A   465  N7    ? ? ? 1_555 A  G   474  N2    ? ? 0 A   466  0 G   475  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog519  hydrog ? ? A  G   466  N1    ? ? ? 1_555 A  C   473  N3    ? ? 0 G   467  0 C   474  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog520  hydrog ? ? A  G   466  N2    ? ? ? 1_555 A  C   473  O2    ? ? 0 G   467  0 C   474  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog521  hydrog ? ? A  G   466  O6    ? ? ? 1_555 A  C   473  N4    ? ? 0 G   467  0 C   474  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog522  hydrog ? ? A  U   467  N3    ? ? ? 1_555 A  A   472  N1    ? ? 0 U   468  0 A   473  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog523  hydrog ? ? A  U   467  O4    ? ? ? 1_555 A  A   472  N6    ? ? 0 U   468  0 A   473  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog524  hydrog ? ? A  G   468  N2    ? ? ? 1_555 A  A   471  N7    ? ? 0 G   469  0 A   472  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog525  hydrog ? ? A  G   470  N2    ? ? ? 1_555 A  C   773  O2    ? ? 0 G   471  0 C   774  1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog526  hydrog ? ? A  U   480  N3    ? ? ? 1_555 A  A   484  N7    ? ? 0 U   481  0 A   485  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog527  hydrog ? ? A  U   480  O2    ? ? ? 1_555 A  A   484  N6    ? ? 0 U   481  0 A   485  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog528  hydrog ? ? A  G   481  N2    ? ? ? 1_555 A  A   485  N7    ? ? 0 G   482  0 A   486  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog529  hydrog ? ? A  C   482  N4    ? ? ? 1_555 A  A   506  N7    ? ? 0 C   483  0 A   507  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog530  hydrog ? ? A  A   484  N1    ? ? ? 1_555 A  A   508  N6    ? ? 0 A   485  0 A   509  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog531  hydrog ? ? A  A   484  N6    ? ? ? 1_555 A  A   508  N1    ? ? 0 A   485  0 A   509  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog532  hydrog ? ? A  A   485  N1    ? ? ? 1_555 A  A   510  N6    ? ? 0 A   486  0 A   511  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog533  hydrog ? ? A  A   485  N6    ? ? ? 1_555 A  A   510  N1    ? ? 0 A   486  0 A   511  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog534  hydrog ? ? A  G   486  N3    ? ? ? 1_555 A  G   511  N2    ? ? 0 G   487  0 G   512  1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog535  hydrog ? ? A  G   486  N1    ? ? ? 1_555 A  C   514  N3    ? ? 0 G   487  0 C   515  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog536  hydrog ? ? A  G   486  N2    ? ? ? 1_555 A  C   514  O2    ? ? 0 G   487  0 C   515  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog537  hydrog ? ? A  G   486  O6    ? ? ? 1_555 A  C   514  N4    ? ? 0 G   487  0 C   515  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog538  hydrog ? ? A  U   487  O2    ? ? ? 1_555 A  G   502  N1    ? ? 0 U   488  0 G   503  1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog539  hydrog ? ? A  A   488  N6    ? ? ? 1_555 A  G   502  N3    ? ? 0 A   489  0 G   503  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog540  hydrog ? ? A  A   488  N7    ? ? ? 1_555 A  G   502  N2    ? ? 0 A   489  0 G   503  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog541  hydrog ? ? A  C   489  N4    ? ? ? 1_555 A  A   501  N1    ? ? 0 C   490  0 A   502  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog542  hydrog ? ? A  C   490  N3    ? ? ? 1_555 A  G   500  N1    ? ? 0 C   491  0 G   501  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog543  hydrog ? ? A  C   490  N4    ? ? ? 1_555 A  G   500  O6    ? ? 0 C   491  0 G   501  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog544  hydrog ? ? A  C   490  O2    ? ? ? 1_555 A  G   500  N2    ? ? 0 C   491  0 G   501  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog545  hydrog ? ? A  C   490  N4    ? ? ? 1_555 A  A   501  N1    ? ? 0 C   491  0 A   502  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog546  hydrog ? ? A  C   491  N3    ? ? ? 1_555 A  G   499  N1    ? ? 0 C   492  0 G   500  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog547  hydrog ? ? A  C   491  N4    ? ? ? 1_555 A  G   499  O6    ? ? 0 C   492  0 G   500  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog548  hydrog ? ? A  C   491  O2    ? ? ? 1_555 A  G   499  N2    ? ? 0 C   492  0 G   500  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog549  hydrog ? ? A  U   492  N3    ? ? ? 1_555 A  G   498  O6    ? ? 0 U   493  0 G   499  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog550  hydrog ? ? A  U   492  O2    ? ? ? 1_555 A  G   498  N1    ? ? 0 U   493  0 G   499  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog551  hydrog ? ? A  C   493  O2    ? ? ? 1_555 A  A   497  N6    ? ? 0 C   494  0 A   498  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog552  hydrog ? ? A  G   503  N1    ? ? ? 1_555 A  G   511  O6    ? ? 0 G   504  0 G   512  1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog553  hydrog ? ? A  C   504  O2    ? ? ? 1_555 A  A   508  N6    ? ? 0 C   505  0 A   509  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog554  hydrog ? ? A  G   505  N2    ? ? ? 1_555 A  A   510  N7    ? ? 0 G   506  0 A   511  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog555  hydrog ? ? A  G   505  N3    ? ? ? 1_555 A  A   510  N6    ? ? 0 G   506  0 A   511  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog556  hydrog ? ? A  A   520  N3    ? ? ? 1_555 A  G   1363 N2    ? ? 0 A   521  0 G   1364 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog557  hydrog ? ? A  A   531  N3    ? ? ? 1_555 A  G   2659 N2    ? ? 0 A   532  0 G   2660 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog558  hydrog ? ? A  G   534  N7    ? ? ? 1_555 A  G   2081 N1    ? ? 0 G   535  0 G   2082 1_555 ? ? ? ? ? ? TYPE_7_PAIR ? ? 
hydrog559  hydrog ? ? A  G   534  O6    ? ? ? 1_555 A  G   2081 N2    ? ? 0 G   535  0 G   2082 1_555 ? ? ? ? ? ? TYPE_7_PAIR ? ? 
hydrog560  hydrog ? ? A  A   535  N3    ? ? ? 1_555 A  G   2074 N2    ? ? 0 A   536  0 G   2075 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog561  hydrog ? ? A  G   536  N1    ? ? ? 1_555 A  U   2058 O2    ? ? 0 G   537  0 U   2059 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog562  hydrog ? ? A  G   536  O6    ? ? ? 1_555 A  U   2058 N3    ? ? 0 G   537  0 U   2059 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog563  hydrog ? ? A  C   537  N4    ? ? ? 1_555 A  A   2059 N3    ? ? 0 C   538  0 A   2060 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog564  hydrog ? ? A  G   538  N1    ? ? ? 1_555 A  C   616  N3    ? ? 0 G   539  0 C   617  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog565  hydrog ? ? A  G   538  N2    ? ? ? 1_555 A  C   616  O2    ? ? 0 G   539  0 C   617  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog566  hydrog ? ? A  G   538  O6    ? ? ? 1_555 A  C   616  N4    ? ? 0 G   539  0 C   617  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog567  hydrog ? ? A  A   539  N1    ? ? ? 1_555 A  U   615  N3    ? ? 0 A   540  0 U   616  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog568  hydrog ? ? A  A   539  N6    ? ? ? 1_555 A  U   615  O4    ? ? 0 A   540  0 U   616  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog569  hydrog ? ? A  C   540  N3    ? ? ? 1_555 A  G   614  N1    ? ? 0 C   541  0 G   615  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog570  hydrog ? ? A  C   540  N4    ? ? ? 1_555 A  G   614  O6    ? ? 0 C   541  0 G   615  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog571  hydrog ? ? A  C   540  O2    ? ? ? 1_555 A  G   614  N2    ? ? 0 C   541  0 G   615  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog572  hydrog ? ? A  A   541  N1    ? ? ? 1_555 A  U   613  N3    ? ? 0 A   542  0 U   614  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog573  hydrog ? ? A  A   541  N6    ? ? ? 1_555 A  U   613  O4    ? ? 0 A   542  0 U   614  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog574  hydrog ? ? A  G   542  N1    ? ? ? 1_555 A  C   612  N3    ? ? 0 G   543  0 C   613  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog575  hydrog ? ? A  G   542  N2    ? ? ? 1_555 A  C   612  O2    ? ? 0 G   543  0 C   613  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog576  hydrog ? ? A  G   542  O6    ? ? ? 1_555 A  C   612  N4    ? ? 0 G   543  0 C   613  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog577  hydrog ? ? A  G   543  N1    ? ? ? 1_555 A  U   611  O2    ? ? 0 G   544  0 U   612  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog578  hydrog ? ? A  G   543  O6    ? ? ? 1_555 A  U   611  N3    ? ? 0 G   544  0 U   612  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog579  hydrog ? ? A  G   544  N1    ? ? ? 1_555 A  U   610  O2    ? ? 0 G   545  0 U   611  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog580  hydrog ? ? A  G   544  O6    ? ? ? 1_555 A  U   610  N3    ? ? 0 G   545  0 U   611  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog581  hydrog ? ? A  C   545  N3    ? ? ? 1_555 A  G   609  N1    ? ? 0 C   546  0 G   610  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog582  hydrog ? ? A  C   545  N4    ? ? ? 1_555 A  G   609  O6    ? ? 0 C   546  0 G   610  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog583  hydrog ? ? A  C   545  O2    ? ? ? 1_555 A  G   609  N2    ? ? 0 C   546  0 G   610  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog584  hydrog ? ? A  A   546  N1    ? ? ? 1_555 A  U   608  N3    ? ? 0 A   547  0 U   609  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog585  hydrog ? ? A  A   546  N6    ? ? ? 1_555 A  U   608  O4    ? ? 0 A   547  0 U   609  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog586  hydrog ? ? A  U   547  N3    ? ? ? 1_555 A  A   607  N1    ? ? 0 U   548  0 A   608  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog587  hydrog ? ? A  U   547  O4    ? ? ? 1_555 A  A   607  N6    ? ? 0 U   548  0 A   608  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog588  hydrog ? ? A  A   551  N3    ? ? ? 1_555 A  G   1322 N2    ? ? 0 A   552  0 G   1323 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog589  hydrog ? ? A  G   552  N1    ? ? ? 1_555 A  C   605  N3    ? ? 0 G   553  0 C   606  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog590  hydrog ? ? A  G   552  N2    ? ? ? 1_555 A  C   605  O2    ? ? 0 G   553  0 C   606  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog591  hydrog ? ? A  G   552  O6    ? ? ? 1_555 A  C   605  N4    ? ? 0 G   553  0 C   606  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog592  hydrog ? ? A  G   553  N1    ? ? ? 1_555 A  C   604  N3    ? ? 0 G   554  0 C   605  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog593  hydrog ? ? A  G   553  N2    ? ? ? 1_555 A  C   604  O2    ? ? 0 G   554  0 C   605  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog594  hydrog ? ? A  G   553  O6    ? ? ? 1_555 A  C   604  N4    ? ? 0 G   554  0 C   605  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog595  hydrog ? ? A  U   554  N3    ? ? ? 1_555 A  A   601  N1    ? ? 0 U   555  0 A   602  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog596  hydrog ? ? A  U   554  O4    ? ? ? 1_555 A  A   601  N6    ? ? 0 U   555  0 A   602  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog597  hydrog ? ? A  C   555  N3    ? ? ? 1_555 A  G   600  N1    ? ? 0 C   556  0 G   601  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog598  hydrog ? ? A  C   555  N4    ? ? ? 1_555 A  G   600  O6    ? ? 0 C   556  0 G   601  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog599  hydrog ? ? A  C   555  O2    ? ? ? 1_555 A  G   600  N2    ? ? 0 C   556  0 G   601  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog600  hydrog ? ? A  C   556  N3    ? ? ? 1_555 A  G   599  N1    ? ? 0 C   557  0 G   600  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog601  hydrog ? ? A  C   556  N4    ? ? ? 1_555 A  G   599  O6    ? ? 0 C   557  0 G   600  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog602  hydrog ? ? A  C   556  O2    ? ? ? 1_555 A  G   599  N2    ? ? 0 C   557  0 G   600  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog603  hydrog ? ? A  C   557  N3    ? ? ? 1_555 A  G   598  N1    ? ? 0 C   558  0 G   599  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog604  hydrog ? ? A  C   557  N4    ? ? ? 1_555 A  G   598  O6    ? ? 0 C   558  0 G   599  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog605  hydrog ? ? A  C   557  O2    ? ? ? 1_555 A  G   598  N2    ? ? 0 C   558  0 G   599  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog606  hydrog ? ? A  U   558  O4    ? ? ? 1_555 A  C   597  N4    ? ? 0 U   559  0 C   598  1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog607  hydrog ? ? A  C   559  N4    ? ? ? 1_555 A  A   596  N1    ? ? 0 C   560  0 A   597  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog608  hydrog ? ? A  G   560  N1    ? ? ? 1_555 A  C   595  N3    ? ? 0 G   561  0 C   596  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog609  hydrog ? ? A  G   560  N2    ? ? ? 1_555 A  C   595  O2    ? ? 0 G   561  0 C   596  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog610  hydrog ? ? A  G   560  O6    ? ? ? 1_555 A  C   595  N4    ? ? 0 G   561  0 C   596  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog611  hydrog ? ? A  A   561  N1    ? ? ? 1_555 A  U   594  N3    ? ? 0 A   562  0 U   595  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog612  hydrog ? ? A  A   561  N6    ? ? ? 1_555 A  U   594  O4    ? ? 0 A   562  0 U   595  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog613  hydrog ? ? A  C   562  O2    ? ? ? 1_555 A  C   593  N4    ? ? 0 C   563  0 C   594  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog614  hydrog ? ? A  A   565  N6    ? ? ? 1_555 A  G   591  N3    ? ? 0 A   566  0 G   592  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog615  hydrog ? ? A  A   565  N7    ? ? ? 1_555 A  G   591  N2    ? ? 0 A   566  0 G   592  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog616  hydrog ? ? A  A   565  N3    ? ? ? 1_555 A  G   1092 N2    ? ? 0 A   566  0 G   1093 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog617  hydrog ? ? A  U   566  N3    ? ? ? 1_555 A  A   590  N1    ? ? 0 U   567  0 A   591  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog618  hydrog ? ? A  U   566  O4    ? ? ? 1_555 A  A   590  N6    ? ? 0 U   567  0 A   591  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog619  hydrog ? ? A  G   567  N2    ? ? ? 1_555 A  A   589  N7    ? ? 0 G   568  0 A   590  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog620  hydrog ? ? A  G   567  N3    ? ? ? 1_555 A  A   589  N6    ? ? 0 G   568  0 A   590  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog621  hydrog ? ? A  A   568  N6    ? ? ? 1_555 A  U   588  O2    ? ? 0 A   569  0 U   589  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog622  hydrog ? ? A  A   568  N7    ? ? ? 1_555 A  U   588  N3    ? ? 0 A   569  0 U   589  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog623  hydrog ? ? A  C   570  N4    ? ? ? 1_555 A  C   585  O2    ? ? 0 C   571  0 C   586  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog624  hydrog ? ? A  G   571  N1    ? ? ? 1_555 A  C   584  N3    ? ? 0 G   572  0 C   585  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog625  hydrog ? ? A  G   571  N2    ? ? ? 1_555 A  C   584  O2    ? ? 0 G   572  0 C   585  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog626  hydrog ? ? A  G   571  O6    ? ? ? 1_555 A  C   584  N4    ? ? 0 G   572  0 C   585  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog627  hydrog ? ? A  A   572  N1    ? ? ? 1_555 A  U   583  N3    ? ? 0 A   573  0 U   584  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog628  hydrog ? ? A  A   572  N6    ? ? ? 1_555 A  U   583  O4    ? ? 0 A   573  0 U   584  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog629  hydrog ? ? A  C   573  N3    ? ? ? 1_555 A  G   582  N1    ? ? 0 C   574  0 G   583  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog630  hydrog ? ? A  C   573  N4    ? ? ? 1_555 A  G   582  O6    ? ? 0 C   574  0 G   583  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog631  hydrog ? ? A  C   573  O2    ? ? ? 1_555 A  G   582  N2    ? ? 0 C   574  0 G   583  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog632  hydrog ? ? A  G   574  N1    ? ? ? 1_555 A  C   581  N3    ? ? 0 G   575  0 C   582  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog633  hydrog ? ? A  G   574  N2    ? ? ? 1_555 A  C   581  O2    ? ? 0 G   575  0 C   582  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog634  hydrog ? ? A  G   574  O6    ? ? ? 1_555 A  C   581  N4    ? ? 0 G   575  0 C   582  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog635  hydrog ? ? A  C   575  N3    ? ? ? 1_555 A  G   580  N1    ? ? 0 C   576  0 G   581  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog636  hydrog ? ? A  C   575  N4    ? ? ? 1_555 A  G   580  O6    ? ? 0 C   576  0 G   581  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog637  hydrog ? ? A  C   575  O2    ? ? ? 1_555 A  G   580  N2    ? ? 0 C   576  0 G   581  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog638  hydrog ? ? A  G   576  N2    ? ? ? 1_555 A  A   579  N7    ? ? 0 G   577  0 A   580  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog639  hydrog ? ? A  G   578  N2    ? ? ? 1_555 A  U   1110 O2    ? ? 0 G   579  0 U   1111 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog640  hydrog ? ? A  A   579  N3    ? ? ? 1_555 A  G   1109 N2    ? ? 0 A   580  0 G   1110 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog641  hydrog ? ? A  G   587  N2    ? ? ? 1_555 A  U   588  O4    ? ? 0 G   588  0 U   589  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog642  hydrog ? ? A  G   603  N1    ? ? ? 1_555 A  G   606  O6    ? ? 0 G   604  0 G   607  1_555 ? ? ? ? ? ? TYPE_6_PAIR ? ? 
hydrog643  hydrog ? ? A  G   603  N2    ? ? ? 1_555 A  G   606  N7    ? ? 0 G   604  0 G   607  1_555 ? ? ? ? ? ? TYPE_6_PAIR ? ? 
hydrog644  hydrog ? ? A  U   618  N3    ? ? ? 1_555 A  A   2073 N1    ? ? 0 U   619  0 A   2074 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog645  hydrog ? ? A  U   618  O4    ? ? ? 1_555 A  A   2073 N6    ? ? 0 U   619  0 A   2074 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog646  hydrog ? ? A  A   619  N6    ? ? ? 1_555 A  A   634  N1    ? ? 0 A   620  0 A   635  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog647  hydrog ? ? A  C   620  N3    ? ? ? 1_555 A  G   633  N1    ? ? 0 C   621  0 G   634  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog648  hydrog ? ? A  C   620  N4    ? ? ? 1_555 A  G   633  O6    ? ? 0 C   621  0 G   634  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog649  hydrog ? ? A  C   620  O2    ? ? ? 1_555 A  G   633  N2    ? ? 0 C   621  0 G   634  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog650  hydrog ? ? A  G   621  N1    ? ? ? 1_555 A  C   632  N3    ? ? 0 G   622  0 C   633  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog651  hydrog ? ? A  G   621  N2    ? ? ? 1_555 A  C   632  O2    ? ? 0 G   622  0 C   633  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog652  hydrog ? ? A  G   621  O6    ? ? ? 1_555 A  C   632  N4    ? ? 0 G   622  0 C   633  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog653  hydrog ? ? A  U   622  N3    ? ? ? 1_555 A  A   631  N1    ? ? 0 U   623  0 A   632  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog654  hydrog ? ? A  U   622  O4    ? ? ? 1_555 A  A   631  N6    ? ? 0 U   623  0 A   632  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog655  hydrog ? ? A  U   623  N3    ? ? ? 1_555 A  1MA 627  N7    ? ? 0 U   624  0 1MA 628  1_555 ? ? ? ? ? ? 'U-1MA PAIR' ? ? 
hydrog656  hydrog ? ? A  U   624  O2    ? ? ? 1_555 A  C   2070 N4    ? ? 0 U   625  0 C   2071 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog657  hydrog ? ? A  U   625  O2    ? ? ? 1_555 A  A   1080 N6    ? ? 0 U   626  0 A   1081 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog658  hydrog ? ? A  A   628  N1    ? ? ? 1_555 A  G   2069 N2    ? ? 0 A   629  0 G   2070 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog659  hydrog ? ? A  A   628  N6    ? ? ? 1_555 A  G   2069 N3    ? ? 0 A   629  0 G   2070 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog660  hydrog ? ? A  G   635  N1    ? ? ? 1_555 A  C   1364 N3    ? ? 0 G   636  0 C   1365 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog661  hydrog ? ? A  G   635  N2    ? ? ? 1_555 A  C   1364 O2    ? ? 0 G   636  0 C   1365 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog662  hydrog ? ? A  G   635  O6    ? ? ? 1_555 A  C   1364 N4    ? ? 0 G   636  0 C   1365 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog663  hydrog ? ? A  C   636  N3    ? ? ? 1_555 A  G   1363 N1    ? ? 0 C   637  0 G   1364 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog664  hydrog ? ? A  C   636  N4    ? ? ? 1_555 A  G   1363 O6    ? ? 0 C   637  0 G   1364 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog665  hydrog ? ? A  C   636  O2    ? ? ? 1_555 A  G   1363 N2    ? ? 0 C   637  0 G   1364 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog666  hydrog ? ? A  C   637  N3    ? ? ? 1_555 A  G   1362 N1    ? ? 0 C   638  0 G   1363 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog667  hydrog ? ? A  C   637  N4    ? ? ? 1_555 A  G   1362 O6    ? ? 0 C   638  0 G   1363 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog668  hydrog ? ? A  C   637  O2    ? ? ? 1_555 A  G   1362 N2    ? ? 0 C   638  0 G   1363 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog669  hydrog ? ? A  A   638  N1    ? ? ? 1_555 A  U   1361 N3    ? ? 0 A   639  0 U   1362 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog670  hydrog ? ? A  A   638  N6    ? ? ? 1_555 A  U   1361 O4    ? ? 0 A   639  0 U   1362 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog671  hydrog ? ? A  G   639  N1    ? ? ? 1_555 A  C   1360 N3    ? ? 0 G   640  0 C   1361 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog672  hydrog ? ? A  G   639  N2    ? ? ? 1_555 A  C   1360 O2    ? ? 0 G   640  0 C   1361 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog673  hydrog ? ? A  G   639  O6    ? ? ? 1_555 A  C   1360 N4    ? ? 0 G   640  0 C   1361 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog674  hydrog ? ? A  G   640  N1    ? ? ? 1_555 A  C   1359 N3    ? ? 0 G   641  0 C   1360 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog675  hydrog ? ? A  G   640  N2    ? ? ? 1_555 A  C   1359 O2    ? ? 0 G   641  0 C   1360 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog676  hydrog ? ? A  G   640  O6    ? ? ? 1_555 A  C   1359 N4    ? ? 0 G   641  0 C   1360 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog677  hydrog ? ? A  G   641  N2    ? ? ? 1_555 A  A   1357 N7    ? ? 0 G   642  0 A   1358 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog678  hydrog ? ? A  G   641  N3    ? ? ? 1_555 A  A   1357 N6    ? ? 0 G   642  0 A   1358 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog679  hydrog ? ? A  A   642  N3    ? ? ? 1_555 A  G   901  N2    ? ? 0 A   643  0 G   902  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog680  hydrog ? ? A  A   642  N6    ? ? ? 1_555 A  A   1354 N7    ? ? 0 A   643  0 A   1355 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog681  hydrog ? ? A  A   642  N7    ? ? ? 1_555 A  A   1354 N6    ? ? 0 A   643  0 A   1355 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog682  hydrog ? ? A  G   643  N1    ? ? ? 1_555 A  U   902  O2    ? ? 0 G   644  0 U   903  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog683  hydrog ? ? A  U   644  N3    ? ? ? 1_555 A  A   760  N3    ? ? 0 U   645  0 A   761  1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog684  hydrog ? ? A  G   645  N1    ? ? ? 1_555 A  C   758  N3    ? ? 0 G   646  0 C   759  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog685  hydrog ? ? A  G   645  N2    ? ? ? 1_555 A  C   758  O2    ? ? 0 G   646  0 C   759  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog686  hydrog ? ? A  G   645  O6    ? ? ? 1_555 A  C   758  N4    ? ? 0 G   646  0 C   759  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog687  hydrog ? ? A  U   646  N3    ? ? ? 1_555 A  A   757  N1    ? ? 0 U   647  0 A   758  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog688  hydrog ? ? A  U   646  O4    ? ? ? 1_555 A  A   757  N6    ? ? 0 U   647  0 A   758  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog689  hydrog ? ? A  G   647  N1    ? ? ? 1_555 A  C   756  N3    ? ? 0 G   648  0 C   757  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog690  hydrog ? ? A  G   647  N2    ? ? ? 1_555 A  C   756  O2    ? ? 0 G   648  0 C   757  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog691  hydrog ? ? A  G   647  O6    ? ? ? 1_555 A  C   756  N4    ? ? 0 G   648  0 C   757  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog692  hydrog ? ? A  U   648  N3    ? ? ? 1_555 A  A   755  N1    ? ? 0 U   649  0 A   756  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog693  hydrog ? ? A  U   648  O4    ? ? ? 1_555 A  A   755  N6    ? ? 0 U   649  0 A   756  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog694  hydrog ? ? A  C   649  N3    ? ? ? 1_555 A  G   754  N1    ? ? 0 C   650  0 G   755  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog695  hydrog ? ? A  C   649  N4    ? ? ? 1_555 A  G   754  O6    ? ? 0 C   650  0 G   755  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog696  hydrog ? ? A  C   649  O2    ? ? ? 1_555 A  G   754  N2    ? ? 0 C   650  0 G   755  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog697  hydrog ? ? A  U   650  N3    ? ? ? 1_555 A  G   753  O6    ? ? 0 U   651  0 G   754  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog698  hydrog ? ? A  U   650  O2    ? ? ? 1_555 A  G   753  N1    ? ? 0 U   651  0 G   754  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog699  hydrog ? ? A  G   651  N1    ? ? ? 1_555 A  U   752  O2    ? ? 0 G   652  0 U   753  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog700  hydrog ? ? A  G   651  O6    ? ? ? 1_555 A  U   752  N3    ? ? 0 G   652  0 U   753  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog701  hydrog ? ? A  C   652  N3    ? ? ? 1_555 A  G   751  N1    ? ? 0 C   653  0 G   752  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog702  hydrog ? ? A  C   652  N4    ? ? ? 1_555 A  G   751  O6    ? ? 0 C   653  0 G   752  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog703  hydrog ? ? A  C   652  O2    ? ? ? 1_555 A  G   751  N2    ? ? 0 C   653  0 G   752  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog704  hydrog ? ? A  A   653  N1    ? ? ? 1_555 A  U   750  N3    ? ? 0 A   654  0 U   751  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog705  hydrog ? ? A  A   653  N6    ? ? ? 1_555 A  U   750  O4    ? ? 0 A   654  0 U   751  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog706  hydrog ? ? A  U   654  N3    ? ? ? 1_555 A  A   749  N1    ? ? 0 U   655  0 A   750  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog707  hydrog ? ? A  U   654  O4    ? ? ? 1_555 A  A   749  N6    ? ? 0 U   655  0 A   750  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog708  hydrog ? ? A  G   655  N1    ? ? ? 1_555 A  C   748  N3    ? ? 0 G   656  0 C   749  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog709  hydrog ? ? A  G   655  N2    ? ? ? 1_555 A  C   748  O2    ? ? 0 G   656  0 C   749  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog710  hydrog ? ? A  G   655  O6    ? ? ? 1_555 A  C   748  N4    ? ? 0 G   656  0 C   749  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog711  hydrog ? ? A  G   656  N1    ? ? ? 1_555 A  C   747  N3    ? ? 0 G   657  0 C   748  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog712  hydrog ? ? A  G   656  N2    ? ? ? 1_555 A  C   747  O2    ? ? 0 G   657  0 C   748  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog713  hydrog ? ? A  G   656  O6    ? ? ? 1_555 A  C   747  N4    ? ? 0 G   657  0 C   748  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog714  hydrog ? ? A  C   657  N3    ? ? ? 1_555 A  G   746  N1    ? ? 0 C   658  0 G   747  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog715  hydrog ? ? A  C   657  N4    ? ? ? 1_555 A  G   746  O6    ? ? 0 C   658  0 G   747  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog716  hydrog ? ? A  C   657  O2    ? ? ? 1_555 A  G   746  N2    ? ? 0 C   658  0 G   747  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog717  hydrog ? ? A  G   660  N1    ? ? ? 1_555 A  C   684  N3    ? ? 0 G   661  0 C   685  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog718  hydrog ? ? A  G   660  N2    ? ? ? 1_555 A  C   684  O2    ? ? 0 G   661  0 C   685  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog719  hydrog ? ? A  G   660  O6    ? ? ? 1_555 A  C   684  N4    ? ? 0 G   661  0 C   685  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog720  hydrog ? ? A  U   661  N3    ? ? ? 1_555 A  G   683  O6    ? ? 0 U   662  0 G   684  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog721  hydrog ? ? A  U   661  O2    ? ? ? 1_555 A  G   683  N1    ? ? 0 U   662  0 G   684  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog722  hydrog ? ? A  C   662  N3    ? ? ? 1_555 A  G   682  N1    ? ? 0 C   663  0 G   683  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog723  hydrog ? ? A  C   662  N4    ? ? ? 1_555 A  G   682  O6    ? ? 0 C   663  0 G   683  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog724  hydrog ? ? A  C   662  O2    ? ? ? 1_555 A  G   682  N2    ? ? 0 C   663  0 G   683  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog725  hydrog ? ? A  U   663  N3    ? ? ? 1_555 A  A   681  N7    ? ? 0 U   664  0 A   682  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog726  hydrog ? ? A  U   663  O2    ? ? ? 1_555 A  A   681  N6    ? ? 0 U   664  0 A   682  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog727  hydrog ? ? A  A   665  N6    ? ? ? 1_555 A  G   679  N3    ? ? 0 A   666  0 G   680  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog728  hydrog ? ? A  A   665  N7    ? ? ? 1_555 A  G   679  N2    ? ? 0 A   666  0 G   680  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog729  hydrog ? ? A  C   666  N3    ? ? ? 1_555 A  G   678  N1    ? ? 0 C   667  0 G   679  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog730  hydrog ? ? A  C   666  N4    ? ? ? 1_555 A  G   678  O6    ? ? 0 C   667  0 G   679  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog731  hydrog ? ? A  C   666  O2    ? ? ? 1_555 A  G   678  N2    ? ? 0 C   667  0 G   679  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog732  hydrog ? ? A  C   667  N3    ? ? ? 1_555 A  G   677  N1    ? ? 0 C   668  0 G   678  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog733  hydrog ? ? A  C   667  N4    ? ? ? 1_555 A  G   677  O6    ? ? 0 C   668  0 G   678  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog734  hydrog ? ? A  C   667  O2    ? ? ? 1_555 A  G   677  N2    ? ? 0 C   668  0 G   678  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog735  hydrog ? ? A  G   668  N1    ? ? ? 1_555 A  C   676  N3    ? ? 0 G   669  0 C   677  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog736  hydrog ? ? A  G   668  N2    ? ? ? 1_555 A  C   676  O2    ? ? 0 G   669  0 C   677  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog737  hydrog ? ? A  G   668  O6    ? ? ? 1_555 A  C   676  N4    ? ? 0 G   669  0 C   677  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog738  hydrog ? ? A  G   669  N1    ? ? ? 1_555 A  C   675  N3    ? ? 0 G   670  0 C   676  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog739  hydrog ? ? A  G   669  N2    ? ? ? 1_555 A  C   675  O2    ? ? 0 G   670  0 C   676  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog740  hydrog ? ? A  G   669  O6    ? ? ? 1_555 A  C   675  N4    ? ? 0 G   670  0 C   676  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog741  hydrog ? ? A  G   688  N1    ? ? ? 1_555 A  C   695  N3    ? ? 0 G   689  0 C   696  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog742  hydrog ? ? A  G   688  N2    ? ? ? 1_555 A  C   695  O2    ? ? 0 G   689  0 C   696  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog743  hydrog ? ? A  G   688  O6    ? ? ? 1_555 A  C   695  N4    ? ? 0 G   689  0 C   696  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog744  hydrog ? ? A  G   689  N1    ? ? ? 1_555 A  C   694  N3    ? ? 0 G   690  0 C   695  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog745  hydrog ? ? A  G   689  N2    ? ? ? 1_555 A  C   694  O2    ? ? 0 G   690  0 C   695  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog746  hydrog ? ? A  G   689  O6    ? ? ? 1_555 A  C   694  N4    ? ? 0 G   690  0 C   695  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog747  hydrog ? ? A  G   690  N2    ? ? ? 1_555 A  A   693  N7    ? ? 0 G   691  0 A   694  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog748  hydrog ? ? A  A   691  N1    ? ? ? 1_555 A  G   2452 N2    ? ? 0 A   692  0 G   2453 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog749  hydrog ? ? A  A   697  N3    ? ? ? 1_555 A  G   741  N2    ? ? 0 A   698  0 G   742  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog750  hydrog ? ? A  C   698  N3    ? ? ? 1_555 A  G   726  N1    ? ? 0 C   699  0 G   727  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog751  hydrog ? ? A  C   698  N4    ? ? ? 1_555 A  G   726  O6    ? ? 0 C   699  0 G   727  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog752  hydrog ? ? A  C   698  O2    ? ? ? 1_555 A  G   726  N2    ? ? 0 C   699  0 G   727  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog753  hydrog ? ? A  G   701  N1    ? ? ? 1_555 A  C   725  N3    ? ? 0 G   702  0 C   726  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog754  hydrog ? ? A  G   701  N2    ? ? ? 1_555 A  C   725  O2    ? ? 0 G   702  0 C   726  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog755  hydrog ? ? A  G   701  O6    ? ? ? 1_555 A  C   725  N4    ? ? 0 G   702  0 C   726  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog756  hydrog ? ? A  G   701  N7    ? ? ? 1_555 A  G   743  N2    ? ? 0 G   702  0 G   744  1_555 ? ? ? ? ? ? TYPE_6_PAIR ? ? 
hydrog757  hydrog ? ? A  G   701  O6    ? ? ? 1_555 A  G   743  N1    ? ? 0 G   702  0 G   744  1_555 ? ? ? ? ? ? TYPE_6_PAIR ? ? 
hydrog758  hydrog ? ? A  G   702  N1    ? ? ? 1_555 A  C   724  N3    ? ? 0 G   703  0 C   725  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog759  hydrog ? ? A  G   702  N2    ? ? ? 1_555 A  C   724  O2    ? ? 0 G   703  0 C   725  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog760  hydrog ? ? A  G   702  O6    ? ? ? 1_555 A  C   724  N4    ? ? 0 G   703  0 C   725  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog761  hydrog ? ? A  C   703  N3    ? ? ? 1_555 A  G   723  N1    ? ? 0 C   704  0 G   724  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog762  hydrog ? ? A  C   703  N4    ? ? ? 1_555 A  G   723  O6    ? ? 0 C   704  0 G   724  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog763  hydrog ? ? A  C   703  O2    ? ? ? 1_555 A  G   723  N2    ? ? 0 C   704  0 G   724  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog764  hydrog ? ? A  C   704  N3    ? ? ? 1_555 A  G   722  N1    ? ? 0 C   705  0 G   723  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog765  hydrog ? ? A  C   704  N4    ? ? ? 1_555 A  G   722  O6    ? ? 0 C   705  0 G   723  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog766  hydrog ? ? A  C   704  O2    ? ? ? 1_555 A  G   722  N2    ? ? 0 C   705  0 G   723  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog767  hydrog ? ? A  G   705  N2    ? ? ? 1_555 A  G   721  O6    ? ? 0 G   706  0 G   722  1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog768  hydrog ? ? A  C   706  N3    ? ? ? 1_555 A  A   720  N6    ? ? 0 C   707  0 A   721  1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog769  hydrog ? ? A  C   706  N4    ? ? ? 1_555 A  A   720  N7    ? ? 0 C   707  0 A   721  1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog770  hydrog ? ? A  A   707  N6    ? ? ? 1_555 A  G   719  N3    ? ? 0 A   708  0 G   720  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog771  hydrog ? ? A  A   707  N7    ? ? ? 1_555 A  G   719  N2    ? ? 0 A   708  0 G   720  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog772  hydrog ? ? A  G   708  N1    ? ? ? 1_555 A  C   718  N3    ? ? 0 G   709  0 C   719  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog773  hydrog ? ? A  G   708  N2    ? ? ? 1_555 A  C   718  O2    ? ? 0 G   709  0 C   719  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog774  hydrog ? ? A  G   708  O6    ? ? ? 1_555 A  C   718  N4    ? ? 0 G   709  0 C   719  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog775  hydrog ? ? A  G   709  N1    ? ? ? 1_555 A  C   717  N3    ? ? 0 G   710  0 C   718  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog776  hydrog ? ? A  G   709  N2    ? ? ? 1_555 A  C   717  O2    ? ? 0 G   710  0 C   718  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog777  hydrog ? ? A  G   709  O6    ? ? ? 1_555 A  C   717  N4    ? ? 0 G   710  0 C   718  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog778  hydrog ? ? A  G   710  N1    ? ? ? 1_555 A  C   716  N3    ? ? 0 G   711  0 C   717  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog779  hydrog ? ? A  G   710  N2    ? ? ? 1_555 A  C   716  O2    ? ? 0 G   711  0 C   717  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog780  hydrog ? ? A  G   710  O6    ? ? ? 1_555 A  C   716  N4    ? ? 0 G   711  0 C   717  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog781  hydrog ? ? A  C   711  N3    ? ? ? 1_555 A  G   715  N1    ? ? 0 C   712  0 G   716  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog782  hydrog ? ? A  C   711  N4    ? ? ? 1_555 A  G   715  O6    ? ? 0 C   712  0 G   716  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog783  hydrog ? ? A  C   711  O2    ? ? ? 1_555 A  G   715  N2    ? ? 0 C   712  0 G   716  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog784  hydrog ? ? A  C   725  N4    ? ? ? 1_555 A  G   743  O6    ? ? 0 C   726  0 G   744  1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog785  hydrog ? ? A  C   727  N3    ? ? ? 1_555 A  G   742  N1    ? ? 0 C   728  0 G   743  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog786  hydrog ? ? A  C   727  N4    ? ? ? 1_555 A  G   742  O6    ? ? 0 C   728  0 G   743  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog787  hydrog ? ? A  C   727  O2    ? ? ? 1_555 A  G   742  N2    ? ? 0 C   728  0 G   743  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog788  hydrog ? ? A  C   728  N3    ? ? ? 1_555 A  G   741  N1    ? ? 0 C   729  0 G   742  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog789  hydrog ? ? A  C   728  N4    ? ? ? 1_555 A  G   741  O6    ? ? 0 C   729  0 G   742  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog790  hydrog ? ? A  C   728  O2    ? ? ? 1_555 A  G   741  N2    ? ? 0 C   729  0 G   742  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog791  hydrog ? ? A  G   729  N1    ? ? ? 1_555 A  C   740  N3    ? ? 0 G   730  0 C   741  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog792  hydrog ? ? A  G   729  N2    ? ? ? 1_555 A  C   740  O2    ? ? 0 G   730  0 C   741  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog793  hydrog ? ? A  G   729  O6    ? ? ? 1_555 A  C   740  N4    ? ? 0 G   730  0 C   741  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog794  hydrog ? ? A  U   730  N3    ? ? ? 1_555 A  G   739  O6    ? ? 0 U   731  0 G   740  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog795  hydrog ? ? A  U   730  O2    ? ? ? 1_555 A  G   739  N1    ? ? 0 U   731  0 G   740  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog796  hydrog ? ? A  C   731  N3    ? ? ? 1_555 A  G   738  N1    ? ? 0 C   732  0 G   739  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog797  hydrog ? ? A  C   731  N4    ? ? ? 1_555 A  G   738  O6    ? ? 0 C   732  0 G   739  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog798  hydrog ? ? A  C   731  O2    ? ? ? 1_555 A  G   738  N2    ? ? 0 C   732  0 G   739  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog799  hydrog ? ? A  U   732  N3    ? ? ? 1_555 A  G   737  O6    ? ? 0 U   733  0 G   738  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog800  hydrog ? ? A  U   732  O2    ? ? ? 1_555 A  G   737  N1    ? ? 0 U   733  0 G   738  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog801  hydrog ? ? A  C   761  N3    ? ? ? 1_555 A  G   901  N1    ? ? 0 C   762  0 G   902  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog802  hydrog ? ? A  C   761  N4    ? ? ? 1_555 A  G   901  O6    ? ? 0 C   762  0 G   902  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog803  hydrog ? ? A  C   761  O2    ? ? ? 1_555 A  G   901  N2    ? ? 0 C   762  0 G   902  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog804  hydrog ? ? A  C   762  N3    ? ? ? 1_555 A  G   900  N1    ? ? 0 C   763  0 G   901  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog805  hydrog ? ? A  C   762  N4    ? ? ? 1_555 A  G   900  O6    ? ? 0 C   763  0 G   901  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog806  hydrog ? ? A  C   762  O2    ? ? ? 1_555 A  G   900  N2    ? ? 0 C   763  0 G   901  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog807  hydrog ? ? A  C   763  N4    ? ? ? 1_555 A  U   899  O4    ? ? 0 C   764  0 U   900  1_555 ? ? ? ? ? ? 'C-U MISPAIR' ? 
? 
hydrog808  hydrog ? ? A  G   764  N1    ? ? ? 1_555 A  C   898  N3    ? ? 0 G   765  0 C   899  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog809  hydrog ? ? A  G   764  N2    ? ? ? 1_555 A  C   898  O2    ? ? 0 G   765  0 C   899  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog810  hydrog ? ? A  G   764  O6    ? ? ? 1_555 A  C   898  N4    ? ? 0 G   765  0 C   899  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog811  hydrog ? ? A  A   765  N6    ? ? ? 1_555 A  C   895  N3    ? ? 0 A   766  0 C   896  1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog812  hydrog ? ? A  A   765  N7    ? ? ? 1_555 A  C   895  N4    ? ? 0 A   766  0 C   896  1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog813  hydrog ? ? A  A   766  N6    ? ? ? 1_555 A  A   894  N1    ? ? 0 A   767  0 A   895  1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog814  hydrog ? ? A  A   766  N7    ? ? ? 1_555 A  A   894  N6    ? ? 0 A   767  0 A   895  1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog815  hydrog ? ? A  A   766  N3    ? ? ? 1_555 A  G   2109 N2    ? ? 0 A   767  0 G   2110 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog816  hydrog ? ? A  U   767  O4    ? ? ? 1_555 A  C   892  N4    ? ? 0 U   768  0 C   893  1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog817  hydrog ? ? A  C   768  N3    ? ? ? 1_555 A  G   891  N1    ? ? 0 C   769  0 G   892  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog818  hydrog ? ? A  C   768  N4    ? ? ? 1_555 A  G   891  O6    ? ? 0 C   769  0 G   892  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog819  hydrog ? ? A  C   768  O2    ? ? ? 1_555 A  G   891  N2    ? ? 0 C   769  0 G   892  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog820  hydrog ? ? A  C   769  N3    ? ? ? 1_555 A  G   890  N1    ? ? 0 C   770  0 G   891  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog821  hydrog ? ? A  C   769  N4    ? ? ? 1_555 A  G   890  O6    ? ? 0 C   770  0 G   891  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog822  hydrog ? ? A  C   769  O2    ? ? ? 1_555 A  G   890  N2    ? ? 0 C   770  0 G   891  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog823  hydrog ? ? A  G   770  N1    ? ? ? 1_555 A  C   889  N3    ? ? 0 G   771  0 C   890  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog824  hydrog ? ? A  G   770  N2    ? ? ? 1_555 A  C   889  O2    ? ? 0 G   771  0 C   890  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog825  hydrog ? ? A  G   770  O6    ? ? ? 1_555 A  C   889  N4    ? ? 0 G   771  0 C   890  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog826  hydrog ? ? A  G   771  N1    ? ? ? 1_555 A  C   888  N3    ? ? 0 G   772  0 C   889  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog827  hydrog ? ? A  G   771  N2    ? ? ? 1_555 A  C   888  O2    ? ? 0 G   772  0 C   889  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog828  hydrog ? ? A  G   771  O6    ? ? ? 1_555 A  C   888  N4    ? ? 0 G   772  0 C   889  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog829  hydrog ? ? A  A   772  N1    ? ? ? 1_555 A  U   887  N3    ? ? 0 A   773  0 U   888  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog830  hydrog ? ? A  A   772  N6    ? ? ? 1_555 A  U   887  O4    ? ? 0 A   773  0 U   888  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog831  hydrog ? ? A  C   773  N3    ? ? ? 1_555 A  G   886  N1    ? ? 0 C   774  0 G   887  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog832  hydrog ? ? A  C   773  N4    ? ? ? 1_555 A  G   886  O6    ? ? 0 C   774  0 G   887  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog833  hydrog ? ? A  C   773  O2    ? ? ? 1_555 A  G   886  N2    ? ? 0 C   774  0 G   887  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog834  hydrog ? ? A  G   774  N1    ? ? ? 1_555 A  G   867  N7    ? ? 0 G   775  0 G   868  1_555 ? ? ? ? ? ? TYPE_7_PAIR ? ? 
hydrog835  hydrog ? ? A  G   774  N2    ? ? ? 1_555 A  G   867  O6    ? ? 0 G   775  0 G   868  1_555 ? ? ? ? ? ? TYPE_7_PAIR ? ? 
hydrog836  hydrog ? ? A  A   775  N3    ? ? ? 1_555 A  U   778  N3    ? ? 0 A   776  0 U   779  1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog837  hydrog ? ? A  A   775  N1    ? ? ? 1_555 A  G   870  N2    ? ? 0 A   776  0 G   871  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog838  hydrog ? ? A  A   775  N6    ? ? ? 1_555 A  G   870  N3    ? ? 0 A   776  0 G   871  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog839  hydrog ? ? A  C   777  O2    ? ? ? 1_555 A  A   1835 N6    ? ? 0 C   778  0 A   1836 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog840  hydrog ? ? A  A   779  N1    ? ? ? 1_555 A  U   865  N3    ? ? 0 A   780  0 U   866  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog841  hydrog ? ? A  A   779  N6    ? ? ? 1_555 A  U   865  O4    ? ? 0 A   780  0 U   866  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog842  hydrog ? ? A  C   780  N3    ? ? ? 1_555 A  G   864  N1    ? ? 0 C   781  0 G   865  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog843  hydrog ? ? A  C   780  N4    ? ? ? 1_555 A  G   864  O6    ? ? 0 C   781  0 G   865  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog844  hydrog ? ? A  C   780  O2    ? ? ? 1_555 A  G   864  N2    ? ? 0 C   781  0 G   865  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog845  hydrog ? ? A  G   781  N1    ? ? ? 1_555 A  U   863  O2    ? ? 0 G   782  0 U   864  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog846  hydrog ? ? A  G   781  O6    ? ? ? 1_555 A  U   863  N3    ? ? 0 G   782  0 U   864  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog847  hydrog ? ? A  C   782  N3    ? ? ? 1_555 A  G   862  N1    ? ? 0 C   783  0 G   863  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog848  hydrog ? ? A  C   782  N4    ? ? ? 1_555 A  G   862  O6    ? ? 0 C   783  0 G   863  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog849  hydrog ? ? A  C   782  O2    ? ? ? 1_555 A  G   862  N2    ? ? 0 C   783  0 G   863  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog850  hydrog ? ? A  A   783  N1    ? ? ? 1_555 A  U   861  N3    ? ? 0 A   784  0 U   862  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog851  hydrog ? ? A  A   783  N6    ? ? ? 1_555 A  U   861  O4    ? ? 0 A   784  0 U   862  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog852  hydrog ? ? A  U   784  N3    ? ? ? 1_555 A  A   860  N1    ? ? 0 U   785  0 A   861  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog853  hydrog ? ? A  U   784  O4    ? ? ? 1_555 A  A   860  N6    ? ? 0 U   785  0 A   861  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog854  hydrog ? ? A  G   785  N1    ? ? ? 1_555 A  U   859  O2    ? ? 0 G   786  0 U   860  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog855  hydrog ? ? A  G   785  O6    ? ? ? 1_555 A  U   859  N3    ? ? 0 G   786  0 U   860  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog856  hydrog ? ? A  G   786  N1    ? ? ? 1_555 A  C   858  N3    ? ? 0 G   787  0 C   859  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog857  hydrog ? ? A  G   786  N2    ? ? ? 1_555 A  C   858  O2    ? ? 0 G   787  0 C   859  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog858  hydrog ? ? A  G   786  O6    ? ? ? 1_555 A  C   858  N4    ? ? 0 G   787  0 C   859  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog859  hydrog ? ? A  A   787  N1    ? ? ? 1_555 A  U   857  N3    ? ? 0 A   788  0 U   858  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog860  hydrog ? ? A  A   787  N6    ? ? ? 1_555 A  U   857  O4    ? ? 0 A   788  0 U   858  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog861  hydrog ? ? A  C   788  N3    ? ? ? 1_555 A  G   855  N1    ? ? 0 C   789  0 G   856  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog862  hydrog ? ? A  C   788  N4    ? ? ? 1_555 A  G   855  O6    ? ? 0 C   789  0 G   856  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog863  hydrog ? ? A  C   788  O2    ? ? ? 1_555 A  G   855  N2    ? ? 0 C   789  0 G   856  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog864  hydrog ? ? A  A   789  N6    ? ? ? 1_555 A  G   823  N3    ? ? 0 A   790  0 G   824  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog865  hydrog ? ? A  A   789  N7    ? ? ? 1_555 A  G   823  N2    ? ? 0 A   790  0 G   824  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog866  hydrog ? ? A  A   789  N1    ? ? ? 1_555 A  G   1708 N2    ? ? 0 A   790  0 G   1709 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog867  hydrog ? ? A  A   790  N1    ? ? ? 1_555 A  U   822  N3    ? ? 0 A   791  0 U   823  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog868  hydrog ? ? A  A   790  N6    ? ? ? 1_555 A  U   822  O4    ? ? 0 A   791  0 U   823  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog869  hydrog ? ? A  G   791  N1    ? ? ? 1_555 A  C   821  N3    ? ? 0 G   792  0 C   822  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog870  hydrog ? ? A  G   791  N2    ? ? ? 1_555 A  C   821  O2    ? ? 0 G   792  0 C   822  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog871  hydrog ? ? A  G   791  O6    ? ? ? 1_555 A  C   821  N4    ? ? 0 G   792  0 C   822  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog872  hydrog ? ? A  A   792  N1    ? ? ? 1_555 A  U   820  N3    ? ? 0 A   793  0 U   821  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog873  hydrog ? ? A  A   792  N6    ? ? ? 1_555 A  U   820  O4    ? ? 0 A   793  0 U   821  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog874  hydrog ? ? A  U   793  O2    ? ? ? 1_555 A  A   817  N6    ? ? 0 U   794  0 A   818  1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog875  hydrog ? ? A  U   793  N3    ? ? ? 1_555 A  A   818  N1    ? ? 0 U   794  0 A   819  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog876  hydrog ? ? A  U   793  O4    ? ? ? 1_555 A  A   818  N6    ? ? 0 U   794  0 A   819  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog877  hydrog ? ? A  G   794  N2    ? ? ? 1_555 A  A   817  N7    ? ? 0 G   795  0 A   818  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog878  hydrog ? ? A  G   794  N3    ? ? ? 1_555 A  A   817  N6    ? ? 0 G   795  0 A   818  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog879  hydrog ? ? A  A   795  N6    ? ? ? 1_555 A  G   816  N3    ? ? 0 A   796  0 G   817  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog880  hydrog ? ? A  A   795  N7    ? ? ? 1_555 A  G   816  N2    ? ? 0 A   796  0 G   817  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog881  hydrog ? ? A  A   796  N6    ? ? ? 1_555 A  G   815  N3    ? ? 0 A   797  0 G   816  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog882  hydrog ? ? A  A   796  N7    ? ? ? 1_555 A  G   815  N2    ? ? 0 A   797  0 G   816  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog883  hydrog ? ? A  G   797  N1    ? ? ? 1_555 A  U   814  O2    ? ? 0 G   798  0 U   815  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog884  hydrog ? ? A  G   797  O6    ? ? ? 1_555 A  U   814  N3    ? ? 0 G   798  0 U   815  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog885  hydrog ? ? A  C   798  N3    ? ? ? 1_555 A  G   813  N1    ? ? 0 C   799  0 G   814  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog886  hydrog ? ? A  C   798  N4    ? ? ? 1_555 A  G   813  O6    ? ? 0 C   799  0 G   814  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog887  hydrog ? ? A  C   798  O2    ? ? ? 1_555 A  G   813  N2    ? ? 0 C   799  0 G   814  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog888  hydrog ? ? A  G   799  N1    ? ? ? 1_555 A  C   812  N3    ? ? 0 G   800  0 C   813  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog889  hydrog ? ? A  G   799  N2    ? ? ? 1_555 A  C   812  O2    ? ? 0 G   800  0 C   813  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog890  hydrog ? ? A  G   799  O6    ? ? ? 1_555 A  C   812  N4    ? ? 0 G   800  0 C   813  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog891  hydrog ? ? A  U   800  N3    ? ? ? 1_555 A  A   811  N1    ? ? 0 U   801  0 A   812  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog892  hydrog ? ? A  U   800  O4    ? ? ? 1_555 A  A   811  N6    ? ? 0 U   801  0 A   812  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog893  hydrog ? ? A  G   801  N1    ? ? ? 1_555 A  C   810  N3    ? ? 0 G   802  0 C   811  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog894  hydrog ? ? A  G   801  N2    ? ? ? 1_555 A  C   810  O2    ? ? 0 G   802  0 C   811  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog895  hydrog ? ? A  G   801  O6    ? ? ? 1_555 A  C   810  N4    ? ? 0 G   802  0 C   811  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog896  hydrog ? ? A  C   802  N3    ? ? ? 1_555 A  G   809  N1    ? ? 0 C   803  0 G   810  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog897  hydrog ? ? A  C   802  N4    ? ? ? 1_555 A  G   809  O6    ? ? 0 C   803  0 G   810  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog898  hydrog ? ? A  C   802  O2    ? ? ? 1_555 A  G   809  N2    ? ? 0 C   803  0 G   810  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog899  hydrog ? ? A  C   803  N3    ? ? ? 1_555 A  G   808  N1    ? ? 0 C   804  0 G   809  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog900  hydrog ? ? A  C   803  N4    ? ? ? 1_555 A  G   808  O6    ? ? 0 C   804  0 G   809  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog901  hydrog ? ? A  C   803  O2    ? ? ? 1_555 A  G   808  N2    ? ? 0 C   804  0 G   809  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog902  hydrog ? ? A  G   804  N2    ? ? ? 1_555 A  A   807  N7    ? ? 0 G   805  0 A   808  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog903  hydrog ? ? A  G   819  N1    ? ? ? 1_555 A  C   1829 N3    ? ? 0 G   820  0 C   1830 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog904  hydrog ? ? A  G   819  N2    ? ? ? 1_555 A  C   1829 O2    ? ? 0 G   820  0 C   1830 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog905  hydrog ? ? A  G   819  O6    ? ? ? 1_555 A  C   1829 N4    ? ? 0 G   820  0 C   1830 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog906  hydrog ? ? A  A   826  N6    ? ? ? 1_555 A  G   853  N3    ? ? 0 A   827  0 G   854  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog907  hydrog ? ? A  A   826  N7    ? ? ? 1_555 A  G   853  N2    ? ? 0 A   827  0 G   854  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog908  hydrog ? ? A  G   827  N1    ? ? ? 1_555 A  C   852  N3    ? ? 0 G   828  0 C   853  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog909  hydrog ? ? A  G   827  N2    ? ? ? 1_555 A  C   852  O2    ? ? 0 G   828  0 C   853  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog910  hydrog ? ? A  G   827  O6    ? ? ? 1_555 A  C   852  N4    ? ? 0 G   828  0 C   853  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog911  hydrog ? ? A  A   828  N1    ? ? ? 1_555 A  U   851  N3    ? ? 0 A   829  0 U   852  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog912  hydrog ? ? A  A   828  N6    ? ? ? 1_555 A  U   851  O4    ? ? 0 A   829  0 U   852  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog913  hydrog ? ? A  G   829  N1    ? ? ? 1_555 A  C   850  N3    ? ? 0 G   830  0 C   851  1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog914  hydrog ? ? A  G   829  N2    ? ? ? 1_555 A  A   2021 N1    ? ? 0 G   830  0 A   2022 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog915  hydrog ? ? A  U   831  N3    ? ? ? 1_555 A  U   849  O2    ? ? 0 U   832  0 U   850  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog916  hydrog ? ? A  U   831  O4    ? ? ? 1_555 A  U   849  N3    ? ? 0 U   832  0 U   850  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog917  hydrog ? ? A  G   832  N1    ? ? ? 1_555 A  C   848  N3    ? ? 0 G   833  0 C   849  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog918  hydrog ? ? A  G   832  N2    ? ? ? 1_555 A  C   848  O2    ? ? 0 G   833  0 C   849  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog919  hydrog ? ? A  G   832  O6    ? ? ? 1_555 A  C   848  N4    ? ? 0 G   833  0 C   849  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog920  hydrog ? ? A  G   833  N1    ? ? ? 1_555 A  C   847  N3    ? ? 0 G   834  0 C   848  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog921  hydrog ? ? A  G   833  N2    ? ? ? 1_555 A  C   847  O2    ? ? 0 G   834  0 C   848  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog922  hydrog ? ? A  G   833  O6    ? ? ? 1_555 A  C   847  N4    ? ? 0 G   834  0 C   848  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog923  hydrog ? ? A  G   835  N1    ? ? ? 1_555 A  C   846  N3    ? ? 0 G   836  0 C   847  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog924  hydrog ? ? A  G   835  N2    ? ? ? 1_555 A  C   846  O2    ? ? 0 G   836  0 C   847  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog925  hydrog ? ? A  G   835  O6    ? ? ? 1_555 A  C   846  N4    ? ? 0 G   836  0 C   847  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog926  hydrog ? ? A  U   836  N3    ? ? ? 1_555 A  A   845  N1    ? ? 0 U   837  0 A   846  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog927  hydrog ? ? A  U   836  O4    ? ? ? 1_555 A  A   845  N6    ? ? 0 U   837  0 A   846  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog928  hydrog ? ? A  C   837  O2    ? ? ? 1_555 A  A   842  N6    ? ? 0 C   838  0 A   843  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog929  hydrog ? ? A  U   839  N3    ? ? ? 1_555 A  A   2054 N3    ? ? 0 U   840  0 A   2055 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog930  hydrog ? ? A  C   841  N4    ? ? ? 1_555 A  A   845  N3    ? ? 0 C   842  0 A   846  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog931  hydrog ? ? A  A   856  N6    ? ? ? 1_555 A  U   1830 O4    ? ? 0 A   857  0 U   1831 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog932  hydrog ? ? A  A   856  N7    ? ? ? 1_555 A  U   1830 N3    ? ? 0 A   857  0 U   1831 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog933  hydrog ? ? A  A   856  N6    ? ? ? 1_555 A  A   1844 N3    ? ? 0 A   857  0 A   1845 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog934  hydrog ? ? A  A   860  N3    ? ? ? 1_555 A  U   1487 N3    ? ? 0 A   861  0 U   1488 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog935  hydrog ? ? A  G   862  N2    ? ? ? 1_555 A  A   1458 N3    ? ? 0 G   863  0 A   1459 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog936  hydrog ? ? A  A   866  N3    ? ? ? 1_555 A  G   869  N2    ? ? 0 A   867  0 G   870  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog937  hydrog ? ? A  G   867  N1    ? ? ? 1_555 A  C   883  N3    ? ? 0 G   868  0 C   884  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog938  hydrog ? ? A  G   867  N2    ? ? ? 1_555 A  C   883  O2    ? ? 0 G   868  0 C   884  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog939  hydrog ? ? A  G   867  O6    ? ? ? 1_555 A  C   883  N4    ? ? 0 G   868  0 C   884  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog940  hydrog ? ? A  G   869  N1    ? ? ? 1_555 A  C   879  N3    ? ? 0 G   870  0 C   880  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog941  hydrog ? ? A  G   869  N2    ? ? ? 1_555 A  C   879  O2    ? ? 0 G   870  0 C   880  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog942  hydrog ? ? A  G   869  O6    ? ? ? 1_555 A  C   879  N4    ? ? 0 G   870  0 C   880  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog943  hydrog ? ? A  G   870  N1    ? ? ? 1_555 A  C   878  N3    ? ? 0 G   871  0 C   879  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog944  hydrog ? ? A  G   870  N2    ? ? ? 1_555 A  C   878  O2    ? ? 0 G   871  0 C   879  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog945  hydrog ? ? A  G   870  O6    ? ? ? 1_555 A  C   878  N4    ? ? 0 G   871  0 C   879  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog946  hydrog ? ? A  U   871  N3    ? ? ? 1_555 A  G   877  O6    ? ? 0 U   872  0 G   878  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog947  hydrog ? ? A  U   871  O2    ? ? ? 1_555 A  G   877  N1    ? ? 0 U   872  0 G   878  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog948  hydrog ? ? A  G   872  N2    ? ? ? 1_555 A  A   875  N1    ? ? 0 G   873  0 A   876  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog949  hydrog ? ? A  G   872  N3    ? ? ? 1_555 A  A   875  N6    ? ? 0 G   873  0 A   876  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog950  hydrog ? ? A  A   873  N3    ? ? ? 1_555 A  G   1831 N2    ? ? 0 A   874  0 G   1832 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog951  hydrog ? ? A  C   879  N4    ? ? ? 1_555 A  C   883  O2    ? ? 0 C   880  0 C   884  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog952  hydrog ? ? A  G   884  N2    ? ? ? 1_555 A  G   2112 N3    ? ? 0 G   885  0 G   2113 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog953  hydrog ? ? A  U   899  O2    ? ? ? 1_555 A  A   2100 N6    ? ? 0 U   900  0 A   2101 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog954  hydrog ? ? A  G   900  N2    ? ? ? 1_555 A  A   1357 N3    ? ? 0 G   901  0 A   1358 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog955  hydrog ? ? A  C   904  N3    ? ? ? 1_555 A  G   1299 N1    ? ? 0 C   905  0 G   1300 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog956  hydrog ? ? A  C   904  N4    ? ? ? 1_555 A  G   1299 O6    ? ? 0 C   905  0 G   1300 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog957  hydrog ? ? A  C   904  O2    ? ? ? 1_555 A  G   1299 N2    ? ? 0 C   905  0 G   1300 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog958  hydrog ? ? A  C   905  N3    ? ? ? 1_555 A  G   1298 N1    ? ? 0 C   906  0 G   1299 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog959  hydrog ? ? A  C   905  N4    ? ? ? 1_555 A  G   1298 O6    ? ? 0 C   906  0 G   1299 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog960  hydrog ? ? A  C   905  O2    ? ? ? 1_555 A  G   1298 N2    ? ? 0 C   906  0 G   1299 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog961  hydrog ? ? A  A   906  N1    ? ? ? 1_555 A  U   1297 N3    ? ? 0 A   907  0 U   1298 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog962  hydrog ? ? A  A   906  N6    ? ? ? 1_555 A  U   1297 O4    ? ? 0 A   907  0 U   1298 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog963  hydrog ? ? A  A   907  N1    ? ? ? 1_555 A  U   1296 N3    ? ? 0 A   908  0 U   1297 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog964  hydrog ? ? A  A   907  N6    ? ? ? 1_555 A  U   1296 O4    ? ? 0 A   908  0 U   1297 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog965  hydrog ? ? A  U   908  N3    ? ? ? 1_555 A  A   1295 N1    ? ? 0 U   909  0 A   1296 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog966  hydrog ? ? A  U   908  O4    ? ? ? 1_555 A  A   1295 N6    ? ? 0 U   909  0 A   1296 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog967  hydrog ? ? A  C   909  N3    ? ? ? 1_555 A  G   1294 N1    ? ? 0 C   910  0 G   1295 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog968  hydrog ? ? A  C   909  N4    ? ? ? 1_555 A  G   1294 O6    ? ? 0 C   910  0 G   1295 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog969  hydrog ? ? A  C   909  O2    ? ? ? 1_555 A  G   1294 N2    ? ? 0 C   910  0 G   1295 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog970  hydrog ? ? A  G   910  N2    ? ? ? 1_555 A  A   1293 N7    ? ? 0 G   911  0 A   1294 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog971  hydrog ? ? A  G   910  N3    ? ? ? 1_555 A  A   1293 N6    ? ? 0 G   911  0 A   1294 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog972  hydrog ? ? A  A   911  N6    ? ? ? 1_555 A  U   1292 O2    ? ? 0 A   912  0 U   1293 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog973  hydrog ? ? A  A   911  N7    ? ? ? 1_555 A  U   1292 N3    ? ? 0 A   912  0 U   1293 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog974  hydrog ? ? A  A   912  N6    ? ? ? 1_555 A  G   1070 O6    ? ? 0 A   913  0 G   1071 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog975  hydrog ? ? A  A   913  N6    ? ? ? 1_555 A  A   1069 N3    ? ? 0 A   914  0 A   1070 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog976  hydrog ? ? A  C   914  N3    ? ? ? 1_555 A  G   927  N1    ? ? 0 C   915  0 G   928  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog977  hydrog ? ? A  C   914  N4    ? ? ? 1_555 A  G   927  O6    ? ? 0 C   915  0 G   928  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog978  hydrog ? ? A  C   914  O2    ? ? ? 1_555 A  G   927  N2    ? ? 0 C   915  0 G   928  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog979  hydrog ? ? A  C   914  N4    ? ? ? 1_555 A  U   1041 O2    ? ? 0 C   915  0 U   1042 1_555 ? ? ? ? ? ? 'C-U MISPAIR' ? 
? 
hydrog980  hydrog ? ? A  A   915  N1    ? ? ? 1_555 A  U   926  N3    ? ? 0 A   916  0 U   927  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog981  hydrog ? ? A  A   915  N6    ? ? ? 1_555 A  U   926  O4    ? ? 0 A   916  0 U   927  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog982  hydrog ? ? A  A   915  N6    ? ? ? 1_555 A  C   1042 O2    ? ? 0 A   916  0 C   1043 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog983  hydrog ? ? A  U   916  N3    ? ? ? 1_555 A  A   925  N1    ? ? 0 U   917  0 A   926  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog984  hydrog ? ? A  U   916  O4    ? ? ? 1_555 A  A   925  N6    ? ? 0 U   917  0 A   926  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog985  hydrog ? ? A  G   917  N1    ? ? ? 1_555 A  C   924  N3    ? ? 0 G   918  0 C   925  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog986  hydrog ? ? A  G   917  N2    ? ? ? 1_555 A  C   924  O2    ? ? 0 G   918  0 C   925  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog987  hydrog ? ? A  G   917  O6    ? ? ? 1_555 A  C   924  N4    ? ? 0 G   918  0 C   925  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog988  hydrog ? ? A  U   918  N3    ? ? ? 1_555 A  G   923  O6    ? ? 0 U   919  0 G   924  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog989  hydrog ? ? A  U   918  O2    ? ? ? 1_555 A  G   923  N1    ? ? 0 U   919  0 G   924  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog990  hydrog ? ? A  G   920  O6    ? ? ? 1_555 A  G   2278 N2    ? ? 0 G   921  0 G   2279 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog991  hydrog ? ? A  A   922  N6    ? ? ? 1_555 A  U   2106 O2    ? ? 0 A   923  0 U   2107 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog992  hydrog ? ? A  A   922  N6    ? ? ? 1_555 A  G   2479 N3    ? ? 0 A   923  0 G   2480 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog993  hydrog ? ? A  A   925  N6    ? ? ? 1_555 A  C   1042 N3    ? ? 0 A   926  0 C   1043 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog994  hydrog ? ? A  A   925  N7    ? ? ? 1_555 A  C   1042 N4    ? ? 0 A   926  0 C   1043 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog995  hydrog ? ? A  G   927  N2    ? ? ? 1_555 A  A   2393 N1    ? ? 0 G   928  0 A   2394 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog996  hydrog ? ? A  A   928  N6    ? ? ? 1_555 A  U   1040 O4    ? ? 0 A   929  0 U   1041 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog997  hydrog ? ? A  C   929  O2    ? ? ? 1_555 A  A   1039 N6    ? ? 0 C   930  0 A   1040 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog998  hydrog ? ? A  C   930  N3    ? ? ? 1_555 A  G   1038 N1    ? ? 0 C   931  0 G   1039 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog999  hydrog ? ? A  C   930  N4    ? ? ? 1_555 A  G   1038 O6    ? ? 0 C   931  0 G   1039 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1000 hydrog ? ? A  C   930  O2    ? ? ? 1_555 A  G   1038 N2    ? ? 0 C   931  0 G   1039 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1001 hydrog ? ? A  U   931  N3    ? ? ? 1_555 A  G   1037 O6    ? ? 0 U   932  0 G   1038 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1002 hydrog ? ? A  U   931  O2    ? ? ? 1_555 A  G   1037 N1    ? ? 0 U   932  0 G   1038 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1003 hydrog ? ? A  C   932  N3    ? ? ? 1_555 A  G   1036 N1    ? ? 0 C   933  0 G   1037 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1004 hydrog ? ? A  C   932  N4    ? ? ? 1_555 A  G   1036 O6    ? ? 0 C   933  0 G   1037 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1005 hydrog ? ? A  C   932  O2    ? ? ? 1_555 A  G   1036 N2    ? ? 0 C   933  0 G   1037 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1006 hydrog ? ? A  C   933  N3    ? ? ? 1_555 A  G   1035 N1    ? ? 0 C   934  0 G   1036 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1007 hydrog ? ? A  C   933  N4    ? ? ? 1_555 A  G   1035 O6    ? ? 0 C   934  0 G   1036 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1008 hydrog ? ? A  C   933  O2    ? ? ? 1_555 A  G   1035 N2    ? ? 0 C   934  0 G   1036 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1009 hydrog ? ? A  G   934  N1    ? ? ? 1_555 A  C   1034 N3    ? ? 0 G   935  0 C   1035 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1010 hydrog ? ? A  G   934  N2    ? ? ? 1_555 A  C   1034 O2    ? ? 0 G   935  0 C   1035 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1011 hydrog ? ? A  G   934  O6    ? ? ? 1_555 A  C   1034 N4    ? ? 0 G   935  0 C   1035 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1012 hydrog ? ? A  C   935  N3    ? ? ? 1_555 A  G   1033 N1    ? ? 0 C   936  0 G   1034 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1013 hydrog ? ? A  C   935  N4    ? ? ? 1_555 A  G   1033 O6    ? ? 0 C   936  0 G   1034 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1014 hydrog ? ? A  C   935  O2    ? ? ? 1_555 A  G   1033 N2    ? ? 0 C   936  0 G   1034 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1015 hydrog ? ? A  C   936  O2    ? ? ? 1_555 A  C   1032 N4    ? ? 0 C   937  0 C   1033 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1016 hydrog ? ? A  G   937  N2    ? ? ? 1_555 A  A   1031 N7    ? ? 0 G   938  0 A   1032 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1017 hydrog ? ? A  A   938  N3    ? ? ? 1_555 A  G   1026 N2    ? ? 0 A   939  0 G   1027 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1018 hydrog ? ? A  A   938  N6    ? ? ? 1_555 A  G   1030 N3    ? ? 0 A   939  0 G   1031 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1019 hydrog ? ? A  A   938  N7    ? ? ? 1_555 A  G   1030 N2    ? ? 0 A   939  0 G   1031 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1020 hydrog ? ? A  G   939  N1    ? ? ? 1_555 A  C   1025 O2    ? ? 0 G   940  0 C   1026 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1021 hydrog ? ? A  G   939  N2    ? ? ? 1_555 A  A   1031 N3    ? ? 0 G   940  0 A   1032 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1022 hydrog ? ? A  G   940  N1    ? ? ? 1_555 A  C   1024 N3    ? ? 0 G   941  0 C   1025 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1023 hydrog ? ? A  G   940  N2    ? ? ? 1_555 A  C   1024 O2    ? ? 0 G   941  0 C   1025 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1024 hydrog ? ? A  G   940  O6    ? ? ? 1_555 A  C   1024 N4    ? ? 0 G   941  0 C   1025 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1025 hydrog ? ? A  U   941  N3    ? ? ? 1_555 A  G   1023 O6    ? ? 0 U   942  0 G   1024 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1026 hydrog ? ? A  U   941  O2    ? ? ? 1_555 A  G   1023 N1    ? ? 0 U   942  0 G   1024 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1027 hydrog ? ? A  A   942  N6    ? ? ? 1_555 A  C   1024 O2    ? ? 0 A   943  0 C   1025 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog1028 hydrog ? ? A  G   943  N1    ? ? ? 1_555 A  C   1022 N3    ? ? 0 G   944  0 C   1023 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1029 hydrog ? ? A  G   943  N2    ? ? ? 1_555 A  C   1022 O2    ? ? 0 G   944  0 C   1023 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1030 hydrog ? ? A  G   943  O6    ? ? ? 1_555 A  C   1022 N4    ? ? 0 G   944  0 C   1023 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1031 hydrog ? ? A  U   944  N3    ? ? ? 1_555 A  A   1021 N1    ? ? 0 U   945  0 A   1022 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1032 hydrog ? ? A  U   944  O4    ? ? ? 1_555 A  A   1021 N6    ? ? 0 U   945  0 A   1022 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1033 hydrog ? ? A  C   945  N3    ? ? ? 1_555 A  G   1020 N1    ? ? 0 C   946  0 G   1021 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1034 hydrog ? ? A  C   945  N4    ? ? ? 1_555 A  G   1020 O6    ? ? 0 C   946  0 G   1021 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1035 hydrog ? ? A  C   945  O2    ? ? ? 1_555 A  G   1020 N2    ? ? 0 C   946  0 G   1021 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1036 hydrog ? ? A  U   946  N3    ? ? ? 1_555 A  A   1019 N1    ? ? 0 U   947  0 A   1020 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1037 hydrog ? ? A  U   946  O4    ? ? ? 1_555 A  A   1019 N6    ? ? 0 U   947  0 A   1020 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1038 hydrog ? ? A  G   947  N1    ? ? ? 1_555 A  C   1018 N3    ? ? 0 G   948  0 C   1019 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1039 hydrog ? ? A  G   947  N2    ? ? ? 1_555 A  C   1018 O2    ? ? 0 G   948  0 C   1019 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1040 hydrog ? ? A  G   947  O6    ? ? ? 1_555 A  C   1018 N4    ? ? 0 G   948  0 C   1019 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1041 hydrog ? ? A  U   948  N3    ? ? ? 1_555 A  A   1017 N1    ? ? 0 U   949  0 A   1018 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1042 hydrog ? ? A  U   948  O4    ? ? ? 1_555 A  A   1017 N6    ? ? 0 U   949  0 A   1018 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1043 hydrog ? ? A  G   949  N1    ? ? ? 1_555 A  U   1016 O2    ? ? 0 G   950  0 U   1017 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1044 hydrog ? ? A  G   949  O6    ? ? ? 1_555 A  U   1016 N3    ? ? 0 G   950  0 U   1017 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1045 hydrog ? ? A  A   950  N1    ? ? ? 1_555 A  U   1015 N3    ? ? 0 A   951  0 U   1016 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1046 hydrog ? ? A  A   950  N6    ? ? ? 1_555 A  U   1015 O4    ? ? 0 A   951  0 U   1016 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1047 hydrog ? ? A  G   951  N1    ? ? ? 1_555 A  C   1014 N3    ? ? 0 G   952  0 C   1015 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1048 hydrog ? ? A  G   951  N2    ? ? ? 1_555 A  C   1014 O2    ? ? 0 G   952  0 C   1015 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1049 hydrog ? ? A  G   951  O6    ? ? ? 1_555 A  C   1014 N4    ? ? 0 G   952  0 C   1015 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1050 hydrog ? ? A  G   952  N2    ? ? ? 1_555 A  U   953  O4    ? ? 0 G   953  0 U   954  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1051 hydrog ? ? A  U   953  N3    ? ? ? 1_555 A  A   1012 N7    ? ? 0 U   954  0 A   1013 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1052 hydrog ? ? A  U   953  O2    ? ? ? 1_555 A  A   1012 N6    ? ? 0 U   954  0 A   1013 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1053 hydrog ? ? A  A   954  N6    ? ? ? 1_555 A  A   1011 N3    ? ? 0 A   955  0 A   1012 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog1054 hydrog ? ? A  G   955  N1    ? ? ? 1_555 A  C   1010 N3    ? ? 0 G   956  0 C   1011 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1055 hydrog ? ? A  G   955  N2    ? ? ? 1_555 A  C   1010 O2    ? ? 0 G   956  0 C   1011 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1056 hydrog ? ? A  G   955  O6    ? ? ? 1_555 A  C   1010 N4    ? ? 0 G   956  0 C   1011 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1057 hydrog ? ? A  A   956  N1    ? ? ? 1_555 A  U   1008 N3    ? ? 0 A   957  0 U   1009 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1058 hydrog ? ? A  A   956  N6    ? ? ? 1_555 A  U   1008 O4    ? ? 0 A   957  0 U   1009 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1059 hydrog ? ? A  G   957  N2    ? ? ? 1_555 A  A   960  N1    ? ? 0 G   958  0 A   961  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog1060 hydrog ? ? A  G   957  N3    ? ? ? 1_555 A  A   960  N6    ? ? 0 G   958  0 A   961  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog1061 hydrog ? ? A  G   957  N1    ? ? ? 1_555 A  C   1007 N3    ? ? 0 G   958  0 C   1008 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1062 hydrog ? ? A  G   957  N2    ? ? ? 1_555 A  C   1007 O2    ? ? 0 G   958  0 C   1008 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1063 hydrog ? ? A  G   957  O6    ? ? ? 1_555 A  C   1007 N4    ? ? 0 G   958  0 C   1008 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1064 hydrog ? ? A  C   958  O2    ? ? ? 1_555 A  C   961  N4    ? ? 0 C   959  0 C   962  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1065 hydrog ? ? A  C   958  O2    ? ? ? 1_555 A  C   962  N4    ? ? 0 C   959  0 C   963  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1066 hydrog ? ? A  C   958  N3    ? ? ? 1_555 A  A   1004 N6    ? ? 0 C   959  0 A   1005 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1067 hydrog ? ? A  C   958  N4    ? ? ? 1_555 A  A   1004 N7    ? ? 0 C   959  0 A   1005 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1068 hydrog ? ? A  C   961  N4    ? ? ? 1_555 A  C   1007 O2    ? ? 0 C   962  0 C   1008 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1069 hydrog ? ? A  C   962  N3    ? ? ? 1_555 A  A   1004 N6    ? ? 0 C   963  0 A   1005 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog1070 hydrog ? ? A  G   963  N1    ? ? ? 1_555 A  C   1003 N3    ? ? 0 G   964  0 C   1004 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1071 hydrog ? ? A  G   963  N2    ? ? ? 1_555 A  C   1003 O2    ? ? 0 G   964  0 C   1004 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1072 hydrog ? ? A  G   963  O6    ? ? ? 1_555 A  C   1003 N4    ? ? 0 G   964  0 C   1004 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1073 hydrog ? ? A  A   964  N1    ? ? ? 1_555 A  U   1002 N3    ? ? 0 A   965  0 U   1003 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1074 hydrog ? ? A  A   964  N6    ? ? ? 1_555 A  U   1002 O4    ? ? 0 A   965  0 U   1003 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1075 hydrog ? ? A  U   965  O2    ? ? ? 1_555 A  G   1001 N1    ? ? 0 U   966  0 G   1002 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog1076 hydrog ? ? A  U   966  N3    ? ? ? 1_555 A  U   1000 O2    ? ? 0 U   967  0 U   1001 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog1077 hydrog ? ? A  U   966  O4    ? ? ? 1_555 A  U   1000 N3    ? ? 0 U   967  0 U   1001 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog1078 hydrog ? ? A  G   967  N1    ? ? ? 1_555 A  C   999  N3    ? ? 0 G   968  0 C   1000 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1079 hydrog ? ? A  G   968  N1    ? ? ? 1_555 A  C   998  N3    ? ? 0 G   969  0 C   999  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1080 hydrog ? ? A  G   968  N2    ? ? ? 1_555 A  C   998  O2    ? ? 0 G   969  0 C   999  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1081 hydrog ? ? A  G   968  O6    ? ? ? 1_555 A  C   998  N4    ? ? 0 G   969  0 C   999  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1082 hydrog ? ? A  U   1008 O2    ? ? ? 1_555 A  C   1009 N4    ? ? 0 U   1009 0 C   1010 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog1083 hydrog ? ? A  A   1013 N6    ? ? ? 1_555 A  A   2301 N7    ? ? 0 A   1014 0 A   2302 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1084 hydrog ? ? A  A   1013 N7    ? ? ? 1_555 A  A   2301 N6    ? ? 0 A   1014 0 A   2302 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1085 hydrog ? ? A  G   1044 N1    ? ? ? 1_555 A  C   1068 N3    ? ? 0 G   1045 0 C   1069 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1086 hydrog ? ? A  G   1044 N2    ? ? ? 1_555 A  C   1068 O2    ? ? 0 G   1045 0 C   1069 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1087 hydrog ? ? A  G   1044 O6    ? ? ? 1_555 A  C   1068 N4    ? ? 0 G   1045 0 C   1069 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1088 hydrog ? ? A  G   1045 N1    ? ? ? 1_555 A  C   1067 N3    ? ? 0 G   1046 0 C   1068 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1089 hydrog ? ? A  G   1045 N2    ? ? ? 1_555 A  C   1067 O2    ? ? 0 G   1046 0 C   1068 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1090 hydrog ? ? A  G   1045 O6    ? ? ? 1_555 A  C   1067 N4    ? ? 0 G   1046 0 C   1068 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1091 hydrog ? ? A  G   1045 N2    ? ? ? 1_555 A  A   1081 N3    ? ? 0 G   1046 0 A   1082 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1092 hydrog ? ? A  U   1046 N3    ? ? ? 1_555 A  A   1066 N1    ? ? 0 U   1047 0 A   1067 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1093 hydrog ? ? A  U   1046 O4    ? ? ? 1_555 A  A   1066 N6    ? ? 0 U   1047 0 A   1067 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1094 hydrog ? ? A  G   1047 N1    ? ? ? 1_555 A  U   1065 O2    ? ? 0 G   1048 0 U   1066 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1095 hydrog ? ? A  G   1047 O6    ? ? ? 1_555 A  U   1065 N3    ? ? 0 G   1048 0 U   1066 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1096 hydrog ? ? A  C   1048 N3    ? ? ? 1_555 A  G   1064 N1    ? ? 0 C   1049 0 G   1065 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1097 hydrog ? ? A  C   1048 N4    ? ? ? 1_555 A  G   1064 O6    ? ? 0 C   1049 0 G   1065 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1098 hydrog ? ? A  C   1048 O2    ? ? ? 1_555 A  G   1064 N2    ? ? 0 C   1049 0 G   1065 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1099 hydrog ? ? A  G   1049 N1    ? ? ? 1_555 A  U   1063 O2    ? ? 0 G   1050 0 U   1064 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1100 hydrog ? ? A  G   1049 O6    ? ? ? 1_555 A  U   1063 N3    ? ? 0 G   1050 0 U   1064 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1101 hydrog ? ? A  C   1050 N3    ? ? ? 1_555 A  G   1062 N1    ? ? 0 C   1051 0 G   1063 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1102 hydrog ? ? A  C   1050 N4    ? ? ? 1_555 A  G   1062 O6    ? ? 0 C   1051 0 G   1063 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1103 hydrog ? ? A  C   1050 O2    ? ? ? 1_555 A  G   1062 N2    ? ? 0 C   1051 0 G   1063 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1104 hydrog ? ? A  G   1051 N1    ? ? ? 1_555 A  U   1061 O2    ? ? 0 G   1052 0 U   1062 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1105 hydrog ? ? A  G   1051 O6    ? ? ? 1_555 A  U   1061 N3    ? ? 0 G   1052 0 U   1062 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1106 hydrog ? ? A  G   1052 N1    ? ? ? 1_555 A  C   1060 N3    ? ? 0 G   1053 0 C   1061 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1107 hydrog ? ? A  G   1052 N2    ? ? ? 1_555 A  C   1060 O2    ? ? 0 G   1053 0 C   1061 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1108 hydrog ? ? A  G   1052 O6    ? ? ? 1_555 A  C   1060 N4    ? ? 0 G   1053 0 C   1061 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1109 hydrog ? ? A  G   1052 N2    ? ? ? 1_555 A  U   2307 O2    ? ? 0 G   1053 0 U   2308 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1110 hydrog ? ? A  G   1053 N1    ? ? ? 1_555 A  C   1059 N3    ? ? 0 G   1054 0 C   1060 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1111 hydrog ? ? A  G   1053 N2    ? ? ? 1_555 A  C   1059 O2    ? ? 0 G   1054 0 C   1060 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1112 hydrog ? ? A  G   1053 O6    ? ? ? 1_555 A  C   1059 N4    ? ? 0 G   1054 0 C   1060 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1113 hydrog ? ? A  G   1053 N2    ? ? ? 1_555 A  G   2282 O6    ? ? 0 G   1054 0 G   2283 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog1114 hydrog ? ? A  G   1054 N2    ? ? ? 1_555 A  A   1057 N7    ? ? 0 G   1055 0 A   1058 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1115 hydrog ? ? A  U   1055 O4    ? ? ? 1_555 A  G   2528 N2    ? ? 0 U   1056 0 G   2529 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog1116 hydrog ? ? A  A   1057 N3    ? ? ? 1_555 A  G   2490 N2    ? ? 0 A   1058 0 G   2491 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1117 hydrog ? ? A  G   1062 N2    ? ? ? 1_555 A  A   2300 N7    ? ? 0 G   1063 0 A   2301 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1118 hydrog ? ? A  G   1071 N2    ? ? ? 1_555 A  A   1087 N7    ? ? 0 G   1072 0 A   1088 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1119 hydrog ? ? A  G   1071 N3    ? ? ? 1_555 A  A   1087 N6    ? ? 0 G   1072 0 A   1088 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1120 hydrog ? ? A  A   1072 N6    ? ? ? 1_555 A  A   1085 N3    ? ? 0 A   1073 0 A   1086 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog1121 hydrog ? ? A  A   1072 N7    ? ? ? 1_555 A  G   1086 N2    ? ? 0 A   1073 0 G   1087 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1122 hydrog ? ? A  G   1073 N1    ? ? ? 1_555 A  C   1084 N3    ? ? 0 G   1074 0 C   1085 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1123 hydrog ? ? A  G   1073 N2    ? ? ? 1_555 A  C   1084 O2    ? ? 0 G   1074 0 C   1085 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1124 hydrog ? ? A  G   1073 O6    ? ? ? 1_555 A  C   1084 N4    ? ? 0 G   1074 0 C   1085 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1125 hydrog ? ? A  G   1074 N1    ? ? ? 1_555 A  C   1083 N3    ? ? 0 G   1075 0 C   1084 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1126 hydrog ? ? A  G   1074 N2    ? ? ? 1_555 A  C   1083 O2    ? ? 0 G   1075 0 C   1084 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1127 hydrog ? ? A  G   1074 O6    ? ? ? 1_555 A  C   1083 N4    ? ? 0 G   1075 0 C   1084 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1128 hydrog ? ? A  G   1074 N2    ? ? ? 1_555 A  A   1097 N3    ? ? 0 G   1075 0 A   1098 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1129 hydrog ? ? A  G   1075 N1    ? ? ? 1_555 A  C   1082 N3    ? ? 0 G   1076 0 C   1083 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1130 hydrog ? ? A  G   1075 N2    ? ? ? 1_555 A  C   1082 O2    ? ? 0 G   1076 0 C   1083 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1131 hydrog ? ? A  G   1075 O6    ? ? ? 1_555 A  C   1082 N4    ? ? 0 G   1076 0 C   1083 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1132 hydrog ? ? A  G   1075 N2    ? ? ? 1_555 B  U   87   O4    ? ? 0 G   1076 9 U   87   1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1133 hydrog ? ? A  A   1078 N3    ? ? ? 1_555 A  G   2067 N2    ? ? 0 A   1079 0 G   2068 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1134 hydrog ? ? A  C   1082 O2    ? ? ? 1_555 A  A   1123 N6    ? ? 0 C   1083 0 A   1124 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog1135 hydrog ? ? A  G   1088 N1    ? ? ? 1_555 A  C   1266 N3    ? ? 0 G   1089 0 C   1267 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1136 hydrog ? ? A  G   1088 N2    ? ? ? 1_555 A  C   1266 O2    ? ? 0 G   1089 0 C   1267 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1137 hydrog ? ? A  G   1088 O6    ? ? ? 1_555 A  C   1266 N4    ? ? 0 G   1089 0 C   1267 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1138 hydrog ? ? A  A   1089 N1    ? ? ? 1_555 A  U   1265 N3    ? ? 0 A   1090 0 U   1266 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1139 hydrog ? ? A  A   1089 N6    ? ? ? 1_555 A  U   1265 O4    ? ? 0 A   1090 0 U   1266 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1140 hydrog ? ? A  U   1090 N3    ? ? ? 1_555 A  G   1264 O6    ? ? 0 U   1091 0 G   1265 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1141 hydrog ? ? A  U   1090 O2    ? ? ? 1_555 A  G   1264 N1    ? ? 0 U   1091 0 G   1265 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1142 hydrog ? ? A  A   1091 N1    ? ? ? 1_555 A  U   1263 N3    ? ? 0 A   1092 0 U   1264 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1143 hydrog ? ? A  G   1092 N1    ? ? ? 1_555 A  C   1262 N3    ? ? 0 G   1093 0 C   1263 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1144 hydrog ? ? A  G   1092 N2    ? ? ? 1_555 A  C   1262 O2    ? ? 0 G   1093 0 C   1263 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1145 hydrog ? ? A  G   1092 O6    ? ? ? 1_555 A  C   1262 N4    ? ? 0 G   1093 0 C   1263 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1146 hydrog ? ? A  G   1093 N1    ? ? ? 1_555 A  C   1261 N3    ? ? 0 G   1094 0 C   1262 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1147 hydrog ? ? A  G   1093 N2    ? ? ? 1_555 A  C   1261 O2    ? ? 0 G   1094 0 C   1262 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1148 hydrog ? ? A  G   1093 O6    ? ? ? 1_555 A  C   1261 N4    ? ? 0 G   1094 0 C   1262 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1149 hydrog ? ? A  U   1094 N3    ? ? ? 1_555 A  A   1260 N1    ? ? 0 U   1095 0 A   1261 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1150 hydrog ? ? A  U   1094 O4    ? ? ? 1_555 A  A   1260 N6    ? ? 0 U   1095 0 A   1261 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1151 hydrog ? ? A  U   1095 N3    ? ? ? 1_555 A  A   1258 N7    ? ? 0 U   1096 0 A   1259 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1152 hydrog ? ? A  U   1095 O2    ? ? ? 1_555 A  A   1258 N6    ? ? 0 U   1096 0 A   1259 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1153 hydrog ? ? A  A   1097 N6    ? ? ? 1_555 A  G   1257 N3    ? ? 0 A   1098 0 G   1258 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1154 hydrog ? ? A  A   1097 N7    ? ? ? 1_555 A  G   1257 N2    ? ? 0 A   1098 0 G   1258 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1155 hydrog ? ? A  G   1098 N1    ? ? ? 1_555 A  C   1256 N3    ? ? 0 G   1099 0 C   1257 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1156 hydrog ? ? A  G   1098 N2    ? ? ? 1_555 A  C   1256 O2    ? ? 0 G   1099 0 C   1257 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1157 hydrog ? ? A  G   1098 O6    ? ? ? 1_555 A  C   1256 N4    ? ? 0 G   1099 0 C   1257 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1158 hydrog ? ? A  G   1099 N2    ? ? ? 1_555 A  A   1106 N3    ? ? 0 G   1100 0 A   1107 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1159 hydrog ? ? A  G   1099 N1    ? ? ? 1_555 A  C   1255 N3    ? ? 0 G   1100 0 C   1256 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1160 hydrog ? ? A  G   1099 N2    ? ? ? 1_555 A  C   1255 O2    ? ? 0 G   1100 0 C   1256 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1161 hydrog ? ? A  G   1099 O6    ? ? ? 1_555 A  C   1255 N4    ? ? 0 G   1100 0 C   1256 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1162 hydrog ? ? A  U   1100 N3    ? ? ? 1_555 A  A   1254 N1    ? ? 0 U   1101 0 A   1255 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1163 hydrog ? ? A  U   1100 O4    ? ? ? 1_555 A  A   1254 N6    ? ? 0 U   1101 0 A   1255 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1164 hydrog ? ? A  C   1101 N3    ? ? ? 1_555 A  G   1240 N1    ? ? 0 C   1102 0 G   1241 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1165 hydrog ? ? A  C   1101 N4    ? ? ? 1_555 A  G   1240 O6    ? ? 0 C   1102 0 G   1241 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1166 hydrog ? ? A  C   1101 O2    ? ? ? 1_555 A  G   1240 N2    ? ? 0 C   1102 0 G   1241 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1167 hydrog ? ? A  C   1102 N3    ? ? ? 1_555 A  G   1239 N1    ? ? 0 C   1103 0 G   1240 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1168 hydrog ? ? A  C   1102 N4    ? ? ? 1_555 A  G   1239 O6    ? ? 0 C   1103 0 G   1240 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1169 hydrog ? ? A  C   1102 O2    ? ? ? 1_555 A  G   1239 N2    ? ? 0 C   1103 0 G   1240 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1170 hydrog ? ? A  C   1103 N3    ? ? ? 1_555 A  G   1238 N1    ? ? 0 C   1104 0 G   1239 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1171 hydrog ? ? A  C   1103 N4    ? ? ? 1_555 A  G   1238 O6    ? ? 0 C   1104 0 G   1239 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1172 hydrog ? ? A  C   1103 O2    ? ? ? 1_555 A  G   1238 N2    ? ? 0 C   1104 0 G   1239 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1173 hydrog ? ? A  C   1104 O2    ? ? ? 1_555 A  A   1105 N6    ? ? 0 C   1105 0 A   1106 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog1174 hydrog ? ? A  C   1104 O2    ? ? ? 1_555 A  A   1106 N6    ? ? 0 C   1105 0 A   1107 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog1175 hydrog ? ? A  G   1107 N1    ? ? ? 1_555 A  C   1253 N3    ? ? 0 G   1108 0 C   1254 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1176 hydrog ? ? A  G   1107 N2    ? ? ? 1_555 A  C   1253 O2    ? ? 0 G   1108 0 C   1254 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1177 hydrog ? ? A  G   1107 O6    ? ? ? 1_555 A  C   1253 N4    ? ? 0 G   1108 0 C   1254 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1178 hydrog ? ? A  U   1108 N3    ? ? ? 1_555 A  A   1246 N7    ? ? 0 U   1109 0 A   1247 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog1179 hydrog ? ? A  U   1108 O4    ? ? ? 1_555 A  A   1246 N6    ? ? 0 U   1109 0 A   1247 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog1180 hydrog ? ? A  G   1109 N1    ? ? ? 1_555 A  C   1252 N3    ? ? 0 G   1110 0 C   1253 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1181 hydrog ? ? A  G   1109 N2    ? ? ? 1_555 A  C   1252 O2    ? ? 0 G   1110 0 C   1253 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1182 hydrog ? ? A  G   1109 O6    ? ? ? 1_555 A  C   1252 N4    ? ? 0 G   1110 0 C   1253 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1183 hydrog ? ? A  U   1110 N3    ? ? ? 1_555 A  A   1251 N1    ? ? 0 U   1111 0 A   1252 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1184 hydrog ? ? A  U   1110 O4    ? ? ? 1_555 A  A   1251 N6    ? ? 0 U   1111 0 A   1252 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1185 hydrog ? ? A  G   1111 N1    ? ? ? 1_555 A  C   1250 N3    ? ? 0 G   1112 0 C   1251 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1186 hydrog ? ? A  G   1111 N2    ? ? ? 1_555 A  C   1250 O2    ? ? 0 G   1112 0 C   1251 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1187 hydrog ? ? A  G   1111 O6    ? ? ? 1_555 A  C   1250 N4    ? ? 0 G   1112 0 C   1251 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1188 hydrog ? ? A  G   1112 N1    ? ? ? 1_555 A  C   1249 N3    ? ? 0 G   1113 0 C   1250 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1189 hydrog ? ? A  G   1112 N2    ? ? ? 1_555 A  C   1249 O2    ? ? 0 G   1113 0 C   1250 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1190 hydrog ? ? A  G   1112 O6    ? ? ? 1_555 A  C   1249 N4    ? ? 0 G   1113 0 C   1250 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1191 hydrog ? ? A  A   1113 N1    ? ? ? 1_555 A  U   1248 N3    ? ? 0 A   1114 0 U   1249 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1192 hydrog ? ? A  A   1113 N6    ? ? ? 1_555 A  U   1248 O4    ? ? 0 A   1114 0 U   1249 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1193 hydrog ? ? A  U   1114 N3    ? ? ? 1_555 A  A   1247 N1    ? ? 0 U   1115 0 A   1248 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1194 hydrog ? ? A  U   1114 O4    ? ? ? 1_555 A  A   1247 N6    ? ? 0 U   1115 0 A   1248 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1195 hydrog ? ? A  U   1115 O2    ? ? ? 1_555 A  A   1245 N6    ? ? 0 U   1116 0 A   1246 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog1196 hydrog ? ? A  A   1117 N6    ? ? ? 1_555 A  U   1243 O2    ? ? 0 A   1118 0 U   1244 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1197 hydrog ? ? A  G   1118 N2    ? ? ? 1_555 A  U   1119 O4    ? ? 0 G   1119 0 U   1120 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1198 hydrog ? ? A  G   1120 N1    ? ? ? 1_555 A  C   1242 N3    ? ? 0 G   1121 0 C   1243 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1199 hydrog ? ? A  G   1120 N2    ? ? ? 1_555 A  C   1242 O2    ? ? 0 G   1121 0 C   1243 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1200 hydrog ? ? A  G   1120 O6    ? ? ? 1_555 A  C   1242 N4    ? ? 0 G   1121 0 C   1243 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1201 hydrog ? ? A  U   1121 N3    ? ? ? 1_555 A  A   1241 N1    ? ? 0 U   1122 0 A   1242 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1202 hydrog ? ? A  U   1121 O4    ? ? ? 1_555 A  A   1241 N6    ? ? 0 U   1122 0 A   1242 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1203 hydrog ? ? A  A   1131 N6    ? ? ? 1_555 A  A   1229 N7    ? ? 0 A   1132 0 A   1230 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1204 hydrog ? ? A  A   1131 N7    ? ? ? 1_555 A  A   1229 N6    ? ? 0 A   1132 0 A   1230 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1205 hydrog ? ? A  A   1132 N6    ? ? ? 1_555 A  C   1228 O2    ? ? 0 A   1133 0 C   1229 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog1206 hydrog ? ? A  A   1132 N3    ? ? ? 1_555 A  G   2519 N2    ? ? 0 A   1133 0 G   2520 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1207 hydrog ? ? A  G   1133 N1    ? ? ? 1_555 A  C   1227 N3    ? ? 0 G   1134 0 C   1228 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1208 hydrog ? ? A  G   1133 N2    ? ? ? 1_555 A  C   1227 O2    ? ? 0 G   1134 0 C   1228 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1209 hydrog ? ? A  G   1133 O6    ? ? ? 1_555 A  C   1227 N4    ? ? 0 G   1134 0 C   1228 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1210 hydrog ? ? A  G   1134 N1    ? ? ? 1_555 A  C   1226 N3    ? ? 0 G   1135 0 C   1227 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1211 hydrog ? ? A  G   1134 N2    ? ? ? 1_555 A  C   1226 O2    ? ? 0 G   1135 0 C   1227 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1212 hydrog ? ? A  G   1134 O6    ? ? ? 1_555 A  C   1226 N4    ? ? 0 G   1135 0 C   1227 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1213 hydrog ? ? A  U   1135 N3    ? ? ? 1_555 A  G   1225 O6    ? ? 0 U   1136 0 G   1226 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1214 hydrog ? ? A  U   1135 O2    ? ? ? 1_555 A  G   1225 N1    ? ? 0 U   1136 0 G   1226 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1215 hydrog ? ? A  G   1137 N1    ? ? ? 1_555 A  C   1224 N3    ? ? 0 G   1138 0 C   1225 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1216 hydrog ? ? A  G   1137 N2    ? ? ? 1_555 A  C   1224 O2    ? ? 0 G   1138 0 C   1225 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1217 hydrog ? ? A  G   1137 O6    ? ? ? 1_555 A  C   1224 N4    ? ? 0 G   1138 0 C   1225 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1218 hydrog ? ? A  U   1138 N3    ? ? ? 1_555 A  G   1223 O6    ? ? 0 U   1139 0 G   1224 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1219 hydrog ? ? A  U   1138 O2    ? ? ? 1_555 A  G   1223 N1    ? ? 0 U   1139 0 G   1224 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1220 hydrog ? ? A  C   1139 N3    ? ? ? 1_555 A  G   1222 N1    ? ? 0 C   1140 0 G   1223 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1221 hydrog ? ? A  C   1139 N4    ? ? ? 1_555 A  G   1222 O6    ? ? 0 C   1140 0 G   1223 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1222 hydrog ? ? A  C   1139 O2    ? ? ? 1_555 A  G   1222 N2    ? ? 0 C   1140 0 G   1223 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1223 hydrog ? ? A  U   1140 N3    ? ? ? 1_555 A  A   1221 N1    ? ? 0 U   1141 0 A   1222 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1224 hydrog ? ? A  U   1140 O4    ? ? ? 1_555 A  A   1221 N6    ? ? 0 U   1141 0 A   1222 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1225 hydrog ? ? A  C   1141 N3    ? ? ? 1_555 A  G   1220 N1    ? ? 0 C   1142 0 G   1221 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1226 hydrog ? ? A  C   1141 N4    ? ? ? 1_555 A  G   1220 O6    ? ? 0 C   1142 0 G   1221 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1227 hydrog ? ? A  C   1141 O2    ? ? ? 1_555 A  G   1220 N2    ? ? 0 C   1142 0 G   1221 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1228 hydrog ? ? A  G   1142 N1    ? ? ? 1_555 A  U   1219 O2    ? ? 0 G   1143 0 U   1220 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1229 hydrog ? ? A  G   1142 O6    ? ? ? 1_555 A  U   1219 N3    ? ? 0 G   1143 0 U   1220 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1230 hydrog ? ? A  A   1143 N1    ? ? ? 1_555 A  U   1218 N3    ? ? 0 A   1144 0 U   1219 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1231 hydrog ? ? A  A   1143 N6    ? ? ? 1_555 A  U   1218 O4    ? ? 0 A   1144 0 U   1219 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1232 hydrog ? ? A  G   1144 N1    ? ? ? 1_555 A  U   1217 O2    ? ? 0 G   1145 0 U   1218 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1233 hydrog ? ? A  G   1144 O6    ? ? ? 1_555 A  U   1217 N3    ? ? 0 G   1145 0 U   1218 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1234 hydrog ? ? A  C   1145 N3    ? ? ? 1_555 A  G   1216 N1    ? ? 0 C   1146 0 G   1217 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1235 hydrog ? ? A  C   1145 N4    ? ? ? 1_555 A  G   1216 O6    ? ? 0 C   1146 0 G   1217 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1236 hydrog ? ? A  C   1145 O2    ? ? ? 1_555 A  G   1216 N2    ? ? 0 C   1146 0 G   1217 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1237 hydrog ? ? A  C   1146 N3    ? ? ? 1_555 A  G   1215 N1    ? ? 0 C   1147 0 G   1216 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1238 hydrog ? ? A  C   1146 N4    ? ? ? 1_555 A  G   1215 O6    ? ? 0 C   1147 0 G   1216 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1239 hydrog ? ? A  C   1146 O2    ? ? ? 1_555 A  G   1215 N2    ? ? 0 C   1147 0 G   1216 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1240 hydrog ? ? A  G   1150 N2    ? ? ? 1_555 A  A   1214 N7    ? ? 0 G   1151 0 A   1215 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1241 hydrog ? ? A  G   1150 N3    ? ? ? 1_555 A  A   1214 N6    ? ? 0 G   1151 0 A   1215 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1242 hydrog ? ? A  A   1151 N7    ? ? ? 1_555 A  G   1213 N2    ? ? 0 A   1152 0 G   1214 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1243 hydrog ? ? A  A   1151 N3    ? ? ? 1_555 A  G   1215 N2    ? ? 0 A   1152 0 G   1216 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1244 hydrog ? ? A  A   1151 N6    ? ? ? 1_555 A  G   2785 O6    ? ? 0 A   1152 0 G   2786 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1245 hydrog ? ? A  C   1152 N4    ? ? ? 1_555 A  G   2785 O6    ? ? 0 C   1153 0 G   2786 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog1246 hydrog ? ? A  A   1153 N6    ? ? ? 1_555 A  C   1212 O2    ? ? 0 A   1154 0 C   1213 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog1247 hydrog ? ? A  G   1154 N1    ? ? ? 1_555 A  C   1211 N3    ? ? 0 G   1155 0 C   1212 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1248 hydrog ? ? A  G   1154 N2    ? ? ? 1_555 A  C   1211 O2    ? ? 0 G   1155 0 C   1212 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1249 hydrog ? ? A  G   1154 O6    ? ? ? 1_555 A  C   1211 N4    ? ? 0 G   1155 0 C   1212 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1250 hydrog ? ? A  C   1155 N3    ? ? ? 1_555 A  G   1210 N1    ? ? 0 C   1156 0 G   1211 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1251 hydrog ? ? A  C   1155 N4    ? ? ? 1_555 A  G   1210 O6    ? ? 0 C   1156 0 G   1211 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1252 hydrog ? ? A  C   1155 O2    ? ? ? 1_555 A  G   1210 N2    ? ? 0 C   1156 0 G   1211 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1253 hydrog ? ? A  C   1156 N3    ? ? ? 1_555 A  G   1209 N1    ? ? 0 C   1157 0 G   1210 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1254 hydrog ? ? A  C   1156 N4    ? ? ? 1_555 A  G   1209 O6    ? ? 0 C   1157 0 G   1210 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1255 hydrog ? ? A  C   1156 O2    ? ? ? 1_555 A  G   1209 N2    ? ? 0 C   1157 0 G   1210 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1256 hydrog ? ? A  G   1157 N1    ? ? ? 1_555 A  C   1208 N3    ? ? 0 G   1158 0 C   1209 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1257 hydrog ? ? A  G   1157 N2    ? ? ? 1_555 A  C   1208 O2    ? ? 0 G   1158 0 C   1209 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1258 hydrog ? ? A  G   1157 O6    ? ? ? 1_555 A  C   1208 N4    ? ? 0 G   1158 0 C   1209 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1259 hydrog ? ? A  G   1158 N1    ? ? ? 1_555 A  C   1207 N3    ? ? 0 G   1159 0 C   1208 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1260 hydrog ? ? A  G   1158 N2    ? ? ? 1_555 A  C   1207 O2    ? ? 0 G   1159 0 C   1208 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1261 hydrog ? ? A  G   1158 O6    ? ? ? 1_555 A  C   1207 N4    ? ? 0 G   1159 0 C   1208 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1262 hydrog ? ? A  A   1160 N1    ? ? ? 1_555 A  U   1184 N3    ? ? 0 A   1161 0 U   1185 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1263 hydrog ? ? A  G   1161 N1    ? ? ? 1_555 A  C   1183 N3    ? ? 0 G   1162 0 C   1184 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1264 hydrog ? ? A  G   1161 N2    ? ? ? 1_555 A  C   1183 O2    ? ? 0 G   1162 0 C   1184 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1265 hydrog ? ? A  G   1161 O6    ? ? ? 1_555 A  C   1183 N4    ? ? 0 G   1162 0 C   1184 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1266 hydrog ? ? A  G   1162 N2    ? ? ? 1_555 A  C   1182 O2    ? ? 0 G   1163 0 C   1183 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1267 hydrog ? ? A  G   1162 N1    ? ? ? 1_555 A  C   1183 N3    ? ? 0 G   1163 0 C   1184 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1268 hydrog ? ? A  A   1165 N6    ? ? ? 1_555 A  U   1179 O4    ? ? 0 A   1166 0 U   1180 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1269 hydrog ? ? A  G   1166 N1    ? ? ? 1_555 A  C   1178 N3    ? ? 0 G   1167 0 C   1179 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1270 hydrog ? ? A  G   1166 N2    ? ? ? 1_555 A  C   1178 O2    ? ? 0 G   1167 0 C   1179 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1271 hydrog ? ? A  G   1166 O6    ? ? ? 1_555 A  C   1178 N4    ? ? 0 G   1167 0 C   1179 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1272 hydrog ? ? A  C   1167 O2    ? ? ? 1_555 A  G   1177 N1    ? ? 0 C   1168 0 G   1178 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog1273 hydrog ? ? A  U   1168 O2    ? ? ? 1_555 A  A   1176 N6    ? ? 0 U   1169 0 A   1177 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog1274 hydrog ? ? A  G   1174 O6    ? ? ? 1_555 A  C   1203 N4    ? ? 0 G   1175 0 C   1204 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1275 hydrog ? ? A  C   1175 N3    ? ? ? 1_555 A  C   1195 N4    ? ? 0 C   1176 0 C   1196 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1276 hydrog ? ? A  C   1175 N4    ? ? ? 1_555 A  G   1202 O6    ? ? 0 C   1176 0 G   1203 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog1277 hydrog ? ? A  C   1185 N3    ? ? ? 1_555 A  G   1189 N2    ? ? 0 C   1186 0 G   1190 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog1278 hydrog ? ? A  C   1185 O2    ? ? ? 1_555 A  G   1189 N1    ? ? 0 C   1186 0 G   1190 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog1279 hydrog ? ? A  A   1192 N3    ? ? ? 1_555 A  A   1193 N6    ? ? 0 A   1193 0 A   1194 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog1280 hydrog ? ? A  G   1194 N1    ? ? ? 1_555 A  C   1203 N3    ? ? 0 G   1195 0 C   1204 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1281 hydrog ? ? A  C   1195 N3    ? ? ? 1_555 A  G   1202 N1    ? ? 0 C   1196 0 G   1203 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1282 hydrog ? ? A  C   1195 N4    ? ? ? 1_555 A  G   1202 O6    ? ? 0 C   1196 0 G   1203 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1283 hydrog ? ? A  C   1195 O2    ? ? ? 1_555 A  G   1202 N2    ? ? 0 C   1196 0 G   1203 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1284 hydrog ? ? A  G   1196 N2    ? ? ? 1_555 A  A   1201 N7    ? ? 0 G   1197 0 A   1202 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1285 hydrog ? ? A  G   1196 N3    ? ? ? 1_555 A  A   1201 N6    ? ? 0 G   1197 0 A   1202 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1286 hydrog ? ? A  A   1230 N6    ? ? ? 1_555 A  C   2497 O2    ? ? 0 A   1231 0 C   2498 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog1287 hydrog ? ? A  A   1230 N6    ? ? ? 1_555 A  U   2522 O2    ? ? 0 A   1231 0 U   2523 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1288 hydrog ? ? A  G   1234 N2    ? ? ? 1_555 A  A   1235 N7    ? ? 0 G   1235 0 A   1236 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1289 hydrog ? ? A  G   1234 O6    ? ? ? 1_555 A  G   2079 N2    ? ? 0 G   1235 0 G   2080 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog1290 hydrog ? ? A  C   1237 N4    ? ? ? 1_555 A  G   1240 N7    ? ? 0 C   1238 0 G   1241 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog1291 hydrog ? ? A  C   1267 N3    ? ? ? 1_555 A  G   1289 N1    ? ? 0 C   1268 0 G   1290 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1292 hydrog ? ? A  C   1267 N4    ? ? ? 1_555 A  G   1289 O6    ? ? 0 C   1268 0 G   1290 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1293 hydrog ? ? A  C   1267 O2    ? ? ? 1_555 A  G   1289 N2    ? ? 0 C   1268 0 G   1290 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1294 hydrog ? ? A  G   1268 N1    ? ? ? 1_555 A  C   1288 N3    ? ? 0 G   1269 0 C   1289 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1295 hydrog ? ? A  G   1268 N2    ? ? ? 1_555 A  C   1288 O2    ? ? 0 G   1269 0 C   1289 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1296 hydrog ? ? A  G   1268 O6    ? ? ? 1_555 A  C   1288 N4    ? ? 0 G   1269 0 C   1289 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1297 hydrog ? ? A  U   1269 N3    ? ? ? 1_555 A  A   1285 N1    ? ? 0 U   1270 0 A   1286 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1298 hydrog ? ? A  U   1269 O4    ? ? ? 1_555 A  A   1285 N6    ? ? 0 U   1270 0 A   1286 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1299 hydrog ? ? A  A   1270 N1    ? ? ? 1_555 A  U   1284 N3    ? ? 0 A   1271 0 U   1285 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1300 hydrog ? ? A  A   1270 N6    ? ? ? 1_555 A  U   1284 O4    ? ? 0 A   1271 0 U   1285 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1301 hydrog ? ? A  C   1271 N3    ? ? ? 1_555 A  G   1283 N1    ? ? 0 C   1272 0 G   1284 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1302 hydrog ? ? A  C   1271 N4    ? ? ? 1_555 A  G   1283 O6    ? ? 0 C   1272 0 G   1284 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1303 hydrog ? ? A  C   1271 O2    ? ? ? 1_555 A  G   1283 N2    ? ? 0 C   1272 0 G   1284 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1304 hydrog ? ? A  C   1272 N3    ? ? ? 1_555 A  G   1282 N1    ? ? 0 C   1273 0 G   1283 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1305 hydrog ? ? A  C   1272 N4    ? ? ? 1_555 A  G   1282 O6    ? ? 0 C   1273 0 G   1283 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1306 hydrog ? ? A  C   1272 O2    ? ? ? 1_555 A  G   1282 N2    ? ? 0 C   1273 0 G   1283 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1307 hydrog ? ? A  A   1273 N1    ? ? ? 1_555 A  U   1281 N3    ? ? 0 A   1274 0 U   1282 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1308 hydrog ? ? A  A   1273 N6    ? ? ? 1_555 A  U   1281 O4    ? ? 0 A   1274 0 U   1282 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1309 hydrog ? ? A  C   1274 O2    ? ? ? 1_555 A  C   1280 N4    ? ? 0 C   1275 0 C   1281 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1310 hydrog ? ? A  U   1275 O2    ? ? ? 1_555 A  A   1279 N6    ? ? 0 U   1276 0 A   1280 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog1311 hydrog ? ? A  G   1291 N2    ? ? ? 1_555 A  U   1292 O4    ? ? 0 G   1292 0 U   1293 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1312 hydrog ? ? A  G   1299 N2    ? ? ? 1_555 A  A   1329 N3    ? ? 0 G   1300 0 A   1330 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1313 hydrog ? ? A  C   1300 N3    ? ? ? 1_555 A  G   1353 N1    ? ? 0 C   1301 0 G   1354 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1314 hydrog ? ? A  C   1300 N4    ? ? ? 1_555 A  G   1353 O6    ? ? 0 C   1301 0 G   1354 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1315 hydrog ? ? A  C   1300 O2    ? ? ? 1_555 A  G   1353 N2    ? ? 0 C   1301 0 G   1354 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1316 hydrog ? ? A  G   1301 N1    ? ? ? 1_555 A  C   1352 O2    ? ? 0 G   1302 0 C   1353 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1317 hydrog ? ? A  C   1302 N3    ? ? ? 1_555 A  G   1350 N1    ? ? 0 C   1303 0 G   1351 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1318 hydrog ? ? A  C   1302 N4    ? ? ? 1_555 A  G   1350 O6    ? ? 0 C   1303 0 G   1351 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1319 hydrog ? ? A  C   1302 O2    ? ? ? 1_555 A  G   1350 N2    ? ? 0 C   1303 0 G   1351 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1320 hydrog ? ? A  U   1303 N3    ? ? ? 1_555 A  U   1349 O2    ? ? 0 U   1304 0 U   1350 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog1321 hydrog ? ? A  U   1303 O4    ? ? ? 1_555 A  U   1349 N3    ? ? 0 U   1304 0 U   1350 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog1322 hydrog ? ? A  C   1304 N3    ? ? ? 1_555 A  G   1348 N1    ? ? 0 C   1305 0 G   1349 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1323 hydrog ? ? A  C   1304 N4    ? ? ? 1_555 A  G   1348 O6    ? ? 0 C   1305 0 G   1349 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1324 hydrog ? ? A  C   1304 O2    ? ? ? 1_555 A  G   1348 N2    ? ? 0 C   1305 0 G   1349 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1325 hydrog ? ? A  U   1305 N3    ? ? ? 1_555 A  A   1347 N1    ? ? 0 U   1306 0 A   1348 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1326 hydrog ? ? A  U   1305 O4    ? ? ? 1_555 A  A   1347 N6    ? ? 0 U   1306 0 A   1348 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1327 hydrog ? ? A  A   1306 N1    ? ? ? 1_555 A  U   1346 N3    ? ? 0 A   1307 0 U   1347 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1328 hydrog ? ? A  A   1306 N6    ? ? ? 1_555 A  U   1346 O4    ? ? 0 A   1307 0 U   1347 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1329 hydrog ? ? A  A   1307 N1    ? ? ? 1_555 A  U   1345 N3    ? ? 0 A   1308 0 U   1346 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1330 hydrog ? ? A  A   1307 N6    ? ? ? 1_555 A  U   1345 O4    ? ? 0 A   1308 0 U   1346 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1331 hydrog ? ? A  U   1308 N3    ? ? ? 1_555 A  A   1344 N1    ? ? 0 U   1309 0 A   1345 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1332 hydrog ? ? A  U   1308 O4    ? ? ? 1_555 A  A   1344 N6    ? ? 0 U   1309 0 A   1345 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1333 hydrog ? ? A  U   1309 N3    ? ? ? 1_555 A  G   1343 O6    ? ? 0 U   1310 0 G   1344 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1334 hydrog ? ? A  U   1309 O2    ? ? ? 1_555 A  G   1343 N1    ? ? 0 U   1310 0 G   1344 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1335 hydrog ? ? A  G   1310 N1    ? ? ? 1_555 A  C   1342 N3    ? ? 0 G   1311 0 C   1343 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1336 hydrog ? ? A  G   1310 N2    ? ? ? 1_555 A  C   1342 O2    ? ? 0 G   1311 0 C   1343 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1337 hydrog ? ? A  G   1310 O6    ? ? ? 1_555 A  C   1342 N4    ? ? 0 G   1311 0 C   1343 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1338 hydrog ? ? A  G   1311 N1    ? ? ? 1_555 A  C   1341 N3    ? ? 0 G   1312 0 C   1342 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1339 hydrog ? ? A  G   1311 N2    ? ? ? 1_555 A  C   1341 O2    ? ? 0 G   1312 0 C   1342 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1340 hydrog ? ? A  G   1311 O6    ? ? ? 1_555 A  C   1341 N4    ? ? 0 G   1312 0 C   1342 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1341 hydrog ? ? A  G   1315 N2    ? ? ? 1_555 A  A   1340 N7    ? ? 0 G   1316 0 A   1341 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1342 hydrog ? ? A  G   1315 N3    ? ? ? 1_555 A  A   1340 N6    ? ? 0 G   1316 0 A   1341 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1343 hydrog ? ? A  A   1316 N6    ? ? ? 1_555 A  G   1339 N3    ? ? 0 A   1317 0 G   1340 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1344 hydrog ? ? A  A   1316 N7    ? ? ? 1_555 A  G   1339 N2    ? ? 0 A   1317 0 G   1340 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1345 hydrog ? ? A  A   1317 N6    ? ? ? 1_555 A  G   1338 N3    ? ? 0 A   1318 0 G   1339 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1346 hydrog ? ? A  A   1317 N7    ? ? ? 1_555 A  G   1338 N2    ? ? 0 A   1318 0 G   1339 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1347 hydrog ? ? A  G   1318 N1    ? ? ? 1_555 A  U   1337 O2    ? ? 0 G   1319 0 U   1338 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1348 hydrog ? ? A  G   1318 O6    ? ? ? 1_555 A  U   1337 N3    ? ? 0 G   1319 0 U   1338 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1349 hydrog ? ? A  U   1319 N3    ? ? ? 1_555 A  A   1336 N1    ? ? 0 U   1320 0 A   1337 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1350 hydrog ? ? A  U   1319 O4    ? ? ? 1_555 A  A   1336 N6    ? ? 0 U   1320 0 A   1337 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1351 hydrog ? ? A  A   1320 N1    ? ? ? 1_555 A  U   1335 N3    ? ? 0 A   1321 0 U   1336 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1352 hydrog ? ? A  A   1320 N6    ? ? ? 1_555 A  U   1335 O4    ? ? 0 A   1321 0 U   1336 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1353 hydrog ? ? A  G   1321 N1    ? ? ? 1_555 A  C   1334 N3    ? ? 0 G   1322 0 C   1335 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1354 hydrog ? ? A  G   1321 N2    ? ? ? 1_555 A  C   1334 O2    ? ? 0 G   1322 0 C   1335 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1355 hydrog ? ? A  G   1321 O6    ? ? ? 1_555 A  C   1334 N4    ? ? 0 G   1322 0 C   1335 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1356 hydrog ? ? A  G   1322 N1    ? ? ? 1_555 A  C   1333 N3    ? ? 0 G   1323 0 C   1334 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1357 hydrog ? ? A  G   1322 N2    ? ? ? 1_555 A  C   1333 O2    ? ? 0 G   1323 0 C   1334 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1358 hydrog ? ? A  G   1322 O6    ? ? ? 1_555 A  C   1333 N4    ? ? 0 G   1323 0 C   1334 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1359 hydrog ? ? A  G   1323 N1    ? ? ? 1_555 A  U   1332 O2    ? ? 0 G   1324 0 U   1333 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1360 hydrog ? ? A  G   1323 O6    ? ? ? 1_555 A  U   1332 N3    ? ? 0 G   1324 0 U   1333 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1361 hydrog ? ? A  G   1324 N1    ? ? ? 1_555 A  C   1331 N3    ? ? 0 G   1325 0 C   1332 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1362 hydrog ? ? A  G   1324 N2    ? ? ? 1_555 A  C   1331 O2    ? ? 0 G   1325 0 C   1332 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1363 hydrog ? ? A  G   1324 O6    ? ? ? 1_555 A  C   1331 N4    ? ? 0 G   1325 0 C   1332 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1364 hydrog ? ? A  U   1325 N3    ? ? ? 1_555 A  A   1330 N1    ? ? 0 U   1326 0 A   1331 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1365 hydrog ? ? A  U   1325 O4    ? ? ? 1_555 A  A   1330 N6    ? ? 0 U   1326 0 A   1331 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1366 hydrog ? ? A  G   1326 N2    ? ? ? 1_555 A  A   1329 N7    ? ? 0 G   1327 0 A   1330 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1367 hydrog ? ? A  C   1365 N3    ? ? ? 1_555 A  G   2057 N1    ? ? 0 C   1366 0 G   2058 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1368 hydrog ? ? A  C   1365 N4    ? ? ? 1_555 A  G   2057 O6    ? ? 0 C   1366 0 G   2058 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1369 hydrog ? ? A  C   1365 O2    ? ? ? 1_555 A  G   2057 N2    ? ? 0 C   1366 0 G   2058 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1370 hydrog ? ? A  A   1366 N1    ? ? ? 1_555 A  U   2056 N3    ? ? 0 A   1367 0 U   2057 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1371 hydrog ? ? A  A   1366 N6    ? ? ? 1_555 A  U   2056 O4    ? ? 0 A   1367 0 U   2057 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1372 hydrog ? ? A  U   1367 O2    ? ? ? 1_555 A  C   2055 N4    ? ? 0 U   1368 0 C   2056 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog1373 hydrog ? ? A  A   1368 N6    ? ? ? 1_555 A  A   2054 N7    ? ? 0 A   1369 0 A   2055 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1374 hydrog ? ? A  A   1368 N7    ? ? ? 1_555 A  A   2054 N6    ? ? 0 A   1369 0 A   2055 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1375 hydrog ? ? A  G   1369 N2    ? ? ? 1_555 A  U   1370 O4    ? ? 0 G   1370 0 U   1371 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1376 hydrog ? ? A  U   1370 N3    ? ? ? 1_555 A  A   2053 N7    ? ? 0 U   1371 0 A   2054 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1377 hydrog ? ? A  U   1370 O2    ? ? ? 1_555 A  A   2053 N6    ? ? 0 U   1371 0 A   2054 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1378 hydrog ? ? A  A   1371 N6    ? ? ? 1_555 A  G   2052 N3    ? ? 0 A   1372 0 G   2053 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1379 hydrog ? ? A  A   1371 N7    ? ? ? 1_555 A  G   2052 N2    ? ? 0 A   1372 0 G   2053 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1380 hydrog ? ? A  G   1372 N2    ? ? ? 1_555 A  C   1430 O2    ? ? 0 G   1373 0 C   1431 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1381 hydrog ? ? A  G   1372 N1    ? ? ? 1_555 A  U   2051 O2    ? ? 0 G   1373 0 U   2052 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1382 hydrog ? ? A  G   1372 O6    ? ? ? 1_555 A  U   2051 N3    ? ? 0 G   1373 0 U   2052 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1383 hydrog ? ? A  C   1373 N3    ? ? ? 1_555 A  G   2050 N1    ? ? 0 C   1374 0 G   2051 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1384 hydrog ? ? A  C   1373 N4    ? ? ? 1_555 A  G   2050 O6    ? ? 0 C   1374 0 G   2051 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1385 hydrog ? ? A  C   1373 O2    ? ? ? 1_555 A  G   2050 N2    ? ? 0 C   1374 0 G   2051 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1386 hydrog ? ? A  C   1376 N3    ? ? ? 1_555 A  G   1682 N2    ? ? 0 C   1377 0 G   1683 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog1387 hydrog ? ? A  C   1376 O2    ? ? ? 1_555 A  G   1682 N1    ? ? 0 C   1377 0 G   1683 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog1388 hydrog ? ? A  A   1380 N3    ? ? ? 1_555 A  G   1400 N2    ? ? 0 A   1381 0 G   1401 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1389 hydrog ? ? A  G   1381 N1    ? ? ? 1_555 A  C   1399 N3    ? ? 0 G   1382 0 C   1400 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1390 hydrog ? ? A  G   1381 N2    ? ? ? 1_555 A  C   1399 O2    ? ? 0 G   1382 0 C   1400 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1391 hydrog ? ? A  G   1381 O6    ? ? ? 1_555 A  C   1399 N4    ? ? 0 G   1382 0 C   1400 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1392 hydrog ? ? A  U   1382 N3    ? ? ? 1_555 A  A   1398 N1    ? ? 0 U   1383 0 A   1399 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1393 hydrog ? ? A  U   1382 O4    ? ? ? 1_555 A  A   1398 N6    ? ? 0 U   1383 0 A   1399 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1394 hydrog ? ? A  C   1383 N3    ? ? ? 1_555 A  G   1397 N1    ? ? 0 C   1384 0 G   1398 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1395 hydrog ? ? A  C   1383 N4    ? ? ? 1_555 A  G   1397 O6    ? ? 0 C   1384 0 G   1398 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1396 hydrog ? ? A  C   1383 O2    ? ? ? 1_555 A  G   1397 N2    ? ? 0 C   1384 0 G   1398 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1397 hydrog ? ? A  G   1384 N1    ? ? ? 1_555 A  C   1396 N3    ? ? 0 G   1385 0 C   1397 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1398 hydrog ? ? A  G   1384 N2    ? ? ? 1_555 A  C   1396 O2    ? ? 0 G   1385 0 C   1397 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1399 hydrog ? ? A  G   1384 O6    ? ? ? 1_555 A  C   1396 N4    ? ? 0 G   1385 0 C   1397 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1400 hydrog ? ? A  G   1385 N1    ? ? ? 1_555 A  C   1395 N3    ? ? 0 G   1386 0 C   1396 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1401 hydrog ? ? A  G   1385 N2    ? ? ? 1_555 A  C   1395 O2    ? ? 0 G   1386 0 C   1396 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1402 hydrog ? ? A  G   1385 O6    ? ? ? 1_555 A  C   1395 N4    ? ? 0 G   1386 0 C   1396 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1403 hydrog ? ? A  G   1386 N1    ? ? ? 1_555 A  C   1394 N3    ? ? 0 G   1387 0 C   1395 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1404 hydrog ? ? A  G   1386 N2    ? ? ? 1_555 A  C   1394 O2    ? ? 0 G   1387 0 C   1395 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1405 hydrog ? ? A  G   1386 O6    ? ? ? 1_555 A  C   1394 N4    ? ? 0 G   1387 0 C   1395 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1406 hydrog ? ? A  U   1387 N3    ? ? ? 1_555 A  A   1391 N7    ? ? 0 U   1388 0 A   1392 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1407 hydrog ? ? A  U   1387 O2    ? ? ? 1_555 A  A   1391 N6    ? ? 0 U   1388 0 A   1392 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1408 hydrog ? ? A  G   1388 N2    ? ? ? 1_555 A  U   1434 O4    ? ? 0 G   1389 0 U   1435 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1409 hydrog ? ? A  A   1392 N6    ? ? ? 1_555 A  C   1724 O2    ? ? 0 A   1393 0 C   1725 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog1410 hydrog ? ? A  C   1393 N3    ? ? ? 1_555 A  U   1431 N3    ? ? 0 C   1394 0 U   1432 1_555 ? ? ? ? ? ? TYPE_17_PAIR ? ? 
hydrog1411 hydrog ? ? A  C   1393 N4    ? ? ? 1_555 A  U   1431 O2    ? ? 0 C   1394 0 U   1432 1_555 ? ? ? ? ? ? TYPE_17_PAIR ? ? 
hydrog1412 hydrog ? ? A  G   1400 N1    ? ? ? 1_555 A  C   1720 N3    ? ? 0 G   1401 0 C   1721 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1413 hydrog ? ? A  G   1400 N2    ? ? ? 1_555 A  C   1720 O2    ? ? 0 G   1401 0 C   1721 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1414 hydrog ? ? A  G   1400 O6    ? ? ? 1_555 A  C   1720 N4    ? ? 0 G   1401 0 C   1721 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1415 hydrog ? ? A  G   1401 N1    ? ? ? 1_555 A  C   1719 N3    ? ? 0 G   1402 0 C   1720 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1416 hydrog ? ? A  G   1401 N2    ? ? ? 1_555 A  C   1719 O2    ? ? 0 G   1402 0 C   1720 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1417 hydrog ? ? A  G   1401 O6    ? ? ? 1_555 A  C   1719 N4    ? ? 0 G   1402 0 C   1720 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1418 hydrog ? ? A  C   1402 N3    ? ? ? 1_555 A  G   1718 N1    ? ? 0 C   1403 0 G   1719 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1419 hydrog ? ? A  C   1402 N4    ? ? ? 1_555 A  G   1718 O6    ? ? 0 C   1403 0 G   1719 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1420 hydrog ? ? A  C   1402 O2    ? ? ? 1_555 A  G   1718 N2    ? ? 0 C   1403 0 G   1719 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1421 hydrog ? ? A  C   1403 N3    ? ? ? 1_555 A  G   1717 N1    ? ? 0 C   1404 0 G   1718 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1422 hydrog ? ? A  C   1403 N4    ? ? ? 1_555 A  G   1717 O6    ? ? 0 C   1404 0 G   1718 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1423 hydrog ? ? A  C   1403 O2    ? ? ? 1_555 A  G   1717 N2    ? ? 0 C   1404 0 G   1718 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1424 hydrog ? ? A  U   1404 N3    ? ? ? 1_555 A  A   1715 N7    ? ? 0 U   1405 0 A   1716 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1425 hydrog ? ? A  U   1404 O2    ? ? ? 1_555 A  A   1715 N6    ? ? 0 U   1405 0 A   1716 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1426 hydrog ? ? A  A   1406 N1    ? ? ? 1_555 A  A   1716 N6    ? ? 0 A   1407 0 A   1717 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog1427 hydrog ? ? A  A   1406 N6    ? ? ? 1_555 A  A   1716 N1    ? ? 0 A   1407 0 A   1717 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog1428 hydrog ? ? A  G   1408 N1    ? ? ? 1_555 A  C   1699 N3    ? ? 0 G   1409 0 C   1700 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1429 hydrog ? ? A  G   1408 N2    ? ? ? 1_555 A  C   1699 O2    ? ? 0 G   1409 0 C   1700 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1430 hydrog ? ? A  G   1408 O6    ? ? ? 1_555 A  C   1699 N4    ? ? 0 G   1409 0 C   1700 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1431 hydrog ? ? A  G   1409 N1    ? ? ? 1_555 A  C   1698 N3    ? ? 0 G   1410 0 C   1699 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1432 hydrog ? ? A  G   1409 N2    ? ? ? 1_555 A  C   1698 O2    ? ? 0 G   1410 0 C   1699 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1433 hydrog ? ? A  G   1409 O6    ? ? ? 1_555 A  C   1698 N4    ? ? 0 G   1410 0 C   1699 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1434 hydrog ? ? A  A   1410 N1    ? ? ? 1_555 A  U   1697 N3    ? ? 0 A   1411 0 U   1698 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1435 hydrog ? ? A  A   1410 N6    ? ? ? 1_555 A  U   1697 O4    ? ? 0 A   1411 0 U   1698 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1436 hydrog ? ? A  U   1411 N3    ? ? ? 1_555 A  G   1696 O6    ? ? 0 U   1412 0 G   1697 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1437 hydrog ? ? A  U   1411 O2    ? ? ? 1_555 A  G   1696 N1    ? ? 0 U   1412 0 G   1697 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1438 hydrog ? ? A  A   1413 N6    ? ? ? 1_555 A  G   1680 N3    ? ? 0 A   1414 0 G   1681 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1439 hydrog ? ? A  A   1413 N7    ? ? ? 1_555 A  G   1680 N2    ? ? 0 A   1414 0 G   1681 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1440 hydrog ? ? A  A   1413 N1    ? ? ? 1_555 A  A   1681 N6    ? ? 0 A   1414 0 A   1682 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog1441 hydrog ? ? A  A   1413 N6    ? ? ? 1_555 A  A   1681 N1    ? ? 0 A   1414 0 A   1682 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog1442 hydrog ? ? A  G   1414 N1    ? ? ? 1_555 A  C   1679 N3    ? ? 0 G   1415 0 C   1680 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1443 hydrog ? ? A  G   1414 N2    ? ? ? 1_555 A  C   1679 O2    ? ? 0 G   1415 0 C   1680 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1444 hydrog ? ? A  G   1414 O6    ? ? ? 1_555 A  C   1679 N4    ? ? 0 G   1415 0 C   1680 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1445 hydrog ? ? A  G   1415 N1    ? ? ? 1_555 A  C   1678 N3    ? ? 0 G   1416 0 C   1679 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1446 hydrog ? ? A  G   1415 N2    ? ? ? 1_555 A  C   1678 O2    ? ? 0 G   1416 0 C   1679 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1447 hydrog ? ? A  G   1415 O6    ? ? ? 1_555 A  C   1678 N4    ? ? 0 G   1416 0 C   1679 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1448 hydrog ? ? A  G   1415 N2    ? ? ? 1_555 A  A   1684 N3    ? ? 0 G   1416 0 A   1685 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1449 hydrog ? ? A  U   1417 N3    ? ? ? 1_555 A  U   1445 O4    ? ? 0 U   1418 0 U   1446 1_555 ? ? ? ? ? ? 'U-U MISPAIR' ? 
? 
hydrog1450 hydrog ? ? A  U   1418 N3    ? ? ? 1_555 A  A   1677 N1    ? ? 0 U   1419 0 A   1678 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1451 hydrog ? ? A  U   1418 O4    ? ? ? 1_555 A  A   1677 N6    ? ? 0 U   1419 0 A   1678 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1452 hydrog ? ? A  C   1419 N3    ? ? ? 1_555 A  G   1443 N1    ? ? 0 C   1420 0 G   1444 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1453 hydrog ? ? A  C   1419 N4    ? ? ? 1_555 A  G   1443 O6    ? ? 0 C   1420 0 G   1444 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1454 hydrog ? ? A  C   1419 O2    ? ? ? 1_555 A  G   1443 N2    ? ? 0 C   1420 0 G   1444 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1455 hydrog ? ? A  C   1420 N3    ? ? ? 1_555 A  G   1442 N1    ? ? 0 C   1421 0 G   1443 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1456 hydrog ? ? A  C   1420 N4    ? ? ? 1_555 A  G   1442 O6    ? ? 0 C   1421 0 G   1443 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1457 hydrog ? ? A  C   1420 O2    ? ? ? 1_555 A  G   1442 N2    ? ? 0 C   1421 0 G   1443 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1458 hydrog ? ? A  U   1421 N3    ? ? ? 1_555 A  A   1441 N1    ? ? 0 U   1422 0 A   1442 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1459 hydrog ? ? A  U   1421 O4    ? ? ? 1_555 A  A   1441 N6    ? ? 0 U   1422 0 A   1442 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1460 hydrog ? ? A  C   1422 N3    ? ? ? 1_555 A  G   1440 N1    ? ? 0 C   1423 0 G   1441 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1461 hydrog ? ? A  C   1422 N4    ? ? ? 1_555 A  G   1440 O6    ? ? 0 C   1423 0 G   1441 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1462 hydrog ? ? A  C   1422 O2    ? ? ? 1_555 A  G   1440 N2    ? ? 0 C   1423 0 G   1441 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1463 hydrog ? ? A  A   1423 N1    ? ? ? 1_555 A  U   1439 N3    ? ? 0 A   1424 0 U   1440 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1464 hydrog ? ? A  A   1423 N6    ? ? ? 1_555 A  U   1439 O4    ? ? 0 A   1424 0 U   1440 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1465 hydrog ? ? A  G   1424 N1    ? ? ? 1_555 A  C   1438 N3    ? ? 0 G   1425 0 C   1439 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1466 hydrog ? ? A  G   1424 N2    ? ? ? 1_555 A  C   1438 O2    ? ? 0 G   1425 0 C   1439 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1467 hydrog ? ? A  G   1424 O6    ? ? ? 1_555 A  C   1438 N4    ? ? 0 G   1425 0 C   1439 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1468 hydrog ? ? A  C   1425 N3    ? ? ? 1_555 A  A   1436 N6    ? ? 0 C   1426 0 A   1437 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1469 hydrog ? ? A  C   1425 N4    ? ? ? 1_555 A  A   1436 N7    ? ? 0 C   1426 0 A   1437 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1470 hydrog ? ? A  C   1427 N4    ? ? ? 1_555 A  C   1438 O2    ? ? 0 C   1428 0 C   1439 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1471 hydrog ? ? A  U   1428 N3    ? ? ? 1_555 A  A   1436 N1    ? ? 0 U   1429 0 A   1437 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1472 hydrog ? ? A  U   1428 O4    ? ? ? 1_555 A  A   1436 N6    ? ? 0 U   1429 0 A   1437 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1473 hydrog ? ? A  G   1429 N1    ? ? ? 1_555 A  C   1435 N3    ? ? 0 G   1430 0 C   1436 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1474 hydrog ? ? A  G   1429 N2    ? ? ? 1_555 A  C   1435 O2    ? ? 0 G   1430 0 C   1436 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1475 hydrog ? ? A  G   1429 O6    ? ? ? 1_555 A  C   1435 N4    ? ? 0 G   1430 0 C   1436 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1476 hydrog ? ? A  G   1429 N3    ? ? ? 1_555 A  A   1690 N6    ? ? 0 G   1430 0 A   1691 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1477 hydrog ? ? A  G   1443 N2    ? ? ? 1_555 A  A   1501 N3    ? ? 0 G   1444 0 A   1502 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1478 hydrog ? ? A  A   1447 N6    ? ? ? 1_555 A  U   1676 O2    ? ? 0 A   1448 0 U   1677 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1479 hydrog ? ? A  A   1447 N7    ? ? ? 1_555 A  U   1676 N3    ? ? 0 A   1448 0 U   1677 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1480 hydrog ? ? A  G   1448 N2    ? ? ? 1_555 A  A   1492 N3    ? ? 0 G   1449 0 A   1493 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1481 hydrog ? ? A  G   1448 N1    ? ? ? 1_555 A  C   1512 N3    ? ? 0 G   1449 0 C   1513 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1482 hydrog ? ? A  G   1448 N2    ? ? ? 1_555 A  C   1512 O2    ? ? 0 G   1449 0 C   1513 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1483 hydrog ? ? A  G   1448 O6    ? ? ? 1_555 A  C   1512 N4    ? ? 0 G   1449 0 C   1513 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1484 hydrog ? ? A  C   1449 N3    ? ? ? 1_555 A  G   1511 N1    ? ? 0 C   1450 0 G   1512 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1485 hydrog ? ? A  C   1449 N4    ? ? ? 1_555 A  G   1511 O6    ? ? 0 C   1450 0 G   1512 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1486 hydrog ? ? A  C   1449 O2    ? ? ? 1_555 A  G   1511 N2    ? ? 0 C   1450 0 G   1512 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1487 hydrog ? ? A  C   1450 N3    ? ? ? 1_555 A  G   1675 N1    ? ? 0 C   1451 0 G   1676 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1488 hydrog ? ? A  C   1450 N4    ? ? ? 1_555 A  G   1675 O6    ? ? 0 C   1451 0 G   1676 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1489 hydrog ? ? A  C   1450 O2    ? ? ? 1_555 A  G   1675 N2    ? ? 0 C   1451 0 G   1676 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1490 hydrog ? ? A  G   1451 N2    ? ? ? 1_555 A  A   1485 N1    ? ? 0 G   1452 0 A   1486 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1491 hydrog ? ? A  G   1451 N1    ? ? ? 1_555 A  C   1674 N3    ? ? 0 G   1452 0 C   1675 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1492 hydrog ? ? A  G   1451 N2    ? ? ? 1_555 A  C   1674 O2    ? ? 0 G   1452 0 C   1675 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1493 hydrog ? ? A  G   1451 O6    ? ? ? 1_555 A  C   1674 N4    ? ? 0 G   1452 0 C   1675 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1494 hydrog ? ? A  G   1452 N1    ? ? ? 1_555 A  C   1673 N3    ? ? 0 G   1453 0 C   1674 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1495 hydrog ? ? A  G   1452 N2    ? ? ? 1_555 A  C   1673 O2    ? ? 0 G   1453 0 C   1674 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1496 hydrog ? ? A  G   1452 O6    ? ? ? 1_555 A  C   1673 N4    ? ? 0 G   1453 0 C   1674 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1497 hydrog ? ? A  U   1453 O4    ? ? ? 1_555 A  G   1490 N2    ? ? 0 U   1454 0 G   1491 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog1498 hydrog ? ? A  C   1454 N3    ? ? ? 1_555 A  G   1489 N1    ? ? 0 C   1455 0 G   1490 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1499 hydrog ? ? A  C   1454 N4    ? ? ? 1_555 A  G   1489 O6    ? ? 0 C   1455 0 G   1490 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1500 hydrog ? ? A  C   1454 O2    ? ? ? 1_555 A  G   1489 N2    ? ? 0 C   1455 0 G   1490 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1501 hydrog ? ? A  C   1455 N3    ? ? ? 1_555 A  G   1488 N1    ? ? 0 C   1456 0 G   1489 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1502 hydrog ? ? A  C   1455 N4    ? ? ? 1_555 A  G   1488 O6    ? ? 0 C   1456 0 G   1489 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1503 hydrog ? ? A  C   1455 O2    ? ? ? 1_555 A  G   1488 N2    ? ? 0 C   1456 0 G   1489 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1504 hydrog ? ? A  U   1456 N3    ? ? ? 1_555 A  A   1484 N7    ? ? 0 U   1457 0 A   1485 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1505 hydrog ? ? A  U   1456 O2    ? ? ? 1_555 A  A   1484 N6    ? ? 0 U   1457 0 A   1485 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1506 hydrog ? ? A  A   1458 N6    ? ? ? 1_555 A  G   1483 N3    ? ? 0 A   1459 0 G   1484 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1507 hydrog ? ? A  A   1458 N7    ? ? ? 1_555 A  G   1483 N2    ? ? 0 A   1459 0 G   1484 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1508 hydrog ? ? A  G   1459 N1    ? ? ? 1_555 A  C   1482 N3    ? ? 0 G   1460 0 C   1483 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1509 hydrog ? ? A  G   1459 N2    ? ? ? 1_555 A  C   1482 O2    ? ? 0 G   1460 0 C   1483 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1510 hydrog ? ? A  G   1459 O6    ? ? ? 1_555 A  C   1482 N4    ? ? 0 G   1460 0 C   1483 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1511 hydrog ? ? A  U   1460 N3    ? ? ? 1_555 A  A   1481 N1    ? ? 0 U   1461 0 A   1482 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1512 hydrog ? ? A  U   1460 O4    ? ? ? 1_555 A  A   1481 N6    ? ? 0 U   1461 0 A   1482 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1513 hydrog ? ? A  C   1461 N3    ? ? ? 1_555 A  G   1480 N1    ? ? 0 C   1462 0 G   1481 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1514 hydrog ? ? A  C   1461 N4    ? ? ? 1_555 A  G   1480 O6    ? ? 0 C   1462 0 G   1481 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1515 hydrog ? ? A  C   1461 O2    ? ? ? 1_555 A  G   1480 N2    ? ? 0 C   1462 0 G   1481 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1516 hydrog ? ? A  A   1462 N1    ? ? ? 1_555 A  U   1479 N3    ? ? 0 A   1463 0 U   1480 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1517 hydrog ? ? A  A   1462 N6    ? ? ? 1_555 A  U   1479 O4    ? ? 0 A   1463 0 U   1480 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1518 hydrog ? ? A  U   1463 N3    ? ? ? 1_555 A  A   1478 N1    ? ? 0 U   1464 0 A   1479 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1519 hydrog ? ? A  U   1463 O4    ? ? ? 1_555 A  A   1478 N6    ? ? 0 U   1464 0 A   1479 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1520 hydrog ? ? A  A   1464 N1    ? ? ? 1_555 A  U   1477 N3    ? ? 0 A   1465 0 U   1478 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1521 hydrog ? ? A  A   1464 N6    ? ? ? 1_555 A  U   1477 O4    ? ? 0 A   1465 0 U   1478 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1522 hydrog ? ? A  C   1465 O2    ? ? ? 1_555 A  C   1476 N4    ? ? 0 C   1466 0 C   1477 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1523 hydrog ? ? A  C   1466 N3    ? ? ? 1_555 A  G   1474 N1    ? ? 0 C   1467 0 G   1475 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1524 hydrog ? ? A  C   1466 N4    ? ? ? 1_555 A  G   1474 O6    ? ? 0 C   1467 0 G   1475 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1525 hydrog ? ? A  C   1466 O2    ? ? ? 1_555 A  G   1474 N2    ? ? 0 C   1467 0 G   1475 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1526 hydrog ? ? A  C   1466 O2    ? ? ? 1_555 A  A   1475 N6    ? ? 0 C   1467 0 A   1476 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog1527 hydrog ? ? A  G   1467 N1    ? ? ? 1_555 A  C   1473 N3    ? ? 0 G   1468 0 C   1474 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1528 hydrog ? ? A  G   1467 N2    ? ? ? 1_555 A  C   1473 O2    ? ? 0 G   1468 0 C   1474 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1529 hydrog ? ? A  G   1467 O6    ? ? ? 1_555 A  C   1473 N4    ? ? 0 G   1468 0 C   1474 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1530 hydrog ? ? A  G   1474 N2    ? ? ? 1_555 A  A   1865 N3    ? ? 0 G   1475 0 A   1866 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1531 hydrog ? ? A  A   1484 N6    ? ? ? 1_555 A  A   1655 N1    ? ? 0 A   1485 0 A   1656 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog1532 hydrog ? ? A  A   1486 N3    ? ? ? 1_555 A  G   1696 N2    ? ? 0 A   1487 0 G   1697 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1533 hydrog ? ? A  G   1488 N3    ? ? ? 1_555 A  A   1655 N6    ? ? 0 G   1489 0 A   1656 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1534 hydrog ? ? A  G   1488 N2    ? ? ? 1_555 A  A   1656 N1    ? ? 0 G   1489 0 A   1657 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1535 hydrog ? ? A  A   1493 N1    ? ? ? 1_555 A  U   1510 N3    ? ? 0 A   1494 0 U   1511 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1536 hydrog ? ? A  A   1493 N6    ? ? ? 1_555 A  U   1510 O4    ? ? 0 A   1494 0 U   1511 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1537 hydrog ? ? A  C   1494 N3    ? ? ? 1_555 A  G   1509 N1    ? ? 0 C   1495 0 G   1510 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1538 hydrog ? ? A  C   1494 N4    ? ? ? 1_555 A  G   1509 O6    ? ? 0 C   1495 0 G   1510 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1539 hydrog ? ? A  C   1494 O2    ? ? ? 1_555 A  G   1509 N2    ? ? 0 C   1495 0 G   1510 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1540 hydrog ? ? A  G   1495 N1    ? ? ? 1_555 A  C   1508 N3    ? ? 0 G   1496 0 C   1509 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1541 hydrog ? ? A  G   1495 N2    ? ? ? 1_555 A  C   1508 O2    ? ? 0 G   1496 0 C   1509 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1542 hydrog ? ? A  G   1495 O6    ? ? ? 1_555 A  C   1508 N4    ? ? 0 G   1496 0 C   1509 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1543 hydrog ? ? A  G   1496 N1    ? ? ? 1_555 A  C   1507 N3    ? ? 0 G   1497 0 C   1508 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1544 hydrog ? ? A  G   1496 N2    ? ? ? 1_555 A  C   1507 O2    ? ? 0 G   1497 0 C   1508 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1545 hydrog ? ? A  G   1496 O6    ? ? ? 1_555 A  C   1507 N4    ? ? 0 G   1497 0 C   1508 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1546 hydrog ? ? A  G   1497 N1    ? ? ? 1_555 A  C   1506 N3    ? ? 0 G   1498 0 C   1507 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1547 hydrog ? ? A  G   1497 N2    ? ? ? 1_555 A  C   1506 O2    ? ? 0 G   1498 0 C   1507 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1548 hydrog ? ? A  G   1497 O6    ? ? ? 1_555 A  C   1506 N4    ? ? 0 G   1498 0 C   1507 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1549 hydrog ? ? A  U   1498 N3    ? ? ? 1_555 A  A   1503 N7    ? ? 0 U   1499 0 A   1504 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1550 hydrog ? ? A  U   1498 O2    ? ? ? 1_555 A  A   1503 N6    ? ? 0 U   1499 0 A   1504 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1551 hydrog ? ? A  C   1513 N3    ? ? ? 1_555 A  G   1671 N1    ? ? 0 C   1514 0 G   1672 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1552 hydrog ? ? A  C   1513 N4    ? ? ? 1_555 A  G   1671 O6    ? ? 0 C   1514 0 G   1672 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1553 hydrog ? ? A  C   1513 O2    ? ? ? 1_555 A  G   1671 N2    ? ? 0 C   1514 0 G   1672 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1554 hydrog ? ? A  A   1514 N1    ? ? ? 1_555 A  U   1670 N3    ? ? 0 A   1515 0 U   1671 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1555 hydrog ? ? A  A   1514 N6    ? ? ? 1_555 A  U   1670 O4    ? ? 0 A   1515 0 U   1671 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1556 hydrog ? ? A  C   1515 N3    ? ? ? 1_555 A  G   1669 N1    ? ? 0 C   1516 0 G   1670 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1557 hydrog ? ? A  C   1515 N4    ? ? ? 1_555 A  G   1669 O6    ? ? 0 C   1516 0 G   1670 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1558 hydrog ? ? A  C   1515 O2    ? ? ? 1_555 A  G   1669 N2    ? ? 0 C   1516 0 G   1670 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1559 hydrog ? ? A  U   1516 N3    ? ? ? 1_555 A  A   1668 N1    ? ? 0 U   1517 0 A   1669 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1560 hydrog ? ? A  U   1516 O4    ? ? ? 1_555 A  A   1668 N6    ? ? 0 U   1517 0 A   1669 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1561 hydrog ? ? A  A   1517 N1    ? ? ? 1_555 A  U   1667 N3    ? ? 0 A   1518 0 U   1668 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1562 hydrog ? ? A  A   1517 N6    ? ? ? 1_555 A  U   1667 O4    ? ? 0 A   1518 0 U   1668 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1563 hydrog ? ? A  U   1518 N3    ? ? ? 1_555 A  A   1666 N1    ? ? 0 U   1519 0 A   1667 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1564 hydrog ? ? A  U   1518 O4    ? ? ? 1_555 A  A   1666 N6    ? ? 0 U   1519 0 A   1667 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1565 hydrog ? ? A  G   1519 N1    ? ? ? 1_555 A  C   1665 N3    ? ? 0 G   1520 0 C   1666 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1566 hydrog ? ? A  G   1519 N2    ? ? ? 1_555 A  C   1665 O2    ? ? 0 G   1520 0 C   1666 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1567 hydrog ? ? A  G   1519 O6    ? ? ? 1_555 A  C   1665 N4    ? ? 0 G   1520 0 C   1666 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1568 hydrog ? ? A  C   1520 O2    ? ? ? 1_555 A  G   1664 N2    ? ? 0 C   1521 0 G   1665 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog1569 hydrog ? ? A  A   1526 N6    ? ? ? 1_555 A  A   1663 N7    ? ? 0 A   1527 0 A   1664 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1570 hydrog ? ? A  A   1526 N7    ? ? ? 1_555 A  A   1663 N6    ? ? 0 A   1527 0 A   1664 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1571 hydrog ? ? A  A   1527 N6    ? ? ? 1_555 A  G   1662 N3    ? ? 0 A   1528 0 G   1663 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1572 hydrog ? ? A  A   1527 N7    ? ? ? 1_555 A  G   1662 N2    ? ? 0 A   1528 0 G   1663 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1573 hydrog ? ? A  G   1528 N1    ? ? ? 1_555 A  C   1661 N3    ? ? 0 G   1529 0 C   1662 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1574 hydrog ? ? A  G   1528 N2    ? ? ? 1_555 A  C   1661 O2    ? ? 0 G   1529 0 C   1662 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1575 hydrog ? ? A  G   1528 O6    ? ? ? 1_555 A  C   1661 N4    ? ? 0 G   1529 0 C   1662 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1576 hydrog ? ? A  U   1529 N3    ? ? ? 1_555 A  A   1660 N1    ? ? 0 U   1530 0 A   1661 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1577 hydrog ? ? A  U   1529 O4    ? ? ? 1_555 A  A   1660 N6    ? ? 0 U   1530 0 A   1661 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1578 hydrog ? ? A  U   1530 N3    ? ? ? 1_555 A  G   1659 O6    ? ? 0 U   1531 0 G   1660 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1579 hydrog ? ? A  U   1530 O2    ? ? ? 1_555 A  G   1659 N1    ? ? 0 U   1531 0 G   1660 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1580 hydrog ? ? A  G   1531 N2    ? ? ? 1_555 A  A   1658 N7    ? ? 0 G   1532 0 A   1659 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1581 hydrog ? ? A  G   1531 N3    ? ? ? 1_555 A  A   1658 N6    ? ? 0 G   1532 0 A   1659 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1582 hydrog ? ? A  A   1532 N6    ? ? ? 1_555 A  A   1657 N7    ? ? 0 A   1533 0 A   1658 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1583 hydrog ? ? A  A   1532 N7    ? ? ? 1_555 A  A   1657 N6    ? ? 0 A   1533 0 A   1658 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1584 hydrog ? ? A  C   1533 N4    ? ? ? 1_555 A  A   1656 N7    ? ? 0 C   1534 0 A   1657 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog1585 hydrog ? ? A  G   1534 N1    ? ? ? 1_555 A  C   1649 N3    ? ? 0 G   1535 0 C   1650 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1586 hydrog ? ? A  G   1534 N2    ? ? ? 1_555 A  C   1649 O2    ? ? 0 G   1535 0 C   1650 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1587 hydrog ? ? A  G   1534 O6    ? ? ? 1_555 A  C   1649 N4    ? ? 0 G   1535 0 C   1650 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1588 hydrog ? ? A  C   1535 N3    ? ? ? 1_555 A  G   1648 N1    ? ? 0 C   1536 0 G   1649 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1589 hydrog ? ? A  C   1535 N4    ? ? ? 1_555 A  G   1648 O6    ? ? 0 C   1536 0 G   1649 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1590 hydrog ? ? A  C   1535 O2    ? ? ? 1_555 A  G   1648 N2    ? ? 0 C   1536 0 G   1649 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1591 hydrog ? ? A  C   1536 N3    ? ? ? 1_555 A  G   1647 N1    ? ? 0 C   1537 0 G   1648 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1592 hydrog ? ? A  C   1536 N4    ? ? ? 1_555 A  G   1647 O6    ? ? 0 C   1537 0 G   1648 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1593 hydrog ? ? A  C   1536 O2    ? ? ? 1_555 A  G   1647 N2    ? ? 0 C   1537 0 G   1648 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1594 hydrog ? ? A  C   1537 N3    ? ? ? 1_555 A  G   1646 N1    ? ? 0 C   1538 0 G   1647 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1595 hydrog ? ? A  C   1537 N4    ? ? ? 1_555 A  G   1646 O6    ? ? 0 C   1538 0 G   1647 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1596 hydrog ? ? A  C   1537 O2    ? ? ? 1_555 A  G   1646 N2    ? ? 0 C   1538 0 G   1647 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1597 hydrog ? ? A  U   1538 N3    ? ? ? 1_555 A  G   1645 O6    ? ? 0 U   1539 0 G   1646 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1598 hydrog ? ? A  U   1538 O2    ? ? ? 1_555 A  G   1645 N1    ? ? 0 U   1539 0 G   1646 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1599 hydrog ? ? A  G   1539 N1    ? ? ? 1_555 A  U   1644 O2    ? ? 0 G   1540 0 U   1645 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1600 hydrog ? ? A  G   1539 O6    ? ? ? 1_555 A  U   1644 N3    ? ? 0 G   1540 0 U   1645 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1601 hydrog ? ? A  G   1540 N1    ? ? ? 1_555 A  C   1643 N3    ? ? 0 G   1541 0 C   1644 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1602 hydrog ? ? A  G   1540 N2    ? ? ? 1_555 A  C   1643 O2    ? ? 0 G   1541 0 C   1644 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1603 hydrog ? ? A  G   1540 O6    ? ? ? 1_555 A  C   1643 N4    ? ? 0 G   1541 0 C   1644 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1604 hydrog ? ? A  G   1541 N2    ? ? ? 1_555 A  A   1615 N3    ? ? 0 G   1542 0 A   1616 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1605 hydrog ? ? A  G   1541 N1    ? ? ? 1_555 A  C   1642 N3    ? ? 0 G   1542 0 C   1643 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1606 hydrog ? ? A  G   1541 N2    ? ? ? 1_555 A  C   1642 O2    ? ? 0 G   1542 0 C   1643 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1607 hydrog ? ? A  G   1541 O6    ? ? ? 1_555 A  C   1642 N4    ? ? 0 G   1542 0 C   1643 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1608 hydrog ? ? A  G   1542 N2    ? ? ? 1_555 A  A   1641 N7    ? ? 0 G   1543 0 A   1642 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1609 hydrog ? ? A  G   1542 N3    ? ? ? 1_555 A  A   1641 N6    ? ? 0 G   1543 0 A   1642 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1610 hydrog ? ? A  U   1543 N3    ? ? ? 1_555 A  A   1640 N7    ? ? 0 U   1544 0 A   1641 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1611 hydrog ? ? A  U   1543 O2    ? ? ? 1_555 A  A   1640 N6    ? ? 0 U   1544 0 A   1641 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1612 hydrog ? ? A  C   1544 N4    ? ? ? 1_555 A  C   1639 O2    ? ? 0 C   1545 0 C   1640 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1613 hydrog ? ? A  C   1544 N3    ? ? ? 1_555 A  U   1701 N3    ? ? 0 C   1545 0 U   1702 1_555 ? ? ? ? ? ? TYPE_18_PAIR ? ? 
hydrog1614 hydrog ? ? A  C   1544 N4    ? ? ? 1_555 A  U   1701 O4    ? ? 0 C   1545 0 U   1702 1_555 ? ? ? ? ? ? TYPE_18_PAIR ? ? 
hydrog1615 hydrog ? ? A  G   1545 N1    ? ? ? 1_555 A  U   1638 O2    ? ? 0 G   1546 0 U   1639 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1616 hydrog ? ? A  G   1545 O6    ? ? ? 1_555 A  U   1638 N3    ? ? 0 G   1546 0 U   1639 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1617 hydrog ? ? A  A   1546 N1    ? ? ? 1_555 A  U   1637 N3    ? ? 0 A   1547 0 U   1638 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1618 hydrog ? ? A  A   1546 N6    ? ? ? 1_555 A  U   1637 O4    ? ? 0 A   1547 0 U   1638 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1619 hydrog ? ? A  U   1547 N3    ? ? ? 1_555 A  A   1636 N1    ? ? 0 U   1548 0 A   1637 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1620 hydrog ? ? A  U   1547 O4    ? ? ? 1_555 A  A   1636 N6    ? ? 0 U   1548 0 A   1637 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1621 hydrog ? ? A  C   1548 N3    ? ? ? 1_555 A  G   1635 N1    ? ? 0 C   1549 0 G   1636 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1622 hydrog ? ? A  C   1548 N4    ? ? ? 1_555 A  G   1635 O6    ? ? 0 C   1549 0 G   1636 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1623 hydrog ? ? A  C   1548 O2    ? ? ? 1_555 A  G   1635 N2    ? ? 0 C   1549 0 G   1636 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1624 hydrog ? ? A  A   1549 N1    ? ? ? 1_555 A  U   1634 N3    ? ? 0 A   1550 0 U   1635 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1625 hydrog ? ? A  A   1549 N6    ? ? ? 1_555 A  U   1634 O4    ? ? 0 A   1550 0 U   1635 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1626 hydrog ? ? A  C   1550 N3    ? ? ? 1_555 A  G   1633 N1    ? ? 0 C   1551 0 G   1634 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1627 hydrog ? ? A  C   1550 N4    ? ? ? 1_555 A  G   1633 O6    ? ? 0 C   1551 0 G   1634 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1628 hydrog ? ? A  C   1550 O2    ? ? ? 1_555 A  G   1633 N2    ? ? 0 C   1551 0 G   1634 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1629 hydrog ? ? A  G   1551 N1    ? ? ? 1_555 A  U   1568 O2    ? ? 0 G   1552 0 U   1569 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1630 hydrog ? ? A  G   1551 O6    ? ? ? 1_555 A  U   1568 N3    ? ? 0 G   1552 0 U   1569 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1631 hydrog ? ? A  C   1552 N3    ? ? ? 1_555 A  G   1567 N1    ? ? 0 C   1553 0 G   1568 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1632 hydrog ? ? A  C   1552 N4    ? ? ? 1_555 A  G   1567 O6    ? ? 0 C   1553 0 G   1568 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1633 hydrog ? ? A  C   1552 O2    ? ? ? 1_555 A  G   1567 N2    ? ? 0 C   1553 0 G   1568 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1634 hydrog ? ? A  U   1553 N3    ? ? ? 1_555 A  A   1566 N1    ? ? 0 U   1554 0 A   1567 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1635 hydrog ? ? A  U   1553 O4    ? ? ? 1_555 A  A   1566 N6    ? ? 0 U   1554 0 A   1567 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1636 hydrog ? ? A  G   1554 N1    ? ? ? 1_555 A  C   1565 N3    ? ? 0 G   1555 0 C   1566 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1637 hydrog ? ? A  G   1554 N2    ? ? ? 1_555 A  C   1565 O2    ? ? 0 G   1555 0 C   1566 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1638 hydrog ? ? A  G   1554 O6    ? ? ? 1_555 A  C   1565 N4    ? ? 0 G   1555 0 C   1566 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1639 hydrog ? ? A  G   1555 N1    ? ? ? 1_555 A  C   1564 N3    ? ? 0 G   1556 0 C   1565 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1640 hydrog ? ? A  G   1555 N2    ? ? ? 1_555 A  C   1564 O2    ? ? 0 G   1556 0 C   1565 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1641 hydrog ? ? A  G   1555 O6    ? ? ? 1_555 A  C   1564 N4    ? ? 0 G   1556 0 C   1565 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1642 hydrog ? ? A  G   1556 N1    ? ? ? 1_555 A  C   1563 N3    ? ? 0 G   1557 0 C   1564 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1643 hydrog ? ? A  G   1556 N2    ? ? ? 1_555 A  C   1563 O2    ? ? 0 G   1557 0 C   1564 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1644 hydrog ? ? A  G   1556 O6    ? ? ? 1_555 A  C   1563 N4    ? ? 0 G   1557 0 C   1564 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1645 hydrog ? ? A  U   1560 N3    ? ? ? 1_555 A  A   2738 N1    ? ? 0 U   1561 0 A   2739 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1646 hydrog ? ? A  U   1560 O4    ? ? ? 1_555 A  A   2738 N6    ? ? 0 U   1561 0 A   2739 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1647 hydrog ? ? A  C   1561 N3    ? ? ? 1_555 A  G   2737 N1    ? ? 0 C   1562 0 G   2738 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1648 hydrog ? ? A  C   1561 N4    ? ? ? 1_555 A  G   2737 O6    ? ? 0 C   1562 0 G   2738 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1649 hydrog ? ? A  C   1561 O2    ? ? ? 1_555 A  G   2737 N2    ? ? 0 C   1562 0 G   2738 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1650 hydrog ? ? A  G   1567 N2    ? ? ? 1_555 A  A   1631 N3    ? ? 0 G   1568 0 A   1632 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1651 hydrog ? ? A  C   1569 N3    ? ? ? 1_555 A  G   1626 N1    ? ? 0 C   1570 0 G   1627 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1652 hydrog ? ? A  C   1569 N4    ? ? ? 1_555 A  G   1626 O6    ? ? 0 C   1570 0 G   1627 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1653 hydrog ? ? A  C   1569 O2    ? ? ? 1_555 A  G   1626 N2    ? ? 0 C   1570 0 G   1627 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1654 hydrog ? ? A  G   1570 N2    ? ? ? 1_555 A  A   1625 N7    ? ? 0 G   1571 0 A   1626 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1655 hydrog ? ? A  G   1570 N3    ? ? ? 1_555 A  A   1625 N6    ? ? 0 G   1571 0 A   1626 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1656 hydrog ? ? A  A   1571 N6    ? ? ? 1_555 A  A   1623 N7    ? ? 0 A   1572 0 A   1624 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1657 hydrog ? ? A  A   1571 N7    ? ? ? 1_555 A  A   1623 N6    ? ? 0 A   1572 0 A   1624 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1658 hydrog ? ? A  A   1572 N6    ? ? ? 1_555 A  C   1622 O2    ? ? 0 A   1573 0 C   1623 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog1659 hydrog ? ? A  C   1573 N3    ? ? ? 1_555 A  G   1621 N1    ? ? 0 C   1574 0 G   1622 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1660 hydrog ? ? A  C   1573 N4    ? ? ? 1_555 A  G   1621 O6    ? ? 0 C   1574 0 G   1622 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1661 hydrog ? ? A  C   1573 O2    ? ? ? 1_555 A  G   1621 N2    ? ? 0 C   1574 0 G   1622 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1662 hydrog ? ? A  C   1574 N3    ? ? ? 1_555 A  G   1620 N1    ? ? 0 C   1575 0 G   1621 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1663 hydrog ? ? A  C   1574 N4    ? ? ? 1_555 A  G   1620 O6    ? ? 0 C   1575 0 G   1621 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1664 hydrog ? ? A  C   1574 O2    ? ? ? 1_555 A  G   1620 N2    ? ? 0 C   1575 0 G   1621 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1665 hydrog ? ? A  G   1575 N1    ? ? ? 1_555 A  C   1619 N3    ? ? 0 G   1576 0 C   1620 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1666 hydrog ? ? A  G   1575 N2    ? ? ? 1_555 A  C   1619 O2    ? ? 0 G   1576 0 C   1620 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1667 hydrog ? ? A  G   1575 O6    ? ? ? 1_555 A  C   1619 N4    ? ? 0 G   1576 0 C   1620 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1668 hydrog ? ? A  U   1576 N3    ? ? ? 1_555 A  G   1618 O6    ? ? 0 U   1577 0 G   1619 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1669 hydrog ? ? A  U   1576 O2    ? ? ? 1_555 A  G   1618 N1    ? ? 0 U   1577 0 G   1619 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1670 hydrog ? ? A  C   1577 N3    ? ? ? 1_555 A  G   1617 N1    ? ? 0 C   1578 0 G   1618 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1671 hydrog ? ? A  C   1577 N4    ? ? ? 1_555 A  G   1617 O6    ? ? 0 C   1578 0 G   1618 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1672 hydrog ? ? A  C   1577 O2    ? ? ? 1_555 A  G   1617 N2    ? ? 0 C   1578 0 G   1618 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1673 hydrog ? ? A  C   1578 N3    ? ? ? 1_555 A  A   1615 N6    ? ? 0 C   1579 0 A   1616 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1674 hydrog ? ? A  C   1578 N4    ? ? ? 1_555 A  A   1615 N7    ? ? 0 C   1579 0 A   1616 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1675 hydrog ? ? A  C   1578 N4    ? ? ? 1_555 A  G   1617 O6    ? ? 0 C   1579 0 G   1618 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog1676 hydrog ? ? A  A   1580 N6    ? ? ? 1_555 A  G   1613 N3    ? ? 0 A   1581 0 G   1614 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1677 hydrog ? ? A  A   1580 N7    ? ? ? 1_555 A  G   1613 N2    ? ? 0 A   1581 0 G   1614 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1678 hydrog ? ? A  C   1581 N4    ? ? ? 1_555 A  C   1612 N3    ? ? 0 C   1582 0 C   1613 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1679 hydrog ? ? A  U   1582 N3    ? ? ? 1_555 A  A   1611 N1    ? ? 0 U   1583 0 A   1612 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1680 hydrog ? ? A  U   1582 O4    ? ? ? 1_555 A  A   1611 N6    ? ? 0 U   1583 0 A   1612 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1681 hydrog ? ? A  C   1583 N3    ? ? ? 1_555 A  G   1610 N1    ? ? 0 C   1584 0 G   1611 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1682 hydrog ? ? A  C   1583 N4    ? ? ? 1_555 A  G   1610 O6    ? ? 0 C   1584 0 G   1611 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1683 hydrog ? ? A  C   1583 O2    ? ? ? 1_555 A  G   1610 N2    ? ? 0 C   1584 0 G   1611 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1684 hydrog ? ? A  C   1584 N3    ? ? ? 1_555 A  G   1609 N1    ? ? 0 C   1585 0 G   1610 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1685 hydrog ? ? A  C   1584 N4    ? ? ? 1_555 A  G   1609 O6    ? ? 0 C   1585 0 G   1610 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1686 hydrog ? ? A  C   1584 O2    ? ? ? 1_555 A  G   1609 N2    ? ? 0 C   1585 0 G   1610 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1687 hydrog ? ? A  G   1585 N1    ? ? ? 1_555 A  C   1608 N3    ? ? 0 G   1586 0 C   1609 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1688 hydrog ? ? A  G   1585 N2    ? ? ? 1_555 A  C   1608 O2    ? ? 0 G   1586 0 C   1609 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1689 hydrog ? ? A  G   1585 O6    ? ? ? 1_555 A  C   1608 N4    ? ? 0 G   1586 0 C   1609 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1690 hydrog ? ? A  U   1586 N3    ? ? ? 1_555 A  G   1607 O6    ? ? 0 U   1587 0 G   1608 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1691 hydrog ? ? A  U   1586 O2    ? ? ? 1_555 A  G   1607 N1    ? ? 0 U   1587 0 G   1608 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1692 hydrog ? ? A  G   1587 N2    ? ? ? 1_555 A  A   1606 N7    ? ? 0 G   1588 0 A   1607 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1693 hydrog ? ? A  G   1587 N3    ? ? ? 1_555 A  A   1606 N6    ? ? 0 G   1588 0 A   1607 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1694 hydrog ? ? A  G   1588 N2    ? ? ? 1_555 A  A   1605 N7    ? ? 0 G   1589 0 A   1606 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1695 hydrog ? ? A  A   1589 N6    ? ? ? 1_555 A  G   1604 N3    ? ? 0 A   1590 0 G   1605 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1696 hydrog ? ? A  A   1589 N7    ? ? ? 1_555 A  G   1604 N2    ? ? 0 A   1590 0 G   1605 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1697 hydrog ? ? A  G   1591 N1    ? ? ? 1_555 A  C   1601 N3    ? ? 0 G   1592 0 C   1602 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1698 hydrog ? ? A  G   1591 N2    ? ? ? 1_555 A  C   1601 O2    ? ? 0 G   1592 0 C   1602 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1699 hydrog ? ? A  G   1591 O6    ? ? ? 1_555 A  C   1601 N4    ? ? 0 G   1592 0 C   1602 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1700 hydrog ? ? A  C   1592 N3    ? ? ? 1_555 A  G   1600 N1    ? ? 0 C   1593 0 G   1601 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1701 hydrog ? ? A  C   1592 N4    ? ? ? 1_555 A  G   1600 O6    ? ? 0 C   1593 0 G   1601 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1702 hydrog ? ? A  C   1592 O2    ? ? ? 1_555 A  G   1600 N2    ? ? 0 C   1593 0 G   1601 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1703 hydrog ? ? A  C   1593 N3    ? ? ? 1_555 A  G   1599 N1    ? ? 0 C   1594 0 G   1600 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1704 hydrog ? ? A  C   1593 N4    ? ? ? 1_555 A  G   1599 O6    ? ? 0 C   1594 0 G   1600 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1705 hydrog ? ? A  C   1593 O2    ? ? ? 1_555 A  G   1599 N2    ? ? 0 C   1594 0 G   1600 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1706 hydrog ? ? A  A   1596 N1    ? ? ? 1_555 A  G   1646 N2    ? ? 0 A   1597 0 G   1647 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog1707 hydrog ? ? A  A   1596 N6    ? ? ? 1_555 A  G   1646 N3    ? ? 0 A   1597 0 G   1647 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog1708 hydrog ? ? A  G   1627 N1    ? ? ? 1_555 A  C   1632 N3    ? ? 0 G   1628 0 C   1633 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1709 hydrog ? ? A  G   1627 N2    ? ? ? 1_555 A  C   1632 O2    ? ? 0 G   1628 0 C   1633 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1710 hydrog ? ? A  G   1627 O6    ? ? ? 1_555 A  C   1632 N4    ? ? 0 G   1628 0 C   1633 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1711 hydrog ? ? A  G   1628 N2    ? ? ? 1_555 A  A   1631 N7    ? ? 0 G   1629 0 A   1632 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1712 hydrog ? ? A  C   1650 N3    ? ? ? 1_555 A  G   1654 N1    ? ? 0 C   1651 0 G   1655 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1713 hydrog ? ? A  C   1650 N4    ? ? ? 1_555 A  G   1654 O6    ? ? 0 C   1651 0 G   1655 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1714 hydrog ? ? A  C   1650 O2    ? ? ? 1_555 A  G   1654 N2    ? ? 0 C   1651 0 G   1655 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1715 hydrog ? ? A  A   1681 N6    ? ? ? 1_555 A  U   1695 O2    ? ? 0 A   1682 0 U   1696 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1716 hydrog ? ? A  A   1681 N7    ? ? ? 1_555 A  U   1695 N3    ? ? 0 A   1682 0 U   1696 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1717 hydrog ? ? A  A   1683 N6    ? ? ? 1_555 A  U   1721 O4    ? ? 0 A   1684 0 U   1722 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog1718 hydrog ? ? A  A   1683 N7    ? ? ? 1_555 A  U   1721 N3    ? ? 0 A   1684 0 U   1722 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog1719 hydrog ? ? A  C   1685 N3    ? ? ? 1_555 A  G   1694 N1    ? ? 0 C   1686 0 G   1695 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1720 hydrog ? ? A  C   1685 N4    ? ? ? 1_555 A  G   1694 O6    ? ? 0 C   1686 0 G   1695 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1721 hydrog ? ? A  C   1685 O2    ? ? ? 1_555 A  G   1694 N2    ? ? 0 C   1686 0 G   1695 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1722 hydrog ? ? A  C   1686 N3    ? ? ? 1_555 A  G   1693 N1    ? ? 0 C   1687 0 G   1694 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1723 hydrog ? ? A  C   1686 N4    ? ? ? 1_555 A  G   1693 O6    ? ? 0 C   1687 0 G   1694 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1724 hydrog ? ? A  C   1686 O2    ? ? ? 1_555 A  G   1693 N2    ? ? 0 C   1687 0 G   1694 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1725 hydrog ? ? A  G   1702 N1    ? ? ? 1_555 A  C   1714 N3    ? ? 0 G   1703 0 C   1715 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1726 hydrog ? ? A  G   1702 N2    ? ? ? 1_555 A  C   1714 O2    ? ? 0 G   1703 0 C   1715 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1727 hydrog ? ? A  G   1702 O6    ? ? ? 1_555 A  C   1714 N4    ? ? 0 G   1703 0 C   1715 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1728 hydrog ? ? A  G   1703 N1    ? ? ? 1_555 A  C   1713 N3    ? ? 0 G   1704 0 C   1714 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1729 hydrog ? ? A  G   1703 N2    ? ? ? 1_555 A  C   1713 O2    ? ? 0 G   1704 0 C   1714 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1730 hydrog ? ? A  G   1703 O6    ? ? ? 1_555 A  C   1713 N4    ? ? 0 G   1704 0 C   1714 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1731 hydrog ? ? A  C   1704 N3    ? ? ? 1_555 A  G   1712 N1    ? ? 0 C   1705 0 G   1713 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1732 hydrog ? ? A  C   1704 N4    ? ? ? 1_555 A  G   1712 O6    ? ? 0 C   1705 0 G   1713 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1733 hydrog ? ? A  C   1704 O2    ? ? ? 1_555 A  G   1712 N2    ? ? 0 C   1705 0 G   1713 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1734 hydrog ? ? A  G   1705 N2    ? ? ? 1_555 A  A   1711 N7    ? ? 0 G   1706 0 A   1712 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1735 hydrog ? ? A  G   1705 N3    ? ? ? 1_555 A  A   1711 N6    ? ? 0 G   1706 0 A   1712 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1736 hydrog ? ? A  G   1706 N2    ? ? ? 1_555 A  A   1710 N7    ? ? 0 G   1707 0 A   1711 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1737 hydrog ? ? A  C   1724 N3    ? ? ? 1_555 A  G   2049 N1    ? ? 0 C   1725 0 G   2050 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1738 hydrog ? ? A  C   1724 N4    ? ? ? 1_555 A  G   2049 O6    ? ? 0 C   1725 0 G   2050 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1739 hydrog ? ? A  C   1724 O2    ? ? ? 1_555 A  G   2049 N2    ? ? 0 C   1725 0 G   2050 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1740 hydrog ? ? A  G   1725 N1    ? ? ? 1_555 A  C   2048 N3    ? ? 0 G   1726 0 C   2049 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1741 hydrog ? ? A  G   1725 N2    ? ? ? 1_555 A  C   2048 O2    ? ? 0 G   1726 0 C   2049 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1742 hydrog ? ? A  G   1725 O6    ? ? ? 1_555 A  C   2048 N4    ? ? 0 G   1726 0 C   2049 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1743 hydrog ? ? A  G   1726 N1    ? ? ? 1_555 A  C   2047 N3    ? ? 0 G   1727 0 C   2048 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1744 hydrog ? ? A  G   1726 N2    ? ? ? 1_555 A  C   2047 O2    ? ? 0 G   1727 0 C   2048 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1745 hydrog ? ? A  G   1726 O6    ? ? ? 1_555 A  C   2047 N4    ? ? 0 G   1727 0 C   2048 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1746 hydrog ? ? A  G   1727 N1    ? ? ? 1_555 A  C   2046 N3    ? ? 0 G   1728 0 C   2047 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1747 hydrog ? ? A  G   1727 N2    ? ? ? 1_555 A  C   2046 O2    ? ? 0 G   1728 0 C   2047 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1748 hydrog ? ? A  G   1727 O6    ? ? ? 1_555 A  C   2046 N4    ? ? 0 G   1728 0 C   2047 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1749 hydrog ? ? A  A   1732 N6    ? ? ? 1_555 A  G   2045 N3    ? ? 0 A   1733 0 G   2046 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1750 hydrog ? ? A  A   1732 N7    ? ? ? 1_555 A  G   2045 N2    ? ? 0 A   1733 0 G   2046 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1751 hydrog ? ? A  C   1733 N3    ? ? ? 1_555 A  G   2044 N1    ? ? 0 C   1734 0 G   2045 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1752 hydrog ? ? A  C   1733 N4    ? ? ? 1_555 A  G   2044 O6    ? ? 0 C   1734 0 G   2045 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1753 hydrog ? ? A  C   1733 O2    ? ? ? 1_555 A  G   2044 N2    ? ? 0 C   1734 0 G   2045 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1754 hydrog ? ? A  C   1734 N3    ? ? ? 1_555 A  G   2043 N1    ? ? 0 C   1735 0 G   2044 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1755 hydrog ? ? A  C   1734 N4    ? ? ? 1_555 A  G   2043 O6    ? ? 0 C   1735 0 G   2044 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1756 hydrog ? ? A  C   1734 O2    ? ? ? 1_555 A  G   2043 N2    ? ? 0 C   1735 0 G   2044 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1757 hydrog ? ? A  A   1735 N1    ? ? ? 1_555 A  U   2042 N3    ? ? 0 A   1736 0 U   2043 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1758 hydrog ? ? A  A   1735 N6    ? ? ? 1_555 A  U   2042 O4    ? ? 0 A   1736 0 U   2043 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1759 hydrog ? ? A  A   1736 N1    ? ? ? 1_555 A  U   2041 N3    ? ? 0 A   1737 0 U   2042 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1760 hydrog ? ? A  A   1736 N6    ? ? ? 1_555 A  U   2041 O4    ? ? 0 A   1737 0 U   2042 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1761 hydrog ? ? A  C   1737 N3    ? ? ? 1_555 A  G   2040 N1    ? ? 0 C   1738 0 G   2041 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1762 hydrog ? ? A  C   1737 N4    ? ? ? 1_555 A  G   2040 O6    ? ? 0 C   1738 0 G   2041 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1763 hydrog ? ? A  C   1737 O2    ? ? ? 1_555 A  G   2040 N2    ? ? 0 C   1738 0 G   2041 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1764 hydrog ? ? A  G   1738 N1    ? ? ? 1_555 A  C   2039 N3    ? ? 0 G   1739 0 C   2040 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1765 hydrog ? ? A  G   1738 N2    ? ? ? 1_555 A  C   2039 O2    ? ? 0 G   1739 0 C   2040 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1766 hydrog ? ? A  G   1738 O6    ? ? ? 1_555 A  C   2039 N4    ? ? 0 G   1739 0 C   2040 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1767 hydrog ? ? A  U   1739 N3    ? ? ? 1_555 A  A   2038 N1    ? ? 0 U   1740 0 A   2039 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1768 hydrog ? ? A  U   1739 O4    ? ? ? 1_555 A  A   2038 N6    ? ? 0 U   1740 0 A   2039 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1769 hydrog ? ? A  U   1740 N3    ? ? ? 1_555 A  A   2037 N1    ? ? 0 U   1741 0 A   2038 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1770 hydrog ? ? A  U   1740 O4    ? ? ? 1_555 A  A   2037 N6    ? ? 0 U   1741 0 A   2038 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1771 hydrog ? ? A  A   1741 N6    ? ? ? 1_555 A  G   2032 O6    ? ? 0 A   1742 0 G   2033 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1772 hydrog ? ? A  A   1741 N1    ? ? ? 1_555 A  C   2036 N4    ? ? 0 A   1742 0 C   2037 1_555 ? ? ? ? ? ? TYPE_26_PAIR ? ? 
hydrog1773 hydrog ? ? A  A   1741 N6    ? ? ? 1_555 A  C   2036 N3    ? ? 0 A   1742 0 C   2037 1_555 ? ? ? ? ? ? TYPE_26_PAIR ? ? 
hydrog1774 hydrog ? ? A  G   1742 N1    ? ? ? 1_555 A  C   2035 N3    ? ? 0 G   1743 0 C   2036 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1775 hydrog ? ? A  G   1742 N2    ? ? ? 1_555 A  C   2035 O2    ? ? 0 G   1743 0 C   2036 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1776 hydrog ? ? A  G   1742 O6    ? ? ? 1_555 A  C   2035 N4    ? ? 0 G   1743 0 C   2036 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1777 hydrog ? ? A  G   1743 N1    ? ? ? 1_555 A  C   2034 N3    ? ? 0 G   1744 0 C   2035 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1778 hydrog ? ? A  G   1743 N2    ? ? ? 1_555 A  C   2034 O2    ? ? 0 G   1744 0 C   2035 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1779 hydrog ? ? A  G   1743 O6    ? ? ? 1_555 A  C   2034 N4    ? ? 0 G   1744 0 C   2035 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1780 hydrog ? ? A  G   1744 N2    ? ? ? 1_555 A  U   2033 O4    ? ? 0 G   1745 0 U   2034 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1781 hydrog ? ? A  A   1745 N6    ? ? ? 1_555 A  U   2031 O2    ? ? 0 A   1746 0 U   2032 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1782 hydrog ? ? A  A   1745 N7    ? ? ? 1_555 A  U   2031 N3    ? ? 0 A   1746 0 U   2032 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1783 hydrog ? ? A  A   1746 N1    ? ? ? 1_555 A  U   2033 N3    ? ? 0 A   1747 0 U   2034 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1784 hydrog ? ? A  A   1746 N6    ? ? ? 1_555 A  U   2033 O4    ? ? 0 A   1747 0 U   2034 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1785 hydrog ? ? A  G   1751 N1    ? ? ? 1_555 A  C   2030 N3    ? ? 0 G   1752 0 C   2031 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1786 hydrog ? ? A  G   1751 N2    ? ? ? 1_555 A  C   2030 O2    ? ? 0 G   1752 0 C   2031 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1787 hydrog ? ? A  G   1751 O6    ? ? ? 1_555 A  C   2030 N4    ? ? 0 G   1752 0 C   2031 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1788 hydrog ? ? A  G   1759 N1    ? ? ? 1_555 A  U   1783 O2    ? ? 0 G   1760 0 U   1784 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1789 hydrog ? ? A  G   1759 O6    ? ? ? 1_555 A  U   1783 N3    ? ? 0 G   1760 0 U   1784 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1790 hydrog ? ? A  U   1760 N3    ? ? ? 1_555 A  A   1782 N1    ? ? 0 U   1761 0 A   1783 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1791 hydrog ? ? A  U   1760 O4    ? ? ? 1_555 A  A   1782 N6    ? ? 0 U   1761 0 A   1783 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1792 hydrog ? ? A  C   1761 N3    ? ? ? 1_555 A  G   1781 N1    ? ? 0 C   1762 0 G   1782 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1793 hydrog ? ? A  C   1761 N4    ? ? ? 1_555 A  G   1781 O6    ? ? 0 C   1762 0 G   1782 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1794 hydrog ? ? A  C   1761 O2    ? ? ? 1_555 A  G   1781 N2    ? ? 0 C   1762 0 G   1782 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1795 hydrog ? ? A  C   1762 N3    ? ? ? 1_555 A  G   1780 N1    ? ? 0 C   1763 0 G   1781 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1796 hydrog ? ? A  C   1762 N4    ? ? ? 1_555 A  G   1780 O6    ? ? 0 C   1763 0 G   1781 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1797 hydrog ? ? A  C   1762 O2    ? ? ? 1_555 A  G   1780 N2    ? ? 0 C   1763 0 G   1781 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1798 hydrog ? ? A  C   1763 N3    ? ? ? 1_555 A  G   1779 N1    ? ? 0 C   1764 0 G   1780 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1799 hydrog ? ? A  C   1763 N4    ? ? ? 1_555 A  G   1779 O6    ? ? 0 C   1764 0 G   1780 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1800 hydrog ? ? A  C   1763 O2    ? ? ? 1_555 A  G   1779 N2    ? ? 0 C   1764 0 G   1780 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1801 hydrog ? ? A  G   1764 N2    ? ? ? 1_555 A  A   1778 N7    ? ? 0 G   1765 0 A   1779 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1802 hydrog ? ? A  G   1764 N3    ? ? ? 1_555 A  A   1778 N6    ? ? 0 G   1765 0 A   1779 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1803 hydrog ? ? A  A   1766 N6    ? ? ? 1_555 A  A   1775 N7    ? ? 0 A   1767 0 A   1776 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1804 hydrog ? ? A  A   1766 N7    ? ? ? 1_555 A  A   1775 N6    ? ? 0 A   1767 0 A   1776 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1805 hydrog ? ? A  C   1767 N4    ? ? ? 1_555 A  A   1774 N3    ? ? 0 C   1768 0 A   1775 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog1806 hydrog ? ? A  C   1768 N3    ? ? ? 1_555 A  G   1773 N1    ? ? 0 C   1769 0 G   1774 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1807 hydrog ? ? A  C   1768 N4    ? ? ? 1_555 A  G   1773 O6    ? ? 0 C   1769 0 G   1774 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1808 hydrog ? ? A  C   1768 O2    ? ? ? 1_555 A  G   1773 N2    ? ? 0 C   1769 0 G   1774 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1809 hydrog ? ? A  U   1769 O2    ? ? ? 1_555 A  G   1772 N1    ? ? 0 U   1770 0 G   1773 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog1810 hydrog ? ? A  U   1770 N3    ? ? ? 1_555 A  A   1884 N1    ? ? 0 U   1771 0 A   1885 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1811 hydrog ? ? A  U   1770 O4    ? ? ? 1_555 A  A   1884 N6    ? ? 0 U   1771 0 A   1885 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1812 hydrog ? ? A  G   1784 N1    ? ? ? 1_555 A  U   1806 O2    ? ? 0 G   1785 0 U   1807 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1813 hydrog ? ? A  G   1784 O6    ? ? ? 1_555 A  U   1806 N3    ? ? 0 G   1785 0 U   1807 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1814 hydrog ? ? A  C   1785 N3    ? ? ? 1_555 A  G   1805 N1    ? ? 0 C   1786 0 G   1806 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1815 hydrog ? ? A  C   1785 N4    ? ? ? 1_555 A  G   1805 O6    ? ? 0 C   1786 0 G   1806 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1816 hydrog ? ? A  C   1785 O2    ? ? ? 1_555 A  G   1805 N2    ? ? 0 C   1786 0 G   1806 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1817 hydrog ? ? A  C   1786 N3    ? ? ? 1_555 A  G   1804 N1    ? ? 0 C   1787 0 G   1805 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1818 hydrog ? ? A  C   1786 N4    ? ? ? 1_555 A  G   1804 O6    ? ? 0 C   1787 0 G   1805 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1819 hydrog ? ? A  C   1786 O2    ? ? ? 1_555 A  G   1804 N2    ? ? 0 C   1787 0 G   1805 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1820 hydrog ? ? A  U   1787 N3    ? ? ? 1_555 A  A   1803 N1    ? ? 0 U   1788 0 A   1804 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1821 hydrog ? ? A  U   1787 O4    ? ? ? 1_555 A  A   1803 N6    ? ? 0 U   1788 0 A   1804 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1822 hydrog ? ? A  G   1788 N1    ? ? ? 1_555 A  C   1802 N3    ? ? 0 G   1789 0 C   1803 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1823 hydrog ? ? A  G   1788 N2    ? ? ? 1_555 A  C   1802 O2    ? ? 0 G   1789 0 C   1803 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1824 hydrog ? ? A  G   1788 O6    ? ? ? 1_555 A  C   1802 N4    ? ? 0 G   1789 0 C   1803 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1825 hydrog ? ? A  C   1789 N3    ? ? ? 1_555 A  G   1801 N1    ? ? 0 C   1790 0 G   1802 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1826 hydrog ? ? A  C   1789 N4    ? ? ? 1_555 A  G   1801 O6    ? ? 0 C   1790 0 G   1802 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1827 hydrog ? ? A  C   1789 O2    ? ? ? 1_555 A  G   1801 N2    ? ? 0 C   1790 0 G   1802 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1828 hydrog ? ? A  U   1790 N3    ? ? ? 1_555 A  A   1800 N1    ? ? 0 U   1791 0 A   1801 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1829 hydrog ? ? A  U   1790 O4    ? ? ? 1_555 A  A   1800 N6    ? ? 0 U   1791 0 A   1801 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1830 hydrog ? ? A  C   1791 N3    ? ? ? 1_555 A  G   1799 N1    ? ? 0 C   1792 0 G   1800 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1831 hydrog ? ? A  C   1791 N4    ? ? ? 1_555 A  G   1799 O6    ? ? 0 C   1792 0 G   1800 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1832 hydrog ? ? A  C   1791 O2    ? ? ? 1_555 A  G   1799 N2    ? ? 0 C   1792 0 G   1800 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1833 hydrog ? ? A  C   1792 N3    ? ? ? 1_555 A  G   1798 N1    ? ? 0 C   1793 0 G   1799 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1834 hydrog ? ? A  C   1792 N4    ? ? ? 1_555 A  G   1798 O6    ? ? 0 C   1793 0 G   1799 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1835 hydrog ? ? A  C   1792 O2    ? ? ? 1_555 A  G   1798 N2    ? ? 0 C   1793 0 G   1799 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1836 hydrog ? ? A  G   1793 N2    ? ? ? 1_555 A  A   1796 N7    ? ? 0 G   1794 0 A   1797 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1837 hydrog ? ? A  G   1805 N2    ? ? ? 1_555 A  A   2882 N3    ? ? 0 G   1806 0 A   2883 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1838 hydrog ? ? A  C   1807 N3    ? ? ? 1_555 A  G   1811 N1    ? ? 0 C   1808 0 G   1812 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1839 hydrog ? ? A  C   1807 N4    ? ? ? 1_555 A  G   1811 O6    ? ? 0 C   1808 0 G   1812 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1840 hydrog ? ? A  C   1807 O2    ? ? ? 1_555 A  G   1811 N2    ? ? 0 C   1808 0 G   1812 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1841 hydrog ? ? A  C   1809 N4    ? ? ? 1_555 A  C   2751 O2    ? ? 0 C   1810 0 C   2752 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1842 hydrog ? ? A  A   1810 N1    ? ? ? 1_555 A  G   2730 N2    ? ? 0 A   1811 0 G   2731 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1843 hydrog ? ? A  U   1812 O2    ? ? ? 1_555 A  U   1816 N3    ? ? 0 U   1813 0 U   1817 1_555 ? ? ? ? ? ? 'U-U MISPAIR' ? 
? 
hydrog1844 hydrog ? ? A  U   1812 N3    ? ? ? 1_555 A  C   1817 O2    ? ? 0 U   1813 0 C   1818 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog1845 hydrog ? ? A  G   1819 N1    ? ? ? 1_555 A  C   2028 N3    ? ? 0 G   1820 0 C   2029 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1846 hydrog ? ? A  G   1819 N2    ? ? ? 1_555 A  C   2028 O2    ? ? 0 G   1820 0 C   2029 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1847 hydrog ? ? A  G   1819 O6    ? ? ? 1_555 A  C   2028 N4    ? ? 0 G   1820 0 C   2029 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1848 hydrog ? ? A  A   1820 N1    ? ? ? 1_555 A  U   2027 N3    ? ? 0 A   1821 0 U   2028 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1849 hydrog ? ? A  A   1820 N6    ? ? ? 1_555 A  U   2027 O4    ? ? 0 A   1821 0 U   2028 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1850 hydrog ? ? A  A   1821 N1    ? ? ? 1_555 A  U   2026 N3    ? ? 0 A   1822 0 U   2027 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1851 hydrog ? ? A  A   1821 N6    ? ? ? 1_555 A  U   2026 O4    ? ? 0 A   1822 0 U   2027 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1852 hydrog ? ? A  G   1822 N1    ? ? ? 1_555 A  C   2025 N3    ? ? 0 G   1823 0 C   2026 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1853 hydrog ? ? A  G   1822 N2    ? ? ? 1_555 A  C   2025 O2    ? ? 0 G   1823 0 C   2026 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1854 hydrog ? ? A  G   1822 O6    ? ? ? 1_555 A  C   2025 N4    ? ? 0 G   1823 0 C   2026 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1855 hydrog ? ? A  C   1823 N3    ? ? ? 1_555 A  G   2024 N1    ? ? 0 C   1824 0 G   2025 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1856 hydrog ? ? A  C   1823 N4    ? ? ? 1_555 A  G   2024 O6    ? ? 0 C   1824 0 G   2025 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1857 hydrog ? ? A  C   1823 O2    ? ? ? 1_555 A  G   2024 N2    ? ? 0 C   1824 0 G   2025 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1858 hydrog ? ? A  U   1824 N3    ? ? ? 1_555 A  A   2023 N1    ? ? 0 U   1825 0 A   2024 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1859 hydrog ? ? A  U   1824 O4    ? ? ? 1_555 A  A   2023 N6    ? ? 0 U   1825 0 A   2024 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1860 hydrog ? ? A  C   1825 N3    ? ? ? 1_555 A  G   2022 N1    ? ? 0 C   1826 0 G   2023 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1861 hydrog ? ? A  C   1825 N4    ? ? ? 1_555 A  G   2022 O6    ? ? 0 C   1826 0 G   2023 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1862 hydrog ? ? A  C   1825 O2    ? ? ? 1_555 A  G   2022 N2    ? ? 0 C   1826 0 G   2023 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1863 hydrog ? ? A  G   1826 N1    ? ? ? 1_555 A  C   2020 N3    ? ? 0 G   1827 0 C   2021 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1864 hydrog ? ? A  G   1826 N2    ? ? ? 1_555 A  C   2020 O2    ? ? 0 G   1827 0 C   2021 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1865 hydrog ? ? A  G   1826 O6    ? ? ? 1_555 A  C   2020 N4    ? ? 0 G   1827 0 C   2021 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1866 hydrog ? ? A  G   1827 N1    ? ? ? 1_555 A  C   2019 N3    ? ? 0 G   1828 0 C   2020 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1867 hydrog ? ? A  G   1827 N2    ? ? ? 1_555 A  C   2019 O2    ? ? 0 G   1828 0 C   2020 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1868 hydrog ? ? A  G   1827 O6    ? ? ? 1_555 A  C   2019 N4    ? ? 0 G   1828 0 C   2020 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1869 hydrog ? ? A  A   1828 N3    ? ? ? 1_555 A  A   2017 N6    ? ? 0 A   1829 0 A   2018 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog1870 hydrog ? ? A  C   1829 N4    ? ? ? 1_555 A  U   1845 O2    ? ? 0 C   1830 0 U   1846 1_555 ? ? ? ? ? ? 'C-U MISPAIR' ? 
? 
hydrog1871 hydrog ? ? A  G   1831 N1    ? ? ? 1_555 A  C   1843 N3    ? ? 0 G   1832 0 C   1844 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1872 hydrog ? ? A  G   1831 N2    ? ? ? 1_555 A  C   1843 O2    ? ? 0 G   1832 0 C   1844 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1873 hydrog ? ? A  G   1831 O6    ? ? ? 1_555 A  C   1843 N4    ? ? 0 G   1832 0 C   1844 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1874 hydrog ? ? A  U   1832 N3    ? ? ? 1_555 A  A   1842 N1    ? ? 0 U   1833 0 A   1843 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1875 hydrog ? ? A  U   1832 O4    ? ? ? 1_555 A  A   1842 N6    ? ? 0 U   1833 0 A   1843 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1876 hydrog ? ? A  C   1833 O2    ? ? ? 1_555 A  C   1840 N4    ? ? 0 C   1834 0 C   1841 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1877 hydrog ? ? A  U   1834 O4    ? ? ? 1_555 A  C   1840 N4    ? ? 0 U   1835 0 C   1841 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog1878 hydrog ? ? A  U   1837 N3    ? ? ? 1_555 A  PSU 2620 O2    ? ? 0 U   1838 0 PSU 2621 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog1879 hydrog ? ? A  U   1837 O4    ? ? ? 1_555 A  PSU 2620 N3    ? ? 0 U   1838 0 PSU 2621 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog1880 hydrog ? ? A  A   1838 N3    ? ? ? 1_555 A  G   2641 N2    ? ? 0 A   1839 0 G   2642 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1881 hydrog ? ? A  C   1840 O2    ? ? ? 1_555 A  G   2622 N2    ? ? 0 C   1841 0 G   2623 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog1882 hydrog ? ? A  A   1846 N6    ? ? ? 1_555 A  G   1883 N3    ? ? 0 A   1847 0 G   1884 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1883 hydrog ? ? A  A   1846 N7    ? ? ? 1_555 A  G   1883 N2    ? ? 0 A   1847 0 G   1884 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1884 hydrog ? ? A  G   1847 N1    ? ? ? 1_555 A  U   1882 O2    ? ? 0 G   1848 0 U   1883 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1885 hydrog ? ? A  G   1847 O6    ? ? ? 1_555 A  U   1882 N3    ? ? 0 G   1848 0 U   1883 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1886 hydrog ? ? A  G   1848 N1    ? ? ? 1_555 A  C   1881 N3    ? ? 0 G   1849 0 C   1882 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1887 hydrog ? ? A  G   1848 N2    ? ? ? 1_555 A  C   1881 O2    ? ? 0 G   1849 0 C   1882 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1888 hydrog ? ? A  G   1848 O6    ? ? ? 1_555 A  C   1881 N4    ? ? 0 G   1849 0 C   1882 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1889 hydrog ? ? A  U   1849 N3    ? ? ? 1_555 A  A   1880 N1    ? ? 0 U   1850 0 A   1881 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1890 hydrog ? ? A  U   1849 O4    ? ? ? 1_555 A  A   1880 N6    ? ? 0 U   1850 0 A   1881 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1891 hydrog ? ? A  G   1850 N1    ? ? ? 1_555 A  C   1879 N3    ? ? 0 G   1851 0 C   1880 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1892 hydrog ? ? A  G   1850 N2    ? ? ? 1_555 A  C   1879 O2    ? ? 0 G   1851 0 C   1880 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1893 hydrog ? ? A  G   1850 O6    ? ? ? 1_555 A  C   1879 N4    ? ? 0 G   1851 0 C   1880 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1894 hydrog ? ? A  A   1851 N1    ? ? ? 1_555 A  U   1878 N3    ? ? 0 A   1852 0 U   1879 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1895 hydrog ? ? A  A   1851 N6    ? ? ? 1_555 A  U   1878 O4    ? ? 0 A   1852 0 U   1879 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1896 hydrog ? ? A  C   1852 N3    ? ? ? 1_555 A  G   1877 N1    ? ? 0 C   1853 0 G   1878 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1897 hydrog ? ? A  C   1852 N4    ? ? ? 1_555 A  G   1877 O6    ? ? 0 C   1853 0 G   1878 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1898 hydrog ? ? A  C   1852 O2    ? ? ? 1_555 A  G   1877 N2    ? ? 0 C   1853 0 G   1878 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1899 hydrog ? ? A  C   1853 N3    ? ? ? 1_555 A  G   1876 N1    ? ? 0 C   1854 0 G   1877 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1900 hydrog ? ? A  C   1853 N4    ? ? ? 1_555 A  G   1876 O6    ? ? 0 C   1854 0 G   1877 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1901 hydrog ? ? A  C   1853 O2    ? ? ? 1_555 A  G   1876 N2    ? ? 0 C   1854 0 G   1877 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1902 hydrog ? ? A  G   1854 N2    ? ? ? 1_555 A  U   1873 O2    ? ? 0 G   1855 0 U   1874 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1903 hydrog ? ? A  C   1855 N3    ? ? ? 1_555 A  G   1872 N2    ? ? 0 C   1856 0 G   1873 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog1904 hydrog ? ? A  C   1855 O2    ? ? ? 1_555 A  G   1872 N1    ? ? 0 C   1856 0 G   1873 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog1905 hydrog ? ? A  C   1855 N4    ? ? ? 1_555 A  A   1874 N7    ? ? 0 C   1856 0 A   1875 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog1906 hydrog ? ? A  A   1856 N6    ? ? ? 1_555 A  U   2245 O2    ? ? 0 A   1857 0 U   2246 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1907 hydrog ? ? A  A   1857 N6    ? ? ? 1_555 A  U   1870 O4    ? ? 0 A   1858 0 U   1871 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1908 hydrog ? ? A  A   1858 N6    ? ? ? 1_555 A  C   1869 O2    ? ? 0 A   1859 0 C   1870 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog1909 hydrog ? ? A  A   1858 N3    ? ? ? 1_555 A  G   1877 N2    ? ? 0 A   1859 0 G   1878 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1910 hydrog ? ? A  U   1859 N3    ? ? ? 1_555 A  A   1868 N1    ? ? 0 U   1860 0 A   1869 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1911 hydrog ? ? A  U   1859 O4    ? ? ? 1_555 A  A   1868 N6    ? ? 0 U   1860 0 A   1869 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1912 hydrog ? ? A  C   1860 N3    ? ? ? 1_555 A  G   1867 N1    ? ? 0 C   1861 0 G   1868 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1913 hydrog ? ? A  C   1860 N4    ? ? ? 1_555 A  G   1867 O6    ? ? 0 C   1861 0 G   1868 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1914 hydrog ? ? A  C   1860 O2    ? ? ? 1_555 A  G   1867 N2    ? ? 0 C   1861 0 G   1868 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1915 hydrog ? ? A  C   1861 N3    ? ? ? 1_555 A  G   1866 N1    ? ? 0 C   1862 0 G   1867 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1916 hydrog ? ? A  C   1861 N4    ? ? ? 1_555 A  G   1866 O6    ? ? 0 C   1862 0 G   1867 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1917 hydrog ? ? A  C   1861 O2    ? ? ? 1_555 A  G   1866 N2    ? ? 0 C   1862 0 G   1867 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1918 hydrog ? ? A  G   1862 N2    ? ? ? 1_555 A  A   1865 N7    ? ? 0 G   1863 0 A   1866 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1919 hydrog ? ? A  A   1884 N6    ? ? ? 1_555 A  U   2016 O2    ? ? 0 A   1885 0 U   2017 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1920 hydrog ? ? A  A   1885 N6    ? ? ? 1_555 A  U   2015 O2    ? ? 0 A   1886 0 U   2016 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1921 hydrog ? ? A  U   1886 N3    ? ? ? 1_555 A  A   2014 N1    ? ? 0 U   1887 0 A   2015 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1922 hydrog ? ? A  U   1886 O4    ? ? ? 1_555 A  A   2014 N6    ? ? 0 U   1887 0 A   2015 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1923 hydrog ? ? A  C   1887 N3    ? ? ? 1_555 A  G   2013 N1    ? ? 0 C   1888 0 G   2014 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1924 hydrog ? ? A  C   1887 N4    ? ? ? 1_555 A  G   2013 O6    ? ? 0 C   1888 0 G   2014 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1925 hydrog ? ? A  C   1887 O2    ? ? ? 1_555 A  G   2013 N2    ? ? 0 C   1888 0 G   2014 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1926 hydrog ? ? A  C   1888 N3    ? ? ? 1_555 A  G   2012 N1    ? ? 0 C   1889 0 G   2013 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1927 hydrog ? ? A  C   1888 N4    ? ? ? 1_555 A  G   2012 O6    ? ? 0 C   1889 0 G   2013 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1928 hydrog ? ? A  C   1888 O2    ? ? ? 1_555 A  G   2012 N2    ? ? 0 C   1889 0 G   2013 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1929 hydrog ? ? A  U   1889 O4    ? ? ? 1_555 A  A   1940 N6    ? ? 0 U   1890 0 A   1941 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog1930 hydrog ? ? A  U   1889 N3    ? ? ? 1_555 A  A   2010 N7    ? ? 0 U   1890 0 A   2011 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog1931 hydrog ? ? A  U   1889 O4    ? ? ? 1_555 A  A   2010 N6    ? ? 0 U   1890 0 A   2011 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog1932 hydrog ? ? A  G   1890 N1    ? ? ? 1_555 A  C   1945 N3    ? ? 0 G   1891 0 C   1946 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1933 hydrog ? ? A  G   1890 N2    ? ? ? 1_555 A  C   1945 O2    ? ? 0 G   1891 0 C   1946 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1934 hydrog ? ? A  G   1890 O6    ? ? ? 1_555 A  C   1945 N4    ? ? 0 G   1891 0 C   1946 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1935 hydrog ? ? A  C   1891 N3    ? ? ? 1_555 A  G   1944 N1    ? ? 0 C   1892 0 G   1945 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1936 hydrog ? ? A  C   1891 N4    ? ? ? 1_555 A  G   1944 O6    ? ? 0 C   1892 0 G   1945 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1937 hydrog ? ? A  C   1891 O2    ? ? ? 1_555 A  G   1944 N2    ? ? 0 C   1892 0 G   1945 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1938 hydrog ? ? A  C   1892 N3    ? ? ? 1_555 A  G   1943 N1    ? ? 0 C   1893 0 G   1944 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1939 hydrog ? ? A  C   1892 N4    ? ? ? 1_555 A  G   1943 O6    ? ? 0 C   1893 0 G   1944 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1940 hydrog ? ? A  C   1892 O2    ? ? ? 1_555 A  G   1943 N2    ? ? 0 C   1893 0 G   1944 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1941 hydrog ? ? A  C   1893 N3    ? ? ? 1_555 A  A   1941 N6    ? ? 0 C   1894 0 A   1942 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1942 hydrog ? ? A  C   1893 N4    ? ? ? 1_555 A  A   1941 N7    ? ? 0 C   1894 0 A   1942 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1943 hydrog ? ? A  G   1895 N1    ? ? ? 1_555 A  C   1942 N3    ? ? 0 G   1896 0 C   1943 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1944 hydrog ? ? A  G   1895 N2    ? ? ? 1_555 A  C   1942 O2    ? ? 0 G   1896 0 C   1943 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1945 hydrog ? ? A  G   1895 O6    ? ? ? 1_555 A  C   1942 N4    ? ? 0 G   1896 0 C   1943 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1946 hydrog ? ? A  U   1896 N3    ? ? ? 1_555 A  A   1941 N1    ? ? 0 U   1897 0 A   1942 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1947 hydrog ? ? A  U   1896 O4    ? ? ? 1_555 A  A   1941 N6    ? ? 0 U   1897 0 A   1942 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1948 hydrog ? ? A  G   1897 N1    ? ? ? 1_555 A  U   1938 O2    ? ? 0 G   1898 0 U   1939 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1949 hydrog ? ? A  G   1897 O6    ? ? ? 1_555 A  U   1938 N3    ? ? 0 G   1898 0 U   1939 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1950 hydrog ? ? A  C   1898 N3    ? ? ? 1_555 A  G   1937 N1    ? ? 0 C   1899 0 G   1938 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1951 hydrog ? ? A  C   1898 N4    ? ? ? 1_555 A  G   1937 O6    ? ? 0 C   1899 0 G   1938 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1952 hydrog ? ? A  C   1898 O2    ? ? ? 1_555 A  G   1937 N2    ? ? 0 C   1899 0 G   1938 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1953 hydrog ? ? A  A   1899 N1    ? ? ? 1_555 A  U   1936 N3    ? ? 0 A   1900 0 U   1937 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1954 hydrog ? ? A  A   1899 N6    ? ? ? 1_555 A  U   1936 O4    ? ? 0 A   1900 0 U   1937 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1955 hydrog ? ? A  G   1900 N1    ? ? ? 1_555 A  C   1935 N3    ? ? 0 G   1901 0 C   1936 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1956 hydrog ? ? A  G   1900 N2    ? ? ? 1_555 A  C   1935 O2    ? ? 0 G   1901 0 C   1936 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1957 hydrog ? ? A  G   1900 O6    ? ? ? 1_555 A  C   1935 N4    ? ? 0 G   1901 0 C   1936 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1958 hydrog ? ? A  G   1901 N1    ? ? ? 1_555 A  C   1934 N3    ? ? 0 G   1902 0 C   1935 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1959 hydrog ? ? A  G   1901 N2    ? ? ? 1_555 A  C   1934 O2    ? ? 0 G   1902 0 C   1935 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1960 hydrog ? ? A  G   1901 O6    ? ? ? 1_555 A  C   1934 N4    ? ? 0 G   1902 0 C   1935 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1961 hydrog ? ? A  U   1902 O2    ? ? ? 1_555 A  A   1933 N6    ? ? 0 U   1903 0 A   1934 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog1962 hydrog ? ? A  U   1904 N3    ? ? ? 1_555 A  A   1933 N1    ? ? 0 U   1905 0 A   1934 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1963 hydrog ? ? A  U   1904 O4    ? ? ? 1_555 A  A   1933 N6    ? ? 0 U   1905 0 A   1934 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1964 hydrog ? ? A  C   1905 N3    ? ? ? 1_555 A  G   1932 N1    ? ? 0 C   1906 0 G   1933 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1965 hydrog ? ? A  C   1905 N4    ? ? ? 1_555 A  G   1932 O6    ? ? 0 C   1906 0 G   1933 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1966 hydrog ? ? A  C   1905 O2    ? ? ? 1_555 A  G   1932 N2    ? ? 0 C   1906 0 G   1933 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1967 hydrog ? ? A  U   1906 N3    ? ? ? 1_555 A  G   1931 O6    ? ? 0 U   1907 0 G   1932 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1968 hydrog ? ? A  U   1906 O2    ? ? ? 1_555 A  G   1931 N1    ? ? 0 U   1907 0 G   1932 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1969 hydrog ? ? A  G   1907 N2    ? ? ? 1_555 A  A   1930 N7    ? ? 0 G   1908 0 A   1931 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1970 hydrog ? ? A  G   1907 N3    ? ? ? 1_555 A  A   1930 N6    ? ? 0 G   1908 0 A   1931 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1971 hydrog ? ? A  A   1909 N3    ? ? ? 1_555 A  G   2127 N2    ? ? 0 A   1910 0 G   2128 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1972 hydrog ? ? A  A   1911 N6    ? ? ? 1_555 A  A   1926 N1    ? ? 0 A   1912 0 A   1927 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog1973 hydrog ? ? A  C   1912 N3    ? ? ? 1_555 A  G   1925 N1    ? ? 0 C   1913 0 G   1926 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1974 hydrog ? ? A  C   1912 N4    ? ? ? 1_555 A  G   1925 O6    ? ? 0 C   1913 0 G   1926 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1975 hydrog ? ? A  C   1912 O2    ? ? ? 1_555 A  G   1925 N2    ? ? 0 C   1913 0 G   1926 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1976 hydrog ? ? A  C   1913 N3    ? ? ? 1_555 A  G   1924 N1    ? ? 0 C   1914 0 G   1925 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1977 hydrog ? ? A  C   1913 N4    ? ? ? 1_555 A  G   1924 O6    ? ? 0 C   1914 0 G   1925 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1978 hydrog ? ? A  C   1913 O2    ? ? ? 1_555 A  G   1924 N2    ? ? 0 C   1914 0 G   1925 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1979 hydrog ? ? A  U   1914 N3    ? ? ? 1_555 A  A   1923 N1    ? ? 0 U   1915 0 A   1924 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1980 hydrog ? ? A  U   1914 O4    ? ? ? 1_555 A  A   1923 N6    ? ? 0 U   1915 0 A   1924 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1981 hydrog ? ? A  C   1915 N3    ? ? ? 1_555 A  G   1922 N1    ? ? 0 C   1916 0 G   1923 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1982 hydrog ? ? A  C   1915 N4    ? ? ? 1_555 A  G   1922 O6    ? ? 0 C   1916 0 G   1923 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1983 hydrog ? ? A  C   1915 O2    ? ? ? 1_555 A  G   1922 N2    ? ? 0 C   1916 0 G   1923 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1984 hydrog ? ? A  G   1916 N2    ? ? ? 1_555 A  A   1921 N7    ? ? 0 G   1917 0 A   1922 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1985 hydrog ? ? A  A   1920 N1    ? ? ? 1_555 A  G   2448 N2    ? ? 0 A   1921 0 G   2449 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog1986 hydrog ? ? A  A   1920 N6    ? ? ? 1_555 A  G   2448 N3    ? ? 0 A   1921 0 G   2449 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog1987 hydrog ? ? A  A   1930 N3    ? ? ? 1_555 A  G   2266 N2    ? ? 0 A   1931 0 G   2267 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1988 hydrog ? ? A  C   1939 O2    ? ? ? 1_555 A  C   1942 N4    ? ? 0 C   1940 0 C   1943 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1989 hydrog ? ? A  G   1944 N2    ? ? ? 1_555 A  A   1968 N3    ? ? 0 G   1945 0 A   1969 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1990 hydrog ? ? A  G   1946 N1    ? ? ? 1_555 A  C   1964 N3    ? ? 0 G   1947 0 C   1965 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1991 hydrog ? ? A  G   1946 N2    ? ? ? 1_555 A  C   1964 O2    ? ? 0 G   1947 0 C   1965 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1992 hydrog ? ? A  G   1946 O6    ? ? ? 1_555 A  C   1964 N4    ? ? 0 G   1947 0 C   1965 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1993 hydrog ? ? A  G   1947 N1    ? ? ? 1_555 A  U   1963 O2    ? ? 0 G   1948 0 U   1964 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1994 hydrog ? ? A  G   1947 O6    ? ? ? 1_555 A  U   1963 N3    ? ? 0 G   1948 0 U   1964 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1995 hydrog ? ? A  U   1965 N3    ? ? ? 1_555 A  G   1969 O6    ? ? 0 U   1966 0 G   1970 1_555 ? ? ? ? ? ? TYPE_27_PAIR ? ? 
hydrog1996 hydrog ? ? A  U   1965 O4    ? ? ? 1_555 A  G   1969 N1    ? ? 0 U   1966 0 G   1970 1_555 ? ? ? ? ? ? TYPE_27_PAIR ? ? 
hydrog1997 hydrog ? ? A  G   1970 N2    ? ? ? 1_555 A  U   1971 O4    ? ? 0 G   1971 0 U   1972 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1998 hydrog ? ? A  U   1971 N3    ? ? ? 1_555 A  A   2009 N7    ? ? 0 U   1972 0 A   2010 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog1999 hydrog ? ? A  A   1972 N6    ? ? ? 1_555 A  G   2008 N3    ? ? 0 A   1973 0 G   2009 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2000 hydrog ? ? A  A   1972 N7    ? ? ? 1_555 A  G   2008 N2    ? ? 0 A   1973 0 G   2009 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2001 hydrog ? ? A  G   1973 N1    ? ? ? 1_555 A  U   2007 O2    ? ? 0 G   1974 0 U   2008 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2002 hydrog ? ? A  G   1973 O6    ? ? ? 1_555 A  U   2007 N3    ? ? 0 G   1974 0 U   2008 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2003 hydrog ? ? A  C   1974 N3    ? ? ? 1_555 A  G   2004 N1    ? ? 0 C   1975 0 G   2005 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2004 hydrog ? ? A  C   1974 N4    ? ? ? 1_555 A  G   2004 O6    ? ? 0 C   1975 0 G   2005 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2005 hydrog ? ? A  C   1974 O2    ? ? ? 1_555 A  G   2004 N2    ? ? 0 C   1975 0 G   2005 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2006 hydrog ? ? A  U   1976 N3    ? ? ? 1_555 A  U   1983 O4    ? ? 0 U   1977 0 U   1984 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2007 hydrog ? ? A  U   1976 O2    ? ? ? 1_555 A  U   1983 N3    ? ? 0 U   1977 0 U   1984 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2008 hydrog ? ? A  A   1977 N1    ? ? ? 1_555 A  G   2004 N2    ? ? 0 A   1978 0 G   2005 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2009 hydrog ? ? A  G   1978 N2    ? ? ? 1_555 A  U   2639 O2    ? ? 0 G   1979 0 U   2640 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2010 hydrog ? ? A  A   1980 N3    ? ? ? 1_555 A  C   1982 N4    ? ? 0 A   1981 0 C   1983 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog2011 hydrog ? ? A  G   1985 N1    ? ? ? 1_555 A  C   2001 N3    ? ? 0 G   1986 0 C   2002 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2012 hydrog ? ? A  G   1985 N2    ? ? ? 1_555 A  C   2001 O2    ? ? 0 G   1986 0 C   2002 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2013 hydrog ? ? A  G   1985 O6    ? ? ? 1_555 A  C   2001 N4    ? ? 0 G   1986 0 C   2002 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2014 hydrog ? ? A  C   1986 N3    ? ? ? 1_555 A  G   2000 N1    ? ? 0 C   1987 0 G   2001 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2015 hydrog ? ? A  C   1986 N4    ? ? ? 1_555 A  G   2000 O6    ? ? 0 C   1987 0 G   2001 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2016 hydrog ? ? A  C   1986 O2    ? ? ? 1_555 A  G   2000 N2    ? ? 0 C   1987 0 G   2001 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2017 hydrog ? ? A  C   1987 N3    ? ? ? 1_555 A  G   1999 N1    ? ? 0 C   1988 0 G   2000 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2018 hydrog ? ? A  C   1987 N4    ? ? ? 1_555 A  G   1999 O6    ? ? 0 C   1988 0 G   2000 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2019 hydrog ? ? A  C   1987 O2    ? ? ? 1_555 A  G   1999 N2    ? ? 0 C   1988 0 G   2000 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2020 hydrog ? ? A  G   1988 N1    ? ? ? 1_555 A  C   1998 N3    ? ? 0 G   1989 0 C   1999 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2021 hydrog ? ? A  G   1988 N2    ? ? ? 1_555 A  C   1998 O2    ? ? 0 G   1989 0 C   1999 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2022 hydrog ? ? A  G   1988 O6    ? ? ? 1_555 A  C   1998 N4    ? ? 0 G   1989 0 C   1999 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2023 hydrog ? ? A  C   1989 N3    ? ? ? 1_555 A  G   1997 N1    ? ? 0 C   1990 0 G   1998 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2024 hydrog ? ? A  C   1989 N4    ? ? ? 1_555 A  G   1997 O6    ? ? 0 C   1990 0 G   1998 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2025 hydrog ? ? A  C   1989 O2    ? ? ? 1_555 A  G   1997 N2    ? ? 0 C   1990 0 G   1998 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2026 hydrog ? ? A  A   1993 N3    ? ? ? 1_555 A  G   2583 N2    ? ? 0 A   1994 0 G   2584 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2027 hydrog ? ? A  U   1995 O4    ? ? ? 1_555 A  C   2590 N4    ? ? 0 U   1996 0 C   2591 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog2028 hydrog ? ? A  A   2006 N1    ? ? ? 1_555 A  G   2626 N2    ? ? 0 A   2007 0 G   2627 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2029 hydrog ? ? A  A   2009 N3    ? ? ? 1_555 A  G   2012 N2    ? ? 0 A   2010 0 G   2013 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2030 hydrog ? ? A  G   2032 N1    ? ? ? 1_555 A  C   2036 O2    ? ? 0 G   2033 0 C   2037 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog2031 hydrog ? ? A  G   2040 N2    ? ? ? 1_555 A  U   2725 O4    ? ? 0 G   2041 0 U   2726 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2032 hydrog ? ? A  A   2053 N1    ? ? ? 1_555 A  U   2647 N3    ? ? 0 A   2054 0 U   2648 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2033 hydrog ? ? A  A   2053 N6    ? ? ? 1_555 A  U   2647 O2    ? ? 0 A   2054 0 U   2648 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2034 hydrog ? ? A  A   2059 N1    ? ? ? 1_555 A  U   2075 N3    ? ? 0 A   2060 0 U   2076 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2035 hydrog ? ? A  A   2059 N6    ? ? ? 1_555 A  U   2075 O4    ? ? 0 A   2060 0 U   2076 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2036 hydrog ? ? A  C   2060 N3    ? ? ? 1_555 A  G   2074 N1    ? ? 0 C   2061 0 G   2075 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2037 hydrog ? ? A  C   2060 N4    ? ? ? 1_555 A  G   2074 O6    ? ? 0 C   2061 0 G   2075 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2038 hydrog ? ? A  C   2060 O2    ? ? ? 1_555 A  G   2074 N2    ? ? 0 C   2061 0 G   2075 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2039 hydrog ? ? A  U   2062 N3    ? ? ? 1_555 A  A   2082 N3    ? ? 0 U   2063 0 A   2083 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2040 hydrog ? ? A  U   2063 N3    ? ? ? 1_555 A  A   2080 N1    ? ? 0 U   2064 0 A   2081 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2041 hydrog ? ? A  U   2063 O4    ? ? ? 1_555 A  A   2080 N6    ? ? 0 U   2064 0 A   2081 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2042 hydrog ? ? A  C   2064 N3    ? ? ? 1_555 A  G   2079 N1    ? ? 0 C   2065 0 G   2080 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2043 hydrog ? ? A  C   2064 N4    ? ? ? 1_555 A  G   2079 O6    ? ? 0 C   2065 0 G   2080 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2044 hydrog ? ? A  C   2064 O2    ? ? ? 1_555 A  G   2079 N2    ? ? 0 C   2065 0 G   2080 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2045 hydrog ? ? A  C   2065 N3    ? ? ? 1_555 A  G   2078 N1    ? ? 0 C   2066 0 G   2079 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2046 hydrog ? ? A  C   2065 N4    ? ? ? 1_555 A  G   2078 O6    ? ? 0 C   2066 0 G   2079 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2047 hydrog ? ? A  C   2065 O2    ? ? ? 1_555 A  G   2078 N2    ? ? 0 C   2066 0 G   2079 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2048 hydrog ? ? A  A   2066 N1    ? ? ? 1_555 A  U   2077 N3    ? ? 0 A   2067 0 U   2078 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2049 hydrog ? ? A  A   2066 N6    ? ? ? 1_555 A  U   2077 O4    ? ? 0 A   2067 0 U   2078 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2050 hydrog ? ? A  G   2067 N1    ? ? ? 1_555 A  C   2076 N3    ? ? 0 G   2068 0 C   2077 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2051 hydrog ? ? A  G   2067 N2    ? ? ? 1_555 A  C   2076 O2    ? ? 0 G   2068 0 C   2077 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2052 hydrog ? ? A  G   2067 O6    ? ? ? 1_555 A  C   2076 N4    ? ? 0 G   2068 0 C   2077 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2053 hydrog ? ? A  U   2068 N3    ? ? ? 1_555 A  A   2073 N7    ? ? 0 U   2069 0 A   2074 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2054 hydrog ? ? A  U   2068 O2    ? ? ? 1_555 A  A   2073 N6    ? ? 0 U   2069 0 A   2074 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2055 hydrog ? ? A  G   2071 N2    ? ? ? 1_555 A  A   2489 N3    ? ? 0 G   2072 0 A   2490 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2056 hydrog ? ? A  C   2083 N3    ? ? ? 1_555 A  G   2659 N1    ? ? 0 C   2084 0 G   2660 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2057 hydrog ? ? A  C   2083 N4    ? ? ? 1_555 A  G   2659 O6    ? ? 0 C   2084 0 G   2660 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2058 hydrog ? ? A  C   2083 O2    ? ? ? 1_555 A  G   2659 N2    ? ? 0 C   2084 0 G   2660 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2059 hydrog ? ? A  A   2084 N1    ? ? ? 1_555 A  U   2658 N3    ? ? 0 A   2085 0 U   2659 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2060 hydrog ? ? A  A   2084 N6    ? ? ? 1_555 A  U   2658 O4    ? ? 0 A   2085 0 U   2659 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2061 hydrog ? ? A  C   2085 N3    ? ? ? 1_555 A  G   2657 N1    ? ? 0 C   2086 0 G   2658 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2062 hydrog ? ? A  C   2085 N4    ? ? ? 1_555 A  G   2657 O6    ? ? 0 C   2086 0 G   2658 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2063 hydrog ? ? A  C   2085 O2    ? ? ? 1_555 A  G   2657 N2    ? ? 0 C   2086 0 G   2658 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2064 hydrog ? ? A  C   2086 N3    ? ? ? 1_555 A  G   2656 N1    ? ? 0 C   2087 0 G   2657 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2065 hydrog ? ? A  C   2086 N4    ? ? ? 1_555 A  G   2656 O6    ? ? 0 C   2087 0 G   2657 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2066 hydrog ? ? A  C   2086 O2    ? ? ? 1_555 A  G   2656 N2    ? ? 0 C   2087 0 G   2657 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2067 hydrog ? ? A  C   2087 N3    ? ? ? 1_555 A  G   2655 N1    ? ? 0 C   2088 0 G   2656 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2068 hydrog ? ? A  C   2087 N4    ? ? ? 1_555 A  G   2655 O6    ? ? 0 C   2088 0 G   2656 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2069 hydrog ? ? A  C   2087 O2    ? ? ? 1_555 A  G   2655 N2    ? ? 0 C   2088 0 G   2656 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2070 hydrog ? ? A  C   2087 O2    ? ? ? 1_555 A  A   2839 N6    ? ? 0 C   2088 0 A   2840 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2071 hydrog ? ? A  A   2088 N1    ? ? ? 1_555 A  U   2654 N3    ? ? 0 A   2089 0 U   2655 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2072 hydrog ? ? A  A   2088 N6    ? ? ? 1_555 A  U   2654 O4    ? ? 0 A   2089 0 U   2655 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2073 hydrog ? ? A  G   2089 N1    ? ? ? 1_555 A  C   2653 N3    ? ? 0 G   2090 0 C   2654 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2074 hydrog ? ? A  G   2089 N2    ? ? ? 1_555 A  C   2653 O2    ? ? 0 G   2090 0 C   2654 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2075 hydrog ? ? A  G   2089 O6    ? ? ? 1_555 A  C   2653 N4    ? ? 0 G   2090 0 C   2654 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2076 hydrog ? ? A  G   2090 N1    ? ? ? 1_555 A  A   2652 N1    ? ? 0 G   2091 0 A   2653 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2077 hydrog ? ? A  G   2090 O6    ? ? ? 1_555 A  A   2652 N6    ? ? 0 G   2091 0 A   2653 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2078 hydrog ? ? A  G   2091 N2    ? ? ? 1_555 A  G   2092 O6    ? ? 0 G   2092 0 G   2093 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog2079 hydrog ? ? A  G   2091 N2    ? ? ? 1_555 A  U   2651 O4    ? ? 0 G   2092 0 U   2652 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2080 hydrog ? ? A  G   2092 N1    ? ? ? 1_555 A  U   2651 O2    ? ? 0 G   2093 0 U   2652 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2081 hydrog ? ? A  G   2092 O6    ? ? ? 1_555 A  U   2651 N3    ? ? 0 G   2093 0 U   2652 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2082 hydrog ? ? A  G   2093 N1    ? ? ? 1_555 A  C   2650 N3    ? ? 0 G   2094 0 C   2651 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2083 hydrog ? ? A  G   2093 N2    ? ? ? 1_555 A  C   2650 O2    ? ? 0 G   2094 0 C   2651 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2084 hydrog ? ? A  G   2093 O6    ? ? ? 1_555 A  C   2650 N4    ? ? 0 G   2094 0 C   2651 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2085 hydrog ? ? A  A   2094 N6    ? ? ? 1_555 A  A   2611 N1    ? ? 0 A   2095 0 A   2612 1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog2086 hydrog ? ? A  A   2094 N7    ? ? ? 1_555 A  A   2611 N6    ? ? 0 A   2095 0 A   2612 1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog2087 hydrog ? ? A  A   2094 N1    ? ? ? 1_555 A  U   2649 N3    ? ? 0 A   2095 0 U   2650 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2088 hydrog ? ? A  A   2094 N6    ? ? ? 1_555 A  U   2649 O4    ? ? 0 A   2095 0 U   2650 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2089 hydrog ? ? A  G   2096 N1    ? ? ? 1_555 A  C   2646 N3    ? ? 0 G   2097 0 C   2647 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2090 hydrog ? ? A  G   2096 N2    ? ? ? 1_555 A  C   2646 O2    ? ? 0 G   2097 0 C   2647 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2091 hydrog ? ? A  G   2096 O6    ? ? ? 1_555 A  C   2646 N4    ? ? 0 G   2097 0 C   2647 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2092 hydrog ? ? A  C   2097 N3    ? ? ? 1_555 A  G   2645 N1    ? ? 0 C   2098 0 G   2646 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2093 hydrog ? ? A  C   2097 N4    ? ? ? 1_555 A  G   2645 O6    ? ? 0 C   2098 0 G   2646 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2094 hydrog ? ? A  C   2097 O2    ? ? ? 1_555 A  G   2645 N2    ? ? 0 C   2098 0 G   2646 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2095 hydrog ? ? A  G   2101 N1    ? ? ? 1_555 A  A   2485 N1    ? ? 0 G   2102 0 A   2486 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2096 hydrog ? ? A  G   2101 O6    ? ? ? 1_555 A  A   2485 N6    ? ? 0 G   2102 0 A   2486 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2097 hydrog ? ? A  A   2102 N6    ? ? ? 1_555 A  A   2537 N7    ? ? 0 A   2103 0 A   2538 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2098 hydrog ? ? A  A   2102 N7    ? ? ? 1_555 A  A   2537 N6    ? ? 0 A   2103 0 A   2538 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2099 hydrog ? ? A  C   2103 N3    ? ? ? 1_555 A  A   2484 N6    ? ? 0 C   2104 0 A   2485 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2100 hydrog ? ? A  C   2103 N4    ? ? ? 1_555 A  C   2535 O2    ? ? 0 C   2104 0 C   2536 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog2101 hydrog ? ? A  C   2104 N3    ? ? ? 1_555 A  G   2480 N1    ? ? 0 C   2105 0 G   2481 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2102 hydrog ? ? A  C   2104 N4    ? ? ? 1_555 A  G   2480 O6    ? ? 0 C   2105 0 G   2481 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2103 hydrog ? ? A  C   2104 O2    ? ? ? 1_555 A  G   2480 N2    ? ? 0 C   2105 0 G   2481 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2104 hydrog ? ? A  C   2105 N3    ? ? ? 1_555 A  G   2479 N1    ? ? 0 C   2106 0 G   2480 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2105 hydrog ? ? A  C   2105 N4    ? ? ? 1_555 A  G   2479 O6    ? ? 0 C   2106 0 G   2480 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2106 hydrog ? ? A  C   2105 O2    ? ? ? 1_555 A  G   2479 N2    ? ? 0 C   2106 0 G   2480 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2107 hydrog ? ? A  U   2106 N3    ? ? ? 1_555 A  A   2478 N1    ? ? 0 U   2107 0 A   2479 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2108 hydrog ? ? A  U   2106 O4    ? ? ? 1_555 A  A   2478 N6    ? ? 0 U   2107 0 A   2479 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2109 hydrog ? ? A  A   2107 N1    ? ? ? 1_555 A  U   2477 N3    ? ? 0 A   2108 0 U   2478 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2110 hydrog ? ? A  A   2107 N6    ? ? ? 1_555 A  U   2477 O4    ? ? 0 A   2108 0 U   2478 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2111 hydrog ? ? A  U   2108 N3    ? ? ? 1_555 A  A   2466 N1    ? ? 0 U   2109 0 A   2467 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2112 hydrog ? ? A  U   2108 O2    ? ? ? 1_555 A  A   2466 N6    ? ? 0 U   2109 0 A   2467 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2113 hydrog ? ? A  G   2109 N1    ? ? ? 1_555 A  C   2476 N3    ? ? 0 G   2110 0 C   2477 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2114 hydrog ? ? A  G   2109 N2    ? ? ? 1_555 A  C   2476 O2    ? ? 0 G   2110 0 C   2477 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2115 hydrog ? ? A  G   2109 O6    ? ? ? 1_555 A  C   2476 N4    ? ? 0 G   2110 0 C   2477 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2116 hydrog ? ? A  G   2110 N1    ? ? ? 1_555 A  C   2475 N3    ? ? 0 G   2111 0 C   2476 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2117 hydrog ? ? A  G   2110 N2    ? ? ? 1_555 A  C   2475 O2    ? ? 0 G   2111 0 C   2476 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2118 hydrog ? ? A  G   2110 O6    ? ? ? 1_555 A  C   2475 N4    ? ? 0 G   2111 0 C   2476 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2119 hydrog ? ? A  A   2111 N1    ? ? ? 1_555 A  U   2472 N3    ? ? 0 A   2112 0 U   2473 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2120 hydrog ? ? A  A   2111 N6    ? ? ? 1_555 A  U   2472 O4    ? ? 0 A   2112 0 U   2473 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2121 hydrog ? ? A  G   2112 N1    ? ? ? 1_555 A  C   2471 N3    ? ? 0 G   2113 0 C   2472 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2122 hydrog ? ? A  G   2112 N2    ? ? ? 1_555 A  C   2471 O2    ? ? 0 G   2113 0 C   2472 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2123 hydrog ? ? A  G   2112 O6    ? ? ? 1_555 A  C   2471 N4    ? ? 0 G   2113 0 C   2472 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2124 hydrog ? ? A  G   2112 N3    ? ? ? 1_555 A  C   2474 N4    ? ? 0 G   2113 0 C   2475 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog2125 hydrog ? ? A  C   2113 N3    ? ? ? 1_555 A  G   2470 N1    ? ? 0 C   2114 0 G   2471 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2126 hydrog ? ? A  C   2113 N4    ? ? ? 1_555 A  G   2470 O6    ? ? 0 C   2114 0 G   2471 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2127 hydrog ? ? A  C   2113 O2    ? ? ? 1_555 A  G   2470 N2    ? ? 0 C   2114 0 G   2471 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2128 hydrog ? ? A  U   2114 N3    ? ? ? 1_555 A  A   2469 N1    ? ? 0 U   2115 0 A   2470 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2129 hydrog ? ? A  U   2114 O4    ? ? ? 1_555 A  A   2469 N6    ? ? 0 U   2115 0 A   2470 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2130 hydrog ? ? A  U   2114 O2    ? ? ? 1_555 A  G   2631 N2    ? ? 0 U   2115 0 G   2632 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog2131 hydrog ? ? A  U   2115 N3    ? ? ? 1_555 A  A   2117 N7    ? ? 0 U   2116 0 A   2118 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog2132 hydrog ? ? A  U   2115 O4    ? ? ? 1_555 A  A   2117 N6    ? ? 0 U   2116 0 A   2118 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog2133 hydrog ? ? A  A   2117 N1    ? ? ? 1_555 A  U   2275 N3    ? ? 0 A   2118 0 U   2276 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2134 hydrog ? ? A  A   2117 N6    ? ? ? 1_555 A  U   2275 O4    ? ? 0 A   2118 0 U   2276 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2135 hydrog ? ? A  C   2118 N4    ? ? ? 1_555 A  G   2270 O6    ? ? 0 C   2119 0 G   2271 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2136 hydrog ? ? A  C   2118 N3    ? ? ? 1_555 A  G   2274 N1    ? ? 0 C   2119 0 G   2275 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2137 hydrog ? ? A  C   2118 N4    ? ? ? 1_555 A  G   2274 O6    ? ? 0 C   2119 0 G   2275 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2138 hydrog ? ? A  C   2118 O2    ? ? ? 1_555 A  G   2274 N2    ? ? 0 C   2119 0 G   2275 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2139 hydrog ? ? A  U   2119 N3    ? ? ? 1_555 A  A   2273 N1    ? ? 0 U   2120 0 A   2274 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2140 hydrog ? ? A  U   2119 O4    ? ? ? 1_555 A  A   2273 N6    ? ? 0 U   2120 0 A   2274 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2141 hydrog ? ? A  G   2120 N1    ? ? ? 1_555 A  C   2272 N3    ? ? 0 G   2121 0 C   2273 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2142 hydrog ? ? A  G   2120 N2    ? ? ? 1_555 A  C   2272 O2    ? ? 0 G   2121 0 C   2273 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2143 hydrog ? ? A  G   2120 O6    ? ? ? 1_555 A  C   2272 N4    ? ? 0 G   2121 0 C   2273 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2144 hydrog ? ? A  C   2121 N3    ? ? ? 1_555 A  G   2271 N1    ? ? 0 C   2122 0 G   2272 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2145 hydrog ? ? A  C   2121 N4    ? ? ? 1_555 A  G   2271 O6    ? ? 0 C   2122 0 G   2272 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2146 hydrog ? ? A  C   2121 O2    ? ? ? 1_555 A  G   2271 N2    ? ? 0 C   2122 0 G   2272 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2147 hydrog ? ? A  A   2122 N6    ? ? ? 1_555 A  G   2269 N3    ? ? 0 A   2123 0 G   2270 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2148 hydrog ? ? A  A   2122 N7    ? ? ? 1_555 A  G   2269 N2    ? ? 0 A   2123 0 G   2270 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2149 hydrog ? ? A  G   2123 N1    ? ? ? 1_555 A  C   2268 N3    ? ? 0 G   2124 0 C   2269 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2150 hydrog ? ? A  G   2123 N2    ? ? ? 1_555 A  C   2268 O2    ? ? 0 G   2124 0 C   2269 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2151 hydrog ? ? A  G   2123 O6    ? ? ? 1_555 A  C   2268 N4    ? ? 0 G   2124 0 C   2269 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2152 hydrog ? ? A  G   2124 N1    ? ? ? 1_555 A  C   2267 N3    ? ? 0 G   2125 0 C   2268 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2153 hydrog ? ? A  G   2124 N2    ? ? ? 1_555 A  C   2267 O2    ? ? 0 G   2125 0 C   2268 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2154 hydrog ? ? A  G   2124 O6    ? ? ? 1_555 A  C   2267 N4    ? ? 0 G   2125 0 C   2268 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2155 hydrog ? ? A  C   2125 N3    ? ? ? 1_555 A  G   2266 N1    ? ? 0 C   2126 0 G   2267 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2156 hydrog ? ? A  C   2125 N4    ? ? ? 1_555 A  G   2266 O6    ? ? 0 C   2126 0 G   2267 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2157 hydrog ? ? A  C   2125 O2    ? ? ? 1_555 A  G   2266 N2    ? ? 0 C   2126 0 G   2267 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2158 hydrog ? ? A  U   2126 N3    ? ? ? 1_555 A  A   2265 N1    ? ? 0 U   2127 0 A   2266 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2159 hydrog ? ? A  U   2126 O4    ? ? ? 1_555 A  A   2265 N6    ? ? 0 U   2127 0 A   2266 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2160 hydrog ? ? A  G   2127 N1    ? ? ? 1_555 A  U   2264 O2    ? ? 0 G   2128 0 U   2265 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2161 hydrog ? ? A  G   2127 O6    ? ? ? 1_555 A  U   2264 N3    ? ? 0 G   2128 0 U   2265 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2162 hydrog ? ? A  U   2128 N3    ? ? ? 1_555 A  A   2263 N1    ? ? 0 U   2129 0 A   2264 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2163 hydrog ? ? A  U   2128 O4    ? ? ? 1_555 A  A   2263 N6    ? ? 0 U   2129 0 A   2264 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2164 hydrog ? ? A  C   2129 N3    ? ? ? 1_555 A  G   2262 N1    ? ? 0 C   2130 0 G   2263 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2165 hydrog ? ? A  C   2129 N4    ? ? ? 1_555 A  G   2262 O6    ? ? 0 C   2130 0 G   2263 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2166 hydrog ? ? A  C   2129 O2    ? ? ? 1_555 A  G   2262 N2    ? ? 0 C   2130 0 G   2263 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2167 hydrog ? ? A  G   2130 N1    ? ? ? 1_555 A  C   2261 N3    ? ? 0 G   2131 0 C   2262 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2168 hydrog ? ? A  G   2130 N2    ? ? ? 1_555 A  C   2261 O2    ? ? 0 G   2131 0 C   2262 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2169 hydrog ? ? A  G   2130 O6    ? ? ? 1_555 A  C   2261 N4    ? ? 0 G   2131 0 C   2262 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2170 hydrog ? ? A  C   2131 O2    ? ? ? 1_555 A  C   2260 N4    ? ? 0 C   2132 0 C   2261 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog2171 hydrog ? ? A  U   2132 O4    ? ? ? 1_555 A  A   2259 N6    ? ? 0 U   2133 0 A   2260 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2172 hydrog ? ? A  G   2133 N1    ? ? ? 1_555 A  C   2240 N3    ? ? 0 G   2134 0 C   2241 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2173 hydrog ? ? A  G   2133 N2    ? ? ? 1_555 A  C   2240 O2    ? ? 0 G   2134 0 C   2241 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2174 hydrog ? ? A  G   2133 O6    ? ? ? 1_555 A  C   2240 N4    ? ? 0 G   2134 0 C   2241 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2175 hydrog ? ? A  A   2134 N1    ? ? ? 1_555 A  U   2239 N3    ? ? 0 A   2135 0 U   2240 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2176 hydrog ? ? A  A   2134 N6    ? ? ? 1_555 A  U   2239 O4    ? ? 0 A   2135 0 U   2240 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2177 hydrog ? ? A  G   2135 N1    ? ? ? 1_555 A  C   2238 N3    ? ? 0 G   2136 0 C   2239 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2178 hydrog ? ? A  G   2135 N2    ? ? ? 1_555 A  C   2238 O2    ? ? 0 G   2136 0 C   2239 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2179 hydrog ? ? A  G   2135 O6    ? ? ? 1_555 A  C   2238 N4    ? ? 0 G   2136 0 C   2239 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2180 hydrog ? ? A  U   2241 N3    ? ? ? 1_555 A  A   2257 N7    ? ? 0 U   2242 0 A   2258 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2181 hydrog ? ? A  U   2241 O2    ? ? ? 1_555 A  A   2257 N6    ? ? 0 U   2242 0 A   2258 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2182 hydrog ? ? A  A   2243 N6    ? ? ? 1_555 A  G   2256 N3    ? ? 0 A   2244 0 G   2257 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2183 hydrog ? ? A  A   2243 N7    ? ? ? 1_555 A  G   2256 N2    ? ? 0 A   2244 0 G   2257 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2184 hydrog ? ? A  C   2244 N3    ? ? ? 1_555 A  G   2255 N1    ? ? 0 C   2245 0 G   2256 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2185 hydrog ? ? A  C   2244 N4    ? ? ? 1_555 A  G   2255 O6    ? ? 0 C   2245 0 G   2256 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2186 hydrog ? ? A  C   2244 O2    ? ? ? 1_555 A  G   2255 N2    ? ? 0 C   2245 0 G   2256 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2187 hydrog ? ? A  U   2245 N3    ? ? ? 1_555 A  A   2254 N1    ? ? 0 U   2246 0 A   2255 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2188 hydrog ? ? A  U   2245 O4    ? ? ? 1_555 A  A   2254 N6    ? ? 0 U   2246 0 A   2255 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2189 hydrog ? ? A  C   2246 N3    ? ? ? 1_555 A  G   2253 N1    ? ? 0 C   2247 0 G   2254 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2190 hydrog ? ? A  C   2246 N4    ? ? ? 1_555 A  G   2253 O6    ? ? 0 C   2247 0 G   2254 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2191 hydrog ? ? A  C   2246 O2    ? ? ? 1_555 A  G   2253 N2    ? ? 0 C   2247 0 G   2254 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2192 hydrog ? ? A  C   2247 N3    ? ? ? 1_555 A  G   2252 N1    ? ? 0 C   2248 0 G   2253 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2193 hydrog ? ? A  C   2247 N4    ? ? ? 1_555 A  G   2252 O6    ? ? 0 C   2248 0 G   2253 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2194 hydrog ? ? A  C   2247 O2    ? ? ? 1_555 A  G   2252 N2    ? ? 0 C   2248 0 G   2253 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2195 hydrog ? ? A  G   2248 N2    ? ? ? 1_555 A  A   2251 N7    ? ? 0 G   2249 0 A   2252 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2196 hydrog ? ? A  U   2276 N3    ? ? ? 1_555 A  A   2469 N7    ? ? 0 U   2277 0 A   2470 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog2197 hydrog ? ? A  U   2276 O4    ? ? ? 1_555 A  A   2469 N6    ? ? 0 U   2277 0 A   2470 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog2198 hydrog ? ? A  U   2277 N3    ? ? ? 1_555 A  G   2470 N7    ? ? 0 U   2278 0 G   2471 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog2199 hydrog ? ? A  G   2278 N1    ? ? ? 1_555 A  C   2291 N3    ? ? 0 G   2279 0 C   2292 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2200 hydrog ? ? A  G   2278 N2    ? ? ? 1_555 A  C   2291 O2    ? ? 0 G   2279 0 C   2292 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2201 hydrog ? ? A  G   2278 O6    ? ? ? 1_555 A  C   2291 N4    ? ? 0 G   2279 0 C   2292 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2202 hydrog ? ? A  A   2279 N1    ? ? ? 1_555 A  U   2289 N3    ? ? 0 A   2280 0 U   2290 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2203 hydrog ? ? A  A   2279 N6    ? ? ? 1_555 A  U   2289 O4    ? ? 0 A   2280 0 U   2290 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2204 hydrog ? ? A  C   2280 N3    ? ? ? 1_555 A  G   2288 N1    ? ? 0 C   2281 0 G   2289 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2205 hydrog ? ? A  C   2280 N4    ? ? ? 1_555 A  G   2288 O6    ? ? 0 C   2281 0 G   2289 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2206 hydrog ? ? A  C   2280 O2    ? ? ? 1_555 A  G   2288 N2    ? ? 0 C   2281 0 G   2289 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2207 hydrog ? ? A  G   2287 N1    ? ? ? 1_555 A  C   2308 N3    ? ? 0 G   2288 0 C   2309 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2208 hydrog ? ? A  G   2287 N2    ? ? ? 1_555 A  C   2308 O2    ? ? 0 G   2288 0 C   2309 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2209 hydrog ? ? A  G   2287 O6    ? ? ? 1_555 A  C   2308 N4    ? ? 0 G   2288 0 C   2309 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2210 hydrog ? ? A  G   2288 N2    ? ? ? 1_555 A  A   2290 N1    ? ? 0 G   2289 0 A   2291 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2211 hydrog ? ? A  G   2292 N1    ? ? ? 1_555 A  C   2314 N3    ? ? 0 G   2293 0 C   2315 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2212 hydrog ? ? A  G   2292 N2    ? ? ? 1_555 A  C   2314 O2    ? ? 0 G   2293 0 C   2315 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2213 hydrog ? ? A  G   2292 O6    ? ? ? 1_555 A  C   2314 N4    ? ? 0 G   2293 0 C   2315 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2214 hydrog ? ? A  C   2293 N3    ? ? ? 1_555 A  G   2313 N1    ? ? 0 C   2294 0 G   2314 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2215 hydrog ? ? A  C   2293 N4    ? ? ? 1_555 A  G   2313 O6    ? ? 0 C   2294 0 G   2314 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2216 hydrog ? ? A  C   2293 O2    ? ? ? 1_555 A  G   2313 N2    ? ? 0 C   2294 0 G   2314 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2217 hydrog ? ? A  G   2294 N1    ? ? ? 1_555 A  C   2312 N3    ? ? 0 G   2295 0 C   2313 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2218 hydrog ? ? A  G   2294 N2    ? ? ? 1_555 A  C   2312 O2    ? ? 0 G   2295 0 C   2313 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2219 hydrog ? ? A  G   2294 O6    ? ? ? 1_555 A  C   2312 N4    ? ? 0 G   2295 0 C   2313 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2220 hydrog ? ? A  G   2294 N2    ? ? ? 1_555 A  A   2360 N3    ? ? 0 G   2295 0 A   2361 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2221 hydrog ? ? A  C   2295 N3    ? ? ? 1_555 A  G   2311 N1    ? ? 0 C   2296 0 G   2312 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2222 hydrog ? ? A  C   2295 N4    ? ? ? 1_555 A  G   2311 O6    ? ? 0 C   2296 0 G   2312 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2223 hydrog ? ? A  C   2295 O2    ? ? ? 1_555 A  G   2311 N2    ? ? 0 C   2296 0 G   2312 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2224 hydrog ? ? A  U   2296 N3    ? ? ? 1_555 A  A   2310 N1    ? ? 0 U   2297 0 A   2311 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2225 hydrog ? ? A  U   2296 O4    ? ? ? 1_555 A  A   2310 N6    ? ? 0 U   2297 0 A   2311 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2226 hydrog ? ? A  C   2297 N3    ? ? ? 1_555 A  G   2309 N1    ? ? 0 C   2298 0 G   2310 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2227 hydrog ? ? A  C   2297 N4    ? ? ? 1_555 A  G   2309 O6    ? ? 0 C   2298 0 G   2310 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2228 hydrog ? ? A  C   2297 O2    ? ? ? 1_555 A  G   2309 N2    ? ? 0 C   2298 0 G   2310 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2229 hydrog ? ? A  G   2298 N2    ? ? ? 1_555 A  U   2307 O4    ? ? 0 G   2299 0 U   2308 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2230 hydrog ? ? A  A   2299 N6    ? ? ? 1_555 A  A   2306 N7    ? ? 0 A   2300 0 A   2307 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2231 hydrog ? ? A  A   2299 N7    ? ? ? 1_555 A  A   2306 N6    ? ? 0 A   2300 0 A   2307 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2232 hydrog ? ? A  A   2300 N1    ? ? ? 1_555 A  U   2305 N3    ? ? 0 A   2301 0 U   2306 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2233 hydrog ? ? A  A   2300 N6    ? ? ? 1_555 A  U   2305 O2    ? ? 0 A   2301 0 U   2306 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2234 hydrog ? ? A  G   2313 N2    ? ? ? 1_555 A  A   2424 N3    ? ? 0 G   2314 0 A   2425 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2235 hydrog ? ? A  G   2315 N1    ? ? ? 1_555 A  C   2463 N3    ? ? 0 G   2316 0 C   2464 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2236 hydrog ? ? A  G   2315 N2    ? ? ? 1_555 A  C   2463 O2    ? ? 0 G   2316 0 C   2464 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2237 hydrog ? ? A  G   2315 O6    ? ? ? 1_555 A  C   2463 N4    ? ? 0 G   2316 0 C   2464 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2238 hydrog ? ? A  C   2316 N3    ? ? ? 1_555 A  G   2358 N1    ? ? 0 C   2317 0 G   2359 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2239 hydrog ? ? A  C   2316 N4    ? ? ? 1_555 A  G   2358 O6    ? ? 0 C   2317 0 G   2359 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2240 hydrog ? ? A  C   2316 O2    ? ? ? 1_555 A  G   2358 N2    ? ? 0 C   2317 0 G   2359 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2241 hydrog ? ? A  C   2317 N3    ? ? ? 1_555 A  G   2420 N1    ? ? 0 C   2318 0 G   2421 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2242 hydrog ? ? A  C   2317 N4    ? ? ? 1_555 A  G   2420 O6    ? ? 0 C   2318 0 G   2421 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2243 hydrog ? ? A  C   2317 O2    ? ? ? 1_555 A  G   2420 N2    ? ? 0 C   2318 0 G   2421 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2244 hydrog ? ? A  C   2318 N3    ? ? ? 1_555 A  G   2419 N1    ? ? 0 C   2319 0 G   2420 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2245 hydrog ? ? A  C   2318 N4    ? ? ? 1_555 A  G   2419 O6    ? ? 0 C   2319 0 G   2420 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2246 hydrog ? ? A  C   2318 O2    ? ? ? 1_555 A  G   2419 N2    ? ? 0 C   2319 0 G   2420 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2247 hydrog ? ? A  A   2320 N1    ? ? ? 1_555 A  U   2377 N3    ? ? 0 A   2321 0 U   2378 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2248 hydrog ? ? A  A   2320 N6    ? ? ? 1_555 A  U   2377 O2    ? ? 0 A   2321 0 U   2378 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2249 hydrog ? ? A  A   2320 N6    ? ? ? 1_555 A  A   2379 N7    ? ? 0 A   2321 0 A   2380 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2250 hydrog ? ? A  A   2320 N7    ? ? ? 1_555 A  A   2379 N6    ? ? 0 A   2321 0 A   2380 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2251 hydrog ? ? A  U   2321 O2    ? ? ? 1_555 A  G   2420 N2    ? ? 0 U   2322 0 G   2421 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog2252 hydrog ? ? A  G   2322 N1    ? ? ? 1_555 A  U   2376 O2    ? ? 0 G   2323 0 U   2377 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2253 hydrog ? ? A  G   2322 O6    ? ? ? 1_555 A  U   2376 N3    ? ? 0 G   2323 0 U   2377 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2254 hydrog ? ? A  G   2323 N1    ? ? ? 1_555 A  C   2375 N3    ? ? 0 G   2324 0 C   2376 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2255 hydrog ? ? A  G   2323 N2    ? ? ? 1_555 A  C   2375 O2    ? ? 0 G   2324 0 C   2376 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2256 hydrog ? ? A  G   2323 O6    ? ? ? 1_555 A  C   2375 N4    ? ? 0 G   2324 0 C   2376 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2257 hydrog ? ? A  C   2324 N3    ? ? ? 1_555 A  G   2374 N1    ? ? 0 C   2325 0 G   2375 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2258 hydrog ? ? A  C   2324 N4    ? ? ? 1_555 A  G   2374 O6    ? ? 0 C   2325 0 G   2375 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2259 hydrog ? ? A  C   2324 O2    ? ? ? 1_555 A  G   2374 N2    ? ? 0 C   2325 0 G   2375 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2260 hydrog ? ? A  U   2325 N3    ? ? ? 1_555 A  A   2373 N1    ? ? 0 U   2326 0 A   2374 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2261 hydrog ? ? A  U   2325 O4    ? ? ? 1_555 A  A   2373 N6    ? ? 0 U   2326 0 A   2374 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2262 hydrog ? ? A  A   2326 N1    ? ? ? 1_555 A  U   2372 N3    ? ? 0 A   2327 0 U   2373 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2263 hydrog ? ? A  A   2326 N6    ? ? ? 1_555 A  U   2372 O4    ? ? 0 A   2327 0 U   2373 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2264 hydrog ? ? A  U   2327 N3    ? ? ? 1_555 A  A   2371 N1    ? ? 0 U   2328 0 A   2372 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2265 hydrog ? ? A  U   2327 O4    ? ? ? 1_555 A  A   2371 N6    ? ? 0 U   2328 0 A   2372 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2266 hydrog ? ? A  C   2328 N3    ? ? ? 1_555 A  G   2370 N1    ? ? 0 C   2329 0 G   2371 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2267 hydrog ? ? A  C   2328 N4    ? ? ? 1_555 A  G   2370 O6    ? ? 0 C   2329 0 G   2371 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2268 hydrog ? ? A  C   2328 O2    ? ? ? 1_555 A  G   2370 N2    ? ? 0 C   2329 0 G   2371 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2269 hydrog ? ? A  U   2329 N3    ? ? ? 1_555 A  A   2368 N7    ? ? 0 U   2330 0 A   2369 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2270 hydrog ? ? A  U   2329 O2    ? ? ? 1_555 A  A   2368 N6    ? ? 0 U   2330 0 A   2369 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2271 hydrog ? ? A  C   2330 N3    ? ? ? 1_555 A  G   2354 N1    ? ? 0 C   2331 0 G   2355 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2272 hydrog ? ? A  C   2330 N4    ? ? ? 1_555 A  G   2354 O6    ? ? 0 C   2331 0 G   2355 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2273 hydrog ? ? A  C   2330 O2    ? ? ? 1_555 A  G   2354 N2    ? ? 0 C   2331 0 G   2355 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2274 hydrog ? ? A  A   2331 N6    ? ? ? 1_555 A  G   2351 N3    ? ? 0 A   2332 0 G   2352 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2275 hydrog ? ? A  A   2331 N7    ? ? ? 1_555 A  G   2351 N2    ? ? 0 A   2332 0 G   2352 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2276 hydrog ? ? A  G   2332 N1    ? ? ? 1_555 A  C   2350 N3    ? ? 0 G   2333 0 C   2351 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2277 hydrog ? ? A  G   2332 N2    ? ? ? 1_555 A  C   2350 O2    ? ? 0 G   2333 0 C   2351 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2278 hydrog ? ? A  G   2332 O6    ? ? ? 1_555 A  C   2350 N4    ? ? 0 G   2333 0 C   2351 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2279 hydrog ? ? A  C   2333 N3    ? ? ? 1_555 A  G   2349 N1    ? ? 0 C   2334 0 G   2350 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2280 hydrog ? ? A  C   2333 N4    ? ? ? 1_555 A  G   2349 O6    ? ? 0 C   2334 0 G   2350 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2281 hydrog ? ? A  C   2333 O2    ? ? ? 1_555 A  G   2349 N2    ? ? 0 C   2334 0 G   2350 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2282 hydrog ? ? A  C   2334 N3    ? ? ? 1_555 A  G   2348 N1    ? ? 0 C   2335 0 G   2349 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2283 hydrog ? ? A  C   2334 N4    ? ? ? 1_555 A  G   2348 O6    ? ? 0 C   2335 0 G   2349 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2284 hydrog ? ? A  C   2334 O2    ? ? ? 1_555 A  G   2348 N2    ? ? 0 C   2335 0 G   2349 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2285 hydrog ? ? A  G   2335 N1    ? ? ? 1_555 A  C   2347 N3    ? ? 0 G   2336 0 C   2348 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2286 hydrog ? ? A  G   2335 N2    ? ? ? 1_555 A  C   2347 O2    ? ? 0 G   2336 0 C   2348 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2287 hydrog ? ? A  G   2335 O6    ? ? ? 1_555 A  C   2347 N4    ? ? 0 G   2336 0 C   2348 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2288 hydrog ? ? A  G   2336 N1    ? ? ? 1_555 A  C   2346 N3    ? ? 0 G   2337 0 C   2347 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2289 hydrog ? ? A  G   2336 N2    ? ? ? 1_555 A  C   2346 O2    ? ? 0 G   2337 0 C   2347 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2290 hydrog ? ? A  G   2336 O6    ? ? ? 1_555 A  C   2346 N4    ? ? 0 G   2337 0 C   2347 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2291 hydrog ? ? A  G   2337 N1    ? ? ? 1_555 A  C   2345 N3    ? ? 0 G   2338 0 C   2346 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2292 hydrog ? ? A  G   2337 N2    ? ? ? 1_555 A  C   2345 O2    ? ? 0 G   2338 0 C   2346 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2293 hydrog ? ? A  G   2337 O6    ? ? ? 1_555 A  C   2345 N4    ? ? 0 G   2338 0 C   2346 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2294 hydrog ? ? A  A   2355 N1    ? ? ? 1_555 A  A   2368 N6    ? ? 0 A   2356 0 A   2369 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog2295 hydrog ? ? A  A   2355 N6    ? ? ? 1_555 A  A   2368 N1    ? ? 0 A   2356 0 A   2369 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog2296 hydrog ? ? A  G   2356 N1    ? ? ? 1_555 A  C   2365 N3    ? ? 0 G   2357 0 C   2366 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2297 hydrog ? ? A  G   2356 N2    ? ? ? 1_555 A  C   2365 O2    ? ? 0 G   2357 0 C   2366 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2298 hydrog ? ? A  G   2356 O6    ? ? ? 1_555 A  C   2365 N4    ? ? 0 G   2357 0 C   2366 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2299 hydrog ? ? A  U   2357 N3    ? ? ? 1_555 A  G   2364 O6    ? ? 0 U   2358 0 G   2365 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2300 hydrog ? ? A  U   2357 O2    ? ? ? 1_555 A  G   2364 N1    ? ? 0 U   2358 0 G   2365 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2301 hydrog ? ? A  C   2359 O2    ? ? ? 1_555 A  A   2424 N6    ? ? 0 C   2360 0 A   2425 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2302 hydrog ? ? A  C   2359 N3    ? ? ? 1_555 A  G   2425 N1    ? ? 0 C   2360 0 G   2426 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2303 hydrog ? ? A  C   2359 N4    ? ? ? 1_555 A  G   2425 O6    ? ? 0 C   2360 0 G   2426 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2304 hydrog ? ? A  C   2359 O2    ? ? ? 1_555 A  G   2425 N2    ? ? 0 C   2360 0 G   2426 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2305 hydrog ? ? A  A   2361 N1    ? ? ? 1_555 A  U   2423 N3    ? ? 0 A   2362 0 U   2424 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2306 hydrog ? ? A  A   2361 N6    ? ? ? 1_555 A  U   2423 O4    ? ? 0 A   2362 0 U   2424 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2307 hydrog ? ? A  G   2362 N1    ? ? ? 1_555 A  C   2422 N3    ? ? 0 G   2363 0 C   2423 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2308 hydrog ? ? A  G   2362 N2    ? ? ? 1_555 A  C   2422 O2    ? ? 0 G   2363 0 C   2423 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2309 hydrog ? ? A  G   2362 O6    ? ? ? 1_555 A  C   2422 N4    ? ? 0 G   2363 0 C   2423 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2310 hydrog ? ? A  A   2363 N1    ? ? ? 1_555 A  U   2421 N3    ? ? 0 A   2364 0 U   2422 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2311 hydrog ? ? A  A   2363 N6    ? ? ? 1_555 A  U   2421 O4    ? ? 0 A   2364 0 U   2422 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2312 hydrog ? ? A  G   2364 N2    ? ? ? 1_555 A  A   2369 N3    ? ? 0 G   2365 0 A   2370 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2313 hydrog ? ? A  G   2378 O6    ? ? ? 1_555 A  A   2407 N6    ? ? 0 G   2379 0 A   2408 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2314 hydrog ? ? A  C   2380 N3    ? ? ? 1_555 A  G   2406 N1    ? ? 0 C   2381 0 G   2407 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2315 hydrog ? ? A  C   2380 N4    ? ? ? 1_555 A  G   2406 O6    ? ? 0 C   2381 0 G   2407 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2316 hydrog ? ? A  C   2380 O2    ? ? ? 1_555 A  G   2406 N2    ? ? 0 C   2381 0 G   2407 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2317 hydrog ? ? A  A   2381 N1    ? ? ? 1_555 A  U   2405 N3    ? ? 0 A   2382 0 U   2406 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2318 hydrog ? ? A  A   2381 N6    ? ? ? 1_555 A  U   2405 O4    ? ? 0 A   2382 0 U   2406 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2319 hydrog ? ? A  G   2382 N1    ? ? ? 1_555 A  C   2404 N3    ? ? 0 G   2383 0 C   2405 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2320 hydrog ? ? A  G   2382 N2    ? ? ? 1_555 A  C   2404 O2    ? ? 0 G   2383 0 C   2405 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2321 hydrog ? ? A  G   2382 O6    ? ? ? 1_555 A  C   2404 N4    ? ? 0 G   2383 0 C   2405 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2322 hydrog ? ? A  U   2383 N3    ? ? ? 1_555 A  G   2403 O6    ? ? 0 U   2384 0 G   2404 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2323 hydrog ? ? A  U   2383 O2    ? ? ? 1_555 A  G   2403 N1    ? ? 0 U   2384 0 G   2404 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2324 hydrog ? ? A  G   2384 N1    ? ? ? 1_555 A  C   2402 N3    ? ? 0 G   2385 0 C   2403 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2325 hydrog ? ? A  G   2384 N2    ? ? ? 1_555 A  C   2402 O2    ? ? 0 G   2385 0 C   2403 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2326 hydrog ? ? A  G   2384 O6    ? ? ? 1_555 A  C   2402 N4    ? ? 0 G   2385 0 C   2403 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2327 hydrog ? ? A  U   2385 N3    ? ? ? 1_555 A  A   2401 N1    ? ? 0 U   2386 0 A   2402 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2328 hydrog ? ? A  U   2385 O4    ? ? ? 1_555 A  A   2401 N6    ? ? 0 U   2386 0 A   2402 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2329 hydrog ? ? A  U   2386 N3    ? ? ? 1_555 A  A   2400 N1    ? ? 0 U   2387 0 A   2401 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2330 hydrog ? ? A  U   2386 O4    ? ? ? 1_555 A  A   2400 N6    ? ? 0 U   2387 0 A   2401 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2331 hydrog ? ? A  C   2387 N3    ? ? ? 1_555 A  G   2399 N1    ? ? 0 C   2388 0 G   2400 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2332 hydrog ? ? A  C   2387 N4    ? ? ? 1_555 A  G   2399 O6    ? ? 0 C   2388 0 G   2400 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2333 hydrog ? ? A  C   2387 O2    ? ? ? 1_555 A  G   2399 N2    ? ? 0 C   2388 0 G   2400 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2334 hydrog ? ? A  U   2388 N3    ? ? ? 1_555 A  G   2398 O6    ? ? 0 U   2389 0 G   2399 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2335 hydrog ? ? A  U   2388 O2    ? ? ? 1_555 A  G   2398 N1    ? ? 0 U   2389 0 G   2399 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2336 hydrog ? ? A  U   2389 O2    ? ? ? 1_555 A  A   2397 N6    ? ? 0 U   2390 0 A   2398 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2337 hydrog ? ? A  C   2390 N4    ? ? ? 1_555 A  G   2396 N7    ? ? 0 C   2391 0 G   2397 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2338 hydrog ? ? A  C   2408 N3    ? ? ? 1_555 A  G   2417 N1    ? ? 0 C   2409 0 G   2418 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2339 hydrog ? ? A  C   2408 N4    ? ? ? 1_555 A  G   2417 O6    ? ? 0 C   2409 0 G   2418 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2340 hydrog ? ? A  C   2408 O2    ? ? ? 1_555 A  G   2417 N2    ? ? 0 C   2409 0 G   2418 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2341 hydrog ? ? A  G   2409 N1    ? ? ? 1_555 A  C   2416 N3    ? ? 0 G   2410 0 C   2417 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2342 hydrog ? ? A  G   2409 N2    ? ? ? 1_555 A  C   2416 O2    ? ? 0 G   2410 0 C   2417 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2343 hydrog ? ? A  G   2409 O6    ? ? ? 1_555 A  C   2416 N4    ? ? 0 G   2410 0 C   2417 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2344 hydrog ? ? A  C   2410 N3    ? ? ? 1_555 A  G   2415 N1    ? ? 0 C   2411 0 G   2416 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2345 hydrog ? ? A  C   2410 N4    ? ? ? 1_555 A  G   2415 O6    ? ? 0 C   2411 0 G   2416 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2346 hydrog ? ? A  C   2410 O2    ? ? ? 1_555 A  G   2415 N2    ? ? 0 C   2411 0 G   2416 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2347 hydrog ? ? A  G   2411 N2    ? ? ? 1_555 A  A   2414 N7    ? ? 0 G   2412 0 A   2415 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2348 hydrog ? ? A  C   2426 N4    ? ? ? 1_555 A  G   2461 O6    ? ? 0 C   2427 0 G   2462 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2349 hydrog ? ? A  G   2427 N2    ? ? ? 1_555 A  G   2465 N3    ? ? 0 G   2428 0 G   2466 1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog2350 hydrog ? ? A  G   2427 N3    ? ? ? 1_555 A  G   2465 N2    ? ? 0 G   2428 0 G   2466 1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog2351 hydrog ? ? A  A   2428 N6    ? ? ? 1_555 A  U   2460 O2    ? ? 0 A   2429 0 U   2461 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2352 hydrog ? ? A  A   2428 N7    ? ? ? 1_555 A  U   2460 N3    ? ? 0 A   2429 0 U   2461 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2353 hydrog ? ? A  A   2429 N6    ? ? ? 1_555 A  A   2459 N1    ? ? 0 A   2430 0 A   2460 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2354 hydrog ? ? A  C   2431 N3    ? ? ? 1_555 A  G   2458 N1    ? ? 0 C   2432 0 G   2459 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2355 hydrog ? ? A  C   2431 N4    ? ? ? 1_555 A  G   2458 O6    ? ? 0 C   2432 0 G   2459 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2356 hydrog ? ? A  C   2431 O2    ? ? ? 1_555 A  G   2458 N2    ? ? 0 C   2432 0 G   2459 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2357 hydrog ? ? A  A   2432 N1    ? ? ? 1_555 A  U   2457 N3    ? ? 0 A   2433 0 U   2458 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2358 hydrog ? ? A  A   2432 N6    ? ? ? 1_555 A  U   2457 O4    ? ? 0 A   2433 0 U   2458 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2359 hydrog ? ? A  A   2433 N1    ? ? ? 1_555 A  U   2456 N3    ? ? 0 A   2434 0 U   2457 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2360 hydrog ? ? A  A   2433 N6    ? ? ? 1_555 A  U   2456 O4    ? ? 0 A   2434 0 U   2457 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2361 hydrog ? ? A  U   2434 N3    ? ? ? 1_555 A  A   2455 N1    ? ? 0 U   2435 0 A   2456 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2362 hydrog ? ? A  U   2434 O4    ? ? ? 1_555 A  A   2455 N6    ? ? 0 U   2435 0 A   2456 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2363 hydrog ? ? A  U   2435 N3    ? ? ? 1_555 A  A   2454 N1    ? ? 0 U   2436 0 A   2455 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2364 hydrog ? ? A  U   2435 O4    ? ? ? 1_555 A  A   2454 N6    ? ? 0 U   2436 0 A   2455 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2365 hydrog ? ? A  G   2437 N1    ? ? ? 1_555 A  C   2453 N3    ? ? 0 G   2438 0 C   2454 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2366 hydrog ? ? A  G   2437 N2    ? ? ? 1_555 A  C   2453 O2    ? ? 0 G   2438 0 C   2454 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2367 hydrog ? ? A  G   2437 O6    ? ? ? 1_555 A  C   2453 N4    ? ? 0 G   2438 0 C   2454 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2368 hydrog ? ? A  C   2438 N3    ? ? ? 1_555 A  G   2452 N1    ? ? 0 C   2439 0 G   2453 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2369 hydrog ? ? A  C   2438 N4    ? ? ? 1_555 A  G   2452 O6    ? ? 0 C   2439 0 G   2453 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2370 hydrog ? ? A  C   2438 O2    ? ? ? 1_555 A  G   2452 N2    ? ? 0 C   2439 0 G   2453 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2371 hydrog ? ? A  C   2439 N3    ? ? ? 1_555 A  G   2451 N1    ? ? 0 C   2440 0 G   2452 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2372 hydrog ? ? A  C   2439 N4    ? ? ? 1_555 A  G   2451 O6    ? ? 0 C   2440 0 G   2452 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2373 hydrog ? ? A  C   2439 O2    ? ? ? 1_555 A  G   2451 N2    ? ? 0 C   2440 0 G   2452 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2374 hydrog ? ? A  U   2440 N3    ? ? ? 1_555 A  G   2450 O6    ? ? 0 U   2441 0 G   2451 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2375 hydrog ? ? A  U   2440 O2    ? ? ? 1_555 A  G   2450 N1    ? ? 0 U   2441 0 G   2451 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2376 hydrog ? ? A  G   2441 N1    ? ? ? 1_555 A  C   2449 N3    ? ? 0 G   2442 0 C   2450 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2377 hydrog ? ? A  G   2441 N2    ? ? ? 1_555 A  C   2449 O2    ? ? 0 G   2442 0 C   2450 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2378 hydrog ? ? A  G   2441 O6    ? ? ? 1_555 A  C   2449 N4    ? ? 0 G   2442 0 C   2450 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2379 hydrog ? ? A  G   2470 N2    ? ? ? 1_555 A  A   2632 N3    ? ? 0 G   2471 0 A   2633 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2380 hydrog ? ? A  U   2472 O2    ? ? ? 1_555 A  C   2474 N4    ? ? 0 U   2473 0 C   2475 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog2381 hydrog ? ? A  G   2481 O6    ? ? ? 1_555 A  A   2485 N6    ? ? 0 G   2482 0 A   2486 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2382 hydrog ? ? A  G   2481 O6    ? ? ? 1_555 A  C   2486 N4    ? ? 0 G   2482 0 C   2487 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog2383 hydrog ? ? A  A   2484 N6    ? ? ? 1_555 A  C   2535 N3    ? ? 0 A   2485 0 C   2536 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog2384 hydrog ? ? A  A   2484 N7    ? ? ? 1_555 A  C   2535 N4    ? ? 0 A   2485 0 C   2536 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog2385 hydrog ? ? A  A   2487 N6    ? ? ? 1_555 A  C   2533 N3    ? ? 0 A   2488 0 C   2534 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog2386 hydrog ? ? A  G   2488 N1    ? ? ? 1_555 A  C   2532 N3    ? ? 0 G   2489 0 C   2533 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2387 hydrog ? ? A  G   2488 N2    ? ? ? 1_555 A  C   2532 O2    ? ? 0 G   2489 0 C   2533 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2388 hydrog ? ? A  G   2488 O6    ? ? ? 1_555 A  C   2532 N4    ? ? 0 G   2489 0 C   2533 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2389 hydrog ? ? A  A   2489 N1    ? ? ? 1_555 A  U   2530 N3    ? ? 0 A   2490 0 U   2531 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2390 hydrog ? ? A  A   2489 N6    ? ? ? 1_555 A  U   2530 O4    ? ? 0 A   2490 0 U   2531 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2391 hydrog ? ? A  G   2490 N1    ? ? ? 1_555 A  C   2529 N3    ? ? 0 G   2491 0 C   2530 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2392 hydrog ? ? A  G   2490 N2    ? ? ? 1_555 A  C   2529 O2    ? ? 0 G   2491 0 C   2530 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2393 hydrog ? ? A  G   2490 O6    ? ? ? 1_555 A  C   2529 N4    ? ? 0 G   2491 0 C   2530 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2394 hydrog ? ? A  U   2491 N3    ? ? ? 1_555 A  G   2528 O6    ? ? 0 U   2492 0 G   2529 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2395 hydrog ? ? A  U   2491 O2    ? ? ? 1_555 A  G   2528 N1    ? ? 0 U   2492 0 G   2529 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2396 hydrog ? ? A  G   2493 N1    ? ? ? 1_555 A  U   2527 O2    ? ? 0 G   2494 0 U   2528 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2397 hydrog ? ? A  G   2493 O6    ? ? ? 1_555 A  U   2527 N3    ? ? 0 G   2494 0 U   2528 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2398 hydrog ? ? A  U   2494 O4    ? ? ? 1_555 A  G   2524 N2    ? ? 0 U   2495 0 G   2525 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog2399 hydrog ? ? A  U   2494 N3    ? ? ? 1_555 A  U   2526 O4    ? ? 0 U   2495 0 U   2527 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2400 hydrog ? ? A  U   2494 O2    ? ? ? 1_555 A  U   2526 N3    ? ? 0 U   2495 0 U   2527 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2401 hydrog ? ? A  C   2495 N3    ? ? ? 1_555 A  G   2523 N1    ? ? 0 C   2496 0 G   2524 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2402 hydrog ? ? A  C   2495 N4    ? ? ? 1_555 A  G   2523 O6    ? ? 0 C   2496 0 G   2524 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2403 hydrog ? ? A  C   2495 O2    ? ? ? 1_555 A  G   2523 N2    ? ? 0 C   2496 0 G   2524 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2404 hydrog ? ? A  A   2496 N1    ? ? ? 1_555 A  U   2522 N3    ? ? 0 A   2497 0 U   2523 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2405 hydrog ? ? A  A   2496 N6    ? ? ? 1_555 A  U   2522 O4    ? ? 0 A   2497 0 U   2523 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2406 hydrog ? ? A  C   2497 N3    ? ? ? 1_555 A  G   2521 N1    ? ? 0 C   2498 0 G   2522 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2407 hydrog ? ? A  C   2497 N4    ? ? ? 1_555 A  G   2521 O6    ? ? 0 C   2498 0 G   2522 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2408 hydrog ? ? A  C   2497 O2    ? ? ? 1_555 A  G   2521 N2    ? ? 0 C   2498 0 G   2522 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2409 hydrog ? ? A  U   2498 N3    ? ? ? 1_555 A  A   2520 N1    ? ? 0 U   2499 0 A   2521 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2410 hydrog ? ? A  U   2498 O4    ? ? ? 1_555 A  A   2520 N6    ? ? 0 U   2499 0 A   2521 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2411 hydrog ? ? A  C   2499 N3    ? ? ? 1_555 A  G   2519 N1    ? ? 0 C   2500 0 G   2520 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2412 hydrog ? ? A  C   2499 N4    ? ? ? 1_555 A  G   2519 O6    ? ? 0 C   2500 0 G   2520 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2413 hydrog ? ? A  C   2499 O2    ? ? ? 1_555 A  G   2519 N2    ? ? 0 C   2500 0 G   2520 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2414 hydrog ? ? A  G   2500 N1    ? ? ? 1_555 A  C   2518 N3    ? ? 0 G   2501 0 C   2519 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2415 hydrog ? ? A  G   2500 N2    ? ? ? 1_555 A  C   2518 O2    ? ? 0 G   2501 0 C   2519 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2416 hydrog ? ? A  G   2500 O6    ? ? ? 1_555 A  C   2518 N4    ? ? 0 G   2501 0 C   2519 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2417 hydrog ? ? A  C   2501 O2    ? ? ? 1_555 A  C   2517 N4    ? ? 0 C   2502 0 C   2518 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog2418 hydrog ? ? A  A   2502 N3    ? ? ? 1_555 A  A   2516 N6    ? ? 0 A   2503 0 A   2517 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2419 hydrog ? ? A  A   2503 N6    ? ? ? 1_555 A  G   2515 N3    ? ? 0 A   2504 0 G   2516 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2420 hydrog ? ? A  A   2503 N7    ? ? ? 1_555 A  G   2515 N2    ? ? 0 A   2504 0 G   2516 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2421 hydrog ? ? A  G   2504 N1    ? ? ? 1_555 A  C   2514 N3    ? ? 0 G   2505 0 C   2515 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2422 hydrog ? ? A  G   2504 N2    ? ? ? 1_555 A  C   2514 O2    ? ? 0 G   2505 0 C   2515 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2423 hydrog ? ? A  G   2504 O6    ? ? ? 1_555 A  C   2514 N4    ? ? 0 G   2505 0 C   2515 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2424 hydrog ? ? A  A   2505 N1    ? ? ? 1_555 A  U   2513 N3    ? ? 0 A   2506 0 U   2514 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2425 hydrog ? ? A  A   2505 N6    ? ? ? 1_555 A  U   2513 O4    ? ? 0 A   2506 0 U   2514 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2426 hydrog ? ? A  G   2506 N2    ? ? ? 1_555 A  A   2512 N7    ? ? 0 G   2507 0 A   2513 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2427 hydrog ? ? A  G   2506 N3    ? ? ? 1_555 A  A   2512 N6    ? ? 0 G   2507 0 A   2513 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2428 hydrog ? ? A  G   2506 N2    ? ? ? 1_555 A  G   2563 O6    ? ? 0 G   2507 0 G   2564 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog2429 hydrog ? ? A  C   2509 N3    ? ? ? 1_555 A  G   2563 N2    ? ? 0 C   2510 0 G   2564 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2430 hydrog ? ? A  C   2509 O2    ? ? ? 1_555 A  G   2563 N1    ? ? 0 C   2510 0 G   2564 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2431 hydrog ? ? A  G   2524 N2    ? ? ? 1_555 A  U   2526 O4    ? ? 0 G   2525 0 U   2527 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2432 hydrog ? ? A  A   2531 N3    ? ? ? 1_555 A  C   2532 N4    ? ? 0 A   2532 0 C   2533 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog2433 hydrog ? ? A  G   2539 N1    ? ? ? 1_555 A  U   2644 O2    ? ? 0 G   2540 0 U   2645 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2434 hydrog ? ? A  U   2540 N3    ? ? ? 1_555 A  G   2617 O6    ? ? 0 U   2541 0 G   2618 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2435 hydrog ? ? A  U   2540 O2    ? ? ? 1_555 A  G   2617 N1    ? ? 0 U   2541 0 G   2618 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2436 hydrog ? ? A  C   2541 O2    ? ? ? 1_555 A  OMG 2587 N2    ? ? 0 C   2542 0 OMG 2588 1_555 ? ? ? ? ? ? 'C-OMG PAIR' ? ? 
hydrog2437 hydrog ? ? A  C   2541 N3    ? ? ? 1_555 A  G   2616 N1    ? ? 0 C   2542 0 G   2617 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2438 hydrog ? ? A  C   2541 N4    ? ? ? 1_555 A  G   2616 O6    ? ? 0 C   2542 0 G   2617 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2439 hydrog ? ? A  C   2541 O2    ? ? ? 1_555 A  G   2616 N2    ? ? 0 C   2542 0 G   2617 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2440 hydrog ? ? A  G   2542 N1    ? ? ? 1_555 A  U   2614 O2    ? ? 0 G   2543 0 U   2615 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2441 hydrog ? ? A  G   2542 O6    ? ? ? 1_555 A  U   2614 N3    ? ? 0 G   2543 0 U   2615 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2442 hydrog ? ? A  G   2543 N1    ? ? ? 1_555 A  C   2613 N3    ? ? 0 G   2544 0 C   2614 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2443 hydrog ? ? A  G   2543 N2    ? ? ? 1_555 A  C   2613 O2    ? ? 0 G   2544 0 C   2614 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2444 hydrog ? ? A  G   2543 O6    ? ? ? 1_555 A  C   2613 N4    ? ? 0 G   2544 0 C   2614 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2445 hydrog ? ? A  U   2544 N3    ? ? ? 1_555 A  G   2612 O6    ? ? 0 U   2545 0 G   2613 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2446 hydrog ? ? A  U   2544 O2    ? ? ? 1_555 A  G   2612 N1    ? ? 0 U   2545 0 G   2613 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2447 hydrog ? ? A  U   2545 N3    ? ? ? 1_555 A  U   2609 O2    ? ? 0 U   2546 0 U   2610 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2448 hydrog ? ? A  U   2545 O4    ? ? ? 1_555 A  U   2609 N3    ? ? 0 U   2546 0 U   2610 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2449 hydrog ? ? A  C   2546 N3    ? ? ? 1_555 A  G   2608 N1    ? ? 0 C   2547 0 G   2609 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2450 hydrog ? ? A  C   2546 N4    ? ? ? 1_555 A  G   2608 O6    ? ? 0 C   2547 0 G   2609 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2451 hydrog ? ? A  C   2546 O2    ? ? ? 1_555 A  G   2608 N2    ? ? 0 C   2547 0 G   2609 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2452 hydrog ? ? A  C   2547 N3    ? ? ? 1_555 A  G   2605 N1    ? ? 0 C   2548 0 G   2606 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2453 hydrog ? ? A  C   2547 N4    ? ? ? 1_555 A  G   2605 O6    ? ? 0 C   2548 0 G   2606 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2454 hydrog ? ? A  C   2547 O2    ? ? ? 1_555 A  G   2605 N2    ? ? 0 C   2548 0 G   2606 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2455 hydrog ? ? A  C   2548 N3    ? ? ? 1_555 A  G   2604 N1    ? ? 0 C   2549 0 G   2605 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2456 hydrog ? ? A  C   2548 N4    ? ? ? 1_555 A  G   2604 O6    ? ? 0 C   2549 0 G   2605 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2457 hydrog ? ? A  C   2548 O2    ? ? ? 1_555 A  G   2604 N2    ? ? 0 C   2549 0 G   2605 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2458 hydrog ? ? A  U   2549 N3    ? ? ? 1_555 A  A   2603 N1    ? ? 0 U   2550 0 A   2604 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2459 hydrog ? ? A  U   2549 O4    ? ? ? 1_555 A  A   2603 N6    ? ? 0 U   2550 0 A   2604 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2460 hydrog ? ? A  C   2550 N3    ? ? ? 1_555 A  G   2602 N1    ? ? 0 C   2551 0 G   2603 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2461 hydrog ? ? A  C   2550 N4    ? ? ? 1_555 A  G   2602 O6    ? ? 0 C   2551 0 G   2603 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2462 hydrog ? ? A  C   2550 O2    ? ? ? 1_555 A  G   2602 N2    ? ? 0 C   2551 0 G   2603 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2463 hydrog ? ? A  C   2551 N3    ? ? ? 1_555 A  G   2601 N1    ? ? 0 C   2552 0 G   2602 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2464 hydrog ? ? A  C   2551 N4    ? ? ? 1_555 A  G   2601 O6    ? ? 0 C   2552 0 G   2602 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2465 hydrog ? ? A  C   2551 O2    ? ? ? 1_555 A  G   2601 N2    ? ? 0 C   2552 0 G   2602 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2466 hydrog ? ? A  U   2553 O2    ? ? ? 1_555 A  C   2555 N4    ? ? 0 U   2554 0 C   2556 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog2467 hydrog ? ? A  C   2554 N4    ? ? ? 1_555 A  A   2576 N1    ? ? 0 C   2555 0 A   2577 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2468 hydrog ? ? A  C   2554 N3    ? ? ? 1_555 A  G   2579 N1    ? ? 0 C   2555 0 G   2580 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2469 hydrog ? ? A  C   2554 N4    ? ? ? 1_555 A  G   2579 O6    ? ? 0 C   2555 0 G   2580 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2470 hydrog ? ? A  C   2554 O2    ? ? ? 1_555 A  G   2579 N2    ? ? 0 C   2555 0 G   2580 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2471 hydrog ? ? A  C   2555 N3    ? ? ? 1_555 A  G   2578 N1    ? ? 0 C   2556 0 G   2579 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2472 hydrog ? ? A  C   2555 N4    ? ? ? 1_555 A  G   2578 O6    ? ? 0 C   2556 0 G   2579 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2473 hydrog ? ? A  C   2555 O2    ? ? ? 1_555 A  G   2578 N2    ? ? 0 C   2556 0 G   2579 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2474 hydrog ? ? A  U   2556 N3    ? ? ? 1_555 A  G   2577 O6    ? ? 0 U   2557 0 G   2578 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2475 hydrog ? ? A  U   2556 O2    ? ? ? 1_555 A  G   2577 N1    ? ? 0 U   2557 0 G   2578 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2476 hydrog ? ? A  G   2557 N1    ? ? ? 1_555 A  C   2574 N3    ? ? 0 G   2558 0 C   2575 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2477 hydrog ? ? A  G   2557 N2    ? ? ? 1_555 A  C   2574 O2    ? ? 0 G   2558 0 C   2575 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2478 hydrog ? ? A  G   2557 O6    ? ? ? 1_555 A  C   2574 N4    ? ? 0 G   2558 0 C   2575 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2479 hydrog ? ? A  G   2557 N2    ? ? ? 1_555 A  A   2798 N3    ? ? 0 G   2558 0 A   2799 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2480 hydrog ? ? A  C   2558 N3    ? ? ? 1_555 A  G   2573 N1    ? ? 0 C   2559 0 G   2574 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2481 hydrog ? ? A  C   2558 N4    ? ? ? 1_555 A  G   2573 O6    ? ? 0 C   2559 0 G   2574 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2482 hydrog ? ? A  C   2558 O2    ? ? ? 1_555 A  G   2573 N2    ? ? 0 C   2559 0 G   2574 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2483 hydrog ? ? A  C   2559 N3    ? ? ? 1_555 A  G   2572 N1    ? ? 0 C   2560 0 G   2573 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2484 hydrog ? ? A  C   2559 N4    ? ? ? 1_555 A  G   2572 O6    ? ? 0 C   2560 0 G   2573 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2485 hydrog ? ? A  C   2559 O2    ? ? ? 1_555 A  G   2572 N2    ? ? 0 C   2560 0 G   2573 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2486 hydrog ? ? A  C   2560 N3    ? ? ? 1_555 A  G   2571 N1    ? ? 0 C   2561 0 G   2572 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2487 hydrog ? ? A  C   2560 N4    ? ? ? 1_555 A  G   2571 O6    ? ? 0 C   2561 0 G   2572 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2488 hydrog ? ? A  C   2560 O2    ? ? ? 1_555 A  G   2571 N2    ? ? 0 C   2561 0 G   2572 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2489 hydrog ? ? A  G   2561 N1    ? ? ? 1_555 A  C   2570 N3    ? ? 0 G   2562 0 C   2571 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2490 hydrog ? ? A  G   2561 N2    ? ? ? 1_555 A  C   2570 O2    ? ? 0 G   2562 0 C   2571 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2491 hydrog ? ? A  G   2561 O6    ? ? ? 1_555 A  C   2570 N4    ? ? 0 G   2562 0 C   2571 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2492 hydrog ? ? A  U   2562 N3    ? ? ? 1_555 A  G   2569 O6    ? ? 0 U   2563 0 G   2570 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2493 hydrog ? ? A  U   2562 O2    ? ? ? 1_555 A  G   2569 N1    ? ? 0 U   2563 0 G   2570 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2494 hydrog ? ? A  A   2565 N1    ? ? ? 1_555 A  A   2698 N6    ? ? 0 A   2566 0 A   2699 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog2495 hydrog ? ? A  A   2565 N6    ? ? ? 1_555 A  A   2698 N1    ? ? 0 A   2566 0 A   2699 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog2496 hydrog ? ? A  G   2566 N2    ? ? ? 1_555 A  G   2699 N3    ? ? 0 G   2567 0 G   2700 1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog2497 hydrog ? ? A  G   2566 N3    ? ? ? 1_555 A  G   2699 N2    ? ? 0 G   2567 0 G   2700 1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog2498 hydrog ? ? A  G   2573 N2    ? ? ? 1_555 A  A   2775 N3    ? ? 0 G   2574 0 A   2776 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2499 hydrog ? ? A  A   2575 N3    ? ? ? 1_555 A  A   2799 N6    ? ? 0 A   2576 0 A   2800 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2500 hydrog ? ? A  G   2579 N2    ? ? ? 1_555 A  A   2599 N3    ? ? 0 G   2580 0 A   2600 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2501 hydrog ? ? A  U   2580 N3    ? ? ? 1_555 A  G   2601 N7    ? ? 0 U   2581 0 G   2602 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog2502 hydrog ? ? A  G   2581 N1    ? ? ? 1_555 A  A   2595 N1    ? ? 0 G   2582 0 A   2596 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2503 hydrog ? ? A  G   2581 O6    ? ? ? 1_555 A  A   2595 N6    ? ? 0 G   2582 0 A   2596 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2504 hydrog ? ? A  A   2582 N1    ? ? ? 1_555 A  U   2594 N3    ? ? 0 A   2583 0 U   2595 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2505 hydrog ? ? A  A   2582 N6    ? ? ? 1_555 A  U   2594 O4    ? ? 0 A   2583 0 U   2595 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2506 hydrog ? ? A  G   2583 N1    ? ? ? 1_555 A  C   2593 N3    ? ? 0 G   2584 0 C   2594 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2507 hydrog ? ? A  G   2583 N2    ? ? ? 1_555 A  C   2593 O2    ? ? 0 G   2584 0 C   2594 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2508 hydrog ? ? A  G   2583 O6    ? ? ? 1_555 A  C   2593 N4    ? ? 0 G   2584 0 C   2594 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2509 hydrog ? ? A  G   2584 N1    ? ? ? 1_555 A  C   2592 N3    ? ? 0 G   2585 0 C   2593 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2510 hydrog ? ? A  G   2584 N2    ? ? ? 1_555 A  C   2592 O2    ? ? 0 G   2585 0 C   2593 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2511 hydrog ? ? A  G   2584 O6    ? ? ? 1_555 A  C   2592 N4    ? ? 0 G   2585 0 C   2593 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2512 hydrog ? ? A  U   2585 O4    ? ? ? 1_555 A  G   2591 N1    ? ? 0 U   2586 0 G   2592 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog2513 hydrog ? ? A  OMU 2586 O2    ? ? ? 1_555 A  C   2590 N4    ? ? 0 OMU 2587 0 C   2591 1_555 ? ? ? ? ? ? 'OMU-C MISPAIR' 
?     ? 
hydrog2514 hydrog ? ? A  U   2596 N3    ? ? ? 1_555 A  A   2600 N7    ? ? 0 U   2597 0 A   2601 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2515 hydrog ? ? A  U   2596 O2    ? ? ? 1_555 A  A   2600 N6    ? ? 0 U   2597 0 A   2601 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2516 hydrog ? ? A  A   2621 N6    ? ? ? 1_555 A  G   2642 N3    ? ? 0 A   2622 0 G   2643 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2517 hydrog ? ? A  A   2621 N7    ? ? ? 1_555 A  G   2642 N2    ? ? 0 A   2622 0 G   2643 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2518 hydrog ? ? A  G   2622 N1    ? ? ? 1_555 A  C   2640 N3    ? ? 0 G   2623 0 C   2641 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2519 hydrog ? ? A  G   2622 N2    ? ? ? 1_555 A  C   2640 O2    ? ? 0 G   2623 0 C   2641 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2520 hydrog ? ? A  G   2622 O6    ? ? ? 1_555 A  C   2640 N4    ? ? 0 G   2623 0 C   2641 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2521 hydrog ? ? A  A   2623 N1    ? ? ? 1_555 A  U   2639 N3    ? ? 0 A   2624 0 U   2640 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog2522 hydrog ? ? A  C   2624 N3    ? ? ? 1_555 A  G   2638 N1    ? ? 0 C   2625 0 G   2639 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2523 hydrog ? ? A  C   2624 N4    ? ? ? 1_555 A  G   2638 O6    ? ? 0 C   2625 0 G   2639 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2524 hydrog ? ? A  C   2624 O2    ? ? ? 1_555 A  G   2638 N2    ? ? 0 C   2625 0 G   2639 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2525 hydrog ? ? A  C   2625 N3    ? ? ? 1_555 A  G   2637 N1    ? ? 0 C   2626 0 G   2638 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2526 hydrog ? ? A  C   2625 N4    ? ? ? 1_555 A  G   2637 O6    ? ? 0 C   2626 0 G   2638 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2527 hydrog ? ? A  C   2625 O2    ? ? ? 1_555 A  G   2637 N2    ? ? 0 C   2626 0 G   2638 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2528 hydrog ? ? A  G   2626 N1    ? ? ? 1_555 A  C   2635 N3    ? ? 0 G   2627 0 C   2636 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2529 hydrog ? ? A  G   2626 N2    ? ? ? 1_555 A  C   2635 O2    ? ? 0 G   2627 0 C   2636 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2530 hydrog ? ? A  G   2626 O6    ? ? ? 1_555 A  C   2635 N4    ? ? 0 G   2627 0 C   2636 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2531 hydrog ? ? A  U   2627 N3    ? ? ? 1_555 A  A   2634 N1    ? ? 0 U   2628 0 A   2635 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2532 hydrog ? ? A  U   2627 O4    ? ? ? 1_555 A  A   2634 N6    ? ? 0 U   2628 0 A   2635 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2533 hydrog ? ? A  C   2628 N3    ? ? ? 1_555 A  G   2633 N1    ? ? 0 C   2629 0 G   2634 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2534 hydrog ? ? A  C   2628 N4    ? ? ? 1_555 A  G   2633 O6    ? ? 0 C   2629 0 G   2634 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2535 hydrog ? ? A  C   2628 O2    ? ? ? 1_555 A  G   2633 N2    ? ? 0 C   2629 0 G   2634 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2536 hydrog ? ? A  G   2629 N2    ? ? ? 1_555 A  A   2632 N7    ? ? 0 G   2630 0 A   2633 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2537 hydrog ? ? A  A   2648 N3    ? ? ? 1_555 A  C   2650 N4    ? ? 0 A   2649 0 C   2651 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog2538 hydrog ? ? A  G   2656 N2    ? ? ? 1_555 A  A   2840 N1    ? ? 0 G   2657 0 A   2841 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog2539 hydrog ? ? A  G   2656 N3    ? ? ? 1_555 A  A   2840 N6    ? ? 0 G   2657 0 A   2841 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog2540 hydrog ? ? A  U   2660 O2    ? ? ? 1_555 A  A   2811 N6    ? ? 0 U   2661 0 A   2812 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2541 hydrog ? ? A  G   2661 N2    ? ? ? 1_555 A  A   2815 N3    ? ? 0 G   2662 0 A   2816 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2542 hydrog ? ? A  G   2666 N1    ? ? ? 1_555 A  C   2821 N3    ? ? 0 G   2667 0 C   2822 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2543 hydrog ? ? A  G   2666 N2    ? ? ? 1_555 A  C   2821 O2    ? ? 0 G   2667 0 C   2822 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2544 hydrog ? ? A  G   2666 O6    ? ? ? 1_555 A  C   2821 N4    ? ? 0 G   2667 0 C   2822 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2545 hydrog ? ? A  G   2666 N2    ? ? ? 1_555 A  A   2826 N3    ? ? 0 G   2667 0 A   2827 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2546 hydrog ? ? A  G   2667 N1    ? ? ? 1_555 A  C   2820 N3    ? ? 0 G   2668 0 C   2821 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2547 hydrog ? ? A  G   2667 N2    ? ? ? 1_555 A  C   2820 O2    ? ? 0 G   2668 0 C   2821 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2548 hydrog ? ? A  G   2667 O6    ? ? ? 1_555 A  C   2820 N4    ? ? 0 G   2668 0 C   2821 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2549 hydrog ? ? A  U   2668 N3    ? ? ? 1_555 A  A   2819 N1    ? ? 0 U   2669 0 A   2820 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2550 hydrog ? ? A  U   2668 O4    ? ? ? 1_555 A  A   2819 N6    ? ? 0 U   2669 0 A   2820 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2551 hydrog ? ? A  G   2669 N1    ? ? ? 1_555 A  C   2818 N3    ? ? 0 G   2670 0 C   2819 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2552 hydrog ? ? A  G   2669 N2    ? ? ? 1_555 A  C   2818 O2    ? ? 0 G   2670 0 C   2819 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2553 hydrog ? ? A  G   2669 O6    ? ? ? 1_555 A  C   2818 N4    ? ? 0 G   2670 0 C   2819 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2554 hydrog ? ? A  U   2670 N3    ? ? ? 1_555 A  A   2817 N1    ? ? 0 U   2671 0 A   2818 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2555 hydrog ? ? A  U   2670 O4    ? ? ? 1_555 A  A   2817 N6    ? ? 0 U   2671 0 A   2818 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2556 hydrog ? ? A  C   2671 N3    ? ? ? 1_555 A  G   2816 N1    ? ? 0 C   2672 0 G   2817 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2557 hydrog ? ? A  C   2671 N4    ? ? ? 1_555 A  G   2816 O6    ? ? 0 C   2672 0 G   2817 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2558 hydrog ? ? A  C   2671 O2    ? ? ? 1_555 A  G   2816 N2    ? ? 0 C   2672 0 G   2817 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2559 hydrog ? ? A  U   2672 N3    ? ? ? 1_555 A  A   2810 N7    ? ? 0 U   2673 0 A   2811 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2560 hydrog ? ? A  U   2672 O2    ? ? ? 1_555 A  A   2810 N6    ? ? 0 U   2673 0 A   2811 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2561 hydrog ? ? A  G   2673 N2    ? ? ? 1_555 A  A   2812 N7    ? ? 0 G   2674 0 A   2813 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2562 hydrog ? ? A  G   2673 N3    ? ? ? 1_555 A  A   2812 N6    ? ? 0 G   2674 0 A   2813 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2563 hydrog ? ? A  A   2674 N6    ? ? ? 1_555 A  G   2809 N3    ? ? 0 A   2675 0 G   2810 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2564 hydrog ? ? A  A   2674 N7    ? ? ? 1_555 A  G   2809 N2    ? ? 0 A   2675 0 G   2810 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2565 hydrog ? ? A  C   2675 N3    ? ? ? 1_555 A  G   2808 N1    ? ? 0 C   2676 0 G   2809 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2566 hydrog ? ? A  C   2675 N4    ? ? ? 1_555 A  G   2808 O6    ? ? 0 C   2676 0 G   2809 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2567 hydrog ? ? A  C   2675 O2    ? ? ? 1_555 A  G   2808 N2    ? ? 0 C   2676 0 G   2809 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2568 hydrog ? ? A  A   2676 N1    ? ? ? 1_555 A  U   2807 N3    ? ? 0 A   2677 0 U   2808 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2569 hydrog ? ? A  A   2676 N6    ? ? ? 1_555 A  U   2807 O4    ? ? 0 A   2677 0 U   2808 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2570 hydrog ? ? A  A   2677 N1    ? ? ? 1_555 A  U   2806 N3    ? ? 0 A   2678 0 U   2807 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2571 hydrog ? ? A  A   2677 N6    ? ? ? 1_555 A  U   2806 O4    ? ? 0 A   2678 0 U   2807 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2572 hydrog ? ? A  G   2678 N1    ? ? ? 1_555 A  C   2805 N3    ? ? 0 G   2679 0 C   2806 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2573 hydrog ? ? A  G   2678 N2    ? ? ? 1_555 A  C   2805 O2    ? ? 0 G   2679 0 C   2806 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2574 hydrog ? ? A  G   2678 O6    ? ? ? 1_555 A  C   2805 N4    ? ? 0 G   2679 0 C   2806 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2575 hydrog ? ? A  A   2679 N1    ? ? ? 1_555 A  G   2711 N2    ? ? 0 A   2680 0 G   2712 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2576 hydrog ? ? A  A   2680 N3    ? ? ? 1_555 A  G   2712 N2    ? ? 0 A   2681 0 G   2713 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2577 hydrog ? ? A  C   2681 N3    ? ? ? 1_555 A  G   2711 N1    ? ? 0 C   2682 0 G   2712 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2578 hydrog ? ? A  C   2681 N4    ? ? ? 1_555 A  G   2711 O6    ? ? 0 C   2682 0 G   2712 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2579 hydrog ? ? A  C   2681 O2    ? ? ? 1_555 A  G   2711 N2    ? ? 0 C   2682 0 G   2712 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2580 hydrog ? ? A  G   2682 N1    ? ? ? 1_555 A  U   2710 O2    ? ? 0 G   2683 0 U   2711 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2581 hydrog ? ? A  G   2682 O6    ? ? ? 1_555 A  U   2710 N3    ? ? 0 G   2683 0 U   2711 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2582 hydrog ? ? A  A   2683 N1    ? ? ? 1_555 A  U   2709 N3    ? ? 0 A   2684 0 U   2710 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2583 hydrog ? ? A  A   2683 N6    ? ? ? 1_555 A  U   2709 O4    ? ? 0 A   2684 0 U   2710 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2584 hydrog ? ? A  C   2684 N3    ? ? ? 1_555 A  G   2708 N1    ? ? 0 C   2685 0 G   2709 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2585 hydrog ? ? A  C   2684 N4    ? ? ? 1_555 A  G   2708 O6    ? ? 0 C   2685 0 G   2709 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2586 hydrog ? ? A  C   2684 O2    ? ? ? 1_555 A  G   2708 N2    ? ? 0 C   2685 0 G   2709 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2587 hydrog ? ? A  C   2685 N3    ? ? ? 1_555 A  G   2707 N1    ? ? 0 C   2686 0 G   2708 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2588 hydrog ? ? A  C   2685 N4    ? ? ? 1_555 A  G   2707 O6    ? ? 0 C   2686 0 G   2708 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2589 hydrog ? ? A  C   2685 O2    ? ? ? 1_555 A  G   2707 N2    ? ? 0 C   2686 0 G   2708 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2590 hydrog ? ? A  G   2686 N1    ? ? ? 1_555 A  C   2706 N3    ? ? 0 G   2687 0 C   2707 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2591 hydrog ? ? A  G   2686 N2    ? ? ? 1_555 A  C   2706 O2    ? ? 0 G   2687 0 C   2707 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2592 hydrog ? ? A  G   2686 O6    ? ? ? 1_555 A  C   2706 N4    ? ? 0 G   2687 0 C   2707 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2593 hydrog ? ? A  U   2687 N3    ? ? ? 1_555 A  A   2705 N1    ? ? 0 U   2688 0 A   2706 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2594 hydrog ? ? A  U   2687 O4    ? ? ? 1_555 A  A   2705 N6    ? ? 0 U   2688 0 A   2706 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2595 hydrog ? ? A  A   2688 N1    ? ? ? 1_555 A  U   2704 N3    ? ? 0 A   2689 0 U   2705 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2596 hydrog ? ? A  A   2688 N6    ? ? ? 1_555 A  U   2704 O4    ? ? 0 A   2689 0 U   2705 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2597 hydrog ? ? A  U   2689 O2    ? ? ? 1_555 A  C   2703 N4    ? ? 0 U   2690 0 C   2704 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog2598 hydrog ? ? A  A   2690 N6    ? ? ? 1_555 A  A   2702 N7    ? ? 0 A   2691 0 A   2703 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2599 hydrog ? ? A  A   2690 N7    ? ? ? 1_555 A  A   2702 N6    ? ? 0 A   2691 0 A   2703 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2600 hydrog ? ? A  G   2691 N2    ? ? ? 1_555 A  U   2692 O4    ? ? 0 G   2692 0 U   2693 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2601 hydrog ? ? A  U   2692 N3    ? ? ? 1_555 A  A   2701 N7    ? ? 0 U   2693 0 A   2702 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2602 hydrog ? ? A  U   2692 O2    ? ? ? 1_555 A  A   2701 N6    ? ? 0 U   2693 0 A   2702 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2603 hydrog ? ? A  A   2693 N6    ? ? ? 1_555 A  G   2700 N3    ? ? 0 A   2694 0 G   2701 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2604 hydrog ? ? A  A   2693 N7    ? ? ? 1_555 A  G   2700 N2    ? ? 0 A   2694 0 G   2701 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2605 hydrog ? ? A  C   2694 N3    ? ? ? 1_555 A  G   2699 N1    ? ? 0 C   2695 0 G   2700 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2606 hydrog ? ? A  C   2694 N4    ? ? ? 1_555 A  G   2699 O6    ? ? 0 C   2695 0 G   2700 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2607 hydrog ? ? A  C   2694 O2    ? ? ? 1_555 A  G   2699 N2    ? ? 0 C   2695 0 G   2700 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2608 hydrog ? ? A  G   2695 N2    ? ? ? 1_555 A  A   2698 N7    ? ? 0 G   2696 0 A   2699 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2609 hydrog ? ? A  G   2712 N1    ? ? ? 1_555 A  C   2766 N3    ? ? 0 G   2713 0 C   2767 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2610 hydrog ? ? A  G   2712 N2    ? ? ? 1_555 A  C   2766 O2    ? ? 0 G   2713 0 C   2767 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2611 hydrog ? ? A  G   2712 O6    ? ? ? 1_555 A  C   2766 N4    ? ? 0 G   2713 0 C   2767 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2612 hydrog ? ? A  U   2713 N3    ? ? ? 1_555 A  A   2765 N1    ? ? 0 U   2714 0 A   2766 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2613 hydrog ? ? A  U   2713 O4    ? ? ? 1_555 A  A   2765 N6    ? ? 0 U   2714 0 A   2766 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2614 hydrog ? ? A  G   2714 N1    ? ? ? 1_555 A  C   2764 N3    ? ? 0 G   2715 0 C   2765 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2615 hydrog ? ? A  G   2714 N2    ? ? ? 1_555 A  C   2764 O2    ? ? 0 G   2715 0 C   2765 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2616 hydrog ? ? A  G   2714 O6    ? ? ? 1_555 A  C   2764 N4    ? ? 0 G   2715 0 C   2765 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2617 hydrog ? ? A  G   2715 N1    ? ? ? 1_555 A  C   2763 N3    ? ? 0 G   2716 0 C   2764 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2618 hydrog ? ? A  G   2715 N2    ? ? ? 1_555 A  C   2763 O2    ? ? 0 G   2716 0 C   2764 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2619 hydrog ? ? A  G   2715 O6    ? ? ? 1_555 A  C   2763 N4    ? ? 0 G   2716 0 C   2764 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2620 hydrog ? ? A  C   2716 N3    ? ? ? 1_555 A  G   2762 N1    ? ? 0 C   2717 0 G   2763 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2621 hydrog ? ? A  C   2716 N4    ? ? ? 1_555 A  G   2762 O6    ? ? 0 C   2717 0 G   2763 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2622 hydrog ? ? A  C   2716 O2    ? ? ? 1_555 A  G   2762 N2    ? ? 0 C   2717 0 G   2763 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2623 hydrog ? ? A  C   2717 N3    ? ? ? 1_555 A  A   2760 N6    ? ? 0 C   2718 0 A   2761 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog2624 hydrog ? ? A  C   2717 N4    ? ? ? 1_555 A  A   2760 N7    ? ? 0 C   2718 0 A   2761 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog2625 hydrog ? ? A  C   2719 N4    ? ? ? 1_555 A  G   2762 N3    ? ? 0 C   2720 0 G   2763 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2626 hydrog ? ? A  U   2720 N3    ? ? ? 1_555 A  A   2760 N1    ? ? 0 U   2721 0 A   2761 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2627 hydrog ? ? A  U   2720 O4    ? ? ? 1_555 A  A   2760 N6    ? ? 0 U   2721 0 A   2761 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2628 hydrog ? ? A  G   2721 N1    ? ? ? 1_555 A  C   2759 N3    ? ? 0 G   2722 0 C   2760 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2629 hydrog ? ? A  G   2721 N2    ? ? ? 1_555 A  C   2759 O2    ? ? 0 G   2722 0 C   2760 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2630 hydrog ? ? A  G   2721 O6    ? ? ? 1_555 A  C   2759 N4    ? ? 0 G   2722 0 C   2760 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2631 hydrog ? ? A  G   2722 N1    ? ? ? 1_555 A  C   2758 N3    ? ? 0 G   2723 0 C   2759 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2632 hydrog ? ? A  G   2722 N2    ? ? ? 1_555 A  C   2758 O2    ? ? 0 G   2723 0 C   2759 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2633 hydrog ? ? A  G   2722 O6    ? ? ? 1_555 A  C   2758 N4    ? ? 0 G   2723 0 C   2759 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2634 hydrog ? ? A  U   2723 N3    ? ? ? 1_555 A  G   2757 O6    ? ? 0 U   2724 0 G   2758 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2635 hydrog ? ? A  U   2723 O2    ? ? ? 1_555 A  G   2757 N1    ? ? 0 U   2724 0 G   2758 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2636 hydrog ? ? A  G   2724 N2    ? ? ? 1_555 A  A   2756 N7    ? ? 0 G   2725 0 A   2757 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2637 hydrog ? ? A  G   2724 N3    ? ? ? 1_555 A  A   2756 N6    ? ? 0 G   2725 0 A   2757 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2638 hydrog ? ? A  A   2726 N7    ? ? ? 1_555 A  G   2754 N2    ? ? 0 A   2727 0 G   2755 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2639 hydrog ? ? A  C   2727 N3    ? ? ? 1_555 A  G   2753 N1    ? ? 0 C   2728 0 G   2754 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2640 hydrog ? ? A  C   2727 N4    ? ? ? 1_555 A  G   2753 O6    ? ? 0 C   2728 0 G   2754 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2641 hydrog ? ? A  C   2727 O2    ? ? ? 1_555 A  G   2753 N2    ? ? 0 C   2728 0 G   2754 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2642 hydrog ? ? A  C   2728 N3    ? ? ? 1_555 A  G   2752 N1    ? ? 0 C   2729 0 G   2753 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2643 hydrog ? ? A  C   2728 N4    ? ? ? 1_555 A  G   2752 O6    ? ? 0 C   2729 0 G   2753 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2644 hydrog ? ? A  C   2728 O2    ? ? ? 1_555 A  G   2752 N2    ? ? 0 C   2729 0 G   2753 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2645 hydrog ? ? A  G   2729 N1    ? ? ? 1_555 A  C   2751 N3    ? ? 0 G   2730 0 C   2752 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2646 hydrog ? ? A  G   2729 N2    ? ? ? 1_555 A  C   2751 O2    ? ? 0 G   2730 0 C   2752 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2647 hydrog ? ? A  G   2729 O6    ? ? ? 1_555 A  C   2751 N4    ? ? 0 G   2730 0 C   2752 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2648 hydrog ? ? A  G   2730 N1    ? ? ? 1_555 A  C   2750 N3    ? ? 0 G   2731 0 C   2751 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2649 hydrog ? ? A  G   2730 N2    ? ? ? 1_555 A  C   2750 O2    ? ? 0 G   2731 0 C   2751 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2650 hydrog ? ? A  G   2730 O6    ? ? ? 1_555 A  C   2750 N4    ? ? 0 G   2731 0 C   2751 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2651 hydrog ? ? A  U   2731 N3    ? ? ? 1_555 A  G   2749 O6    ? ? 0 U   2732 0 G   2750 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2652 hydrog ? ? A  U   2731 O2    ? ? ? 1_555 A  G   2749 N1    ? ? 0 U   2732 0 G   2750 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2653 hydrog ? ? A  U   2732 N3    ? ? ? 1_555 A  A   2745 N1    ? ? 0 U   2733 0 A   2746 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2654 hydrog ? ? A  U   2732 O4    ? ? ? 1_555 A  A   2745 N6    ? ? 0 U   2733 0 A   2746 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2655 hydrog ? ? A  G   2733 N1    ? ? ? 1_555 A  C   2744 N3    ? ? 0 G   2734 0 C   2745 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2656 hydrog ? ? A  G   2733 N2    ? ? ? 1_555 A  C   2744 O2    ? ? 0 G   2734 0 C   2745 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2657 hydrog ? ? A  G   2733 O6    ? ? ? 1_555 A  C   2744 N4    ? ? 0 G   2734 0 C   2745 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2658 hydrog ? ? A  U   2734 N3    ? ? ? 1_555 A  G   2743 O6    ? ? 0 U   2735 0 G   2744 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2659 hydrog ? ? A  U   2734 O2    ? ? ? 1_555 A  G   2743 N1    ? ? 0 U   2735 0 G   2744 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2660 hydrog ? ? A  U   2735 N3    ? ? ? 1_555 A  A   2742 N1    ? ? 0 U   2736 0 A   2743 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2661 hydrog ? ? A  U   2735 O4    ? ? ? 1_555 A  A   2742 N6    ? ? 0 U   2736 0 A   2743 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2662 hydrog ? ? A  C   2736 N3    ? ? ? 1_555 A  G   2741 N1    ? ? 0 C   2737 0 G   2742 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2663 hydrog ? ? A  C   2736 N4    ? ? ? 1_555 A  G   2741 O6    ? ? 0 C   2737 0 G   2742 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2664 hydrog ? ? A  C   2736 O2    ? ? ? 1_555 A  G   2741 N2    ? ? 0 C   2737 0 G   2742 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2665 hydrog ? ? A  U   2755 N3    ? ? ? 1_555 A  A   2895 N1    ? ? 0 U   2756 0 A   2896 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2666 hydrog ? ? A  A   2767 N6    ? ? ? 1_555 A  A   2804 N3    ? ? 0 A   2768 0 A   2805 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2667 hydrog ? ? A  C   2768 N4    ? ? ? 1_555 A  A   2804 N3    ? ? 0 C   2769 0 A   2805 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2668 hydrog ? ? A  G   2769 N1    ? ? ? 1_555 A  C   2803 N3    ? ? 0 G   2770 0 C   2804 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2669 hydrog ? ? A  G   2769 N2    ? ? ? 1_555 A  C   2803 O2    ? ? 0 G   2770 0 C   2804 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2670 hydrog ? ? A  G   2769 O6    ? ? ? 1_555 A  C   2803 N4    ? ? 0 G   2770 0 C   2804 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2671 hydrog ? ? A  G   2770 N1    ? ? ? 1_555 A  C   2802 N3    ? ? 0 G   2771 0 C   2803 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2672 hydrog ? ? A  G   2770 N2    ? ? ? 1_555 A  C   2802 O2    ? ? 0 G   2771 0 C   2803 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2673 hydrog ? ? A  G   2770 O6    ? ? ? 1_555 A  C   2802 N4    ? ? 0 G   2771 0 C   2803 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2674 hydrog ? ? A  G   2771 N1    ? ? ? 1_555 A  C   2801 N3    ? ? 0 G   2772 0 C   2802 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2675 hydrog ? ? A  G   2771 N2    ? ? ? 1_555 A  C   2801 O2    ? ? 0 G   2772 0 C   2802 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2676 hydrog ? ? A  G   2771 O6    ? ? ? 1_555 A  C   2801 N4    ? ? 0 G   2772 0 C   2802 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2677 hydrog ? ? A  G   2772 N1    ? ? ? 1_555 A  A   2800 N1    ? ? 0 G   2773 0 A   2801 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2678 hydrog ? ? A  G   2772 O6    ? ? ? 1_555 A  A   2800 N6    ? ? 0 G   2773 0 A   2801 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2679 hydrog ? ? A  U   2773 N3    ? ? ? 1_555 A  A   2798 N7    ? ? 0 U   2774 0 A   2799 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2680 hydrog ? ? A  U   2773 O2    ? ? ? 1_555 A  A   2798 N6    ? ? 0 U   2774 0 A   2799 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2681 hydrog ? ? A  A   2775 N6    ? ? ? 1_555 A  G   2797 N3    ? ? 0 A   2776 0 G   2798 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2682 hydrog ? ? A  A   2775 N7    ? ? ? 1_555 A  G   2797 N2    ? ? 0 A   2776 0 G   2798 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2683 hydrog ? ? A  G   2776 N1    ? ? ? 1_555 A  C   2796 N3    ? ? 0 G   2777 0 C   2797 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2684 hydrog ? ? A  G   2776 N2    ? ? ? 1_555 A  C   2796 O2    ? ? 0 G   2777 0 C   2797 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2685 hydrog ? ? A  G   2776 O6    ? ? ? 1_555 A  C   2796 N4    ? ? 0 G   2777 0 C   2797 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2686 hydrog ? ? A  A   2777 N1    ? ? ? 1_555 A  U   2795 N3    ? ? 0 A   2778 0 U   2796 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2687 hydrog ? ? A  A   2777 N6    ? ? ? 1_555 A  U   2795 O4    ? ? 0 A   2778 0 U   2796 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2688 hydrog ? ? A  G   2778 N1    ? ? ? 1_555 A  C   2794 N3    ? ? 0 G   2779 0 C   2795 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2689 hydrog ? ? A  G   2778 N2    ? ? ? 1_555 A  C   2794 O2    ? ? 0 G   2779 0 C   2795 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2690 hydrog ? ? A  G   2778 O6    ? ? ? 1_555 A  C   2794 N4    ? ? 0 G   2779 0 C   2795 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2691 hydrog ? ? A  C   2779 N3    ? ? ? 1_555 A  G   2793 N1    ? ? 0 C   2780 0 G   2794 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2692 hydrog ? ? A  C   2779 N4    ? ? ? 1_555 A  G   2793 O6    ? ? 0 C   2780 0 G   2794 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2693 hydrog ? ? A  C   2779 O2    ? ? ? 1_555 A  G   2793 N2    ? ? 0 C   2780 0 G   2794 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2694 hydrog ? ? A  U   2780 N3    ? ? ? 1_555 A  U   2790 O4    ? ? 0 U   2781 0 U   2791 1_555 ? ? ? ? ? ? 'U-U MISPAIR' ? 
? 
hydrog2695 hydrog ? ? A  U   2780 O2    ? ? ? 1_555 A  A   2792 N6    ? ? 0 U   2781 0 A   2793 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2696 hydrog ? ? A  G   2781 N2    ? ? ? 1_555 A  A   2791 N7    ? ? 0 G   2782 0 A   2792 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2697 hydrog ? ? A  G   2781 N3    ? ? ? 1_555 A  A   2791 N6    ? ? 0 G   2782 0 A   2792 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2698 hydrog ? ? A  A   2782 N6    ? ? ? 1_555 A  U   2788 O2    ? ? 0 A   2783 0 U   2789 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2699 hydrog ? ? A  A   2782 N7    ? ? ? 1_555 A  U   2788 N3    ? ? 0 A   2783 0 U   2789 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2700 hydrog ? ? A  A   2783 N6    ? ? ? 1_555 A  A   2787 N1    ? ? 0 A   2784 0 A   2788 1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog2701 hydrog ? ? A  A   2783 N7    ? ? ? 1_555 A  A   2787 N6    ? ? 0 A   2784 0 A   2788 1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog2702 hydrog ? ? A  C   2784 O2    ? ? ? 1_555 A  C   2786 N4    ? ? 0 C   2785 0 C   2787 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog2703 hydrog ? ? A  U   2790 N3    ? ? ? 1_555 A  A   2792 N7    ? ? 0 U   2791 0 A   2793 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog2704 hydrog ? ? A  U   2790 O4    ? ? ? 1_555 A  A   2792 N6    ? ? 0 U   2791 0 A   2793 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog2705 hydrog ? ? A  A   2811 N1    ? ? ? 1_555 A  A   2813 N6    ? ? 0 A   2812 0 A   2814 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2706 hydrog ? ? A  G   2822 N2    ? ? ? 1_555 A  A   2913 N3    ? ? 0 G   2823 0 A   2914 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2707 hydrog ? ? A  G   2825 N2    ? ? ? 1_555 A  A   2913 N7    ? ? 0 G   2826 0 A   2914 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2708 hydrog ? ? A  G   2825 N3    ? ? ? 1_555 A  A   2913 N6    ? ? 0 G   2826 0 A   2914 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2709 hydrog ? ? A  A   2826 N6    ? ? ? 1_555 A  A   2912 N3    ? ? 0 A   2827 0 A   2913 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2710 hydrog ? ? A  G   2827 N1    ? ? ? 1_555 A  C   2911 N3    ? ? 0 G   2828 0 C   2912 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2711 hydrog ? ? A  G   2827 N2    ? ? ? 1_555 A  C   2911 O2    ? ? 0 G   2828 0 C   2912 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2712 hydrog ? ? A  G   2827 O6    ? ? ? 1_555 A  C   2911 N4    ? ? 0 G   2828 0 C   2912 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2713 hydrog ? ? A  G   2828 N1    ? ? ? 1_555 A  C   2910 N3    ? ? 0 G   2829 0 C   2911 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2714 hydrog ? ? A  G   2828 N2    ? ? ? 1_555 A  C   2910 O2    ? ? 0 G   2829 0 C   2911 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2715 hydrog ? ? A  G   2828 O6    ? ? ? 1_555 A  C   2910 N4    ? ? 0 G   2829 0 C   2911 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2716 hydrog ? ? A  U   2829 N3    ? ? ? 1_555 A  A   2909 N1    ? ? 0 U   2830 0 A   2910 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2717 hydrog ? ? A  U   2829 O4    ? ? ? 1_555 A  A   2909 N6    ? ? 0 U   2830 0 A   2910 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2718 hydrog ? ? A  C   2830 O2    ? ? ? 1_555 A  G   2908 N2    ? ? 0 C   2831 0 G   2909 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2719 hydrog ? ? A  C   2831 N3    ? ? ? 1_555 A  G   2847 N1    ? ? 0 C   2832 0 G   2848 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2720 hydrog ? ? A  C   2831 N4    ? ? ? 1_555 A  G   2847 O6    ? ? 0 C   2832 0 G   2848 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2721 hydrog ? ? A  C   2831 O2    ? ? ? 1_555 A  G   2847 N2    ? ? 0 C   2832 0 G   2848 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2722 hydrog ? ? A  C   2831 O2    ? ? ? 1_555 A  A   2907 N6    ? ? 0 C   2832 0 A   2908 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2723 hydrog ? ? A  C   2832 N3    ? ? ? 1_555 A  G   2846 N1    ? ? 0 C   2833 0 G   2847 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2724 hydrog ? ? A  C   2832 N4    ? ? ? 1_555 A  G   2846 O6    ? ? 0 C   2833 0 G   2847 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2725 hydrog ? ? A  C   2832 O2    ? ? ? 1_555 A  G   2846 N2    ? ? 0 C   2833 0 G   2847 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2726 hydrog ? ? A  G   2833 N1    ? ? ? 1_555 A  C   2845 N3    ? ? 0 G   2834 0 C   2846 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2727 hydrog ? ? A  G   2833 N2    ? ? ? 1_555 A  C   2845 O2    ? ? 0 G   2834 0 C   2846 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2728 hydrog ? ? A  G   2833 O6    ? ? ? 1_555 A  C   2845 N4    ? ? 0 G   2834 0 C   2846 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2729 hydrog ? ? A  C   2834 N3    ? ? ? 1_555 A  G   2844 N1    ? ? 0 C   2835 0 G   2845 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2730 hydrog ? ? A  C   2834 N4    ? ? ? 1_555 A  G   2844 O6    ? ? 0 C   2835 0 G   2845 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2731 hydrog ? ? A  C   2834 O2    ? ? ? 1_555 A  G   2844 N2    ? ? 0 C   2835 0 G   2845 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2732 hydrog ? ? A  G   2835 N1    ? ? ? 1_555 A  C   2843 N3    ? ? 0 G   2836 0 C   2844 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2733 hydrog ? ? A  G   2835 N2    ? ? ? 1_555 A  C   2843 O2    ? ? 0 G   2836 0 C   2844 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2734 hydrog ? ? A  G   2835 O6    ? ? ? 1_555 A  C   2843 N4    ? ? 0 G   2836 0 C   2844 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2735 hydrog ? ? A  A   2837 N3    ? ? ? 1_555 A  A   2842 N6    ? ? 0 A   2838 0 A   2843 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2736 hydrog ? ? A  G   2846 N2    ? ? ? 1_555 A  A   2905 N3    ? ? 0 G   2847 0 A   2906 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2737 hydrog ? ? A  G   2850 N2    ? ? ? 1_555 A  A   2905 N7    ? ? 0 G   2851 0 A   2906 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2738 hydrog ? ? A  G   2850 N3    ? ? ? 1_555 A  A   2905 N6    ? ? 0 G   2851 0 A   2906 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2739 hydrog ? ? A  A   2851 N1    ? ? ? 1_555 A  C   2902 N4    ? ? 0 A   2852 0 C   2903 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog2740 hydrog ? ? A  U   2852 O4    ? ? ? 1_555 A  A   2901 N6    ? ? 0 U   2853 0 A   2902 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2741 hydrog ? ? A  U   2852 N3    ? ? ? 1_555 A  A   2904 N1    ? ? 0 U   2853 0 A   2905 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2742 hydrog ? ? A  U   2852 O4    ? ? ? 1_555 A  A   2904 N6    ? ? 0 U   2853 0 A   2905 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2743 hydrog ? ? A  A   2853 N1    ? ? ? 1_555 A  U   2903 N3    ? ? 0 A   2854 0 U   2904 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2744 hydrog ? ? A  A   2853 N6    ? ? ? 1_555 A  U   2903 O4    ? ? 0 A   2854 0 U   2904 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2745 hydrog ? ? A  G   2854 N1    ? ? ? 1_555 A  C   2902 N3    ? ? 0 G   2855 0 C   2903 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2746 hydrog ? ? A  G   2854 N2    ? ? ? 1_555 A  C   2902 O2    ? ? 0 G   2855 0 C   2903 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2747 hydrog ? ? A  G   2854 O6    ? ? ? 1_555 A  C   2902 N4    ? ? 0 G   2855 0 C   2903 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2748 hydrog ? ? A  A   2855 N6    ? ? ? 1_555 A  C   2900 O2    ? ? 0 A   2856 0 C   2901 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog2749 hydrog ? ? A  C   2856 N3    ? ? ? 1_555 A  G   2899 N1    ? ? 0 C   2857 0 G   2900 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2750 hydrog ? ? A  C   2856 N4    ? ? ? 1_555 A  G   2899 O6    ? ? 0 C   2857 0 G   2900 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2751 hydrog ? ? A  C   2856 O2    ? ? ? 1_555 A  G   2899 N2    ? ? 0 C   2857 0 G   2900 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2752 hydrog ? ? A  U   2857 N3    ? ? ? 1_555 A  A   2898 N1    ? ? 0 U   2858 0 A   2899 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2753 hydrog ? ? A  U   2857 O4    ? ? ? 1_555 A  A   2898 N6    ? ? 0 U   2858 0 A   2899 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2754 hydrog ? ? A  C   2858 N3    ? ? ? 1_555 A  G   2897 N1    ? ? 0 C   2859 0 G   2898 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2755 hydrog ? ? A  C   2858 N4    ? ? ? 1_555 A  G   2897 O6    ? ? 0 C   2859 0 G   2898 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2756 hydrog ? ? A  C   2858 O2    ? ? ? 1_555 A  G   2897 N2    ? ? 0 C   2859 0 G   2898 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2757 hydrog ? ? A  G   2859 N1    ? ? ? 1_555 A  C   2896 N3    ? ? 0 G   2860 0 C   2897 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2758 hydrog ? ? A  G   2859 N2    ? ? ? 1_555 A  C   2896 O2    ? ? 0 G   2860 0 C   2897 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2759 hydrog ? ? A  G   2859 O6    ? ? ? 1_555 A  C   2896 N4    ? ? 0 G   2860 0 C   2897 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2760 hydrog ? ? A  G   2860 N1    ? ? ? 1_555 A  C   2894 N3    ? ? 0 G   2861 0 C   2895 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2761 hydrog ? ? A  G   2860 N2    ? ? ? 1_555 A  C   2894 O2    ? ? 0 G   2861 0 C   2895 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2762 hydrog ? ? A  G   2860 O6    ? ? ? 1_555 A  C   2894 N4    ? ? 0 G   2861 0 C   2895 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2763 hydrog ? ? A  G   2861 N1    ? ? ? 1_555 A  C   2893 N3    ? ? 0 G   2862 0 C   2894 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2764 hydrog ? ? A  G   2861 N2    ? ? ? 1_555 A  C   2893 O2    ? ? 0 G   2862 0 C   2894 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2765 hydrog ? ? A  G   2861 O6    ? ? ? 1_555 A  C   2893 N4    ? ? 0 G   2862 0 C   2894 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2766 hydrog ? ? A  G   2862 N1    ? ? ? 1_555 A  C   2892 N3    ? ? 0 G   2863 0 C   2893 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2767 hydrog ? ? A  G   2862 N2    ? ? ? 1_555 A  C   2892 O2    ? ? 0 G   2863 0 C   2893 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2768 hydrog ? ? A  G   2862 O6    ? ? ? 1_555 A  C   2892 N4    ? ? 0 G   2863 0 C   2893 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2769 hydrog ? ? A  U   2863 N3    ? ? ? 1_555 A  G   2891 O6    ? ? 0 U   2864 0 G   2892 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2770 hydrog ? ? A  U   2863 O2    ? ? ? 1_555 A  G   2891 N1    ? ? 0 U   2864 0 G   2892 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2771 hydrog ? ? A  G   2864 N2    ? ? ? 1_555 A  A   2890 N7    ? ? 0 G   2865 0 A   2891 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2772 hydrog ? ? A  G   2864 N3    ? ? ? 1_555 A  A   2890 N6    ? ? 0 G   2865 0 A   2891 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2773 hydrog ? ? A  C   2867 N4    ? ? ? 1_555 A  U   2888 O4    ? ? 0 C   2868 0 U   2889 1_555 ? ? ? ? ? ? 'C-U MISPAIR' ? 
? 
hydrog2774 hydrog ? ? A  G   2868 N1    ? ? ? 1_555 A  U   2887 O2    ? ? 0 G   2869 0 U   2888 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2775 hydrog ? ? A  G   2868 O6    ? ? ? 1_555 A  U   2887 N3    ? ? 0 G   2869 0 U   2888 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2776 hydrog ? ? A  C   2869 N3    ? ? ? 1_555 A  G   2886 N1    ? ? 0 C   2870 0 G   2887 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2777 hydrog ? ? A  C   2869 N4    ? ? ? 1_555 A  G   2886 O6    ? ? 0 C   2870 0 G   2887 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2778 hydrog ? ? A  C   2869 O2    ? ? ? 1_555 A  G   2886 N2    ? ? 0 C   2870 0 G   2887 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2779 hydrog ? ? A  G   2870 N1    ? ? ? 1_555 A  C   2885 N3    ? ? 0 G   2871 0 C   2886 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2780 hydrog ? ? A  G   2870 N2    ? ? ? 1_555 A  C   2885 O2    ? ? 0 G   2871 0 C   2886 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2781 hydrog ? ? A  G   2870 O6    ? ? ? 1_555 A  C   2885 N4    ? ? 0 G   2871 0 C   2886 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2782 hydrog ? ? A  U   2871 N3    ? ? ? 1_555 A  A   2884 N1    ? ? 0 U   2872 0 A   2885 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2783 hydrog ? ? A  U   2871 O4    ? ? ? 1_555 A  A   2884 N6    ? ? 0 U   2872 0 A   2885 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2784 hydrog ? ? A  C   2872 N3    ? ? ? 1_555 A  G   2883 N1    ? ? 0 C   2873 0 G   2884 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2785 hydrog ? ? A  C   2872 N4    ? ? ? 1_555 A  G   2883 O6    ? ? 0 C   2873 0 G   2884 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2786 hydrog ? ? A  C   2872 O2    ? ? ? 1_555 A  G   2883 N2    ? ? 0 C   2873 0 G   2884 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2787 hydrog ? ? A  G   2873 N2    ? ? ? 1_555 A  A   2882 N7    ? ? 0 G   2874 0 A   2883 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2788 hydrog ? ? A  G   2873 N3    ? ? ? 1_555 A  A   2882 N6    ? ? 0 G   2874 0 A   2883 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2789 hydrog ? ? A  A   2874 N6    ? ? ? 1_555 A  G   2881 N3    ? ? 0 A   2875 0 G   2882 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2790 hydrog ? ? A  A   2874 N7    ? ? ? 1_555 A  G   2881 N2    ? ? 0 A   2875 0 G   2882 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2791 hydrog ? ? A  G   2875 N1    ? ? ? 1_555 A  C   2880 N3    ? ? 0 G   2876 0 C   2881 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2792 hydrog ? ? A  G   2875 N2    ? ? ? 1_555 A  C   2880 O2    ? ? 0 G   2876 0 C   2881 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2793 hydrog ? ? A  G   2875 O6    ? ? ? 1_555 A  C   2880 N4    ? ? 0 G   2876 0 C   2881 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2794 hydrog ? ? A  G   2876 N2    ? ? ? 1_555 A  A   2879 N7    ? ? 0 G   2877 0 A   2880 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2795 hydrog ? ? A  A   2901 N7    ? ? ? 1_555 A  A   2904 N6    ? ? 0 A   2902 0 A   2905 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2796 hydrog ? ? B  A   3    N3    ? ? ? 1_555 B  G   21   N2    ? ? 9 A   3    9 G   21   1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2797 hydrog ? ? B  A   3    N6    ? ? ? 1_555 B  G   25   O6    ? ? 9 A   3    9 G   25   1_555 ? ? ? ? ? ? TYPE_9_PAIR ? ? 
hydrog2798 hydrog ? ? B  A   3    N7    ? ? ? 1_555 B  G   25   N1    ? ? 9 A   3    9 G   25   1_555 ? ? ? ? ? ? TYPE_9_PAIR ? ? 
hydrog2799 hydrog ? ? B  G   4    N1    ? ? ? 1_555 B  C   119  N3    ? ? 9 G   4    9 C   119  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2800 hydrog ? ? B  G   4    N2    ? ? ? 1_555 B  C   119  O2    ? ? 9 G   4    9 C   119  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2801 hydrog ? ? B  G   4    O6    ? ? ? 1_555 B  C   119  N4    ? ? 9 G   4    9 C   119  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2802 hydrog ? ? B  G   5    N1    ? ? ? 1_555 B  C   118  N3    ? ? 9 G   5    9 C   118  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2803 hydrog ? ? B  G   5    N2    ? ? ? 1_555 B  C   118  O2    ? ? 9 G   5    9 C   118  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2804 hydrog ? ? B  G   5    O6    ? ? ? 1_555 B  C   118  N4    ? ? 9 G   5    9 C   118  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2805 hydrog ? ? B  C   6    N3    ? ? ? 1_555 B  G   117  N1    ? ? 9 C   6    9 G   117  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2806 hydrog ? ? B  C   6    N4    ? ? ? 1_555 B  G   117  O6    ? ? 9 C   6    9 G   117  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2807 hydrog ? ? B  C   6    O2    ? ? ? 1_555 B  G   117  N2    ? ? 9 C   6    9 G   117  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2808 hydrog ? ? B  G   7    N1    ? ? ? 1_555 B  C   116  N3    ? ? 9 G   7    9 C   116  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2809 hydrog ? ? B  G   7    N2    ? ? ? 1_555 B  C   116  O2    ? ? 9 G   7    9 C   116  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2810 hydrog ? ? B  G   7    O6    ? ? ? 1_555 B  C   116  N4    ? ? 9 G   7    9 C   116  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2811 hydrog ? ? B  G   8    N1    ? ? ? 1_555 B  C   115  N3    ? ? 9 G   8    9 C   115  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2812 hydrog ? ? B  G   8    N2    ? ? ? 1_555 B  C   115  O2    ? ? 9 G   8    9 C   115  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2813 hydrog ? ? B  G   8    O6    ? ? ? 1_555 B  C   115  N4    ? ? 9 G   8    9 C   115  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2814 hydrog ? ? B  C   9    N3    ? ? ? 1_555 B  G   114  N1    ? ? 9 C   9    9 G   114  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2815 hydrog ? ? B  C   9    N4    ? ? ? 1_555 B  G   114  O6    ? ? 9 C   9    9 G   114  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2816 hydrog ? ? B  C   9    O2    ? ? ? 1_555 B  G   114  N2    ? ? 9 C   9    9 G   114  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2817 hydrog ? ? B  A   11   N3    ? ? ? 1_555 B  G   68   N2    ? ? 9 A   11   9 G   68   1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2818 hydrog ? ? B  G   14   N1    ? ? ? 1_555 B  C   67   N3    ? ? 9 G   14   9 C   67   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2819 hydrog ? ? B  G   14   N2    ? ? ? 1_555 B  C   67   O2    ? ? 9 G   14   9 C   67   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2820 hydrog ? ? B  G   14   O6    ? ? ? 1_555 B  C   67   N4    ? ? 9 G   14   9 C   67   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2821 hydrog ? ? B  C   15   N3    ? ? ? 1_555 B  G   66   N1    ? ? 9 C   15   9 G   66   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2822 hydrog ? ? B  C   15   N4    ? ? ? 1_555 B  G   66   O6    ? ? 9 C   15   9 G   66   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2823 hydrog ? ? B  C   15   O2    ? ? ? 1_555 B  G   66   N2    ? ? 9 C   15   9 G   66   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2824 hydrog ? ? B  C   15   N4    ? ? ? 1_555 B  C   113  O2    ? ? 9 C   15   9 C   113  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog2825 hydrog ? ? B  G   16   N1    ? ? ? 1_555 B  C   64   N3    ? ? 9 G   16   9 C   64   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2826 hydrog ? ? B  G   16   N2    ? ? ? 1_555 B  C   64   O2    ? ? 9 G   16   9 C   64   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2827 hydrog ? ? B  G   16   O6    ? ? ? 1_555 B  C   64   N4    ? ? 9 G   16   9 C   64   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2828 hydrog ? ? B  G   17   N1    ? ? ? 1_555 B  C   63   N3    ? ? 9 G   17   9 C   63   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2829 hydrog ? ? B  G   17   N2    ? ? ? 1_555 B  C   63   O2    ? ? 9 G   17   9 C   63   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2830 hydrog ? ? B  G   17   O6    ? ? ? 1_555 B  C   63   N4    ? ? 9 G   17   9 C   63   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2831 hydrog ? ? B  U   18   N3    ? ? ? 1_555 B  A   62   N1    ? ? 9 U   18   9 A   62   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2832 hydrog ? ? B  U   18   O4    ? ? ? 1_555 B  A   62   N6    ? ? 9 U   18   9 A   62   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2833 hydrog ? ? B  G   19   N1    ? ? ? 1_555 B  C   61   N3    ? ? 9 G   19   9 C   61   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2834 hydrog ? ? B  G   19   N2    ? ? ? 1_555 B  C   61   O2    ? ? 9 G   19   9 C   61   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2835 hydrog ? ? B  G   19   O6    ? ? ? 1_555 B  C   61   N4    ? ? 9 G   19   9 C   61   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2836 hydrog ? ? B  G   20   N1    ? ? ? 1_555 B  C   60   N3    ? ? 9 G   20   9 C   60   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2837 hydrog ? ? B  G   20   N2    ? ? ? 1_555 B  C   60   O2    ? ? 9 G   20   9 C   60   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2838 hydrog ? ? B  G   20   O6    ? ? ? 1_555 B  C   60   N4    ? ? 9 G   20   9 C   60   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2839 hydrog ? ? B  G   21   N1    ? ? ? 1_555 B  C   59   N3    ? ? 9 G   21   9 C   59   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2840 hydrog ? ? B  G   21   N2    ? ? ? 1_555 B  C   59   O2    ? ? 9 G   21   9 C   59   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2841 hydrog ? ? B  G   21   O6    ? ? ? 1_555 B  C   59   N4    ? ? 9 G   21   9 C   59   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2842 hydrog ? ? B  G   22   N2    ? ? ? 1_555 B  C   26   N3    ? ? 9 G   22   9 C   26   1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog2843 hydrog ? ? B  G   22   N1    ? ? ? 1_555 B  G   58   O6    ? ? 9 G   22   9 G   58   1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog2844 hydrog ? ? B  C   27   N4    ? ? ? 1_555 B  U   55   O4    ? ? 9 C   27   9 U   55   1_555 ? ? ? ? ? ? 'C-U MISPAIR' ? 
? 
hydrog2845 hydrog ? ? B  C   27   O2    ? ? ? 1_555 B  G   58   N1    ? ? 9 C   27   9 G   58   1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2846 hydrog ? ? B  U   28   N3    ? ? ? 1_555 B  A   54   N1    ? ? 9 U   28   9 A   54   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2847 hydrog ? ? B  U   28   O4    ? ? ? 1_555 B  A   54   N6    ? ? 9 U   28   9 A   54   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2848 hydrog ? ? B  U   28   O2    ? ? ? 1_555 B  A   57   N6    ? ? 9 U   28   9 A   57   1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2849 hydrog ? ? B  C   29   N3    ? ? ? 1_555 B  G   53   N1    ? ? 9 C   29   9 G   53   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2850 hydrog ? ? B  C   29   N4    ? ? ? 1_555 B  G   53   O6    ? ? 9 C   29   9 G   53   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2851 hydrog ? ? B  C   29   O2    ? ? ? 1_555 B  G   53   N2    ? ? 9 C   29   9 G   53   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2852 hydrog ? ? B  C   29   O2    ? ? ? 1_555 B  A   56   N6    ? ? 9 C   29   9 A   56   1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2853 hydrog ? ? B  C   30   N3    ? ? ? 1_555 B  G   50   N1    ? ? 9 C   30   9 G   50   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2854 hydrog ? ? B  C   30   N4    ? ? ? 1_555 B  G   50   O6    ? ? 9 C   30   9 G   50   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2855 hydrog ? ? B  C   30   O2    ? ? ? 1_555 B  G   50   N2    ? ? 9 C   30   9 G   50   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2856 hydrog ? ? B  C   30   O2    ? ? ? 1_555 B  A   52   N6    ? ? 9 C   30   9 A   52   1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2857 hydrog ? ? B  C   31   N3    ? ? ? 1_555 B  G   49   N1    ? ? 9 C   31   9 G   49   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2858 hydrog ? ? B  C   31   N4    ? ? ? 1_555 B  G   49   O6    ? ? 9 C   31   9 G   49   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2859 hydrog ? ? B  C   31   O2    ? ? ? 1_555 B  G   49   N2    ? ? 9 C   31   9 G   49   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2860 hydrog ? ? B  G   32   N1    ? ? ? 1_555 B  C   48   N3    ? ? 9 G   32   9 C   48   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2861 hydrog ? ? B  G   32   N2    ? ? ? 1_555 B  C   48   O2    ? ? 9 G   32   9 C   48   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2862 hydrog ? ? B  G   32   O6    ? ? ? 1_555 B  C   48   N4    ? ? 9 G   32   9 C   48   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2863 hydrog ? ? B  U   33   O2    ? ? ? 1_555 B  C   35   N4    ? ? 9 U   33   9 C   35   1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog2864 hydrog ? ? B  U   33   N3    ? ? ? 1_555 B  A   47   N1    ? ? 9 U   33   9 A   47   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2865 hydrog ? ? B  U   33   O4    ? ? ? 1_555 B  A   47   N6    ? ? 9 U   33   9 A   47   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2866 hydrog ? ? B  C   35   N4    ? ? ? 1_555 B  C   48   O2    ? ? 9 C   35   9 C   48   1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog2867 hydrog ? ? B  C   36   N4    ? ? ? 1_555 B  A   47   N3    ? ? 9 C   36   9 A   47   1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2868 hydrog ? ? B  C   37   N3    ? ? ? 1_555 B  G   43   N1    ? ? 9 C   37   9 G   43   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2869 hydrog ? ? B  C   37   N4    ? ? ? 1_555 B  G   43   O6    ? ? 9 C   37   9 G   43   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2870 hydrog ? ? B  C   37   O2    ? ? ? 1_555 B  G   43   N2    ? ? 9 C   37   9 G   43   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2871 hydrog ? ? B  A   38   N3    ? ? ? 1_555 B  A   45   N6    ? ? 9 A   38   9 A   45   1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2872 hydrog ? ? B  U   39   O2    ? ? ? 1_555 B  A   44   N6    ? ? 9 U   39   9 A   44   1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2873 hydrog ? ? B  G   43   N2    ? ? ? 1_555 B  C   46   O2    ? ? 9 G   43   9 C   46   1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog2874 hydrog ? ? B  A   51   N3    ? ? ? 1_555 B  A   52   N6    ? ? 9 A   51   9 A   52   1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2875 hydrog ? ? B  A   54   N3    ? ? ? 1_555 B  A   56   N6    ? ? 9 A   54   9 A   56   1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2876 hydrog ? ? B  A   65   N3    ? ? ? 1_555 B  C   67   N4    ? ? 9 A   65   9 C   67   1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog2877 hydrog ? ? B  G   66   O6    ? ? ? 1_555 B  C   113  N4    ? ? 9 G   66   9 C   113  1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog2878 hydrog ? ? B  U   69   N3    ? ? ? 1_555 B  U   112  O2    ? ? 9 U   69   9 U   112  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2879 hydrog ? ? B  U   69   O4    ? ? ? 1_555 B  U   112  N3    ? ? 9 U   69   9 U   112  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2880 hydrog ? ? B  U   70   N3    ? ? ? 1_555 B  U   111  O2    ? ? 9 U   70   9 U   111  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2881 hydrog ? ? B  U   70   O4    ? ? ? 1_555 B  U   111  N3    ? ? 9 U   70   9 U   111  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2882 hydrog ? ? B  C   71   N3    ? ? ? 1_555 B  G   110  N1    ? ? 9 C   71   9 G   110  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2883 hydrog ? ? B  C   71   N4    ? ? ? 1_555 B  G   110  O6    ? ? 9 C   71   9 G   110  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2884 hydrog ? ? B  C   71   O2    ? ? ? 1_555 B  G   110  N2    ? ? 9 C   71   9 G   110  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2885 hydrog ? ? B  C   72   N3    ? ? ? 1_555 B  G   109  N1    ? ? 9 C   72   9 G   109  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2886 hydrog ? ? B  C   72   N4    ? ? ? 1_555 B  G   109  O6    ? ? 9 C   72   9 G   109  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2887 hydrog ? ? B  C   72   O2    ? ? ? 1_555 B  G   109  N2    ? ? 9 C   72   9 G   109  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2888 hydrog ? ? B  G   73   N1    ? ? ? 1_555 B  C   108  N3    ? ? 9 G   73   9 C   108  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2889 hydrog ? ? B  G   73   N2    ? ? ? 1_555 B  C   108  O2    ? ? 9 G   73   9 C   108  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2890 hydrog ? ? B  G   73   O6    ? ? ? 1_555 B  C   108  N4    ? ? 9 G   73   9 C   108  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2891 hydrog ? ? B  G   74   N1    ? ? ? 1_555 B  C   107  N3    ? ? 9 G   74   9 C   107  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2892 hydrog ? ? B  G   74   N2    ? ? ? 1_555 B  C   107  O2    ? ? 9 G   74   9 C   107  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2893 hydrog ? ? B  G   74   O6    ? ? ? 1_555 B  C   107  N4    ? ? 9 G   74   9 C   107  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2894 hydrog ? ? B  G   75   N1    ? ? ? 1_555 B  C   106  N3    ? ? 9 G   75   9 C   106  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2895 hydrog ? ? B  G   75   N2    ? ? ? 1_555 B  C   106  O2    ? ? 9 G   75   9 C   106  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2896 hydrog ? ? B  G   75   O6    ? ? ? 1_555 B  C   106  N4    ? ? 9 G   75   9 C   106  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2897 hydrog ? ? B  G   76   N2    ? ? ? 1_555 B  A   105  N7    ? ? 9 G   76   9 A   105  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2898 hydrog ? ? B  G   76   N3    ? ? ? 1_555 B  A   105  N6    ? ? 9 G   76   9 A   105  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2899 hydrog ? ? B  A   77   N6    ? ? ? 1_555 B  A   104  N7    ? ? 9 A   77   9 A   104  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2900 hydrog ? ? B  A   77   N7    ? ? ? 1_555 B  A   104  N6    ? ? 9 A   77   9 A   104  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2901 hydrog ? ? B  G   78   N2    ? ? ? 1_555 B  U   79   O4    ? ? 9 G   78   9 U   79   1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2902 hydrog ? ? B  U   79   N3    ? ? ? 1_555 B  A   103  N7    ? ? 9 U   79   9 A   103  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2903 hydrog ? ? B  U   79   O2    ? ? ? 1_555 B  A   103  N6    ? ? 9 U   79   9 A   103  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2904 hydrog ? ? B  A   80   N6    ? ? ? 1_555 B  G   102  N3    ? ? 9 A   80   9 G   102  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2905 hydrog ? ? B  A   80   N7    ? ? ? 1_555 B  G   102  N2    ? ? 9 A   80   9 G   102  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2906 hydrog ? ? B  C   81   N3    ? ? ? 1_555 B  G   101  N1    ? ? 9 C   81   9 G   101  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2907 hydrog ? ? B  C   81   N4    ? ? ? 1_555 B  G   101  O6    ? ? 9 C   81   9 G   101  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2908 hydrog ? ? B  C   81   O2    ? ? ? 1_555 B  G   101  N2    ? ? 9 C   81   9 G   101  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2909 hydrog ? ? B  U   82   N3    ? ? ? 1_555 B  G   100  O6    ? ? 9 U   82   9 G   100  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2910 hydrog ? ? B  U   82   O2    ? ? ? 1_555 B  G   100  N1    ? ? 9 U   82   9 G   100  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2911 hydrog ? ? B  G   83   N1    ? ? ? 1_555 B  U   99   O2    ? ? 9 G   83   9 U   99   1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2912 hydrog ? ? B  G   83   O6    ? ? ? 1_555 B  U   99   N3    ? ? 9 G   83   9 U   99   1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2913 hydrog ? ? B  G   84   N1    ? ? ? 1_555 B  C   98   N3    ? ? 9 G   84   9 C   98   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2914 hydrog ? ? B  G   84   N2    ? ? ? 1_555 B  C   98   O2    ? ? 9 G   84   9 C   98   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2915 hydrog ? ? B  G   84   O6    ? ? ? 1_555 B  C   98   N4    ? ? 9 G   84   9 C   98   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2916 hydrog ? ? B  A   85   N1    ? ? ? 1_555 B  U   97   N3    ? ? 9 A   85   9 U   97   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2917 hydrog ? ? B  A   85   N6    ? ? ? 1_555 B  U   97   O4    ? ? 9 A   85   9 U   97   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2918 hydrog ? ? B  G   86   N1    ? ? ? 1_555 B  C   96   N3    ? ? 9 G   86   9 C   96   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2919 hydrog ? ? B  G   86   N2    ? ? ? 1_555 B  C   96   O2    ? ? 9 G   86   9 C   96   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2920 hydrog ? ? B  G   86   O6    ? ? ? 1_555 B  C   96   N4    ? ? 9 G   86   9 C   96   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2921 hydrog ? ? B  G   88   N1    ? ? ? 1_555 B  C   95   N3    ? ? 9 G   88   9 C   95   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2922 hydrog ? ? B  G   88   N2    ? ? ? 1_555 B  C   95   O2    ? ? 9 G   88   9 C   95   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2923 hydrog ? ? B  G   88   O6    ? ? ? 1_555 B  C   95   N4    ? ? 9 G   88   9 C   95   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2924 hydrog ? ? B  C   89   N3    ? ? ? 1_555 B  G   94   N1    ? ? 9 C   89   9 G   94   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2925 hydrog ? ? B  C   89   N4    ? ? ? 1_555 B  G   94   O6    ? ? 9 C   89   9 G   94   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2926 hydrog ? ? B  C   89   O2    ? ? ? 1_555 B  G   94   N2    ? ? 9 C   89   9 G   94   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2927 hydrog ? ? B  G   90   N2    ? ? ? 1_555 B  A   93   N7    ? ? 9 G   90   9 A   93   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TRP 187 C . ? TRP 186 A PRO 188 C ? PRO 187 A 1 -0.58 
2 GLY 15  D . ? GLY 14  B PRO 16  D ? PRO 15  B 1 -0.37 
3 ASN 244 D . ? ASN 243 B PRO 245 D ? PRO 244 B 1 0.19  
4 VAL 136 E . ? VAL 136 C PRO 137 E ? PRO 137 C 1 0.05  
5 GLN 56  H . ? GLN 55  F PRO 57  H ? PRO 56  F 1 0.45  
6 ARG 184 O . ? ARG 184 M PRO 185 O ? PRO 185 M 1 -0.05 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 4 ? 
B  ? 6 ? 
C  ? 2 ? 
D  ? 5 ? 
E  ? 5 ? 
F  ? 8 ? 
G  ? 2 ? 
H  ? 6 ? 
I  ? 2 ? 
J  ? 2 ? 
K  ? 5 ? 
L  ? 3 ? 
M  ? 3 ? 
N  ? 4 ? 
O  ? 3 ? 
P  ? 4 ? 
Q  ? 5 ? 
R  ? 3 ? 
S  ? 2 ? 
T  ? 3 ? 
U  ? 2 ? 
V  ? 5 ? 
W  ? 2 ? 
X  ? 6 ? 
Y  ? 2 ? 
Z  ? 3 ? 
AA ? 3 ? 
AB ? 4 ? 
AC ? 4 ? 
AD ? 4 ? 
AE ? 3 ? 
AF ? 2 ? 
AG ? 5 ? 
AH ? 3 ? 
AI ? 2 ? 
AJ ? 2 ? 
AK ? 4 ? 
AL ? 6 ? 
AM ? 2 ? 
AN ? 5 ? 
AO ? 4 ? 
AP ? 2 ? 
AQ ? 2 ? 
AR ? 3 ? 
AS ? 3 ? 
AT ? 2 ? 
AU ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? anti-parallel 
A  2 3 ? anti-parallel 
A  3 4 ? anti-parallel 
B  1 2 ? anti-parallel 
B  2 3 ? anti-parallel 
B  3 4 ? anti-parallel 
B  4 5 ? anti-parallel 
B  5 6 ? anti-parallel 
C  1 2 ? parallel      
D  1 2 ? anti-parallel 
D  2 3 ? anti-parallel 
D  3 4 ? anti-parallel 
D  4 5 ? anti-parallel 
E  1 2 ? anti-parallel 
E  2 3 ? anti-parallel 
E  3 4 ? anti-parallel 
E  4 5 ? anti-parallel 
F  1 2 ? anti-parallel 
F  2 3 ? anti-parallel 
F  3 4 ? anti-parallel 
F  4 5 ? anti-parallel 
F  5 6 ? anti-parallel 
F  6 7 ? anti-parallel 
F  7 8 ? anti-parallel 
G  1 2 ? anti-parallel 
H  1 2 ? anti-parallel 
H  2 3 ? parallel      
H  3 4 ? parallel      
H  4 5 ? parallel      
H  5 6 ? parallel      
I  1 2 ? anti-parallel 
J  1 2 ? anti-parallel 
K  1 2 ? anti-parallel 
K  2 3 ? anti-parallel 
K  3 4 ? anti-parallel 
K  4 5 ? anti-parallel 
L  1 2 ? anti-parallel 
L  2 3 ? anti-parallel 
M  1 2 ? anti-parallel 
M  2 3 ? anti-parallel 
N  1 2 ? anti-parallel 
N  2 3 ? anti-parallel 
N  3 4 ? anti-parallel 
O  1 2 ? anti-parallel 
O  2 3 ? anti-parallel 
P  1 2 ? anti-parallel 
P  2 3 ? anti-parallel 
P  3 4 ? parallel      
Q  1 2 ? anti-parallel 
Q  2 3 ? anti-parallel 
Q  3 4 ? anti-parallel 
Q  4 5 ? anti-parallel 
R  1 2 ? anti-parallel 
R  2 3 ? anti-parallel 
S  1 2 ? parallel      
T  1 2 ? parallel      
T  2 3 ? parallel      
U  1 2 ? anti-parallel 
V  1 2 ? anti-parallel 
V  2 3 ? anti-parallel 
V  3 4 ? parallel      
V  4 5 ? anti-parallel 
W  1 2 ? anti-parallel 
X  1 2 ? anti-parallel 
X  2 3 ? anti-parallel 
X  3 4 ? anti-parallel 
X  4 5 ? anti-parallel 
X  5 6 ? parallel      
Y  1 2 ? parallel      
Z  1 2 ? parallel      
Z  2 3 ? parallel      
AA 1 2 ? parallel      
AA 2 3 ? parallel      
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AC 3 4 ? parallel      
AD 1 2 ? parallel      
AD 2 3 ? parallel      
AD 3 4 ? parallel      
AE 1 2 ? parallel      
AE 2 3 ? parallel      
AF 1 2 ? anti-parallel 
AG 1 2 ? anti-parallel 
AG 2 3 ? anti-parallel 
AG 3 4 ? anti-parallel 
AG 4 5 ? anti-parallel 
AH 1 2 ? anti-parallel 
AH 2 3 ? anti-parallel 
AI 1 2 ? anti-parallel 
AJ 1 2 ? anti-parallel 
AK 1 2 ? anti-parallel 
AK 2 3 ? anti-parallel 
AK 3 4 ? anti-parallel 
AL 1 2 ? anti-parallel 
AL 2 3 ? parallel      
AL 3 4 ? anti-parallel 
AL 4 5 ? anti-parallel 
AL 5 6 ? anti-parallel 
AM 1 2 ? anti-parallel 
AN 1 2 ? anti-parallel 
AN 2 3 ? anti-parallel 
AN 3 4 ? anti-parallel 
AN 4 5 ? parallel      
AO 1 2 ? anti-parallel 
AO 2 3 ? anti-parallel 
AO 3 4 ? parallel      
AP 1 2 ? anti-parallel 
AQ 1 2 ? parallel      
AR 1 2 ? anti-parallel 
AR 2 3 ? anti-parallel 
AS 1 2 ? anti-parallel 
AS 2 3 ? anti-parallel 
AT 1 2 ? parallel      
AU 1 2 ? anti-parallel 
AU 2 3 ? anti-parallel 
AU 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 ARG C  66  ? LEU C  70  ? ARG A 65  LEU A 69  
A  2 PRO C  55  ? PHE C  61  ? PRO A 54  PHE A 60  
A  3 ALA C  40  ? HIS C  48  ? ALA A 39  HIS A 47  
A  4 GLU C  80  ? GLN C  82  ? GLU A 79  GLN A 81  
B  1 THR C  94  ? PRO C  96  ? THR A 93  PRO A 95  
B  2 ARG C  154 ? ILE C  157 ? ARG A 153 ILE A 156 
B  3 PRO C  105 ? CYS C  107 ? PRO A 104 CYS A 106 
B  4 ALA C  127 ? THR C  131 ? ALA A 126 THR A 130 
B  5 ALA C  137 ? LYS C  140 ? ALA A 136 LYS A 139 
B  6 MET C  146 ? LEU C  149 ? MET A 145 LEU A 148 
C  1 SER C  215 ? ILE C  216 ? SER A 214 ILE A 215 
C  2 ASP C  228 ? ILE C  229 ? ASP A 227 ILE A 228 
D  1 GLY D  38  ? VAL D  39  ? GLY B 37  VAL B 38  
D  2 VAL D  162 ? GLY D  168 ? VAL B 161 GLY B 167 
D  3 LEU D  138 ? HIS D  146 ? LEU B 137 HIS B 145 
D  4 MET D  80  ? THR D  91  ? MET B 79  THR B 90  
D  5 GLY D  94  ? TRP D  102 ? GLY B 93  TRP B 101 
E  1 GLY D  38  ? VAL D  39  ? GLY B 37  VAL B 38  
E  2 VAL D  162 ? GLY D  168 ? VAL B 161 GLY B 167 
E  3 LEU D  138 ? HIS D  146 ? LEU B 137 HIS B 145 
E  4 MET D  80  ? THR D  91  ? MET B 79  THR B 90  
E  5 GLU D  188 ? HIS D  189 ? GLU B 187 HIS B 188 
F  1 VAL D  328 ? VAL D  331 ? VAL B 327 VAL B 330 
F  2 PHE D  42  ? LEU D  54  ? PHE B 41  LEU B 53  
F  3 LEU D  309 ? PRO D  314 ? LEU B 308 PRO B 313 
F  4 TYR D  200 ? VAL D  206 ? TYR B 199 VAL B 205 
F  5 GLN D  262 ? GLY D  276 ? GLN B 261 GLY B 275 
F  6 GLY D  293 ? LYS D  299 ? GLY B 292 LYS B 298 
F  7 THR D  69  ? GLU D  76  ? THR B 68  GLU B 75  
F  8 PHE D  42  ? LEU D  54  ? PHE B 41  LEU B 53  
G  1 THR D  212 ? GLN D  213 ? THR B 211 GLN B 212 
G  2 GLY D  256 ? GLN D  257 ? GLY B 255 GLN B 256 
H  1 THR E  12  ? ASP E  17  ? THR C 12  ASP C 17  
H  2 GLN E  2   ? TYR E  6   ? GLN C 2   TYR C 6   
H  3 VAL E  138 ? VAL E  140 ? VAL C 138 VAL C 140 
H  4 THR E  233 ? THR E  236 ? THR C 233 THR C 236 
H  5 LEU E  193 ? THR E  196 ? LEU C 193 THR C 196 
H  6 ASP E  211 ? THR E  214 ? ASP C 211 THR C 214 
I  1 LYS E  72  ? LEU E  73  ? LYS C 72  LEU C 73  
I  2 ARG E  76  ? ALA E  77  ? ARG C 76  ALA C 77  
J  1 LYS E  173 ? ILE E  174 ? LYS C 173 ILE C 174 
J  2 TYR E  186 ? ARG E  187 ? TYR C 186 ARG C 187 
K  1 VAL F  51  ? ARG F  52  ? VAL D 50  ARG D 51  
K  2 ALA F  72  ? ARG F  77  ? ALA D 71  ARG D 76  
K  3 ARG F  18  ? MET F  26  ? ARG D 17  MET D 25  
K  4 ASP F  130 ? VAL F  136 ? ASP D 129 VAL D 135 
K  5 PHE F  105 ? PHE F  107 ? PHE D 104 PHE D 106 
L  1 ARG G  3   ? GLU G  7   ? ARG E 2   GLU E 6   
L  2 THR G  47  ? GLU G  51  ? THR E 46  GLU E 50  
L  3 ASP G  40  ? ASP G  44  ? ASP E 39  ASP E 43  
M  1 ASP G  13  ? ASP G  17  ? ASP E 12  ASP E 16  
M  2 ASP G  20  ? GLY G  25  ? ASP E 19  GLY E 24  
M  3 GLY G  28  ? ARG G  33  ? GLY E 27  ARG E 32  
N  1 ASP G  124 ? ASP G  128 ? ASP E 123 ASP E 127 
N  2 GLU G  131 ? GLY G  136 ? GLU E 130 GLY E 135 
N  3 TRP G  81  ? PHE G  88  ? TRP E 80  PHE E 87  
N  4 GLY G  166 ? ARG G  171 ? GLY E 165 ARG E 170 
O  1 GLN G  95  ? VAL G  98  ? GLN E 94  VAL E 97  
O  2 GLU G  102 ? GLU G  106 ? GLU E 101 GLU E 105 
O  3 ARG G  115 ? THR G  118 ? ARG E 114 THR E 117 
P  1 VAL H  30  ? LYS H  32  ? VAL F 29  LYS F 31  
P  2 ALA H  96  ? VAL H  99  ? ALA F 95  VAL F 98  
P  3 VAL H  49  ? ALA H  52  ? VAL F 48  ALA F 51  
P  4 PHE H  75  ? VAL H  78  ? PHE F 74  VAL F 77  
Q  1 LYS J  32  ? GLY J  34  ? LYS H 32  GLY H 34  
Q  2 TYR J  83  ? LEU J  87  ? TYR H 83  LEU H 87  
Q  3 GLN J  132 ? CYS J  138 ? GLN H 132 CYS H 138 
Q  4 VAL J  45  ? VAL J  51  ? VAL H 45  VAL H 51  
Q  5 CYS J  161 ? SER J  165 ? CYS H 161 SER H 165 
R  1 VAL J  55  ? ARG J  58  ? VAL H 55  ARG H 58  
R  2 LYS J  119 ? VAL J  127 ? LYS H 119 VAL H 127 
R  3 GLN J  93  ? GLU J  97  ? GLN H 93  GLU H 97  
S  1 ALA K  94  ? SER K  97  ? ALA I 98  SER I 101 
S  2 VAL K  133 ? GLU K  136 ? VAL I 137 GLU I 140 
T  1 VAL L  10  ? ASP L  13  ? VAL J 10  ASP J 13  
T  2 VAL L  36  ? VAL L  39  ? VAL J 36  VAL J 39  
T  3 VAL L  101 ? VAL L  103 ? VAL J 101 VAL J 103 
U  1 VAL L  45  ? THR L  47  ? VAL J 45  THR J 47  
U  2 PHE L  129 ? THR L  131 ? PHE J 129 THR J 131 
V  1 ASP M  7   ? VAL M  8   ? ASP K 7   VAL K 8   
V  2 ILE M  80  ? ARG M  81  ? ILE K 80  ARG K 81  
V  3 ARG M  87  ? PHE M  90  ? ARG K 87  PHE K 90  
V  4 THR W  19  ? VAL W  22  ? THR U 19  VAL U 22  
V  5 THR W  28  ? PHE W  31  ? THR U 28  PHE U 31  
W  1 LEU M  12  ? GLU M  13  ? LEU K 12  GLU K 13  
W  2 LYS M  46  ? ALA M  47  ? LYS K 46  ALA K 47  
X  1 LEU M  17  ? CYS M  20  ? LEU K 17  CYS K 20  
X  2 ALA M  26  ? VAL M  34  ? ALA K 26  VAL K 34  
X  3 LYS M  52  ? GLY M  60  ? LYS K 52  GLY K 60  
X  4 VAL M  68  ? ARG M  75  ? VAL K 68  ARG K 75  
X  5 ALA M  94  ? VAL M  98  ? ALA K 94  VAL K 98  
X  6 LEU M  17  ? CYS M  20  ? LEU K 17  CYS K 20  
Y  1 ILE M  113 ? ALA M  114 ? ILE K 113 ALA K 114 
Y  2 ILE M  131 ? VAL M  132 ? ILE K 131 VAL K 132 
Z  1 ALA N  62  ? ASP N  66  ? ALA L 61  ASP L 65  
Z  2 TYR N  106 ? LEU N  110 ? TYR L 105 LEU L 109 
Z  3 ASP N  125 ? PHE N  126 ? ASP L 124 PHE L 125 
AA 1 ARG N  91  ? ASP N  93  ? ARG L 90  ASP L 92  
AA 2 THR N  120 ? ALA N  123 ? THR L 119 ALA L 122 
AA 3 SER N  140 ? LEU N  143 ? SER L 139 LEU L 142 
AB 1 VAL O  37  ? ARG O  39  ? VAL M 37  ARG M 39  
AB 2 VAL O  60  ? ARG O  68  ? VAL M 60  ARG M 68  
AB 3 GLN O  126 ? ILE O  134 ? GLN M 126 ILE M 134 
AB 4 ARG O  113 ? GLN O  122 ? ARG M 113 GLN M 122 
AC 1 ASP P  57  ? HIS P  63  ? ASP N 56  HIS N 62  
AC 2 VAL P  44  ? THR P  50  ? VAL N 43  THR N 49  
AC 3 ARG P  34  ? LYS P  39  ? ARG N 33  LYS N 38  
AC 4 VAL P  102 ? ASP P  104 ? VAL N 101 ASP N 103 
AD 1 ALA Q  42  ? ASN Q  45  ? ALA O 41  ASN O 44  
AD 2 THR Q  58  ? LEU Q  66  ? THR O 57  LEU O 65  
AD 3 THR Q  76  ? PHE Q  82  ? THR O 75  PHE O 81  
AD 4 GLU Q  95  ? SER Q  98  ? GLU O 94  SER O 97  
AE 1 ALA Q  42  ? ASN Q  45  ? ALA O 41  ASN O 44  
AE 2 THR Q  58  ? LEU Q  66  ? THR O 57  LEU O 65  
AE 3 VAL Q  112 ? VAL Q  114 ? VAL O 111 VAL O 113 
AF 1 VAL R  22  ? PHE R  24  ? VAL P 21  PHE P 23  
AF 2 ILE R  50  ? ALA R  52  ? ILE P 49  ALA P 51  
AG 1 LYS S  81  ? VAL S  87  ? LYS Q 80  VAL Q 86  
AG 2 ALA S  71  ? ASP S  78  ? ALA Q 70  ASP Q 77  
AG 3 THR S  61  ? GLN S  68  ? THR Q 60  GLN Q 67  
AG 4 LYS S  39  ? LEU S  42  ? LYS Q 38  LEU Q 41  
AG 5 LEU S  92  ? ARG S  94  ? LEU Q 91  ARG Q 93  
AH 1 THR T  14  ? ARG T  22  ? THR R 13  ARG R 21  
AH 2 SER T  139 ? GLU T  149 ? SER R 138 GLU R 148 
AH 3 THR T  111 ? GLN T  123 ? THR R 110 GLN R 122 
AI 1 VAL T  58  ? PRO T  59  ? VAL R 57  PRO R 58  
AI 2 GLY T  79  ? ARG T  80  ? GLY R 78  ARG R 79  
AJ 1 ARG T  126 ? PRO T  128 ? ARG R 125 PRO R 127 
AJ 2 ALA T  134 ? ALA T  136 ? ALA R 133 ALA R 135 
AK 1 ILE U  6   ? PRO U  9   ? ILE S 5   PRO S 8   
AK 2 LYS U  24  ? VAL U  29  ? LYS S 23  VAL S 28  
AK 3 LYS U  63  ? LEU U  69  ? LYS S 62  LEU S 68  
AK 4 VAL U  50  ? ASN U  57  ? VAL S 49  ASN S 56  
AL 1 ASN V  40  ? ARG V  42  ? ASN T 39  ARG T 41  
AL 2 ARG V  25  ? LEU V  28  ? ARG T 24  LEU T 27  
AL 3 VAL V  97  ? ASP V  101 ? VAL T 96  ASP T 100 
AL 4 THR V  48  ? VAL V  51  ? THR T 47  VAL T 50  
AL 5 GLU V  60  ? ASP V  67  ? GLU T 59  ASP T 66  
AL 6 VAL V  72  ? VAL V  75  ? VAL T 71  VAL T 74  
AM 1 THR V  79  ? GLU V  81  ? THR T 78  GLU T 80  
AM 2 GLU V  87  ? PRO V  89  ? GLU T 86  PRO T 88  
AN 1 LEU Y  116 ? ARG Y  117 ? LEU W 116 ARG W 117 
AN 2 HIS Y  31  ? VAL Y  35  ? HIS W 31  VAL W 35  
AN 3 HIS Y  2   ? GLN Y  6   ? HIS W 2   GLN W 6   
AN 4 VAL Y  52  ? GLY Y  55  ? VAL W 52  GLY W 55  
AN 5 GLY Y  139 ? LYS Y  140 ? GLY W 139 LYS W 140 
AO 1 ARG Z  9   ? PRO Z  14  ? ARG X 8   PRO X 13  
AO 2 LYS Z  70  ? PHE Z  78  ? LYS X 69  PHE X 77  
AO 3 GLU Z  83  ? GLU Z  87  ? GLU X 82  GLU X 86  
AO 4 VAL Z  49  ? LEU Z  51  ? VAL X 48  LEU X 50  
AP 1 GLU AA 97  ? ALA AA 100 ? GLU Y 96  ALA Y 99  
AP 2 TYR AA 234 ? VAL AA 237 ? TYR Y 233 VAL Y 236 
AQ 1 GLU AA 184 ? VAL AA 188 ? GLU Y 183 VAL Y 187 
AQ 2 GLU AA 202 ? ILE AA 206 ? GLU Y 201 ILE Y 205 
AR 1 VAL BA 38  ? GLY BA 42  ? VAL Z 47  GLY Z 51  
AR 2 ILE BA 45  ? CYS BA 48  ? ILE Z 54  CYS Z 57  
AR 3 LYS BA 54  ? THR BA 56  ? LYS Z 63  THR Z 65  
AS 1 HIS CA 17  ? LYS CA 19  ? HIS 1 16  LYS 1 18  
AS 2 LYS CA 26  ? HIS CA 29  ? LYS 1 25  HIS 1 28  
AS 3 VAL CA 34  ? CYS CA 35  ? VAL 1 33  CYS 1 34  
AT 1 GLN EA 2   ? PRO EA 4   ? GLN 3 2   PRO 3 4   
AT 2 GLU EA 89  ? GLN EA 91  ? GLU 3 89  GLN 3 91  
AU 1 ARG EA 6   ? CYS EA 11  ? ARG 3 6   CYS 3 11  
AU 2 GLU EA 16  ? LYS EA 24  ? GLU 3 16  LYS 3 24  
AU 3 LEU EA 67  ? CYS EA 71  ? LEU 3 67  CYS 3 71  
AU 4 ALA EA 77  ? HIS EA 78  ? ALA 3 77  HIS 3 78  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 O ILE C  69  ? O ILE A 68  N ALA C  57  ? N ALA A 56  
A  2 3 O VAL C  56  ? O VAL A 55  N GLU C  47  ? N GLU A 46  
A  3 4 N GLY C  41  ? N GLY A 40  O LEU C  81  ? O LEU A 80  
B  1 2 N LEU C  95  ? N LEU A 94  O ALA C  155 ? O ALA A 154 
B  2 3 O THR C  156 ? O THR A 155 N CYS C  107 ? N CYS A 106 
B  3 4 N VAL C  106 ? N VAL A 105 O ALA C  127 ? O ALA A 126 
B  4 5 N GLN C  128 ? N GLN A 127 O LYS C  140 ? O LYS A 139 
B  5 6 N VAL C  139 ? N VAL A 138 O LYS C  147 ? O LYS A 146 
C  1 2 N ILE C  216 ? N ILE A 215 O ASP C  228 ? O ASP A 227 
D  1 2 N GLY D  38  ? N GLY B 37  O GLY D  168 ? O GLY B 167 
D  2 3 O THR D  165 ? O THR B 164 N LEU D  143 ? N LEU B 142 
D  3 4 O GLY D  139 ? O GLY B 138 N TYR D  88  ? N TYR B 87  
D  4 5 N ALA D  87  ? N ALA B 86  O LEU D  98  ? O LEU B 97  
E  1 2 N GLY D  38  ? N GLY B 37  O GLY D  168 ? O GLY B 167 
E  2 3 O THR D  165 ? O THR B 164 N LEU D  143 ? N LEU B 142 
E  3 4 O GLY D  139 ? O GLY B 138 N TYR D  88  ? N TYR B 87  
E  4 5 N MET D  80  ? N MET B 79  O HIS D  189 ? O HIS B 188 
F  1 2 O TYR D  330 ? O TYR B 329 N VAL D  53  ? N VAL B 52  
F  2 3 N PHE D  42  ? N PHE B 41  O PHE D  312 ? O PHE B 311 
F  3 4 O ARG D  313 ? O ARG B 312 N ASP D  202 ? N ASP B 201 
F  4 5 N ALA D  201 ? N ALA B 200 O LYS D  268 ? O LYS B 267 
F  5 6 N ASP D  272 ? N ASP B 271 O LEU D  297 ? O LEU B 296 
F  6 7 O VAL D  298 ? O VAL B 297 N THR D  73  ? N THR B 72  
F  7 8 O VAL D  74  ? O VAL B 73  N GLY D  48  ? N GLY B 47  
G  1 2 N GLN D  213 ? N GLN B 212 O GLY D  256 ? O GLY B 255 
H  1 2 O VAL E  16  ? O VAL C 16  N ALA E  3   ? N ALA C 3   
H  2 3 N TYR E  6   ? N TYR C 6   O VAL E  139 ? O VAL C 139 
H  3 4 N VAL E  138 ? N VAL C 138 O THR E  233 ? O THR C 233 
H  4 5 O VAL E  234 ? O VAL C 234 N VAL E  195 ? N VAL C 195 
H  5 6 N PHE E  194 ? N PHE C 194 O ASP E  211 ? O ASP C 211 
I  1 2 N LEU E  73  ? N LEU C 73  O ARG E  76  ? O ARG C 76  
J  1 2 N LYS E  173 ? N LYS C 173 O ARG E  187 ? O ARG C 187 
K  1 2 N VAL F  51  ? N VAL D 50  O LYS F  73  ? O LYS D 72  
K  2 3 O VAL F  74  ? O VAL D 73  N VAL F  24  ? N VAL D 23  
K  3 4 N GLU F  20  ? N GLU D 19  O ASN F  134 ? O ASN D 133 
K  4 5 O VAL F  133 ? O VAL D 132 N PHE F  105 ? N PHE D 104 
L  1 2 N LEU G  6   ? N LEU E 5   O VAL G  48  ? O VAL E 47  
L  2 3 O VAL G  49  ? O VAL E 48  N SER G  42  ? N SER E 41  
M  1 2 N GLU G  15  ? N GLU E 14  O THR G  22  ? O THR E 21  
M  2 3 N GLY G  25  ? N GLY E 24  O GLY G  28  ? O GLY E 27  
N  1 2 N ASP G  124 ? N ASP E 123 O SER G  135 ? O SER E 134 
N  2 3 O LEU G  132 ? O LEU E 131 N MET G  85  ? N MET E 84  
N  3 4 N GLY G  84  ? N GLY E 83  O THR G  170 ? O THR E 169 
O  1 2 N ASN G  97  ? N ASN E 96  O VAL G  104 ? O VAL E 103 
O  2 3 N ILE G  105 ? N ILE E 104 O ARG G  115 ? O ARG E 114 
P  1 2 N LYS H  31  ? N LYS F 30  O ALA H  98  ? O ALA F 97  
P  2 3 O ALA H  97  ? O ALA F 96  N PHE H  50  ? N PHE F 49  
P  3 4 N VAL H  49  ? N VAL F 48  O ILE H  76  ? O ILE F 75  
Q  1 2 N MET J  33  ? N MET H 33  O MET J  85  ? O MET H 85  
Q  2 3 N THR J  86  ? N THR H 86  O THR J  135 ? O THR H 135 
Q  3 4 O ALA J  136 ? O ALA H 136 N ILE J  47  ? N ILE H 47  
Q  4 5 N SER J  48  ? N SER H 48  O ASP J  164 ? O ASP H 164 
R  1 2 N LEU J  57  ? N LEU H 57  O ALA J  125 ? O ALA H 125 
R  2 3 O GLY J  122 ? O GLY H 122 N LEU J  95  ? N LEU H 95  
S  1 2 N ALA K  94  ? N ALA I 98  O THR K  134 ? O THR I 138 
T  1 2 N VAL L  12  ? N VAL J 12  O VAL L  39  ? O VAL J 39  
T  2 3 N VAL L  38  ? N VAL J 38  O ARG L  102 ? O ARG J 102 
U  1 2 N ILE L  46  ? N ILE J 46  O VAL L  130 ? O VAL J 130 
V  1 2 N ASP M  7   ? N ASP K 7   O ARG M  81  ? O ARG K 81  
V  2 3 N ILE M  80  ? N ILE K 80  O VAL M  88  ? O VAL K 88  
V  3 4 N ARG M  87  ? N ARG K 87  O MET W  20  ? O MET U 20  
V  4 5 N THR W  19  ? N THR U 19  O PHE W  31  ? O PHE U 31  
W  1 2 N LEU M  12  ? N LEU K 12  O ALA M  47  ? O ALA K 47  
X  1 2 N ILE M  18  ? N ILE K 18  O LEU M  29  ? O LEU K 29  
X  2 3 N LYS M  30  ? N LYS K 30  O SER M  56  ? O SER K 56  
X  3 4 N VAL M  55  ? N VAL K 55  O LEU M  69  ? O LEU K 69  
X  4 5 N VAL M  74  ? N VAL K 74  O ALA M  94  ? O ALA K 94  
X  5 6 O ALA M  95  ? O ALA K 95  N THR M  19  ? N THR K 19  
Y  1 2 N ILE M  113 ? N ILE K 113 O VAL M  132 ? O VAL K 132 
Z  1 2 N ALA N  63  ? N ALA L 62  O TYR N  106 ? O TYR L 105 
Z  2 3 N VAL N  109 ? N VAL L 108 O ASP N  125 ? O ASP L 124 
AA 1 2 N VAL N  92  ? N VAL L 91  O THR N  120 ? O THR L 119 
AA 2 3 N LEU N  121 ? N LEU L 120 O GLU N  142 ? O GLU L 141 
AB 1 2 N GLU O  38  ? N GLU M 38  O ARG O  64  ? O ARG M 64  
AB 2 3 N VAL O  67  ? N VAL M 67  O LYS O  127 ? O LYS M 127 
AB 3 4 O ILE O  132 ? O ILE M 132 N LEU O  115 ? N LEU M 115 
AC 1 2 O ASP P  57  ? O ASP N 56  N THR P  50  ? N THR N 49  
AC 2 3 O GLN P  47  ? O GLN N 46  N VAL P  36  ? N VAL N 35  
AC 3 4 N LEU P  35  ? N LEU N 34  O VAL P  102 ? O VAL N 101 
AD 1 2 N VAL Q  44  ? N VAL O 43  O LEU Q  66  ? O LEU O 65  
AD 2 3 N VAL Q  59  ? N VAL O 58  O ALA Q  78  ? O ALA O 77  
AD 3 4 N VAL Q  77  ? N VAL O 76  O VAL Q  97  ? O VAL O 96  
AE 1 2 N VAL Q  44  ? N VAL O 43  O LEU Q  66  ? O LEU O 65  
AE 2 3 N VAL Q  60  ? N VAL O 59  O ARG Q  113 ? O ARG O 112 
AF 1 2 N TRP R  23  ? N TRP P 22  O GLN R  51  ? O GLN P 50  
AG 1 2 O ILE S  85  ? O ILE Q 84  N VAL S  74  ? N VAL Q 73  
AG 2 3 O LYS S  73  ? O LYS Q 72  N GLU S  65  ? N GLU Q 64  
AG 3 4 O GLY S  62  ? O GLY Q 61  N VAL S  40  ? N VAL Q 39  
AG 4 5 N HIS S  41  ? N HIS Q 40  O ARG S  93  ? O ARG Q 92  
AH 1 2 N ALA T  15  ? N ALA R 14  O LEU T  148 ? O LEU R 147 
AH 2 3 O SER T  139 ? O SER R 138 N GLN T  123 ? N GLN R 122 
AI 1 2 N VAL T  58  ? N VAL R 57  O ARG T  80  ? O ARG R 79  
AJ 1 2 N LYS T  127 ? N LYS R 126 O SER T  135 ? O SER R 134 
AK 1 2 N HIS U  8   ? N HIS S 7   O ALA U  28  ? O ALA S 27  
AK 2 3 N LEU U  25  ? N LEU S 24  O VAL U  67  ? O VAL S 66  
AK 3 4 O VAL U  66  ? O VAL S 65  N ASN U  54  ? N ASN S 53  
AL 1 2 O VAL V  41  ? O VAL T 40  N ALA V  26  ? N ALA T 25  
AL 2 3 N THR V  27  ? N THR T 26  O VAL V  99  ? O VAL T 98  
AL 3 4 O ARG V  98  ? O ARG T 97  N GLU V  50  ? N GLU T 49  
AL 4 5 N VAL V  49  ? N VAL T 48  O GLY V  61  ? O GLY T 60  
AL 5 6 N ASP V  67  ? N ASP T 66  O VAL V  72  ? O VAL T 71  
AM 1 2 N LEU V  80  ? N LEU T 79  O VAL V  88  ? O VAL T 87  
AN 1 2 O LEU Y  116 ? O LEU W 116 N CYS Y  32  ? N CYS W 32  
AN 2 3 O THR Y  33  ? O THR W 33  N LEU Y  4   ? N LEU W 4   
AN 3 4 N ALA Y  3   ? N ALA W 3   O GLY Y  55  ? O GLY W 55  
AN 4 5 N VAL Y  52  ? N VAL W 52  O GLY Y  139 ? O GLY W 139 
AO 1 2 N VAL Z  11  ? N VAL X 10  O VAL Z  73  ? O VAL X 72  
AO 2 3 N ARG Z  74  ? N ARG X 73  O GLU Z  87  ? O GLU X 86  
AO 3 4 O ALA Z  84  ? O ALA X 83  N ARG Z  50  ? N ARG X 49  
AP 1 2 N GLN AA 99  ? N GLN Y 98  O VAL AA 235 ? O VAL Y 234 
AQ 1 2 N VAL AA 188 ? N VAL Y 187 O ARG AA 205 ? O ARG Y 204 
AR 1 2 N GLN BA 41  ? N GLN Z 50  O ILE BA 45  ? O ILE Z 54  
AR 2 3 N TRP BA 46  ? N TRP Z 55  O PHE BA 55  ? O PHE Z 64  
AS 1 2 N THR CA 18  ? N THR 1 17  O TYR CA 28  ? O TYR 1 27  
AS 2 3 N HIS CA 29  ? N HIS 1 28  O VAL CA 34  ? O VAL 1 33  
AT 1 2 N MET EA 3   ? N MET 3 3   O GLN EA 91  ? O GLN 3 91  
AU 1 2 N PHE EA 7   ? N PHE 3 7   O HIS EA 20  ? O HIS 3 20  
AU 2 3 N GLU EA 21  ? N GLU 3 21  O ARG EA 70  ? O ARG 3 70  
AU 3 4 N TYR EA 69  ? N TYR 3 69  O HIS EA 78  ? O HIS 3 78  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG 0 8001' 
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8002' 
AC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8003' 
AC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8004' 
AC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8005' 
AC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8006' 
AC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8007' 
AC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8008' 
AC9 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE MG 0 8009' 
BC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8010' 
BC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8011' 
BC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8012' 
BC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8013' 
BC5 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG 0 8014' 
BC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8015' 
BC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8016' 
BC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8017' 
BC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8018' 
CC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8019' 
CC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8020' 
CC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8021' 
CC4 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG 0 8022' 
CC5 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG 0 8023' 
CC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG 0 8024' 
CC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8025' 
CC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8026' 
CC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8027' 
DC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8028' 
DC2 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE MG 0 8029' 
DC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8030' 
DC4 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG 0 8031' 
DC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8032' 
DC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8033' 
DC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8034' 
DC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8035' 
DC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8036' 
EC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8037' 
EC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8038' 
EC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8039' 
EC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8040' 
EC5 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG 0 8041' 
EC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8042' 
EC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8043' 
EC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8044' 
EC9 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG 0 8045' 
FC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG 0 8046' 
FC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG 0 8047' 
FC3 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG 0 8048' 
FC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG 0 8049' 
FC5 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MG 0 8050' 
FC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG 0 8051' 
FC7 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG 0 8052' 
FC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8053' 
FC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8054' 
GC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8056' 
GC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8057' 
GC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8058' 
GC4 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG 0 8059' 
GC5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG 0 8060' 
GC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8061' 
GC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8062' 
GC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8063' 
GC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8064' 
HC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MG 0 8066' 
HC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8067' 
HC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8068' 
HC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG 0 8070' 
HC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8071' 
HC6 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG 0 8072' 
HC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8074' 
HC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8075' 
HC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8076' 
IC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8077' 
IC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8079' 
IC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8080' 
IC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG 0 8081' 
IC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8082' 
IC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8083' 
IC7 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG 0 8084' 
IC8 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE MG 0 8085' 
IC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8086' 
JC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG 0 8087' 
JC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG 0 8088' 
JC3 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG 0 8089' 
JC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG 0 8090' 
JC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8091' 
JC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG 0 8092' 
JC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8093' 
JC8 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG 0 8094' 
JC9 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG 0 8096' 
KC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8097' 
KC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8098' 
KC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG 0 8099' 
KC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8100' 
KC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8101' 
KC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8102' 
KC7 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MG 0 8103' 
KC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8104' 
KC9 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG 0 8105' 
LC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8106' 
LC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8107' 
LC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8109' 
LC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8110' 
LC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8111' 
LC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8112' 
LC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8113' 
LC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8114' 
LC9 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG 0 8115' 
MC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8116' 
MC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE K 0 8201'  
MC3 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE K 0 8202'  
MC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 0 8301' 
MC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 0 8302' 
MC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 8303' 
MC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 0 8305' 
MC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 0 8306' 
MC9 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 0 8307' 
NC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 8308' 
NC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 0 8310' 
NC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 8311' 
NC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 8313' 
NC5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 8314' 
NC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 0 8315' 
NC7 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NA 0 8316' 
NC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 0 8317' 
NC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 0 8318' 
OC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE NA 0 8319' 
OC2 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE NA 0 8320' 
OC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 8321' 
OC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 0 8323' 
OC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 0 8324' 
OC6 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE NA 0 8325' 
OC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 0 8326' 
OC8 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE NA 0 8327' 
OC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 0 8328' 
PC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 0 8329' 
PC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NA 0 8330' 
PC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 8331' 
PC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 0 8332' 
PC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 0 8333' 
PC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 8334' 
PC7 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 8335' 
PC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 0 8336' 
PC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 0 8338' 
QC1 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE NA 0 8339' 
QC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 0 8340' 
QC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 0 8341' 
QC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 0 8342' 
QC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 0 8344' 
QC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 8349' 
QC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 0 8350' 
QC8 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 8352' 
QC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 0 8353' 
RC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 0 8354' 
RC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 0 8355' 
RC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 8356' 
RC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 0 8357' 
RC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 0 8358' 
RC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 8359' 
RC7 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 8360' 
RC8 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 8361' 
RC9 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 8362' 
SC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NA 0 8363' 
SC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 8364' 
SC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 0 8365' 
SC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 0 8366' 
SC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 0 8367' 
SC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 8368' 
SC7 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE NA 0 8369' 
SC8 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 0 8370' 
SC9 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 0 8371' 
TC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NA 0 8372' 
TC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 0 8373' 
TC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 8374' 
TC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 8375' 
TC5 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE NA 0 8376' 
TC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 0 8377' 
TC7 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE NA 0 8378' 
TC8 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 8379' 
TC9 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE NA 0 8381' 
UC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NA 0 8382' 
UC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NA 0 8384' 
UC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NA 0 8385' 
UC4 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL 0 8503' 
UC5 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL 0 8505' 
UC6 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL 0 8511' 
UC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CL 0 8512' 
UC8 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CL 0 8513' 
UC9 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL 0 8514' 
VC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL 0 8515' 
VC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL 0 8516' 
VC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL 0 8517' 
VC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL 0 8522' 
VC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG 9 8095' 
VC6 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE NA 9 8351' 
VC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 9 8383' 
VC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8065' 
VC9 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE NA A 8345' 
WC1 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CL A 8509' 
WC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG B 8055' 
WC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CL B 8519' 
WC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA C 8304' 
WC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA H 8309' 
WC6 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NA H 8322' 
WC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA J 8346' 
WC8 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL J 8501' 
WC9 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL J 8502' 
XC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CL J 8521' 
XC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG K 8069' 
XC3 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE NA L 8380' 
XC4 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CL L 8510' 
XC5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA M 8347' 
XC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL M 8518' 
XC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL N 8507' 
XC8 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CD O 8405' 
XC9 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL O 8508' 
YC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA Q 8348' 
YC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA R 8337' 
YC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA R 8386' 
YC4 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL R 8506' 
YC5 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NA S 8312' 
YC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG T 8073' 
YC7 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE NA T 8343' 
YC8 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CD U 8401' 
YC9 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG Y 8108' 
ZC1 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CL Y 8520' 
ZC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CD Z 8403' 
ZC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CD 1 8402' 
ZC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 3 8078' 
ZC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CD 3 8404' 
ZC6 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CL 3 8504' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1    AC1 7 G   A  2481 ? G   0 2482 . ? 1_555 ? 
2    AC1 7 A   A  2482 ? A   0 2483 . ? 1_555 ? 
3    AC1 7 C   A  2532 ? C   0 2533 . ? 1_555 ? 
4    AC1 7 C   A  2533 ? C   0 2534 . ? 1_555 ? 
5    AC1 7 HOH CJ .    ? HOH 0 3137 . ? 1_555 ? 
6    AC1 7 HOH CJ .    ? HOH 0 7282 . ? 1_555 ? 
7    AC1 7 HOH CJ .    ? HOH 0 8694 . ? 1_555 ? 
8    AC2 6 G   A  626  ? G   0 627  . ? 1_555 ? 
9    AC2 6 A   A  2482 ? A   0 2483 . ? 1_555 ? 
10   AC2 6 C   A  2533 ? C   0 2534 . ? 1_555 ? 
11   AC2 6 HOH CJ .    ? HOH 0 3851 . ? 1_555 ? 
12   AC2 6 HOH CJ .    ? HOH 0 7260 . ? 1_555 ? 
13   AC2 6 HOH CJ .    ? HOH 0 7261 . ? 1_555 ? 
14   AC3 6 A   A  875  ? A   0 876  . ? 1_555 ? 
15   AC3 6 G   A  876  ? G   0 877  . ? 1_555 ? 
16   AC3 6 A   A  2623 ? A   0 2624 . ? 1_555 ? 
17   AC3 6 HOH CJ .    ? HOH 0 3188 . ? 1_555 ? 
18   AC3 6 HOH EJ .    ? HOH A 8512 . ? 1_555 ? 
19   AC3 6 HOH EJ .    ? HOH A 8535 . ? 1_555 ? 
20   AC4 6 G   A  455  ? G   0 456  . ? 1_555 ? 
21   AC4 6 A   A  458  ? A   0 459  . ? 1_555 ? 
22   AC4 6 HOH CJ .    ? HOH 0 3305 . ? 1_555 ? 
23   AC4 6 HOH CJ .    ? HOH 0 7267 . ? 1_555 ? 
24   AC4 6 HOH CJ .    ? HOH 0 8567 . ? 1_555 ? 
25   AC4 6 HOH CJ .    ? HOH 0 9300 . ? 1_555 ? 
26   AC5 6 A   A  1835 ? A   0 1836 . ? 1_555 ? 
27   AC5 6 U   A  1837 ? U   0 1838 . ? 1_555 ? 
28   AC5 6 A   A  1838 ? A   0 1839 . ? 1_555 ? 
29   AC5 6 HOH CJ .    ? HOH 0 3134 . ? 1_555 ? 
30   AC5 6 HOH CJ .    ? HOH 0 7283 . ? 1_555 ? 
31   AC5 6 HOH CJ .    ? HOH 0 7284 . ? 1_555 ? 
32   AC6 6 U   A  820  ? U   0 821  . ? 1_555 ? 
33   AC6 6 C   A  821  ? C   0 822  . ? 1_555 ? 
34   AC6 6 G   A  853  ? G   0 854  . ? 1_555 ? 
35   AC6 6 HOH CJ .    ? HOH 0 3139 . ? 1_555 ? 
36   AC6 6 HOH CJ .    ? HOH 0 3276 . ? 1_555 ? 
37   AC6 6 HOH CJ .    ? HOH 0 9332 . ? 1_555 ? 
38   AC7 6 U   A  831  ? U   0 832  . ? 1_555 ? 
39   AC7 6 A   A  1838 ? A   0 1839 . ? 1_555 ? 
40   AC7 6 A   A  1839 ? A   0 1840 . ? 1_555 ? 
41   AC7 6 HOH CJ .    ? HOH 0 7272 . ? 1_555 ? 
42   AC7 6 HOH CJ .    ? HOH 0 8528 . ? 1_555 ? 
43   AC7 6 HOH CJ .    ? HOH 0 9879 . ? 1_555 ? 
44   AC8 6 U   A  918  ? U   0 919  . ? 1_555 ? 
45   AC8 6 C   A  2463 ? C   0 2464 . ? 1_555 ? 
46   AC8 6 A   A  2464 ? A   0 2465 . ? 1_555 ? 
47   AC8 6 HOH CJ .    ? HOH 0 3151 . ? 1_555 ? 
48   AC8 6 HOH CJ .    ? HOH 0 7276 . ? 1_555 ? 
49   AC8 6 HOH CJ .    ? HOH 0 7359 . ? 1_555 ? 
50   AC9 8 U   A  2609 ? U   0 2610 . ? 1_555 ? 
51   AC9 8 G   A  2610 ? G   0 2611 . ? 1_555 ? 
52   AC9 8 A   A  2611 ? A   0 2612 . ? 1_555 ? 
53   AC9 8 HOH CJ .    ? HOH 0 3261 . ? 1_555 ? 
54   AC9 8 HOH CJ .    ? HOH 0 6939 . ? 1_555 ? 
55   AC9 8 HOH CJ .    ? HOH 0 7277 . ? 1_555 ? 
56   AC9 8 HOH CJ .    ? HOH 0 7278 . ? 1_555 ? 
57   AC9 8 NA  GG .    ? NA  0 8358 . ? 1_555 ? 
58   BC1 6 G   A  835  ? G   0 836  . ? 1_555 ? 
59   BC1 6 U   A  2614 ? U   0 2615 . ? 1_555 ? 
60   BC1 6 HOH CJ .    ? HOH 0 3360 . ? 1_555 ? 
61   BC1 6 HOH CJ .    ? HOH 0 8881 . ? 1_555 ? 
62   BC1 6 GLN D  231  ? GLN B 230  . ? 1_555 ? 
63   BC1 6 HOH FJ .    ? HOH B 8526 . ? 1_555 ? 
64   BC2 6 G   A  823  ? G   0 824  . ? 1_555 ? 
65   BC2 6 G   A  853  ? G   0 854  . ? 1_555 ? 
66   BC2 6 HOH CJ .    ? HOH 0 3481 . ? 1_555 ? 
67   BC2 6 HOH CJ .    ? HOH 0 3815 . ? 1_555 ? 
68   BC2 6 HOH CJ .    ? HOH 0 3951 . ? 1_555 ? 
69   BC2 6 HOH CJ .    ? HOH 0 4055 . ? 1_555 ? 
70   BC3 6 G   A  27   ? G   0 28   . ? 1_555 ? 
71   BC3 6 HOH CJ .    ? HOH 0 3169 . ? 1_555 ? 
72   BC3 6 HOH CJ .    ? HOH 0 7360 . ? 1_555 ? 
73   BC3 6 HOH CJ .    ? HOH 0 8559 . ? 1_555 ? 
74   BC3 6 HOH CJ .    ? HOH 0 9156 . ? 1_555 ? 
75   BC3 6 HOH CJ .    ? HOH 0 9747 . ? 1_555 ? 
76   BC4 6 G   A  876  ? G   0 877  . ? 1_555 ? 
77   BC4 6 G   A  2622 ? G   0 2623 . ? 1_555 ? 
78   BC4 6 HOH CJ .    ? HOH 0 3163 . ? 1_555 ? 
79   BC4 6 HOH CJ .    ? HOH 0 3176 . ? 1_555 ? 
80   BC4 6 HOH CJ .    ? HOH 0 8541 . ? 1_555 ? 
81   BC4 6 HOH EJ .    ? HOH A 8631 . ? 1_555 ? 
82   BC5 7 A   A  2100 ? A   0 2101 . ? 1_555 ? 
83   BC5 7 G   A  2101 ? G   0 2102 . ? 1_555 ? 
84   BC5 7 G   A  2536 ? G   0 2537 . ? 1_555 ? 
85   BC5 7 HOH CJ .    ? HOH 0 3181 . ? 1_555 ? 
86   BC5 7 HOH CJ .    ? HOH 0 3688 . ? 1_555 ? 
87   BC5 7 HOH CJ .    ? HOH 0 7258 . ? 1_555 ? 
88   BC5 7 HOH CJ .    ? HOH 0 8553 . ? 1_555 ? 
89   BC6 6 A   A  843  ? A   0 844  . ? 1_555 ? 
90   BC6 6 A   A  1688 ? A   0 1689 . ? 1_555 ? 
91   BC6 6 HOH CJ .    ? HOH 0 3143 . ? 1_555 ? 
92   BC6 6 HOH CJ .    ? HOH 0 7292 . ? 1_555 ? 
93   BC6 6 HOH CJ .    ? HOH 0 8526 . ? 1_555 ? 
94   BC6 6 HOH CJ .    ? HOH 0 8544 . ? 1_555 ? 
95   BC7 6 A   A  1503 ? A   0 1504 . ? 1_555 ? 
96   BC7 6 A   A  1677 ? A   0 1678 . ? 1_555 ? 
97   BC7 6 C   A  1678 ? C   0 1679 . ? 1_555 ? 
98   BC7 6 HOH CJ .    ? HOH 0 3268 . ? 1_555 ? 
99   BC7 6 HOH CJ .    ? HOH 0 7285 . ? 1_555 ? 
100  BC7 6 HOH CJ .    ? HOH 0 7286 . ? 1_555 ? 
101  BC8 6 G   A  455  ? G   0 456  . ? 1_555 ? 
102  BC8 6 HOH CJ .    ? HOH 0 3465 . ? 1_555 ? 
103  BC8 6 HOH CJ .    ? HOH 0 7268 . ? 1_555 ? 
104  BC8 6 HOH CJ .    ? HOH 0 8933 . ? 1_555 ? 
105  BC8 6 HOH GJ .    ? HOH C 8356 . ? 1_555 ? 
106  BC8 6 HOH GJ .    ? HOH C 8466 . ? 1_555 ? 
107  BC9 6 A   A  1290 ? A   0 1291 . ? 1_555 ? 
108  BC9 6 G   A  1291 ? G   0 1292 . ? 1_555 ? 
109  BC9 6 HOH CJ .    ? HOH 0 3135 . ? 1_555 ? 
110  BC9 6 HOH CJ .    ? HOH 0 6975 . ? 1_555 ? 
111  BC9 6 HOH CJ .    ? HOH 0 7361 . ? 1_555 ? 
112  BC9 6 HOH CJ .    ? HOH 0 9740 . ? 1_555 ? 
113  CC1 6 A   A  2010 ? A   0 2011 . ? 1_555 ? 
114  CC1 6 HOH CJ .    ? HOH 0 3675 . ? 1_555 ? 
115  CC1 6 HOH CJ .    ? HOH 0 6750 . ? 1_555 ? 
116  CC1 6 HOH CJ .    ? HOH 0 7287 . ? 1_555 ? 
117  CC1 6 HOH CJ .    ? HOH 0 7288 . ? 1_555 ? 
118  CC1 6 HOH CJ .    ? HOH 0 7289 . ? 1_555 ? 
119  CC2 6 C   A  1829 ? C   0 1830 . ? 1_555 ? 
120  CC2 6 HOH CJ .    ? HOH 0 7271 . ? 1_555 ? 
121  CC2 6 HOH CJ .    ? HOH 0 7290 . ? 1_555 ? 
122  CC2 6 HOH CJ .    ? HOH 0 8641 . ? 1_555 ? 
123  CC2 6 HOH CJ .    ? HOH 0 8644 . ? 1_555 ? 
124  CC2 6 HOH CJ .    ? HOH 0 8714 . ? 1_555 ? 
125  CC3 6 G   A  2303 ? G   0 2304 . ? 1_555 ? 
126  CC3 6 HOH CJ .    ? HOH 0 3159 . ? 1_555 ? 
127  CC3 6 HOH CJ .    ? HOH 0 3160 . ? 1_555 ? 
128  CC3 6 HOH CJ .    ? HOH 0 7274 . ? 1_555 ? 
129  CC3 6 HOH CJ .    ? HOH 0 7275 . ? 1_555 ? 
130  CC3 6 HOH CJ .    ? HOH 0 9486 . ? 1_555 ? 
131  CC4 7 G   A  2096 ? G   0 2097 . ? 1_555 ? 
132  CC4 7 U   A  2538 ? U   0 2539 . ? 1_555 ? 
133  CC4 7 G   A  2539 ? G   0 2540 . ? 1_555 ? 
134  CC4 7 HOH CJ .    ? HOH 0 3390 . ? 1_555 ? 
135  CC4 7 HOH CJ .    ? HOH 0 7279 . ? 1_555 ? 
136  CC4 7 HOH CJ .    ? HOH 0 8630 . ? 1_555 ? 
137  CC4 7 HOH CJ .    ? HOH 0 8976 . ? 1_555 ? 
138  CC5 7 G   A  2615 ? G   0 2616 . ? 1_555 ? 
139  CC5 7 G   A  2616 ? G   0 2617 . ? 1_555 ? 
140  CC5 7 G   A  2617 ? G   0 2618 . ? 1_555 ? 
141  CC5 7 HOH CJ .    ? HOH 0 3149 . ? 1_555 ? 
142  CC5 7 HOH CJ .    ? HOH 0 3342 . ? 1_555 ? 
143  CC5 7 HOH CJ .    ? HOH 0 7294 . ? 1_555 ? 
144  CC5 7 HOH CJ .    ? HOH 0 7295 . ? 1_555 ? 
145  CC6 5 A   A  1380 ? A   0 1381 . ? 1_555 ? 
146  CC6 5 HOH CJ .    ? HOH 0 4645 . ? 1_555 ? 
147  CC6 5 HOH CJ .    ? HOH 0 7362 . ? 1_555 ? 
148  CC6 5 HOH CJ .    ? HOH 0 7363 . ? 1_555 ? 
149  CC6 5 HOH CJ .    ? HOH 0 9459 . ? 1_555 ? 
150  CC7 6 U   A  1119 ? U   0 1120 . ? 1_555 ? 
151  CC7 6 G   A  1120 ? G   0 1121 . ? 1_555 ? 
152  CC7 6 HOH CJ .    ? HOH 0 3693 . ? 1_555 ? 
153  CC7 6 HOH CJ .    ? HOH 0 7296 . ? 1_555 ? 
154  CC7 6 HOH CJ .    ? HOH 0 7297 . ? 1_555 ? 
155  CC7 6 HOH CJ .    ? HOH 0 7364 . ? 1_555 ? 
156  CC8 6 C   A  2607 ? C   0 2608 . ? 1_555 ? 
157  CC8 6 G   A  2608 ? G   0 2609 . ? 1_555 ? 
158  CC8 6 U   A  2609 ? U   0 2610 . ? 1_555 ? 
159  CC8 6 HOH CJ .    ? HOH 0 7298 . ? 1_555 ? 
160  CC8 6 HOH CJ .    ? HOH 0 7299 . ? 1_555 ? 
161  CC8 6 HOH CJ .    ? HOH 0 8912 . ? 1_555 ? 
162  CC9 6 C   A  239  ? C   0 240  . ? 1_555 ? 
163  CC9 6 G   A  268  ? G   0 269  . ? 1_555 ? 
164  CC9 6 HOH CJ .    ? HOH 0 3393 . ? 1_555 ? 
165  CC9 6 HOH CJ .    ? HOH 0 3538 . ? 1_555 ? 
166  CC9 6 HOH CJ .    ? HOH 0 3680 . ? 1_555 ? 
167  CC9 6 HOH CJ .    ? HOH 0 7365 . ? 1_555 ? 
168  DC1 6 A   A  1447 ? A   0 1448 . ? 1_555 ? 
169  DC1 6 U   A  1676 ? U   0 1677 . ? 1_555 ? 
170  DC1 6 HOH CJ .    ? HOH 0 3200 . ? 1_555 ? 
171  DC1 6 HOH CJ .    ? HOH 0 3221 . ? 1_555 ? 
172  DC1 6 HOH CJ .    ? HOH 0 3233 . ? 1_555 ? 
173  DC1 6 HOH WJ .    ? HOH S 8345 . ? 1_555 ? 
174  DC2 8 A   A  1501 ? A   0 1502 . ? 1_555 ? 
175  DC2 8 U   A  1502 ? U   0 1503 . ? 1_555 ? 
176  DC2 8 A   A  1503 ? A   0 1504 . ? 1_555 ? 
177  DC2 8 C   A  1678 ? C   0 1679 . ? 1_555 ? 
178  DC2 8 HOH CJ .    ? HOH 0 7302 . ? 1_555 ? 
179  DC2 8 HOH CJ .    ? HOH 0 7303 . ? 1_555 ? 
180  DC2 8 HOH CJ .    ? HOH 0 7304 . ? 1_555 ? 
181  DC2 8 HOH CJ .    ? HOH 0 7305 . ? 1_555 ? 
182  DC3 6 U   A  1747 ? U   0 1748 . ? 1_555 ? 
183  DC3 6 U   A  1748 ? U   0 1749 . ? 1_555 ? 
184  DC3 6 HOH CJ .    ? HOH 0 3161 . ? 1_555 ? 
185  DC3 6 HOH CJ .    ? HOH 0 7269 . ? 1_555 ? 
186  DC3 6 HOH CJ .    ? HOH 0 7270 . ? 1_555 ? 
187  DC3 6 HOH CJ .    ? HOH 0 7280 . ? 1_555 ? 
188  DC4 7 U   A  776  ? U   0 777  . ? 1_555 ? 
189  DC4 7 C   A  777  ? C   0 778  . ? 1_555 ? 
190  DC4 7 HOH CJ .    ? HOH 0 7307 . ? 1_555 ? 
191  DC4 7 HOH CJ .    ? HOH 0 7308 . ? 1_555 ? 
192  DC4 7 HOH CJ .    ? HOH 0 7309 . ? 1_555 ? 
193  DC4 7 NA  GF .    ? NA  0 8325 . ? 1_555 ? 
194  DC4 7 HOH CJ .    ? HOH 0 9796 . ? 1_555 ? 
195  DC5 6 U   A  2114 ? U   0 2115 . ? 1_555 ? 
196  DC5 6 HOH CJ .    ? HOH 0 3311 . ? 1_555 ? 
197  DC5 6 HOH CJ .    ? HOH 0 3714 . ? 1_555 ? 
198  DC5 6 HOH CJ .    ? HOH 0 9512 . ? 1_555 ? 
199  DC5 6 HOH EJ .    ? HOH A 8551 . ? 1_555 ? 
200  DC5 6 HOH EJ .    ? HOH A 8632 . ? 1_555 ? 
201  DC6 6 A   A  1746 ? A   0 1747 . ? 1_555 ? 
202  DC6 6 U   A  1747 ? U   0 1748 . ? 1_555 ? 
203  DC6 6 U   A  1748 ? U   0 1749 . ? 1_555 ? 
204  DC6 6 G   A  2584 ? G   0 2585 . ? 1_555 ? 
205  DC6 6 HOH CJ .    ? HOH 0 3337 . ? 1_555 ? 
206  DC6 6 HOH CJ .    ? HOH 0 9198 . ? 1_555 ? 
207  DC7 6 A   A  2301 ? A   0 2302 . ? 1_555 ? 
208  DC7 6 A   A  2302 ? A   0 2303 . ? 1_555 ? 
209  DC7 6 HOH CJ .    ? HOH 0 3164 . ? 1_555 ? 
210  DC7 6 HOH CJ .    ? HOH 0 3292 . ? 1_555 ? 
211  DC7 6 HOH CJ .    ? HOH 0 4392 . ? 1_555 ? 
212  DC7 6 HOH CJ .    ? HOH 0 7310 . ? 1_555 ? 
213  DC8 6 G   A  1483 ? G   0 1484 . ? 1_555 ? 
214  DC8 6 HOH CJ .    ? HOH 0 3238 . ? 1_555 ? 
215  DC8 6 HOH CJ .    ? HOH 0 7311 . ? 1_555 ? 
216  DC8 6 HOH CJ .    ? HOH 0 7312 . ? 1_555 ? 
217  DC8 6 HOH CJ .    ? HOH 0 7367 . ? 1_555 ? 
218  DC8 6 HOH CJ .    ? HOH 0 7368 . ? 1_555 ? 
219  DC9 6 G   A  955  ? G   0 956  . ? 1_555 ? 
220  DC9 6 HOH CJ .    ? HOH 0 3192 . ? 1_555 ? 
221  DC9 6 HOH CJ .    ? HOH 0 7313 . ? 1_555 ? 
222  DC9 6 HOH CJ .    ? HOH 0 7314 . ? 1_555 ? 
223  DC9 6 HOH CJ .    ? HOH 0 7315 . ? 1_555 ? 
224  DC9 6 HOH CJ .    ? HOH 0 8886 . ? 1_555 ? 
225  EC1 6 A   A  2552 ? A   0 2553 . ? 1_555 ? 
226  EC1 6 HOH CJ .    ? HOH 0 3170 . ? 1_555 ? 
227  EC1 6 HOH CJ .    ? HOH 0 7369 . ? 1_555 ? 
228  EC1 6 HOH CJ .    ? HOH 0 8598 . ? 1_555 ? 
229  EC1 6 HOH CJ .    ? HOH 0 9655 . ? 1_555 ? 
230  EC1 6 HOH CJ .    ? HOH 0 9730 . ? 1_555 ? 
231  EC2 6 HOH CJ .    ? HOH 0 3147 . ? 1_555 ? 
232  EC2 6 HOH CJ .    ? HOH 0 3171 . ? 1_555 ? 
233  EC2 6 HOH CJ .    ? HOH 0 3193 . ? 1_555 ? 
234  EC2 6 HOH CJ .    ? HOH 0 3195 . ? 1_555 ? 
235  EC2 6 HOH CJ .    ? HOH 0 7317 . ? 1_555 ? 
236  EC2 6 HOH CJ .    ? HOH 0 8802 . ? 1_555 ? 
237  EC3 6 U   A  114  ? U   0 115  . ? 1_555 ? 
238  EC3 6 HOH CJ .    ? HOH 0 3488 . ? 1_555 ? 
239  EC3 6 HOH CJ .    ? HOH 0 4624 . ? 1_555 ? 
240  EC3 6 HOH CJ .    ? HOH 0 7318 . ? 1_555 ? 
241  EC3 6 HOH CJ .    ? HOH 0 7319 . ? 1_555 ? 
242  EC3 6 HOH CJ .    ? HOH 0 9431 . ? 1_555 ? 
243  EC4 6 U   A  391  ? U   0 392  . ? 1_555 ? 
244  EC4 6 HOH CJ .    ? HOH 0 3312 . ? 1_555 ? 
245  EC4 6 HOH CJ .    ? HOH 0 4168 . ? 1_555 ? 
246  EC4 6 HOH CJ .    ? HOH 0 7371 . ? 1_555 ? 
247  EC4 6 HOH CJ .    ? HOH 0 7372 . ? 1_555 ? 
248  EC4 6 HOH CJ .    ? HOH 0 9213 . ? 1_555 ? 
249  EC5 7 C   A  194  ? C   0 195  . ? 1_555 ? 
250  EC5 7 G   A  195  ? G   0 196  . ? 1_555 ? 
251  EC5 7 A   A  226  ? A   0 227  . ? 1_555 ? 
252  EC5 7 C   A  227  ? C   0 228  . ? 1_555 ? 
253  EC5 7 HOH CJ .    ? HOH 0 3632 . ? 1_555 ? 
254  EC5 7 HOH CJ .    ? HOH 0 3725 . ? 1_555 ? 
255  EC5 7 HOH CJ .    ? HOH 0 4903 . ? 1_555 ? 
256  EC6 6 U   A  1308 ? U   0 1309 . ? 1_555 ? 
257  EC6 6 U   A  1345 ? U   0 1346 . ? 1_555 ? 
258  EC6 6 HOH CJ .    ? HOH 0 3179 . ? 1_555 ? 
259  EC6 6 HOH CJ .    ? HOH 0 3947 . ? 1_555 ? 
260  EC6 6 HOH CJ .    ? HOH 0 7320 . ? 1_555 ? 
261  EC6 6 HOH CJ .    ? HOH 0 8955 . ? 1_555 ? 
262  EC7 6 G   A  815  ? G   0 816  . ? 1_555 ? 
263  EC7 6 G   A  816  ? G   0 817  . ? 1_555 ? 
264  EC7 6 HOH CJ .    ? HOH 0 6929 . ? 1_555 ? 
265  EC7 6 HOH CJ .    ? HOH 0 7373 . ? 1_555 ? 
266  EC7 6 MG  ZD .    ? MG  0 8105 . ? 1_555 ? 
267  EC7 6 HOH CJ .    ? HOH 0 9336 . ? 1_555 ? 
268  EC8 6 C   A  2047 ? C   0 2048 . ? 1_555 ? 
269  EC8 6 C   A  2087 ? C   0 2088 . ? 1_555 ? 
270  EC8 6 A   A  2088 ? A   0 2089 . ? 1_555 ? 
271  EC8 6 HOH CJ .    ? HOH 0 9816 . ? 1_555 ? 
272  EC8 6 GLY T  66   ? GLY R 65   . ? 1_555 ? 
273  EC8 6 HOH VJ .    ? HOH R 8589 . ? 1_555 ? 
274  EC9 5 G   A  1978 ? G   0 1979 . ? 1_555 ? 
275  EC9 5 HOH CJ .    ? HOH 0 7321 . ? 1_555 ? 
276  EC9 5 HOH CJ .    ? HOH 0 7374 . ? 1_555 ? 
277  EC9 5 HOH CJ .    ? HOH 0 7375 . ? 1_555 ? 
278  EC9 5 HOH CJ .    ? HOH 0 7376 . ? 1_555 ? 
279  FC1 4 G   A  1793 ? G   0 1794 . ? 1_555 ? 
280  FC1 4 HOH CJ .    ? HOH 0 6812 . ? 1_555 ? 
281  FC1 4 HOH CJ .    ? HOH 0 7377 . ? 1_555 ? 
282  FC1 4 HOH CJ .    ? HOH 0 7378 . ? 1_555 ? 
283  FC2 4 A   A  1097 ? A   0 1098 . ? 1_555 ? 
284  FC2 4 HOH CJ .    ? HOH 0 5796 . ? 1_555 ? 
285  FC2 4 HOH CJ .    ? HOH 0 7392 . ? 1_555 ? 
286  FC2 4 HOH CJ .    ? HOH 0 9649 . ? 1_555 ? 
287  FC3 7 A   A  2745 ? A   0 2746 . ? 1_555 ? 
288  FC3 7 U   A  2748 ? U   0 2749 . ? 1_555 ? 
289  FC3 7 G   A  2749 ? G   0 2750 . ? 1_555 ? 
290  FC3 7 HOH CJ .    ? HOH 0 5403 . ? 1_555 ? 
291  FC3 7 HOH CJ .    ? HOH 0 5787 . ? 1_555 ? 
292  FC3 7 HOH CJ .    ? HOH 0 7379 . ? 1_555 ? 
293  FC3 7 HOH CJ .    ? HOH 0 7414 . ? 1_555 ? 
294  FC4 4 G   A  2420 ? G   0 2421 . ? 1_555 ? 
295  FC4 4 U   A  2421 ? U   0 2422 . ? 1_555 ? 
296  FC4 4 C   A  2422 ? C   0 2423 . ? 1_555 ? 
297  FC4 4 HOH CJ .    ? HOH 0 7380 . ? 1_555 ? 
298  FC5 2 C   A  2247 ? C   0 2248 . ? 1_555 ? 
299  FC5 2 HOH CJ .    ? HOH 0 6835 . ? 1_555 ? 
300  FC6 4 G   A  640  ? G   0 641  . ? 1_555 ? 
301  FC6 4 HOH CJ .    ? HOH 0 3627 . ? 1_555 ? 
302  FC6 4 HOH CJ .    ? HOH 0 7322 . ? 1_555 ? 
303  FC6 4 HOH CJ .    ? HOH 0 7323 . ? 1_555 ? 
304  FC7 7 U   A  1124 ? U   0 1125 . ? 1_555 ? 
305  FC7 7 C   A  1128 ? C   0 1129 . ? 1_555 ? 
306  FC7 7 HOH CJ .    ? HOH 0 3145 . ? 1_555 ? 
307  FC7 7 HOH CJ .    ? HOH 0 7394 . ? 1_555 ? 
308  FC7 7 G   B  92   ? G   9 92   . ? 1_555 ? 
309  FC7 7 HOH DJ .    ? HOH 9 8389 . ? 1_555 ? 
310  FC7 7 HOH DJ .    ? HOH 9 8415 . ? 1_555 ? 
311  FC8 6 G   A  470  ? G   0 471  . ? 1_555 ? 
312  FC8 6 HOH CJ .    ? HOH 0 3927 . ? 1_555 ? 
313  FC8 6 HOH CJ .    ? HOH 0 5142 . ? 1_555 ? 
314  FC8 6 HOH CJ .    ? HOH 0 8722 . ? 1_555 ? 
315  FC8 6 HOH CJ .    ? HOH 0 8761 . ? 1_555 ? 
316  FC8 6 HOH CJ .    ? HOH 0 9561 . ? 1_555 ? 
317  FC9 6 C   A  161  ? C   0 162  . ? 1_555 ? 
318  FC9 6 U   A  2275 ? U   0 2276 . ? 1_555 ? 
319  FC9 6 HOH CJ .    ? HOH 0 7273 . ? 1_555 ? 
320  FC9 6 HOH CJ .    ? HOH 0 7324 . ? 1_555 ? 
321  FC9 6 HOH CJ .    ? HOH 0 7325 . ? 1_555 ? 
322  FC9 6 HOH CJ .    ? HOH 0 8951 . ? 1_555 ? 
323  GC1 6 A   A  2756 ? A   0 2757 . ? 1_555 ? 
324  GC1 6 HOH CJ .    ? HOH 0 3190 . ? 1_555 ? 
325  GC1 6 HOH CJ .    ? HOH 0 3497 . ? 1_555 ? 
326  GC1 6 HOH CJ .    ? HOH 0 7343 . ? 1_555 ? 
327  GC1 6 ASN D  336  ? ASN B 335  . ? 1_555 ? 
328  GC1 6 HOH FJ .    ? HOH B 8543 . ? 1_555 ? 
329  GC2 6 U   A  1882 ? U   0 1883 . ? 1_555 ? 
330  GC2 6 U   A  2011 ? U   0 2012 . ? 1_555 ? 
331  GC2 6 G   A  2012 ? G   0 2013 . ? 1_555 ? 
332  GC2 6 HOH CJ .    ? HOH 0 4534 . ? 1_555 ? 
333  GC2 6 GLN C  208  ? GLN A 207  . ? 1_555 ? 
334  GC2 6 HOH EJ .    ? HOH A 8635 . ? 1_555 ? 
335  GC3 6 G   A  2012 ? G   0 2013 . ? 1_555 ? 
336  GC3 6 HOH CJ .    ? HOH 0 3286 . ? 1_555 ? 
337  GC3 6 HOH CJ .    ? HOH 0 7326 . ? 1_555 ? 
338  GC3 6 HOH CJ .    ? HOH 0 7327 . ? 1_555 ? 
339  GC3 6 HOH EJ .    ? HOH A 8633 . ? 1_555 ? 
340  GC3 6 HOH EJ .    ? HOH A 8635 . ? 1_555 ? 
341  GC4 7 G   A  2617 ? G   0 2618 . ? 1_555 ? 
342  GC4 7 HOH CJ .    ? HOH 0 3244 . ? 1_555 ? 
343  GC4 7 HOH CJ .    ? HOH 0 3574 . ? 1_555 ? 
344  GC4 7 HOH CJ .    ? HOH 0 7281 . ? 1_555 ? 
345  GC4 7 MG  GD .    ? MG  0 8085 . ? 1_555 ? 
346  GC4 7 HOH CJ .    ? HOH 0 8558 . ? 1_555 ? 
347  GC4 7 HOH CJ .    ? HOH 0 8562 . ? 1_555 ? 
348  GC5 5 G   A  174  ? G   0 175  . ? 1_555 ? 
349  GC5 5 HOH CJ .    ? HOH 0 7328 . ? 1_555 ? 
350  GC5 5 HOH CJ .    ? HOH 0 7329 . ? 1_555 ? 
351  GC5 5 HOH CJ .    ? HOH 0 7330 . ? 1_555 ? 
352  GC5 5 HOH CJ .    ? HOH 0 8687 . ? 1_555 ? 
353  GC6 6 A   A  1368 ? A   0 1369 . ? 1_555 ? 
354  GC6 6 U   A  2649 ? U   0 2650 . ? 1_555 ? 
355  GC6 6 HOH CJ .    ? HOH 0 7331 . ? 1_555 ? 
356  GC6 6 HOH CJ .    ? HOH 0 7332 . ? 1_555 ? 
357  GC6 6 HOH CJ .    ? HOH 0 7333 . ? 1_555 ? 
358  GC6 6 HOH CJ .    ? HOH 0 9341 . ? 1_555 ? 
359  GC7 6 G   A  1488 ? G   0 1489 . ? 1_555 ? 
360  GC7 6 G   A  1490 ? G   0 1491 . ? 1_555 ? 
361  GC7 6 HOH CJ .    ? HOH 0 3154 . ? 1_555 ? 
362  GC7 6 HOH CJ .    ? HOH 0 3479 . ? 1_555 ? 
363  GC7 6 HOH CJ .    ? HOH 0 5700 . ? 1_555 ? 
364  GC7 6 HOH CJ .    ? HOH 0 8915 . ? 1_555 ? 
365  GC8 6 HOH CJ .    ? HOH 0 3705 . ? 1_555 ? 
366  GC8 6 HOH CJ .    ? HOH 0 6522 . ? 1_555 ? 
367  GC8 6 HOH CJ .    ? HOH 0 6946 . ? 1_555 ? 
368  GC8 6 HOH CJ .    ? HOH 0 7266 . ? 1_555 ? 
369  GC8 6 HOH CJ .    ? HOH 0 7342 . ? 1_555 ? 
370  GC8 6 HOH CJ .    ? HOH 0 7395 . ? 1_555 ? 
371  GC9 6 U   A  2276 ? U   0 2277 . ? 1_555 ? 
372  GC9 6 U   A  2277 ? U   0 2278 . ? 1_555 ? 
373  GC9 6 G   A  2470 ? G   0 2471 . ? 1_555 ? 
374  GC9 6 HOH CJ .    ? HOH 0 3275 . ? 1_555 ? 
375  GC9 6 HOH CJ .    ? HOH 0 3283 . ? 1_555 ? 
376  GC9 6 HOH CJ .    ? HOH 0 9109 . ? 1_555 ? 
377  HC1 3 C   A  1871 ? C   0 1872 . ? 1_555 ? 
378  HC1 3 G   A  1872 ? G   0 1873 . ? 1_555 ? 
379  HC1 3 ASP C  27   ? ASP A 26   . ? 1_555 ? 
380  HC2 6 A   A  1844 ? A   0 1845 . ? 1_555 ? 
381  HC2 6 U   A  1845 ? U   0 1846 . ? 1_555 ? 
382  HC2 6 G   A  1883 ? G   0 1884 . ? 1_555 ? 
383  HC2 6 HOH CJ .    ? HOH 0 7335 . ? 1_555 ? 
384  HC2 6 ASN C  189  ? ASN A 188  . ? 1_555 ? 
385  HC2 6 ARG C  191  ? ARG A 190  . ? 1_555 ? 
386  HC3 6 A   A  2567 ? A   0 2568 . ? 1_555 ? 
387  HC3 6 HOH CJ .    ? HOH 0 3274 . ? 1_555 ? 
388  HC3 6 HOH CJ .    ? HOH 0 4347 . ? 1_555 ? 
389  HC3 6 HOH CJ .    ? HOH 0 5748 . ? 1_555 ? 
390  HC3 6 HOH CJ .    ? HOH 0 7396 . ? 1_555 ? 
391  HC3 6 HOH CJ .    ? HOH 0 9257 . ? 1_555 ? 
392  HC4 5 A   A  165  ? A   0 166  . ? 1_555 ? 
393  HC4 5 G   A  218  ? G   0 219  . ? 1_555 ? 
394  HC4 5 HOH CJ .    ? HOH 0 3338 . ? 1_555 ? 
395  HC4 5 HOH CJ .    ? HOH 0 4483 . ? 1_555 ? 
396  HC4 5 HOH CJ .    ? HOH 0 8642 . ? 1_555 ? 
397  HC5 6 HOH CJ .    ? HOH 0 3636 . ? 1_555 ? 
398  HC5 6 HOH CJ .    ? HOH 0 5579 . ? 1_555 ? 
399  HC5 6 HOH CJ .    ? HOH 0 6933 . ? 1_555 ? 
400  HC5 6 HOH CJ .    ? HOH 0 7068 . ? 1_555 ? 
401  HC5 6 HOH CJ .    ? HOH 0 7340 . ? 1_555 ? 
402  HC5 6 HOH CJ .    ? HOH 0 7341 . ? 1_555 ? 
403  HC6 7 G   A  952  ? G   0 953  . ? 1_555 ? 
404  HC6 7 U   A  953  ? U   0 954  . ? 1_555 ? 
405  HC6 7 HOH CJ .    ? HOH 0 3519 . ? 1_555 ? 
406  HC6 7 HOH CJ .    ? HOH 0 6928 . ? 1_555 ? 
407  HC6 7 HOH CJ .    ? HOH 0 7339 . ? 1_555 ? 
408  HC6 7 HOH CJ .    ? HOH 0 7397 . ? 1_555 ? 
409  HC6 7 HOH CJ .    ? HOH 0 9752 . ? 1_555 ? 
410  HC7 6 A   A  1285 ? A   0 1286 . ? 1_555 ? 
411  HC7 6 A   A  1286 ? A   0 1287 . ? 1_555 ? 
412  HC7 6 HOH CJ .    ? HOH 0 7336 . ? 1_555 ? 
413  HC7 6 HOH CJ .    ? HOH 0 7337 . ? 1_555 ? 
414  HC7 6 HOH CJ .    ? HOH 0 7398 . ? 1_555 ? 
415  HC7 6 HOH CJ .    ? HOH 0 7399 . ? 1_555 ? 
416  HC8 6 A   A  906  ? A   0 907  . ? 1_555 ? 
417  HC8 6 A   A  907  ? A   0 908  . ? 1_555 ? 
418  HC8 6 HOH CJ .    ? HOH 0 3158 . ? 1_555 ? 
419  HC8 6 HOH CJ .    ? HOH 0 3437 . ? 1_555 ? 
420  HC8 6 HOH CJ .    ? HOH 0 4462 . ? 1_555 ? 
421  HC8 6 HOH CJ .    ? HOH 0 7338 . ? 1_555 ? 
422  HC9 6 HOH CJ .    ? HOH 0 6372 . ? 1_555 ? 
423  HC9 6 HOH CJ .    ? HOH 0 7344 . ? 1_555 ? 
424  HC9 6 HOH CJ .    ? HOH 0 7345 . ? 1_555 ? 
425  HC9 6 HOH CJ .    ? HOH 0 7400 . ? 1_555 ? 
426  HC9 6 HOH CJ .    ? HOH 0 7401 . ? 1_555 ? 
427  HC9 6 HOH FK .    ? HOH 2 7875 . ? 1_555 ? 
428  IC1 6 C   A  879  ? C   0 880  . ? 1_555 ? 
429  IC1 6 U   A  882  ? U   0 883  . ? 1_555 ? 
430  IC1 6 HOH CJ .    ? HOH 0 3144 . ? 1_555 ? 
431  IC1 6 HOH CJ .    ? HOH 0 7346 . ? 1_555 ? 
432  IC1 6 HOH CJ .    ? HOH 0 7347 . ? 1_555 ? 
433  IC1 6 HOH CJ .    ? HOH 0 8760 . ? 1_555 ? 
434  IC2 6 A   A  164  ? A   0 165  . ? 1_555 ? 
435  IC2 6 A   A  166  ? A   0 167  . ? 1_555 ? 
436  IC2 6 C   A  167  ? C   0 168  . ? 1_555 ? 
437  IC2 6 HOH CJ .    ? HOH 0 3133 . ? 1_555 ? 
438  IC2 6 HOH CJ .    ? HOH 0 3138 . ? 1_555 ? 
439  IC2 6 HOH CJ .    ? HOH 0 3150 . ? 1_555 ? 
440  IC3 6 A   A  1683 ? A   0 1684 . ? 1_555 ? 
441  IC3 6 U   A  1723 ? U   0 1724 . ? 1_555 ? 
442  IC3 6 HOH CJ .    ? HOH 0 3729 . ? 1_555 ? 
443  IC3 6 HOH CJ .    ? HOH 0 4019 . ? 1_555 ? 
444  IC3 6 HOH CJ .    ? HOH 0 7348 . ? 1_555 ? 
445  IC3 6 HOH CJ .    ? HOH 0 7402 . ? 1_555 ? 
446  IC4 5 C   A  1419 ? C   0 1420 . ? 1_555 ? 
447  IC4 5 C   A  1420 ? C   0 1421 . ? 1_555 ? 
448  IC4 5 G   A  1437 ? G   0 1438 . ? 1_555 ? 
449  IC4 5 HOH CJ .    ? HOH 0 3622 . ? 1_555 ? 
450  IC4 5 HOH CJ .    ? HOH 0 9131 . ? 1_555 ? 
451  IC5 6 C   A  1435 ? C   0 1436 . ? 1_555 ? 
452  IC5 6 A   A  1436 ? A   0 1437 . ? 1_555 ? 
453  IC5 6 HOH CJ .    ? HOH 0 4681 . ? 1_555 ? 
454  IC5 6 HOH CJ .    ? HOH 0 4767 . ? 1_555 ? 
455  IC5 6 HOH CJ .    ? HOH 0 7410 . ? 1_555 ? 
456  IC5 6 HOH TJ .    ? HOH P 213  . ? 1_555 ? 
457  IC6 6 A   A  1753 ? A   0 1754 . ? 1_555 ? 
458  IC6 6 HOH CJ .    ? HOH 0 3229 . ? 1_555 ? 
459  IC6 6 HOH CJ .    ? HOH 0 3676 . ? 1_555 ? 
460  IC6 6 HOH CJ .    ? HOH 0 5881 . ? 1_555 ? 
461  IC6 6 HOH CJ .    ? HOH 0 7349 . ? 1_555 ? 
462  IC6 6 HOH CJ .    ? HOH 0 7403 . ? 1_555 ? 
463  IC7 7 A   A  1741 ? A   0 1742 . ? 1_555 ? 
464  IC7 7 G   A  1744 ? G   0 1745 . ? 1_555 ? 
465  IC7 7 HOH CJ .    ? HOH 0 3156 . ? 1_555 ? 
466  IC7 7 HOH CJ .    ? HOH 0 7350 . ? 1_555 ? 
467  IC7 7 HOH CJ .    ? HOH 0 8769 . ? 1_555 ? 
468  IC7 7 HOH CJ .    ? HOH 0 8893 . ? 1_555 ? 
469  IC7 7 HOH CJ .    ? HOH 0 9274 . ? 1_555 ? 
470  IC8 8 G   A  2616 ? G   0 2617 . ? 1_555 ? 
471  IC8 8 G   A  2617 ? G   0 2618 . ? 1_555 ? 
472  IC8 8 HOH CJ .    ? HOH 0 3310 . ? 1_555 ? 
473  IC8 8 HOH CJ .    ? HOH 0 3886 . ? 1_555 ? 
474  IC8 8 HOH CJ .    ? HOH 0 4012 . ? 1_555 ? 
475  IC8 8 MG  KC .    ? MG  0 8059 . ? 1_555 ? 
476  IC8 8 HOH CJ .    ? HOH 0 8558 . ? 1_555 ? 
477  IC8 8 HOH CJ .    ? HOH 0 9121 . ? 1_555 ? 
478  IC9 6 A   A  531  ? A   0 532  . ? 1_555 ? 
479  IC9 6 U   A  532  ? U   0 533  . ? 1_555 ? 
480  IC9 6 HOH CJ .    ? HOH 0 3255 . ? 1_555 ? 
481  IC9 6 HOH CJ .    ? HOH 0 3498 . ? 1_555 ? 
482  IC9 6 HOH CJ .    ? HOH 0 7351 . ? 1_555 ? 
483  IC9 6 HOH CJ .    ? HOH 0 7352 . ? 1_555 ? 
484  JC1 4 A   A  681  ? A   0 682  . ? 1_555 ? 
485  JC1 4 G   A  682  ? G   0 683  . ? 1_555 ? 
486  JC1 4 HOH CJ .    ? HOH 0 3199 . ? 1_555 ? 
487  JC1 4 HOH CJ .    ? HOH 0 7411 . ? 1_555 ? 
488  JC2 7 G   A  2539 ? G   0 2540 . ? 1_555 ? 
489  JC2 7 G   A  2610 ? G   0 2611 . ? 1_555 ? 
490  JC2 7 HOH CJ .    ? HOH 0 3818 . ? 1_555 ? 
491  JC2 7 NA  TF .    ? NA  0 8339 . ? 1_555 ? 
492  JC2 7 HOH CJ .    ? HOH 0 8584 . ? 1_555 ? 
493  JC2 7 HOH CJ .    ? HOH 0 8816 . ? 1_555 ? 
494  JC2 7 HOH CJ .    ? HOH 0 9565 . ? 1_555 ? 
495  JC3 7 C   A  514  ? C   0 515  . ? 1_555 ? 
496  JC3 7 A   A  515  ? A   0 516  . ? 1_555 ? 
497  JC3 7 U   A  516  ? U   0 517  . ? 1_555 ? 
498  JC3 7 G   A  517  ? G   0 518  . ? 1_555 ? 
499  JC3 7 HOH CJ .    ? HOH 0 7353 . ? 1_555 ? 
500  JC3 7 HOH CJ .    ? HOH 0 7404 . ? 1_555 ? 
501  JC3 7 HOH CJ .    ? HOH 0 7405 . ? 1_555 ? 
502  JC4 4 A   A  2102 ? A   0 2103 . ? 1_555 ? 
503  JC4 4 U   A  2477 ? U   0 2478 . ? 1_555 ? 
504  JC4 4 HOH CJ .    ? HOH 0 3136 . ? 1_555 ? 
505  JC4 4 HOH CJ .    ? HOH 0 3319 . ? 1_555 ? 
506  JC5 6 G   A  917  ? G   0 918  . ? 1_555 ? 
507  JC5 6 HOH CJ .    ? HOH 0 6006 . ? 1_555 ? 
508  JC5 6 HOH CJ .    ? HOH 0 7354 . ? 1_555 ? 
509  JC5 6 HOH CJ .    ? HOH 0 8612 . ? 1_555 ? 
510  JC5 6 HOH CJ .    ? HOH 0 9065 . ? 1_555 ? 
511  JC5 6 HOH CJ .    ? HOH 0 9845 . ? 1_555 ? 
512  JC6 4 C   A  1843 ? C   0 1844 . ? 1_555 ? 
513  JC6 4 HOH CJ .    ? HOH 0 3166 . ? 1_555 ? 
514  JC6 4 HOH CJ .    ? HOH 0 3182 . ? 1_555 ? 
515  JC6 4 HOH CJ .    ? HOH 0 7406 . ? 1_555 ? 
516  JC7 6 A   A  1069 ? A   0 1070 . ? 1_555 ? 
517  JC7 6 G   A  1070 ? G   0 1071 . ? 1_555 ? 
518  JC7 6 HOH CJ .    ? HOH 0 3172 . ? 1_555 ? 
519  JC7 6 HOH CJ .    ? HOH 0 3204 . ? 1_555 ? 
520  JC7 6 HOH CJ .    ? HOH 0 3245 . ? 1_555 ? 
521  JC7 6 HOH CJ .    ? HOH 0 9204 . ? 1_555 ? 
522  JC8 4 U   A  1095 ? U   0 1096 . ? 1_555 ? 
523  JC8 4 C   A  1256 ? C   0 1257 . ? 1_555 ? 
524  JC8 4 HOH CJ .    ? HOH 0 7355 . ? 1_555 ? 
525  JC8 4 HOH CJ .    ? HOH 0 7407 . ? 1_555 ? 
526  JC9 7 G   A  1847 ? G   0 1848 . ? 1_555 ? 
527  JC9 7 G   A  1848 ? G   0 1849 . ? 1_555 ? 
528  JC9 7 HOH CJ .    ? HOH 0 3185 . ? 1_555 ? 
529  JC9 7 HOH CJ .    ? HOH 0 3222 . ? 1_555 ? 
530  JC9 7 HOH CJ .    ? HOH 0 3356 . ? 1_555 ? 
531  JC9 7 HOH CJ .    ? HOH 0 3385 . ? 1_555 ? 
532  JC9 7 MG  IE .    ? MG  0 8115 . ? 1_555 ? 
533  KC1 6 G   A  862  ? G   0 863  . ? 1_555 ? 
534  KC1 6 U   A  863  ? U   0 864  . ? 1_555 ? 
535  KC1 6 HOH CJ .    ? HOH 0 3194 . ? 1_555 ? 
536  KC1 6 HOH CJ .    ? HOH 0 3198 . ? 1_555 ? 
537  KC1 6 HOH CJ .    ? HOH 0 5081 . ? 1_555 ? 
538  KC1 6 HOH CJ .    ? HOH 0 9860 . ? 1_555 ? 
539  KC2 6 A   A  906  ? A   0 907  . ? 1_555 ? 
540  KC2 6 HOH CJ .    ? HOH 0 3206 . ? 1_555 ? 
541  KC2 6 HOH CJ .    ? HOH 0 3270 . ? 1_555 ? 
542  KC2 6 HOH CJ .    ? HOH 0 9465 . ? 1_555 ? 
543  KC2 6 HOH CJ .    ? HOH 0 9892 . ? 1_555 ? 
544  KC2 6 HOH CK .    ? HOH Y 8568 . ? 1_555 ? 
545  KC3 4 A   A  2611 ? A   0 2612 . ? 1_555 ? 
546  KC3 4 HOH CJ .    ? HOH 0 3189 . ? 1_555 ? 
547  KC3 4 HOH CJ .    ? HOH 0 3201 . ? 1_555 ? 
548  KC3 4 HOH CJ .    ? HOH 0 9536 . ? 1_555 ? 
549  KC4 6 G   A  2079 ? G   0 2080 . ? 1_555 ? 
550  KC4 6 HOH CJ .    ? HOH 0 3289 . ? 1_555 ? 
551  KC4 6 HOH CJ .    ? HOH 0 3774 . ? 1_555 ? 
552  KC4 6 HOH CJ .    ? HOH 0 5034 . ? 1_555 ? 
553  KC4 6 HOH CJ .    ? HOH 0 7356 . ? 1_555 ? 
554  KC4 6 HOH CJ .    ? HOH 0 7357 . ? 1_555 ? 
555  KC5 6 U   A  2106 ? U   0 2107 . ? 1_555 ? 
556  KC5 6 C   A  2280 ? C   0 2281 . ? 1_555 ? 
557  KC5 6 U   A  2281 ? U   0 2282 . ? 1_555 ? 
558  KC5 6 HOH CJ .    ? HOH 0 3269 . ? 1_555 ? 
559  KC5 6 HOH CJ .    ? HOH 0 4146 . ? 1_555 ? 
560  KC5 6 HOH CJ .    ? HOH 0 6427 . ? 1_555 ? 
561  KC6 6 A   A  2433 ? A   0 2434 . ? 1_555 ? 
562  KC6 6 U   A  2457 ? U   0 2458 . ? 1_555 ? 
563  KC6 6 HOH CJ .    ? HOH 0 7415 . ? 1_555 ? 
564  KC6 6 HOH CJ .    ? HOH 0 8772 . ? 1_555 ? 
565  KC6 6 HOH CJ .    ? HOH 0 9413 . ? 1_555 ? 
566  KC6 6 HOH GK .    ? HOH 3 8523 . ? 1_555 ? 
567  KC7 3 G   A  2577 ? G   0 2578 . ? 1_555 ? 
568  KC7 3 G   A  2578 ? G   0 2579 . ? 1_555 ? 
569  KC7 3 HOH CJ .    ? HOH 0 7408 . ? 1_555 ? 
570  KC8 6 C   A  2103 ? C   0 2104 . ? 1_555 ? 
571  KC8 6 C   A  2104 ? C   0 2105 . ? 1_555 ? 
572  KC8 6 HOH CJ .    ? HOH 0 7262 . ? 1_555 ? 
573  KC8 6 HOH CJ .    ? HOH 0 7263 . ? 1_555 ? 
574  KC8 6 HOH CJ .    ? HOH 0 7264 . ? 1_555 ? 
575  KC8 6 HOH CJ .    ? HOH 0 7265 . ? 1_555 ? 
576  KC9 7 G   A  816  ? G   0 817  . ? 1_555 ? 
577  KC9 7 HOH CJ .    ? HOH 0 3123 . ? 1_555 ? 
578  KC9 7 HOH CJ .    ? HOH 0 6929 . ? 1_555 ? 
579  KC9 7 HOH CJ .    ? HOH 0 7373 . ? 1_555 ? 
580  KC9 7 MG  VB .    ? MG  0 8043 . ? 1_555 ? 
581  KC9 7 HOH TJ .    ? HOH P 186  . ? 1_555 ? 
582  KC9 7 HOH TJ .    ? HOH P 207  . ? 1_555 ? 
583  LC1 6 A   A  1105 ? A   0 1106 . ? 1_555 ? 
584  LC1 6 A   A  1106 ? A   0 1107 . ? 1_555 ? 
585  LC1 6 HOH CJ .    ? HOH 0 7382 . ? 1_555 ? 
586  LC1 6 HOH CJ .    ? HOH 0 7383 . ? 1_555 ? 
587  LC1 6 HOH CJ .    ? HOH 0 7384 . ? 1_555 ? 
588  LC1 6 HOH CJ .    ? HOH 0 7385 . ? 1_555 ? 
589  LC2 6 G   A  2000 ? G   0 2001 . ? 1_555 ? 
590  LC2 6 HOH CJ .    ? HOH 0 5623 . ? 1_555 ? 
591  LC2 6 HOH CJ .    ? HOH 0 7004 . ? 1_555 ? 
592  LC2 6 HOH CJ .    ? HOH 0 7387 . ? 1_555 ? 
593  LC2 6 HOH CJ .    ? HOH 0 7388 . ? 1_555 ? 
594  LC2 6 HOH CJ .    ? HOH 0 7389 . ? 1_555 ? 
595  LC3 6 U   A  902  ? U   0 903  . ? 1_555 ? 
596  LC3 6 A   A  1356 ? A   0 1357 . ? 1_555 ? 
597  LC3 6 HOH CJ .    ? HOH 0 3447 . ? 1_555 ? 
598  LC3 6 HOH CJ .    ? HOH 0 4927 . ? 1_555 ? 
599  LC3 6 HOH CJ .    ? HOH 0 5558 . ? 1_555 ? 
600  LC3 6 HOH CJ .    ? HOH 0 9027 . ? 1_555 ? 
601  LC4 6 G   A  2608 ? G   0 2609 . ? 1_555 ? 
602  LC4 6 HOH CJ .    ? HOH 0 3219 . ? 1_555 ? 
603  LC4 6 HOH CJ .    ? HOH 0 3243 . ? 1_555 ? 
604  LC4 6 HOH CJ .    ? HOH 0 5128 . ? 1_555 ? 
605  LC4 6 HOH CJ .    ? HOH 0 5273 . ? 1_555 ? 
606  LC4 6 HOH CJ .    ? HOH 0 9820 . ? 1_555 ? 
607  LC5 6 A   A  186  ? A   0 187  . ? 1_555 ? 
608  LC5 6 HOH CJ .    ? HOH 0 3249 . ? 1_555 ? 
609  LC5 6 HOH CJ .    ? HOH 0 3290 . ? 1_555 ? 
610  LC5 6 HOH CJ .    ? HOH 0 8648 . ? 1_555 ? 
611  LC5 6 HOH CJ .    ? HOH 0 8851 . ? 1_555 ? 
612  LC5 6 HOH CJ .    ? HOH 0 9087 . ? 1_555 ? 
613  LC6 6 A   A  2111 ? A   0 2112 . ? 1_555 ? 
614  LC6 6 HOH CJ .    ? HOH 0 3275 . ? 1_555 ? 
615  LC6 6 HOH CJ .    ? HOH 0 3445 . ? 1_555 ? 
616  LC6 6 HOH CJ .    ? HOH 0 5657 . ? 1_555 ? 
617  LC6 6 HOH CJ .    ? HOH 0 5924 . ? 1_555 ? 
618  LC6 6 HOH CJ .    ? HOH 0 9109 . ? 1_555 ? 
619  LC7 6 A   A  2429 ? A   0 2430 . ? 1_555 ? 
620  LC7 6 HOH CJ .    ? HOH 0 3191 . ? 1_555 ? 
621  LC7 6 HOH CJ .    ? HOH 0 3487 . ? 1_555 ? 
622  LC7 6 HOH CJ .    ? HOH 0 4343 . ? 1_555 ? 
623  LC7 6 HOH CJ .    ? HOH 0 8869 . ? 1_555 ? 
624  LC7 6 HOH CJ .    ? HOH 0 8969 . ? 1_555 ? 
625  LC8 6 HOH CJ .    ? HOH 0 3810 . ? 1_555 ? 
626  LC8 6 HOH CJ .    ? HOH 0 3828 . ? 1_555 ? 
627  LC8 6 HOH CJ .    ? HOH 0 6124 . ? 1_555 ? 
628  LC8 6 HOH CJ .    ? HOH 0 6255 . ? 1_555 ? 
629  LC8 6 HOH EJ .    ? HOH A 8555 . ? 1_555 ? 
630  LC8 6 HOH EJ .    ? HOH A 8636 . ? 1_555 ? 
631  LC9 7 U   A  1849 ? U   0 1850 . ? 1_555 ? 
632  LC9 7 HOH CJ .    ? HOH 0 3185 . ? 1_555 ? 
633  LC9 7 HOH CJ .    ? HOH 0 3211 . ? 1_555 ? 
634  LC9 7 HOH CJ .    ? HOH 0 3385 . ? 1_555 ? 
635  LC9 7 HOH CJ .    ? HOH 0 6255 . ? 1_555 ? 
636  LC9 7 MG  QD .    ? MG  0 8096 . ? 1_555 ? 
637  LC9 7 HOH EJ .    ? HOH A 8555 . ? 1_555 ? 
638  MC1 6 A   A  1839 ? A   0 1840 . ? 1_555 ? 
639  MC1 6 C   A  1840 ? C   0 1841 . ? 1_555 ? 
640  MC1 6 A   A  2021 ? A   0 2022 . ? 1_555 ? 
641  MC1 6 HOH CJ .    ? HOH 0 4161 . ? 1_555 ? 
642  MC1 6 HOH CJ .    ? HOH 0 6082 . ? 1_555 ? 
643  MC1 6 HOH CJ .    ? HOH 0 8743 . ? 1_555 ? 
644  MC2 3 G   A  2101 ? G   0 2102 . ? 1_555 ? 
645  MC2 3 G   A  2481 ? G   0 2482 . ? 1_555 ? 
646  MC2 3 C   A  2535 ? C   0 2536 . ? 1_555 ? 
647  MC3 8 C   A  161  ? C   0 162  . ? 1_555 ? 
648  MC3 8 U   A  162  ? U   0 163  . ? 1_555 ? 
649  MC3 8 U   A  171  ? U   0 172  . ? 1_555 ? 
650  MC3 8 HOH CJ .    ? HOH 0 4450 . ? 1_555 ? 
651  MC3 8 HOH CJ .    ? HOH 0 8535 . ? 1_555 ? 
652  MC3 8 HOH CJ .    ? HOH 0 8631 . ? 1_555 ? 
653  MC3 8 HOH CJ .    ? HOH 0 8665 . ? 1_555 ? 
654  MC3 8 ARG O  82   ? ARG M 82   . ? 1_555 ? 
655  MC4 6 C   A  1068 ? C   0 1069 . ? 1_555 ? 
656  MC4 6 G   A  1071 ? G   0 1072 . ? 1_555 ? 
657  MC4 6 G   A  1086 ? G   0 1087 . ? 1_555 ? 
658  MC4 6 HOH CJ .    ? HOH 0 4495 . ? 1_555 ? 
659  MC4 6 HOH CJ .    ? HOH 0 9688 . ? 1_555 ? 
660  MC4 6 HOH CJ .    ? HOH 0 9720 . ? 1_555 ? 
661  MC5 6 G   A  1118 ? G   0 1119 . ? 1_555 ? 
662  MC5 6 U   A  1119 ? U   0 1120 . ? 1_555 ? 
663  MC5 6 G   A  1120 ? G   0 1121 . ? 1_555 ? 
664  MC5 6 U   A  1121 ? U   0 1122 . ? 1_555 ? 
665  MC5 6 HOH CJ .    ? HOH 0 4072 . ? 1_555 ? 
666  MC5 6 HOH CJ .    ? HOH 0 7297 . ? 1_555 ? 
667  MC6 5 A   A  642  ? A   0 643  . ? 1_555 ? 
668  MC6 5 G   A  643  ? G   0 644  . ? 1_555 ? 
669  MC6 5 U   A  903  ? U   0 904  . ? 1_555 ? 
670  MC6 5 G   A  1353 ? G   0 1354 . ? 1_555 ? 
671  MC6 5 ARG N  9    ? ARG L 8    . ? 1_555 ? 
672  MC7 6 A   A  629  ? A   0 630  . ? 1_555 ? 
673  MC7 6 A   A  630  ? A   0 631  . ? 1_555 ? 
674  MC7 6 A   A  2073 ? A   0 2074 . ? 1_555 ? 
675  MC7 6 HOH CJ .    ? HOH 0 3612 . ? 1_555 ? 
676  MC7 6 HOH CJ .    ? HOH 0 4225 . ? 1_555 ? 
677  MC7 6 HOH CJ .    ? HOH 0 5310 . ? 1_555 ? 
678  MC8 6 G   A  2091 ? G   0 2092 . ? 1_555 ? 
679  MC8 6 G   A  2092 ? G   0 2093 . ? 1_555 ? 
680  MC8 6 G   A  2093 ? G   0 2094 . ? 1_555 ? 
681  MC8 6 A   A  2611 ? A   0 2612 . ? 1_555 ? 
682  MC8 6 A   A  2648 ? A   0 2649 . ? 1_555 ? 
683  MC8 6 HOH CJ .    ? HOH 0 8646 . ? 1_555 ? 
684  MC9 4 C   A  39   ? C   0 40   . ? 1_555 ? 
685  MC9 4 G   A  40   ? G   0 41   . ? 1_555 ? 
686  MC9 4 A   A  441  ? A   0 442  . ? 1_555 ? 
687  MC9 4 C   A  442  ? C   0 443  . ? 1_555 ? 
688  NC1 5 C   A  1393 ? C   0 1394 . ? 1_555 ? 
689  NC1 5 U   A  1431 ? U   0 1432 . ? 1_555 ? 
690  NC1 5 G   A  1432 ? G   0 1433 . ? 1_555 ? 
691  NC1 5 U   A  1723 ? U   0 1724 . ? 1_555 ? 
692  NC1 5 HOH CJ .    ? HOH 0 9933 . ? 1_555 ? 
693  NC2 4 A   A  2576 ? A   0 2577 . ? 1_555 ? 
694  NC2 4 G   A  2577 ? G   0 2578 . ? 1_555 ? 
695  NC2 4 G   A  2578 ? G   0 2579 . ? 1_555 ? 
696  NC2 4 HOH CJ .    ? HOH 0 4031 . ? 1_555 ? 
697  NC3 5 G   A  2523 ? G   0 2524 . ? 1_555 ? 
698  NC3 5 G   A  2524 ? G   0 2525 . ? 1_555 ? 
699  NC3 5 HOH CJ .    ? HOH 0 3097 . ? 1_555 ? 
700  NC3 5 HOH CJ .    ? HOH 0 4178 . ? 1_555 ? 
701  NC3 5 HOH CJ .    ? HOH 0 8701 . ? 1_555 ? 
702  NC4 5 G   A  2398 ? G   0 2399 . ? 1_555 ? 
703  NC4 5 HOH CJ .    ? HOH 0 3357 . ? 1_555 ? 
704  NC4 5 HOH CJ .    ? HOH 0 4642 . ? 1_555 ? 
705  NC4 5 HOH CJ .    ? HOH 0 5585 . ? 1_555 ? 
706  NC4 5 HOH CJ .    ? HOH 0 9475 . ? 1_555 ? 
707  NC5 5 U   A  2540 ? U   0 2541 . ? 1_555 ? 
708  NC5 5 U   A  2606 ? U   0 2607 . ? 1_555 ? 
709  NC5 5 HOH CJ .    ? HOH 0 8852 . ? 1_555 ? 
710  NC5 5 HOH CJ .    ? HOH 0 9650 . ? 1_555 ? 
711  NC5 5 TRP D  243  ? TRP B 242  . ? 1_555 ? 
712  NC6 4 A   A  164  ? A   0 165  . ? 1_555 ? 
713  NC6 4 A   A  165  ? A   0 166  . ? 1_555 ? 
714  NC6 4 A   A  166  ? A   0 167  . ? 1_555 ? 
715  NC6 4 HOH CJ .    ? HOH 0 9207 . ? 1_555 ? 
716  NC7 3 C   A  895  ? C   0 896  . ? 1_555 ? 
717  NC7 3 A   A  896  ? A   0 897  . ? 1_555 ? 
718  NC7 3 HOH CJ .    ? HOH 0 5839 . ? 1_555 ? 
719  NC8 6 G   A  1415 ? G   0 1416 . ? 1_555 ? 
720  NC8 6 G   A  1416 ? G   0 1417 . ? 1_555 ? 
721  NC8 6 HOH CJ .    ? HOH 0 8797 . ? 1_555 ? 
722  NC8 6 TRP DA 43   ? TRP 2 42   . ? 1_555 ? 
723  NC8 6 ASN DA 46   ? ASN 2 45   . ? 1_555 ? 
724  NC8 6 HOH FK .    ? HOH 2 4135 . ? 1_555 ? 
725  NC9 6 G   A  2542 ? G   0 2543 . ? 1_555 ? 
726  NC9 6 G   A  2543 ? G   0 2544 . ? 1_555 ? 
727  NC9 6 HOH CJ .    ? HOH 0 3451 . ? 1_555 ? 
728  NC9 6 NA  CF .    ? NA  0 8320 . ? 1_555 ? 
729  NC9 6 HOH CJ .    ? HOH 0 8730 . ? 1_555 ? 
730  NC9 6 HOH CJ .    ? HOH 0 9986 . ? 1_555 ? 
731  OC1 7 A   A  2464 ? A   0 2465 . ? 1_555 ? 
732  OC1 7 G   A  2465 ? G   0 2466 . ? 1_555 ? 
733  OC1 7 HOH CJ .    ? HOH 0 3784 . ? 1_555 ? 
734  OC1 7 HOH CJ .    ? HOH 0 5573 . ? 1_555 ? 
735  OC1 7 HOH CJ .    ? HOH 0 8580 . ? 1_555 ? 
736  OC1 7 ASP N  37   ? ASP L 36   . ? 1_555 ? 
737  OC1 7 HOH PJ .    ? HOH L 8535 . ? 1_555 ? 
738  OC2 8 G   A  2542 ? G   0 2543 . ? 1_555 ? 
739  OC2 8 G   A  2543 ? G   0 2544 . ? 1_555 ? 
740  OC2 8 G   A  2610 ? G   0 2611 . ? 1_555 ? 
741  OC2 8 U   A  2614 ? U   0 2615 . ? 1_555 ? 
742  OC2 8 NA  AF .    ? NA  0 8318 . ? 1_555 ? 
743  OC2 8 HOH CJ .    ? HOH 0 8577 . ? 1_555 ? 
744  OC2 8 HOH CJ .    ? HOH 0 8607 . ? 1_555 ? 
745  OC2 8 HOH CJ .    ? HOH 0 9265 . ? 1_555 ? 
746  OC3 5 G   A  835  ? G   0 836  . ? 1_555 ? 
747  OC3 5 U   A  836  ? U   0 837  . ? 1_555 ? 
748  OC3 5 A   A  1735 ? A   0 1736 . ? 1_555 ? 
749  OC3 5 A   A  1736 ? A   0 1737 . ? 1_555 ? 
750  OC3 5 ARG D  230  ? ARG B 229  . ? 1_555 ? 
751  OC4 6 G   A  884  ? G   0 885  . ? 1_555 ? 
752  OC4 6 A   A  2111 ? A   0 2112 . ? 1_555 ? 
753  OC4 6 G   A  2112 ? G   0 2113 . ? 1_555 ? 
754  OC4 6 C   A  2474 ? C   0 2475 . ? 1_555 ? 
755  OC4 6 C   A  2475 ? C   0 2476 . ? 1_555 ? 
756  OC4 6 HOH CJ .    ? HOH 0 4006 . ? 1_555 ? 
757  OC5 6 A   A  44   ? A   0 45   . ? 1_555 ? 
758  OC5 6 C   A  129  ? C   0 130  . ? 1_555 ? 
759  OC5 6 U   A  145  ? U   0 146  . ? 1_555 ? 
760  OC5 6 G   A  146  ? G   0 147  . ? 1_555 ? 
761  OC5 6 HOH CJ .    ? HOH 0 3653 . ? 1_555 ? 
762  OC5 6 HOH CJ .    ? HOH 0 9012 . ? 1_555 ? 
763  OC6 7 A   A  775  ? A   0 776  . ? 1_555 ? 
764  OC6 7 U   A  776  ? U   0 777  . ? 1_555 ? 
765  OC6 7 U   A  778  ? U   0 779  . ? 1_555 ? 
766  OC6 7 HOH CJ .    ? HOH 0 7174 . ? 1_555 ? 
767  OC6 7 MG  JB .    ? MG  0 8031 . ? 1_555 ? 
768  OC6 7 HOH CJ .    ? HOH 0 9144 . ? 1_555 ? 
769  OC6 7 HOH CJ .    ? HOH 0 9796 . ? 1_555 ? 
770  OC7 4 G   A  1970 ? G   0 1971 . ? 1_555 ? 
771  OC7 4 G   A  2008 ? G   0 2009 . ? 1_555 ? 
772  OC7 4 A   A  2009 ? A   0 2010 . ? 1_555 ? 
773  OC7 4 U   A  2011 ? U   0 2012 . ? 1_555 ? 
774  OC8 7 U   A  820  ? U   0 821  . ? 1_555 ? 
775  OC8 7 C   A  852  ? C   0 853  . ? 1_555 ? 
776  OC8 7 G   A  853  ? G   0 854  . ? 1_555 ? 
777  OC8 7 U   A  1830 ? U   0 1831 . ? 1_555 ? 
778  OC8 7 HOH CJ .    ? HOH 0 8557 . ? 1_555 ? 
779  OC8 7 HOH CJ .    ? HOH 0 9253 . ? 1_555 ? 
780  OC8 7 HOH CJ .    ? HOH 0 9724 . ? 1_555 ? 
781  OC9 6 G   A  55   ? G   0 56   . ? 1_555 ? 
782  OC9 6 A   A  58   ? A   0 59   . ? 1_555 ? 
783  OC9 6 A   A  59   ? A   0 60   . ? 1_555 ? 
784  OC9 6 G   A  60   ? G   0 61   . ? 1_555 ? 
785  OC9 6 HOH CJ .    ? HOH 0 4738 . ? 1_555 ? 
786  OC9 6 HOH CJ .    ? HOH 0 6001 . ? 1_555 ? 
787  PC1 4 G   A  65   ? G   0 66   . ? 1_555 ? 
788  PC1 4 U   A  106  ? U   0 107  . ? 1_555 ? 
789  PC1 4 U   A  107  ? U   0 108  . ? 1_555 ? 
790  PC1 4 HOH CJ .    ? HOH 0 6100 . ? 1_555 ? 
791  PC2 3 C   A  140  ? C   0 141  . ? 1_555 ? 
792  PC2 3 G   A  141  ? G   0 142  . ? 1_555 ? 
793  PC2 3 HOH CJ .    ? HOH 0 8753 . ? 1_555 ? 
794  PC3 5 U   A  169  ? U   0 170  . ? 1_555 ? 
795  PC3 5 C   A  170  ? C   0 171  . ? 1_555 ? 
796  PC3 5 C   A  217  ? C   0 218  . ? 1_555 ? 
797  PC3 5 G   A  220  ? G   0 221  . ? 1_555 ? 
798  PC3 5 HOH CJ .    ? HOH 0 8821 . ? 1_555 ? 
799  PC4 6 G   A  385  ? G   0 386  . ? 1_555 ? 
800  PC4 6 G   A  386  ? G   0 387  . ? 1_555 ? 
801  PC4 6 G   A  387  ? G   0 388  . ? 1_555 ? 
802  PC4 6 C   A  400  ? C   0 401  . ? 1_555 ? 
803  PC4 6 U   A  401  ? U   0 402  . ? 1_555 ? 
804  PC4 6 HOH CJ .    ? HOH 0 6589 . ? 1_555 ? 
805  PC5 4 C   A  1893 ? C   0 1894 . ? 1_555 ? 
806  PC5 4 U   A  1896 ? U   0 1897 . ? 1_555 ? 
807  PC5 4 G   A  1897 ? G   0 1898 . ? 1_555 ? 
808  PC5 4 U   A  1938 ? U   0 1939 . ? 1_555 ? 
809  PC6 5 C   A  1893 ? C   0 1894 . ? 1_555 ? 
810  PC6 5 A   A  1894 ? A   0 1895 . ? 1_555 ? 
811  PC6 5 G   A  1895 ? G   0 1896 . ? 1_555 ? 
812  PC6 5 U   A  1896 ? U   0 1897 . ? 1_555 ? 
813  PC6 5 HOH CJ .    ? HOH 0 4773 . ? 1_555 ? 
814  PC7 5 G   A  621  ? G   0 622  . ? 1_555 ? 
815  PC7 5 U   A  622  ? U   0 623  . ? 1_555 ? 
816  PC7 5 1MA A  627  ? 1MA 0 628  . ? 1_555 ? 
817  PC7 5 A   A  629  ? A   0 630  . ? 1_555 ? 
818  PC7 5 HOH CJ .    ? HOH 0 9394 . ? 1_555 ? 
819  PC8 6 G   A  1705 ? G   0 1706 . ? 1_555 ? 
820  PC8 6 G   A  1706 ? G   0 1707 . ? 1_555 ? 
821  PC8 6 HOH CJ .    ? HOH 0 4864 . ? 1_555 ? 
822  PC8 6 HOH CJ .    ? HOH 0 6864 . ? 1_555 ? 
823  PC8 6 HOH CJ .    ? HOH 0 7201 . ? 1_555 ? 
824  PC8 6 HOH CJ .    ? HOH 0 9446 . ? 1_555 ? 
825  PC9 6 U   A  2658 ? U   0 2659 . ? 1_555 ? 
826  PC9 6 G   A  2659 ? G   0 2660 . ? 1_555 ? 
827  PC9 6 VAL T  73   ? VAL R 72   . ? 1_555 ? 
828  PC9 6 TRP T  76   ? TRP R 75   . ? 1_555 ? 
829  PC9 6 HOH VJ .    ? HOH R 8514 . ? 1_555 ? 
830  PC9 6 HOH VJ .    ? HOH R 8526 . ? 1_555 ? 
831  QC1 8 G   A  2539 ? G   0 2540 . ? 1_555 ? 
832  QC1 8 G   A  2610 ? G   0 2611 . ? 1_555 ? 
833  QC1 8 G   A  2615 ? G   0 2616 . ? 1_555 ? 
834  QC1 8 U   A  2644 ? U   0 2645 . ? 1_555 ? 
835  QC1 8 HOH CJ .    ? HOH 0 3818 . ? 1_555 ? 
836  QC1 8 MG  JD .    ? MG  0 8088 . ? 1_555 ? 
837  QC1 8 HOH CJ .    ? HOH 0 8816 . ? 1_555 ? 
838  QC1 8 HOH CJ .    ? HOH 0 9549 . ? 1_555 ? 
839  QC2 4 U   A  1739 ? U   0 1740 . ? 1_555 ? 
840  QC2 4 U   A  1740 ? U   0 1741 . ? 1_555 ? 
841  QC2 4 G   A  2032 ? G   0 2033 . ? 1_555 ? 
842  QC2 4 HOH CJ .    ? HOH 0 9557 . ? 1_555 ? 
843  QC3 4 G   A  680  ? G   0 681  . ? 1_555 ? 
844  QC3 4 A   A  681  ? A   0 682  . ? 1_555 ? 
845  QC3 4 G   A  682  ? G   0 683  . ? 1_555 ? 
846  QC3 4 HOH CJ .    ? HOH 0 7411 . ? 1_555 ? 
847  QC4 4 G   A  891  ? G   0 892  . ? 1_555 ? 
848  QC4 4 C   A  892  ? C   0 893  . ? 1_555 ? 
849  QC4 4 HOH CJ .    ? HOH 0 5152 . ? 1_555 ? 
850  QC4 4 HOH CJ .    ? HOH 0 5793 . ? 1_555 ? 
851  QC5 6 U   A  2662 ? U   0 2663 . ? 1_555 ? 
852  QC5 6 A   A  2810 ? A   0 2811 . ? 1_555 ? 
853  QC5 6 A   A  2811 ? A   0 2812 . ? 1_555 ? 
854  QC5 6 A   A  2815 ? A   0 2816 . ? 1_555 ? 
855  QC5 6 G   A  2816 ? G   0 2817 . ? 1_555 ? 
856  QC5 6 HOH CJ .    ? HOH 0 8742 . ? 1_555 ? 
857  QC6 5 A   A  913  ? A   0 914  . ? 1_555 ? 
858  QC6 5 C   A  914  ? C   0 915  . ? 1_555 ? 
859  QC6 5 C   A  1042 ? C   0 1043 . ? 1_555 ? 
860  QC6 5 C   A  1043 ? C   0 1044 . ? 1_555 ? 
861  QC6 5 G   A  1044 ? G   0 1045 . ? 1_555 ? 
862  QC7 4 U   A  622  ? U   0 623  . ? 1_555 ? 
863  QC7 4 U   A  623  ? U   0 624  . ? 1_555 ? 
864  QC7 4 G   A  900  ? G   0 901  . ? 1_555 ? 
865  QC7 4 HOH CJ .    ? HOH 0 6475 . ? 1_555 ? 
866  QC8 5 A   A  954  ? A   0 955  . ? 1_555 ? 
867  QC8 5 HOH CJ .    ? HOH 0 4781 . ? 1_555 ? 
868  QC8 5 HOH CJ .    ? HOH 0 6128 . ? 1_555 ? 
869  QC8 5 C   B  81   ? C   9 81   . ? 1_555 ? 
870  QC8 5 U   B  82   ? U   9 82   . ? 1_555 ? 
871  QC9 6 A   A  1039 ? A   0 1040 . ? 1_555 ? 
872  QC9 6 G   A  1294 ? G   0 1295 . ? 1_555 ? 
873  QC9 6 A   A  1295 ? A   0 1296 . ? 1_555 ? 
874  QC9 6 HOH CJ .    ? HOH 0 4400 . ? 1_555 ? 
875  QC9 6 GLY N  15   ? GLY L 14   . ? 1_555 ? 
876  QC9 6 HOH PJ .    ? HOH L 8514 . ? 1_555 ? 
877  RC1 6 U   A  767  ? U   0 768  . ? 1_555 ? 
878  RC1 6 C   A  768  ? C   0 769  . ? 1_555 ? 
879  RC1 6 G   A  2110 ? G   0 2111 . ? 1_555 ? 
880  RC1 6 A   A  2111 ? A   0 2112 . ? 1_555 ? 
881  RC1 6 HOH CJ .    ? HOH 0 4344 . ? 1_555 ? 
882  RC1 6 HOH CJ .    ? HOH 0 7105 . ? 1_555 ? 
883  RC2 4 G   A  1118 ? G   0 1119 . ? 1_555 ? 
884  RC2 4 C   A  1242 ? C   0 1243 . ? 1_555 ? 
885  RC2 4 HOH CJ .    ? HOH 0 4336 . ? 1_555 ? 
886  RC2 4 THR L  47   ? THR J 47   . ? 1_555 ? 
887  RC3 5 C   A  919  ? C   0 920  . ? 1_555 ? 
888  RC3 5 U   A  2277 ? U   0 2278 . ? 1_555 ? 
889  RC3 5 G   A  2278 ? G   0 2279 . ? 1_555 ? 
890  RC3 5 A   A  2462 ? A   0 2463 . ? 1_555 ? 
891  RC3 5 HOH CJ .    ? HOH 0 8973 . ? 1_555 ? 
892  RC4 4 G   A  940  ? G   0 941  . ? 1_555 ? 
893  RC4 4 U   A  941  ? U   0 942  . ? 1_555 ? 
894  RC4 4 G   A  1023 ? G   0 1024 . ? 1_555 ? 
895  RC4 4 HOH CJ .    ? HOH 0 5800 . ? 1_555 ? 
896  RC5 6 G   A  2610 ? G   0 2611 . ? 1_555 ? 
897  RC5 6 HOH CJ .    ? HOH 0 6939 . ? 1_555 ? 
898  RC5 6 HOH CJ .    ? HOH 0 7293 . ? 1_555 ? 
899  RC5 6 MG  NA .    ? MG  0 8009 . ? 1_555 ? 
900  RC5 6 HOH CJ .    ? HOH 0 9004 . ? 1_555 ? 
901  RC5 6 TRP D  243  ? TRP B 242  . ? 1_555 ? 
902  RC6 5 G   A  897  ? G   0 898  . ? 1_555 ? 
903  RC6 5 A   A  921  ? A   0 922  . ? 1_555 ? 
904  RC6 5 A   A  922  ? A   0 923  . ? 1_555 ? 
905  RC6 5 G   A  923  ? G   0 924  . ? 1_555 ? 
906  RC6 5 U   A  2108 ? U   0 2109 . ? 1_555 ? 
907  RC7 5 A   A  452  ? A   0 453  . ? 1_555 ? 
908  RC7 5 U   A  453  ? U   0 454  . ? 1_555 ? 
909  RC7 5 C   A  477  ? C   0 478  . ? 1_555 ? 
910  RC7 5 G   A  478  ? G   0 479  . ? 1_555 ? 
911  RC7 5 HOH CJ .    ? HOH 0 5484 . ? 1_555 ? 
912  RC8 5 U   A  836  ? U   0 837  . ? 1_555 ? 
913  RC8 5 HOH CJ .    ? HOH 0 4430 . ? 1_555 ? 
914  RC8 5 HOH CJ .    ? HOH 0 4623 . ? 1_555 ? 
915  RC8 5 HOH CJ .    ? HOH 0 6852 . ? 1_555 ? 
916  RC8 5 GLN D  231  ? GLN B 230  . ? 1_555 ? 
917  RC9 5 A   A  166  ? A   0 167  . ? 1_555 ? 
918  RC9 5 C   A  167  ? C   0 168  . ? 1_555 ? 
919  RC9 5 G   A  2109 ? G   0 2110 . ? 1_555 ? 
920  RC9 5 G   A  2110 ? G   0 2111 . ? 1_555 ? 
921  RC9 5 U   A  2276 ? U   0 2277 . ? 1_555 ? 
922  SC1 3 U   A  1358 ? U   0 1359 . ? 1_555 ? 
923  SC1 3 C   A  1359 ? C   0 1360 . ? 1_555 ? 
924  SC1 3 HOH CJ .    ? HOH 0 9999 . ? 1_555 ? 
925  SC2 5 G   A  635  ? G   0 636  . ? 1_555 ? 
926  SC2 5 U   A  2056 ? U   0 2057 . ? 1_555 ? 
927  SC2 5 G   A  2057 ? G   0 2058 . ? 1_555 ? 
928  SC2 5 HOH CJ .    ? HOH 0 9113 . ? 1_555 ? 
929  SC2 5 HOH CJ .    ? HOH 0 9339 . ? 1_555 ? 
930  SC3 6 U   A  390  ? U   0 391  . ? 1_555 ? 
931  SC3 6 U   A  391  ? U   0 392  . ? 1_555 ? 
932  SC3 6 U   A  397  ? U   0 398  . ? 1_555 ? 
933  SC3 6 C   A  398  ? C   0 399  . ? 1_555 ? 
934  SC3 6 LYS O  193  ? LYS M 193  . ? 1_555 ? 
935  SC3 6 ALA O  194  ? ALA M 194  . ? 1_555 ? 
936  SC4 6 G   A  543  ? G   0 544  . ? 1_555 ? 
937  SC4 6 G   A  544  ? G   0 545  . ? 1_555 ? 
938  SC4 6 G   A  609  ? G   0 610  . ? 1_555 ? 
939  SC4 6 U   A  610  ? U   0 611  . ? 1_555 ? 
940  SC4 6 HOH CJ .    ? HOH 0 3343 . ? 1_555 ? 
941  SC4 6 HOH CJ .    ? HOH 0 9406 . ? 1_555 ? 
942  SC5 6 G   A  463  ? G   0 464  . ? 1_555 ? 
943  SC5 6 G   A  474  ? G   0 475  . ? 1_555 ? 
944  SC5 6 HOH CJ .    ? HOH 0 4127 . ? 1_555 ? 
945  SC5 6 HOH CJ .    ? HOH 0 9350 . ? 1_555 ? 
946  SC5 6 ARG E  55   ? ARG C 55   . ? 1_555 ? 
947  SC5 6 HOH GJ .    ? HOH C 8383 . ? 1_555 ? 
948  SC6 5 G   A  797  ? G   0 798  . ? 1_555 ? 
949  SC6 5 C   A  798  ? C   0 799  . ? 1_555 ? 
950  SC6 5 G   A  813  ? G   0 814  . ? 1_555 ? 
951  SC6 5 U   A  814  ? U   0 815  . ? 1_555 ? 
952  SC6 5 HOH CJ .    ? HOH 0 3405 . ? 1_555 ? 
953  SC7 7 U   A  390  ? U   0 391  . ? 1_555 ? 
954  SC7 7 U   A  391  ? U   0 392  . ? 1_555 ? 
955  SC7 7 A   A  394  ? A   0 395  . ? 1_555 ? 
956  SC7 7 U   A  397  ? U   0 398  . ? 1_555 ? 
957  SC7 7 HOH CJ .    ? HOH 0 6095 . ? 1_555 ? 
958  SC7 7 ARG EA 42   ? ARG 3 42   . ? 1_555 ? 
959  SC7 7 HOH GK .    ? HOH 3 8542 . ? 1_555 ? 
960  SC8 4 G   A  1831 ? G   0 1832 . ? 1_555 ? 
961  SC8 4 A   A  2021 ? A   0 2022 . ? 1_555 ? 
962  SC8 4 HOH CJ .    ? HOH 0 3626 . ? 1_555 ? 
963  SC8 4 HOH CJ .    ? HOH 0 8624 . ? 1_555 ? 
964  SC9 4 G   A  2490 ? G   0 2491 . ? 1_555 ? 
965  SC9 4 U   A  2491 ? U   0 2492 . ? 1_555 ? 
966  SC9 4 G   A  2528 ? G   0 2529 . ? 1_555 ? 
967  SC9 4 HOH CJ .    ? HOH 0 9145 . ? 1_555 ? 
968  TC1 3 U   A  918  ? U   0 919  . ? 1_555 ? 
969  TC1 3 G   A  920  ? G   0 921  . ? 1_555 ? 
970  TC1 3 G   A  923  ? G   0 924  . ? 1_555 ? 
971  TC2 6 G   A  1575 ? G   0 1576 . ? 1_555 ? 
972  TC2 6 U   A  1576 ? U   0 1577 . ? 1_555 ? 
973  TC2 6 G   A  1617 ? G   0 1618 . ? 1_555 ? 
974  TC2 6 G   A  1618 ? G   0 1619 . ? 1_555 ? 
975  TC2 6 HOH CJ .    ? HOH 0 3202 . ? 1_555 ? 
976  TC2 6 HOH CJ .    ? HOH 0 6816 . ? 1_555 ? 
977  TC3 5 C   A  194  ? C   0 195  . ? 1_555 ? 
978  TC3 5 G   A  195  ? G   0 196  . ? 1_555 ? 
979  TC3 5 A   A  414  ? A   0 415  . ? 1_555 ? 
980  TC3 5 G   A  415  ? G   0 416  . ? 1_555 ? 
981  TC3 5 HOH CJ .    ? HOH 0 9418 . ? 1_555 ? 
982  TC4 5 G   A  867  ? G   0 868  . ? 1_555 ? 
983  TC4 5 G   A  868  ? G   0 869  . ? 1_555 ? 
984  TC4 5 A   A  885  ? A   0 886  . ? 1_555 ? 
985  TC4 5 G   A  886  ? G   0 887  . ? 1_555 ? 
986  TC4 5 HOH CJ .    ? HOH 0 8783 . ? 1_555 ? 
987  TC5 8 A   A  631  ? A   0 632  . ? 1_555 ? 
988  TC5 8 C   A  632  ? C   0 633  . ? 1_555 ? 
989  TC5 8 U   A  2534 ? U   0 2535 . ? 1_555 ? 
990  TC5 8 C   A  2535 ? C   0 2536 . ? 1_555 ? 
991  TC5 8 A   A  2537 ? A   0 2538 . ? 1_555 ? 
992  TC5 8 U   A  2538 ? U   0 2539 . ? 1_555 ? 
993  TC5 8 HOH CJ .    ? HOH 0 3168 . ? 1_555 ? 
994  TC5 8 HOH CJ .    ? HOH 0 4382 . ? 1_555 ? 
995  TC6 4 G   A  910  ? G   0 911  . ? 1_555 ? 
996  TC6 4 U   A  1292 ? U   0 1293 . ? 1_555 ? 
997  TC6 4 G   A  1294 ? G   0 1295 . ? 1_555 ? 
998  TC6 4 HOH CJ .    ? HOH 0 5868 . ? 1_555 ? 
999  TC7 7 C   A  761  ? C   0 762  . ? 1_555 ? 
1000 TC7 7 G   A  901  ? G   0 902  . ? 1_555 ? 
1001 TC7 7 U   A  902  ? U   0 903  . ? 1_555 ? 
1002 TC7 7 HOH CJ .    ? HOH 0 9728 . ? 1_555 ? 
1003 TC7 7 HIS N  19   ? HIS L 18   . ? 1_555 ? 
1004 TC7 7 HOH PJ .    ? HOH L 8530 . ? 1_555 ? 
1005 TC7 7 HOH PJ .    ? HOH L 8550 . ? 1_555 ? 
1006 TC8 5 U   A  830  ? U   0 831  . ? 1_555 ? 
1007 TC8 5 U   A  831  ? U   0 832  . ? 1_555 ? 
1008 TC8 5 G   A  832  ? G   0 833  . ? 1_555 ? 
1009 TC8 5 HOH CJ .    ? HOH 0 3236 . ? 1_555 ? 
1010 TC8 5 HOH CJ .    ? HOH 0 3955 . ? 1_555 ? 
1011 TC9 7 G   A  2584 ? G   0 2585 . ? 1_555 ? 
1012 TC9 7 U   A  2585 ? U   0 2586 . ? 1_555 ? 
1013 TC9 7 OMU A  2586 ? OMU 0 2587 . ? 1_555 ? 
1014 TC9 7 G   A  2591 ? G   0 2592 . ? 1_555 ? 
1015 TC9 7 HOH CJ .    ? HOH 0 3213 . ? 1_555 ? 
1016 TC9 7 HOH CJ .    ? HOH 0 6591 . ? 1_555 ? 
1017 TC9 7 HOH CJ .    ? HOH 0 8850 . ? 1_555 ? 
1018 UC1 3 G   A  2771 ? G   0 2772 . ? 1_555 ? 
1019 UC1 3 G   A  2772 ? G   0 2773 . ? 1_555 ? 
1020 UC1 3 HOH CJ .    ? HOH 0 3897 . ? 1_555 ? 
1021 UC2 3 C   A  196  ? C   0 197  . ? 1_555 ? 
1022 UC2 3 HOH CJ .    ? HOH 0 4542 . ? 1_555 ? 
1023 UC2 3 HOH CJ .    ? HOH 0 4777 . ? 1_555 ? 
1024 UC3 3 G   A  1076 ? G   0 1077 . ? 1_555 ? 
1025 UC3 3 A   A  1078 ? A   0 1079 . ? 1_555 ? 
1026 UC3 3 HOH CJ .    ? HOH 0 7194 . ? 1_555 ? 
1027 UC4 2 G   A  1675 ? G   0 1676 . ? 1_555 ? 
1028 UC4 2 LYS DA 3    ? LYS 2 2    . ? 1_555 ? 
1029 UC5 2 G   A  200  ? G   0 201  . ? 1_555 ? 
1030 UC5 2 U   A  201  ? U   0 202  . ? 1_555 ? 
1031 UC6 3 C   A  2387 ? C   0 2388 . ? 1_555 ? 
1032 UC6 3 PHE S  53   ? PHE Q 52   . ? 1_555 ? 
1033 UC6 3 HIS S  54   ? HIS Q 53   . ? 1_555 ? 
1034 UC7 6 G   A  2581 ? G   0 2582 . ? 1_555 ? 
1035 UC7 6 A   A  2595 ? A   0 2596 . ? 1_555 ? 
1036 UC7 6 HOH CJ .    ? HOH 0 4621 . ? 1_555 ? 
1037 UC7 6 LYS M  14   ? LYS K 14   . ? 1_555 ? 
1038 UC7 6 ILE M  32   ? ILE K 32   . ? 1_555 ? 
1039 UC7 6 SER M  33   ? SER K 33   . ? 1_555 ? 
1040 UC8 5 G   A  1298 ? G   0 1299 . ? 1_555 ? 
1041 UC8 5 G   A  1299 ? G   0 1300 . ? 1_555 ? 
1042 UC8 5 A   A  1327 ? A   0 1328 . ? 1_555 ? 
1043 UC8 5 A   A  1328 ? A   0 1329 . ? 1_555 ? 
1044 UC8 5 HOH CJ .    ? HOH 0 4183 . ? 1_555 ? 
1045 UC9 3 G   A  643  ? G   0 644  . ? 1_555 ? 
1046 UC9 3 HIS N  14   ? HIS L 13   . ? 1_555 ? 
1047 UC9 3 HOH PJ .    ? HOH L 8595 . ? 1_555 ? 
1048 VC1 3 A   A  1596 ? A   0 1597 . ? 1_555 ? 
1049 VC1 3 A   A  1597 ? A   0 1598 . ? 1_555 ? 
1050 VC1 3 G   A  1645 ? G   0 1646 . ? 1_555 ? 
1051 VC2 3 G   A  1118 ? G   0 1119 . ? 1_555 ? 
1052 VC2 3 C   A  1242 ? C   0 1243 . ? 1_555 ? 
1053 VC2 3 LYS L  56   ? LYS J 56   . ? 1_555 ? 
1054 VC3 3 C   A  593  ? C   0 594  . ? 1_555 ? 
1055 VC3 3 U   A  594  ? U   0 595  . ? 1_555 ? 
1056 VC3 3 HOH CK .    ? HOH Y 8555 . ? 1_555 ? 
1057 VC4 4 G   A  1071 ? G   0 1072 . ? 1_555 ? 
1058 VC4 4 G   A  1086 ? G   0 1087 . ? 1_555 ? 
1059 VC4 4 A   A  1290 ? A   0 1291 . ? 1_555 ? 
1060 VC4 4 HOH CJ .    ? HOH 0 4856 . ? 1_555 ? 
1061 VC5 4 G   B  21   ? G   9 21   . ? 1_555 ? 
1062 VC5 4 A   B  56   ? A   9 56   . ? 1_555 ? 
1063 VC5 4 A   B  57   ? A   9 57   . ? 1_555 ? 
1064 VC5 4 HOH DJ .    ? HOH 9 8510 . ? 1_555 ? 
1065 VC6 1 C   B  40   ? C   9 40   . ? 1_555 ? 
1066 VC7 6 G   B  21   ? G   9 21   . ? 1_555 ? 
1067 VC7 6 G   B  22   ? G   9 22   . ? 1_555 ? 
1068 VC7 6 U   B  55   ? U   9 55   . ? 1_555 ? 
1069 VC7 6 A   B  57   ? A   9 57   . ? 1_555 ? 
1070 VC7 6 G   B  58   ? G   9 58   . ? 1_555 ? 
1071 VC7 6 HOH DJ .    ? HOH 9 8510 . ? 1_555 ? 
1072 VC8 6 HOH CJ .    ? HOH 0 3492 . ? 1_555 ? 
1073 VC8 6 HOH CJ .    ? HOH 0 9447 . ? 1_555 ? 
1074 VC8 6 HOH EJ .    ? HOH A 8523 . ? 1_555 ? 
1075 VC8 6 HOH EJ .    ? HOH A 8552 . ? 1_555 ? 
1076 VC8 6 HOH EJ .    ? HOH A 8604 . ? 1_555 ? 
1077 VC8 6 HOH EJ .    ? HOH A 8634 . ? 1_555 ? 
1078 VC9 7 A   A  2632 ? A   0 2633 . ? 1_555 ? 
1079 VC9 7 PHE C  202  ? PHE A 201  . ? 1_555 ? 
1080 VC9 7 GLY C  203  ? GLY A 202  . ? 1_555 ? 
1081 VC9 7 GLY C  204  ? GLY A 203  . ? 1_555 ? 
1082 VC9 7 HIS C  209  ? HIS A 208  . ? 1_555 ? 
1083 VC9 7 HOH EJ .    ? HOH A 8558 . ? 1_555 ? 
1084 VC9 7 HOH EJ .    ? HOH A 8603 . ? 1_555 ? 
1085 WC1 1 LYS C  179  ? LYS A 178  . ? 1_555 ? 
1086 WC2 6 HOH CJ .    ? HOH 0 3280 . ? 1_555 ? 
1087 WC2 6 HOH CJ .    ? HOH 0 5942 . ? 1_555 ? 
1088 WC2 6 HOH CJ .    ? HOH 0 7225 . ? 1_555 ? 
1089 WC2 6 HOH FJ .    ? HOH B 8556 . ? 1_555 ? 
1090 WC2 6 HOH FJ .    ? HOH B 8670 . ? 1_555 ? 
1091 WC2 6 HOH FJ .    ? HOH B 8671 . ? 1_555 ? 
1092 WC3 5 HOH CJ .    ? HOH 0 9101 . ? 1_555 ? 
1093 WC3 5 HOH CJ .    ? HOH 0 9166 . ? 1_555 ? 
1094 WC3 5 ARG D  224  ? ARG B 223  . ? 1_555 ? 
1095 WC3 5 LYS D  225  ? LYS B 224  . ? 1_555 ? 
1096 WC3 5 HIS D  228  ? HIS B 227  . ? 1_555 ? 
1097 WC4 5 ASP E  45   ? ASP C 45   . ? 1_555 ? 
1098 WC4 5 THR E  94   ? THR C 94   . ? 1_555 ? 
1099 WC4 5 GLU E  95   ? GLU C 95   . ? 1_555 ? 
1100 WC4 5 LYS E  96   ? LYS C 96   . ? 1_555 ? 
1101 WC4 5 HOH GJ .    ? HOH C 8310 . ? 1_555 ? 
1102 WC5 6 A   A  1132 ? A   0 1133 . ? 1_555 ? 
1103 WC5 6 G   A  1133 ? G   0 1134 . ? 1_555 ? 
1104 WC5 6 TYR J  154  ? TYR H 154  . ? 1_555 ? 
1105 WC5 6 ILE J  157  ? ILE H 157  . ? 1_555 ? 
1106 WC5 6 THR J  158  ? THR H 158  . ? 1_555 ? 
1107 WC5 6 PRO J  159  ? PRO H 159  . ? 1_555 ? 
1108 WC6 3 C   A  2286 ? C   0 2287 . ? 1_555 ? 
1109 WC6 3 ASP J  111  ? ASP H 111  . ? 1_555 ? 
1110 WC6 3 ARG J  114  ? ARG H 114  . ? 1_555 ? 
1111 WC7 6 HOH CJ .    ? HOH 0 5282 . ? 1_555 ? 
1112 WC7 6 HOH CJ .    ? HOH 0 9003 . ? 1_555 ? 
1113 WC7 6 ARG L  60   ? ARG J 60   . ? 1_555 ? 
1114 WC7 6 VAL L  61   ? VAL J 61   . ? 1_555 ? 
1115 WC7 6 ILE L  63   ? ILE J 63   . ? 1_555 ? 
1116 WC7 6 TYR L  69   ? TYR J 69   . ? 1_555 ? 
1117 WC8 4 ILE L  127  ? ILE J 127  . ? 1_555 ? 
1118 WC8 4 LYS L  128  ? LYS J 128  . ? 1_555 ? 
1119 WC8 4 HOH NJ .    ? HOH J 4038 . ? 1_555 ? 
1120 WC8 4 HOH NJ .    ? HOH J 4193 . ? 1_555 ? 
1121 WC9 3 PRO L  88   ? PRO J 88   . ? 1_555 ? 
1122 WC9 3 HIS L  89   ? HIS J 89   . ? 1_555 ? 
1123 WC9 3 LYS L  90   ? LYS J 90   . ? 1_555 ? 
1124 XC1 5 HOH CJ .    ? HOH 0 5282 . ? 1_555 ? 
1125 XC1 5 GLY L  64   ? GLY J 64   . ? 1_555 ? 
1126 XC1 5 ASN L  65   ? ASN J 65   . ? 1_555 ? 
1127 XC1 5 GLY L  68   ? GLY J 68   . ? 1_555 ? 
1128 XC1 5 TYR L  69   ? TYR J 69   . ? 1_555 ? 
1129 XC2 6 HOH CJ .    ? HOH 0 3764 . ? 1_555 ? 
1130 XC2 6 HOH CJ .    ? HOH 0 5571 . ? 1_555 ? 
1131 XC2 6 HOH CJ .    ? HOH 0 9943 . ? 1_555 ? 
1132 XC2 6 ASN M  42   ? ASN K 42   . ? 1_555 ? 
1133 XC2 6 HOH OJ .    ? HOH K 2121 . ? 1_555 ? 
1134 XC2 6 HOH OJ .    ? HOH K 7871 . ? 1_555 ? 
1135 XC3 7 ARG N  28   ? ARG L 27   . ? 1_555 ? 
1136 XC3 7 GLY N  29   ? GLY L 28   . ? 1_555 ? 
1137 XC3 7 GLY N  30   ? GLY L 29   . ? 1_555 ? 
1138 XC3 7 GLY N  32   ? GLY L 31   . ? 1_555 ? 
1139 XC3 7 ALA N  34   ? ALA L 33   . ? 1_555 ? 
1140 XC3 7 GLU N  40   ? GLU L 39   . ? 1_555 ? 
1141 XC3 7 HOH PJ .    ? HOH L 8593 . ? 1_555 ? 
1142 XC4 1 ARG N  54   ? ARG L 53   . ? 1_555 ? 
1143 XC5 5 SER O  106  ? SER M 106  . ? 1_555 ? 
1144 XC5 5 PHE O  109  ? PHE M 109  . ? 1_555 ? 
1145 XC5 5 PRO O  110  ? PRO M 110  . ? 1_555 ? 
1146 XC5 5 LEU O  112  ? LEU M 112  . ? 1_555 ? 
1147 XC5 5 HOH QJ .    ? HOH M 8623 . ? 1_555 ? 
1148 XC6 4 SER O  106  ? SER M 106  . ? 1_555 ? 
1149 XC6 4 ARG O  113  ? ARG M 113  . ? 1_555 ? 
1150 XC6 4 VAL O  114  ? VAL M 114  . ? 1_555 ? 
1151 XC6 4 VAL O  159  ? VAL M 159  . ? 1_555 ? 
1152 XC7 4 LYS F  147  ? LYS D 146  . ? 1_555 ? 
1153 XC7 4 ARG P  38   ? ARG N 37   . ? 1_555 ? 
1154 XC7 4 LYS P  39   ? LYS N 38   . ? 1_555 ? 
1155 XC7 4 ASN P  108  ? ASN N 107  . ? 1_555 ? 
1156 XC8 3 HOH CJ .    ? HOH 0 5541 . ? 1_555 ? 
1157 XC8 3 HIS Q  41   ? HIS O 40   . ? 1_555 ? 
1158 XC8 3 HOH SJ .    ? HOH O 5650 . ? 1_555 ? 
1159 XC9 2 ASN Q  45   ? ASN O 44   . ? 1_555 ? 
1160 XC9 2 ARG Q  48   ? ARG O 47   . ? 1_555 ? 
1161 YC1 6 ASP S  21   ? ASP Q 20   . ? 1_555 ? 
1162 YC1 6 GLY S  23   ? GLY Q 22   . ? 1_555 ? 
1163 YC1 6 SER S  25   ? SER Q 24   . ? 1_555 ? 
1164 YC1 6 SER S  47   ? SER Q 46   . ? 1_555 ? 
1165 YC1 6 HOH UJ .    ? HOH Q 1795 . ? 1_555 ? 
1166 YC1 6 HOH UJ .    ? HOH Q 5427 . ? 1_555 ? 
1167 YC2 5 HOH CJ .    ? HOH 0 5445 . ? 1_555 ? 
1168 YC2 5 SER T  71   ? SER R 70   . ? 1_555 ? 
1169 YC2 5 VAL T  73   ? VAL R 72   . ? 1_555 ? 
1170 YC2 5 HOH VJ .    ? HOH R 8524 . ? 1_555 ? 
1171 YC2 5 HOH VJ .    ? HOH R 8526 . ? 1_555 ? 
1172 YC3 4 U   A  11   ? U   0 12   . ? 1_555 ? 
1173 YC3 4 LYS T  61   ? LYS R 60   . ? 1_555 ? 
1174 YC3 4 GLN T  62   ? GLN R 61   . ? 1_555 ? 
1175 YC3 4 ASN T  64   ? ASN R 63   . ? 1_555 ? 
1176 YC4 2 LYS T  119  ? LYS R 118  . ? 1_555 ? 
1177 YC4 2 HOH VJ .    ? HOH R 8509 . ? 1_555 ? 
1178 YC5 3 HIS U  8    ? HIS S 7    . ? 1_555 ? 
1179 YC5 3 GLU U  62   ? GLU S 61   . ? 1_555 ? 
1180 YC5 3 HOH WJ .    ? HOH S 8324 . ? 1_555 ? 
1181 YC6 6 GLN V  38   ? GLN T 37   . ? 1_555 ? 
1182 YC6 6 ARG V  112  ? ARG T 111  . ? 1_555 ? 
1183 YC6 6 LEU V  113  ? LEU T 112  . ? 1_555 ? 
1184 YC6 6 SER V  115  ? SER T 114  . ? 1_555 ? 
1185 YC6 6 ASP V  118  ? ASP T 117  . ? 1_555 ? 
1186 YC6 6 HOH XJ .    ? HOH T 2868 . ? 1_555 ? 
1187 YC7 7 U   A  307  ? U   0 308  . ? 1_555 ? 
1188 YC7 7 U   A  334  ? U   0 335  . ? 1_555 ? 
1189 YC7 7 A   A  338  ? A   0 339  . ? 1_555 ? 
1190 YC7 7 C   A  341  ? C   0 342  . ? 1_555 ? 
1191 YC7 7 SER V  95   ? SER T 94   . ? 1_555 ? 
1192 YC7 7 ASN V  96   ? ASN T 95   . ? 1_555 ? 
1193 YC7 7 HOH XJ .    ? HOH T 1124 . ? 1_555 ? 
1194 YC8 4 CYS W  6    ? CYS U 6    . ? 1_555 ? 
1195 YC8 4 CYS W  9    ? CYS U 9    . ? 1_555 ? 
1196 YC8 4 CYS W  32   ? CYS U 32   . ? 1_555 ? 
1197 YC8 4 CYS W  36   ? CYS U 36   . ? 1_555 ? 
1198 YC9 7 HIS AA 134  ? HIS Y 133  . ? 1_555 ? 
1199 YC9 7 LYS AA 137  ? LYS Y 136  . ? 1_555 ? 
1200 YC9 7 LYS AA 138  ? LYS Y 137  . ? 1_555 ? 
1201 YC9 7 VAL AA 140  ? VAL Y 139  . ? 1_555 ? 
1202 YC9 7 HOH CK .    ? HOH Y 8560 . ? 1_555 ? 
1203 YC9 7 HOH CK .    ? HOH Y 8582 . ? 1_555 ? 
1204 YC9 7 HOH CK .    ? HOH Y 8616 . ? 1_555 ? 
1205 ZC1 1 ARG AA 170  ? ARG Y 169  . ? 1_555 ? 
1206 ZC2 4 CYS BA 30   ? CYS Z 39   . ? 1_555 ? 
1207 ZC2 4 CYS BA 33   ? CYS Z 42   . ? 1_555 ? 
1208 ZC2 4 CYS BA 48   ? CYS Z 57   . ? 1_555 ? 
1209 ZC2 4 CYS BA 51   ? CYS Z 60   . ? 1_555 ? 
1210 ZC3 4 CYS CA 20   ? CYS 1 19   . ? 1_555 ? 
1211 ZC3 4 CYS CA 23   ? CYS 1 22   . ? 1_555 ? 
1212 ZC3 4 CYS CA 35   ? CYS 1 34   . ? 1_555 ? 
1213 ZC3 4 CYS CA 38   ? CYS 1 37   . ? 1_555 ? 
1214 ZC4 6 HOH CJ .    ? HOH 0 3480 . ? 1_555 ? 
1215 ZC4 6 GLY EA 45   ? GLY 3 45   . ? 1_555 ? 
1216 ZC4 6 GLY EA 47   ? GLY 3 47   . ? 1_555 ? 
1217 ZC4 6 ASP EA 49   ? ASP 3 49   . ? 1_555 ? 
1218 ZC4 6 HOH GK .    ? HOH 3 8574 . ? 1_555 ? 
1219 ZC4 6 HOH GK .    ? HOH 3 8575 . ? 1_555 ? 
1220 ZC5 4 CYS EA 11   ? CYS 3 11   . ? 1_555 ? 
1221 ZC5 4 CYS EA 14   ? CYS 3 14   . ? 1_555 ? 
1222 ZC5 4 CYS EA 71   ? CYS 3 71   . ? 1_555 ? 
1223 ZC5 4 CYS EA 74   ? CYS 3 74   . ? 1_555 ? 
1224 ZC6 1 ASP EA 66   ? ASP 3 66   . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1S72 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1S72 
_atom_sites.fract_transf_matrix[1][1]   0.004725 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.003337 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.001743 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CD 
CL 
K  
MG 
N  
NA 
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     O  "O5'" . U   A  1  9    ? 16.030  148.355 104.290 1.00 83.79  ? 10   U   0 "O5'" 1 
ATOM   2     C  "C5'" . U   A  1  9    ? 16.942  149.450 104.201 1.00 82.36  ? 10   U   0 "C5'" 1 
ATOM   3     C  "C4'" . U   A  1  9    ? 18.405  149.086 104.371 1.00 81.58  ? 10   U   0 "C4'" 1 
ATOM   4     O  "O4'" . U   A  1  9    ? 18.630  148.501 105.679 1.00 83.55  ? 10   U   0 "O4'" 1 
ATOM   5     C  "C3'" . U   A  1  9    ? 18.978  148.021 103.445 1.00 78.95  ? 10   U   0 "C3'" 1 
ATOM   6     O  "O3'" . U   A  1  9    ? 19.159  148.571 102.125 1.00 73.01  ? 10   U   0 "O3'" 1 
ATOM   7     C  "C2'" . U   A  1  9    ? 20.264  147.625 104.181 1.00 80.36  ? 10   U   0 "C2'" 1 
ATOM   8     O  "O2'" . U   A  1  9    ? 21.328  148.530 104.003 1.00 81.20  ? 10   U   0 "O2'" 1 
ATOM   9     C  "C1'" . U   A  1  9    ? 19.841  147.761 105.646 1.00 82.31  ? 10   U   0 "C1'" 1 
ATOM   10    N  N1    . U   A  1  9    ? 19.695  146.523 106.436 1.00 83.22  ? 10   U   0 N1    1 
ATOM   11    C  C2    . U   A  1  9    ? 19.464  146.661 107.803 1.00 84.07  ? 10   U   0 C2    1 
ATOM   12    O  O2    . U   A  1  9    ? 19.346  147.745 108.358 1.00 86.65  ? 10   U   0 O2    1 
ATOM   13    N  N3    . U   A  1  9    ? 19.375  145.483 108.498 1.00 83.09  ? 10   U   0 N3    1 
ATOM   14    C  C4    . U   A  1  9    ? 19.480  144.210 107.992 1.00 83.21  ? 10   U   0 C4    1 
ATOM   15    O  O4    . U   A  1  9    ? 19.390  143.254 108.762 1.00 83.59  ? 10   U   0 O4    1 
ATOM   16    C  C5    . U   A  1  9    ? 19.702  144.141 106.575 1.00 82.53  ? 10   U   0 C5    1 
ATOM   17    C  C6    . U   A  1  9    ? 19.798  145.269 105.863 1.00 82.61  ? 10   U   0 C6    1 
ATOM   18    P  P     . A   A  1  10   ? 20.413  148.134 101.205 1.00 65.72  ? 11   A   0 P     1 
ATOM   19    O  OP1   . A   A  1  10   ? 20.046  148.458 99.805  1.00 67.61  ? 11   A   0 OP1   1 
ATOM   20    O  OP2   . A   A  1  10   ? 20.863  146.760 101.535 1.00 65.62  ? 11   A   0 OP2   1 
ATOM   21    O  "O5'" . A   A  1  10   ? 21.538  149.169 101.650 1.00 61.14  ? 11   A   0 "O5'" 1 
ATOM   22    C  "C5'" . A   A  1  10   ? 22.872  149.049 101.168 1.00 53.49  ? 11   A   0 "C5'" 1 
ATOM   23    C  "C4'" . A   A  1  10   ? 23.822  149.841 102.032 1.00 48.08  ? 11   A   0 "C4'" 1 
ATOM   24    O  "O4'" . A   A  1  10   ? 23.656  149.501 103.432 1.00 44.82  ? 11   A   0 "O4'" 1 
ATOM   25    C  "C3'" . A   A  1  10   ? 25.261  149.504 101.712 1.00 46.07  ? 11   A   0 "C3'" 1 
ATOM   26    O  "O3'" . A   A  1  10   ? 25.713  150.275 100.620 1.00 44.07  ? 11   A   0 "O3'" 1 
ATOM   27    C  "C2'" . A   A  1  10   ? 25.979  149.737 103.029 1.00 44.54  ? 11   A   0 "C2'" 1 
ATOM   28    O  "O2'" . A   A  1  10   ? 26.289  151.092 103.272 1.00 44.73  ? 11   A   0 "O2'" 1 
ATOM   29    C  "C1'" . A   A  1  10   ? 24.920  149.247 104.019 1.00 43.80  ? 11   A   0 "C1'" 1 
ATOM   30    N  N9    . A   A  1  10   ? 24.995  147.811 104.306 1.00 42.37  ? 11   A   0 N9    1 
ATOM   31    C  C8    . A   A  1  10   ? 23.976  146.891 104.240 1.00 40.67  ? 11   A   0 C8    1 
ATOM   32    N  N7    . A   A  1  10   ? 24.333  145.678 104.577 1.00 40.05  ? 11   A   0 N7    1 
ATOM   33    C  C5    . A   A  1  10   ? 25.679  145.799 104.876 1.00 39.09  ? 11   A   0 C5    1 
ATOM   34    C  C6    . A   A  1  10   ? 26.638  144.865 105.299 1.00 39.19  ? 11   A   0 C6    1 
ATOM   35    N  N6    . A   A  1  10   ? 26.379  143.569 105.489 1.00 37.08  ? 11   A   0 N6    1 
ATOM   36    N  N1    . A   A  1  10   ? 27.892  145.314 105.520 1.00 39.46  ? 11   A   0 N1    1 
ATOM   37    C  C2    . A   A  1  10   ? 28.155  146.616 105.318 1.00 40.23  ? 11   A   0 C2    1 
ATOM   38    N  N3    . A   A  1  10   ? 27.340  147.588 104.913 1.00 38.17  ? 11   A   0 N3    1 
ATOM   39    C  C4    . A   A  1  10   ? 26.103  147.108 104.711 1.00 40.24  ? 11   A   0 C4    1 
ATOM   40    P  P     . U   A  1  11   ? 26.018  149.543 99.231  1.00 47.64  ? 12   U   0 P     1 
ATOM   41    O  OP1   . U   A  1  11   ? 26.451  150.604 98.281  1.00 47.81  ? 12   U   0 OP1   1 
ATOM   42    O  OP2   . U   A  1  11   ? 24.872  148.661 98.883  1.00 46.23  ? 12   U   0 OP2   1 
ATOM   43    O  "O5'" . U   A  1  11   ? 27.261  148.601 99.560  1.00 46.01  ? 12   U   0 "O5'" 1 
ATOM   44    C  "C5'" . U   A  1  11   ? 28.560  149.166 99.798  1.00 46.10  ? 12   U   0 "C5'" 1 
ATOM   45    C  "C4'" . U   A  1  11   ? 29.495  148.124 100.357 1.00 45.79  ? 12   U   0 "C4'" 1 
ATOM   46    O  "O4'" . U   A  1  11   ? 29.010  147.683 101.655 1.00 44.97  ? 12   U   0 "O4'" 1 
ATOM   47    C  "C3'" . U   A  1  11   ? 29.619  146.822 99.579  1.00 45.11  ? 12   U   0 "C3'" 1 
ATOM   48    O  "O3'" . U   A  1  11   ? 30.454  146.919 98.434  1.00 44.86  ? 12   U   0 "O3'" 1 
ATOM   49    C  "C2'" . U   A  1  11   ? 30.207  145.911 100.643 1.00 45.05  ? 12   U   0 "C2'" 1 
ATOM   50    O  "O2'" . U   A  1  11   ? 31.575  146.193 100.914 1.00 46.58  ? 12   U   0 "O2'" 1 
ATOM   51    C  "C1'" . U   A  1  11   ? 29.366  146.320 101.853 1.00 43.73  ? 12   U   0 "C1'" 1 
ATOM   52    N  N1    . U   A  1  11   ? 28.138  145.511 101.923 1.00 42.59  ? 12   U   0 N1    1 
ATOM   53    C  C2    . U   A  1  11   ? 28.261  144.200 102.363 1.00 42.52  ? 12   U   0 C2    1 
ATOM   54    O  O2    . U   A  1  11   ? 29.329  143.714 102.711 1.00 42.45  ? 12   U   0 O2    1 
ATOM   55    N  N3    . U   A  1  11   ? 27.091  143.478 102.372 1.00 40.01  ? 12   U   0 N3    1 
ATOM   56    C  C4    . U   A  1  11   ? 25.845  143.917 101.989 1.00 39.19  ? 12   U   0 C4    1 
ATOM   57    O  O4    . U   A  1  11   ? 24.905  143.124 101.972 1.00 39.11  ? 12   U   0 O4    1 
ATOM   58    C  C5    . U   A  1  11   ? 25.797  145.280 101.564 1.00 39.18  ? 12   U   0 C5    1 
ATOM   59    C  C6    . U   A  1  11   ? 26.912  146.013 101.549 1.00 40.43  ? 12   U   0 C6    1 
ATOM   60    P  P     . G   A  1  12   ? 29.906  146.425 97.004  1.00 44.63  ? 13   G   0 P     1 
ATOM   61    O  OP1   . G   A  1  12   ? 31.117  146.240 96.171  1.00 46.33  ? 13   G   0 OP1   1 
ATOM   62    O  OP2   . G   A  1  12   ? 28.833  147.347 96.553  1.00 45.64  ? 13   G   0 OP2   1 
ATOM   63    O  "O5'" . G   A  1  12   ? 29.244  144.996 97.263  1.00 44.87  ? 13   G   0 "O5'" 1 
ATOM   64    C  "C5'" . G   A  1  12   ? 30.041  143.915 97.750  1.00 42.47  ? 13   G   0 "C5'" 1 
ATOM   65    C  "C4'" . G   A  1  12   ? 29.191  142.727 98.146  1.00 41.76  ? 13   G   0 "C4'" 1 
ATOM   66    O  "O4'" . G   A  1  12   ? 28.086  143.129 98.994  1.00 41.11  ? 13   G   0 "O4'" 1 
ATOM   67    C  "C3'" . G   A  1  12   ? 28.448  141.936 97.084  1.00 41.16  ? 13   G   0 "C3'" 1 
ATOM   68    O  "O3'" . G   A  1  12   ? 29.320  141.119 96.303  1.00 42.30  ? 13   G   0 "O3'" 1 
ATOM   69    C  "C2'" . G   A  1  12   ? 27.576  141.058 97.976  1.00 40.67  ? 13   G   0 "C2'" 1 
ATOM   70    O  "O2'" . G   A  1  12   ? 28.321  140.031 98.604  1.00 39.33  ? 13   G   0 "O2'" 1 
ATOM   71    C  "C1'" . G   A  1  12   ? 27.167  142.051 99.065  1.00 39.64  ? 13   G   0 "C1'" 1 
ATOM   72    N  N9    . G   A  1  12   ? 25.804  142.541 98.876  1.00 40.37  ? 13   G   0 N9    1 
ATOM   73    C  C8    . G   A  1  12   ? 25.389  143.804 98.518  1.00 40.11  ? 13   G   0 C8    1 
ATOM   74    N  N7    . G   A  1  12   ? 24.087  143.911 98.434  1.00 39.79  ? 13   G   0 N7    1 
ATOM   75    C  C5    . G   A  1  12   ? 23.616  142.643 98.756  1.00 38.34  ? 13   G   0 C5    1 
ATOM   76    C  C6    . G   A  1  12   ? 22.291  142.145 98.841  1.00 38.31  ? 13   G   0 C6    1 
ATOM   77    O  O6    . G   A  1  12   ? 21.226  142.742 98.645  1.00 39.21  ? 13   G   0 O6    1 
ATOM   78    N  N1    . G   A  1  12   ? 22.272  140.804 99.198  1.00 38.84  ? 13   G   0 N1    1 
ATOM   79    C  C2    . G   A  1  12   ? 23.381  140.034 99.444  1.00 39.14  ? 13   G   0 C2    1 
ATOM   80    N  N2    . G   A  1  12   ? 23.156  138.756 99.774  1.00 38.75  ? 13   G   0 N2    1 
ATOM   81    N  N3    . G   A  1  12   ? 24.617  140.482 99.370  1.00 38.80  ? 13   G   0 N3    1 
ATOM   82    C  C4    . G   A  1  12   ? 24.661  141.787 99.027  1.00 39.45  ? 13   G   0 C4    1 
ATOM   83    P  P     . C   A  1  13   ? 28.794  140.473 94.926  1.00 41.30  ? 14   C   0 P     1 
ATOM   84    O  OP1   . C   A  1  13   ? 29.985  139.988 94.182  1.00 42.70  ? 14   C   0 OP1   1 
ATOM   85    O  OP2   . C   A  1  13   ? 27.865  141.432 94.268  1.00 41.85  ? 14   C   0 OP2   1 
ATOM   86    O  "O5'" . C   A  1  13   ? 27.952  139.206 95.394  1.00 39.72  ? 14   C   0 "O5'" 1 
ATOM   87    C  "C5'" . C   A  1  13   ? 28.601  138.031 95.915  1.00 39.07  ? 14   C   0 "C5'" 1 
ATOM   88    C  "C4'" . C   A  1  13   ? 27.592  136.924 96.113  1.00 39.68  ? 14   C   0 "C4'" 1 
ATOM   89    O  "O4'" . C   A  1  13   ? 26.605  137.350 97.090  1.00 41.24  ? 14   C   0 "O4'" 1 
ATOM   90    C  "C3'" . C   A  1  13   ? 26.766  136.567 94.886  1.00 41.06  ? 14   C   0 "C3'" 1 
ATOM   91    O  "O3'" . C   A  1  13   ? 27.464  135.669 94.031  1.00 41.61  ? 14   C   0 "O3'" 1 
ATOM   92    C  "C2'" . C   A  1  13   ? 25.519  135.955 95.508  1.00 41.46  ? 14   C   0 "C2'" 1 
ATOM   93    O  "O2'" . C   A  1  13   ? 25.725  134.638 95.976  1.00 44.44  ? 14   C   0 "O2'" 1 
ATOM   94    C  "C1'" . C   A  1  13   ? 25.320  136.868 96.718  1.00 40.44  ? 14   C   0 "C1'" 1 
ATOM   95    N  N1    . C   A  1  13   ? 24.450  138.026 96.429  1.00 39.75  ? 14   C   0 N1    1 
ATOM   96    C  C2    . C   A  1  13   ? 23.063  137.830 96.334  1.00 39.36  ? 14   C   0 C2    1 
ATOM   97    O  O2    . C   A  1  13   ? 22.604  136.687 96.479  1.00 40.47  ? 14   C   0 O2    1 
ATOM   98    N  N3    . C   A  1  13   ? 22.263  138.891 96.076  1.00 37.17  ? 14   C   0 N3    1 
ATOM   99    C  C4    . C   A  1  13   ? 22.795  140.102 95.907  1.00 36.42  ? 14   C   0 C4    1 
ATOM   100   N  N4    . C   A  1  13   ? 21.971  141.124 95.658  1.00 34.90  ? 14   C   0 N4    1 
ATOM   101   C  C5    . C   A  1  13   ? 24.198  140.326 95.987  1.00 37.05  ? 14   C   0 C5    1 
ATOM   102   C  C6    . C   A  1  13   ? 24.979  139.273 96.250  1.00 37.50  ? 14   C   0 C6    1 
ATOM   103   P  P     . C   A  1  14   ? 27.312  135.803 92.435  1.00 41.87  ? 15   C   0 P     1 
ATOM   104   O  OP1   . C   A  1  14   ? 28.369  134.948 91.840  1.00 40.69  ? 15   C   0 OP1   1 
ATOM   105   O  OP2   . C   A  1  14   ? 27.224  137.229 92.058  1.00 39.58  ? 15   C   0 OP2   1 
ATOM   106   O  "O5'" . C   A  1  14   ? 25.894  135.148 92.141  1.00 44.13  ? 15   C   0 "O5'" 1 
ATOM   107   C  "C5'" . C   A  1  14   ? 25.632  133.779 92.486  1.00 45.58  ? 15   C   0 "C5'" 1 
ATOM   108   C  "C4'" . C   A  1  14   ? 24.184  133.459 92.247  1.00 46.33  ? 15   C   0 "C4'" 1 
ATOM   109   O  "O4'" . C   A  1  14   ? 23.370  134.176 93.209  1.00 46.96  ? 15   C   0 "O4'" 1 
ATOM   110   C  "C3'" . C   A  1  14   ? 23.630  133.916 90.908  1.00 47.82  ? 15   C   0 "C3'" 1 
ATOM   111   O  "O3'" . C   A  1  14   ? 23.957  133.038 89.845  1.00 48.85  ? 15   C   0 "O3'" 1 
ATOM   112   C  "C2'" . C   A  1  14   ? 22.139  133.962 91.189  1.00 47.42  ? 15   C   0 "C2'" 1 
ATOM   113   O  "O2'" . C   A  1  14   ? 21.568  132.673 91.218  1.00 49.17  ? 15   C   0 "O2'" 1 
ATOM   114   C  "C1'" . C   A  1  14   ? 22.130  134.529 92.608  1.00 46.92  ? 15   C   0 "C1'" 1 
ATOM   115   N  N1    . C   A  1  14   ? 21.977  135.997 92.628  1.00 45.56  ? 15   C   0 N1    1 
ATOM   116   C  C2    . C   A  1  14   ? 20.686  136.530 92.550  1.00 44.75  ? 15   C   0 C2    1 
ATOM   117   O  O2    . C   A  1  14   ? 19.723  135.756 92.466  1.00 46.03  ? 15   C   0 O2    1 
ATOM   118   N  N3    . C   A  1  14   ? 20.521  137.872 92.565  1.00 43.19  ? 15   C   0 N3    1 
ATOM   119   C  C4    . C   A  1  14   ? 21.583  138.675 92.650  1.00 42.92  ? 15   C   0 C4    1 
ATOM   120   N  N4    . C   A  1  14   ? 21.368  139.991 92.657  1.00 42.34  ? 15   C   0 N4    1 
ATOM   121   C  C5    . C   A  1  14   ? 22.910  138.162 92.731  1.00 42.91  ? 15   C   0 C5    1 
ATOM   122   C  C6    . C   A  1  14   ? 23.061  136.829 92.716  1.00 44.79  ? 15   C   0 C6    1 
ATOM   123   P  P     . A   A  1  15   ? 24.050  133.611 88.346  1.00 51.37  ? 16   A   0 P     1 
ATOM   124   O  OP1   . A   A  1  15   ? 24.568  132.504 87.503  1.00 51.51  ? 16   A   0 OP1   1 
ATOM   125   O  OP2   . A   A  1  15   ? 24.763  134.921 88.359  1.00 50.31  ? 16   A   0 OP2   1 
ATOM   126   O  "O5'" . A   A  1  15   ? 22.534  133.896 87.945  1.00 51.30  ? 16   A   0 "O5'" 1 
ATOM   127   C  "C5'" . A   A  1  15   ? 21.631  132.816 87.648  1.00 49.63  ? 16   A   0 "C5'" 1 
ATOM   128   C  "C4'" . A   A  1  15   ? 20.242  133.353 87.400  1.00 49.02  ? 16   A   0 "C4'" 1 
ATOM   129   O  "O4'" . A   A  1  15   ? 19.799  134.075 88.584  1.00 46.14  ? 16   A   0 "O4'" 1 
ATOM   130   C  "C3'" . A   A  1  15   ? 20.108  134.382 86.285  1.00 48.46  ? 16   A   0 "C3'" 1 
ATOM   131   O  "O3'" . A   A  1  15   ? 20.018  133.798 84.986  1.00 50.16  ? 16   A   0 "O3'" 1 
ATOM   132   C  "C2'" . A   A  1  15   ? 18.823  135.099 86.671  1.00 46.88  ? 16   A   0 "C2'" 1 
ATOM   133   O  "O2'" . A   A  1  15   ? 17.664  134.389 86.303  1.00 47.61  ? 16   A   0 "O2'" 1 
ATOM   134   C  "C1'" . A   A  1  15   ? 18.951  135.144 88.195  1.00 45.20  ? 16   A   0 "C1'" 1 
ATOM   135   N  N9    . A   A  1  15   ? 19.554  136.403 88.623  1.00 43.13  ? 16   A   0 N9    1 
ATOM   136   C  C8    . A   A  1  15   ? 20.875  136.681 88.879  1.00 43.85  ? 16   A   0 C8    1 
ATOM   137   N  N7    . A   A  1  15   ? 21.099  137.935 89.195  1.00 42.32  ? 16   A   0 N7    1 
ATOM   138   C  C5    . A   A  1  15   ? 19.841  138.518 89.157  1.00 39.33  ? 16   A   0 C5    1 
ATOM   139   C  C6    . A   A  1  15   ? 19.398  139.827 89.393  1.00 37.85  ? 16   A   0 C6    1 
ATOM   140   N  N6    . A   A  1  15   ? 20.208  140.845 89.699  1.00 34.85  ? 16   A   0 N6    1 
ATOM   141   N  N1    . A   A  1  15   ? 18.073  140.066 89.294  1.00 37.37  ? 16   A   0 N1    1 
ATOM   142   C  C2    . A   A  1  15   ? 17.263  139.060 88.955  1.00 35.60  ? 16   A   0 C2    1 
ATOM   143   N  N3    . A   A  1  15   ? 17.559  137.796 88.691  1.00 37.84  ? 16   A   0 N3    1 
ATOM   144   C  C4    . A   A  1  15   ? 18.879  137.584 88.817  1.00 40.79  ? 16   A   0 C4    1 
ATOM   145   P  P     . G   A  1  16   ? 20.423  134.666 83.688  1.00 51.66  ? 17   G   0 P     1 
ATOM   146   O  OP1   . G   A  1  16   ? 20.298  133.748 82.525  1.00 52.25  ? 17   G   0 OP1   1 
ATOM   147   O  OP2   . G   A  1  16   ? 21.723  135.328 83.955  1.00 52.52  ? 17   G   0 OP2   1 
ATOM   148   O  "O5'" . G   A  1  16   ? 19.307  135.811 83.583  1.00 48.10  ? 17   G   0 "O5'" 1 
ATOM   149   C  "C5'" . G   A  1  16   ? 17.955  135.485 83.207  1.00 47.52  ? 17   G   0 "C5'" 1 
ATOM   150   C  "C4'" . G   A  1  16   ? 17.014  136.647 83.460  1.00 46.22  ? 17   G   0 "C4'" 1 
ATOM   151   O  "O4'" . G   A  1  16   ? 17.251  137.196 84.783  1.00 46.36  ? 17   G   0 "O4'" 1 
ATOM   152   C  "C3'" . G   A  1  16   ? 17.113  137.887 82.583  1.00 44.91  ? 17   G   0 "C3'" 1 
ATOM   153   O  "O3'" . G   A  1  16   ? 16.493  137.691 81.313  1.00 43.90  ? 17   G   0 "O3'" 1 
ATOM   154   C  "C2'" . G   A  1  16   ? 16.307  138.885 83.407  1.00 45.48  ? 17   G   0 "C2'" 1 
ATOM   155   O  "O2'" . G   A  1  16   ? 14.916  138.655 83.294  1.00 46.67  ? 17   G   0 "O2'" 1 
ATOM   156   C  "C1'" . G   A  1  16   ? 16.735  138.521 84.833  1.00 44.43  ? 17   G   0 "C1'" 1 
ATOM   157   N  N9    . G   A  1  16   ? 17.742  139.421 85.399  1.00 41.76  ? 17   G   0 N9    1 
ATOM   158   C  C8    . G   A  1  16   ? 19.064  139.148 85.659  1.00 41.06  ? 17   G   0 C8    1 
ATOM   159   N  N7    . G   A  1  16   ? 19.710  140.167 86.161  1.00 39.06  ? 17   G   0 N7    1 
ATOM   160   C  C5    . G   A  1  16   ? 18.759  141.173 86.239  1.00 39.01  ? 17   G   0 C5    1 
ATOM   161   C  C6    . G   A  1  16   ? 18.871  142.508 86.703  1.00 40.01  ? 17   G   0 C6    1 
ATOM   162   O  O6    . G   A  1  16   ? 19.868  143.090 87.154  1.00 39.46  ? 17   G   0 O6    1 
ATOM   163   N  N1    . G   A  1  16   ? 17.660  143.186 86.604  1.00 39.55  ? 17   G   0 N1    1 
ATOM   164   C  C2    . G   A  1  16   ? 16.495  142.654 86.121  1.00 40.58  ? 17   G   0 C2    1 
ATOM   165   N  N2    . G   A  1  16   ? 15.435  143.475 86.093  1.00 41.47  ? 17   G   0 N2    1 
ATOM   166   N  N3    . G   A  1  16   ? 16.375  141.409 85.690  1.00 41.68  ? 17   G   0 N3    1 
ATOM   167   C  C4    . G   A  1  16   ? 17.539  140.731 85.775  1.00 40.21  ? 17   G   0 C4    1 
ATOM   168   P  P     . C   A  1  17   ? 16.839  138.673 80.084  1.00 42.23  ? 18   C   0 P     1 
ATOM   169   O  OP1   . C   A  1  17   ? 16.035  138.212 78.928  1.00 44.77  ? 18   C   0 OP1   1 
ATOM   170   O  OP2   . C   A  1  17   ? 18.307  138.788 79.949  1.00 43.74  ? 18   C   0 OP2   1 
ATOM   171   O  "O5'" . C   A  1  17   ? 16.275  140.088 80.537  1.00 40.35  ? 18   C   0 "O5'" 1 
ATOM   172   C  "C5'" . C   A  1  17   ? 14.868  140.358 80.510  1.00 37.32  ? 18   C   0 "C5'" 1 
ATOM   173   C  "C4'" . C   A  1  17   ? 14.600  141.783 80.921  1.00 36.36  ? 18   C   0 "C4'" 1 
ATOM   174   O  "O4'" . C   A  1  17   ? 15.075  141.982 82.276  1.00 36.55  ? 18   C   0 "O4'" 1 
ATOM   175   C  "C3'" . C   A  1  17   ? 15.297  142.873 80.119  1.00 36.76  ? 18   C   0 "C3'" 1 
ATOM   176   O  "O3'" . C   A  1  17   ? 14.588  143.173 78.919  1.00 37.10  ? 18   C   0 "O3'" 1 
ATOM   177   C  "C2'" . C   A  1  17   ? 15.281  144.036 81.102  1.00 37.95  ? 18   C   0 "C2'" 1 
ATOM   178   O  "O2'" . C   A  1  17   ? 14.010  144.651 81.187  1.00 39.95  ? 18   C   0 "O2'" 1 
ATOM   179   C  "C1'" . C   A  1  17   ? 15.546  143.310 82.422  1.00 36.71  ? 18   C   0 "C1'" 1 
ATOM   180   N  N1    . C   A  1  17   ? 16.968  143.265 82.812  1.00 38.93  ? 18   C   0 N1    1 
ATOM   181   C  C2    . C   A  1  17   ? 17.528  144.389 83.424  1.00 40.55  ? 18   C   0 C2    1 
ATOM   182   O  O2    . C   A  1  17   ? 16.824  145.399 83.584  1.00 44.63  ? 18   C   0 O2    1 
ATOM   183   N  N3    . C   A  1  17   ? 18.821  144.351 83.826  1.00 40.60  ? 18   C   0 N3    1 
ATOM   184   C  C4    . C   A  1  17   ? 19.548  143.248 83.634  1.00 38.85  ? 18   C   0 C4    1 
ATOM   185   N  N4    . C   A  1  17   ? 20.809  143.250 84.072  1.00 35.30  ? 18   C   0 N4    1 
ATOM   186   C  C5    . C   A  1  17   ? 19.011  142.096 82.993  1.00 37.41  ? 18   C   0 C5    1 
ATOM   187   C  C6    . C   A  1  17   ? 17.730  142.146 82.601  1.00 39.07  ? 18   C   0 C6    1 
ATOM   188   P  P     . U   A  1  18   ? 15.390  143.568 77.576  1.00 36.13  ? 19   U   0 P     1 
ATOM   189   O  OP1   . U   A  1  18   ? 14.377  143.628 76.498  1.00 38.58  ? 19   U   0 OP1   1 
ATOM   190   O  OP2   . U   A  1  18   ? 16.560  142.674 77.416  1.00 36.91  ? 19   U   0 OP2   1 
ATOM   191   O  "O5'" . U   A  1  18   ? 15.901  145.048 77.860  1.00 36.51  ? 19   U   0 "O5'" 1 
ATOM   192   C  "C5'" . U   A  1  18   ? 14.990  146.159 77.826  1.00 35.12  ? 19   U   0 "C5'" 1 
ATOM   193   C  "C4'" . U   A  1  18   ? 15.694  147.440 78.209  1.00 34.87  ? 19   U   0 "C4'" 1 
ATOM   194   O  "O4'" . U   A  1  18   ? 16.105  147.396 79.603  1.00 35.49  ? 19   U   0 "O4'" 1 
ATOM   195   C  "C3'" . U   A  1  18   ? 16.988  147.751 77.482  1.00 34.91  ? 19   U   0 "C3'" 1 
ATOM   196   O  "O3'" . U   A  1  18   ? 16.783  148.262 76.179  1.00 35.53  ? 19   U   0 "O3'" 1 
ATOM   197   C  "C2'" . U   A  1  18   ? 17.615  148.777 78.413  1.00 34.83  ? 19   U   0 "C2'" 1 
ATOM   198   O  "O2'" . U   A  1  18   ? 17.001  150.044 78.323  1.00 33.78  ? 19   U   0 "O2'" 1 
ATOM   199   C  "C1'" . U   A  1  18   ? 17.292  148.160 79.772  1.00 35.55  ? 19   U   0 "C1'" 1 
ATOM   200   N  N1    . U   A  1  18   ? 18.375  147.262 80.207  1.00 37.90  ? 19   U   0 N1    1 
ATOM   201   C  C2    . U   A  1  18   ? 19.482  147.835 80.832  1.00 38.80  ? 19   U   0 C2    1 
ATOM   202   O  O2    . U   A  1  18   ? 19.593  149.039 81.037  1.00 37.61  ? 19   U   0 O2    1 
ATOM   203   N  N3    . U   A  1  18   ? 20.459  146.947 81.203  1.00 38.82  ? 19   U   0 N3    1 
ATOM   204   C  C4    . U   A  1  18   ? 20.454  145.585 81.024  1.00 38.50  ? 19   U   0 C4    1 
ATOM   205   O  O4    . U   A  1  18   ? 21.416  144.929 81.413  1.00 38.20  ? 19   U   0 O4    1 
ATOM   206   C  C5    . U   A  1  18   ? 19.284  145.067 80.374  1.00 38.18  ? 19   U   0 C5    1 
ATOM   207   C  C6    . U   A  1  18   ? 18.311  145.899 79.999  1.00 37.06  ? 19   U   0 C6    1 
ATOM   208   P  P     . G   A  1  19   ? 17.884  147.988 75.044  1.00 33.86  ? 20   G   0 P     1 
ATOM   209   O  OP1   . G   A  1  19   ? 17.373  148.577 73.782  1.00 34.42  ? 20   G   0 OP1   1 
ATOM   210   O  OP2   . G   A  1  19   ? 18.251  146.550 75.089  1.00 33.24  ? 20   G   0 OP2   1 
ATOM   211   O  "O5'" . G   A  1  19   ? 19.156  148.822 75.528  1.00 36.62  ? 20   G   0 "O5'" 1 
ATOM   212   C  "C5'" . G   A  1  19   ? 19.191  150.259 75.436  1.00 33.32  ? 20   G   0 "C5'" 1 
ATOM   213   C  "C4'" . G   A  1  19   ? 20.448  150.796 76.085  1.00 33.46  ? 20   G   0 "C4'" 1 
ATOM   214   O  "O4'" . G   A  1  19   ? 20.484  150.363 77.472  1.00 32.58  ? 20   G   0 "O4'" 1 
ATOM   215   C  "C3'" . G   A  1  19   ? 21.787  150.325 75.534  1.00 32.95  ? 20   G   0 "C3'" 1 
ATOM   216   O  "O3'" . G   A  1  19   ? 22.198  151.048 74.379  1.00 32.71  ? 20   G   0 "O3'" 1 
ATOM   217   C  "C2'" . G   A  1  19   ? 22.709  150.621 76.704  1.00 31.51  ? 20   G   0 "C2'" 1 
ATOM   218   O  "O2'" . G   A  1  19   ? 23.008  151.993 76.811  1.00 35.35  ? 20   G   0 "O2'" 1 
ATOM   219   C  "C1'" . G   A  1  19   ? 21.831  150.207 77.885  1.00 31.36  ? 20   G   0 "C1'" 1 
ATOM   220   N  N9    . G   A  1  19   ? 22.063  148.805 78.219  1.00 30.54  ? 20   G   0 N9    1 
ATOM   221   C  C8    . G   A  1  19   ? 21.299  147.720 77.863  1.00 29.21  ? 20   G   0 C8    1 
ATOM   222   N  N7    . G   A  1  19   ? 21.817  146.583 78.238  1.00 30.32  ? 20   G   0 N7    1 
ATOM   223   C  C5    . G   A  1  19   ? 22.982  146.938 78.902  1.00 32.19  ? 20   G   0 C5    1 
ATOM   224   C  C6    . G   A  1  19   ? 23.973  146.127 79.526  1.00 32.29  ? 20   G   0 C6    1 
ATOM   225   O  O6    . G   A  1  19   ? 24.016  144.892 79.609  1.00 31.46  ? 20   G   0 O6    1 
ATOM   226   N  N1    . G   A  1  19   ? 24.988  146.901 80.084  1.00 31.61  ? 20   G   0 N1    1 
ATOM   227   C  C2    . G   A  1  19   ? 25.048  148.278 80.042  1.00 32.05  ? 20   G   0 C2    1 
ATOM   228   N  N2    . G   A  1  19   ? 26.106  148.849 80.622  1.00 31.53  ? 20   G   0 N2    1 
ATOM   229   N  N3    . G   A  1  19   ? 24.135  149.040 79.467  1.00 30.87  ? 20   G   0 N3    1 
ATOM   230   C  C4    . G   A  1  19   ? 23.137  148.308 78.918  1.00 31.51  ? 20   G   0 C4    1 
ATOM   231   P  P     . G   A  1  20   ? 23.082  150.320 73.248  1.00 36.64  ? 21   G   0 P     1 
ATOM   232   O  OP1   . G   A  1  20   ? 23.220  151.332 72.172  1.00 34.77  ? 21   G   0 OP1   1 
ATOM   233   O  OP2   . G   A  1  20   ? 22.499  149.001 72.940  1.00 35.88  ? 21   G   0 OP2   1 
ATOM   234   O  "O5'" . G   A  1  20   ? 24.506  150.020 73.916  1.00 35.54  ? 21   G   0 "O5'" 1 
ATOM   235   C  "C5'" . G   A  1  20   ? 25.416  151.082 74.195  1.00 34.77  ? 21   G   0 "C5'" 1 
ATOM   236   C  "C4'" . G   A  1  20   ? 26.477  150.676 75.206  1.00 33.21  ? 21   G   0 "C4'" 1 
ATOM   237   O  "O4'" . G   A  1  20   ? 25.964  149.767 76.215  1.00 31.76  ? 21   G   0 "O4'" 1 
ATOM   238   C  "C3'" . G   A  1  20   ? 27.698  149.902 74.746  1.00 32.10  ? 21   G   0 "C3'" 1 
ATOM   239   O  "O3'" . G   A  1  20   ? 28.596  150.719 73.998  1.00 31.12  ? 21   G   0 "O3'" 1 
ATOM   240   C  "C2'" . G   A  1  20   ? 28.316  149.553 76.099  1.00 32.18  ? 21   G   0 "C2'" 1 
ATOM   241   O  "O2'" . G   A  1  20   ? 28.964  150.657 76.709  1.00 29.06  ? 21   G   0 "O2'" 1 
ATOM   242   C  "C1'" . G   A  1  20   ? 27.068  149.236 76.932  1.00 31.15  ? 21   G   0 "C1'" 1 
ATOM   243   N  N9    . G   A  1  20   ? 26.888  147.800 77.124  1.00 34.27  ? 21   G   0 N9    1 
ATOM   244   C  C8    . G   A  1  20   ? 25.877  147.003 76.646  1.00 34.91  ? 21   G   0 C8    1 
ATOM   245   N  N7    . G   A  1  20   ? 26.015  145.746 76.974  1.00 32.88  ? 21   G   0 N7    1 
ATOM   246   C  C5    . G   A  1  20   ? 27.185  145.711 77.721  1.00 33.95  ? 21   G   0 C5    1 
ATOM   247   C  C6    . G   A  1  20   ? 27.853  144.616 78.346  1.00 34.76  ? 21   G   0 C6    1 
ATOM   248   O  O6    . G   A  1  20   ? 27.529  143.422 78.372  1.00 33.18  ? 21   G   0 O6    1 
ATOM   249   N  N1    . G   A  1  20   ? 29.015  145.028 78.987  1.00 35.45  ? 21   G   0 N1    1 
ATOM   250   C  C2    . G   A  1  20   ? 29.481  146.314 79.025  1.00 35.47  ? 21   G   0 C2    1 
ATOM   251   N  N2    . G   A  1  20   ? 30.628  146.499 79.689  1.00 36.68  ? 21   G   0 N2    1 
ATOM   252   N  N3    . G   A  1  20   ? 28.870  147.342 78.455  1.00 35.02  ? 21   G   0 N3    1 
ATOM   253   C  C4    . G   A  1  20   ? 27.736  146.969 77.825  1.00 34.60  ? 21   G   0 C4    1 
ATOM   254   P  P     . U   A  1  21   ? 29.491  150.064 72.834  1.00 30.74  ? 22   U   0 P     1 
ATOM   255   O  OP1   . U   A  1  21   ? 30.207  151.160 72.152  1.00 30.63  ? 22   U   0 OP1   1 
ATOM   256   O  OP2   . U   A  1  21   ? 28.654  149.134 72.044  1.00 30.55  ? 22   U   0 OP2   1 
ATOM   257   O  "O5'" . U   A  1  21   ? 30.551  149.161 73.609  1.00 32.08  ? 22   U   0 "O5'" 1 
ATOM   258   C  "C5'" . U   A  1  21   ? 31.515  149.730 74.515  1.00 29.87  ? 22   U   0 "C5'" 1 
ATOM   259   C  "C4'" . U   A  1  21   ? 32.257  148.626 75.235  1.00 30.20  ? 22   U   0 "C4'" 1 
ATOM   260   O  "O4'" . U   A  1  21   ? 31.338  147.891 76.087  1.00 28.46  ? 22   U   0 "O4'" 1 
ATOM   261   C  "C3'" . U   A  1  21   ? 32.867  147.566 74.330  1.00 30.61  ? 22   U   0 "C3'" 1 
ATOM   262   O  "O3'" . U   A  1  21   ? 34.145  147.988 73.874  1.00 29.04  ? 22   U   0 "O3'" 1 
ATOM   263   C  "C2'" . U   A  1  21   ? 32.965  146.360 75.257  1.00 31.43  ? 22   U   0 "C2'" 1 
ATOM   264   O  "O2'" . U   A  1  21   ? 34.075  146.443 76.130  1.00 34.02  ? 22   U   0 "O2'" 1 
ATOM   265   C  "C1'" . U   A  1  21   ? 31.696  146.520 76.097  1.00 31.32  ? 22   U   0 "C1'" 1 
ATOM   266   N  N1    . U   A  1  21   ? 30.539  145.714 75.669  1.00 31.47  ? 22   U   0 N1    1 
ATOM   267   C  C2    . U   A  1  21   ? 30.476  144.410 76.116  1.00 32.53  ? 22   U   0 C2    1 
ATOM   268   O  O2    . U   A  1  21   ? 31.367  143.887 76.762  1.00 34.67  ? 22   U   0 O2    1 
ATOM   269   N  N3    . U   A  1  21   ? 29.336  143.731 75.773  1.00 32.46  ? 22   U   0 N3    1 
ATOM   270   C  C4    . U   A  1  21   ? 28.279  144.200 75.025  1.00 33.62  ? 22   U   0 C4    1 
ATOM   271   O  O4    . U   A  1  21   ? 27.260  143.509 74.927  1.00 31.00  ? 22   U   0 O4    1 
ATOM   272   C  C5    . U   A  1  21   ? 28.440  145.541 74.546  1.00 32.63  ? 22   U   0 C5    1 
ATOM   273   C  C6    . U   A  1  21   ? 29.535  146.236 74.877  1.00 33.44  ? 22   U   0 C6    1 
ATOM   274   P  P     . G   A  1  22   ? 34.622  147.640 72.381  1.00 30.12  ? 23   G   0 P     1 
ATOM   275   O  OP1   . G   A  1  22   ? 36.012  148.138 72.245  1.00 29.04  ? 23   G   0 OP1   1 
ATOM   276   O  OP2   . G   A  1  22   ? 33.575  148.123 71.437  1.00 30.33  ? 23   G   0 OP2   1 
ATOM   277   O  "O5'" . G   A  1  22   ? 34.654  146.044 72.330  1.00 29.97  ? 23   G   0 "O5'" 1 
ATOM   278   C  "C5'" . G   A  1  22   ? 35.602  145.279 73.105  1.00 26.88  ? 23   G   0 "C5'" 1 
ATOM   279   C  "C4'" . G   A  1  22   ? 35.271  143.806 73.020  1.00 27.85  ? 23   G   0 "C4'" 1 
ATOM   280   O  "O4'" . G   A  1  22   ? 33.991  143.553 73.663  1.00 28.17  ? 23   G   0 "O4'" 1 
ATOM   281   C  "C3'" . G   A  1  22   ? 35.113  143.264 71.609  1.00 26.66  ? 23   G   0 "C3'" 1 
ATOM   282   O  "O3'" . G   A  1  22   ? 36.381  142.874 71.108  1.00 26.28  ? 23   G   0 "O3'" 1 
ATOM   283   C  "C2'" . G   A  1  22   ? 34.187  142.073 71.820  1.00 26.62  ? 23   G   0 "C2'" 1 
ATOM   284   O  "O2'" . G   A  1  22   ? 34.891  140.971 72.339  1.00 25.89  ? 23   G   0 "O2'" 1 
ATOM   285   C  "C1'" . G   A  1  22   ? 33.256  142.600 72.917  1.00 27.45  ? 23   G   0 "C1'" 1 
ATOM   286   N  N9    . G   A  1  22   ? 32.042  143.260 72.441  1.00 29.67  ? 23   G   0 N9    1 
ATOM   287   C  C8    . G   A  1  22   ? 31.950  144.532 71.921  1.00 30.35  ? 23   G   0 C8    1 
ATOM   288   N  N7    . G   A  1  22   ? 30.730  144.873 71.608  1.00 30.36  ? 23   G   0 N7    1 
ATOM   289   C  C5    . G   A  1  22   ? 29.964  143.761 71.933  1.00 29.24  ? 23   G   0 C5    1 
ATOM   290   C  C6    . G   A  1  22   ? 28.567  143.538 71.805  1.00 29.12  ? 23   G   0 C6    1 
ATOM   291   O  O6    . G   A  1  22   ? 27.700  144.310 71.373  1.00 27.18  ? 23   G   0 O6    1 
ATOM   292   N  N1    . G   A  1  22   ? 28.210  142.262 72.237  1.00 28.70  ? 23   G   0 N1    1 
ATOM   293   C  C2    . G   A  1  22   ? 29.082  141.325 72.729  1.00 28.85  ? 23   G   0 C2    1 
ATOM   294   N  N2    . G   A  1  22   ? 28.549  140.153 73.079  1.00 29.49  ? 23   G   0 N2    1 
ATOM   295   N  N3    . G   A  1  22   ? 30.385  141.522 72.863  1.00 29.78  ? 23   G   0 N3    1 
ATOM   296   C  C4    . G   A  1  22   ? 30.757  142.752 72.444  1.00 30.10  ? 23   G   0 C4    1 
ATOM   297   P  P     . G   A  1  23   ? 36.732  143.057 69.548  1.00 27.18  ? 24   G   0 P     1 
ATOM   298   O  OP1   . G   A  1  23   ? 38.208  142.898 69.424  1.00 27.81  ? 24   G   0 OP1   1 
ATOM   299   O  OP2   . G   A  1  23   ? 36.086  144.297 69.055  1.00 26.39  ? 24   G   0 OP2   1 
ATOM   300   O  "O5'" . G   A  1  23   ? 36.034  141.825 68.824  1.00 23.44  ? 24   G   0 "O5'" 1 
ATOM   301   C  "C5'" . G   A  1  23   ? 36.191  140.485 69.313  1.00 24.66  ? 24   G   0 "C5'" 1 
ATOM   302   C  "C4'" . G   A  1  23   ? 35.066  139.627 68.797  1.00 24.48  ? 24   G   0 "C4'" 1 
ATOM   303   O  "O4'" . G   A  1  23   ? 33.818  140.279 69.166  1.00 24.47  ? 24   G   0 "O4'" 1 
ATOM   304   C  "C3'" . G   A  1  23   ? 35.017  139.462 67.276  1.00 24.41  ? 24   G   0 "C3'" 1 
ATOM   305   O  "O3'" . G   A  1  23   ? 34.365  138.230 66.987  1.00 28.50  ? 24   G   0 "O3'" 1 
ATOM   306   C  "C2'" . G   A  1  23   ? 34.116  140.615 66.866  1.00 25.08  ? 24   G   0 "C2'" 1 
ATOM   307   O  "O2'" . G   A  1  23   ? 33.461  140.423 65.639  1.00 26.85  ? 24   G   0 "O2'" 1 
ATOM   308   C  "C1'" . G   A  1  23   ? 33.093  140.592 67.995  1.00 27.39  ? 24   G   0 "C1'" 1 
ATOM   309   N  N9    . G   A  1  23   ? 32.389  141.859 68.165  1.00 27.87  ? 24   G   0 N9    1 
ATOM   310   C  C8    . G   A  1  23   ? 32.891  143.128 67.981  1.00 29.08  ? 24   G   0 C8    1 
ATOM   311   N  N7    . G   A  1  23   ? 31.987  144.061 68.113  1.00 29.84  ? 24   G   0 N7    1 
ATOM   312   C  C5    . G   A  1  23   ? 30.823  143.367 68.420  1.00 28.77  ? 24   G   0 C5    1 
ATOM   313   C  C6    . G   A  1  23   ? 29.510  143.838 68.651  1.00 26.86  ? 24   G   0 C6    1 
ATOM   314   O  O6    . G   A  1  23   ? 29.090  144.995 68.609  1.00 26.36  ? 24   G   0 O6    1 
ATOM   315   N  N1    . G   A  1  23   ? 28.641  142.801 68.948  1.00 27.66  ? 24   G   0 N1    1 
ATOM   316   C  C2    . G   A  1  23   ? 28.986  141.476 69.012  1.00 29.73  ? 24   G   0 C2    1 
ATOM   317   N  N2    . G   A  1  23   ? 28.000  140.629 69.339  1.00 29.88  ? 24   G   0 N2    1 
ATOM   318   N  N3    . G   A  1  23   ? 30.205  141.018 68.776  1.00 27.57  ? 24   G   0 N3    1 
ATOM   319   C  C4    . G   A  1  23   ? 31.064  142.011 68.488  1.00 27.72  ? 24   G   0 C4    1 
ATOM   320   P  P     . A   A  1  24   ? 34.750  137.381 65.672  1.00 27.56  ? 25   A   0 P     1 
ATOM   321   O  OP1   . A   A  1  24   ? 36.222  137.157 65.648  1.00 28.67  ? 25   A   0 OP1   1 
ATOM   322   O  OP2   . A   A  1  24   ? 34.078  137.943 64.484  1.00 26.87  ? 25   A   0 OP2   1 
ATOM   323   O  "O5'" . A   A  1  24   ? 34.043  135.984 65.954  1.00 26.51  ? 25   A   0 "O5'" 1 
ATOM   324   C  "C5'" . A   A  1  24   ? 34.477  135.142 67.021  1.00 23.66  ? 25   A   0 "C5'" 1 
ATOM   325   C  "C4'" . A   A  1  24   ? 33.298  134.440 67.644  1.00 26.24  ? 25   A   0 "C4'" 1 
ATOM   326   O  "O4'" . A   A  1  24   ? 32.496  135.374 68.418  1.00 27.07  ? 25   A   0 "O4'" 1 
ATOM   327   C  "C3'" . A   A  1  24   ? 32.301  133.812 66.687  1.00 26.91  ? 25   A   0 "C3'" 1 
ATOM   328   O  "O3'" . A   A  1  24   ? 32.752  132.557 66.185  1.00 27.37  ? 25   A   0 "O3'" 1 
ATOM   329   C  "C2'" . A   A  1  24   ? 31.076  133.668 67.580  1.00 27.84  ? 25   A   0 "C2'" 1 
ATOM   330   O  "O2'" . A   A  1  24   ? 31.204  132.580 68.472  1.00 26.80  ? 25   A   0 "O2'" 1 
ATOM   331   C  "C1'" . A   A  1  24   ? 31.134  134.971 68.382  1.00 28.32  ? 25   A   0 "C1'" 1 
ATOM   332   N  N9    . A   A  1  24   ? 30.344  136.047 67.777  1.00 30.71  ? 25   A   0 N9    1 
ATOM   333   C  C8    . A   A  1  24   ? 30.813  137.181 67.160  1.00 32.55  ? 25   A   0 C8    1 
ATOM   334   N  N7    . A   A  1  24   ? 29.870  137.964 66.699  1.00 32.94  ? 25   A   0 N7    1 
ATOM   335   C  C5    . A   A  1  24   ? 28.697  137.308 67.036  1.00 32.45  ? 25   A   0 C5    1 
ATOM   336   C  C6    . A   A  1  24   ? 27.349  137.622 66.820  1.00 33.05  ? 25   A   0 C6    1 
ATOM   337   N  N6    . A   A  1  24   ? 26.936  138.735 66.204  1.00 31.21  ? 25   A   0 N6    1 
ATOM   338   N  N1    . A   A  1  24   ? 26.424  136.747 67.267  1.00 33.54  ? 25   A   0 N1    1 
ATOM   339   C  C2    . A   A  1  24   ? 26.837  135.643 67.897  1.00 31.07  ? 25   A   0 C2    1 
ATOM   340   N  N3    . A   A  1  24   ? 28.070  135.243 68.169  1.00 32.68  ? 25   A   0 N3    1 
ATOM   341   C  C4    . A   A  1  24   ? 28.970  136.128 67.705  1.00 32.47  ? 25   A   0 C4    1 
ATOM   342   P  P     . U   A  1  25   ? 32.226  132.033 64.755  1.00 26.09  ? 26   U   0 P     1 
ATOM   343   O  OP1   . U   A  1  25   ? 32.619  130.608 64.594  1.00 24.29  ? 26   U   0 OP1   1 
ATOM   344   O  OP2   . U   A  1  25   ? 32.650  133.030 63.742  1.00 24.64  ? 26   U   0 OP2   1 
ATOM   345   O  "O5'" . U   A  1  25   ? 30.641  132.091 64.884  1.00 24.36  ? 26   U   0 "O5'" 1 
ATOM   346   C  "C5'" . U   A  1  25   ? 29.932  131.186 65.743  1.00 24.06  ? 26   U   0 "C5'" 1 
ATOM   347   C  "C4'" . U   A  1  25   ? 28.455  131.442 65.642  1.00 24.07  ? 26   U   0 "C4'" 1 
ATOM   348   O  "O4'" . U   A  1  25   ? 28.167  132.778 66.125  1.00 26.19  ? 26   U   0 "O4'" 1 
ATOM   349   C  "C3'" . U   A  1  25   ? 27.918  131.426 64.223  1.00 25.67  ? 26   U   0 "C3'" 1 
ATOM   350   O  "O3'" . U   A  1  25   ? 27.627  130.101 63.827  1.00 25.74  ? 26   U   0 "O3'" 1 
ATOM   351   C  "C2'" . U   A  1  25   ? 26.680  132.299 64.334  1.00 26.70  ? 26   U   0 "C2'" 1 
ATOM   352   O  "O2'" . U   A  1  25   ? 25.593  131.607 64.916  1.00 29.18  ? 26   U   0 "O2'" 1 
ATOM   353   C  "C1'" . U   A  1  25   ? 27.162  133.370 65.315  1.00 26.99  ? 26   U   0 "C1'" 1 
ATOM   354   N  N1    . U   A  1  25   ? 27.719  134.583 64.684  1.00 27.70  ? 26   U   0 N1    1 
ATOM   355   C  C2    . U   A  1  25   ? 26.825  135.528 64.202  1.00 27.93  ? 26   U   0 C2    1 
ATOM   356   O  O2    . U   A  1  25   ? 25.629  135.355 64.190  1.00 28.52  ? 26   U   0 O2    1 
ATOM   357   N  N3    . U   A  1  25   ? 27.395  136.679 63.718  1.00 26.60  ? 26   U   0 N3    1 
ATOM   358   C  C4    . U   A  1  25   ? 28.744  136.969 63.632  1.00 28.09  ? 26   U   0 C4    1 
ATOM   359   O  O4    . U   A  1  25   ? 29.097  138.092 63.255  1.00 27.53  ? 26   U   0 O4    1 
ATOM   360   C  C5    . U   A  1  25   ? 29.610  135.922 64.094  1.00 25.16  ? 26   U   0 C5    1 
ATOM   361   C  C6    . U   A  1  25   ? 29.082  134.796 64.594  1.00 25.46  ? 26   U   0 C6    1 
ATOM   362   P  P     . U   A  1  26   ? 27.888  129.640 62.312  1.00 29.65  ? 27   U   0 P     1 
ATOM   363   O  OP1   . U   A  1  26   ? 27.686  128.166 62.291  1.00 27.04  ? 27   U   0 OP1   1 
ATOM   364   O  OP2   . U   A  1  26   ? 29.161  130.214 61.813  1.00 29.76  ? 27   U   0 OP2   1 
ATOM   365   O  "O5'" . U   A  1  26   ? 26.702  130.322 61.499  1.00 30.23  ? 27   U   0 "O5'" 1 
ATOM   366   C  "C5'" . U   A  1  26   ? 25.337  129.945 61.742  1.00 27.56  ? 27   U   0 "C5'" 1 
ATOM   367   C  "C4'" . U   A  1  26   ? 24.405  130.891 61.043  1.00 26.48  ? 27   U   0 "C4'" 1 
ATOM   368   O  "O4'" . U   A  1  26   ? 24.466  132.196 61.670  1.00 25.48  ? 27   U   0 "O4'" 1 
ATOM   369   C  "C3'" . U   A  1  26   ? 24.723  131.181 59.590  1.00 26.74  ? 27   U   0 "C3'" 1 
ATOM   370   O  "O3'" . U   A  1  26   ? 24.286  130.141 58.733  1.00 26.35  ? 27   U   0 "O3'" 1 
ATOM   371   C  "C2'" . U   A  1  26   ? 23.982  132.488 59.369  1.00 26.54  ? 27   U   0 "C2'" 1 
ATOM   372   O  "O2'" . U   A  1  26   ? 22.589  132.297 59.250  1.00 26.86  ? 27   U   0 "O2'" 1 
ATOM   373   C  "C1'" . U   A  1  26   ? 24.248  133.199 60.696  1.00 26.75  ? 27   U   0 "C1'" 1 
ATOM   374   N  N1    . U   A  1  26   ? 25.424  134.080 60.664  1.00 30.17  ? 27   U   0 N1    1 
ATOM   375   C  C2    . U   A  1  26   ? 25.218  135.418 60.370  1.00 31.04  ? 27   U   0 C2    1 
ATOM   376   O  O2    . U   A  1  26   ? 24.121  135.877 60.108  1.00 31.64  ? 27   U   0 O2    1 
ATOM   377   N  N3    . U   A  1  26   ? 26.349  136.194 60.386  1.00 31.03  ? 27   U   0 N3    1 
ATOM   378   C  C4    . U   A  1  26   ? 27.636  135.776 60.647  1.00 30.73  ? 27   U   0 C4    1 
ATOM   379   O  O4    . U   A  1  26   ? 28.553  136.591 60.612  1.00 31.37  ? 27   U   0 O4    1 
ATOM   380   C  C5    . U   A  1  26   ? 27.768  134.381 60.925  1.00 29.97  ? 27   U   0 C5    1 
ATOM   381   C  C6    . U   A  1  26   ? 26.689  133.601 60.924  1.00 28.96  ? 27   U   0 C6    1 
ATOM   382   P  P     . G   A  1  27   ? 25.068  129.875 57.360  1.00 29.38  ? 28   G   0 P     1 
ATOM   383   O  OP1   . G   A  1  27   ? 24.546  128.623 56.763  1.00 26.69  ? 28   G   0 OP1   1 
ATOM   384   O  OP2   . G   A  1  27   ? 26.524  130.001 57.608  1.00 32.28  ? 28   G   0 OP2   1 
ATOM   385   O  "O5'" . G   A  1  27   ? 24.686  131.135 56.463  1.00 30.50  ? 28   G   0 "O5'" 1 
ATOM   386   C  "C5'" . G   A  1  27   ? 23.328  131.434 56.130  1.00 27.56  ? 28   G   0 "C5'" 1 
ATOM   387   C  "C4'" . G   A  1  27   ? 23.224  132.832 55.569  1.00 28.17  ? 28   G   0 "C4'" 1 
ATOM   388   O  "O4'" . G   A  1  27   ? 23.541  133.798 56.606  1.00 28.20  ? 28   G   0 "O4'" 1 
ATOM   389   C  "C3'" . G   A  1  27   ? 24.196  133.213 54.461  1.00 29.45  ? 28   G   0 "C3'" 1 
ATOM   390   O  "O3'" . G   A  1  27   ? 23.866  132.668 53.194  1.00 26.62  ? 28   G   0 "O3'" 1 
ATOM   391   C  "C2'" . G   A  1  27   ? 24.107  134.731 54.503  1.00 29.49  ? 28   G   0 "C2'" 1 
ATOM   392   O  "O2'" . G   A  1  27   ? 22.898  135.243 53.975  1.00 31.57  ? 28   G   0 "O2'" 1 
ATOM   393   C  "C1'" . G   A  1  27   ? 24.090  134.969 56.010  1.00 30.30  ? 28   G   0 "C1'" 1 
ATOM   394   N  N9    . G   A  1  27   ? 25.446  135.164 56.509  1.00 29.54  ? 28   G   0 N9    1 
ATOM   395   C  C8    . G   A  1  27   ? 26.264  134.222 57.078  1.00 31.74  ? 28   G   0 C8    1 
ATOM   396   N  N7    . G   A  1  27   ? 27.435  134.690 57.404  1.00 32.01  ? 28   G   0 N7    1 
ATOM   397   C  C5    . G   A  1  27   ? 27.387  136.025 57.036  1.00 31.79  ? 28   G   0 C5    1 
ATOM   398   C  C6    . G   A  1  27   ? 28.370  137.048 57.154  1.00 32.15  ? 28   G   0 C6    1 
ATOM   399   O  O6    . G   A  1  27   ? 29.518  136.968 57.622  1.00 32.52  ? 28   G   0 O6    1 
ATOM   400   N  N1    . G   A  1  27   ? 27.904  138.261 56.659  1.00 30.12  ? 28   G   0 N1    1 
ATOM   401   C  C2    . G   A  1  27   ? 26.658  138.468 56.117  1.00 30.47  ? 28   G   0 C2    1 
ATOM   402   N  N2    . G   A  1  27   ? 26.404  139.713 55.688  1.00 27.15  ? 28   G   0 N2    1 
ATOM   403   N  N3    . G   A  1  27   ? 25.732  137.524 56.004  1.00 30.27  ? 28   G   0 N3    1 
ATOM   404   C  C4    . G   A  1  27   ? 26.164  136.335 56.481  1.00 31.12  ? 28   G   0 C4    1 
ATOM   405   P  P     . C   A  1  28   ? 25.044  132.265 52.177  1.00 26.68  ? 29   C   0 P     1 
ATOM   406   O  OP1   . C   A  1  28   ? 24.424  131.692 50.967  1.00 25.79  ? 29   C   0 OP1   1 
ATOM   407   O  OP2   . C   A  1  28   ? 26.080  131.485 52.904  1.00 29.55  ? 29   C   0 OP2   1 
ATOM   408   O  "O5'" . C   A  1  28   ? 25.703  133.658 51.794  1.00 28.86  ? 29   C   0 "O5'" 1 
ATOM   409   C  "C5'" . C   A  1  28   ? 24.948  134.680 51.136  1.00 27.05  ? 29   C   0 "C5'" 1 
ATOM   410   C  "C4'" . C   A  1  28   ? 25.804  135.898 50.930  1.00 27.91  ? 29   C   0 "C4'" 1 
ATOM   411   O  "O4'" . C   A  1  28   ? 26.234  136.411 52.217  1.00 28.76  ? 29   C   0 "O4'" 1 
ATOM   412   C  "C3'" . C   A  1  28   ? 27.112  135.673 50.189  1.00 30.29  ? 29   C   0 "C3'" 1 
ATOM   413   O  "O3'" . C   A  1  28   ? 26.894  135.627 48.788  1.00 30.33  ? 29   C   0 "O3'" 1 
ATOM   414   C  "C2'" . C   A  1  28   ? 27.917  136.896 50.607  1.00 30.89  ? 29   C   0 "C2'" 1 
ATOM   415   O  "O2'" . C   A  1  28   ? 27.536  138.061 49.911  1.00 31.85  ? 29   C   0 "O2'" 1 
ATOM   416   C  "C1'" . C   A  1  28   ? 27.487  137.055 52.069  1.00 29.24  ? 29   C   0 "C1'" 1 
ATOM   417   N  N1    . C   A  1  28   ? 28.454  136.485 53.029  1.00 29.72  ? 29   C   0 N1    1 
ATOM   418   C  C2    . C   A  1  28   ? 29.553  137.263 53.393  1.00 27.94  ? 29   C   0 C2    1 
ATOM   419   O  O2    . C   A  1  28   ? 29.654  138.397 52.925  1.00 30.29  ? 29   C   0 O2    1 
ATOM   420   N  N3    . C   A  1  28   ? 30.474  136.763 54.245  1.00 28.39  ? 29   C   0 N3    1 
ATOM   421   C  C4    . C   A  1  28   ? 30.329  135.533 54.738  1.00 28.46  ? 29   C   0 C4    1 
ATOM   422   N  N4    . C   A  1  28   ? 31.276  135.083 55.564  1.00 27.26  ? 29   C   0 N4    1 
ATOM   423   C  C5    . C   A  1  28   ? 29.209  134.712 54.400  1.00 28.54  ? 29   C   0 C5    1 
ATOM   424   C  C6    . C   A  1  28   ? 28.301  135.225 53.550  1.00 30.05  ? 29   C   0 C6    1 
ATOM   425   P  P     . U   A  1  29   ? 27.783  134.657 47.862  1.00 35.97  ? 30   U   0 P     1 
ATOM   426   O  OP1   . U   A  1  29   ? 27.119  134.688 46.529  1.00 36.56  ? 30   U   0 OP1   1 
ATOM   427   O  OP2   . U   A  1  29   ? 28.006  133.359 48.531  1.00 32.58  ? 30   U   0 OP2   1 
ATOM   428   O  "O5'" . U   A  1  29   ? 29.182  135.415 47.738  1.00 34.68  ? 30   U   0 "O5'" 1 
ATOM   429   C  "C5'" . U   A  1  29   ? 29.224  136.817 47.420  1.00 34.46  ? 30   U   0 "C5'" 1 
ATOM   430   C  "C4'" . U   A  1  29   ? 30.648  137.333 47.431  1.00 36.58  ? 30   U   0 "C4'" 1 
ATOM   431   O  "O4'" . U   A  1  29   ? 31.190  137.275 48.779  1.00 35.49  ? 30   U   0 "O4'" 1 
ATOM   432   C  "C3'" . U   A  1  29   ? 31.665  136.634 46.528  1.00 36.15  ? 30   U   0 "C3'" 1 
ATOM   433   O  "O3'" . U   A  1  29   ? 32.588  137.594 46.039  1.00 38.62  ? 30   U   0 "O3'" 1 
ATOM   434   C  "C2'" . U   A  1  29   ? 32.430  135.752 47.503  1.00 35.38  ? 30   U   0 "C2'" 1 
ATOM   435   O  "O2'" . U   A  1  29   ? 33.750  135.524 47.055  1.00 36.62  ? 30   U   0 "O2'" 1 
ATOM   436   C  "C1'" . U   A  1  29   ? 32.448  136.639 48.746  1.00 35.12  ? 30   U   0 "C1'" 1 
ATOM   437   N  N1    . U   A  1  29   ? 32.667  135.949 50.028  1.00 35.86  ? 30   U   0 N1    1 
ATOM   438   C  C2    . U   A  1  29   ? 33.544  136.539 50.928  1.00 36.22  ? 30   U   0 C2    1 
ATOM   439   O  O2    . U   A  1  29   ? 34.104  137.601 50.715  1.00 35.47  ? 30   U   0 O2    1 
ATOM   440   N  N3    . U   A  1  29   ? 33.742  135.837 52.089  1.00 34.88  ? 30   U   0 N3    1 
ATOM   441   C  C4    . U   A  1  29   ? 33.171  134.637 52.440  1.00 35.51  ? 30   U   0 C4    1 
ATOM   442   O  O4    . U   A  1  29   ? 33.500  134.101 53.499  1.00 34.28  ? 30   U   0 O4    1 
ATOM   443   C  C5    . U   A  1  29   ? 32.262  134.103 51.472  1.00 35.18  ? 30   U   0 C5    1 
ATOM   444   C  C6    . U   A  1  29   ? 32.045  134.760 50.331  1.00 34.45  ? 30   U   0 C6    1 
ATOM   445   P  P     . C   A  1  30   ? 32.430  138.174 44.556  1.00 38.95  ? 31   C   0 P     1 
ATOM   446   O  OP1   . C   A  1  30   ? 32.082  139.601 44.715  1.00 41.04  ? 31   C   0 OP1   1 
ATOM   447   O  OP2   . C   A  1  30   ? 31.555  137.290 43.758  1.00 39.76  ? 31   C   0 OP2   1 
ATOM   448   O  "O5'" . C   A  1  30   ? 33.880  138.059 43.915  1.00 41.35  ? 31   C   0 "O5'" 1 
ATOM   449   C  "C5'" . C   A  1  30   ? 35.066  138.015 44.727  1.00 45.93  ? 31   C   0 "C5'" 1 
ATOM   450   C  "C4'" . C   A  1  30   ? 36.125  138.915 44.132  1.00 47.37  ? 31   C   0 "C4'" 1 
ATOM   451   O  "O4'" . C   A  1  30   ? 35.654  140.293 44.174  1.00 52.34  ? 31   C   0 "O4'" 1 
ATOM   452   C  "C3'" . C   A  1  30   ? 37.469  138.914 44.846  1.00 45.42  ? 31   C   0 "C3'" 1 
ATOM   453   O  "O3'" . C   A  1  30   ? 38.467  139.223 43.887  1.00 35.42  ? 31   C   0 "O3'" 1 
ATOM   454   C  "C2'" . C   A  1  30   ? 37.319  140.074 45.823  1.00 50.48  ? 31   C   0 "C2'" 1 
ATOM   455   O  "O2'" . C   A  1  30   ? 38.553  140.636 46.221  1.00 49.91  ? 31   C   0 "O2'" 1 
ATOM   456   C  "C1'" . C   A  1  30   ? 36.530  141.069 44.972  1.00 55.22  ? 31   C   0 "C1'" 1 
ATOM   457   N  N1    . C   A  1  30   ? 35.740  142.059 45.739  1.00 61.61  ? 31   C   0 N1    1 
ATOM   458   C  C2    . C   A  1  30   ? 36.410  143.159 46.329  1.00 65.84  ? 31   C   0 C2    1 
ATOM   459   O  O2    . C   A  1  30   ? 37.651  143.261 46.204  1.00 67.52  ? 31   C   0 O2    1 
ATOM   460   N  N3    . C   A  1  30   ? 35.689  144.077 47.018  1.00 67.99  ? 31   C   0 N3    1 
ATOM   461   C  C4    . C   A  1  30   ? 34.363  143.938 47.133  1.00 68.37  ? 31   C   0 C4    1 
ATOM   462   N  N4    . C   A  1  30   ? 33.696  144.873 47.818  1.00 69.05  ? 31   C   0 N4    1 
ATOM   463   C  C5    . C   A  1  30   ? 33.663  142.835 46.552  1.00 66.36  ? 31   C   0 C5    1 
ATOM   464   C  C6    . C   A  1  30   ? 34.383  141.928 45.874  1.00 64.02  ? 31   C   0 C6    1 
ATOM   465   P  P     . G   A  1  31   ? 39.451  138.074 43.356  1.00 31.11  ? 32   G   0 P     1 
ATOM   466   O  OP1   . G   A  1  31   ? 40.436  138.738 42.473  1.00 32.88  ? 32   G   0 OP1   1 
ATOM   467   O  OP2   . G   A  1  31   ? 38.653  136.933 42.832  1.00 32.79  ? 32   G   0 OP2   1 
ATOM   468   O  "O5'" . G   A  1  31   ? 40.187  137.562 44.665  1.00 30.22  ? 32   G   0 "O5'" 1 
ATOM   469   C  "C5'" . G   A  1  31   ? 40.960  138.448 45.492  1.00 26.45  ? 32   G   0 "C5'" 1 
ATOM   470   C  "C4'" . G   A  1  31   ? 41.516  137.686 46.674  1.00 27.75  ? 32   G   0 "C4'" 1 
ATOM   471   O  "O4'" . G   A  1  31   ? 40.422  137.205 47.510  1.00 25.68  ? 32   G   0 "O4'" 1 
ATOM   472   C  "C3'" . G   A  1  31   ? 42.291  136.423 46.314  1.00 26.73  ? 32   G   0 "C3'" 1 
ATOM   473   O  "O3'" . G   A  1  31   ? 43.631  136.731 45.947  1.00 25.49  ? 32   G   0 "O3'" 1 
ATOM   474   C  "C2'" . G   A  1  31   ? 42.176  135.606 47.593  1.00 26.64  ? 32   G   0 "C2'" 1 
ATOM   475   O  "O2'" . G   A  1  31   ? 43.045  136.070 48.607  1.00 28.05  ? 32   G   0 "O2'" 1 
ATOM   476   C  "C1'" . G   A  1  31   ? 40.740  135.921 48.017  1.00 26.85  ? 32   G   0 "C1'" 1 
ATOM   477   N  N9    . G   A  1  31   ? 39.767  134.965 47.495  1.00 30.22  ? 32   G   0 N9    1 
ATOM   478   C  C8    . G   A  1  31   ? 39.037  135.070 46.337  1.00 28.55  ? 32   G   0 C8    1 
ATOM   479   N  N7    . G   A  1  31   ? 38.241  134.057 46.141  1.00 31.28  ? 32   G   0 N7    1 
ATOM   480   C  C5    . G   A  1  31   ? 38.457  133.230 47.234  1.00 30.38  ? 32   G   0 C5    1 
ATOM   481   C  C6    . G   A  1  31   ? 37.877  131.975 47.574  1.00 29.83  ? 32   G   0 C6    1 
ATOM   482   O  O6    . G   A  1  31   ? 37.018  131.327 46.958  1.00 27.33  ? 32   G   0 O6    1 
ATOM   483   N  N1    . G   A  1  31   ? 38.396  131.480 48.768  1.00 29.14  ? 32   G   0 N1    1 
ATOM   484   C  C2    . G   A  1  31   ? 39.345  132.109 49.534  1.00 28.70  ? 32   G   0 C2    1 
ATOM   485   N  N2    . G   A  1  31   ? 39.728  131.481 50.644  1.00 28.84  ? 32   G   0 N2    1 
ATOM   486   N  N3    . G   A  1  31   ? 39.883  133.273 49.231  1.00 29.51  ? 32   G   0 N3    1 
ATOM   487   C  C4    . G   A  1  31   ? 39.399  133.773 48.077  1.00 30.23  ? 32   G   0 C4    1 
ATOM   488   P  P     . G   A  1  32   ? 44.585  135.583 45.359  1.00 26.91  ? 33   G   0 P     1 
ATOM   489   O  OP1   . G   A  1  32   ? 45.898  136.194 45.089  1.00 26.40  ? 33   G   0 OP1   1 
ATOM   490   O  OP2   . G   A  1  32   ? 43.868  134.887 44.268  1.00 28.22  ? 33   G   0 OP2   1 
ATOM   491   O  "O5'" . G   A  1  32   ? 44.751  134.586 46.593  1.00 28.75  ? 33   G   0 "O5'" 1 
ATOM   492   C  "C5'" . G   A  1  32   ? 44.995  133.185 46.392  1.00 27.41  ? 33   G   0 "C5'" 1 
ATOM   493   C  "C4'" . G   A  1  32   ? 44.663  132.415 47.648  1.00 29.06  ? 33   G   0 "C4'" 1 
ATOM   494   O  "O4'" . G   A  1  32   ? 43.245  132.535 47.953  1.00 29.67  ? 33   G   0 "O4'" 1 
ATOM   495   C  "C3'" . G   A  1  32   ? 44.913  130.922 47.542  1.00 26.13  ? 33   G   0 "C3'" 1 
ATOM   496   O  "O3'" . G   A  1  32   ? 46.280  130.646 47.836  1.00 26.40  ? 33   G   0 "O3'" 1 
ATOM   497   C  "C2'" . G   A  1  32   ? 43.958  130.356 48.585  1.00 27.34  ? 33   G   0 "C2'" 1 
ATOM   498   O  "O2'" . G   A  1  32   ? 44.451  130.488 49.900  1.00 28.30  ? 33   G   0 "O2'" 1 
ATOM   499   C  "C1'" . G   A  1  32   ? 42.753  131.290 48.436  1.00 30.31  ? 33   G   0 "C1'" 1 
ATOM   500   N  N9    . G   A  1  32   ? 41.737  130.805 47.499  1.00 33.24  ? 33   G   0 N9    1 
ATOM   501   C  C8    . G   A  1  32   ? 41.309  131.444 46.361  1.00 34.64  ? 33   G   0 C8    1 
ATOM   502   N  N7    . G   A  1  32   ? 40.400  130.778 45.709  1.00 35.18  ? 33   G   0 N7    1 
ATOM   503   C  C5    . G   A  1  32   ? 40.209  129.629 46.457  1.00 33.80  ? 33   G   0 C5    1 
ATOM   504   C  C6    . G   A  1  32   ? 39.346  128.530 46.232  1.00 34.57  ? 33   G   0 C6    1 
ATOM   505   O  O6    . G   A  1  32   ? 38.555  128.354 45.304  1.00 32.60  ? 33   G   0 O6    1 
ATOM   506   N  N1    . G   A  1  32   ? 39.470  127.571 47.232  1.00 35.03  ? 33   G   0 N1    1 
ATOM   507   C  C2    . G   A  1  32   ? 40.318  127.658 48.307  1.00 33.91  ? 33   G   0 C2    1 
ATOM   508   N  N2    . G   A  1  32   ? 40.298  126.624 49.159  1.00 32.25  ? 33   G   0 N2    1 
ATOM   509   N  N3    . G   A  1  32   ? 41.127  128.684 48.528  1.00 33.02  ? 33   G   0 N3    1 
ATOM   510   C  C4    . G   A  1  32   ? 41.022  129.626 47.568  1.00 33.01  ? 33   G   0 C4    1 
ATOM   511   P  P     . C   A  1  33   ? 47.128  129.676 46.875  1.00 24.99  ? 34   C   0 P     1 
ATOM   512   O  OP1   . C   A  1  33   ? 48.514  129.638 47.365  1.00 25.61  ? 34   C   0 OP1   1 
ATOM   513   O  OP2   . C   A  1  33   ? 46.858  130.062 45.467  1.00 30.11  ? 34   C   0 OP2   1 
ATOM   514   O  "O5'" . C   A  1  33   ? 46.485  128.241 47.107  1.00 26.46  ? 34   C   0 "O5'" 1 
ATOM   515   C  "C5'" . C   A  1  33   ? 46.514  127.616 48.400  1.00 24.48  ? 34   C   0 "C5'" 1 
ATOM   516   C  "C4'" . C   A  1  33   ? 45.624  126.392 48.403  1.00 26.79  ? 34   C   0 "C4'" 1 
ATOM   517   O  "O4'" . C   A  1  33   ? 44.221  126.778 48.311  1.00 26.64  ? 34   C   0 "O4'" 1 
ATOM   518   C  "C3'" . C   A  1  33   ? 45.817  125.461 47.222  1.00 24.06  ? 34   C   0 "C3'" 1 
ATOM   519   O  "O3'" . C   A  1  33   ? 46.951  124.635 47.398  1.00 22.78  ? 34   C   0 "O3'" 1 
ATOM   520   C  "C2'" . C   A  1  33   ? 44.498  124.707 47.201  1.00 24.03  ? 34   C   0 "C2'" 1 
ATOM   521   O  "O2'" . C   A  1  33   ? 44.390  123.756 48.238  1.00 23.11  ? 34   C   0 "O2'" 1 
ATOM   522   C  "C1'" . C   A  1  33   ? 43.519  125.834 47.519  1.00 25.13  ? 34   C   0 "C1'" 1 
ATOM   523   N  N1    . C   A  1  33   ? 43.014  126.509 46.307  1.00 28.70  ? 34   C   0 N1    1 
ATOM   524   C  C2    . C   A  1  33   ? 41.961  125.912 45.587  1.00 28.52  ? 34   C   0 C2    1 
ATOM   525   O  O2    . C   A  1  33   ? 41.516  124.818 45.961  1.00 31.51  ? 34   C   0 O2    1 
ATOM   526   N  N3    . C   A  1  33   ? 41.464  126.537 44.504  1.00 28.29  ? 34   C   0 N3    1 
ATOM   527   C  C4    . C   A  1  33   ? 41.976  127.705 44.111  1.00 31.33  ? 34   C   0 C4    1 
ATOM   528   N  N4    . C   A  1  33   ? 41.432  128.297 43.038  1.00 28.76  ? 34   C   0 N4    1 
ATOM   529   C  C5    . C   A  1  33   ? 43.065  128.324 44.802  1.00 30.56  ? 34   C   0 C5    1 
ATOM   530   C  C6    . C   A  1  33   ? 43.546  127.697 45.885  1.00 29.56  ? 34   C   0 C6    1 
ATOM   531   P  P     . U   A  1  34   ? 47.818  124.217 46.121  1.00 23.82  ? 35   U   0 P     1 
ATOM   532   O  OP1   . U   A  1  34   ? 49.034  123.498 46.579  1.00 21.47  ? 35   U   0 OP1   1 
ATOM   533   O  OP2   . U   A  1  34   ? 47.956  125.400 45.254  1.00 24.32  ? 35   U   0 OP2   1 
ATOM   534   O  "O5'" . U   A  1  34   ? 46.883  123.192 45.347  1.00 26.86  ? 35   U   0 "O5'" 1 
ATOM   535   C  "C5'" . U   A  1  34   ? 46.554  121.913 45.916  1.00 25.95  ? 35   U   0 "C5'" 1 
ATOM   536   C  "C4'" . U   A  1  34   ? 45.449  121.261 45.126  1.00 25.92  ? 35   U   0 "C4'" 1 
ATOM   537   O  "O4'" . U   A  1  34   ? 44.269  122.110 45.162  1.00 26.04  ? 35   U   0 "O4'" 1 
ATOM   538   C  "C3'" . U   A  1  34   ? 45.682  121.062 43.637  1.00 25.84  ? 35   U   0 "C3'" 1 
ATOM   539   O  "O3'" . U   A  1  34   ? 46.497  119.932 43.365  1.00 26.42  ? 35   U   0 "O3'" 1 
ATOM   540   C  "C2'" . U   A  1  34   ? 44.256  120.882 43.134  1.00 27.12  ? 35   U   0 "C2'" 1 
ATOM   541   O  "O2'" . U   A  1  34   ? 43.727  119.609 43.461  1.00 26.38  ? 35   U   0 "O2'" 1 
ATOM   542   C  "C1'" . U   A  1  34   ? 43.522  121.929 43.970  1.00 26.59  ? 35   U   0 "C1'" 1 
ATOM   543   N  N1    . U   A  1  34   ? 43.424  123.217 43.269  1.00 27.71  ? 35   U   0 N1    1 
ATOM   544   C  C2    . U   A  1  34   ? 42.386  123.371 42.365  1.00 27.92  ? 35   U   0 C2    1 
ATOM   545   O  O2    . U   A  1  34   ? 41.568  122.503 42.151  1.00 29.93  ? 35   U   0 O2    1 
ATOM   546   N  N3    . U   A  1  34   ? 42.350  124.577 41.720  1.00 27.85  ? 35   U   0 N3    1 
ATOM   547   C  C4    . U   A  1  34   ? 43.230  125.628 41.876  1.00 30.57  ? 35   U   0 C4    1 
ATOM   548   O  O4    . U   A  1  34   ? 43.064  126.659 41.220  1.00 29.31  ? 35   U   0 O4    1 
ATOM   549   C  C5    . U   A  1  34   ? 44.277  125.397 42.836  1.00 29.08  ? 35   U   0 C5    1 
ATOM   550   C  C6    . U   A  1  34   ? 44.332  124.233 43.483  1.00 27.75  ? 35   U   0 C6    1 
ATOM   551   P  P     . C   A  1  35   ? 47.184  119.772 41.916  1.00 26.02  ? 36   C   0 P     1 
ATOM   552   O  OP1   . C   A  1  35   ? 48.118  118.614 41.985  1.00 24.82  ? 36   C   0 OP1   1 
ATOM   553   O  OP2   . C   A  1  35   ? 47.680  121.084 41.466  1.00 26.27  ? 36   C   0 OP2   1 
ATOM   554   O  "O5'" . C   A  1  35   ? 45.976  119.397 40.953  1.00 27.76  ? 36   C   0 "O5'" 1 
ATOM   555   C  "C5'" . C   A  1  35   ? 45.295  118.146 41.073  1.00 25.78  ? 36   C   0 "C5'" 1 
ATOM   556   C  "C4'" . C   A  1  35   ? 44.133  118.107 40.123  1.00 26.82  ? 36   C   0 "C4'" 1 
ATOM   557   O  "O4'" . C   A  1  35   ? 43.256  119.230 40.405  1.00 25.82  ? 36   C   0 "O4'" 1 
ATOM   558   C  "C3'" . C   A  1  35   ? 44.472  118.309 38.658  1.00 27.50  ? 36   C   0 "C3'" 1 
ATOM   559   O  "O3'" . C   A  1  35   ? 44.955  117.140 38.026  1.00 29.96  ? 36   C   0 "O3'" 1 
ATOM   560   C  "C2'" . C   A  1  35   ? 43.134  118.740 38.093  1.00 28.21  ? 36   C   0 "C2'" 1 
ATOM   561   O  "O2'" . C   A  1  35   ? 42.225  117.664 37.992  1.00 26.97  ? 36   C   0 "O2'" 1 
ATOM   562   C  "C1'" . C   A  1  35   ? 42.655  119.675 39.197  1.00 27.69  ? 36   C   0 "C1'" 1 
ATOM   563   N  N1    . C   A  1  35   ? 43.045  121.074 38.939  1.00 27.71  ? 36   C   0 N1    1 
ATOM   564   C  C2    . C   A  1  35   ? 42.260  121.835 38.064  1.00 28.06  ? 36   C   0 C2    1 
ATOM   565   O  O2    . C   A  1  35   ? 41.304  121.292 37.483  1.00 24.50  ? 36   C   0 O2    1 
ATOM   566   N  N3    . C   A  1  35   ? 42.567  123.140 37.863  1.00 29.20  ? 36   C   0 N3    1 
ATOM   567   C  C4    . C   A  1  35   ? 43.619  123.683 38.482  1.00 30.96  ? 36   C   0 C4    1 
ATOM   568   N  N4    . C   A  1  35   ? 43.863  124.987 38.276  1.00 30.79  ? 36   C   0 N4    1 
ATOM   569   C  C5    . C   A  1  35   ? 44.462  122.920 39.345  1.00 28.05  ? 36   C   0 C5    1 
ATOM   570   C  C6    . C   A  1  35   ? 44.141  121.633 39.543  1.00 30.18  ? 36   C   0 C6    1 
ATOM   571   P  P     . A   A  1  36   ? 45.959  117.280 36.782  1.00 31.53  ? 37   A   0 P     1 
ATOM   572   O  OP1   . A   A  1  36   ? 46.393  115.908 36.438  1.00 33.00  ? 37   A   0 OP1   1 
ATOM   573   O  OP2   . A   A  1  36   ? 46.969  118.309 37.084  1.00 31.11  ? 37   A   0 OP2   1 
ATOM   574   O  "O5'" . A   A  1  36   ? 45.049  117.870 35.614  1.00 34.67  ? 37   A   0 "O5'" 1 
ATOM   575   C  "C5'" . A   A  1  36   ? 43.939  117.123 35.113  1.00 34.88  ? 37   A   0 "C5'" 1 
ATOM   576   C  "C4'" . A   A  1  36   ? 43.191  117.919 34.077  1.00 34.30  ? 37   A   0 "C4'" 1 
ATOM   577   O  "O4'" . A   A  1  36   ? 42.630  119.107 34.687  1.00 34.23  ? 37   A   0 "O4'" 1 
ATOM   578   C  "C3'" . A   A  1  36   ? 43.996  118.463 32.910  1.00 34.79  ? 37   A   0 "C3'" 1 
ATOM   579   O  "O3'" . A   A  1  36   ? 44.251  117.466 31.930  1.00 33.30  ? 37   A   0 "O3'" 1 
ATOM   580   C  "C2'" . A   A  1  36   ? 43.077  119.564 32.396  1.00 35.97  ? 37   A   0 "C2'" 1 
ATOM   581   O  "O2'" . A   A  1  36   ? 41.984  119.066 31.653  1.00 36.41  ? 37   A   0 "O2'" 1 
ATOM   582   C  "C1'" . A   A  1  36   ? 42.542  120.137 33.711  1.00 36.36  ? 37   A   0 "C1'" 1 
ATOM   583   N  N9    . A   A  1  36   ? 43.319  121.284 34.178  1.00 37.11  ? 37   A   0 N9    1 
ATOM   584   C  C8    . A   A  1  36   ? 44.297  121.308 35.141  1.00 36.87  ? 37   A   0 C8    1 
ATOM   585   N  N7    . A   A  1  36   ? 44.807  122.495 35.347  1.00 36.14  ? 37   A   0 N7    1 
ATOM   586   C  C5    . A   A  1  36   ? 44.123  123.310 34.458  1.00 36.98  ? 37   A   0 C5    1 
ATOM   587   C  C6    . A   A  1  36   ? 44.199  124.687 34.189  1.00 36.40  ? 37   A   0 C6    1 
ATOM   588   N  N6    . A   A  1  36   ? 45.035  125.518 34.816  1.00 35.48  ? 37   A   0 N6    1 
ATOM   589   N  N1    . A   A  1  36   ? 43.378  125.188 33.240  1.00 35.87  ? 37   A   0 N1    1 
ATOM   590   C  C2    . A   A  1  36   ? 42.543  124.354 32.611  1.00 36.25  ? 37   A   0 C2    1 
ATOM   591   N  N3    . A   A  1  36   ? 42.376  123.043 32.779  1.00 37.62  ? 37   A   0 N3    1 
ATOM   592   C  C4    . A   A  1  36   ? 43.206  122.577 33.729  1.00 37.05  ? 37   A   0 C4    1 
ATOM   593   P  P     . G   A  1  37   ? 45.490  117.642 30.922  1.00 34.41  ? 38   G   0 P     1 
ATOM   594   O  OP1   . G   A  1  37   ? 45.677  116.350 30.218  1.00 33.09  ? 38   G   0 OP1   1 
ATOM   595   O  OP2   . G   A  1  37   ? 46.637  118.225 31.668  1.00 36.19  ? 38   G   0 OP2   1 
ATOM   596   O  "O5'" . G   A  1  37   ? 44.970  118.736 29.882  1.00 34.75  ? 38   G   0 "O5'" 1 
ATOM   597   C  "C5'" . G   A  1  37   ? 43.975  118.404 28.891  1.00 35.99  ? 38   G   0 "C5'" 1 
ATOM   598   C  "C4'" . G   A  1  37   ? 43.559  119.634 28.111  1.00 36.84  ? 38   G   0 "C4'" 1 
ATOM   599   O  "O4'" . G   A  1  37   ? 42.980  120.610 29.021  1.00 37.87  ? 38   G   0 "O4'" 1 
ATOM   600   C  "C3'" . G   A  1  37   ? 44.656  120.424 27.416  1.00 37.83  ? 38   G   0 "C3'" 1 
ATOM   601   O  "O3'" . G   A  1  37   ? 45.084  119.866 26.187  1.00 37.48  ? 38   G   0 "O3'" 1 
ATOM   602   C  "C2'" . G   A  1  37   ? 43.982  121.769 27.220  1.00 37.99  ? 38   G   0 "C2'" 1 
ATOM   603   O  "O2'" . G   A  1  37   ? 43.027  121.749 26.178  1.00 40.28  ? 38   G   0 "O2'" 1 
ATOM   604   C  "C1'" . G   A  1  37   ? 43.272  121.923 28.563  1.00 36.73  ? 38   G   0 "C1'" 1 
ATOM   605   N  N9    . G   A  1  37   ? 44.152  122.563 29.536  1.00 36.49  ? 38   G   0 N9    1 
ATOM   606   C  C8    . G   A  1  37   ? 44.857  121.959 30.549  1.00 35.52  ? 38   G   0 C8    1 
ATOM   607   N  N7    . G   A  1  37   ? 45.577  122.799 31.242  1.00 35.50  ? 38   G   0 N7    1 
ATOM   608   C  C5    . G   A  1  37   ? 45.331  124.032 30.653  1.00 34.99  ? 38   G   0 C5    1 
ATOM   609   C  C6    . G   A  1  37   ? 45.836  125.320 30.969  1.00 34.46  ? 38   G   0 C6    1 
ATOM   610   O  O6    . G   A  1  37   ? 46.629  125.640 31.860  1.00 33.62  ? 38   G   0 O6    1 
ATOM   611   N  N1    . G   A  1  37   ? 45.324  126.290 30.115  1.00 35.35  ? 38   G   0 N1    1 
ATOM   612   C  C2    . G   A  1  37   ? 44.449  126.054 29.085  1.00 35.75  ? 38   G   0 C2    1 
ATOM   613   N  N2    . G   A  1  37   ? 44.077  127.113 28.364  1.00 35.73  ? 38   G   0 N2    1 
ATOM   614   N  N3    . G   A  1  37   ? 43.973  124.863 28.781  1.00 37.28  ? 38   G   0 N3    1 
ATOM   615   C  C4    . G   A  1  37   ? 44.451  123.904 29.601  1.00 36.33  ? 38   G   0 C4    1 
ATOM   616   P  P     . G   A  1  38   ? 46.578  120.156 25.671  1.00 38.52  ? 39   G   0 P     1 
ATOM   617   O  OP1   . G   A  1  38   ? 46.761  119.440 24.385  1.00 39.37  ? 39   G   0 OP1   1 
ATOM   618   O  OP2   . G   A  1  38   ? 47.512  119.890 26.792  1.00 39.91  ? 39   G   0 OP2   1 
ATOM   619   O  "O5'" . G   A  1  38   ? 46.582  121.723 25.382  1.00 37.20  ? 39   G   0 "O5'" 1 
ATOM   620   C  "C5'" . G   A  1  38   ? 45.789  122.279 24.319  1.00 37.21  ? 39   G   0 "C5'" 1 
ATOM   621   C  "C4'" . G   A  1  38   ? 45.947  123.782 24.275  1.00 38.02  ? 39   G   0 "C4'" 1 
ATOM   622   O  "O4'" . G   A  1  38   ? 45.587  124.314 25.579  1.00 37.96  ? 39   G   0 "O4'" 1 
ATOM   623   C  "C3'" . G   A  1  38   ? 47.350  124.329 24.031  1.00 37.58  ? 39   G   0 "C3'" 1 
ATOM   624   O  "O3'" . G   A  1  38   ? 47.703  124.371 22.649  1.00 35.26  ? 39   G   0 "O3'" 1 
ATOM   625   C  "C2'" . G   A  1  38   ? 47.247  125.723 24.630  1.00 37.93  ? 39   G   0 "C2'" 1 
ATOM   626   O  "O2'" . G   A  1  38   ? 46.563  126.633 23.788  1.00 39.97  ? 39   G   0 "O2'" 1 
ATOM   627   C  "C1'" . G   A  1  38   ? 46.394  125.444 25.870  1.00 37.96  ? 39   G   0 "C1'" 1 
ATOM   628   N  N9    . G   A  1  38   ? 47.208  125.136 27.042  1.00 37.10  ? 39   G   0 N9    1 
ATOM   629   C  C8    . G   A  1  38   ? 47.448  123.896 27.589  1.00 37.40  ? 39   G   0 C8    1 
ATOM   630   N  N7    . G   A  1  38   ? 48.236  123.939 28.629  1.00 35.00  ? 39   G   0 N7    1 
ATOM   631   C  C5    . G   A  1  38   ? 48.529  125.286 28.778  1.00 35.59  ? 39   G   0 C5    1 
ATOM   632   C  C6    . G   A  1  38   ? 49.337  125.946 29.734  1.00 35.88  ? 39   G   0 C6    1 
ATOM   633   O  O6    . G   A  1  38   ? 49.968  125.455 30.677  1.00 34.61  ? 39   G   0 O6    1 
ATOM   634   N  N1    . G   A  1  38   ? 49.368  127.321 29.517  1.00 35.22  ? 39   G   0 N1    1 
ATOM   635   C  C2    . G   A  1  38   ? 48.700  127.978 28.514  1.00 36.37  ? 39   G   0 C2    1 
ATOM   636   N  N2    . G   A  1  38   ? 48.855  129.308 28.470  1.00 35.36  ? 39   G   0 N2    1 
ATOM   637   N  N3    . G   A  1  38   ? 47.934  127.373 27.619  1.00 36.43  ? 39   G   0 N3    1 
ATOM   638   C  C4    . G   A  1  38   ? 47.897  126.037 27.809  1.00 36.04  ? 39   G   0 C4    1 
ATOM   639   P  P     . C   A  1  39   ? 49.255  124.244 22.205  1.00 36.55  ? 40   C   0 P     1 
ATOM   640   O  OP1   . C   A  1  39   ? 49.271  124.408 20.737  1.00 38.01  ? 40   C   0 OP1   1 
ATOM   641   O  OP2   . C   A  1  39   ? 49.845  123.019 22.807  1.00 35.39  ? 40   C   0 OP2   1 
ATOM   642   O  "O5'" . C   A  1  39   ? 49.988  125.505 22.851  1.00 35.53  ? 40   C   0 "O5'" 1 
ATOM   643   C  "C5'" . C   A  1  39   ? 49.660  126.851 22.460  1.00 36.55  ? 40   C   0 "C5'" 1 
ATOM   644   C  "C4'" . C   A  1  39   ? 50.373  127.843 23.358  1.00 37.02  ? 40   C   0 "C4'" 1 
ATOM   645   O  "O4'" . C   A  1  39   ? 49.959  127.619 24.731  1.00 38.05  ? 40   C   0 "O4'" 1 
ATOM   646   C  "C3'" . C   A  1  39   ? 51.893  127.739 23.389  1.00 35.55  ? 40   C   0 "C3'" 1 
ATOM   647   O  "O3'" . C   A  1  39   ? 52.481  128.506 22.337  1.00 33.30  ? 40   C   0 "O3'" 1 
ATOM   648   C  "C2'" . C   A  1  39   ? 52.235  128.301 24.763  1.00 36.82  ? 40   C   0 "C2'" 1 
ATOM   649   O  "O2'" . C   A  1  39   ? 52.224  129.716 24.792  1.00 37.72  ? 40   C   0 "O2'" 1 
ATOM   650   C  "C1'" . C   A  1  39   ? 51.067  127.776 25.603  1.00 37.46  ? 40   C   0 "C1'" 1 
ATOM   651   N  N1    . C   A  1  39   ? 51.329  126.476 26.250  1.00 37.93  ? 40   C   0 N1    1 
ATOM   652   C  C2    . C   A  1  39   ? 51.959  126.449 27.504  1.00 38.52  ? 40   C   0 C2    1 
ATOM   653   O  O2    . C   A  1  39   ? 52.318  127.516 28.024  1.00 39.31  ? 40   C   0 O2    1 
ATOM   654   N  N3    . C   A  1  39   ? 52.161  125.255 28.115  1.00 39.22  ? 40   C   0 N3    1 
ATOM   655   C  C4    . C   A  1  39   ? 51.759  124.123 27.521  1.00 39.65  ? 40   C   0 C4    1 
ATOM   656   N  N4    . C   A  1  39   ? 51.931  122.967 28.176  1.00 39.87  ? 40   C   0 N4    1 
ATOM   657   C  C5    . C   A  1  39   ? 51.148  124.124 26.234  1.00 38.74  ? 40   C   0 C5    1 
ATOM   658   C  C6    . C   A  1  39   ? 50.954  125.307 25.643  1.00 38.50  ? 40   C   0 C6    1 
ATOM   659   P  P     . G   A  1  40   ? 54.013  128.254 21.913  1.00 34.19  ? 41   G   0 P     1 
ATOM   660   O  OP1   . G   A  1  40   ? 54.336  129.269 20.876  1.00 36.73  ? 41   G   0 OP1   1 
ATOM   661   O  OP2   . G   A  1  40   ? 54.233  126.808 21.615  1.00 30.57  ? 41   G   0 OP2   1 
ATOM   662   O  "O5'" . G   A  1  40   ? 54.841  128.624 23.223  1.00 34.08  ? 41   G   0 "O5'" 1 
ATOM   663   C  "C5'" . G   A  1  40   ? 55.075  129.997 23.600  1.00 34.65  ? 41   G   0 "C5'" 1 
ATOM   664   C  "C4'" . G   A  1  40   ? 56.046  130.053 24.755  1.00 35.12  ? 41   G   0 "C4'" 1 
ATOM   665   O  "O4'" . G   A  1  40   ? 55.432  129.460 25.928  1.00 36.81  ? 41   G   0 "O4'" 1 
ATOM   666   C  "C3'" . G   A  1  40   ? 57.318  129.250 24.536  1.00 34.63  ? 41   G   0 "C3'" 1 
ATOM   667   O  "O3'" . G   A  1  40   ? 58.270  130.038 23.853  1.00 33.83  ? 41   G   0 "O3'" 1 
ATOM   668   C  "C2'" . G   A  1  40   ? 57.747  128.914 25.957  1.00 35.45  ? 41   G   0 "C2'" 1 
ATOM   669   O  "O2'" . G   A  1  40   ? 58.387  129.985 26.619  1.00 37.91  ? 41   G   0 "O2'" 1 
ATOM   670   C  "C1'" . G   A  1  40   ? 56.391  128.693 26.629  1.00 35.54  ? 41   G   0 "C1'" 1 
ATOM   671   N  N9    . G   A  1  40   ? 55.950  127.305 26.619  1.00 35.15  ? 41   G   0 N9    1 
ATOM   672   C  C8    . G   A  1  40   ? 55.370  126.616 25.577  1.00 34.50  ? 41   G   0 C8    1 
ATOM   673   N  N7    . G   A  1  40   ? 55.058  125.390 25.889  1.00 33.63  ? 41   G   0 N7    1 
ATOM   674   C  C5    . G   A  1  40   ? 55.464  125.258 27.211  1.00 34.38  ? 41   G   0 C5    1 
ATOM   675   C  C6    . G   A  1  40   ? 55.386  124.152 28.094  1.00 33.20  ? 41   G   0 C6    1 
ATOM   676   O  O6    . G   A  1  40   ? 54.925  123.033 27.882  1.00 31.45  ? 41   G   0 O6    1 
ATOM   677   N  N1    . G   A  1  40   ? 55.920  124.456 29.342  1.00 34.81  ? 41   G   0 N1    1 
ATOM   678   C  C2    . G   A  1  40   ? 56.451  125.670 29.701  1.00 33.90  ? 41   G   0 C2    1 
ATOM   679   N  N2    . G   A  1  40   ? 56.899  125.777 30.957  1.00 32.80  ? 41   G   0 N2    1 
ATOM   680   N  N3    . G   A  1  40   ? 56.530  126.705 28.889  1.00 33.25  ? 41   G   0 N3    1 
ATOM   681   C  C4    . G   A  1  40   ? 56.022  126.432 27.671  1.00 34.04  ? 41   G   0 C4    1 
ATOM   682   P  P     . C   A  1  41   ? 59.039  129.446 22.578  1.00 34.95  ? 42   C   0 P     1 
ATOM   683   O  OP1   . C   A  1  41   ? 58.999  130.535 21.567  1.00 34.98  ? 42   C   0 OP1   1 
ATOM   684   O  OP2   . C   A  1  41   ? 58.493  128.105 22.229  1.00 37.28  ? 42   C   0 OP2   1 
ATOM   685   O  "O5'" . C   A  1  41   ? 60.538  129.281 23.101  1.00 33.39  ? 42   C   0 "O5'" 1 
ATOM   686   C  "C5'" . C   A  1  41   ? 61.451  130.406 23.113  1.00 32.90  ? 42   C   0 "C5'" 1 
ATOM   687   C  "C4'" . C   A  1  41   ? 61.199  131.289 24.319  1.00 31.64  ? 42   C   0 "C4'" 1 
ATOM   688   O  "O4'" . C   A  1  41   ? 61.455  130.549 25.541  1.00 31.03  ? 42   C   0 "O4'" 1 
ATOM   689   C  "C3'" . C   A  1  41   ? 62.096  132.512 24.438  1.00 32.28  ? 42   C   0 "C3'" 1 
ATOM   690   O  "O3'" . C   A  1  41   ? 61.602  133.591 23.639  1.00 32.58  ? 42   C   0 "O3'" 1 
ATOM   691   C  "C2'" . C   A  1  41   ? 62.005  132.829 25.923  1.00 30.25  ? 42   C   0 "C2'" 1 
ATOM   692   O  "O2'" . C   A  1  41   ? 60.813  133.497 26.266  1.00 33.59  ? 42   C   0 "O2'" 1 
ATOM   693   C  "C1'" . C   A  1  41   ? 61.969  131.426 26.529  1.00 28.83  ? 42   C   0 "C1'" 1 
ATOM   694   N  N1    . C   A  1  41   ? 63.315  130.975 26.925  1.00 27.72  ? 42   C   0 N1    1 
ATOM   695   C  C2    . C   A  1  41   ? 63.894  131.545 28.061  1.00 26.78  ? 42   C   0 C2    1 
ATOM   696   O  O2    . C   A  1  41   ? 63.221  132.345 28.736  1.00 26.18  ? 42   C   0 O2    1 
ATOM   697   N  N3    . C   A  1  41   ? 65.162  131.209 28.401  1.00 27.21  ? 42   C   0 N3    1 
ATOM   698   C  C4    . C   A  1  41   ? 65.838  130.330 27.663  1.00 28.86  ? 42   C   0 C4    1 
ATOM   699   N  N4    . C   A  1  41   ? 67.095  130.042 28.023  1.00 27.80  ? 42   C   0 N4    1 
ATOM   700   C  C5    . C   A  1  41   ? 65.256  129.705 26.519  1.00 27.79  ? 42   C   0 C5    1 
ATOM   701   C  C6    . C   A  1  41   ? 64.004  130.049 26.193  1.00 25.42  ? 42   C   0 C6    1 
ATOM   702   P  P     . U   A  1  42   ? 62.634  134.586 22.900  1.00 34.57  ? 43   U   0 P     1 
ATOM   703   O  OP1   . U   A  1  42   ? 61.827  135.331 21.892  1.00 32.04  ? 43   U   0 OP1   1 
ATOM   704   O  OP2   . U   A  1  42   ? 63.829  133.811 22.454  1.00 30.59  ? 43   U   0 OP2   1 
ATOM   705   O  "O5'" . U   A  1  42   ? 63.089  135.594 24.054  1.00 31.65  ? 43   U   0 "O5'" 1 
ATOM   706   C  "C5'" . U   A  1  42   ? 62.134  136.456 24.696  1.00 28.56  ? 43   U   0 "C5'" 1 
ATOM   707   C  "C4'" . U   A  1  42   ? 62.774  137.210 25.838  1.00 29.98  ? 43   U   0 "C4'" 1 
ATOM   708   O  "O4'" . U   A  1  42   ? 63.087  136.313 26.938  1.00 30.86  ? 43   U   0 "O4'" 1 
ATOM   709   C  "C3'" . U   A  1  42   ? 64.110  137.869 25.552  1.00 29.91  ? 43   U   0 "C3'" 1 
ATOM   710   O  "O3'" . U   A  1  42   ? 63.974  139.076 24.837  1.00 28.58  ? 43   U   0 "O3'" 1 
ATOM   711   C  "C2'" . U   A  1  42   ? 64.639  138.111 26.955  1.00 28.95  ? 43   U   0 "C2'" 1 
ATOM   712   O  "O2'" . U   A  1  42   ? 64.023  139.215 27.583  1.00 31.85  ? 43   U   0 "O2'" 1 
ATOM   713   C  "C1'" . U   A  1  42   ? 64.213  136.817 27.649  1.00 28.76  ? 43   U   0 "C1'" 1 
ATOM   714   N  N1    . U   A  1  42   ? 65.303  135.834 27.584  1.00 26.58  ? 43   U   0 N1    1 
ATOM   715   C  C2    . U   A  1  42   ? 66.352  135.998 28.477  1.00 26.06  ? 43   U   0 C2    1 
ATOM   716   O  O2    . U   A  1  42   ? 66.390  136.915 29.288  1.00 23.29  ? 43   U   0 O2    1 
ATOM   717   N  N3    . U   A  1  42   ? 67.360  135.070 28.369  1.00 22.89  ? 43   U   0 N3    1 
ATOM   718   C  C4    . U   A  1  42   ? 67.433  134.030 27.466  1.00 23.79  ? 43   U   0 C4    1 
ATOM   719   O  O4    . U   A  1  42   ? 68.436  133.311 27.446  1.00 20.33  ? 43   U   0 O4    1 
ATOM   720   C  C5    . U   A  1  42   ? 66.312  133.933 26.577  1.00 23.59  ? 43   U   0 C5    1 
ATOM   721   C  C6    . U   A  1  42   ? 65.307  134.810 26.671  1.00 22.70  ? 43   U   0 C6    1 
ATOM   722   P  P     . G   A  1  43   ? 65.117  139.507 23.804  1.00 30.32  ? 44   G   0 P     1 
ATOM   723   O  OP1   . G   A  1  43   ? 64.593  140.756 23.178  1.00 32.96  ? 44   G   0 OP1   1 
ATOM   724   O  OP2   . G   A  1  43   ? 65.514  138.353 22.955  1.00 27.05  ? 44   G   0 OP2   1 
ATOM   725   O  "O5'" . G   A  1  43   ? 66.380  139.831 24.717  1.00 31.85  ? 44   G   0 "O5'" 1 
ATOM   726   C  "C5'" . G   A  1  43   ? 66.368  140.940 25.624  1.00 30.25  ? 44   G   0 "C5'" 1 
ATOM   727   C  "C4'" . G   A  1  43   ? 67.695  141.053 26.325  1.00 30.67  ? 44   G   0 "C4'" 1 
ATOM   728   O  "O4'" . G   A  1  43   ? 67.861  139.954 27.256  1.00 28.34  ? 44   G   0 "O4'" 1 
ATOM   729   C  "C3'" . G   A  1  43   ? 68.936  140.966 25.452  1.00 30.01  ? 44   G   0 "C3'" 1 
ATOM   730   O  "O3'" . G   A  1  43   ? 69.213  142.188 24.781  1.00 32.75  ? 44   G   0 "O3'" 1 
ATOM   731   C  "C2'" . G   A  1  43   ? 69.999  140.635 26.487  1.00 29.23  ? 44   G   0 "C2'" 1 
ATOM   732   O  "O2'" . G   A  1  43   ? 70.345  141.748 27.275  1.00 27.98  ? 44   G   0 "O2'" 1 
ATOM   733   C  "C1'" . G   A  1  43   ? 69.246  139.645 27.376  1.00 29.13  ? 44   G   0 "C1'" 1 
ATOM   734   N  N9    . G   A  1  43   ? 69.468  138.279 26.918  1.00 28.23  ? 44   G   0 N9    1 
ATOM   735   C  C8    . G   A  1  43   ? 68.616  137.511 26.162  1.00 28.31  ? 44   G   0 C8    1 
ATOM   736   N  N7    . G   A  1  43   ? 69.111  136.343 25.862  1.00 28.37  ? 44   G   0 N7    1 
ATOM   737   C  C5    . G   A  1  43   ? 70.358  136.328 26.469  1.00 26.11  ? 44   G   0 C5    1 
ATOM   738   C  C6    . G   A  1  43   ? 71.354  135.324 26.483  1.00 25.90  ? 44   G   0 C6    1 
ATOM   739   O  O6    . G   A  1  43   ? 71.324  134.208 25.967  1.00 25.53  ? 44   G   0 O6    1 
ATOM   740   N  N1    . G   A  1  43   ? 72.479  135.724 27.196  1.00 26.48  ? 44   G   0 N1    1 
ATOM   741   C  C2    . G   A  1  43   ? 72.621  136.932 27.829  1.00 28.35  ? 44   G   0 C2    1 
ATOM   742   N  N2    . G   A  1  43   ? 73.791  137.123 28.469  1.00 26.25  ? 44   G   0 N2    1 
ATOM   743   N  N3    . G   A  1  43   ? 71.687  137.881 27.833  1.00 26.89  ? 44   G   0 N3    1 
ATOM   744   C  C4    . G   A  1  43   ? 70.593  137.512 27.133  1.00 26.62  ? 44   G   0 C4    1 
ATOM   745   P  P     . A   A  1  44   ? 69.873  142.170 23.306  1.00 34.48  ? 45   A   0 P     1 
ATOM   746   O  OP1   . A   A  1  44   ? 68.786  142.558 22.378  1.00 33.97  ? 45   A   0 OP1   1 
ATOM   747   O  OP2   . A   A  1  44   ? 70.628  140.918 23.063  1.00 30.63  ? 45   A   0 OP2   1 
ATOM   748   O  "O5'" . A   A  1  44   ? 70.949  143.346 23.366  1.00 34.34  ? 45   A   0 "O5'" 1 
ATOM   749   C  "C5'" . A   A  1  44   ? 71.921  143.397 24.420  1.00 34.81  ? 45   A   0 "C5'" 1 
ATOM   750   C  "C4'" . A   A  1  44   ? 73.055  144.319 24.042  1.00 36.87  ? 45   A   0 "C4'" 1 
ATOM   751   O  "O4'" . A   A  1  44   ? 73.973  144.420 25.163  1.00 34.81  ? 45   A   0 "O4'" 1 
ATOM   752   C  "C3'" . A   A  1  44   ? 73.905  143.875 22.856  1.00 37.07  ? 45   A   0 "C3'" 1 
ATOM   753   O  "O3'" . A   A  1  44   ? 74.467  145.040 22.266  1.00 41.42  ? 45   A   0 "O3'" 1 
ATOM   754   C  "C2'" . A   A  1  44   ? 75.022  143.088 23.528  1.00 35.94  ? 45   A   0 "C2'" 1 
ATOM   755   O  "O2'" . A   A  1  44   ? 76.208  143.036 22.761  1.00 36.66  ? 45   A   0 "O2'" 1 
ATOM   756   C  "C1'" . A   A  1  44   ? 75.244  143.920 24.788  1.00 35.27  ? 45   A   0 "C1'" 1 
ATOM   757   N  N9    . A   A  1  44   ? 75.788  143.175 25.924  1.00 35.31  ? 45   A   0 N9    1 
ATOM   758   C  C8    . A   A  1  44   ? 76.911  143.476 26.647  1.00 33.57  ? 45   A   0 C8    1 
ATOM   759   N  N7    . A   A  1  44   ? 77.129  142.660 27.647  1.00 34.38  ? 45   A   0 N7    1 
ATOM   760   C  C5    . A   A  1  44   ? 76.082  141.754 27.575  1.00 35.84  ? 45   A   0 C5    1 
ATOM   761   C  C6    . A   A  1  44   ? 75.730  140.642 28.372  1.00 35.47  ? 45   A   0 C6    1 
ATOM   762   N  N6    . A   A  1  44   ? 76.407  140.255 29.459  1.00 30.59  ? 45   A   0 N6    1 
ATOM   763   N  N1    . A   A  1  44   ? 74.635  139.941 28.013  1.00 35.63  ? 45   A   0 N1    1 
ATOM   764   C  C2    . A   A  1  44   ? 73.937  140.343 26.942  1.00 35.48  ? 45   A   0 C2    1 
ATOM   765   N  N3    . A   A  1  44   ? 74.156  141.375 26.130  1.00 34.71  ? 45   A   0 N3    1 
ATOM   766   C  C4    . A   A  1  44   ? 75.258  142.046 26.506  1.00 35.21  ? 45   A   0 C4    1 
ATOM   767   P  P     . U   A  1  45   ? 74.287  145.316 20.698  1.00 40.50  ? 46   U   0 P     1 
ATOM   768   O  OP1   . U   A  1  45   ? 74.399  144.032 19.965  1.00 40.83  ? 46   U   0 OP1   1 
ATOM   769   O  OP2   . U   A  1  45   ? 75.221  146.421 20.393  1.00 42.17  ? 46   U   0 OP2   1 
ATOM   770   O  "O5'" . U   A  1  45   ? 72.799  145.863 20.577  1.00 40.69  ? 46   U   0 "O5'" 1 
ATOM   771   C  "C5'" . U   A  1  45   ? 72.457  147.160 21.099  1.00 41.01  ? 46   U   0 "C5'" 1 
ATOM   772   C  "C4'" . U   A  1  45   ? 70.967  147.388 21.010  1.00 43.36  ? 46   U   0 "C4'" 1 
ATOM   773   O  "O4'" . U   A  1  45   ? 70.561  147.326 19.612  1.00 46.23  ? 46   U   0 "O4'" 1 
ATOM   774   C  "C3'" . U   A  1  45   ? 70.078  146.391 21.751  1.00 42.65  ? 46   U   0 "C3'" 1 
ATOM   775   O  "O3'" . U   A  1  45   ? 68.921  147.068 22.225  1.00 39.97  ? 46   U   0 "O3'" 1 
ATOM   776   C  "C2'" . U   A  1  45   ? 69.669  145.427 20.642  1.00 45.34  ? 46   U   0 "C2'" 1 
ATOM   777   O  "O2'" . U   A  1  45   ? 68.438  144.774 20.875  1.00 47.13  ? 46   U   0 "O2'" 1 
ATOM   778   C  "C1'" . U   A  1  45   ? 69.527  146.381 19.460  1.00 46.98  ? 46   U   0 "C1'" 1 
ATOM   779   N  N1    . U   A  1  45   ? 69.666  145.732 18.149  1.00 50.21  ? 46   U   0 N1    1 
ATOM   780   C  C2    . U   A  1  45   ? 68.528  145.627 17.364  1.00 52.45  ? 46   U   0 C2    1 
ATOM   781   O  O2    . U   A  1  45   ? 67.439  146.070 17.702  1.00 53.14  ? 46   U   0 O2    1 
ATOM   782   N  N3    . U   A  1  45   ? 68.713  144.987 16.164  1.00 55.07  ? 46   U   0 N3    1 
ATOM   783   C  C4    . U   A  1  45   ? 69.892  144.458 15.676  1.00 56.52  ? 46   U   0 C4    1 
ATOM   784   O  O4    . U   A  1  45   ? 69.895  143.903 14.575  1.00 58.91  ? 46   U   0 O4    1 
ATOM   785   C  C5    . U   A  1  45   ? 71.025  144.619 16.541  1.00 54.75  ? 46   U   0 C5    1 
ATOM   786   C  C6    . U   A  1  45   ? 70.876  145.236 17.717  1.00 51.94  ? 46   U   0 C6    1 
ATOM   787   P  P     . G   A  1  46   ? 68.966  147.830 23.636  1.00 37.92  ? 47   G   0 P     1 
ATOM   788   O  OP1   . G   A  1  46   ? 67.574  147.898 24.160  1.00 36.95  ? 47   G   0 OP1   1 
ATOM   789   O  OP2   . G   A  1  46   ? 69.751  149.079 23.470  1.00 38.66  ? 47   G   0 OP2   1 
ATOM   790   O  "O5'" . G   A  1  46   ? 69.849  146.873 24.549  1.00 36.60  ? 47   G   0 "O5'" 1 
ATOM   791   C  "C5'" . G   A  1  46   ? 69.312  145.671 25.111  1.00 33.61  ? 47   G   0 "C5'" 1 
ATOM   792   C  "C4'" . G   A  1  46   ? 69.674  145.594 26.568  1.00 33.34  ? 47   G   0 "C4'" 1 
ATOM   793   O  "O4'" . G   A  1  46   ? 71.123  145.487 26.665  1.00 31.69  ? 47   G   0 "O4'" 1 
ATOM   794   C  "C3'" . G   A  1  46   ? 69.270  146.815 27.395  1.00 32.12  ? 47   G   0 "C3'" 1 
ATOM   795   O  "O3'" . G   A  1  46   ? 68.875  146.444 28.704  1.00 32.34  ? 47   G   0 "O3'" 1 
ATOM   796   C  "C2'" . G   A  1  46   ? 70.551  147.644 27.438  1.00 32.60  ? 47   G   0 "C2'" 1 
ATOM   797   O  "O2'" . G   A  1  46   ? 70.678  148.447 28.593  1.00 33.15  ? 47   G   0 "O2'" 1 
ATOM   798   C  "C1'" . G   A  1  46   ? 71.638  146.571 27.416  1.00 31.34  ? 47   G   0 "C1'" 1 
ATOM   799   N  N9    . G   A  1  46   ? 72.844  147.048 26.744  1.00 31.22  ? 47   G   0 N9    1 
ATOM   800   C  C8    . G   A  1  46   ? 72.900  147.763 25.567  1.00 30.48  ? 47   G   0 C8    1 
ATOM   801   N  N7    . G   A  1  46   ? 74.116  148.062 25.206  1.00 32.37  ? 47   G   0 N7    1 
ATOM   802   C  C5    . G   A  1  46   ? 74.919  147.515 26.198  1.00 30.89  ? 47   G   0 C5    1 
ATOM   803   C  C6    . G   A  1  46   ? 76.335  147.529 26.350  1.00 31.76  ? 47   G   0 C6    1 
ATOM   804   O  O6    . G   A  1  46   ? 77.182  148.051 25.623  1.00 32.49  ? 47   G   0 O6    1 
ATOM   805   N  N1    . G   A  1  46   ? 76.735  146.851 27.499  1.00 32.37  ? 47   G   0 N1    1 
ATOM   806   C  C2    . G   A  1  46   ? 75.883  146.247 28.395  1.00 30.83  ? 47   G   0 C2    1 
ATOM   807   N  N2    . G   A  1  46   ? 76.462  145.646 29.447  1.00 29.74  ? 47   G   0 N2    1 
ATOM   808   N  N3    . G   A  1  46   ? 74.562  146.234 28.269  1.00 30.50  ? 47   G   0 N3    1 
ATOM   809   C  C4    . G   A  1  46   ? 74.151  146.881 27.155  1.00 31.14  ? 47   G   0 C4    1 
ATOM   810   P  P     . A   A  1  47   ? 67.520  147.047 29.329  1.00 32.31  ? 48   A   0 P     1 
ATOM   811   O  OP1   . A   A  1  47   ? 66.871  147.939 28.342  1.00 35.24  ? 48   A   0 OP1   1 
ATOM   812   O  OP2   . A   A  1  47   ? 67.852  147.575 30.666  1.00 32.17  ? 48   A   0 OP2   1 
ATOM   813   O  "O5'" . A   A  1  47   ? 66.591  145.764 29.487  1.00 32.68  ? 48   A   0 "O5'" 1 
ATOM   814   C  "C5'" . A   A  1  47   ? 66.077  145.067 28.330  1.00 31.88  ? 48   A   0 "C5'" 1 
ATOM   815   C  "C4'" . A   A  1  47   ? 65.872  143.599 28.647  1.00 32.05  ? 48   A   0 "C4'" 1 
ATOM   816   O  "O4'" . A   A  1  47   ? 67.151  142.928 28.709  1.00 33.60  ? 48   A   0 "O4'" 1 
ATOM   817   C  "C3'" . A   A  1  47   ? 65.215  143.326 29.993  1.00 32.98  ? 48   A   0 "C3'" 1 
ATOM   818   O  "O3'" . A   A  1  47   ? 63.797  143.386 29.880  1.00 31.20  ? 48   A   0 "O3'" 1 
ATOM   819   C  "C2'" . A   A  1  47   ? 65.737  141.939 30.353  1.00 33.21  ? 48   A   0 "C2'" 1 
ATOM   820   O  "O2'" . A   A  1  47   ? 65.048  140.889 29.715  1.00 35.03  ? 48   A   0 "O2'" 1 
ATOM   821   C  "C1'" . A   A  1  47   ? 67.145  141.982 29.763  1.00 32.86  ? 48   A   0 "C1'" 1 
ATOM   822   N  N9    . A   A  1  47   ? 68.194  142.352 30.710  1.00 33.22  ? 48   A   0 N9    1 
ATOM   823   C  C8    . A   A  1  47   ? 68.880  143.540 30.782  1.00 32.22  ? 48   A   0 C8    1 
ATOM   824   N  N7    . A   A  1  47   ? 69.824  143.550 31.688  1.00 31.63  ? 48   A   0 N7    1 
ATOM   825   C  C5    . A   A  1  47   ? 69.749  142.292 32.264  1.00 31.40  ? 48   A   0 C5    1 
ATOM   826   C  C6    . A   A  1  47   ? 70.497  141.670 33.273  1.00 30.43  ? 48   A   0 C6    1 
ATOM   827   N  N6    . A   A  1  47   ? 71.546  142.240 33.882  1.00 29.05  ? 48   A   0 N6    1 
ATOM   828   N  N1    . A   A  1  47   ? 70.143  140.418 33.630  1.00 29.26  ? 48   A   0 N1    1 
ATOM   829   C  C2    . A   A  1  47   ? 69.124  139.832 32.995  1.00 31.70  ? 48   A   0 C2    1 
ATOM   830   N  N3    . A   A  1  47   ? 68.359  140.302 32.016  1.00 31.64  ? 48   A   0 N3    1 
ATOM   831   C  C4    . A   A  1  47   ? 68.728  141.552 31.691  1.00 33.39  ? 48   A   0 C4    1 
ATOM   832   P  P     . A   A  1  48   ? 62.934  144.097 31.027  1.00 33.69  ? 49   A   0 P     1 
ATOM   833   O  OP1   . A   A  1  48   ? 61.518  144.139 30.565  1.00 32.53  ? 49   A   0 OP1   1 
ATOM   834   O  OP2   . A   A  1  48   ? 63.624  145.358 31.401  1.00 34.64  ? 49   A   0 OP2   1 
ATOM   835   O  "O5'" . A   A  1  48   ? 63.050  143.098 32.267  1.00 35.62  ? 49   A   0 "O5'" 1 
ATOM   836   C  "C5'" . A   A  1  48   ? 62.512  141.766 32.203  1.00 30.28  ? 49   A   0 "C5'" 1 
ATOM   837   C  "C4'" . A   A  1  48   ? 63.003  140.937 33.372  1.00 29.62  ? 49   A   0 "C4'" 1 
ATOM   838   O  "O4'" . A   A  1  48   ? 64.422  140.672 33.233  1.00 30.81  ? 49   A   0 "O4'" 1 
ATOM   839   C  "C3'" . A   A  1  48   ? 62.887  141.569 34.748  1.00 29.76  ? 49   A   0 "C3'" 1 
ATOM   840   O  "O3'" . A   A  1  48   ? 61.581  141.460 35.289  1.00 29.48  ? 49   A   0 "O3'" 1 
ATOM   841   C  "C2'" . A   A  1  48   ? 63.903  140.773 35.551  1.00 30.53  ? 49   A   0 "C2'" 1 
ATOM   842   O  "O2'" . A   A  1  48   ? 63.419  139.517 35.968  1.00 32.42  ? 49   A   0 "O2'" 1 
ATOM   843   C  "C1'" . A   A  1  48   ? 65.020  140.586 34.519  1.00 31.66  ? 49   A   0 "C1'" 1 
ATOM   844   N  N9    . A   A  1  48   ? 66.016  141.652 34.642  1.00 32.74  ? 49   A   0 N9    1 
ATOM   845   C  C8    . A   A  1  48   ? 66.032  142.874 34.010  1.00 33.79  ? 49   A   0 C8    1 
ATOM   846   N  N7    . A   A  1  48   ? 67.013  143.654 34.393  1.00 33.05  ? 49   A   0 N7    1 
ATOM   847   C  C5    . A   A  1  48   ? 67.698  142.894 35.328  1.00 33.28  ? 49   A   0 C5    1 
ATOM   848   C  C6    . A   A  1  48   ? 68.821  143.170 36.134  1.00 33.99  ? 49   A   0 C6    1 
ATOM   849   N  N6    . A   A  1  48   ? 69.460  144.342 36.145  1.00 33.24  ? 49   A   0 N6    1 
ATOM   850   N  N1    . A   A  1  48   ? 69.259  142.189 36.950  1.00 33.60  ? 49   A   0 N1    1 
ATOM   851   C  C2    . A   A  1  48   ? 68.596  141.027 36.967  1.00 33.62  ? 49   A   0 C2    1 
ATOM   852   N  N3    . A   A  1  48   ? 67.518  140.658 36.280  1.00 32.89  ? 49   A   0 N3    1 
ATOM   853   C  C4    . A   A  1  48   ? 67.113  141.648 35.470  1.00 32.62  ? 49   A   0 C4    1 
ATOM   854   P  P     . G   A  1  49   ? 60.968  142.678 36.142  1.00 27.23  ? 50   G   0 P     1 
ATOM   855   O  OP1   . G   A  1  49   ? 59.708  142.193 36.759  1.00 29.42  ? 50   G   0 OP1   1 
ATOM   856   O  OP2   . G   A  1  49   ? 60.948  143.881 35.287  1.00 29.37  ? 50   G   0 OP2   1 
ATOM   857   O  "O5'" . G   A  1  49   ? 62.037  142.934 37.286  1.00 28.68  ? 50   G   0 "O5'" 1 
ATOM   858   C  "C5'" . G   A  1  49   ? 62.211  142.007 38.356  1.00 27.46  ? 50   G   0 "C5'" 1 
ATOM   859   C  "C4'" . G   A  1  49   ? 63.340  142.456 39.239  1.00 30.06  ? 50   G   0 "C4'" 1 
ATOM   860   O  "O4'" . G   A  1  49   ? 64.576  142.505 38.467  1.00 31.39  ? 50   G   0 "O4'" 1 
ATOM   861   C  "C3'" . G   A  1  49   ? 63.232  143.863 39.799  1.00 30.91  ? 50   G   0 "C3'" 1 
ATOM   862   O  "O3'" . G   A  1  49   ? 62.361  143.952 40.918  1.00 30.27  ? 50   G   0 "O3'" 1 
ATOM   863   C  "C2'" . G   A  1  49   ? 64.679  144.131 40.172  1.00 31.07  ? 50   G   0 "C2'" 1 
ATOM   864   O  "O2'" . G   A  1  49   ? 65.042  143.398 41.324  1.00 29.84  ? 50   G   0 "O2'" 1 
ATOM   865   C  "C1'" . G   A  1  49   ? 65.399  143.555 38.949  1.00 32.26  ? 50   G   0 "C1'" 1 
ATOM   866   N  N9    . G   A  1  49   ? 65.533  144.562 37.893  1.00 35.20  ? 50   G   0 N9    1 
ATOM   867   C  C8    . G   A  1  49   ? 64.803  144.651 36.733  1.00 34.60  ? 50   G   0 C8    1 
ATOM   868   N  N7    . G   A  1  49   ? 65.107  145.694 36.013  1.00 33.89  ? 50   G   0 N7    1 
ATOM   869   C  C5    . G   A  1  49   ? 66.110  146.329 36.732  1.00 36.59  ? 50   G   0 C5    1 
ATOM   870   C  C6    . G   A  1  49   ? 66.832  147.529 36.455  1.00 36.11  ? 50   G   0 C6    1 
ATOM   871   O  O6    . G   A  1  49   ? 66.721  148.295 35.489  1.00 36.96  ? 50   G   0 O6    1 
ATOM   872   N  N1    . G   A  1  49   ? 67.761  147.805 37.448  1.00 35.13  ? 50   G   0 N1    1 
ATOM   873   C  C2    . G   A  1  49   ? 67.976  147.037 38.560  1.00 36.48  ? 50   G   0 C2    1 
ATOM   874   N  N2    . G   A  1  49   ? 68.932  147.466 39.394  1.00 36.03  ? 50   G   0 N2    1 
ATOM   875   N  N3    . G   A  1  49   ? 67.309  145.929 38.835  1.00 36.41  ? 50   G   0 N3    1 
ATOM   876   C  C4    . G   A  1  49   ? 66.398  145.636 37.886  1.00 35.78  ? 50   G   0 C4    1 
ATOM   877   P  P     . G   A  1  50   ? 61.597  145.329 41.220  1.00 32.82  ? 51   G   0 P     1 
ATOM   878   O  OP1   . G   A  1  50   ? 60.668  145.085 42.363  1.00 35.57  ? 51   G   0 OP1   1 
ATOM   879   O  OP2   . G   A  1  50   ? 61.067  145.878 39.951  1.00 34.73  ? 51   G   0 OP2   1 
ATOM   880   O  "O5'" . G   A  1  50   ? 62.745  146.322 41.715  1.00 33.15  ? 51   G   0 "O5'" 1 
ATOM   881   C  "C5'" . G   A  1  50   ? 63.492  146.055 42.915  1.00 30.75  ? 51   G   0 "C5'" 1 
ATOM   882   C  "C4'" . G   A  1  50   ? 64.697  146.960 43.002  1.00 30.90  ? 51   G   0 "C4'" 1 
ATOM   883   O  "O4'" . G   A  1  50   ? 65.481  146.819 41.787  1.00 30.46  ? 51   G   0 "O4'" 1 
ATOM   884   C  "C3'" . G   A  1  50   ? 64.436  148.456 43.075  1.00 29.87  ? 51   G   0 "C3'" 1 
ATOM   885   O  "O3'" . G   A  1  50   ? 64.095  148.886 44.385  1.00 28.65  ? 51   G   0 "O3'" 1 
ATOM   886   C  "C2'" . G   A  1  50   ? 65.772  149.017 42.619  1.00 29.65  ? 51   G   0 "C2'" 1 
ATOM   887   O  "O2'" . G   A  1  50   ? 66.784  148.943 43.604  1.00 30.69  ? 51   G   0 "O2'" 1 
ATOM   888   C  "C1'" . G   A  1  50   ? 66.119  148.050 41.491  1.00 30.52  ? 51   G   0 "C1'" 1 
ATOM   889   N  N9    . G   A  1  50   ? 65.612  148.557 40.220  1.00 33.10  ? 51   G   0 N9    1 
ATOM   890   C  C8    . G   A  1  50   ? 64.597  148.050 39.442  1.00 33.51  ? 51   G   0 C8    1 
ATOM   891   N  N7    . G   A  1  50   ? 64.366  148.768 38.375  1.00 32.81  ? 51   G   0 N7    1 
ATOM   892   C  C5    . G   A  1  50   ? 65.290  149.801 38.449  1.00 31.45  ? 51   G   0 C5    1 
ATOM   893   C  C6    . G   A  1  50   ? 65.519  150.895 37.580  1.00 31.93  ? 51   G   0 C6    1 
ATOM   894   O  O6    . G   A  1  50   ? 64.948  151.172 36.524  1.00 32.15  ? 51   G   0 O6    1 
ATOM   895   N  N1    . G   A  1  50   ? 66.540  151.713 38.048  1.00 31.84  ? 51   G   0 N1    1 
ATOM   896   C  C2    . G   A  1  50   ? 67.253  151.503 39.202  1.00 30.63  ? 51   G   0 C2    1 
ATOM   897   N  N2    . G   A  1  50   ? 68.184  152.405 39.500  1.00 29.85  ? 51   G   0 N2    1 
ATOM   898   N  N3    . G   A  1  50   ? 67.060  150.482 40.008  1.00 30.96  ? 51   G   0 N3    1 
ATOM   899   C  C4    . G   A  1  50   ? 66.067  149.680 39.577  1.00 31.61  ? 51   G   0 C4    1 
ATOM   900   P  P     . A   A  1  51   ? 63.276  150.259 44.592  1.00 29.48  ? 52   A   0 P     1 
ATOM   901   O  OP1   . A   A  1  51   ? 63.041  150.362 46.052  1.00 31.53  ? 52   A   0 OP1   1 
ATOM   902   O  OP2   . A   A  1  51   ? 62.117  150.335 43.661  1.00 31.43  ? 52   A   0 OP2   1 
ATOM   903   O  "O5'" . A   A  1  51   ? 64.291  151.407 44.150  1.00 29.43  ? 52   A   0 "O5'" 1 
ATOM   904   C  "C5'" . A   A  1  51   ? 65.533  151.613 44.843  1.00 29.49  ? 52   A   0 "C5'" 1 
ATOM   905   C  "C4'" . A   A  1  51   ? 66.288  152.767 44.227  1.00 31.25  ? 52   A   0 "C4'" 1 
ATOM   906   O  "O4'" . A   A  1  51   ? 66.623  152.456 42.848  1.00 31.45  ? 52   A   0 "O4'" 1 
ATOM   907   C  "C3'" . A   A  1  51   ? 65.524  154.077 44.141  1.00 30.78  ? 52   A   0 "C3'" 1 
ATOM   908   O  "O3'" . A   A  1  51   ? 65.601  154.806 45.359  1.00 29.08  ? 52   A   0 "O3'" 1 
ATOM   909   C  "C2'" . A   A  1  51   ? 66.244  154.795 43.013  1.00 31.65  ? 52   A   0 "C2'" 1 
ATOM   910   O  "O2'" . A   A  1  51   ? 67.466  155.356 43.433  1.00 35.55  ? 52   A   0 "O2'" 1 
ATOM   911   C  "C1'" . A   A  1  51   ? 66.538  153.635 42.063  1.00 32.90  ? 52   A   0 "C1'" 1 
ATOM   912   N  N9    . A   A  1  51   ? 65.491  153.446 41.056  1.00 34.46  ? 52   A   0 N9    1 
ATOM   913   C  C8    . A   A  1  51   ? 64.498  152.500 41.032  1.00 34.39  ? 52   A   0 C8    1 
ATOM   914   N  N7    . A   A  1  51   ? 63.741  152.557 39.969  1.00 34.58  ? 52   A   0 N7    1 
ATOM   915   C  C5    . A   A  1  51   ? 64.259  153.621 39.249  1.00 35.63  ? 52   A   0 C5    1 
ATOM   916   C  C6    . A   A  1  51   ? 63.901  154.192 38.018  1.00 37.32  ? 52   A   0 C6    1 
ATOM   917   N  N6    . A   A  1  51   ? 62.897  153.749 37.259  1.00 37.30  ? 52   A   0 N6    1 
ATOM   918   N  N1    . A   A  1  51   ? 64.620  155.249 37.585  1.00 38.44  ? 52   A   0 N1    1 
ATOM   919   C  C2    . A   A  1  51   ? 65.626  155.690 38.342  1.00 36.79  ? 52   A   0 C2    1 
ATOM   920   N  N3    . A   A  1  51   ? 66.059  155.237 39.510  1.00 37.24  ? 52   A   0 N3    1 
ATOM   921   C  C4    . A   A  1  51   ? 65.326  154.188 39.913  1.00 34.90  ? 52   A   0 C4    1 
ATOM   922   P  P     . C   A  1  52   ? 64.344  155.673 45.842  1.00 31.75  ? 53   C   0 P     1 
ATOM   923   O  OP1   . C   A  1  52   ? 64.702  156.258 47.155  1.00 31.43  ? 53   C   0 OP1   1 
ATOM   924   O  OP2   . C   A  1  52   ? 63.105  154.860 45.713  1.00 31.84  ? 53   C   0 OP2   1 
ATOM   925   O  "O5'" . C   A  1  52   ? 64.268  156.857 44.779  1.00 32.78  ? 53   C   0 "O5'" 1 
ATOM   926   C  "C5'" . C   A  1  52   ? 65.334  157.818 44.692  1.00 34.05  ? 53   C   0 "C5'" 1 
ATOM   927   C  "C4'" . C   A  1  52   ? 65.221  158.631 43.431  1.00 33.23  ? 53   C   0 "C4'" 1 
ATOM   928   O  "O4'" . C   A  1  52   ? 65.379  157.770 42.266  1.00 35.60  ? 53   C   0 "O4'" 1 
ATOM   929   C  "C3'" . C   A  1  52   ? 63.893  159.311 43.162  1.00 34.82  ? 53   C   0 "C3'" 1 
ATOM   930   O  "O3'" . C   A  1  52   ? 63.667  160.476 43.946  1.00 33.87  ? 53   C   0 "O3'" 1 
ATOM   931   C  "C2'" . C   A  1  52   ? 64.025  159.617 41.677  1.00 34.78  ? 53   C   0 "C2'" 1 
ATOM   932   O  "O2'" . C   A  1  52   ? 64.923  160.682 41.431  1.00 35.97  ? 53   C   0 "O2'" 1 
ATOM   933   C  "C1'" . C   A  1  52   ? 64.651  158.318 41.172  1.00 33.70  ? 53   C   0 "C1'" 1 
ATOM   934   N  N1    . C   A  1  52   ? 63.605  157.363 40.753  1.00 34.61  ? 53   C   0 N1    1 
ATOM   935   C  C2    . C   A  1  52   ? 63.068  157.470 39.452  1.00 33.82  ? 53   C   0 C2    1 
ATOM   936   O  O2    . C   A  1  52   ? 63.509  158.335 38.681  1.00 36.52  ? 53   C   0 O2    1 
ATOM   937   N  N3    . C   A  1  52   ? 62.082  156.630 39.076  1.00 32.91  ? 53   C   0 N3    1 
ATOM   938   C  C4    . C   A  1  52   ? 61.625  155.710 39.928  1.00 32.54  ? 53   C   0 C4    1 
ATOM   939   N  N4    . C   A  1  52   ? 60.638  154.911 39.513  1.00 30.24  ? 53   C   0 N4    1 
ATOM   940   C  C5    . C   A  1  52   ? 62.158  155.568 41.244  1.00 32.04  ? 53   C   0 C5    1 
ATOM   941   C  C6    . C   A  1  52   ? 63.140  156.404 41.610  1.00 32.62  ? 53   C   0 C6    1 
ATOM   942   P  P     . G   A  1  53   ? 62.241  161.221 43.860  1.00 34.27  ? 54   G   0 P     1 
ATOM   943   O  OP1   . G   A  1  53   ? 62.161  162.147 45.009  1.00 35.04  ? 54   G   0 OP1   1 
ATOM   944   O  OP2   . G   A  1  53   ? 61.161  160.219 43.656  1.00 34.14  ? 54   G   0 OP2   1 
ATOM   945   O  "O5'" . G   A  1  53   ? 62.371  162.077 42.523  1.00 34.28  ? 54   G   0 "O5'" 1 
ATOM   946   C  "C5'" . G   A  1  53   ? 61.207  162.533 41.817  1.00 33.14  ? 54   G   0 "C5'" 1 
ATOM   947   C  "C4'" . G   A  1  53   ? 61.465  162.533 40.329  1.00 32.83  ? 54   G   0 "C4'" 1 
ATOM   948   O  "O4'" . G   A  1  53   ? 61.943  161.230 39.918  1.00 32.53  ? 54   G   0 "O4'" 1 
ATOM   949   C  "C3'" . G   A  1  53   ? 60.239  162.810 39.467  1.00 33.50  ? 54   G   0 "C3'" 1 
ATOM   950   O  "O3'" . G   A  1  53   ? 60.115  164.197 39.218  1.00 33.45  ? 54   G   0 "O3'" 1 
ATOM   951   C  "C2'" . G   A  1  53   ? 60.557  162.058 38.189  1.00 34.69  ? 54   G   0 "C2'" 1 
ATOM   952   O  "O2'" . G   A  1  53   ? 61.473  162.761 37.369  1.00 33.48  ? 54   G   0 "O2'" 1 
ATOM   953   C  "C1'" . G   A  1  53   ? 61.250  160.818 38.753  1.00 34.39  ? 54   G   0 "C1'" 1 
ATOM   954   N  N9    . G   A  1  53   ? 60.335  159.742 39.133  1.00 37.04  ? 54   G   0 N9    1 
ATOM   955   C  C8    . G   A  1  53   ? 60.200  159.184 40.383  1.00 35.80  ? 54   G   0 C8    1 
ATOM   956   N  N7    . G   A  1  53   ? 59.363  158.185 40.408  1.00 37.12  ? 54   G   0 N7    1 
ATOM   957   C  C5    . G   A  1  53   ? 58.904  158.082 39.103  1.00 35.89  ? 54   G   0 C5    1 
ATOM   958   C  C6    . G   A  1  53   ? 57.997  157.166 38.523  1.00 35.36  ? 54   G   0 C6    1 
ATOM   959   O  O6    . G   A  1  53   ? 57.415  156.224 39.058  1.00 35.15  ? 54   G   0 O6    1 
ATOM   960   N  N1    . G   A  1  53   ? 57.800  157.428 37.173  1.00 35.38  ? 54   G   0 N1    1 
ATOM   961   C  C2    . G   A  1  53   ? 58.406  158.436 36.469  1.00 35.24  ? 54   G   0 C2    1 
ATOM   962   N  N2    . G   A  1  53   ? 58.089  158.525 35.173  1.00 34.11  ? 54   G   0 N2    1 
ATOM   963   N  N3    . G   A  1  53   ? 59.263  159.292 36.997  1.00 35.22  ? 54   G   0 N3    1 
ATOM   964   C  C4    . G   A  1  53   ? 59.468  159.055 38.308  1.00 35.86  ? 54   G   0 C4    1 
ATOM   965   P  P     . U   A  1  54   ? 58.774  164.970 39.629  1.00 35.93  ? 55   U   0 P     1 
ATOM   966   O  OP1   . U   A  1  54   ? 59.089  166.425 39.549  1.00 35.96  ? 55   U   0 OP1   1 
ATOM   967   O  OP2   . U   A  1  54   ? 58.229  164.402 40.894  1.00 36.51  ? 55   U   0 OP2   1 
ATOM   968   O  "O5'" . U   A  1  54   ? 57.747  164.610 38.472  1.00 34.91  ? 55   U   0 "O5'" 1 
ATOM   969   C  "C5'" . U   A  1  54   ? 58.098  164.758 37.094  1.00 35.26  ? 55   U   0 "C5'" 1 
ATOM   970   C  "C4'" . U   A  1  54   ? 57.155  163.949 36.245  1.00 37.96  ? 55   U   0 "C4'" 1 
ATOM   971   O  "O4'" . U   A  1  54   ? 57.436  162.533 36.400  1.00 37.14  ? 55   U   0 "O4'" 1 
ATOM   972   C  "C3'" . U   A  1  54   ? 55.689  164.089 36.630  1.00 37.27  ? 55   U   0 "C3'" 1 
ATOM   973   O  "O3'" . U   A  1  54   ? 55.130  165.257 36.045  1.00 39.04  ? 55   U   0 "O3'" 1 
ATOM   974   C  "C2'" . U   A  1  54   ? 55.089  162.805 36.080  1.00 36.18  ? 55   U   0 "C2'" 1 
ATOM   975   O  "O2'" . U   A  1  54   ? 54.903  162.862 34.684  1.00 38.73  ? 55   U   0 "O2'" 1 
ATOM   976   C  "C1'" . U   A  1  54   ? 56.217  161.807 36.352  1.00 36.63  ? 55   U   0 "C1'" 1 
ATOM   977   N  N1    . U   A  1  54   ? 56.067  161.051 37.605  1.00 36.97  ? 55   U   0 N1    1 
ATOM   978   C  C2    . U   A  1  54   ? 55.342  159.873 37.553  1.00 35.94  ? 55   U   0 C2    1 
ATOM   979   O  O2    . U   A  1  54   ? 54.801  159.473 36.539  1.00 35.80  ? 55   U   0 O2    1 
ATOM   980   N  N3    . U   A  1  54   ? 55.269  159.181 38.735  1.00 36.62  ? 55   U   0 N3    1 
ATOM   981   C  C4    . U   A  1  54   ? 55.829  159.536 39.942  1.00 37.95  ? 55   U   0 C4    1 
ATOM   982   O  O4    . U   A  1  54   ? 55.772  158.744 40.884  1.00 38.78  ? 55   U   0 O4    1 
ATOM   983   C  C5    . U   A  1  54   ? 56.540  160.783 39.928  1.00 36.51  ? 55   U   0 C5    1 
ATOM   984   C  C6    . U   A  1  54   ? 56.633  161.480 38.790  1.00 36.02  ? 55   U   0 C6    1 
ATOM   985   P  P     . G   A  1  55   ? 54.153  166.200 36.907  1.00 39.91  ? 56   G   0 P     1 
ATOM   986   O  OP1   . G   A  1  55   ? 53.887  167.387 36.064  1.00 41.85  ? 56   G   0 OP1   1 
ATOM   987   O  OP2   . G   A  1  55   ? 54.703  166.378 38.273  1.00 40.38  ? 56   G   0 OP2   1 
ATOM   988   O  "O5'" . G   A  1  55   ? 52.801  165.364 37.006  1.00 40.22  ? 56   G   0 "O5'" 1 
ATOM   989   C  "C5'" . G   A  1  55   ? 52.086  165.001 35.818  1.00 38.89  ? 56   G   0 "C5'" 1 
ATOM   990   C  "C4'" . G   A  1  55   ? 50.601  165.057 36.059  1.00 38.54  ? 56   G   0 "C4'" 1 
ATOM   991   O  "O4'" . G   A  1  55   ? 50.198  163.940 36.889  1.00 39.54  ? 56   G   0 "O4'" 1 
ATOM   992   C  "C3'" . G   A  1  55   ? 50.058  166.308 36.740  1.00 39.76  ? 56   G   0 "C3'" 1 
ATOM   993   O  "O3'" . G   A  1  55   ? 48.775  166.599 36.196  1.00 41.41  ? 56   G   0 "O3'" 1 
ATOM   994   C  "C2'" . G   A  1  55   ? 49.900  165.853 38.186  1.00 38.80  ? 56   G   0 "C2'" 1 
ATOM   995   O  "O2'" . G   A  1  55   ? 48.918  166.591 38.878  1.00 38.09  ? 56   G   0 "O2'" 1 
ATOM   996   C  "C1'" . G   A  1  55   ? 49.441  164.413 37.980  1.00 39.71  ? 56   G   0 "C1'" 1 
ATOM   997   N  N9    . G   A  1  55   ? 49.613  163.485 39.096  1.00 41.85  ? 56   G   0 N9    1 
ATOM   998   C  C8    . G   A  1  55   ? 50.372  163.649 40.232  1.00 42.59  ? 56   G   0 C8    1 
ATOM   999   N  N7    . G   A  1  55   ? 50.317  162.622 41.036  1.00 41.72  ? 56   G   0 N7    1 
ATOM   1000  C  C5    . G   A  1  55   ? 49.474  161.728 40.392  1.00 41.72  ? 56   G   0 C5    1 
ATOM   1001  C  C6    . G   A  1  55   ? 49.045  160.436 40.772  1.00 42.01  ? 56   G   0 C6    1 
ATOM   1002  O  O6    . G   A  1  55   ? 49.340  159.795 41.783  1.00 42.09  ? 56   G   0 O6    1 
ATOM   1003  N  N1    . G   A  1  55   ? 48.189  159.883 39.826  1.00 42.83  ? 56   G   0 N1    1 
ATOM   1004  C  C2    . G   A  1  55   ? 47.802  160.492 38.663  1.00 42.14  ? 56   G   0 C2    1 
ATOM   1005  N  N2    . G   A  1  55   ? 46.973  159.801 37.875  1.00 42.03  ? 56   G   0 N2    1 
ATOM   1006  N  N3    . G   A  1  55   ? 48.200  161.693 38.296  1.00 41.39  ? 56   G   0 N3    1 
ATOM   1007  C  C4    . G   A  1  55   ? 49.028  162.249 39.199  1.00 40.97  ? 56   G   0 C4    1 
ATOM   1008  P  P     . C   A  1  56   ? 48.532  167.993 35.440  1.00 41.33  ? 57   C   0 P     1 
ATOM   1009  O  OP1   . C   A  1  56   ? 47.179  167.973 34.834  1.00 45.07  ? 57   C   0 OP1   1 
ATOM   1010  O  OP2   . C   A  1  56   ? 49.717  168.254 34.586  1.00 43.37  ? 57   C   0 OP2   1 
ATOM   1011  O  "O5'" . C   A  1  56   ? 48.508  169.048 36.622  1.00 42.46  ? 57   C   0 "O5'" 1 
ATOM   1012  C  "C5'" . C   A  1  56   ? 48.950  170.388 36.423  1.00 42.23  ? 57   C   0 "C5'" 1 
ATOM   1013  C  "C4'" . C   A  1  56   ? 48.338  171.270 37.469  1.00 42.61  ? 57   C   0 "C4'" 1 
ATOM   1014  O  "O4'" . C   A  1  56   ? 46.907  171.350 37.244  1.00 42.50  ? 57   C   0 "O4'" 1 
ATOM   1015  C  "C3'" . C   A  1  56   ? 48.454  170.723 38.879  1.00 43.56  ? 57   C   0 "C3'" 1 
ATOM   1016  O  "O3'" . C   A  1  56   ? 49.726  171.008 39.436  1.00 47.25  ? 57   C   0 "O3'" 1 
ATOM   1017  C  "C2'" . C   A  1  56   ? 47.305  171.425 39.588  1.00 44.11  ? 57   C   0 "C2'" 1 
ATOM   1018  O  "O2'" . C   A  1  56   ? 47.601  172.772 39.909  1.00 44.95  ? 57   C   0 "O2'" 1 
ATOM   1019  C  "C1'" . C   A  1  56   ? 46.236  171.410 38.491  1.00 41.49  ? 57   C   0 "C1'" 1 
ATOM   1020  N  N1    . C   A  1  56   ? 45.268  170.297 38.570  1.00 38.44  ? 57   C   0 N1    1 
ATOM   1021  C  C2    . C   A  1  56   ? 44.236  170.380 39.512  1.00 38.57  ? 57   C   0 C2    1 
ATOM   1022  O  O2    . C   A  1  56   ? 44.222  171.336 40.306  1.00 40.41  ? 57   C   0 O2    1 
ATOM   1023  N  N3    . C   A  1  56   ? 43.287  169.417 39.543  1.00 35.97  ? 57   C   0 N3    1 
ATOM   1024  C  C4    . C   A  1  56   ? 43.347  168.392 38.694  1.00 35.17  ? 57   C   0 C4    1 
ATOM   1025  N  N4    . C   A  1  56   ? 42.363  167.493 38.741  1.00 33.79  ? 57   C   0 N4    1 
ATOM   1026  C  C5    . C   A  1  56   ? 44.415  168.251 37.755  1.00 34.83  ? 57   C   0 C5    1 
ATOM   1027  C  C6    . C   A  1  56   ? 45.347  169.217 37.730  1.00 38.31  ? 57   C   0 C6    1 
ATOM   1028  P  P     . C   A  1  57   ? 50.416  169.949 40.424  1.00 48.43  ? 58   C   0 P     1 
ATOM   1029  O  OP1   . C   A  1  57   ? 51.742  170.509 40.798  1.00 48.72  ? 58   C   0 OP1   1 
ATOM   1030  O  OP2   . C   A  1  57   ? 50.336  168.597 39.824  1.00 48.94  ? 58   C   0 OP2   1 
ATOM   1031  O  "O5'" . C   A  1  57   ? 49.475  169.968 41.702  1.00 49.41  ? 58   C   0 "O5'" 1 
ATOM   1032  C  "C5'" . C   A  1  57   ? 49.330  171.163 42.475  1.00 51.85  ? 58   C   0 "C5'" 1 
ATOM   1033  C  "C4'" . C   A  1  57   ? 48.271  170.977 43.527  1.00 54.30  ? 58   C   0 "C4'" 1 
ATOM   1034  O  "O4'" . C   A  1  57   ? 46.967  170.871 42.909  1.00 55.08  ? 58   C   0 "O4'" 1 
ATOM   1035  C  "C3'" . C   A  1  57   ? 48.364  169.700 44.338  1.00 55.74  ? 58   C   0 "C3'" 1 
ATOM   1036  O  "O3'" . C   A  1  57   ? 49.362  169.793 45.335  1.00 58.61  ? 58   C   0 "O3'" 1 
ATOM   1037  C  "C2'" . C   A  1  57   ? 46.964  169.605 44.927  1.00 56.29  ? 58   C   0 "C2'" 1 
ATOM   1038  O  "O2'" . C   A  1  57   ? 46.770  170.462 46.033  1.00 56.60  ? 58   C   0 "O2'" 1 
ATOM   1039  C  "C1'" . C   A  1  57   ? 46.118  170.106 43.752  1.00 54.91  ? 58   C   0 "C1'" 1 
ATOM   1040  N  N1    . C   A  1  57   ? 45.505  169.018 42.971  1.00 52.78  ? 58   C   0 N1    1 
ATOM   1041  C  C2    . C   A  1  57   ? 44.186  168.665 43.260  1.00 51.96  ? 58   C   0 C2    1 
ATOM   1042  O  O2    . C   A  1  57   ? 43.585  169.288 44.148  1.00 51.97  ? 58   C   0 O2    1 
ATOM   1043  N  N3    . C   A  1  57   ? 43.601  167.656 42.570  1.00 51.19  ? 58   C   0 N3    1 
ATOM   1044  C  C4    . C   A  1  57   ? 44.287  167.009 41.624  1.00 52.07  ? 58   C   0 C4    1 
ATOM   1045  N  N4    . C   A  1  57   ? 43.673  166.013 40.976  1.00 50.95  ? 58   C   0 N4    1 
ATOM   1046  C  C5    . C   A  1  57   ? 45.635  167.353 41.302  1.00 51.65  ? 58   C   0 C5    1 
ATOM   1047  C  C6    . C   A  1  57   ? 46.199  168.356 41.993  1.00 52.89  ? 58   C   0 C6    1 
ATOM   1048  P  P     . A   A  1  58   ? 50.674  168.874 45.227  1.00 60.63  ? 59   A   0 P     1 
ATOM   1049  O  OP1   . A   A  1  58   ? 51.418  169.063 46.507  1.00 61.59  ? 59   A   0 OP1   1 
ATOM   1050  O  OP2   . A   A  1  58   ? 51.361  169.131 43.925  1.00 60.85  ? 59   A   0 OP2   1 
ATOM   1051  O  "O5'" . A   A  1  58   ? 50.091  167.394 45.173  1.00 58.62  ? 59   A   0 "O5'" 1 
ATOM   1052  C  "C5'" . A   A  1  58   ? 49.562  166.772 46.345  1.00 50.09  ? 59   A   0 "C5'" 1 
ATOM   1053  C  "C4'" . A   A  1  58   ? 49.664  165.277 46.223  1.00 47.53  ? 59   A   0 "C4'" 1 
ATOM   1054  O  "O4'" . A   A  1  58   ? 48.570  164.782 45.404  1.00 45.71  ? 59   A   0 "O4'" 1 
ATOM   1055  C  "C3'" . A   A  1  58   ? 50.948  164.742 45.589  1.00 44.05  ? 59   A   0 "C3'" 1 
ATOM   1056  O  "O3'" . A   A  1  58   ? 51.430  163.661 46.364  1.00 45.83  ? 59   A   0 "O3'" 1 
ATOM   1057  C  "C2'" . A   A  1  58   ? 50.473  164.227 44.232  1.00 43.39  ? 59   A   0 "C2'" 1 
ATOM   1058  O  "O2'" . A   A  1  58   ? 51.239  163.141 43.747  1.00 41.83  ? 59   A   0 "O2'" 1 
ATOM   1059  C  "C1'" . A   A  1  58   ? 49.057  163.768 44.564  1.00 43.47  ? 59   A   0 "C1'" 1 
ATOM   1060  N  N9    . A   A  1  58   ? 48.163  163.662 43.412  1.00 43.53  ? 59   A   0 N9    1 
ATOM   1061  C  C8    . A   A  1  58   ? 48.012  164.556 42.383  1.00 43.37  ? 59   A   0 C8    1 
ATOM   1062  N  N7    . A   A  1  58   ? 47.153  164.175 41.472  1.00 43.73  ? 59   A   0 N7    1 
ATOM   1063  C  C5    . A   A  1  58   ? 46.701  162.948 41.932  1.00 43.13  ? 59   A   0 C5    1 
ATOM   1064  C  C6    . A   A  1  58   ? 45.786  162.021 41.405  1.00 42.67  ? 59   A   0 C6    1 
ATOM   1065  N  N6    . A   A  1  58   ? 45.150  162.192 40.245  1.00 41.18  ? 59   A   0 N6    1 
ATOM   1066  N  N1    . A   A  1  58   ? 45.550  160.895 42.116  1.00 41.84  ? 59   A   0 N1    1 
ATOM   1067  C  C2    . A   A  1  58   ? 46.202  160.721 43.270  1.00 41.16  ? 59   A   0 C2    1 
ATOM   1068  N  N3    . A   A  1  58   ? 47.094  161.514 43.863  1.00 42.78  ? 59   A   0 N3    1 
ATOM   1069  C  C4    . A   A  1  58   ? 47.304  162.624 43.133  1.00 43.11  ? 59   A   0 C4    1 
ATOM   1070  P  P     . A   A  1  59   ? 52.904  163.733 47.005  1.00 43.44  ? 60   A   0 P     1 
ATOM   1071  O  OP1   . A   A  1  59   ? 53.311  165.144 47.147  1.00 43.27  ? 60   A   0 OP1   1 
ATOM   1072  O  OP2   . A   A  1  59   ? 53.766  162.792 46.255  1.00 47.08  ? 60   A   0 OP2   1 
ATOM   1073  O  "O5'" . A   A  1  59   ? 52.678  163.159 48.467  1.00 45.20  ? 60   A   0 "O5'" 1 
ATOM   1074  C  "C5'" . A   A  1  59   ? 53.735  162.532 49.205  1.00 42.25  ? 60   A   0 "C5'" 1 
ATOM   1075  C  "C4'" . A   A  1  59   ? 53.179  161.370 49.987  1.00 41.31  ? 60   A   0 "C4'" 1 
ATOM   1076  O  "O4'" . A   A  1  59   ? 51.834  161.726 50.417  1.00 41.71  ? 60   A   0 "O4'" 1 
ATOM   1077  C  "C3'" . A   A  1  59   ? 52.968  160.096 49.192  1.00 39.87  ? 60   A   0 "C3'" 1 
ATOM   1078  O  "O3'" . A   A  1  59   ? 54.160  159.332 49.122  1.00 36.17  ? 60   A   0 "O3'" 1 
ATOM   1079  C  "C2'" . A   A  1  59   ? 51.874  159.403 49.986  1.00 39.91  ? 60   A   0 "C2'" 1 
ATOM   1080  O  "O2'" . A   A  1  59   ? 52.356  158.826 51.183  1.00 41.91  ? 60   A   0 "O2'" 1 
ATOM   1081  C  "C1'" . A   A  1  59   ? 50.985  160.593 50.343  1.00 41.01  ? 60   A   0 "C1'" 1 
ATOM   1082  N  N9    . A   A  1  59   ? 49.968  160.848 49.321  1.00 41.45  ? 60   A   0 N9    1 
ATOM   1083  C  C8    . A   A  1  59   ? 49.904  161.888 48.421  1.00 41.07  ? 60   A   0 C8    1 
ATOM   1084  N  N7    . A   A  1  59   ? 48.892  161.810 47.596  1.00 41.27  ? 60   A   0 N7    1 
ATOM   1085  C  C5    . A   A  1  59   ? 48.235  160.649 47.982  1.00 41.97  ? 60   A   0 C5    1 
ATOM   1086  C  C6    . A   A  1  59   ? 47.089  160.001 47.490  1.00 42.47  ? 60   A   0 C6    1 
ATOM   1087  N  N6    . A   A  1  59   ? 46.372  160.445 46.459  1.00 42.43  ? 60   A   0 N6    1 
ATOM   1088  N  N1    . A   A  1  59   ? 46.702  158.860 48.100  1.00 43.53  ? 60   A   0 N1    1 
ATOM   1089  C  C2    . A   A  1  59   ? 47.425  158.408 49.133  1.00 43.28  ? 60   A   0 C2    1 
ATOM   1090  N  N3    . A   A  1  59   ? 48.519  158.923 49.684  1.00 41.51  ? 60   A   0 N3    1 
ATOM   1091  C  C4    . A   A  1  59   ? 48.879  160.055 49.053  1.00 41.59  ? 60   A   0 C4    1 
ATOM   1092  P  P     . G   A  1  60   ? 54.318  158.220 47.979  1.00 35.49  ? 61   G   0 P     1 
ATOM   1093  O  OP1   . G   A  1  60   ? 55.635  157.564 48.178  1.00 35.98  ? 61   G   0 OP1   1 
ATOM   1094  O  OP2   . G   A  1  60   ? 54.009  158.848 46.667  1.00 34.19  ? 61   G   0 OP2   1 
ATOM   1095  O  "O5'" . G   A  1  60   ? 53.186  157.163 48.342  1.00 34.30  ? 61   G   0 "O5'" 1 
ATOM   1096  C  "C5'" . G   A  1  60   ? 53.303  156.336 49.515  1.00 33.71  ? 61   G   0 "C5'" 1 
ATOM   1097  C  "C4'" . G   A  1  60   ? 52.244  155.259 49.512  1.00 33.81  ? 61   G   0 "C4'" 1 
ATOM   1098  O  "O4'" . G   A  1  60   ? 50.936  155.877 49.588  1.00 32.73  ? 61   G   0 "O4'" 1 
ATOM   1099  C  "C3'" . G   A  1  60   ? 52.174  154.393 48.263  1.00 34.68  ? 61   G   0 "C3'" 1 
ATOM   1100  O  "O3'" . G   A  1  60   ? 53.115  153.335 48.272  1.00 35.37  ? 61   G   0 "O3'" 1 
ATOM   1101  C  "C2'" . G   A  1  60   ? 50.745  153.883 48.299  1.00 35.10  ? 61   G   0 "C2'" 1 
ATOM   1102  O  "O2'" . G   A  1  60   ? 50.565  152.787 49.175  1.00 35.74  ? 61   G   0 "O2'" 1 
ATOM   1103  C  "C1'" . G   A  1  60   ? 50.011  155.123 48.818  1.00 36.46  ? 61   G   0 "C1'" 1 
ATOM   1104  N  N9    . G   A  1  60   ? 49.531  155.966 47.725  1.00 38.34  ? 61   G   0 N9    1 
ATOM   1105  C  C8    . G   A  1  60   ? 50.007  157.200 47.340  1.00 37.87  ? 61   G   0 C8    1 
ATOM   1106  N  N7    . G   A  1  60   ? 49.359  157.706 46.329  1.00 38.14  ? 61   G   0 N7    1 
ATOM   1107  C  C5    . G   A  1  60   ? 48.398  156.750 46.028  1.00 39.05  ? 61   G   0 C5    1 
ATOM   1108  C  C6    . G   A  1  60   ? 47.397  156.738 45.026  1.00 37.99  ? 61   G   0 C6    1 
ATOM   1109  O  O6    . G   A  1  60   ? 47.140  157.602 44.186  1.00 37.16  ? 61   G   0 O6    1 
ATOM   1110  N  N1    . G   A  1  60   ? 46.654  155.563 45.064  1.00 38.73  ? 61   G   0 N1    1 
ATOM   1111  C  C2    . G   A  1  60   ? 46.848  154.533 45.952  1.00 39.11  ? 61   G   0 C2    1 
ATOM   1112  N  N2    . G   A  1  60   ? 46.044  153.469 45.819  1.00 40.04  ? 61   G   0 N2    1 
ATOM   1113  N  N3    . G   A  1  60   ? 47.765  154.541 46.897  1.00 37.61  ? 61   G   0 N3    1 
ATOM   1114  C  C4    . G   A  1  60   ? 48.499  155.669 46.876  1.00 38.49  ? 61   G   0 C4    1 
ATOM   1115  P  P     . C   A  1  61   ? 53.758  152.837 46.891  1.00 37.75  ? 62   C   0 P     1 
ATOM   1116  O  OP1   . C   A  1  61   ? 54.761  151.796 47.233  1.00 38.52  ? 62   C   0 OP1   1 
ATOM   1117  O  OP2   . C   A  1  61   ? 54.165  154.006 46.075  1.00 37.70  ? 62   C   0 OP2   1 
ATOM   1118  O  "O5'" . C   A  1  61   ? 52.548  152.138 46.133  1.00 36.71  ? 62   C   0 "O5'" 1 
ATOM   1119  C  "C5'" . C   A  1  61   ? 51.956  150.947 46.647  1.00 35.84  ? 62   C   0 "C5'" 1 
ATOM   1120  C  "C4'" . C   A  1  61   ? 50.751  150.581 45.829  1.00 38.39  ? 62   C   0 "C4'" 1 
ATOM   1121  O  "O4'" . C   A  1  61   ? 49.779  151.657 45.911  1.00 38.86  ? 62   C   0 "O4'" 1 
ATOM   1122  C  "C3'" . C   A  1  61   ? 50.985  150.433 44.336  1.00 37.42  ? 62   C   0 "C3'" 1 
ATOM   1123  O  "O3'" . C   A  1  61   ? 51.546  149.180 43.989  1.00 38.92  ? 62   C   0 "O3'" 1 
ATOM   1124  C  "C2'" . C   A  1  61   ? 49.581  150.610 43.786  1.00 37.83  ? 62   C   0 "C2'" 1 
ATOM   1125  O  "O2'" . C   A  1  61   ? 48.769  149.465 43.921  1.00 36.86  ? 62   C   0 "O2'" 1 
ATOM   1126  C  "C1'" . C   A  1  61   ? 49.051  151.721 44.695  1.00 39.89  ? 62   C   0 "C1'" 1 
ATOM   1127  N  N1    . C   A  1  61   ? 49.229  153.053 44.087  1.00 41.36  ? 62   C   0 N1    1 
ATOM   1128  C  C2    . C   A  1  61   ? 48.263  153.495 43.179  1.00 41.37  ? 62   C   0 C2    1 
ATOM   1129  O  O2    . C   A  1  61   ? 47.308  152.750 42.916  1.00 41.72  ? 62   C   0 O2    1 
ATOM   1130  N  N3    . C   A  1  61   ? 48.399  154.715 42.607  1.00 42.97  ? 62   C   0 N3    1 
ATOM   1131  C  C4    . C   A  1  61   ? 49.455  155.479 42.904  1.00 43.30  ? 62   C   0 C4    1 
ATOM   1132  N  N4    . C   A  1  61   ? 49.545  156.673 42.315  1.00 42.67  ? 62   C   0 N4    1 
ATOM   1133  C  C5    . C   A  1  61   ? 50.462  155.050 43.820  1.00 41.90  ? 62   C   0 C5    1 
ATOM   1134  C  C6    . C   A  1  61   ? 50.309  153.842 44.386  1.00 41.33  ? 62   C   0 C6    1 
ATOM   1135  P  P     . U   A  1  62   ? 52.507  149.069 42.707  1.00 43.00  ? 63   U   0 P     1 
ATOM   1136  O  OP1   . U   A  1  62   ? 52.916  147.643 42.564  1.00 42.34  ? 63   U   0 OP1   1 
ATOM   1137  O  OP2   . U   A  1  62   ? 53.550  150.121 42.813  1.00 40.21  ? 63   U   0 OP2   1 
ATOM   1138  O  "O5'" . U   A  1  62   ? 51.545  149.415 41.484  1.00 40.29  ? 63   U   0 "O5'" 1 
ATOM   1139  C  "C5'" . U   A  1  62   ? 50.507  148.503 41.088  1.00 38.81  ? 63   U   0 "C5'" 1 
ATOM   1140  C  "C4'" . U   A  1  62   ? 49.693  149.085 39.957  1.00 38.52  ? 63   U   0 "C4'" 1 
ATOM   1141  O  "O4'" . U   A  1  62   ? 49.053  150.308 40.407  1.00 38.82  ? 63   U   0 "O4'" 1 
ATOM   1142  C  "C3'" . U   A  1  62   ? 50.459  149.524 38.720  1.00 37.60  ? 63   U   0 "C3'" 1 
ATOM   1143  O  "O3'" . U   A  1  62   ? 50.798  148.443 37.869  1.00 37.61  ? 63   U   0 "O3'" 1 
ATOM   1144  C  "C2'" . U   A  1  62   ? 49.479  150.494 38.083  1.00 37.55  ? 63   U   0 "C2'" 1 
ATOM   1145  O  "O2'" . U   A  1  62   ? 48.391  149.843 37.468  1.00 38.19  ? 63   U   0 "O2'" 1 
ATOM   1146  C  "C1'" . U   A  1  62   ? 48.951  151.217 39.321  1.00 38.95  ? 63   U   0 "C1'" 1 
ATOM   1147  N  N1    . U   A  1  62   ? 49.730  152.428 39.634  1.00 41.07  ? 63   U   0 N1    1 
ATOM   1148  C  C2    . U   A  1  62   ? 49.365  153.600 38.991  1.00 40.49  ? 63   U   0 C2    1 
ATOM   1149  O  O2    . U   A  1  62   ? 48.448  153.656 38.188  1.00 41.60  ? 63   U   0 O2    1 
ATOM   1150  N  N3    . U   A  1  62   ? 50.116  154.702 39.320  1.00 40.12  ? 63   U   0 N3    1 
ATOM   1151  C  C4    . U   A  1  62   ? 51.175  154.756 40.201  1.00 39.39  ? 63   U   0 C4    1 
ATOM   1152  O  O4    . U   A  1  62   ? 51.729  155.834 40.406  1.00 39.31  ? 63   U   0 O4    1 
ATOM   1153  C  C5    . U   A  1  62   ? 51.502  153.507 40.823  1.00 38.31  ? 63   U   0 C5    1 
ATOM   1154  C  C6    . U   A  1  62   ? 50.789  152.413 40.529  1.00 39.37  ? 63   U   0 C6    1 
ATOM   1155  P  P     . G   A  1  63   ? 52.141  148.526 36.986  1.00 39.61  ? 64   G   0 P     1 
ATOM   1156  O  OP1   . G   A  1  63   ? 52.247  147.261 36.213  1.00 41.19  ? 64   G   0 OP1   1 
ATOM   1157  O  OP2   . G   A  1  63   ? 53.281  148.952 37.839  1.00 38.64  ? 64   G   0 OP2   1 
ATOM   1158  O  "O5'" . G   A  1  63   ? 51.827  149.716 35.972  1.00 40.46  ? 64   G   0 "O5'" 1 
ATOM   1159  C  "C5'" . G   A  1  63   ? 50.731  149.620 35.045  1.00 36.83  ? 64   G   0 "C5'" 1 
ATOM   1160  C  "C4'" . G   A  1  63   ? 50.556  150.920 34.306  1.00 37.89  ? 64   G   0 "C4'" 1 
ATOM   1161  O  "O4'" . G   A  1  63   ? 50.219  151.974 35.250  1.00 38.83  ? 64   G   0 "O4'" 1 
ATOM   1162  C  "C3'" . G   A  1  63   ? 51.796  151.458 33.610  1.00 38.42  ? 64   G   0 "C3'" 1 
ATOM   1163  O  "O3'" . G   A  1  63   ? 52.052  150.828 32.366  1.00 34.79  ? 64   G   0 "O3'" 1 
ATOM   1164  C  "C2'" . G   A  1  63   ? 51.449  152.928 33.456  1.00 38.59  ? 64   G   0 "C2'" 1 
ATOM   1165  O  "O2'" . G   A  1  63   ? 50.520  153.135 32.416  1.00 40.20  ? 64   G   0 "O2'" 1 
ATOM   1166  C  "C1'" . G   A  1  63   ? 50.762  153.207 34.795  1.00 40.02  ? 64   G   0 "C1'" 1 
ATOM   1167  N  N9    . G   A  1  63   ? 51.685  153.727 35.804  1.00 42.03  ? 64   G   0 N9    1 
ATOM   1168  C  C8    . G   A  1  63   ? 52.241  153.052 36.867  1.00 41.93  ? 64   G   0 C8    1 
ATOM   1169  N  N7    . G   A  1  63   ? 53.017  153.803 37.602  1.00 41.52  ? 64   G   0 N7    1 
ATOM   1170  C  C5    . G   A  1  63   ? 52.974  155.047 36.988  1.00 43.09  ? 64   G   0 C5    1 
ATOM   1171  C  C6    . G   A  1  63   ? 53.613  156.269 37.332  1.00 43.83  ? 64   G   0 C6    1 
ATOM   1172  O  O6    . G   A  1  63   ? 54.363  156.509 38.286  1.00 44.43  ? 64   G   0 O6    1 
ATOM   1173  N  N1    . G   A  1  63   ? 53.304  157.278 36.424  1.00 43.96  ? 64   G   0 N1    1 
ATOM   1174  C  C2    . G   A  1  63   ? 52.494  157.133 35.326  1.00 43.24  ? 64   G   0 C2    1 
ATOM   1175  N  N2    . G   A  1  63   ? 52.338  158.214 34.555  1.00 42.34  ? 64   G   0 N2    1 
ATOM   1176  N  N3    . G   A  1  63   ? 51.885  156.008 35.005  1.00 43.00  ? 64   G   0 N3    1 
ATOM   1177  C  C4    . G   A  1  63   ? 52.166  155.014 35.871  1.00 42.64  ? 64   G   0 C4    1 
ATOM   1178  P  P     . C   A  1  64   ? 53.568  150.610 31.897  1.00 35.21  ? 65   C   0 P     1 
ATOM   1179  O  OP1   . C   A  1  64   ? 53.574  149.796 30.660  1.00 36.43  ? 65   C   0 OP1   1 
ATOM   1180  O  OP2   . C   A  1  64   ? 54.348  150.160 33.069  1.00 36.87  ? 65   C   0 OP2   1 
ATOM   1181  O  "O5'" . C   A  1  64   ? 54.076  152.072 31.517  1.00 37.70  ? 65   C   0 "O5'" 1 
ATOM   1182  C  "C5'" . C   A  1  64   ? 53.433  152.853 30.486  1.00 35.52  ? 65   C   0 "C5'" 1 
ATOM   1183  C  "C4'" . C   A  1  64   ? 53.858  154.300 30.593  1.00 36.57  ? 65   C   0 "C4'" 1 
ATOM   1184  O  "O4'" . C   A  1  64   ? 53.471  154.792 31.904  1.00 36.86  ? 65   C   0 "O4'" 1 
ATOM   1185  C  "C3'" . C   A  1  64   ? 55.359  154.566 30.527  1.00 35.97  ? 65   C   0 "C3'" 1 
ATOM   1186  O  "O3'" . C   A  1  64   ? 55.835  154.675 29.192  1.00 35.38  ? 65   C   0 "O3'" 1 
ATOM   1187  C  "C2'" . C   A  1  64   ? 55.490  155.883 31.275  1.00 37.03  ? 65   C   0 "C2'" 1 
ATOM   1188  O  "O2'" . C   A  1  64   ? 55.142  157.004 30.489  1.00 37.17  ? 65   C   0 "O2'" 1 
ATOM   1189  C  "C1'" . C   A  1  64   ? 54.451  155.703 32.383  1.00 37.42  ? 65   C   0 "C1'" 1 
ATOM   1190  N  N1    . C   A  1  64   ? 55.030  155.183 33.641  1.00 38.34  ? 65   C   0 N1    1 
ATOM   1191  C  C2    . C   A  1  64   ? 55.684  156.081 34.499  1.00 39.02  ? 65   C   0 C2    1 
ATOM   1192  O  O2    . C   A  1  64   ? 55.778  157.272 34.167  1.00 38.40  ? 65   C   0 O2    1 
ATOM   1193  N  N3    . C   A  1  64   ? 56.205  155.626 35.661  1.00 38.43  ? 65   C   0 N3    1 
ATOM   1194  C  C4    . C   A  1  64   ? 56.112  154.333 35.972  1.00 38.26  ? 65   C   0 C4    1 
ATOM   1195  N  N4    . C   A  1  64   ? 56.645  153.936 37.123  1.00 37.86  ? 65   C   0 N4    1 
ATOM   1196  C  C5    . C   A  1  64   ? 55.469  153.394 35.114  1.00 36.33  ? 65   C   0 C5    1 
ATOM   1197  C  C6    . C   A  1  64   ? 54.944  153.857 33.972  1.00 37.61  ? 65   C   0 C6    1 
ATOM   1198  P  P     . G   A  1  65   ? 57.383  154.375 28.865  1.00 38.41  ? 66   G   0 P     1 
ATOM   1199  O  OP1   . G   A  1  65   ? 57.519  154.249 27.390  1.00 39.14  ? 66   G   0 OP1   1 
ATOM   1200  O  OP2   . G   A  1  65   ? 57.823  153.255 29.735  1.00 37.51  ? 66   G   0 OP2   1 
ATOM   1201  O  "O5'" . G   A  1  65   ? 58.159  155.692 29.328  1.00 37.72  ? 66   G   0 "O5'" 1 
ATOM   1202  C  "C5'" . G   A  1  65   ? 57.708  157.007 28.931  1.00 35.42  ? 66   G   0 "C5'" 1 
ATOM   1203  C  "C4'" . G   A  1  65   ? 58.587  158.077 29.547  1.00 35.94  ? 66   G   0 "C4'" 1 
ATOM   1204  O  "O4'" . G   A  1  65   ? 58.559  157.957 30.996  1.00 34.14  ? 66   G   0 "O4'" 1 
ATOM   1205  C  "C3'" . G   A  1  65   ? 60.059  158.032 29.161  1.00 35.08  ? 66   G   0 "C3'" 1 
ATOM   1206  O  "O3'" . G   A  1  65   ? 60.586  159.349 29.273  1.00 37.11  ? 66   G   0 "O3'" 1 
ATOM   1207  C  "C2'" . G   A  1  65   ? 60.658  157.187 30.280  1.00 35.29  ? 66   G   0 "C2'" 1 
ATOM   1208  O  "O2'" . G   A  1  65   ? 62.038  157.429 30.442  1.00 33.62  ? 66   G   0 "O2'" 1 
ATOM   1209  C  "C1'" . G   A  1  65   ? 59.863  157.698 31.481  1.00 35.31  ? 66   G   0 "C1'" 1 
ATOM   1210  N  N9    . G   A  1  65   ? 59.748  156.780 32.613  1.00 34.79  ? 66   G   0 N9    1 
ATOM   1211  C  C8    . G   A  1  65   ? 58.971  155.650 32.676  1.00 36.44  ? 66   G   0 C8    1 
ATOM   1212  N  N7    . G   A  1  65   ? 59.022  155.057 33.837  1.00 37.25  ? 66   G   0 N7    1 
ATOM   1213  C  C5    . G   A  1  65   ? 59.895  155.836 34.586  1.00 36.51  ? 66   G   0 C5    1 
ATOM   1214  C  C6    . G   A  1  65   ? 60.332  155.698 35.933  1.00 34.40  ? 66   G   0 C6    1 
ATOM   1215  O  O6    . G   A  1  65   ? 60.024  154.840 36.758  1.00 35.57  ? 66   G   0 O6    1 
ATOM   1216  N  N1    . G   A  1  65   ? 61.217  156.702 36.287  1.00 34.67  ? 66   G   0 N1    1 
ATOM   1217  C  C2    . G   A  1  65   ? 61.635  157.709 35.464  1.00 33.74  ? 66   G   0 C2    1 
ATOM   1218  N  N2    . G   A  1  65   ? 62.508  158.572 35.995  1.00 34.40  ? 66   G   0 N2    1 
ATOM   1219  N  N3    . G   A  1  65   ? 61.232  157.859 34.213  1.00 35.22  ? 66   G   0 N3    1 
ATOM   1220  C  C4    . G   A  1  65   ? 60.366  156.894 33.841  1.00 34.46  ? 66   G   0 C4    1 
ATOM   1221  P  P     . A   A  1  66   ? 60.530  160.360 28.024  1.00 36.21  ? 67   A   0 P     1 
ATOM   1222  O  OP1   . A   A  1  66   ? 59.652  159.782 26.969  1.00 36.20  ? 67   A   0 OP1   1 
ATOM   1223  O  OP2   . A   A  1  66   ? 61.921  160.756 27.691  1.00 32.86  ? 67   A   0 OP2   1 
ATOM   1224  O  "O5'" . A   A  1  66   ? 59.802  161.642 28.625  1.00 34.89  ? 67   A   0 "O5'" 1 
ATOM   1225  C  "C5'" . A   A  1  66   ? 60.240  162.228 29.859  1.00 34.30  ? 67   A   0 "C5'" 1 
ATOM   1226  C  "C4'" . A   A  1  66   ? 60.617  163.674 29.644  1.00 36.63  ? 67   A   0 "C4'" 1 
ATOM   1227  O  "O4'" . A   A  1  66   ? 61.043  164.242 30.914  1.00 36.98  ? 67   A   0 "O4'" 1 
ATOM   1228  C  "C3'" . A   A  1  66   ? 61.775  163.901 28.677  1.00 34.97  ? 67   A   0 "C3'" 1 
ATOM   1229  O  "O3'" . A   A  1  66   ? 61.624  165.175 28.040  1.00 34.98  ? 67   A   0 "O3'" 1 
ATOM   1230  C  "C2'" . A   A  1  66   ? 62.977  163.903 29.617  1.00 37.15  ? 67   A   0 "C2'" 1 
ATOM   1231  O  "O2'" . A   A  1  66   ? 64.099  164.598 29.120  1.00 40.42  ? 67   A   0 "O2'" 1 
ATOM   1232  C  "C1'" . A   A  1  66   ? 62.407  164.620 30.837  1.00 37.40  ? 67   A   0 "C1'" 1 
ATOM   1233  N  N9    . A   A  1  66   ? 63.052  164.235 32.093  1.00 39.92  ? 67   A   0 N9    1 
ATOM   1234  C  C8    . A   A  1  66   ? 63.721  165.042 32.982  1.00 40.32  ? 67   A   0 C8    1 
ATOM   1235  N  N7    . A   A  1  66   ? 64.157  164.411 34.044  1.00 40.93  ? 67   A   0 N7    1 
ATOM   1236  C  C5    . A   A  1  66   ? 63.759  163.096 33.836  1.00 41.27  ? 67   A   0 C5    1 
ATOM   1237  C  C6    . A   A  1  66   ? 63.920  161.926 34.598  1.00 40.32  ? 67   A   0 C6    1 
ATOM   1238  N  N6    . A   A  1  66   ? 64.546  161.887 35.772  1.00 39.80  ? 67   A   0 N6    1 
ATOM   1239  N  N1    . A   A  1  66   ? 63.410  160.781 34.102  1.00 40.91  ? 67   A   0 N1    1 
ATOM   1240  C  C2    . A   A  1  66   ? 62.783  160.818 32.923  1.00 41.36  ? 67   A   0 C2    1 
ATOM   1241  N  N3    . A   A  1  66   ? 62.567  161.850 32.116  1.00 41.13  ? 67   A   0 N3    1 
ATOM   1242  C  C4    . A   A  1  66   ? 63.086  162.973 32.636  1.00 40.71  ? 67   A   0 C4    1 
ATOM   1243  P  P     . U   A  1  67   ? 61.579  165.280 26.432  1.00 32.25  ? 68   U   0 P     1 
ATOM   1244  O  OP1   . U   A  1  67   ? 62.524  164.322 25.818  1.00 30.32  ? 68   U   0 OP1   1 
ATOM   1245  O  OP2   . U   A  1  67   ? 61.683  166.715 26.100  1.00 36.89  ? 68   U   0 OP2   1 
ATOM   1246  O  "O5'" . U   A  1  67   ? 60.089  164.849 26.076  1.00 35.28  ? 68   U   0 "O5'" 1 
ATOM   1247  C  "C5'" . U   A  1  67   ? 58.990  165.747 26.331  1.00 35.81  ? 68   U   0 "C5'" 1 
ATOM   1248  C  "C4'" . U   A  1  67   ? 57.681  165.073 26.009  1.00 36.59  ? 68   U   0 "C4'" 1 
ATOM   1249  O  "O4'" . U   A  1  67   ? 57.740  164.581 24.645  1.00 35.64  ? 68   U   0 "O4'" 1 
ATOM   1250  C  "C3'" . U   A  1  67   ? 57.309  163.862 26.867  1.00 36.83  ? 68   U   0 "C3'" 1 
ATOM   1251  O  "O3'" . U   A  1  67   ? 55.887  163.784 26.898  1.00 35.20  ? 68   U   0 "O3'" 1 
ATOM   1252  C  "C2'" . U   A  1  67   ? 57.834  162.702 26.032  1.00 37.12  ? 68   U   0 "C2'" 1 
ATOM   1253  O  "O2'" . U   A  1  67   ? 57.164  161.490 26.311  1.00 38.19  ? 68   U   0 "O2'" 1 
ATOM   1254  C  "C1'" . U   A  1  67   ? 57.473  163.199 24.638  1.00 35.42  ? 68   U   0 "C1'" 1 
ATOM   1255  N  N1    . U   A  1  67   ? 58.151  162.586 23.490  1.00 33.94  ? 68   U   0 N1    1 
ATOM   1256  C  C2    . U   A  1  67   ? 57.397  161.733 22.714  1.00 32.32  ? 68   U   0 C2    1 
ATOM   1257  O  O2    . U   A  1  67   ? 56.250  161.434 22.996  1.00 35.63  ? 68   U   0 O2    1 
ATOM   1258  N  N3    . U   A  1  67   ? 58.033  161.235 21.607  1.00 30.98  ? 68   U   0 N3    1 
ATOM   1259  C  C4    . U   A  1  67   ? 59.335  161.478 21.214  1.00 33.35  ? 68   U   0 C4    1 
ATOM   1260  O  O4    . U   A  1  67   ? 59.767  160.940 20.192  1.00 33.98  ? 68   U   0 O4    1 
ATOM   1261  C  C5    . U   A  1  67   ? 60.072  162.347 22.087  1.00 32.18  ? 68   U   0 C5    1 
ATOM   1262  C  C6    . U   A  1  67   ? 59.469  162.860 23.171  1.00 34.29  ? 68   U   0 C6    1 
ATOM   1263  P  P     . A   A  1  68   ? 55.084  164.219 28.216  1.00 38.62  ? 69   A   0 P     1 
ATOM   1264  O  OP1   . A   A  1  68   ? 53.739  164.700 27.803  1.00 38.67  ? 69   A   0 OP1   1 
ATOM   1265  O  OP2   . A   A  1  68   ? 55.950  165.096 29.052  1.00 35.33  ? 69   A   0 OP2   1 
ATOM   1266  O  "O5'" . A   A  1  68   ? 54.853  162.829 28.956  1.00 39.36  ? 69   A   0 "O5'" 1 
ATOM   1267  C  "C5'" . A   A  1  68   ? 55.961  161.986 29.211  1.00 37.90  ? 69   A   0 "C5'" 1 
ATOM   1268  C  "C4'" . A   A  1  68   ? 55.580  160.821 30.079  1.00 35.44  ? 69   A   0 "C4'" 1 
ATOM   1269  O  "O4'" . A   A  1  68   ? 56.863  160.301 30.517  1.00 37.43  ? 69   A   0 "O4'" 1 
ATOM   1270  C  "C3'" . A   A  1  68   ? 54.800  161.127 31.360  1.00 34.93  ? 69   A   0 "C3'" 1 
ATOM   1271  O  "O3'" . A   A  1  68   ? 53.430  160.728 31.253  1.00 34.40  ? 69   A   0 "O3'" 1 
ATOM   1272  C  "C2'" . A   A  1  68   ? 55.509  160.272 32.396  1.00 34.80  ? 69   A   0 "C2'" 1 
ATOM   1273  O  "O2'" . A   A  1  68   ? 55.102  158.929 32.280  1.00 33.61  ? 69   A   0 "O2'" 1 
ATOM   1274  C  "C1'" . A   A  1  68   ? 56.953  160.377 31.918  1.00 36.38  ? 69   A   0 "C1'" 1 
ATOM   1275  N  N9    . A   A  1  68   ? 57.627  161.632 32.275  1.00 36.54  ? 69   A   0 N9    1 
ATOM   1276  C  C8    . A   A  1  68   ? 57.376  162.905 31.820  1.00 34.55  ? 69   A   0 C8    1 
ATOM   1277  N  N7    . A   A  1  68   ? 58.133  163.823 32.367  1.00 35.04  ? 69   A   0 N7    1 
ATOM   1278  C  C5    . A   A  1  68   ? 58.945  163.109 33.239  1.00 35.27  ? 69   A   0 C5    1 
ATOM   1279  C  C6    . A   A  1  68   ? 59.949  163.505 34.137  1.00 33.46  ? 69   A   0 C6    1 
ATOM   1280  N  N6    . A   A  1  68   ? 60.331  164.771 34.313  1.00 31.47  ? 69   A   0 N6    1 
ATOM   1281  N  N1    . A   A  1  68   ? 60.554  162.542 34.865  1.00 34.38  ? 69   A   0 N1    1 
ATOM   1282  C  C2    . A   A  1  68   ? 60.175  161.276 34.694  1.00 33.61  ? 69   A   0 C2    1 
ATOM   1283  N  N3    . A   A  1  68   ? 59.249  160.780 33.885  1.00 35.22  ? 69   A   0 N3    1 
ATOM   1284  C  C4    . A   A  1  68   ? 58.657  161.758 33.180  1.00 35.78  ? 69   A   0 C4    1 
ATOM   1285  P  P     . A   A  1  69   ? 52.387  161.064 32.439  1.00 34.50  ? 70   A   0 P     1 
ATOM   1286  O  OP1   . A   A  1  69   ? 51.758  162.365 32.147  1.00 38.33  ? 70   A   0 OP1   1 
ATOM   1287  O  OP2   . A   A  1  69   ? 53.060  160.863 33.747  1.00 34.08  ? 70   A   0 OP2   1 
ATOM   1288  O  "O5'" . A   A  1  69   ? 51.265  159.940 32.289  1.00 35.98  ? 70   A   0 "O5'" 1 
ATOM   1289  C  "C5'" . A   A  1  69   ? 49.870  160.240 32.502  1.00 37.47  ? 70   A   0 "C5'" 1 
ATOM   1290  C  "C4'" . A   A  1  69   ? 49.040  158.972 32.439  1.00 41.05  ? 70   A   0 "C4'" 1 
ATOM   1291  O  "O4'" . A   A  1  69   ? 49.483  158.049 33.468  1.00 39.76  ? 70   A   0 "O4'" 1 
ATOM   1292  C  "C3'" . A   A  1  69   ? 47.544  159.156 32.674  1.00 41.40  ? 70   A   0 "C3'" 1 
ATOM   1293  O  "O3'" . A   A  1  69   ? 46.837  158.104 32.018  1.00 47.26  ? 70   A   0 "O3'" 1 
ATOM   1294  C  "C2'" . A   A  1  69   ? 47.426  158.957 34.181  1.00 41.53  ? 70   A   0 "C2'" 1 
ATOM   1295  O  "O2'" . A   A  1  69   ? 46.126  158.553 34.574  1.00 38.52  ? 70   A   0 "O2'" 1 
ATOM   1296  C  "C1'" . A   A  1  69   ? 48.451  157.845 34.411  1.00 39.19  ? 70   A   0 "C1'" 1 
ATOM   1297  N  N9    . A   A  1  69   ? 49.079  157.830 35.730  1.00 41.06  ? 70   A   0 N9    1 
ATOM   1298  C  C8    . A   A  1  69   ? 49.143  156.774 36.600  1.00 40.89  ? 70   A   0 C8    1 
ATOM   1299  N  N7    . A   A  1  69   ? 49.853  157.018 37.675  1.00 41.00  ? 70   A   0 N7    1 
ATOM   1300  C  C5    . A   A  1  69   ? 50.266  158.331 37.512  1.00 41.65  ? 70   A   0 C5    1 
ATOM   1301  C  C6    . A   A  1  69   ? 51.065  159.174 38.301  1.00 41.77  ? 70   A   0 C6    1 
ATOM   1302  N  N6    . A   A  1  69   ? 51.628  158.796 39.454  1.00 40.97  ? 70   A   0 N6    1 
ATOM   1303  N  N1    . A   A  1  69   ? 51.278  160.431 37.856  1.00 41.12  ? 70   A   0 N1    1 
ATOM   1304  C  C2    . A   A  1  69   ? 50.733  160.798 36.694  1.00 40.62  ? 70   A   0 C2    1 
ATOM   1305  N  N3    . A   A  1  69   ? 49.977  160.094 35.858  1.00 41.70  ? 70   A   0 N3    1 
ATOM   1306  C  C4    . A   A  1  69   ? 49.778  158.853 36.329  1.00 41.50  ? 70   A   0 C4    1 
ATOM   1307  P  P     . G   A  1  70   ? 46.355  158.283 30.498  1.00 49.67  ? 71   G   0 P     1 
ATOM   1308  O  OP1   . G   A  1  70   ? 45.725  159.630 30.356  1.00 51.45  ? 71   G   0 OP1   1 
ATOM   1309  O  OP2   . G   A  1  70   ? 45.593  157.064 30.095  1.00 49.54  ? 71   G   0 OP2   1 
ATOM   1310  O  "O5'" . G   A  1  70   ? 47.726  158.290 29.703  1.00 49.21  ? 71   G   0 "O5'" 1 
ATOM   1311  C  "C5'" . G   A  1  70   ? 47.819  158.844 28.396  1.00 44.88  ? 71   G   0 "C5'" 1 
ATOM   1312  C  "C4'" . G   A  1  70   ? 49.031  159.723 28.315  1.00 43.15  ? 71   G   0 "C4'" 1 
ATOM   1313  O  "O4'" . G   A  1  70   ? 50.105  159.137 29.096  1.00 41.15  ? 71   G   0 "O4'" 1 
ATOM   1314  C  "C3'" . G   A  1  70   ? 49.593  159.897 26.918  1.00 41.79  ? 71   G   0 "C3'" 1 
ATOM   1315  O  "O3'" . G   A  1  70   ? 48.890  160.932 26.225  1.00 42.81  ? 71   G   0 "O3'" 1 
ATOM   1316  C  "C2'" . G   A  1  70   ? 51.054  160.212 27.215  1.00 40.65  ? 71   G   0 "C2'" 1 
ATOM   1317  O  "O2'" . G   A  1  70   ? 51.213  161.543 27.673  1.00 40.84  ? 71   G   0 "O2'" 1 
ATOM   1318  C  "C1'" . G   A  1  70   ? 51.326  159.273 28.398  1.00 39.09  ? 71   G   0 "C1'" 1 
ATOM   1319  N  N9    . G   A  1  70   ? 51.770  157.931 28.025  1.00 36.53  ? 71   G   0 N9    1 
ATOM   1320  C  C8    . G   A  1  70   ? 51.088  156.752 28.222  1.00 34.89  ? 71   G   0 C8    1 
ATOM   1321  N  N7    . G   A  1  70   ? 51.726  155.710 27.763  1.00 36.21  ? 71   G   0 N7    1 
ATOM   1322  C  C5    . G   A  1  70   ? 52.898  156.231 27.233  1.00 35.24  ? 71   G   0 C5    1 
ATOM   1323  C  C6    . G   A  1  70   ? 53.984  155.584 26.588  1.00 37.42  ? 71   G   0 C6    1 
ATOM   1324  O  O6    . G   A  1  70   ? 54.130  154.384 26.335  1.00 40.12  ? 71   G   0 O6    1 
ATOM   1325  N  N1    . G   A  1  70   ? 54.972  156.489 26.222  1.00 37.32  ? 71   G   0 N1    1 
ATOM   1326  C  C2    . G   A  1  70   ? 54.925  157.839 26.447  1.00 35.85  ? 71   G   0 C2    1 
ATOM   1327  N  N2    . G   A  1  70   ? 55.985  158.548 26.034  1.00 34.62  ? 71   G   0 N2    1 
ATOM   1328  N  N3    . G   A  1  70   ? 53.917  158.453 27.038  1.00 35.97  ? 71   G   0 N3    1 
ATOM   1329  C  C4    . G   A  1  70   ? 52.946  157.596 27.401  1.00 34.39  ? 71   G   0 C4    1 
ATOM   1330  P  P     . C   A  1  71   ? 48.319  160.664 24.737  1.00 43.17  ? 72   C   0 P     1 
ATOM   1331  O  OP1   . C   A  1  71   ? 47.366  161.764 24.436  1.00 41.16  ? 72   C   0 OP1   1 
ATOM   1332  O  OP2   . C   A  1  71   ? 47.872  159.258 24.593  1.00 43.07  ? 72   C   0 OP2   1 
ATOM   1333  O  "O5'" . C   A  1  71   ? 49.603  160.829 23.813  1.00 41.85  ? 72   C   0 "O5'" 1 
ATOM   1334  C  "C5'" . C   A  1  71   ? 50.198  162.115 23.604  1.00 41.89  ? 72   C   0 "C5'" 1 
ATOM   1335  C  "C4'" . C   A  1  71   ? 51.214  162.030 22.500  1.00 43.14  ? 72   C   0 "C4'" 1 
ATOM   1336  O  "O4'" . C   A  1  71   ? 52.353  161.252 22.956  1.00 42.25  ? 72   C   0 "O4'" 1 
ATOM   1337  C  "C3'" . C   A  1  71   ? 50.742  161.293 21.259  1.00 42.00  ? 72   C   0 "C3'" 1 
ATOM   1338  O  "O3'" . C   A  1  71   ? 49.927  162.101 20.417  1.00 41.53  ? 72   C   0 "O3'" 1 
ATOM   1339  C  "C2'" . C   A  1  71   ? 52.059  160.858 20.636  1.00 41.99  ? 72   C   0 "C2'" 1 
ATOM   1340  O  "O2'" . C   A  1  71   ? 52.728  161.917 19.984  1.00 42.03  ? 72   C   0 "O2'" 1 
ATOM   1341  C  "C1'" . C   A  1  71   ? 52.851  160.463 21.886  1.00 41.65  ? 72   C   0 "C1'" 1 
ATOM   1342  N  N1    . C   A  1  71   ? 52.690  159.036 22.243  1.00 42.69  ? 72   C   0 N1    1 
ATOM   1343  C  C2    . C   A  1  71   ? 53.326  158.066 21.455  1.00 42.86  ? 72   C   0 C2    1 
ATOM   1344  O  O2    . C   A  1  71   ? 54.030  158.432 20.501  1.00 44.67  ? 72   C   0 O2    1 
ATOM   1345  N  N3    . C   A  1  71   ? 53.164  156.759 21.755  1.00 41.25  ? 72   C   0 N3    1 
ATOM   1346  C  C4    . C   A  1  71   ? 52.419  156.403 22.802  1.00 41.53  ? 72   C   0 C4    1 
ATOM   1347  N  N4    . C   A  1  71   ? 52.291  155.101 23.057  1.00 41.24  ? 72   C   0 N4    1 
ATOM   1348  C  C5    . C   A  1  71   ? 51.771  157.366 23.631  1.00 39.74  ? 72   C   0 C5    1 
ATOM   1349  C  C6    . C   A  1  71   ? 51.929  158.656 23.318  1.00 40.97  ? 72   C   0 C6    1 
ATOM   1350  P  P     . C   A  1  72   ? 48.720  161.422 19.589  1.00 42.53  ? 73   C   0 P     1 
ATOM   1351  O  OP1   . C   A  1  72   ? 47.924  162.519 18.999  1.00 39.53  ? 73   C   0 OP1   1 
ATOM   1352  O  OP2   . C   A  1  72   ? 48.045  160.402 20.439  1.00 40.68  ? 73   C   0 OP2   1 
ATOM   1353  O  "O5'" . C   A  1  72   ? 49.468  160.643 18.419  1.00 41.32  ? 73   C   0 "O5'" 1 
ATOM   1354  C  "C5'" . C   A  1  72   ? 50.330  161.342 17.505  1.00 41.76  ? 73   C   0 "C5'" 1 
ATOM   1355  C  "C4'" . C   A  1  72   ? 50.889  160.383 16.486  1.00 41.78  ? 73   C   0 "C4'" 1 
ATOM   1356  O  "O4'" . C   A  1  72   ? 51.765  159.444 17.153  1.00 42.95  ? 73   C   0 "O4'" 1 
ATOM   1357  C  "C3'" . C   A  1  72   ? 49.862  159.496 15.799  1.00 42.66  ? 73   C   0 "C3'" 1 
ATOM   1358  O  "O3'" . C   A  1  72   ? 49.208  160.158 14.729  1.00 43.70  ? 73   C   0 "O3'" 1 
ATOM   1359  C  "C2'" . C   A  1  72   ? 50.703  158.311 15.345  1.00 42.16  ? 73   C   0 "C2'" 1 
ATOM   1360  O  "O2'" . C   A  1  72   ? 51.430  158.537 14.160  1.00 39.53  ? 73   C   0 "O2'" 1 
ATOM   1361  C  "C1'" . C   A  1  72   ? 51.676  158.178 16.517  1.00 43.13  ? 73   C   0 "C1'" 1 
ATOM   1362  N  N1    . C   A  1  72   ? 51.256  157.170 17.505  1.00 41.64  ? 73   C   0 N1    1 
ATOM   1363  C  C2    . C   A  1  72   ? 51.486  155.830 17.216  1.00 41.94  ? 73   C   0 C2    1 
ATOM   1364  O  O2    . C   A  1  72   ? 52.000  155.537 16.127  1.00 41.72  ? 73   C   0 O2    1 
ATOM   1365  N  N3    . C   A  1  72   ? 51.144  154.886 18.124  1.00 42.92  ? 73   C   0 N3    1 
ATOM   1366  C  C4    . C   A  1  72   ? 50.585  155.247 19.282  1.00 42.60  ? 73   C   0 C4    1 
ATOM   1367  N  N4    . C   A  1  72   ? 50.283  154.286 20.156  1.00 42.61  ? 73   C   0 N4    1 
ATOM   1368  C  C5    . C   A  1  72   ? 50.318  156.610 19.595  1.00 42.01  ? 73   C   0 C5    1 
ATOM   1369  C  C6    . C   A  1  72   ? 50.665  157.531 18.686  1.00 42.47  ? 73   C   0 C6    1 
ATOM   1370  P  P     . A   A  1  73   ? 47.796  159.611 14.202  1.00 43.96  ? 74   A   0 P     1 
ATOM   1371  O  OP1   . A   A  1  73   ? 47.380  160.536 13.128  1.00 45.04  ? 74   A   0 OP1   1 
ATOM   1372  O  OP2   . A   A  1  73   ? 46.892  159.384 15.349  1.00 46.39  ? 74   A   0 OP2   1 
ATOM   1373  O  "O5'" . A   A  1  73   ? 48.161  158.198 13.559  1.00 44.96  ? 74   A   0 "O5'" 1 
ATOM   1374  C  "C5'" . A   A  1  73   ? 48.970  158.122 12.365  1.00 44.99  ? 74   A   0 "C5'" 1 
ATOM   1375  C  "C4'" . A   A  1  73   ? 49.080  156.691 11.882  1.00 46.38  ? 74   A   0 "C4'" 1 
ATOM   1376  O  "O4'" . A   A  1  73   ? 49.830  155.900 12.841  1.00 46.72  ? 74   A   0 "O4'" 1 
ATOM   1377  C  "C3'" . A   A  1  73   ? 47.778  155.926 11.711  1.00 46.75  ? 74   A   0 "C3'" 1 
ATOM   1378  O  "O3'" . A   A  1  73   ? 47.143  156.237 10.475  1.00 47.67  ? 74   A   0 "O3'" 1 
ATOM   1379  C  "C2'" . A   A  1  73   ? 48.249  154.479 11.775  1.00 46.25  ? 74   A   0 "C2'" 1 
ATOM   1380  O  "O2'" . A   A  1  73   ? 48.837  154.035 10.571  1.00 46.48  ? 74   A   0 "O2'" 1 
ATOM   1381  C  "C1'" . A   A  1  73   ? 49.340  154.569 12.844  1.00 45.95  ? 74   A   0 "C1'" 1 
ATOM   1382  N  N9    . A   A  1  73   ? 48.851  154.262 14.188  1.00 44.17  ? 74   A   0 N9    1 
ATOM   1383  C  C8    . A   A  1  73   ? 48.460  155.137 15.173  1.00 42.98  ? 74   A   0 C8    1 
ATOM   1384  N  N7    . A   A  1  73   ? 48.080  154.551 16.282  1.00 42.39  ? 74   A   0 N7    1 
ATOM   1385  C  C5    . A   A  1  73   ? 48.231  153.197 16.011  1.00 43.68  ? 74   A   0 C5    1 
ATOM   1386  C  C6    . A   A  1  73   ? 48.009  152.044 16.788  1.00 42.92  ? 74   A   0 C6    1 
ATOM   1387  N  N6    . A   A  1  73   ? 47.584  152.073 18.052  1.00 41.69  ? 74   A   0 N6    1 
ATOM   1388  N  N1    . A   A  1  73   ? 48.249  150.847 16.215  1.00 42.30  ? 74   A   0 N1    1 
ATOM   1389  C  C2    . A   A  1  73   ? 48.690  150.818 14.951  1.00 42.62  ? 74   A   0 C2    1 
ATOM   1390  N  N3    . A   A  1  73   ? 48.946  151.828 14.123  1.00 42.53  ? 74   A   0 N3    1 
ATOM   1391  C  C4    . A   A  1  73   ? 48.695  153.005 14.721  1.00 43.63  ? 74   A   0 C4    1 
ATOM   1392  P  P     . U   A  1  74   ? 45.537  156.200 10.370  1.00 48.47  ? 75   U   0 P     1 
ATOM   1393  O  OP1   . U   A  1  74   ? 45.184  156.785 9.050   1.00 50.00  ? 75   U   0 OP1   1 
ATOM   1394  O  OP2   . U   A  1  74   ? 44.951  156.783 11.604  1.00 46.73  ? 75   U   0 OP2   1 
ATOM   1395  O  "O5'" . U   A  1  74   ? 45.209  154.644 10.323  1.00 47.83  ? 75   U   0 "O5'" 1 
ATOM   1396  C  "C5'" . U   A  1  74   ? 45.671  153.837 9.227   1.00 47.40  ? 75   U   0 "C5'" 1 
ATOM   1397  C  "C4'" . U   A  1  74   ? 45.472  152.369 9.526   1.00 48.64  ? 75   U   0 "C4'" 1 
ATOM   1398  O  "O4'" . U   A  1  74   ? 46.372  151.946 10.587  1.00 47.32  ? 75   U   0 "O4'" 1 
ATOM   1399  C  "C3'" . U   A  1  74   ? 44.099  151.955 10.032  1.00 48.30  ? 75   U   0 "C3'" 1 
ATOM   1400  O  "O3'" . U   A  1  74   ? 43.133  151.841 9.000   1.00 50.43  ? 75   U   0 "O3'" 1 
ATOM   1401  C  "C2'" . U   A  1  74   ? 44.411  150.617 10.678  1.00 48.40  ? 75   U   0 "C2'" 1 
ATOM   1402  O  "O2'" . U   A  1  74   ? 44.610  149.591 9.728   1.00 48.48  ? 75   U   0 "O2'" 1 
ATOM   1403  C  "C1'" . U   A  1  74   ? 45.742  150.932 11.362  1.00 47.77  ? 75   U   0 "C1'" 1 
ATOM   1404  N  N1    . U   A  1  74   ? 45.520  151.443 12.726  1.00 46.65  ? 75   U   0 N1    1 
ATOM   1405  C  C2    . U   A  1  74   ? 45.394  150.518 13.756  1.00 45.46  ? 75   U   0 C2    1 
ATOM   1406  O  O2    . U   A  1  74   ? 45.462  149.311 13.583  1.00 44.46  ? 75   U   0 O2    1 
ATOM   1407  N  N3    . U   A  1  74   ? 45.177  151.062 14.999  1.00 44.14  ? 75   U   0 N3    1 
ATOM   1408  C  C4    . U   A  1  74   ? 45.064  152.398 15.313  1.00 42.64  ? 75   U   0 C4    1 
ATOM   1409  O  O4    . U   A  1  74   ? 44.829  152.726 16.472  1.00 41.11  ? 75   U   0 O4    1 
ATOM   1410  C  C5    . U   A  1  74   ? 45.204  153.287 14.202  1.00 44.45  ? 75   U   0 C5    1 
ATOM   1411  C  C6    . U   A  1  74   ? 45.425  152.795 12.980  1.00 46.03  ? 75   U   0 C6    1 
ATOM   1412  P  P     . G   A  1  75   ? 41.579  152.127 9.324   1.00 54.14  ? 76   G   0 P     1 
ATOM   1413  O  OP1   . G   A  1  75   ? 40.867  152.063 8.016   1.00 55.03  ? 76   G   0 OP1   1 
ATOM   1414  O  OP2   . G   A  1  75   ? 41.443  153.344 10.168  1.00 53.55  ? 76   G   0 OP2   1 
ATOM   1415  O  "O5'" . G   A  1  75   ? 41.126  150.874 10.200  1.00 53.85  ? 76   G   0 "O5'" 1 
ATOM   1416  C  "C5'" . G   A  1  75   ? 41.065  149.557 9.616   1.00 55.27  ? 76   G   0 "C5'" 1 
ATOM   1417  C  "C4'" . G   A  1  75   ? 40.871  148.500 10.683  1.00 55.29  ? 76   G   0 "C4'" 1 
ATOM   1418  O  "O4'" . G   A  1  75   ? 41.994  148.538 11.602  1.00 53.94  ? 76   G   0 "O4'" 1 
ATOM   1419  C  "C3'" . G   A  1  75   ? 39.662  148.638 11.595  1.00 55.35  ? 76   G   0 "C3'" 1 
ATOM   1420  O  "O3'" . G   A  1  75   ? 38.449  148.178 11.011  1.00 56.96  ? 76   G   0 "O3'" 1 
ATOM   1421  C  "C2'" . G   A  1  75   ? 40.077  147.783 12.778  1.00 54.25  ? 76   G   0 "C2'" 1 
ATOM   1422  O  "O2'" . G   A  1  75   ? 39.965  146.403 12.509  1.00 56.43  ? 76   G   0 "O2'" 1 
ATOM   1423  C  "C1'" . G   A  1  75   ? 41.555  148.157 12.897  1.00 53.94  ? 76   G   0 "C1'" 1 
ATOM   1424  N  N9    . G   A  1  75   ? 41.729  149.287 13.806  1.00 52.27  ? 76   G   0 N9    1 
ATOM   1425  C  C8    . G   A  1  75   ? 42.058  150.585 13.492  1.00 50.91  ? 76   G   0 C8    1 
ATOM   1426  N  N7    . G   A  1  75   ? 42.081  151.371 14.533  1.00 50.58  ? 76   G   0 N7    1 
ATOM   1427  C  C5    . G   A  1  75   ? 41.759  150.540 15.598  1.00 50.13  ? 76   G   0 C5    1 
ATOM   1428  C  C6    . G   A  1  75   ? 41.607  150.827 16.977  1.00 48.87  ? 76   G   0 C6    1 
ATOM   1429  O  O6    . G   A  1  75   ? 41.726  151.908 17.557  1.00 48.07  ? 76   G   0 O6    1 
ATOM   1430  N  N1    . G   A  1  75   ? 41.270  149.688 17.700  1.00 49.06  ? 76   G   0 N1    1 
ATOM   1431  C  C2    . G   A  1  75   ? 41.094  148.435 17.165  1.00 50.04  ? 76   G   0 C2    1 
ATOM   1432  N  N2    . G   A  1  75   ? 40.769  147.456 18.017  1.00 50.97  ? 76   G   0 N2    1 
ATOM   1433  N  N3    . G   A  1  75   ? 41.225  148.159 15.886  1.00 50.61  ? 76   G   0 N3    1 
ATOM   1434  C  C4    . G   A  1  75   ? 41.554  149.250 15.166  1.00 50.96  ? 76   G   0 C4    1 
ATOM   1435  P  P     . G   A  1  76   ? 37.065  148.919 11.375  1.00 60.00  ? 77   G   0 P     1 
ATOM   1436  O  OP1   . G   A  1  76   ? 36.044  148.404 10.427  1.00 60.25  ? 77   G   0 OP1   1 
ATOM   1437  O  OP2   . G   A  1  76   ? 37.300  150.382 11.474  1.00 59.01  ? 77   G   0 OP2   1 
ATOM   1438  O  "O5'" . G   A  1  76   ? 36.718  148.426 12.853  1.00 57.27  ? 77   G   0 "O5'" 1 
ATOM   1439  C  "C5'" . G   A  1  76   ? 36.605  147.027 13.158  1.00 55.13  ? 77   G   0 "C5'" 1 
ATOM   1440  C  "C4'" . G   A  1  76   ? 36.595  146.809 14.654  1.00 53.70  ? 77   G   0 "C4'" 1 
ATOM   1441  O  "O4'" . G   A  1  76   ? 37.822  147.332 15.228  1.00 52.71  ? 77   G   0 "O4'" 1 
ATOM   1442  C  "C3'" . G   A  1  76   ? 35.519  147.512 15.467  1.00 53.19  ? 77   G   0 "C3'" 1 
ATOM   1443  O  "O3'" . G   A  1  76   ? 34.260  146.851 15.418  1.00 53.82  ? 77   G   0 "O3'" 1 
ATOM   1444  C  "C2'" . G   A  1  76   ? 36.107  147.437 16.867  1.00 52.54  ? 77   G   0 "C2'" 1 
ATOM   1445  O  "O2'" . G   A  1  76   ? 35.957  146.161 17.450  1.00 53.91  ? 77   G   0 "O2'" 1 
ATOM   1446  C  "C1'" . G   A  1  76   ? 37.588  147.691 16.582  1.00 51.87  ? 77   G   0 "C1'" 1 
ATOM   1447  N  N9    . G   A  1  76   ? 37.933  149.098 16.781  1.00 50.44  ? 77   G   0 N9    1 
ATOM   1448  C  C8    . G   A  1  76   ? 38.239  150.041 15.827  1.00 48.50  ? 77   G   0 C8    1 
ATOM   1449  N  N7    . G   A  1  76   ? 38.477  151.220 16.334  1.00 48.17  ? 77   G   0 N7    1 
ATOM   1450  C  C5    . G   A  1  76   ? 38.326  151.045 17.704  1.00 49.71  ? 77   G   0 C5    1 
ATOM   1451  C  C6    . G   A  1  76   ? 38.461  151.971 18.780  1.00 49.39  ? 77   G   0 C6    1 
ATOM   1452  O  O6    . G   A  1  76   ? 38.754  153.167 18.735  1.00 49.67  ? 77   G   0 O6    1 
ATOM   1453  N  N1    . G   A  1  76   ? 38.213  151.369 20.008  1.00 49.53  ? 77   G   0 N1    1 
ATOM   1454  C  C2    . G   A  1  76   ? 37.879  150.051 20.187  1.00 49.19  ? 77   G   0 C2    1 
ATOM   1455  N  N2    . G   A  1  76   ? 37.666  149.664 21.451  1.00 48.96  ? 77   G   0 N2    1 
ATOM   1456  N  N3    . G   A  1  76   ? 37.760  149.179 19.201  1.00 48.01  ? 77   G   0 N3    1 
ATOM   1457  C  C4    . G   A  1  76   ? 37.994  149.741 17.995  1.00 49.12  ? 77   G   0 C4    1 
ATOM   1458  P  P     . G   A  1  77   ? 32.907  147.691 15.669  1.00 54.49  ? 78   G   0 P     1 
ATOM   1459  O  OP1   . G   A  1  77   ? 31.802  146.706 15.826  1.00 54.13  ? 78   G   0 OP1   1 
ATOM   1460  O  OP2   . G   A  1  77   ? 32.810  148.749 14.626  1.00 51.39  ? 78   G   0 OP2   1 
ATOM   1461  O  "O5'" . G   A  1  77   ? 33.144  148.433 17.063  1.00 52.57  ? 78   G   0 "O5'" 1 
ATOM   1462  C  "C5'" . G   A  1  77   ? 33.094  147.732 18.323  1.00 47.99  ? 78   G   0 "C5'" 1 
ATOM   1463  C  "C4'" . G   A  1  77   ? 33.193  148.721 19.464  1.00 47.06  ? 78   G   0 "C4'" 1 
ATOM   1464  O  "O4'" . G   A  1  77   ? 34.475  149.399 19.408  1.00 47.75  ? 78   G   0 "O4'" 1 
ATOM   1465  C  "C3'" . G   A  1  77   ? 32.172  149.844 19.414  1.00 46.95  ? 78   G   0 "C3'" 1 
ATOM   1466  O  "O3'" . G   A  1  77   ? 30.952  149.426 20.010  1.00 46.13  ? 78   G   0 "O3'" 1 
ATOM   1467  C  "C2'" . G   A  1  77   ? 32.861  150.966 20.183  1.00 46.39  ? 78   G   0 "C2'" 1 
ATOM   1468  O  "O2'" . G   A  1  77   ? 32.764  150.809 21.582  1.00 45.98  ? 78   G   0 "O2'" 1 
ATOM   1469  C  "C1'" . G   A  1  77   ? 34.319  150.765 19.762  1.00 47.00  ? 78   G   0 "C1'" 1 
ATOM   1470  N  N9    . G   A  1  77   ? 34.754  151.580 18.626  1.00 48.05  ? 78   G   0 N9    1 
ATOM   1471  C  C8    . G   A  1  77   ? 34.695  151.235 17.298  1.00 47.28  ? 78   G   0 C8    1 
ATOM   1472  N  N7    . G   A  1  77   ? 35.177  152.152 16.507  1.00 48.13  ? 78   G   0 N7    1 
ATOM   1473  C  C5    . G   A  1  77   ? 35.575  153.171 17.360  1.00 48.06  ? 78   G   0 C5    1 
ATOM   1474  C  C6    . G   A  1  77   ? 36.184  154.427 17.075  1.00 48.99  ? 78   G   0 C6    1 
ATOM   1475  O  O6    . G   A  1  77   ? 36.497  154.904 15.974  1.00 49.67  ? 78   G   0 O6    1 
ATOM   1476  N  N1    . G   A  1  77   ? 36.428  155.152 18.236  1.00 48.82  ? 78   G   0 N1    1 
ATOM   1477  C  C2    . G   A  1  77   ? 36.131  154.728 19.507  1.00 48.80  ? 78   G   0 C2    1 
ATOM   1478  N  N2    . G   A  1  77   ? 36.450  155.572 20.495  1.00 47.87  ? 78   G   0 N2    1 
ATOM   1479  N  N3    . G   A  1  77   ? 35.565  153.562 19.788  1.00 48.65  ? 78   G   0 N3    1 
ATOM   1480  C  C4    . G   A  1  77   ? 35.317  152.839 18.673  1.00 48.02  ? 78   G   0 C4    1 
ATOM   1481  P  P     . G   A  1  78   ? 29.554  149.963 19.433  1.00 46.98  ? 79   G   0 P     1 
ATOM   1482  O  OP1   . G   A  1  78   ? 28.475  149.124 20.026  1.00 48.15  ? 79   G   0 OP1   1 
ATOM   1483  O  OP2   . G   A  1  78   ? 29.683  150.061 17.954  1.00 48.53  ? 79   G   0 OP2   1 
ATOM   1484  O  "O5'" . G   A  1  78   ? 29.418  151.426 20.038  1.00 43.36  ? 79   G   0 "O5'" 1 
ATOM   1485  C  "C5'" . G   A  1  78   ? 29.419  151.634 21.457  1.00 41.39  ? 79   G   0 "C5'" 1 
ATOM   1486  C  "C4'" . G   A  1  78   ? 29.791  153.057 21.767  1.00 40.68  ? 79   G   0 "C4'" 1 
ATOM   1487  O  "O4'" . G   A  1  78   ? 31.102  153.332 21.219  1.00 41.26  ? 79   G   0 "O4'" 1 
ATOM   1488  C  "C3'" . G   A  1  78   ? 28.887  154.100 21.133  1.00 40.83  ? 79   G   0 "C3'" 1 
ATOM   1489  O  "O3'" . G   A  1  78   ? 27.728  154.266 21.947  1.00 43.44  ? 79   G   0 "O3'" 1 
ATOM   1490  C  "C2'" . G   A  1  78   ? 29.799  155.321 21.041  1.00 40.65  ? 79   G   0 "C2'" 1 
ATOM   1491  O  "O2'" . G   A  1  78   ? 29.946  156.037 22.247  1.00 38.39  ? 79   G   0 "O2'" 1 
ATOM   1492  C  "C1'" . G   A  1  78   ? 31.142  154.662 20.724  1.00 42.44  ? 79   G   0 "C1'" 1 
ATOM   1493  N  N9    . G   A  1  78   ? 31.494  154.616 19.305  1.00 43.83  ? 79   G   0 N9    1 
ATOM   1494  C  C8    . G   A  1  78   ? 31.050  153.719 18.362  1.00 44.14  ? 79   G   0 C8    1 
ATOM   1495  N  N7    . G   A  1  78   ? 31.591  153.900 17.187  1.00 45.12  ? 79   G   0 N7    1 
ATOM   1496  C  C5    . G   A  1  78   ? 32.433  154.991 17.360  1.00 45.93  ? 79   G   0 C5    1 
ATOM   1497  C  C6    . G   A  1  78   ? 33.297  155.645 16.439  1.00 45.42  ? 79   G   0 C6    1 
ATOM   1498  O  O6    . G   A  1  78   ? 33.502  155.380 15.248  1.00 46.09  ? 79   G   0 O6    1 
ATOM   1499  N  N1    . G   A  1  78   ? 33.969  156.704 17.035  1.00 45.32  ? 79   G   0 N1    1 
ATOM   1500  C  C2    . G   A  1  78   ? 33.834  157.090 18.346  1.00 46.31  ? 79   G   0 C2    1 
ATOM   1501  N  N2    . G   A  1  78   ? 34.582  158.137 18.741  1.00 45.38  ? 79   G   0 N2    1 
ATOM   1502  N  N3    . G   A  1  78   ? 33.031  156.494 19.211  1.00 45.99  ? 79   G   0 N3    1 
ATOM   1503  C  C4    . G   A  1  78   ? 32.371  155.456 18.657  1.00 44.99  ? 79   G   0 C4    1 
ATOM   1504  P  P     . A   A  1  79   ? 26.607  155.347 21.559  1.00 43.72  ? 80   A   0 P     1 
ATOM   1505  O  OP1   . A   A  1  79   ? 25.299  154.839 22.044  1.00 43.91  ? 80   A   0 OP1   1 
ATOM   1506  O  OP2   . A   A  1  79   ? 26.765  155.702 20.124  1.00 46.38  ? 80   A   0 OP2   1 
ATOM   1507  O  "O5'" . A   A  1  79   ? 27.002  156.608 22.447  1.00 42.28  ? 80   A   0 "O5'" 1 
ATOM   1508  C  "C5'" . A   A  1  79   ? 27.181  156.471 23.871  1.00 41.60  ? 80   A   0 "C5'" 1 
ATOM   1509  C  "C4'" . A   A  1  79   ? 27.636  157.778 24.478  1.00 40.41  ? 80   A   0 "C4'" 1 
ATOM   1510  O  "O4'" . A   A  1  79   ? 28.918  158.165 23.906  1.00 38.66  ? 80   A   0 "O4'" 1 
ATOM   1511  C  "C3'" . A   A  1  79   ? 26.709  158.967 24.261  1.00 39.41  ? 80   A   0 "C3'" 1 
ATOM   1512  O  "O3'" . A   A  1  79   ? 26.850  159.850 25.362  1.00 40.10  ? 80   A   0 "O3'" 1 
ATOM   1513  C  "C2'" . A   A  1  79   ? 27.326  159.639 23.043  1.00 39.86  ? 80   A   0 "C2'" 1 
ATOM   1514  O  "O2'" . A   A  1  79   ? 27.004  161.012 22.924  1.00 40.93  ? 80   A   0 "O2'" 1 
ATOM   1515  C  "C1'" . A   A  1  79   ? 28.808  159.459 23.353  1.00 38.97  ? 80   A   0 "C1'" 1 
ATOM   1516  N  N9    . A   A  1  79   ? 29.710  159.562 22.210  1.00 39.29  ? 80   A   0 N9    1 
ATOM   1517  C  C8    . A   A  1  79   ? 29.581  159.028 20.952  1.00 37.91  ? 80   A   0 C8    1 
ATOM   1518  N  N7    . A   A  1  79   ? 30.581  159.313 20.154  1.00 39.44  ? 80   A   0 N7    1 
ATOM   1519  C  C5    . A   A  1  79   ? 31.425  160.089 20.937  1.00 37.69  ? 80   A   0 C5    1 
ATOM   1520  C  C6    . A   A  1  79   ? 32.652  160.720 20.670  1.00 37.73  ? 80   A   0 C6    1 
ATOM   1521  N  N6    . A   A  1  79   ? 33.254  160.696 19.479  1.00 35.11  ? 80   A   0 N6    1 
ATOM   1522  N  N1    . A   A  1  79   ? 33.241  161.400 21.678  1.00 39.29  ? 80   A   0 N1    1 
ATOM   1523  C  C2    . A   A  1  79   ? 32.617  161.463 22.862  1.00 40.40  ? 80   A   0 C2    1 
ATOM   1524  N  N3    . A   A  1  79   ? 31.451  160.934 23.227  1.00 41.11  ? 80   A   0 N3    1 
ATOM   1525  C  C4    . A   A  1  79   ? 30.902  160.247 22.207  1.00 39.78  ? 80   A   0 C4    1 
ATOM   1526  P  P     . G   A  1  80   ? 26.070  159.552 26.723  1.00 42.88  ? 81   G   0 P     1 
ATOM   1527  O  OP1   . G   A  1  80   ? 24.820  158.808 26.396  1.00 42.77  ? 81   G   0 OP1   1 
ATOM   1528  O  OP2   . G   A  1  80   ? 25.990  160.827 27.484  1.00 39.19  ? 81   G   0 OP2   1 
ATOM   1529  O  "O5'" . G   A  1  80   ? 27.030  158.528 27.477  1.00 43.02  ? 81   G   0 "O5'" 1 
ATOM   1530  C  "C5'" . G   A  1  80   ? 28.099  158.990 28.324  1.00 40.69  ? 81   G   0 "C5'" 1 
ATOM   1531  C  "C4'" . G   A  1  80   ? 29.436  158.635 27.713  1.00 40.12  ? 81   G   0 "C4'" 1 
ATOM   1532  O  "O4'" . G   A  1  80   ? 29.630  159.397 26.487  1.00 36.86  ? 81   G   0 "O4'" 1 
ATOM   1533  C  "C3'" . G   A  1  80   ? 30.652  158.961 28.570  1.00 38.57  ? 81   G   0 "C3'" 1 
ATOM   1534  O  "O3'" . G   A  1  80   ? 30.939  157.925 29.513  1.00 39.01  ? 81   G   0 "O3'" 1 
ATOM   1535  C  "C2'" . G   A  1  80   ? 31.734  159.150 27.518  1.00 37.09  ? 81   G   0 "C2'" 1 
ATOM   1536  O  "O2'" . G   A  1  80   ? 32.203  157.919 27.003  1.00 35.56  ? 81   G   0 "O2'" 1 
ATOM   1537  C  "C1'" . G   A  1  80   ? 30.949  159.918 26.449  1.00 36.58  ? 81   G   0 "C1'" 1 
ATOM   1538  N  N9    . G   A  1  80   ? 30.882  161.341 26.782  1.00 35.65  ? 81   G   0 N9    1 
ATOM   1539  C  C8    . G   A  1  80   ? 29.782  162.048 27.209  1.00 34.92  ? 81   G   0 C8    1 
ATOM   1540  N  N7    . G   A  1  80   ? 30.056  163.289 27.511  1.00 33.87  ? 81   G   0 N7    1 
ATOM   1541  C  C5    . G   A  1  80   ? 31.412  163.417 27.252  1.00 34.11  ? 81   G   0 C5    1 
ATOM   1542  C  C6    . G   A  1  80   ? 32.278  164.532 27.408  1.00 36.29  ? 81   G   0 C6    1 
ATOM   1543  O  O6    . G   A  1  80   ? 32.009  165.663 27.844  1.00 37.65  ? 81   G   0 O6    1 
ATOM   1544  N  N1    . G   A  1  80   ? 33.578  164.231 27.007  1.00 32.91  ? 81   G   0 N1    1 
ATOM   1545  C  C2    . G   A  1  80   ? 33.994  163.014 26.528  1.00 34.54  ? 81   G   0 C2    1 
ATOM   1546  N  N2    . G   A  1  80   ? 35.283  162.925 26.167  1.00 34.95  ? 81   G   0 N2    1 
ATOM   1547  N  N3    . G   A  1  80   ? 33.203  161.960 26.401  1.00 35.05  ? 81   G   0 N3    1 
ATOM   1548  C  C4    . G   A  1  80   ? 31.934  162.232 26.776  1.00 35.48  ? 81   G   0 C4    1 
ATOM   1549  P  P     . C   A  1  81   ? 31.436  158.307 30.998  1.00 38.85  ? 82   C   0 P     1 
ATOM   1550  O  OP1   . C   A  1  81   ? 31.230  157.102 31.848  1.00 38.75  ? 82   C   0 OP1   1 
ATOM   1551  O  OP2   . C   A  1  81   ? 30.810  159.606 31.398  1.00 35.77  ? 82   C   0 OP2   1 
ATOM   1552  O  "O5'" . C   A  1  81   ? 33.005  158.551 30.833  1.00 37.70  ? 82   C   0 "O5'" 1 
ATOM   1553  C  "C5'" . C   A  1  81   ? 33.816  157.697 30.000  1.00 36.86  ? 82   C   0 "C5'" 1 
ATOM   1554  C  "C4'" . C   A  1  81   ? 35.093  158.413 29.601  1.00 38.60  ? 82   C   0 "C4'" 1 
ATOM   1555  O  "O4'" . C   A  1  81   ? 34.769  159.585 28.800  1.00 37.02  ? 82   C   0 "O4'" 1 
ATOM   1556  C  "C3'" . C   A  1  81   ? 35.920  158.970 30.754  1.00 39.01  ? 82   C   0 "C3'" 1 
ATOM   1557  O  "O3'" . C   A  1  81   ? 36.764  157.971 31.330  1.00 40.39  ? 82   C   0 "O3'" 1 
ATOM   1558  C  "C2'" . C   A  1  81   ? 36.720  160.077 30.078  1.00 37.92  ? 82   C   0 "C2'" 1 
ATOM   1559  O  "O2'" . C   A  1  81   ? 37.850  159.591 29.379  1.00 37.48  ? 82   C   0 "O2'" 1 
ATOM   1560  C  "C1'" . C   A  1  81   ? 35.692  160.628 29.085  1.00 36.62  ? 82   C   0 "C1'" 1 
ATOM   1561  N  N1    . C   A  1  81   ? 34.951  161.805 29.587  1.00 35.63  ? 82   C   0 N1    1 
ATOM   1562  C  C2    . C   A  1  81   ? 35.626  163.038 29.687  1.00 34.59  ? 82   C   0 C2    1 
ATOM   1563  O  O2    . C   A  1  81   ? 36.822  163.099 29.360  1.00 34.16  ? 82   C   0 O2    1 
ATOM   1564  N  N3    . C   A  1  81   ? 34.955  164.125 30.137  1.00 33.91  ? 82   C   0 N3    1 
ATOM   1565  C  C4    . C   A  1  81   ? 33.665  164.022 30.476  1.00 34.88  ? 82   C   0 C4    1 
ATOM   1566  N  N4    . C   A  1  81   ? 33.042  165.121 30.905  1.00 33.25  ? 82   C   0 N4    1 
ATOM   1567  C  C5    . C   A  1  81   ? 32.957  162.786 30.388  1.00 34.22  ? 82   C   0 C5    1 
ATOM   1568  C  C6    . C   A  1  81   ? 33.632  161.713 29.947  1.00 35.97  ? 82   C   0 C6    1 
ATOM   1569  P  P     . C   A  1  82   ? 37.286  158.134 32.844  1.00 39.41  ? 83   C   0 P     1 
ATOM   1570  O  OP1   . C   A  1  82   ? 38.098  156.927 33.118  1.00 40.09  ? 83   C   0 OP1   1 
ATOM   1571  O  OP2   . C   A  1  82   ? 36.147  158.482 33.741  1.00 39.24  ? 83   C   0 OP2   1 
ATOM   1572  O  "O5'" . C   A  1  82   ? 38.262  159.390 32.799  1.00 40.14  ? 83   C   0 "O5'" 1 
ATOM   1573  C  "C5'" . C   A  1  82   ? 39.538  159.307 32.147  1.00 39.69  ? 83   C   0 "C5'" 1 
ATOM   1574  C  "C4'" . C   A  1  82   ? 40.310  160.582 32.362  1.00 39.55  ? 83   C   0 "C4'" 1 
ATOM   1575  O  "O4'" . C   A  1  82   ? 39.599  161.687 31.742  1.00 40.54  ? 83   C   0 "O4'" 1 
ATOM   1576  C  "C3'" . C   A  1  82   ? 40.455  161.031 33.806  1.00 40.24  ? 83   C   0 "C3'" 1 
ATOM   1577  O  "O3'" . C   A  1  82   ? 41.502  160.324 34.463  1.00 40.68  ? 83   C   0 "O3'" 1 
ATOM   1578  C  "C2'" . C   A  1  82   ? 40.776  162.514 33.641  1.00 40.28  ? 83   C   0 "C2'" 1 
ATOM   1579  O  "O2'" . C   A  1  82   ? 42.115  162.746 33.271  1.00 38.38  ? 83   C   0 "O2'" 1 
ATOM   1580  C  "C1'" . C   A  1  82   ? 39.890  162.886 32.448  1.00 39.51  ? 83   C   0 "C1'" 1 
ATOM   1581  N  N1    . C   A  1  82   ? 38.630  163.570 32.813  1.00 37.52  ? 83   C   0 N1    1 
ATOM   1582  C  C2    . C   A  1  82   ? 38.657  164.959 33.002  1.00 37.22  ? 83   C   0 C2    1 
ATOM   1583  O  O2    . C   A  1  82   ? 39.736  165.562 32.885  1.00 37.78  ? 83   C   0 O2    1 
ATOM   1584  N  N3    . C   A  1  82   ? 37.512  165.608 33.312  1.00 36.61  ? 83   C   0 N3    1 
ATOM   1585  C  C4    . C   A  1  82   ? 36.372  164.926 33.445  1.00 37.79  ? 83   C   0 C4    1 
ATOM   1586  N  N4    . C   A  1  82   ? 35.263  165.616 33.750  1.00 38.36  ? 83   C   0 N4    1 
ATOM   1587  C  C5    . C   A  1  82   ? 36.315  163.511 33.274  1.00 35.50  ? 83   C   0 C5    1 
ATOM   1588  C  C6    . C   A  1  82   ? 37.457  162.879 32.962  1.00 36.17  ? 83   C   0 C6    1 
ATOM   1589  P  P     . G   A  1  83   ? 41.275  159.731 35.946  1.00 41.16  ? 84   G   0 P     1 
ATOM   1590  O  OP1   . G   A  1  83   ? 39.825  159.638 36.254  1.00 40.27  ? 84   G   0 OP1   1 
ATOM   1591  O  OP2   . G   A  1  83   ? 42.170  160.465 36.876  1.00 42.37  ? 84   G   0 OP2   1 
ATOM   1592  O  "O5'" . G   A  1  83   ? 41.820  158.241 35.822  1.00 41.01  ? 84   G   0 "O5'" 1 
ATOM   1593  C  "C5'" . G   A  1  83   ? 41.145  157.275 34.995  1.00 40.10  ? 84   G   0 "C5'" 1 
ATOM   1594  C  "C4'" . G   A  1  83   ? 41.449  155.881 35.479  1.00 40.18  ? 84   G   0 "C4'" 1 
ATOM   1595  O  "O4'" . G   A  1  83   ? 42.875  155.637 35.373  1.00 40.96  ? 84   G   0 "O4'" 1 
ATOM   1596  C  "C3'" . G   A  1  83   ? 41.129  155.644 36.943  1.00 40.41  ? 84   G   0 "C3'" 1 
ATOM   1597  O  "O3'" . G   A  1  83   ? 39.763  155.291 37.099  1.00 42.84  ? 84   G   0 "O3'" 1 
ATOM   1598  C  "C2'" . G   A  1  83   ? 42.074  154.510 37.298  1.00 39.87  ? 84   G   0 "C2'" 1 
ATOM   1599  O  "O2'" . G   A  1  83   ? 41.604  153.273 36.815  1.00 40.01  ? 84   G   0 "O2'" 1 
ATOM   1600  C  "C1'" . G   A  1  83   ? 43.319  154.899 36.497  1.00 40.83  ? 84   G   0 "C1'" 1 
ATOM   1601  N  N9    . G   A  1  83   ? 44.261  155.733 37.241  1.00 42.38  ? 84   G   0 N9    1 
ATOM   1602  C  C8    . G   A  1  83   ? 44.542  157.063 37.024  1.00 41.80  ? 84   G   0 C8    1 
ATOM   1603  N  N7    . G   A  1  83   ? 45.432  157.542 37.849  1.00 40.83  ? 84   G   0 N7    1 
ATOM   1604  C  C5    . G   A  1  83   ? 45.761  156.465 38.662  1.00 43.30  ? 84   G   0 C5    1 
ATOM   1605  C  C6    . G   A  1  83   ? 46.679  156.375 39.740  1.00 42.86  ? 84   G   0 C6    1 
ATOM   1606  O  O6    . G   A  1  83   ? 47.411  157.253 40.204  1.00 42.20  ? 84   G   0 O6    1 
ATOM   1607  N  N1    . G   A  1  83   ? 46.699  155.096 40.284  1.00 42.58  ? 84   G   0 N1    1 
ATOM   1608  C  C2    . G   A  1  83   ? 45.939  154.040 39.847  1.00 41.32  ? 84   G   0 C2    1 
ATOM   1609  N  N2    . G   A  1  83   ? 46.105  152.886 40.496  1.00 40.23  ? 84   G   0 N2    1 
ATOM   1610  N  N3    . G   A  1  83   ? 45.084  154.110 38.845  1.00 40.60  ? 84   G   0 N3    1 
ATOM   1611  C  C4    . G   A  1  83   ? 45.046  155.341 38.301  1.00 42.00  ? 84   G   0 C4    1 
ATOM   1612  P  P     . C   A  1  84   ? 39.024  155.557 38.498  1.00 45.34  ? 85   C   0 P     1 
ATOM   1613  O  OP1   . C   A  1  84   ? 37.613  155.121 38.328  1.00 47.90  ? 85   C   0 OP1   1 
ATOM   1614  O  OP2   . C   A  1  84   ? 39.308  156.947 38.933  1.00 46.09  ? 85   C   0 OP2   1 
ATOM   1615  O  "O5'" . C   A  1  84   ? 39.749  154.561 39.510  1.00 47.30  ? 85   C   0 "O5'" 1 
ATOM   1616  C  "C5'" . C   A  1  84   ? 39.640  153.132 39.352  1.00 48.81  ? 85   C   0 "C5'" 1 
ATOM   1617  C  "C4'" . C   A  1  84   ? 40.335  152.420 40.491  1.00 50.66  ? 85   C   0 "C4'" 1 
ATOM   1618  O  "O4'" . C   A  1  84   ? 41.767  152.648 40.417  1.00 51.25  ? 85   C   0 "O4'" 1 
ATOM   1619  C  "C3'" . C   A  1  84   ? 39.962  152.877 41.893  1.00 51.66  ? 85   C   0 "C3'" 1 
ATOM   1620  O  "O3'" . C   A  1  84   ? 38.743  152.295 42.334  1.00 53.06  ? 85   C   0 "O3'" 1 
ATOM   1621  C  "C2'" . C   A  1  84   ? 41.167  152.428 42.710  1.00 51.42  ? 85   C   0 "C2'" 1 
ATOM   1622  O  "O2'" . C   A  1  84   ? 41.171  151.047 43.009  1.00 51.58  ? 85   C   0 "O2'" 1 
ATOM   1623  C  "C1'" . C   A  1  84   ? 42.307  152.706 41.729  1.00 51.17  ? 85   C   0 "C1'" 1 
ATOM   1624  N  N1    . C   A  1  84   ? 42.931  154.025 41.932  1.00 50.80  ? 85   C   0 N1    1 
ATOM   1625  C  C2    . C   A  1  84   ? 43.926  154.151 42.910  1.00 51.07  ? 85   C   0 C2    1 
ATOM   1626  O  O2    . C   A  1  84   ? 44.226  153.159 43.591  1.00 52.03  ? 85   C   0 O2    1 
ATOM   1627  N  N3    . C   A  1  84   ? 44.533  155.349 43.089  1.00 50.37  ? 85   C   0 N3    1 
ATOM   1628  C  C4    . C   A  1  84   ? 44.177  156.395 42.343  1.00 48.55  ? 85   C   0 C4    1 
ATOM   1629  N  N4    . C   A  1  84   ? 44.813  157.545 42.544  1.00 45.87  ? 85   C   0 N4    1 
ATOM   1630  C  C5    . C   A  1  84   ? 43.152  156.302 41.353  1.00 49.60  ? 85   C   0 C5    1 
ATOM   1631  C  C6    . C   A  1  84   ? 42.561  155.111 41.183  1.00 49.73  ? 85   C   0 C6    1 
ATOM   1632  P  P     . A   A  1  85   ? 37.828  153.075 43.402  1.00 55.95  ? 86   A   0 P     1 
ATOM   1633  O  OP1   . A   A  1  85   ? 38.569  153.108 44.691  1.00 56.30  ? 86   A   0 OP1   1 
ATOM   1634  O  OP2   . A   A  1  85   ? 36.468  152.484 43.354  1.00 55.05  ? 86   A   0 OP2   1 
ATOM   1635  O  "O5'" . A   A  1  85   ? 37.756  154.569 42.859  1.00 54.11  ? 86   A   0 "O5'" 1 
ATOM   1636  C  "C5'" . A   A  1  85   ? 36.810  155.502 43.404  1.00 54.39  ? 86   A   0 "C5'" 1 
ATOM   1637  C  "C4'" . A   A  1  85   ? 37.356  156.909 43.338  1.00 55.73  ? 86   A   0 "C4'" 1 
ATOM   1638  O  "O4'" . A   A  1  85   ? 38.415  157.083 44.322  1.00 55.33  ? 86   A   0 "O4'" 1 
ATOM   1639  C  "C3'" . A   A  1  85   ? 37.950  157.332 42.000  1.00 57.56  ? 86   A   0 "C3'" 1 
ATOM   1640  O  "O3'" . A   A  1  85   ? 37.749  158.731 41.835  1.00 62.36  ? 86   A   0 "O3'" 1 
ATOM   1641  C  "C2'" . A   A  1  85   ? 39.439  157.089 42.216  1.00 56.34  ? 86   A   0 "C2'" 1 
ATOM   1642  O  "O2'" . A   A  1  85   ? 40.232  157.893 41.372  1.00 56.38  ? 86   A   0 "O2'" 1 
ATOM   1643  C  "C1'" . A   A  1  85   ? 39.588  157.529 43.672  1.00 54.83  ? 86   A   0 "C1'" 1 
ATOM   1644  N  N9    . A   A  1  85   ? 40.746  157.009 44.400  1.00 52.96  ? 86   A   0 N9    1 
ATOM   1645  C  C8    . A   A  1  85   ? 40.971  155.732 44.851  1.00 53.65  ? 86   A   0 C8    1 
ATOM   1646  N  N7    . A   A  1  85   ? 42.081  155.601 45.536  1.00 53.22  ? 86   A   0 N7    1 
ATOM   1647  C  C5    . A   A  1  85   ? 42.631  156.876 45.526  1.00 52.86  ? 86   A   0 C5    1 
ATOM   1648  C  C6    . A   A  1  85   ? 43.806  157.406 46.093  1.00 52.34  ? 86   A   0 C6    1 
ATOM   1649  N  N6    . A   A  1  85   ? 44.661  156.696 46.831  1.00 51.32  ? 86   A   0 N6    1 
ATOM   1650  N  N1    . A   A  1  85   ? 44.071  158.712 45.879  1.00 52.47  ? 86   A   0 N1    1 
ATOM   1651  C  C2    . A   A  1  85   ? 43.205  159.431 45.152  1.00 52.83  ? 86   A   0 C2    1 
ATOM   1652  N  N3    . A   A  1  85   ? 42.063  159.051 44.581  1.00 52.59  ? 86   A   0 N3    1 
ATOM   1653  C  C4    . A   A  1  85   ? 41.830  157.747 44.809  1.00 52.69  ? 86   A   0 C4    1 
ATOM   1654  P  P     . C   A  1  86   ? 36.610  159.268 40.840  1.00 65.93  ? 87   C   0 P     1 
ATOM   1655  O  OP1   . C   A  1  86   ? 36.221  158.176 39.897  1.00 64.43  ? 87   C   0 OP1   1 
ATOM   1656  O  OP2   . C   A  1  86   ? 37.098  160.566 40.304  1.00 62.51  ? 87   C   0 OP2   1 
ATOM   1657  O  "O5'" . C   A  1  86   ? 35.373  159.550 41.806  1.00 66.78  ? 87   C   0 "O5'" 1 
ATOM   1658  C  "C5'" . C   A  1  86   ? 34.159  160.095 41.273  1.00 70.47  ? 87   C   0 "C5'" 1 
ATOM   1659  C  "C4'" . C   A  1  86   ? 33.109  160.250 42.348  1.00 71.63  ? 87   C   0 "C4'" 1 
ATOM   1660  O  "O4'" . C   A  1  86   ? 32.767  158.946 42.887  1.00 73.25  ? 87   C   0 "O4'" 1 
ATOM   1661  C  "C3'" . C   A  1  86   ? 33.430  161.141 43.547  1.00 71.15  ? 87   C   0 "C3'" 1 
ATOM   1662  O  "O3'" . C   A  1  86   ? 32.329  162.006 43.773  1.00 68.71  ? 87   C   0 "O3'" 1 
ATOM   1663  C  "C2'" . C   A  1  86   ? 33.547  160.147 44.703  1.00 72.44  ? 87   C   0 "C2'" 1 
ATOM   1664  O  "O2'" . C   A  1  86   ? 33.132  160.695 45.937  1.00 72.05  ? 87   C   0 "O2'" 1 
ATOM   1665  C  "C1'" . C   A  1  86   ? 32.567  159.062 44.275  1.00 74.07  ? 87   C   0 "C1'" 1 
ATOM   1666  N  N1    . C   A  1  86   ? 32.784  157.736 44.886  1.00 77.15  ? 87   C   0 N1    1 
ATOM   1667  C  C2    . C   A  1  86   ? 31.666  156.950 45.216  1.00 78.52  ? 87   C   0 C2    1 
ATOM   1668  O  O2    . C   A  1  86   ? 30.527  157.394 44.999  1.00 79.83  ? 87   C   0 O2    1 
ATOM   1669  N  N3    . C   A  1  86   ? 31.857  155.728 45.763  1.00 79.69  ? 87   C   0 N3    1 
ATOM   1670  C  C4    . C   A  1  86   ? 33.095  155.281 45.984  1.00 79.79  ? 87   C   0 C4    1 
ATOM   1671  N  N4    . C   A  1  86   ? 33.236  154.066 46.518  1.00 80.25  ? 87   C   0 N4    1 
ATOM   1672  C  C5    . C   A  1  86   ? 34.246  156.059 45.666  1.00 79.61  ? 87   C   0 C5    1 
ATOM   1673  C  C6    . C   A  1  86   ? 34.047  157.267 45.124  1.00 78.09  ? 87   C   0 C6    1 
ATOM   1674  P  P     . G   A  1  87   ? 32.428  163.544 43.318  1.00 67.29  ? 88   G   0 P     1 
ATOM   1675  O  OP1   . G   A  1  87   ? 31.070  163.973 42.889  1.00 68.09  ? 88   G   0 OP1   1 
ATOM   1676  O  OP2   . G   A  1  87   ? 33.565  163.667 42.370  1.00 66.06  ? 88   G   0 OP2   1 
ATOM   1677  O  "O5'" . G   A  1  87   ? 32.785  164.324 44.662  1.00 65.29  ? 88   G   0 "O5'" 1 
ATOM   1678  C  "C5'" . G   A  1  87   ? 34.089  164.214 45.248  1.00 62.13  ? 88   G   0 "C5'" 1 
ATOM   1679  C  "C4'" . G   A  1  87   ? 34.475  165.500 45.940  1.00 58.98  ? 88   G   0 "C4'" 1 
ATOM   1680  O  "O4'" . G   A  1  87   ? 35.850  165.376 46.385  1.00 57.56  ? 88   G   0 "O4'" 1 
ATOM   1681  C  "C3'" . G   A  1  87   ? 34.439  166.755 45.075  1.00 59.33  ? 88   G   0 "C3'" 1 
ATOM   1682  O  "O3'" . G   A  1  87   ? 33.194  167.435 45.209  1.00 60.65  ? 88   G   0 "O3'" 1 
ATOM   1683  C  "C2'" . G   A  1  87   ? 35.612  167.574 45.599  1.00 57.30  ? 88   G   0 "C2'" 1 
ATOM   1684  O  "O2'" . G   A  1  87   ? 35.317  168.250 46.804  1.00 58.99  ? 88   G   0 "O2'" 1 
ATOM   1685  C  "C1'" . G   A  1  87   ? 36.612  166.468 45.908  1.00 54.86  ? 88   G   0 "C1'" 1 
ATOM   1686  N  N9    . G   A  1  87   ? 37.403  166.008 44.770  1.00 49.90  ? 88   G   0 N9    1 
ATOM   1687  C  C8    . G   A  1  87   ? 37.128  164.950 43.937  1.00 48.42  ? 88   G   0 C8    1 
ATOM   1688  N  N7    . G   A  1  87   ? 38.065  164.738 43.054  1.00 46.97  ? 88   G   0 N7    1 
ATOM   1689  C  C5    . G   A  1  87   ? 39.007  165.720 43.309  1.00 45.33  ? 88   G   0 C5    1 
ATOM   1690  C  C6    . G   A  1  87   ? 40.253  165.975 42.692  1.00 46.29  ? 88   G   0 C6    1 
ATOM   1691  O  O6    . G   A  1  87   ? 40.803  165.352 41.776  1.00 47.86  ? 88   G   0 O6    1 
ATOM   1692  N  N1    . G   A  1  87   ? 40.882  167.080 43.254  1.00 45.69  ? 88   G   0 N1    1 
ATOM   1693  C  C2    . G   A  1  87   ? 40.381  167.834 44.285  1.00 45.15  ? 88   G   0 C2    1 
ATOM   1694  N  N2    . G   A  1  87   ? 41.125  168.875 44.679  1.00 45.11  ? 88   G   0 N2    1 
ATOM   1695  N  N3    . G   A  1  87   ? 39.231  167.590 44.884  1.00 45.68  ? 88   G   0 N3    1 
ATOM   1696  C  C4    . G   A  1  87   ? 38.601  166.528 44.349  1.00 47.10  ? 88   G   0 C4    1 
ATOM   1697  P  P     . G   A  1  88   ? 32.756  168.533 44.117  1.00 62.84  ? 89   G   0 P     1 
ATOM   1698  O  OP1   . G   A  1  88   ? 31.515  169.153 44.651  1.00 62.90  ? 89   G   0 OP1   1 
ATOM   1699  O  OP2   . G   A  1  88   ? 32.748  167.897 42.768  1.00 61.84  ? 89   G   0 OP2   1 
ATOM   1700  O  "O5'" . G   A  1  88   ? 33.913  169.629 44.143  1.00 59.28  ? 89   G   0 "O5'" 1 
ATOM   1701  C  "C5'" . G   A  1  88   ? 33.915  170.673 45.132  1.00 58.07  ? 89   G   0 "C5'" 1 
ATOM   1702  C  "C4'" . G   A  1  88   ? 35.113  171.569 44.939  1.00 57.11  ? 89   G   0 "C4'" 1 
ATOM   1703  O  "O4'" . G   A  1  88   ? 36.326  170.773 45.053  1.00 57.01  ? 89   G   0 "O4'" 1 
ATOM   1704  C  "C3'" . G   A  1  88   ? 35.241  172.199 43.563  1.00 56.65  ? 89   G   0 "C3'" 1 
ATOM   1705  O  "O3'" . G   A  1  88   ? 34.421  173.338 43.395  1.00 56.92  ? 89   G   0 "O3'" 1 
ATOM   1706  C  "C2'" . G   A  1  88   ? 36.727  172.516 43.491  1.00 55.73  ? 89   G   0 "C2'" 1 
ATOM   1707  O  "O2'" . G   A  1  88   ? 37.114  173.667 44.216  1.00 56.22  ? 89   G   0 "O2'" 1 
ATOM   1708  C  "C1'" . G   A  1  88   ? 37.311  171.271 44.155  1.00 53.97  ? 89   G   0 "C1'" 1 
ATOM   1709  N  N9    . G   A  1  88   ? 37.616  170.239 43.169  1.00 49.46  ? 89   G   0 N9    1 
ATOM   1710  C  C8    . G   A  1  88   ? 36.828  169.183 42.774  1.00 46.67  ? 89   G   0 C8    1 
ATOM   1711  N  N7    . G   A  1  88   ? 37.401  168.427 41.877  1.00 45.68  ? 89   G   0 N7    1 
ATOM   1712  C  C5    . G   A  1  88   ? 38.638  169.023 41.668  1.00 45.07  ? 89   G   0 C5    1 
ATOM   1713  C  C6    . G   A  1  88   ? 39.712  168.649 40.818  1.00 44.62  ? 89   G   0 C6    1 
ATOM   1714  O  O6    . G   A  1  88   ? 39.794  167.677 40.057  1.00 44.05  ? 89   G   0 O6    1 
ATOM   1715  N  N1    . G   A  1  88   ? 40.773  169.542 40.915  1.00 45.08  ? 89   G   0 N1    1 
ATOM   1716  C  C2    . G   A  1  88   ? 40.800  170.652 41.722  1.00 45.80  ? 89   G   0 C2    1 
ATOM   1717  N  N2    . G   A  1  88   ? 41.904  171.412 41.660  1.00 43.80  ? 89   G   0 N2    1 
ATOM   1718  N  N3    . G   A  1  88   ? 39.816  171.000 42.527  1.00 46.12  ? 89   G   0 N3    1 
ATOM   1719  C  C4    . G   A  1  88   ? 38.777  170.147 42.450  1.00 46.67  ? 89   G   0 C4    1 
ATOM   1720  P  P     . A   A  1  89   ? 33.689  173.576 41.987  1.00 59.27  ? 90   A   0 P     1 
ATOM   1721  O  OP1   . A   A  1  89   ? 32.735  174.690 42.222  1.00 60.05  ? 90   A   0 OP1   1 
ATOM   1722  O  OP2   . A   A  1  89   ? 33.189  172.271 41.475  1.00 58.78  ? 90   A   0 OP2   1 
ATOM   1723  O  "O5'" . A   A  1  89   ? 34.849  174.069 41.011  1.00 58.77  ? 90   A   0 "O5'" 1 
ATOM   1724  C  "C5'" . A   A  1  89   ? 35.581  175.273 41.299  1.00 60.13  ? 90   A   0 "C5'" 1 
ATOM   1725  C  "C4'" . A   A  1  89   ? 36.907  175.294 40.563  1.00 61.44  ? 90   A   0 "C4'" 1 
ATOM   1726  O  "O4'" . A   A  1  89   ? 37.695  174.124 40.915  1.00 60.38  ? 90   A   0 "O4'" 1 
ATOM   1727  C  "C3'" . A   A  1  89   ? 36.887  175.236 39.045  1.00 61.04  ? 90   A   0 "C3'" 1 
ATOM   1728  O  "O3'" . A   A  1  89   ? 36.570  176.482 38.446  1.00 62.22  ? 90   A   0 "O3'" 1 
ATOM   1729  C  "C2'" . A   A  1  89   ? 38.327  174.850 38.747  1.00 60.31  ? 90   A   0 "C2'" 1 
ATOM   1730  O  "O2'" . A   A  1  89   ? 39.213  175.943 38.890  1.00 61.08  ? 90   A   0 "O2'" 1 
ATOM   1731  C  "C1'" . A   A  1  89   ? 38.592  173.827 39.854  1.00 58.74  ? 90   A   0 "C1'" 1 
ATOM   1732  N  N9    . A   A  1  89   ? 38.338  172.469 39.370  1.00 55.08  ? 90   A   0 N9    1 
ATOM   1733  C  C8    . A   A  1  89   ? 37.202  171.704 39.472  1.00 53.70  ? 90   A   0 C8    1 
ATOM   1734  N  N7    . A   A  1  89   ? 37.287  170.550 38.855  1.00 53.69  ? 90   A   0 N7    1 
ATOM   1735  C  C5    . A   A  1  89   ? 38.570  170.549 38.322  1.00 53.56  ? 90   A   0 C5    1 
ATOM   1736  C  C6    . A   A  1  89   ? 39.273  169.616 37.540  1.00 53.25  ? 90   A   0 C6    1 
ATOM   1737  N  N6    . A   A  1  89   ? 38.752  168.464 37.116  1.00 55.38  ? 90   A   0 N6    1 
ATOM   1738  N  N1    . A   A  1  89   ? 40.544  169.916 37.194  1.00 52.24  ? 90   A   0 N1    1 
ATOM   1739  C  C2    . A   A  1  89   ? 41.057  171.082 37.596  1.00 51.49  ? 90   A   0 C2    1 
ATOM   1740  N  N3    . A   A  1  89   ? 40.496  172.045 38.318  1.00 52.17  ? 90   A   0 N3    1 
ATOM   1741  C  C4    . A   A  1  89   ? 39.235  171.714 38.652  1.00 53.68  ? 90   A   0 C4    1 
ATOM   1742  P  P     . G   A  1  90   ? 35.824  176.510 37.022  1.00 64.03  ? 91   G   0 P     1 
ATOM   1743  O  OP1   . G   A  1  90   ? 35.706  177.944 36.652  1.00 63.70  ? 91   G   0 OP1   1 
ATOM   1744  O  OP2   . G   A  1  90   ? 34.595  175.670 37.123  1.00 62.51  ? 91   G   0 OP2   1 
ATOM   1745  O  "O5'" . G   A  1  90   ? 36.842  175.807 36.010  1.00 60.14  ? 91   G   0 "O5'" 1 
ATOM   1746  C  "C5'" . G   A  1  90   ? 38.049  176.479 35.591  1.00 57.81  ? 91   G   0 "C5'" 1 
ATOM   1747  C  "C4'" . G   A  1  90   ? 39.000  175.510 34.915  1.00 56.68  ? 91   G   0 "C4'" 1 
ATOM   1748  O  "O4'" . G   A  1  90   ? 39.164  174.344 35.771  1.00 54.93  ? 91   G   0 "O4'" 1 
ATOM   1749  C  "C3'" . G   A  1  90   ? 38.581  174.896 33.585  1.00 56.33  ? 91   G   0 "C3'" 1 
ATOM   1750  O  "O3'" . G   A  1  90   ? 38.777  175.744 32.452  1.00 57.14  ? 91   G   0 "O3'" 1 
ATOM   1751  C  "C2'" . G   A  1  90   ? 39.489  173.677 33.524  1.00 55.51  ? 91   G   0 "C2'" 1 
ATOM   1752  O  "O2'" . G   A  1  90   ? 40.826  174.001 33.192  1.00 56.90  ? 91   G   0 "O2'" 1 
ATOM   1753  C  "C1'" . G   A  1  90   ? 39.419  173.196 34.973  1.00 53.10  ? 91   G   0 "C1'" 1 
ATOM   1754  N  N9    . G   A  1  90   ? 38.317  172.250 35.134  1.00 48.84  ? 91   G   0 N9    1 
ATOM   1755  C  C8    . G   A  1  90   ? 37.088  172.474 35.709  1.00 46.99  ? 91   G   0 C8    1 
ATOM   1756  N  N7    . G   A  1  90   ? 36.293  171.439 35.639  1.00 46.13  ? 91   G   0 N7    1 
ATOM   1757  C  C5    . G   A  1  90   ? 37.048  170.470 34.989  1.00 45.66  ? 91   G   0 C5    1 
ATOM   1758  C  C6    . G   A  1  90   ? 36.719  169.139 34.616  1.00 44.55  ? 91   G   0 C6    1 
ATOM   1759  O  O6    . G   A  1  90   ? 35.654  168.528 34.780  1.00 46.23  ? 91   G   0 O6    1 
ATOM   1760  N  N1    . G   A  1  90   ? 37.783  168.510 33.988  1.00 42.19  ? 91   G   0 N1    1 
ATOM   1761  C  C2    . G   A  1  90   ? 39.002  169.078 33.745  1.00 41.78  ? 91   G   0 C2    1 
ATOM   1762  N  N2    . G   A  1  90   ? 39.897  168.303 33.137  1.00 40.15  ? 91   G   0 N2    1 
ATOM   1763  N  N3    . G   A  1  90   ? 39.321  170.312 34.075  1.00 43.50  ? 91   G   0 N3    1 
ATOM   1764  C  C4    . G   A  1  90   ? 38.303  170.948 34.688  1.00 46.42  ? 91   G   0 C4    1 
ATOM   1765  P  P     . G   A  1  91   ? 37.880  175.525 31.122  1.00 56.14  ? 92   G   0 P     1 
ATOM   1766  O  OP1   . G   A  1  91   ? 38.182  176.663 30.220  1.00 57.01  ? 92   G   0 OP1   1 
ATOM   1767  O  OP2   . G   A  1  91   ? 36.477  175.268 31.539  1.00 53.49  ? 92   G   0 OP2   1 
ATOM   1768  O  "O5'" . G   A  1  91   ? 38.451  174.194 30.447  1.00 54.05  ? 92   G   0 "O5'" 1 
ATOM   1769  C  "C5'" . G   A  1  91   ? 39.831  174.108 30.057  1.00 51.24  ? 92   G   0 "C5'" 1 
ATOM   1770  C  "C4'" . G   A  1  91   ? 40.258  172.665 29.872  1.00 49.02  ? 92   G   0 "C4'" 1 
ATOM   1771  O  "O4'" . G   A  1  91   ? 39.820  171.869 31.010  1.00 46.86  ? 92   G   0 "O4'" 1 
ATOM   1772  C  "C3'" . G   A  1  91   ? 39.695  171.892 28.691  1.00 47.62  ? 92   G   0 "C3'" 1 
ATOM   1773  O  "O3'" . G   A  1  91   ? 40.331  172.233 27.459  1.00 48.05  ? 92   G   0 "O3'" 1 
ATOM   1774  C  "C2'" . G   A  1  91   ? 39.990  170.457 29.114  1.00 45.51  ? 92   G   0 "C2'" 1 
ATOM   1775  O  "O2'" . G   A  1  91   ? 41.358  170.110 29.004  1.00 43.75  ? 92   G   0 "O2'" 1 
ATOM   1776  C  "C1'" . G   A  1  91   ? 39.637  170.516 30.600  1.00 44.39  ? 92   G   0 "C1'" 1 
ATOM   1777  N  N9    . G   A  1  91   ? 38.250  170.120 30.848  1.00 41.38  ? 92   G   0 N9    1 
ATOM   1778  C  C8    . G   A  1  91   ? 37.218  170.922 31.272  1.00 39.37  ? 92   G   0 C8    1 
ATOM   1779  N  N7    . G   A  1  91   ? 36.084  170.284 31.373  1.00 39.13  ? 92   G   0 N7    1 
ATOM   1780  C  C5    . G   A  1  91   ? 36.384  168.982 31.000  1.00 37.35  ? 92   G   0 C5    1 
ATOM   1781  C  C6    . G   A  1  91   ? 35.548  167.840 30.907  1.00 37.40  ? 92   G   0 C6    1 
ATOM   1782  O  O6    . G   A  1  91   ? 34.336  167.751 31.148  1.00 39.92  ? 92   G   0 O6    1 
ATOM   1783  N  N1    . G   A  1  91   ? 36.258  166.720 30.490  1.00 34.45  ? 92   G   0 N1    1 
ATOM   1784  C  C2    . G   A  1  91   ? 37.600  166.697 30.211  1.00 34.38  ? 92   G   0 C2    1 
ATOM   1785  N  N2    . G   A  1  91   ? 38.106  165.513 29.848  1.00 33.89  ? 92   G   0 N2    1 
ATOM   1786  N  N3    . G   A  1  91   ? 38.389  167.757 30.289  1.00 35.57  ? 92   G   0 N3    1 
ATOM   1787  C  C4    . G   A  1  91   ? 37.718  168.858 30.685  1.00 37.20  ? 92   G   0 C4    1 
ATOM   1788  P  P     . C   A  1  92   ? 39.532  172.052 26.068  1.00 50.35  ? 93   C   0 P     1 
ATOM   1789  O  OP1   . C   A  1  92   ? 40.358  172.704 25.015  1.00 50.04  ? 93   C   0 OP1   1 
ATOM   1790  O  OP2   . C   A  1  92   ? 38.110  172.460 26.244  1.00 48.64  ? 93   C   0 OP2   1 
ATOM   1791  O  "O5'" . C   A  1  92   ? 39.546  170.480 25.810  1.00 48.50  ? 93   C   0 "O5'" 1 
ATOM   1792  C  "C5'" . C   A  1  92   ? 40.786  169.766 25.691  1.00 47.56  ? 93   C   0 "C5'" 1 
ATOM   1793  C  "C4'" . C   A  1  92   ? 40.524  168.288 25.529  1.00 47.65  ? 93   C   0 "C4'" 1 
ATOM   1794  O  "O4'" . C   A  1  92   ? 39.890  167.758 26.726  1.00 47.39  ? 93   C   0 "O4'" 1 
ATOM   1795  C  "C3'" . C   A  1  92   ? 39.554  167.910 24.427  1.00 47.61  ? 93   C   0 "C3'" 1 
ATOM   1796  O  "O3'" . C   A  1  92   ? 40.149  167.933 23.137  1.00 48.39  ? 93   C   0 "O3'" 1 
ATOM   1797  C  "C2'" . C   A  1  92   ? 39.131  166.513 24.853  1.00 47.14  ? 93   C   0 "C2'" 1 
ATOM   1798  O  "O2'" . C   A  1  92   ? 40.120  165.541 24.576  1.00 48.23  ? 93   C   0 "O2'" 1 
ATOM   1799  C  "C1'" . C   A  1  92   ? 39.008  166.702 26.365  1.00 45.92  ? 93   C   0 "C1'" 1 
ATOM   1800  N  N1    . C   A  1  92   ? 37.638  167.065 26.769  1.00 43.83  ? 93   C   0 N1    1 
ATOM   1801  C  C2    . C   A  1  92   ? 36.664  166.057 26.823  1.00 44.12  ? 93   C   0 C2    1 
ATOM   1802  O  O2    . C   A  1  92   ? 36.978  164.899 26.518  1.00 43.47  ? 93   C   0 O2    1 
ATOM   1803  N  N3    . C   A  1  92   ? 35.405  166.373 27.202  1.00 43.89  ? 93   C   0 N3    1 
ATOM   1804  C  C4    . C   A  1  92   ? 35.099  167.634 27.519  1.00 42.89  ? 93   C   0 C4    1 
ATOM   1805  N  N4    . C   A  1  92   ? 33.844  167.895 27.899  1.00 43.60  ? 93   C   0 N4    1 
ATOM   1806  C  C5    . C   A  1  92   ? 36.064  168.680 27.464  1.00 41.56  ? 93   C   0 C5    1 
ATOM   1807  C  C6    . C   A  1  92   ? 37.310  168.354 27.088  1.00 43.55  ? 93   C   0 C6    1 
ATOM   1808  P  P     . G   A  1  93   ? 39.236  168.260 21.854  1.00 46.93  ? 94   G   0 P     1 
ATOM   1809  O  OP1   . G   A  1  93   ? 40.117  168.159 20.662  1.00 45.48  ? 94   G   0 OP1   1 
ATOM   1810  O  OP2   . G   A  1  93   ? 38.474  169.509 22.111  1.00 42.80  ? 94   G   0 OP2   1 
ATOM   1811  O  "O5'" . G   A  1  93   ? 38.191  167.061 21.813  1.00 46.11  ? 94   G   0 "O5'" 1 
ATOM   1812  C  "C5'" . G   A  1  93   ? 38.624  165.711 21.587  1.00 45.11  ? 94   G   0 "C5'" 1 
ATOM   1813  C  "C4'" . G   A  1  93   ? 37.439  164.781 21.596  1.00 45.98  ? 94   G   0 "C4'" 1 
ATOM   1814  O  "O4'" . G   A  1  93   ? 36.875  164.692 22.932  1.00 45.28  ? 94   G   0 "O4'" 1 
ATOM   1815  C  "C3'" . G   A  1  93   ? 36.247  165.226 20.769  1.00 46.31  ? 94   G   0 "C3'" 1 
ATOM   1816  O  "O3'" . G   A  1  93   ? 36.434  165.008 19.382  1.00 50.04  ? 94   G   0 "O3'" 1 
ATOM   1817  C  "C2'" . G   A  1  93   ? 35.140  164.362 21.351  1.00 44.24  ? 94   G   0 "C2'" 1 
ATOM   1818  O  "O2'" . G   A  1  93   ? 35.244  163.018 20.925  1.00 43.91  ? 94   G   0 "O2'" 1 
ATOM   1819  C  "C1'" . G   A  1  93   ? 35.477  164.435 22.839  1.00 42.42  ? 94   G   0 "C1'" 1 
ATOM   1820  N  N9    . G   A  1  93   ? 34.752  165.518 23.496  1.00 39.42  ? 94   G   0 N9    1 
ATOM   1821  C  C8    . G   A  1  93   ? 35.236  166.754 23.851  1.00 38.64  ? 94   G   0 C8    1 
ATOM   1822  N  N7    . G   A  1  93   ? 34.332  167.520 24.399  1.00 38.42  ? 94   G   0 N7    1 
ATOM   1823  C  C5    . G   A  1  93   ? 33.182  166.742 24.413  1.00 37.83  ? 94   G   0 C5    1 
ATOM   1824  C  C6    . G   A  1  93   ? 31.872  167.038 24.885  1.00 37.87  ? 94   G   0 C6    1 
ATOM   1825  O  O6    . G   A  1  93   ? 31.452  168.086 25.393  1.00 38.84  ? 94   G   0 O6    1 
ATOM   1826  N  N1    . G   A  1  93   ? 31.011  165.957 24.713  1.00 37.38  ? 94   G   0 N1    1 
ATOM   1827  C  C2    . G   A  1  93   ? 31.361  164.751 24.155  1.00 36.32  ? 94   G   0 C2    1 
ATOM   1828  N  N2    . G   A  1  93   ? 30.394  163.832 24.078  1.00 35.96  ? 94   G   0 N2    1 
ATOM   1829  N  N3    . G   A  1  93   ? 32.571  164.469 23.707  1.00 36.96  ? 94   G   0 N3    1 
ATOM   1830  C  C4    . G   A  1  93   ? 33.426  165.501 23.867  1.00 37.65  ? 94   G   0 C4    1 
ATOM   1831  P  P     . A   A  1  94   ? 36.149  166.205 18.347  1.00 50.58  ? 95   A   0 P     1 
ATOM   1832  O  OP1   . A   A  1  94   ? 37.461  166.805 18.014  1.00 49.73  ? 95   A   0 OP1   1 
ATOM   1833  O  OP2   . A   A  1  94   ? 35.060  167.068 18.881  1.00 50.16  ? 95   A   0 OP2   1 
ATOM   1834  O  "O5'" . A   A  1  94   ? 35.571  165.453 17.069  1.00 52.56  ? 95   A   0 "O5'" 1 
ATOM   1835  C  "C5'" . A   A  1  94   ? 34.382  164.644 17.168  1.00 53.49  ? 95   A   0 "C5'" 1 
ATOM   1836  C  "C4'" . A   A  1  94   ? 33.530  164.818 15.934  1.00 53.65  ? 95   A   0 "C4'" 1 
ATOM   1837  O  "O4'" . A   A  1  94   ? 32.415  163.888 15.979  1.00 52.84  ? 95   A   0 "O4'" 1 
ATOM   1838  C  "C3'" . A   A  1  94   ? 32.916  166.201 15.758  1.00 54.96  ? 95   A   0 "C3'" 1 
ATOM   1839  O  "O3'" . A   A  1  94   ? 32.794  166.479 14.372  1.00 57.19  ? 95   A   0 "O3'" 1 
ATOM   1840  C  "C2'" . A   A  1  94   ? 31.527  166.026 16.354  1.00 54.94  ? 95   A   0 "C2'" 1 
ATOM   1841  O  "O2'" . A   A  1  94   ? 30.596  166.951 15.826  1.00 57.03  ? 95   A   0 "O2'" 1 
ATOM   1842  C  "C1'" . A   A  1  94   ? 31.198  164.602 15.912  1.00 54.41  ? 95   A   0 "C1'" 1 
ATOM   1843  N  N9    . A   A  1  94   ? 30.217  163.915 16.754  1.00 55.00  ? 95   A   0 N9    1 
ATOM   1844  C  C8    . A   A  1  94   ? 29.045  163.333 16.343  1.00 54.33  ? 95   A   0 C8    1 
ATOM   1845  N  N7    . A   A  1  94   ? 28.356  162.786 17.312  1.00 54.18  ? 95   A   0 N7    1 
ATOM   1846  C  C5    . A   A  1  94   ? 29.124  163.022 18.440  1.00 54.75  ? 95   A   0 C5    1 
ATOM   1847  C  C6    . A   A  1  94   ? 28.935  162.699 19.791  1.00 55.18  ? 95   A   0 C6    1 
ATOM   1848  N  N6    . A   A  1  94   ? 27.871  162.035 20.249  1.00 54.37  ? 95   A   0 N6    1 
ATOM   1849  N  N1    . A   A  1  94   ? 29.887  163.086 20.669  1.00 55.51  ? 95   A   0 N1    1 
ATOM   1850  C  C2    . A   A  1  94   ? 30.954  163.753 20.204  1.00 54.66  ? 95   A   0 C2    1 
ATOM   1851  N  N3    . A   A  1  94   ? 31.244  164.114 18.958  1.00 53.57  ? 95   A   0 N3    1 
ATOM   1852  C  C4    . A   A  1  94   ? 30.276  163.716 18.114  1.00 54.71  ? 95   A   0 C4    1 
ATOM   1853  P  P     . A   A  1  95   ? 33.463  167.804 13.764  1.00 57.38  ? 96   A   0 P     1 
ATOM   1854  O  OP1   . A   A  1  95   ? 33.384  168.897 14.775  1.00 56.40  ? 96   A   0 OP1   1 
ATOM   1855  O  OP2   . A   A  1  95   ? 32.828  167.984 12.434  1.00 58.87  ? 96   A   0 OP2   1 
ATOM   1856  O  "O5'" . A   A  1  95   ? 34.990  167.397 13.547  1.00 54.42  ? 96   A   0 "O5'" 1 
ATOM   1857  C  "C5'" . A   A  1  95   ? 35.348  166.397 12.576  1.00 52.96  ? 96   A   0 "C5'" 1 
ATOM   1858  C  "C4'" . A   A  1  95   ? 36.798  166.011 12.722  1.00 52.94  ? 96   A   0 "C4'" 1 
ATOM   1859  O  "O4'" . A   A  1  95   ? 37.625  167.188 12.503  1.00 53.56  ? 96   A   0 "O4'" 1 
ATOM   1860  C  "C3'" . A   A  1  95   ? 37.225  165.439 14.078  1.00 53.42  ? 96   A   0 "C3'" 1 
ATOM   1861  O  "O3'" . A   A  1  95   ? 38.272  164.487 13.876  1.00 51.87  ? 96   A   0 "O3'" 1 
ATOM   1862  C  "C2'" . A   A  1  95   ? 37.836  166.658 14.762  1.00 54.33  ? 96   A   0 "C2'" 1 
ATOM   1863  O  "O2'" . A   A  1  95   ? 38.792  166.324 15.748  1.00 55.16  ? 96   A   0 "O2'" 1 
ATOM   1864  C  "C1'" . A   A  1  95   ? 38.528  167.318 13.576  1.00 55.00  ? 96   A   0 "C1'" 1 
ATOM   1865  N  N9    . A   A  1  95   ? 38.909  168.721 13.728  1.00 56.14  ? 96   A   0 N9    1 
ATOM   1866  C  C8    . A   A  1  95   ? 38.231  169.769 14.308  1.00 56.53  ? 96   A   0 C8    1 
ATOM   1867  N  N7    . A   A  1  95   ? 38.897  170.902 14.292  1.00 56.64  ? 96   A   0 N7    1 
ATOM   1868  C  C5    . A   A  1  95   ? 40.089  170.578 13.655  1.00 57.40  ? 96   A   0 C5    1 
ATOM   1869  C  C6    . A   A  1  95   ? 41.231  171.338 13.327  1.00 58.46  ? 96   A   0 C6    1 
ATOM   1870  N  N6    . A   A  1  95   ? 41.372  172.636 13.618  1.00 59.63  ? 96   A   0 N6    1 
ATOM   1871  N  N1    . A   A  1  95   ? 42.240  170.707 12.683  1.00 58.68  ? 96   A   0 N1    1 
ATOM   1872  C  C2    . A   A  1  95   ? 42.108  169.404 12.398  1.00 57.75  ? 96   A   0 C2    1 
ATOM   1873  N  N3    . A   A  1  95   ? 41.094  168.585 12.658  1.00 57.64  ? 96   A   0 N3    1 
ATOM   1874  C  C4    . A   A  1  95   ? 40.105  169.241 13.296  1.00 57.29  ? 96   A   0 C4    1 
ATOM   1875  P  P     . G   A  1  96   ? 37.921  162.933 13.700  1.00 51.00  ? 97   G   0 P     1 
ATOM   1876  O  OP1   . G   A  1  96   ? 39.177  162.137 13.820  1.00 50.33  ? 97   G   0 OP1   1 
ATOM   1877  O  OP2   . G   A  1  96   ? 37.090  162.803 12.478  1.00 52.26  ? 97   G   0 OP2   1 
ATOM   1878  O  "O5'" . G   A  1  96   ? 36.976  162.611 14.938  1.00 51.26  ? 97   G   0 "O5'" 1 
ATOM   1879  C  "C5'" . G   A  1  96   ? 37.442  162.742 16.290  1.00 49.57  ? 97   G   0 "C5'" 1 
ATOM   1880  C  "C4'" . G   A  1  96   ? 36.844  161.649 17.141  1.00 49.42  ? 97   G   0 "C4'" 1 
ATOM   1881  O  "O4'" . G   A  1  96   ? 35.393  161.747 17.064  1.00 48.07  ? 97   G   0 "O4'" 1 
ATOM   1882  C  "C3'" . G   A  1  96   ? 37.189  160.232 16.697  1.00 48.24  ? 97   G   0 "C3'" 1 
ATOM   1883  O  "O3'" . G   A  1  96   ? 37.205  159.370 17.825  1.00 46.43  ? 97   G   0 "O3'" 1 
ATOM   1884  C  "C2'" . G   A  1  96   ? 36.027  159.881 15.774  1.00 48.38  ? 97   G   0 "C2'" 1 
ATOM   1885  O  "O2'" . G   A  1  96   ? 35.807  158.491 15.634  1.00 46.45  ? 97   G   0 "O2'" 1 
ATOM   1886  C  "C1'" . G   A  1  96   ? 34.860  160.576 16.475  1.00 48.80  ? 97   G   0 "C1'" 1 
ATOM   1887  N  N9    . G   A  1  96   ? 33.804  160.981 15.551  1.00 52.78  ? 97   G   0 N9    1 
ATOM   1888  C  C8    . G   A  1  96   ? 33.955  161.713 14.395  1.00 53.31  ? 97   G   0 C8    1 
ATOM   1889  N  N7    . G   A  1  96   ? 32.832  161.902 13.758  1.00 55.14  ? 97   G   0 N7    1 
ATOM   1890  C  C5    . G   A  1  96   ? 31.879  161.262 14.539  1.00 55.68  ? 97   G   0 C5    1 
ATOM   1891  C  C6    . G   A  1  96   ? 30.480  161.122 14.348  1.00 56.49  ? 97   G   0 C6    1 
ATOM   1892  O  O6    . G   A  1  96   ? 29.781  161.544 13.411  1.00 58.03  ? 97   G   0 O6    1 
ATOM   1893  N  N1    . G   A  1  96   ? 29.893  160.402 15.386  1.00 55.81  ? 97   G   0 N1    1 
ATOM   1894  C  C2    . G   A  1  96   ? 30.564  159.878 16.464  1.00 54.39  ? 97   G   0 C2    1 
ATOM   1895  N  N2    . G   A  1  96   ? 29.819  159.212 17.358  1.00 52.10  ? 97   G   0 N2    1 
ATOM   1896  N  N3    . G   A  1  96   ? 31.867  159.997 16.651  1.00 53.87  ? 97   G   0 N3    1 
ATOM   1897  C  C4    . G   A  1  96   ? 32.459  160.695 15.656  1.00 54.27  ? 97   G   0 C4    1 
ATOM   1898  P  P     . A   A  1  97   ? 38.523  158.527 18.163  1.00 45.41  ? 98   A   0 P     1 
ATOM   1899  O  OP1   . A   A  1  97   ? 39.598  158.917 17.216  1.00 48.21  ? 98   A   0 OP1   1 
ATOM   1900  O  OP2   . A   A  1  97   ? 38.141  157.104 18.281  1.00 47.58  ? 98   A   0 OP2   1 
ATOM   1901  O  "O5'" . A   A  1  97   ? 38.926  159.054 19.611  1.00 47.46  ? 98   A   0 "O5'" 1 
ATOM   1902  C  "C5'" . A   A  1  97   ? 39.679  160.271 19.774  1.00 44.20  ? 98   A   0 "C5'" 1 
ATOM   1903  C  "C4'" . A   A  1  97   ? 39.446  160.850 21.148  1.00 43.39  ? 98   A   0 "C4'" 1 
ATOM   1904  O  "O4'" . A   A  1  97   ? 38.083  161.349 21.247  1.00 45.58  ? 98   A   0 "O4'" 1 
ATOM   1905  C  "C3'" . A   A  1  97   ? 39.566  159.869 22.302  1.00 41.89  ? 98   A   0 "C3'" 1 
ATOM   1906  O  "O3'" . A   A  1  97   ? 40.921  159.653 22.682  1.00 39.48  ? 98   A   0 "O3'" 1 
ATOM   1907  C  "C2'" . A   A  1  97   ? 38.744  160.562 23.378  1.00 42.37  ? 98   A   0 "C2'" 1 
ATOM   1908  O  "O2'" . A   A  1  97   ? 39.437  161.648 23.956  1.00 41.71  ? 98   A   0 "O2'" 1 
ATOM   1909  C  "C1'" . A   A  1  97   ? 37.575  161.107 22.553  1.00 42.58  ? 98   A   0 "C1'" 1 
ATOM   1910  N  N9    . A   A  1  97   ? 36.489  160.130 22.441  1.00 42.69  ? 98   A   0 N9    1 
ATOM   1911  C  C8    . A   A  1  97   ? 36.120  159.413 21.327  1.00 41.99  ? 98   A   0 C8    1 
ATOM   1912  N  N7    . A   A  1  97   ? 35.140  158.570 21.541  1.00 41.64  ? 98   A   0 N7    1 
ATOM   1913  C  C5    . A   A  1  97   ? 34.834  158.748 22.883  1.00 41.77  ? 98   A   0 C5    1 
ATOM   1914  C  C6    . A   A  1  97   ? 33.888  158.136 23.726  1.00 41.11  ? 98   A   0 C6    1 
ATOM   1915  N  N6    . A   A  1  97   ? 33.042  157.189 23.320  1.00 42.06  ? 98   A   0 N6    1 
ATOM   1916  N  N1    . A   A  1  97   ? 33.841  158.538 25.013  1.00 40.62  ? 98   A   0 N1    1 
ATOM   1917  C  C2    . A   A  1  97   ? 34.686  159.493 25.418  1.00 41.14  ? 98   A   0 C2    1 
ATOM   1918  N  N3    . A   A  1  97   ? 35.619  160.145 24.725  1.00 42.01  ? 98   A   0 N3    1 
ATOM   1919  C  C4    . A   A  1  97   ? 35.645  159.718 23.448  1.00 42.45  ? 98   A   0 C4    1 
ATOM   1920  P  P     . A   A  1  98   ? 41.412  158.172 23.077  1.00 36.75  ? 99   A   0 P     1 
ATOM   1921  O  OP1   . A   A  1  98   ? 42.813  158.274 23.543  1.00 39.24  ? 99   A   0 OP1   1 
ATOM   1922  O  OP2   . A   A  1  98   ? 41.080  157.234 21.984  1.00 38.24  ? 99   A   0 OP2   1 
ATOM   1923  O  "O5'" . A   A  1  98   ? 40.500  157.794 24.327  1.00 38.75  ? 99   A   0 "O5'" 1 
ATOM   1924  C  "C5'" . A   A  1  98   ? 40.528  158.587 25.528  1.00 38.24  ? 99   A   0 "C5'" 1 
ATOM   1925  C  "C4'" . A   A  1  98   ? 39.473  158.115 26.505  1.00 40.64  ? 99   A   0 "C4'" 1 
ATOM   1926  O  "O4'" . A   A  1  98   ? 38.156  158.221 25.903  1.00 41.66  ? 99   A   0 "O4'" 1 
ATOM   1927  C  "C3'" . A   A  1  98   ? 39.552  156.662 26.952  1.00 40.79  ? 99   A   0 "C3'" 1 
ATOM   1928  O  "O3'" . A   A  1  98   ? 40.509  156.500 27.993  1.00 41.78  ? 99   A   0 "O3'" 1 
ATOM   1929  C  "C2'" . A   A  1  98   ? 38.134  156.412 27.452  1.00 41.44  ? 99   A   0 "C2'" 1 
ATOM   1930  O  "O2'" . A   A  1  98   ? 37.890  156.952 28.736  1.00 42.15  ? 99   A   0 "O2'" 1 
ATOM   1931  C  "C1'" . A   A  1  98   ? 37.312  157.208 26.434  1.00 41.57  ? 99   A   0 "C1'" 1 
ATOM   1932  N  N9    . A   A  1  98   ? 36.833  156.370 25.337  1.00 40.33  ? 99   A   0 N9    1 
ATOM   1933  C  C8    . A   A  1  98   ? 37.407  156.156 24.109  1.00 40.00  ? 99   A   0 C8    1 
ATOM   1934  N  N7    . A   A  1  98   ? 36.739  155.320 23.353  1.00 39.70  ? 99   A   0 N7    1 
ATOM   1935  C  C5    . A   A  1  98   ? 35.645  154.967 24.132  1.00 40.69  ? 99   A   0 C5    1 
ATOM   1936  C  C6    . A   A  1  98   ? 34.554  154.107 23.904  1.00 41.02  ? 99   A   0 C6    1 
ATOM   1937  N  N6    . A   A  1  98   ? 34.374  153.421 22.771  1.00 38.12  ? 99   A   0 N6    1 
ATOM   1938  N  N1    . A   A  1  98   ? 33.642  153.974 24.894  1.00 41.28  ? 99   A   0 N1    1 
ATOM   1939  C  C2    . A   A  1  98   ? 33.822  154.659 26.026  1.00 39.99  ? 99   A   0 C2    1 
ATOM   1940  N  N3    . A   A  1  98   ? 34.801  155.493 26.358  1.00 41.39  ? 99   A   0 N3    1 
ATOM   1941  C  C4    . A   A  1  98   ? 35.691  155.606 25.356  1.00 41.13  ? 99   A   0 C4    1 
ATOM   1942  P  P     . C   A  1  99   ? 41.729  155.467 27.814  1.00 40.87  ? 100  C   0 P     1 
ATOM   1943  O  OP1   . C   A  1  99   ? 42.437  155.480 29.119  1.00 42.02  ? 100  C   0 OP1   1 
ATOM   1944  O  OP2   . C   A  1  99   ? 42.478  155.778 26.569  1.00 42.69  ? 100  C   0 OP2   1 
ATOM   1945  O  "O5'" . C   A  1  99   ? 41.019  154.059 27.620  1.00 40.62  ? 100  C   0 "O5'" 1 
ATOM   1946  C  "C5'" . C   A  1  99   ? 40.088  153.567 28.596  1.00 41.50  ? 100  C   0 "C5'" 1 
ATOM   1947  C  "C4'" . C   A  1  99   ? 39.210  152.512 27.982  1.00 42.44  ? 100  C   0 "C4'" 1 
ATOM   1948  O  "O4'" . C   A  1  99   ? 38.336  153.118 26.994  1.00 43.65  ? 100  C   0 "O4'" 1 
ATOM   1949  C  "C3'" . C   A  1  99   ? 39.945  151.432 27.206  1.00 41.98  ? 100  C   0 "C3'" 1 
ATOM   1950  O  "O3'" . C   A  1  99   ? 40.464  150.434 28.064  1.00 40.72  ? 100  C   0 "O3'" 1 
ATOM   1951  C  "C2'" . C   A  1  99   ? 38.850  150.909 26.290  1.00 43.76  ? 100  C   0 "C2'" 1 
ATOM   1952  O  "O2'" . C   A  1  99   ? 37.931  150.076 26.973  1.00 40.72  ? 100  C   0 "O2'" 1 
ATOM   1953  C  "C1'" . C   A  1  99   ? 38.151  152.216 25.910  1.00 44.47  ? 100  C   0 "C1'" 1 
ATOM   1954  N  N1    . C   A  1  99   ? 38.702  152.830 24.683  1.00 46.78  ? 100  C   0 N1    1 
ATOM   1955  C  C2    . C   A  1  99   ? 38.169  152.447 23.446  1.00 48.35  ? 100  C   0 C2    1 
ATOM   1956  O  O2    . C   A  1  99   ? 37.279  151.587 23.419  1.00 50.08  ? 100  C   0 O2    1 
ATOM   1957  N  N3    . C   A  1  99   ? 38.641  153.020 22.312  1.00 48.34  ? 100  C   0 N3    1 
ATOM   1958  C  C4    . C   A  1  99   ? 39.614  153.931 22.381  1.00 48.26  ? 100  C   0 C4    1 
ATOM   1959  N  N4    . C   A  1  99   ? 40.044  154.471 21.239  1.00 45.98  ? 100  C   0 N4    1 
ATOM   1960  C  C5    . C   A  1  99   ? 40.189  154.330 23.628  1.00 47.32  ? 100  C   0 C5    1 
ATOM   1961  C  C6    . C   A  1  99   ? 39.708  153.760 24.741  1.00 47.22  ? 100  C   0 C6    1 
ATOM   1962  P  P     . C   A  1  100  ? 41.901  149.789 27.759  1.00 41.65  ? 101  C   0 P     1 
ATOM   1963  O  OP1   . C   A  1  100  ? 42.258  149.020 28.981  1.00 43.48  ? 101  C   0 OP1   1 
ATOM   1964  O  OP2   . C   A  1  100  ? 42.835  150.828 27.253  1.00 41.49  ? 101  C   0 OP2   1 
ATOM   1965  O  "O5'" . C   A  1  100  ? 41.616  148.763 26.576  1.00 39.49  ? 101  C   0 "O5'" 1 
ATOM   1966  C  "C5'" . C   A  1  100  ? 40.881  147.554 26.818  1.00 40.14  ? 101  C   0 "C5'" 1 
ATOM   1967  C  "C4'" . C   A  1  100  ? 40.698  146.785 25.535  1.00 40.51  ? 101  C   0 "C4'" 1 
ATOM   1968  O  "O4'" . C   A  1  100  ? 39.902  147.570 24.616  1.00 41.39  ? 101  C   0 "O4'" 1 
ATOM   1969  C  "C3'" . C   A  1  100  ? 41.958  146.484 24.744  1.00 41.48  ? 101  C   0 "C3'" 1 
ATOM   1970  O  "O3'" . C   A  1  100  ? 42.655  145.361 25.247  1.00 42.65  ? 101  C   0 "O3'" 1 
ATOM   1971  C  "C2'" . C   A  1  100  ? 41.405  146.232 23.353  1.00 41.43  ? 101  C   0 "C2'" 1 
ATOM   1972  O  "O2'" . C   A  1  100  ? 40.824  144.952 23.223  1.00 41.76  ? 101  C   0 "O2'" 1 
ATOM   1973  C  "C1'" . C   A  1  100  ? 40.306  147.291 23.287  1.00 42.23  ? 101  C   0 "C1'" 1 
ATOM   1974  N  N1    . C   A  1  100  ? 40.759  148.541 22.652  1.00 42.55  ? 101  C   0 N1    1 
ATOM   1975  C  C2    . C   A  1  100  ? 40.861  148.571 21.265  1.00 43.03  ? 101  C   0 C2    1 
ATOM   1976  O  O2    . C   A  1  100  ? 40.583  147.545 20.626  1.00 41.84  ? 101  C   0 O2    1 
ATOM   1977  N  N3    . C   A  1  100  ? 41.264  149.710 20.653  1.00 43.52  ? 101  C   0 N3    1 
ATOM   1978  C  C4    . C   A  1  100  ? 41.564  150.787 21.377  1.00 42.53  ? 101  C   0 C4    1 
ATOM   1979  N  N4    . C   A  1  100  ? 41.955  151.890 20.725  1.00 41.69  ? 101  C   0 N4    1 
ATOM   1980  C  C5    . C   A  1  100  ? 41.476  150.784 22.800  1.00 42.00  ? 101  C   0 C5    1 
ATOM   1981  C  C6    . C   A  1  100  ? 41.073  149.650 23.391  1.00 42.56  ? 101  C   0 C6    1 
ATOM   1982  P  P     . A   A  1  101  ? 44.195  145.162 24.867  1.00 46.57  ? 102  A   0 P     1 
ATOM   1983  O  OP1   . A   A  1  101  ? 44.713  143.983 25.613  1.00 48.08  ? 102  A   0 OP1   1 
ATOM   1984  O  OP2   . A   A  1  101  ? 44.865  146.479 25.014  1.00 46.60  ? 102  A   0 OP2   1 
ATOM   1985  O  "O5'" . A   A  1  101  ? 44.155  144.775 23.326  1.00 47.24  ? 102  A   0 "O5'" 1 
ATOM   1986  C  "C5'" . A   A  1  101  ? 43.641  143.499 22.905  1.00 49.21  ? 102  A   0 "C5'" 1 
ATOM   1987  C  "C4'" . A   A  1  101  ? 43.829  143.333 21.420  1.00 50.58  ? 102  A   0 "C4'" 1 
ATOM   1988  O  "O4'" . A   A  1  101  ? 43.021  144.315 20.722  1.00 50.63  ? 102  A   0 "O4'" 1 
ATOM   1989  C  "C3'" . A   A  1  101  ? 45.238  143.600 20.927  1.00 50.38  ? 102  A   0 "C3'" 1 
ATOM   1990  O  "O3'" . A   A  1  101  ? 46.082  142.477 21.117  1.00 51.70  ? 102  A   0 "O3'" 1 
ATOM   1991  C  "C2'" . A   A  1  101  ? 45.005  143.953 19.468  1.00 50.00  ? 102  A   0 "C2'" 1 
ATOM   1992  O  "O2'" . A   A  1  101  ? 44.754  142.816 18.672  1.00 50.92  ? 102  A   0 "O2'" 1 
ATOM   1993  C  "C1'" . A   A  1  101  ? 43.716  144.770 19.572  1.00 50.95  ? 102  A   0 "C1'" 1 
ATOM   1994  N  N9    . A   A  1  101  ? 43.939  146.210 19.717  1.00 51.29  ? 102  A   0 N9    1 
ATOM   1995  C  C8    . A   A  1  101  ? 43.934  146.946 20.878  1.00 51.61  ? 102  A   0 C8    1 
ATOM   1996  N  N7    . A   A  1  101  ? 44.140  148.227 20.693  1.00 50.36  ? 102  A   0 N7    1 
ATOM   1997  C  C5    . A   A  1  101  ? 44.295  148.344 19.320  1.00 50.38  ? 102  A   0 C5    1 
ATOM   1998  C  C6    . A   A  1  101  ? 44.533  149.451 18.490  1.00 50.13  ? 102  A   0 C6    1 
ATOM   1999  N  N6    . A   A  1  101  ? 44.641  150.705 18.940  1.00 48.13  ? 102  A   0 N6    1 
ATOM   2000  N  N1    . A   A  1  101  ? 44.652  149.223 17.163  1.00 50.39  ? 102  A   0 N1    1 
ATOM   2001  C  C2    . A   A  1  101  ? 44.528  147.969 16.714  1.00 49.97  ? 102  A   0 C2    1 
ATOM   2002  N  N3    . A   A  1  101  ? 44.291  146.851 17.393  1.00 50.12  ? 102  A   0 N3    1 
ATOM   2003  C  C4    . A   A  1  101  ? 44.184  147.108 18.706  1.00 50.89  ? 102  A   0 C4    1 
ATOM   2004  P  P     . U   A  1  102  ? 47.648  142.705 21.403  1.00 54.34  ? 103  U   0 P     1 
ATOM   2005  O  OP1   . U   A  1  102  ? 48.251  141.392 21.766  1.00 54.51  ? 103  U   0 OP1   1 
ATOM   2006  O  OP2   . U   A  1  102  ? 47.787  143.861 22.328  1.00 49.95  ? 103  U   0 OP2   1 
ATOM   2007  O  "O5'" . U   A  1  102  ? 48.233  143.105 19.978  1.00 52.71  ? 103  U   0 "O5'" 1 
ATOM   2008  C  "C5'" . U   A  1  102  ? 48.124  142.203 18.868  1.00 51.98  ? 103  U   0 "C5'" 1 
ATOM   2009  C  "C4'" . U   A  1  102  ? 48.452  142.908 17.575  1.00 51.88  ? 103  U   0 "C4'" 1 
ATOM   2010  O  "O4'" . U   A  1  102  ? 47.481  143.959 17.324  1.00 50.62  ? 103  U   0 "O4'" 1 
ATOM   2011  C  "C3'" . U   A  1  102  ? 49.786  143.630 17.520  1.00 52.13  ? 103  U   0 "C3'" 1 
ATOM   2012  O  "O3'" . U   A  1  102  ? 50.868  142.744 17.270  1.00 54.09  ? 103  U   0 "O3'" 1 
ATOM   2013  C  "C2'" . U   A  1  102  ? 49.560  144.597 16.369  1.00 52.68  ? 103  U   0 "C2'" 1 
ATOM   2014  O  "O2'" . U   A  1  102  ? 49.656  143.971 15.106  1.00 55.33  ? 103  U   0 "O2'" 1 
ATOM   2015  C  "C1'" . U   A  1  102  ? 48.107  145.014 16.611  1.00 50.43  ? 103  U   0 "C1'" 1 
ATOM   2016  N  N1    . U   A  1  102  ? 48.017  146.246 17.409  1.00 49.80  ? 103  U   0 N1    1 
ATOM   2017  C  C2    . U   A  1  102  ? 47.940  147.455 16.727  1.00 48.76  ? 103  U   0 C2    1 
ATOM   2018  O  O2    . U   A  1  102  ? 47.928  147.536 15.509  1.00 47.82  ? 103  U   0 O2    1 
ATOM   2019  N  N3    . U   A  1  102  ? 47.879  148.567 17.528  1.00 46.85  ? 103  U   0 N3    1 
ATOM   2020  C  C4    . U   A  1  102  ? 47.886  148.599 18.905  1.00 47.51  ? 103  U   0 C4    1 
ATOM   2021  O  O4    . U   A  1  102  ? 47.807  149.683 19.483  1.00 47.38  ? 103  U   0 O4    1 
ATOM   2022  C  C5    . U   A  1  102  ? 47.965  147.317 19.534  1.00 47.47  ? 103  U   0 C5    1 
ATOM   2023  C  C6    . U   A  1  102  ? 48.023  146.213 18.786  1.00 48.32  ? 103  U   0 C6    1 
ATOM   2024  P  P     . G   A  1  103  ? 52.313  143.047 17.917  1.00 57.92  ? 104  G   0 P     1 
ATOM   2025  O  OP1   . G   A  1  103  ? 53.177  141.876 17.612  1.00 56.30  ? 104  G   0 OP1   1 
ATOM   2026  O  OP2   . G   A  1  103  ? 52.126  143.471 19.333  1.00 56.02  ? 104  G   0 OP2   1 
ATOM   2027  O  "O5'" . G   A  1  103  ? 52.859  144.304 17.096  1.00 56.86  ? 104  G   0 "O5'" 1 
ATOM   2028  C  "C5'" . G   A  1  103  ? 53.258  144.170 15.720  1.00 55.68  ? 104  G   0 "C5'" 1 
ATOM   2029  C  "C4'" . G   A  1  103  ? 53.301  145.519 15.032  1.00 54.86  ? 104  G   0 "C4'" 1 
ATOM   2030  O  "O4'" . G   A  1  103  ? 52.021  146.192 15.187  1.00 54.77  ? 104  G   0 "O4'" 1 
ATOM   2031  C  "C3'" . G   A  1  103  ? 54.277  146.562 15.547  1.00 54.61  ? 104  G   0 "C3'" 1 
ATOM   2032  O  "O3'" . G   A  1  103  ? 55.620  146.338 15.132  1.00 53.77  ? 104  G   0 "O3'" 1 
ATOM   2033  C  "C2'" . G   A  1  103  ? 53.712  147.828 14.919  1.00 54.19  ? 104  G   0 "C2'" 1 
ATOM   2034  O  "O2'" . G   A  1  103  ? 53.983  147.933 13.537  1.00 54.34  ? 104  G   0 "O2'" 1 
ATOM   2035  C  "C1'" . G   A  1  103  ? 52.214  147.599 15.106  1.00 53.84  ? 104  G   0 "C1'" 1 
ATOM   2036  N  N9    . G   A  1  103  ? 51.750  148.224 16.342  1.00 53.95  ? 104  G   0 N9    1 
ATOM   2037  C  C8    . G   A  1  103  ? 51.374  147.604 17.510  1.00 53.31  ? 104  G   0 C8    1 
ATOM   2038  N  N7    . G   A  1  103  ? 51.049  148.446 18.454  1.00 52.81  ? 104  G   0 N7    1 
ATOM   2039  C  C5    . G   A  1  103  ? 51.216  149.697 17.876  1.00 52.10  ? 104  G   0 C5    1 
ATOM   2040  C  C6    . G   A  1  103  ? 51.037  150.995 18.424  1.00 51.45  ? 104  G   0 C6    1 
ATOM   2041  O  O6    . G   A  1  103  ? 50.710  151.308 19.570  1.00 51.62  ? 104  G   0 O6    1 
ATOM   2042  N  N1    . G   A  1  103  ? 51.298  151.987 17.487  1.00 52.83  ? 104  G   0 N1    1 
ATOM   2043  C  C2    . G   A  1  103  ? 51.698  151.762 16.192  1.00 54.00  ? 104  G   0 C2    1 
ATOM   2044  N  N2    . G   A  1  103  ? 51.882  152.850 15.433  1.00 54.49  ? 104  G   0 N2    1 
ATOM   2045  N  N3    . G   A  1  103  ? 51.896  150.559 15.676  1.00 53.46  ? 104  G   0 N3    1 
ATOM   2046  C  C4    . G   A  1  103  ? 51.633  149.579 16.569  1.00 53.17  ? 104  G   0 C4    1 
ATOM   2047  P  P     . G   A  1  104  ? 56.832  146.763 16.106  1.00 52.98  ? 105  G   0 P     1 
ATOM   2048  O  OP1   . G   A  1  104  ? 58.062  146.254 15.452  1.00 52.13  ? 105  G   0 OP1   1 
ATOM   2049  O  OP2   . G   A  1  104  ? 56.508  146.349 17.498  1.00 51.08  ? 105  G   0 OP2   1 
ATOM   2050  O  "O5'" . G   A  1  104  ? 56.856  148.358 16.072  1.00 50.40  ? 105  G   0 "O5'" 1 
ATOM   2051  C  "C5'" . G   A  1  104  ? 57.272  149.042 14.888  1.00 48.54  ? 105  G   0 "C5'" 1 
ATOM   2052  C  "C4'" . G   A  1  104  ? 56.997  150.525 14.981  1.00 46.69  ? 105  G   0 "C4'" 1 
ATOM   2053  O  "O4'" . G   A  1  104  ? 55.606  150.775 15.320  1.00 46.24  ? 105  G   0 "O4'" 1 
ATOM   2054  C  "C3'" . G   A  1  104  ? 57.721  151.344 16.031  1.00 45.30  ? 105  G   0 "C3'" 1 
ATOM   2055  O  "O3'" . G   A  1  104  ? 59.077  151.584 15.698  1.00 44.34  ? 105  G   0 "O3'" 1 
ATOM   2056  C  "C2'" . G   A  1  104  ? 56.915  152.634 15.981  1.00 46.09  ? 105  G   0 "C2'" 1 
ATOM   2057  O  "O2'" . G   A  1  104  ? 57.199  153.408 14.828  1.00 46.06  ? 105  G   0 "O2'" 1 
ATOM   2058  C  "C1'" . G   A  1  104  ? 55.491  152.083 15.875  1.00 45.92  ? 105  G   0 "C1'" 1 
ATOM   2059  N  N9    . G   A  1  104  ? 54.889  151.987 17.200  1.00 45.74  ? 105  G   0 N9    1 
ATOM   2060  C  C8    . G   A  1  104  ? 54.580  150.844 17.896  1.00 46.26  ? 105  G   0 C8    1 
ATOM   2061  N  N7    . G   A  1  104  ? 54.101  151.083 19.086  1.00 46.54  ? 105  G   0 N7    1 
ATOM   2062  C  C5    . G   A  1  104  ? 54.082  152.467 19.178  1.00 44.85  ? 105  G   0 C5    1 
ATOM   2063  C  C6    . G   A  1  104  ? 53.678  153.306 20.240  1.00 44.53  ? 105  G   0 C6    1 
ATOM   2064  O  O6    . G   A  1  104  ? 53.252  152.986 21.351  1.00 45.61  ? 105  G   0 O6    1 
ATOM   2065  N  N1    . G   A  1  104  ? 53.819  154.648 19.914  1.00 45.53  ? 105  G   0 N1    1 
ATOM   2066  C  C2    . G   A  1  104  ? 54.297  155.124 18.719  1.00 45.14  ? 105  G   0 C2    1 
ATOM   2067  N  N2    . G   A  1  104  ? 54.361  156.457 18.599  1.00 44.72  ? 105  G   0 N2    1 
ATOM   2068  N  N3    . G   A  1  104  ? 54.684  154.350 17.720  1.00 44.43  ? 105  G   0 N3    1 
ATOM   2069  C  C4    . G   A  1  104  ? 54.550  153.042 18.017  1.00 45.30  ? 105  G   0 C4    1 
ATOM   2070  P  P     . A   A  1  105  ? 60.116  151.968 16.858  1.00 43.83  ? 106  A   0 P     1 
ATOM   2071  O  OP1   . A   A  1  105  ? 61.443  152.155 16.225  1.00 45.95  ? 106  A   0 OP1   1 
ATOM   2072  O  OP2   . A   A  1  105  ? 59.959  150.998 17.975  1.00 43.14  ? 106  A   0 OP2   1 
ATOM   2073  O  "O5'" . A   A  1  105  ? 59.623  153.394 17.359  1.00 42.61  ? 106  A   0 "O5'" 1 
ATOM   2074  C  "C5'" . A   A  1  105  ? 59.647  154.517 16.474  1.00 40.71  ? 106  A   0 "C5'" 1 
ATOM   2075  C  "C4'" . A   A  1  105  ? 59.305  155.777 17.218  1.00 39.92  ? 106  A   0 "C4'" 1 
ATOM   2076  O  "O4'" . A   A  1  105  ? 57.922  155.728 17.654  1.00 40.64  ? 106  A   0 "O4'" 1 
ATOM   2077  C  "C3'" . A   A  1  105  ? 60.079  156.013 18.504  1.00 39.40  ? 106  A   0 "C3'" 1 
ATOM   2078  O  "O3'" . A   A  1  105  ? 61.380  156.527 18.263  1.00 39.07  ? 106  A   0 "O3'" 1 
ATOM   2079  C  "C2'" . A   A  1  105  ? 59.172  156.993 19.231  1.00 38.57  ? 106  A   0 "C2'" 1 
ATOM   2080  O  "O2'" . A   A  1  105  ? 59.255  158.305 18.724  1.00 33.86  ? 106  A   0 "O2'" 1 
ATOM   2081  C  "C1'" . A   A  1  105  ? 57.795  156.418 18.891  1.00 39.47  ? 106  A   0 "C1'" 1 
ATOM   2082  N  N9    . A   A  1  105  ? 57.352  155.466 19.908  1.00 38.72  ? 106  A   0 N9    1 
ATOM   2083  C  C8    . A   A  1  105  ? 57.396  154.094 19.876  1.00 39.19  ? 106  A   0 C8    1 
ATOM   2084  N  N7    . A   A  1  105  ? 56.935  153.527 20.963  1.00 40.74  ? 106  A   0 N7    1 
ATOM   2085  C  C5    . A   A  1  105  ? 56.558  154.598 21.763  1.00 40.40  ? 106  A   0 C5    1 
ATOM   2086  C  C6    . A   A  1  105  ? 55.993  154.670 23.052  1.00 40.83  ? 106  A   0 C6    1 
ATOM   2087  N  N6    . A   A  1  105  ? 55.688  153.602 23.795  1.00 39.49  ? 106  A   0 N6    1 
ATOM   2088  N  N1    . A   A  1  105  ? 55.747  155.896 23.559  1.00 41.37  ? 106  A   0 N1    1 
ATOM   2089  C  C2    . A   A  1  105  ? 56.049  156.969 22.817  1.00 40.77  ? 106  A   0 C2    1 
ATOM   2090  N  N3    . A   A  1  105  ? 56.575  157.029 21.598  1.00 39.67  ? 106  A   0 N3    1 
ATOM   2091  C  C4    . A   A  1  105  ? 56.809  155.796 21.123  1.00 39.56  ? 106  A   0 C4    1 
ATOM   2092  P  P     . U   A  1  106  ? 62.582  156.144 19.258  1.00 38.32  ? 107  U   0 P     1 
ATOM   2093  O  OP1   . U   A  1  106  ? 63.805  156.792 18.738  1.00 37.47  ? 107  U   0 OP1   1 
ATOM   2094  O  OP2   . U   A  1  106  ? 62.570  154.679 19.468  1.00 38.34  ? 107  U   0 OP2   1 
ATOM   2095  O  "O5'" . U   A  1  106  ? 62.175  156.867 20.618  1.00 37.73  ? 107  U   0 "O5'" 1 
ATOM   2096  C  "C5'" . U   A  1  106  ? 61.939  158.281 20.644  1.00 35.84  ? 107  U   0 "C5'" 1 
ATOM   2097  C  "C4'" . U   A  1  106  ? 61.340  158.697 21.967  1.00 37.44  ? 107  U   0 "C4'" 1 
ATOM   2098  O  "O4'" . U   A  1  106  ? 59.998  158.164 22.112  1.00 37.44  ? 107  U   0 "O4'" 1 
ATOM   2099  C  "C3'" . U   A  1  106  ? 62.052  158.226 23.225  1.00 35.61  ? 107  U   0 "C3'" 1 
ATOM   2100  O  "O3'" . U   A  1  106  ? 63.176  159.031 23.528  1.00 35.16  ? 107  U   0 "O3'" 1 
ATOM   2101  C  "C2'" . U   A  1  106  ? 60.960  158.414 24.263  1.00 37.27  ? 107  U   0 "C2'" 1 
ATOM   2102  O  "O2'" . U   A  1  106  ? 60.783  159.782 24.585  1.00 35.03  ? 107  U   0 "O2'" 1 
ATOM   2103  C  "C1'" . U   A  1  106  ? 59.737  157.920 23.487  1.00 37.52  ? 107  U   0 "C1'" 1 
ATOM   2104  N  N1    . U   A  1  106  ? 59.507  156.477 23.677  1.00 38.01  ? 107  U   0 N1    1 
ATOM   2105  C  C2    . U   A  1  106  ? 58.759  156.079 24.782  1.00 38.46  ? 107  U   0 C2    1 
ATOM   2106  O  O2    . U   A  1  106  ? 58.261  156.865 25.570  1.00 37.71  ? 107  U   0 O2    1 
ATOM   2107  N  N3    . U   A  1  106  ? 58.616  154.722 24.924  1.00 39.11  ? 107  U   0 N3    1 
ATOM   2108  C  C4    . U   A  1  106  ? 59.122  153.741 24.094  1.00 39.90  ? 107  U   0 C4    1 
ATOM   2109  O  O4    . U   A  1  106  ? 58.956  152.557 24.389  1.00 42.01  ? 107  U   0 O4    1 
ATOM   2110  C  C5    . U   A  1  106  ? 59.858  154.229 22.968  1.00 36.90  ? 107  U   0 C5    1 
ATOM   2111  C  C6    . U   A  1  106  ? 60.022  155.543 22.802  1.00 37.60  ? 107  U   0 C6    1 
ATOM   2112  P  P     . U   A  1  107  ? 64.558  158.340 23.958  1.00 37.13  ? 108  U   0 P     1 
ATOM   2113  O  OP1   . U   A  1  107  ? 65.438  159.459 24.358  1.00 34.95  ? 108  U   0 OP1   1 
ATOM   2114  O  OP2   . U   A  1  107  ? 64.988  157.411 22.887  1.00 34.34  ? 108  U   0 OP2   1 
ATOM   2115  O  "O5'" . U   A  1  107  ? 64.192  157.473 25.251  1.00 37.81  ? 108  U   0 "O5'" 1 
ATOM   2116  C  "C5'" . U   A  1  107  ? 63.589  158.079 26.416  1.00 37.27  ? 108  U   0 "C5'" 1 
ATOM   2117  C  "C4'" . U   A  1  107  ? 63.069  157.015 27.364  1.00 38.03  ? 108  U   0 "C4'" 1 
ATOM   2118  O  "O4'" . U   A  1  107  ? 62.004  156.258 26.728  1.00 38.60  ? 108  U   0 "O4'" 1 
ATOM   2119  C  "C3'" . U   A  1  107  ? 64.072  155.960 27.807  1.00 37.76  ? 108  U   0 "C3'" 1 
ATOM   2120  O  "O3'" . U   A  1  107  ? 64.847  156.430 28.904  1.00 35.85  ? 108  U   0 "O3'" 1 
ATOM   2121  C  "C2'" . U   A  1  107  ? 63.164  154.803 28.212  1.00 39.70  ? 108  U   0 "C2'" 1 
ATOM   2122  O  "O2'" . U   A  1  107  ? 62.604  154.966 29.500  1.00 39.67  ? 108  U   0 "O2'" 1 
ATOM   2123  C  "C1'" . U   A  1  107  ? 62.050  154.908 27.163  1.00 39.90  ? 108  U   0 "C1'" 1 
ATOM   2124  N  N1    . U   A  1  107  ? 62.263  154.038 25.993  1.00 41.59  ? 108  U   0 N1    1 
ATOM   2125  C  C2    . U   A  1  107  ? 61.737  152.755 26.037  1.00 42.40  ? 108  U   0 C2    1 
ATOM   2126  O  O2    . U   A  1  107  ? 61.114  152.325 26.988  1.00 43.02  ? 108  U   0 O2    1 
ATOM   2127  N  N3    . U   A  1  107  ? 61.975  151.992 24.920  1.00 44.54  ? 108  U   0 N3    1 
ATOM   2128  C  C4    . U   A  1  107  ? 62.676  152.368 23.786  1.00 44.08  ? 108  U   0 C4    1 
ATOM   2129  O  O4    . U   A  1  107  ? 62.814  151.561 22.861  1.00 46.48  ? 108  U   0 O4    1 
ATOM   2130  C  C5    . U   A  1  107  ? 63.186  153.705 23.817  1.00 41.60  ? 108  U   0 C5    1 
ATOM   2131  C  C6    . U   A  1  107  ? 62.967  154.474 24.887  1.00 41.31  ? 108  U   0 C6    1 
ATOM   2132  P  P     . U   A  1  108  ? 66.410  156.066 29.003  1.00 33.70  ? 109  U   0 P     1 
ATOM   2133  O  OP1   . U   A  1  108  ? 67.054  156.389 27.705  1.00 37.11  ? 109  U   0 OP1   1 
ATOM   2134  O  OP2   . U   A  1  108  ? 66.552  154.698 29.556  1.00 33.79  ? 109  U   0 OP2   1 
ATOM   2135  O  "O5'" . U   A  1  108  ? 66.942  157.084 30.102  1.00 34.65  ? 109  U   0 "O5'" 1 
ATOM   2136  C  "C5'" . U   A  1  108  ? 67.294  158.444 29.768  1.00 34.24  ? 109  U   0 "C5'" 1 
ATOM   2137  C  "C4'" . U   A  1  108  ? 67.537  159.226 31.034  1.00 33.56  ? 109  U   0 "C4'" 1 
ATOM   2138  O  "O4'" . U   A  1  108  ? 66.274  159.413 31.716  1.00 34.31  ? 109  U   0 "O4'" 1 
ATOM   2139  C  "C3'" . U   A  1  108  ? 68.432  158.501 32.029  1.00 33.86  ? 109  U   0 "C3'" 1 
ATOM   2140  O  "O3'" . U   A  1  108  ? 69.799  158.806 31.797  1.00 32.93  ? 109  U   0 "O3'" 1 
ATOM   2141  C  "C2'" . U   A  1  108  ? 67.936  159.024 33.367  1.00 35.18  ? 109  U   0 "C2'" 1 
ATOM   2142  O  "O2'" . U   A  1  108  ? 68.457  160.297 33.674  1.00 36.85  ? 109  U   0 "O2'" 1 
ATOM   2143  C  "C1'" . U   A  1  108  ? 66.433  159.152 33.100  1.00 35.50  ? 109  U   0 "C1'" 1 
ATOM   2144  N  N1    . U   A  1  108  ? 65.636  157.958 33.436  1.00 36.17  ? 109  U   0 N1    1 
ATOM   2145  C  C2    . U   A  1  108  ? 65.592  157.548 34.762  1.00 37.13  ? 109  U   0 C2    1 
ATOM   2146  O  O2    . U   A  1  108  ? 66.236  158.086 35.645  1.00 39.88  ? 109  U   0 O2    1 
ATOM   2147  N  N3    . U   A  1  108  ? 64.769  156.475 35.011  1.00 35.73  ? 109  U   0 N3    1 
ATOM   2148  C  C4    . U   A  1  108  ? 64.015  155.774 34.093  1.00 36.08  ? 109  U   0 C4    1 
ATOM   2149  O  O4    . U   A  1  108  ? 63.239  154.904 34.488  1.00 34.17  ? 109  U   0 O4    1 
ATOM   2150  C  C5    . U   A  1  108  ? 64.149  156.228 32.740  1.00 35.49  ? 109  U   0 C5    1 
ATOM   2151  C  C6    . U   A  1  108  ? 64.931  157.275 32.465  1.00 35.71  ? 109  U   0 C6    1 
ATOM   2152  P  P     . C   A  1  109  ? 70.866  157.621 31.622  1.00 33.89  ? 110  C   0 P     1 
ATOM   2153  O  OP1   . C   A  1  109  ? 72.096  158.218 31.060  1.00 34.16  ? 110  C   0 OP1   1 
ATOM   2154  O  OP2   . C   A  1  109  ? 70.226  156.477 30.929  1.00 32.75  ? 110  C   0 OP2   1 
ATOM   2155  O  "O5'" . C   A  1  109  ? 71.209  157.207 33.113  1.00 32.58  ? 110  C   0 "O5'" 1 
ATOM   2156  C  "C5'" . C   A  1  109  ? 71.814  158.150 34.007  1.00 29.95  ? 110  C   0 "C5'" 1 
ATOM   2157  C  "C4'" . C   A  1  109  ? 71.714  157.653 35.420  1.00 29.44  ? 110  C   0 "C4'" 1 
ATOM   2158  O  "O4'" . C   A  1  109  ? 70.320  157.598 35.809  1.00 30.72  ? 110  C   0 "O4'" 1 
ATOM   2159  C  "C3'" . C   A  1  109  ? 72.201  156.232 35.631  1.00 27.00  ? 110  C   0 "C3'" 1 
ATOM   2160  O  "O3'" . C   A  1  109  ? 73.600  156.194 35.785  1.00 27.96  ? 110  C   0 "O3'" 1 
ATOM   2161  C  "C2'" . C   A  1  109  ? 71.475  155.838 36.902  1.00 28.92  ? 110  C   0 "C2'" 1 
ATOM   2162  O  "O2'" . C   A  1  109  ? 72.040  156.434 38.051  1.00 27.23  ? 110  C   0 "O2'" 1 
ATOM   2163  C  "C1'" . C   A  1  109  ? 70.113  156.482 36.661  1.00 29.07  ? 110  C   0 "C1'" 1 
ATOM   2164  N  N1    . C   A  1  109  ? 69.145  155.571 36.026  1.00 30.63  ? 110  C   0 N1    1 
ATOM   2165  C  C2    . C   A  1  109  ? 68.485  154.633 36.833  1.00 29.80  ? 110  C   0 C2    1 
ATOM   2166  O  O2    . C   A  1  109  ? 68.787  154.561 38.030  1.00 27.44  ? 110  C   0 O2    1 
ATOM   2167  N  N3    . C   A  1  109  ? 67.540  153.832 36.283  1.00 30.12  ? 110  C   0 N3    1 
ATOM   2168  C  C4    . C   A  1  109  ? 67.249  153.939 34.983  1.00 30.30  ? 110  C   0 C4    1 
ATOM   2169  N  N4    . C   A  1  109  ? 66.276  153.166 34.496  1.00 27.73  ? 110  C   0 N4    1 
ATOM   2170  C  C5    . C   A  1  109  ? 67.936  154.857 34.128  1.00 30.12  ? 110  C   0 C5    1 
ATOM   2171  C  C6    . C   A  1  109  ? 68.869  155.643 34.685  1.00 29.96  ? 110  C   0 C6    1 
ATOM   2172  P  P     . C   A  1  110  ? 74.406  154.907 35.298  1.00 29.89  ? 111  C   0 P     1 
ATOM   2173  O  OP1   . C   A  1  110  ? 75.854  155.223 35.309  1.00 30.30  ? 111  C   0 OP1   1 
ATOM   2174  O  OP2   . C   A  1  110  ? 73.770  154.429 34.050  1.00 32.33  ? 111  C   0 OP2   1 
ATOM   2175  O  "O5'" . C   A  1  110  ? 74.113  153.830 36.431  1.00 30.57  ? 111  C   0 "O5'" 1 
ATOM   2176  C  "C5'" . C   A  1  110  ? 74.577  154.017 37.771  1.00 26.85  ? 111  C   0 "C5'" 1 
ATOM   2177  C  "C4'" . C   A  1  110  ? 73.992  152.951 38.665  1.00 28.25  ? 111  C   0 "C4'" 1 
ATOM   2178  O  "O4'" . C   A  1  110  ? 72.549  153.071 38.638  1.00 28.74  ? 111  C   0 "O4'" 1 
ATOM   2179  C  "C3'" . C   A  1  110  ? 74.241  151.502 38.256  1.00 25.93  ? 111  C   0 "C3'" 1 
ATOM   2180  O  "O3'" . C   A  1  110  ? 75.505  151.029 38.704  1.00 24.41  ? 111  C   0 "O3'" 1 
ATOM   2181  C  "C2'" . C   A  1  110  ? 73.109  150.776 38.959  1.00 27.41  ? 111  C   0 "C2'" 1 
ATOM   2182  O  "O2'" . C   A  1  110  ? 73.360  150.538 40.322  1.00 26.44  ? 111  C   0 "O2'" 1 
ATOM   2183  C  "C1'" . C   A  1  110  ? 71.973  151.791 38.833  1.00 31.52  ? 111  C   0 "C1'" 1 
ATOM   2184  N  N1    . C   A  1  110  ? 71.069  151.479 37.716  1.00 34.92  ? 111  C   0 N1    1 
ATOM   2185  C  C2    . C   A  1  110  ? 70.069  150.528 37.931  1.00 35.13  ? 111  C   0 C2    1 
ATOM   2186  O  O2    . C   A  1  110  ? 69.984  149.997 39.050  1.00 37.12  ? 111  C   0 O2    1 
ATOM   2187  N  N3    . C   A  1  110  ? 69.221  150.214 36.922  1.00 34.51  ? 111  C   0 N3    1 
ATOM   2188  C  C4    . C   A  1  110  ? 69.344  150.818 35.736  1.00 35.67  ? 111  C   0 C4    1 
ATOM   2189  N  N4    . C   A  1  110  ? 68.471  150.495 34.776  1.00 34.19  ? 111  C   0 N4    1 
ATOM   2190  C  C5    . C   A  1  110  ? 70.362  151.787 35.484  1.00 33.57  ? 111  C   0 C5    1 
ATOM   2191  C  C6    . C   A  1  110  ? 71.194  152.087 36.493  1.00 34.70  ? 111  C   0 C6    1 
ATOM   2192  P  P     . G   A  1  111  ? 76.183  149.745 38.011  1.00 24.27  ? 112  G   0 P     1 
ATOM   2193  O  OP1   . G   A  1  111  ? 77.184  149.239 38.980  1.00 20.78  ? 112  G   0 OP1   1 
ATOM   2194  O  OP2   . G   A  1  111  ? 76.615  150.082 36.637  1.00 24.51  ? 112  G   0 OP2   1 
ATOM   2195  O  "O5'" . G   A  1  111  ? 75.009  148.669 37.920  1.00 25.98  ? 112  G   0 "O5'" 1 
ATOM   2196  C  "C5'" . G   A  1  111  ? 74.584  147.922 39.091  1.00 24.01  ? 112  G   0 "C5'" 1 
ATOM   2197  C  "C4'" . G   A  1  111  ? 73.437  147.003 38.740  1.00 24.94  ? 112  G   0 "C4'" 1 
ATOM   2198  O  "O4'" . G   A  1  111  ? 72.343  147.780 38.180  1.00 28.32  ? 112  G   0 "O4'" 1 
ATOM   2199  C  "C3'" . G   A  1  111  ? 73.730  145.957 37.675  1.00 26.00  ? 112  G   0 "C3'" 1 
ATOM   2200  O  "O3'" . G   A  1  111  ? 74.336  144.819 38.249  1.00 23.88  ? 112  G   0 "O3'" 1 
ATOM   2201  C  "C2'" . G   A  1  111  ? 72.345  145.642 37.132  1.00 26.69  ? 112  G   0 "C2'" 1 
ATOM   2202  O  "O2'" . G   A  1  111  ? 71.610  144.798 37.999  1.00 23.71  ? 112  G   0 "O2'" 1 
ATOM   2203  C  "C1'" . G   A  1  111  ? 71.695  147.025 37.164  1.00 29.83  ? 112  G   0 "C1'" 1 
ATOM   2204  N  N9    . G   A  1  111  ? 71.780  147.768 35.910  1.00 33.28  ? 112  G   0 N9    1 
ATOM   2205  C  C8    . G   A  1  111  ? 72.747  148.676 35.548  1.00 33.11  ? 112  G   0 C8    1 
ATOM   2206  N  N7    . G   A  1  111  ? 72.513  149.240 34.395  1.00 33.79  ? 112  G   0 N7    1 
ATOM   2207  C  C5    . G   A  1  111  ? 71.326  148.663 33.961  1.00 33.91  ? 112  G   0 C5    1 
ATOM   2208  C  C6    . G   A  1  111  ? 70.558  148.903 32.787  1.00 34.63  ? 112  G   0 C6    1 
ATOM   2209  O  O6    . G   A  1  111  ? 70.764  149.719 31.888  1.00 34.13  ? 112  G   0 O6    1 
ATOM   2210  N  N1    . G   A  1  111  ? 69.440  148.080 32.731  1.00 35.59  ? 112  G   0 N1    1 
ATOM   2211  C  C2    . G   A  1  111  ? 69.092  147.153 33.685  1.00 34.64  ? 112  G   0 C2    1 
ATOM   2212  N  N2    . G   A  1  111  ? 67.989  146.433 33.435  1.00 33.55  ? 112  G   0 N2    1 
ATOM   2213  N  N3    . G   A  1  111  ? 69.780  146.945 34.798  1.00 33.72  ? 112  G   0 N3    1 
ATOM   2214  C  C4    . G   A  1  111  ? 70.877  147.728 34.869  1.00 33.72  ? 112  G   0 C4    1 
ATOM   2215  P  P     . A   A  1  112  ? 75.755  144.323 37.709  1.00 26.68  ? 113  A   0 P     1 
ATOM   2216  O  OP1   . A   A  1  112  ? 76.363  143.447 38.751  1.00 24.88  ? 113  A   0 OP1   1 
ATOM   2217  O  OP2   . A   A  1  112  ? 76.492  145.510 37.227  1.00 28.36  ? 113  A   0 OP2   1 
ATOM   2218  O  "O5'" . A   A  1  112  ? 75.399  143.429 36.442  1.00 28.23  ? 113  A   0 "O5'" 1 
ATOM   2219  C  "C5'" . A   A  1  112  ? 74.986  142.064 36.612  1.00 28.22  ? 113  A   0 "C5'" 1 
ATOM   2220  C  "C4'" . A   A  1  112  ? 75.489  141.213 35.479  1.00 25.95  ? 113  A   0 "C4'" 1 
ATOM   2221  O  "O4'" . A   A  1  112  ? 74.621  141.324 34.326  1.00 28.15  ? 113  A   0 "O4'" 1 
ATOM   2222  C  "C3'" . A   A  1  112  ? 76.825  141.616 34.891  1.00 26.45  ? 113  A   0 "C3'" 1 
ATOM   2223  O  "O3'" . A   A  1  112  ? 77.906  141.250 35.727  1.00 25.87  ? 113  A   0 "O3'" 1 
ATOM   2224  C  "C2'" . A   A  1  112  ? 76.831  140.851 33.570  1.00 25.37  ? 113  A   0 "C2'" 1 
ATOM   2225  O  "O2'" . A   A  1  112  ? 77.213  139.506 33.740  1.00 23.90  ? 113  A   0 "O2'" 1 
ATOM   2226  C  "C1'" . A   A  1  112  ? 75.348  140.907 33.179  1.00 27.69  ? 113  A   0 "C1'" 1 
ATOM   2227  N  N9    . A   A  1  112  ? 75.008  141.788 32.062  1.00 30.17  ? 113  A   0 N9    1 
ATOM   2228  C  C8    . A   A  1  112  ? 75.613  142.950 31.656  1.00 29.60  ? 113  A   0 C8    1 
ATOM   2229  N  N7    . A   A  1  112  ? 75.033  143.516 30.623  1.00 31.50  ? 113  A   0 N7    1 
ATOM   2230  C  C5    . A   A  1  112  ? 73.980  142.661 30.321  1.00 33.04  ? 113  A   0 C5    1 
ATOM   2231  C  C6    . A   A  1  112  ? 72.977  142.692 29.322  1.00 33.98  ? 113  A   0 C6    1 
ATOM   2232  N  N6    . A   A  1  112  ? 72.855  143.666 28.411  1.00 30.52  ? 113  A   0 N6    1 
ATOM   2233  N  N1    . A   A  1  112  ? 72.087  141.675 29.298  1.00 32.83  ? 113  A   0 N1    1 
ATOM   2234  C  C2    . A   A  1  112  ? 72.197  140.707 30.211  1.00 33.31  ? 113  A   0 C2    1 
ATOM   2235  N  N3    . A   A  1  112  ? 73.085  140.568 31.191  1.00 32.68  ? 113  A   0 N3    1 
ATOM   2236  C  C4    . A   A  1  112  ? 73.958  141.589 31.194  1.00 32.73  ? 113  A   0 C4    1 
ATOM   2237  P  P     . A   A  1  113  ? 79.382  141.770 35.384  1.00 24.71  ? 114  A   0 P     1 
ATOM   2238  O  OP1   . A   A  1  113  ? 80.024  140.783 34.472  1.00 24.26  ? 114  A   0 OP1   1 
ATOM   2239  O  OP2   . A   A  1  113  ? 80.023  142.091 36.681  1.00 23.27  ? 114  A   0 OP2   1 
ATOM   2240  O  "O5'" . A   A  1  113  ? 79.131  143.122 34.570  1.00 22.78  ? 114  A   0 "O5'" 1 
ATOM   2241  C  "C5'" . A   A  1  113  ? 78.877  144.370 35.241  1.00 23.73  ? 114  A   0 "C5'" 1 
ATOM   2242  C  "C4'" . A   A  1  113  ? 78.693  145.473 34.224  1.00 25.61  ? 114  A   0 "C4'" 1 
ATOM   2243  O  "O4'" . A   A  1  113  ? 77.476  145.211 33.463  1.00 27.17  ? 114  A   0 "O4'" 1 
ATOM   2244  C  "C3'" . A   A  1  113  ? 78.539  146.892 34.779  1.00 26.76  ? 114  A   0 "C3'" 1 
ATOM   2245  O  "O3'" . A   A  1  113  ? 79.221  147.819 33.933  1.00 28.55  ? 114  A   0 "O3'" 1 
ATOM   2246  C  "C2'" . A   A  1  113  ? 77.036  147.143 34.635  1.00 26.42  ? 114  A   0 "C2'" 1 
ATOM   2247  O  "O2'" . A   A  1  113  ? 76.680  148.506 34.511  1.00 24.97  ? 114  A   0 "O2'" 1 
ATOM   2248  C  "C1'" . A   A  1  113  ? 76.755  146.413 33.332  1.00 26.83  ? 114  A   0 "C1'" 1 
ATOM   2249  N  N9    . A   A  1  113  ? 75.350  146.116 33.047  1.00 28.23  ? 114  A   0 N9    1 
ATOM   2250  C  C8    . A   A  1  113  ? 74.536  145.164 33.604  1.00 27.86  ? 114  A   0 C8    1 
ATOM   2251  N  N7    . A   A  1  113  ? 73.325  145.142 33.096  1.00 30.28  ? 114  A   0 N7    1 
ATOM   2252  C  C5    . A   A  1  113  ? 73.341  146.153 32.145  1.00 29.96  ? 114  A   0 C5    1 
ATOM   2253  C  C6    . A   A  1  113  ? 72.358  146.644 31.253  1.00 30.67  ? 114  A   0 C6    1 
ATOM   2254  N  N6    . A   A  1  113  ? 71.127  146.149 31.156  1.00 29.00  ? 114  A   0 N6    1 
ATOM   2255  N  N1    . A   A  1  113  ? 72.696  147.677 30.451  1.00 29.94  ? 114  A   0 N1    1 
ATOM   2256  C  C2    . A   A  1  113  ? 73.934  148.173 30.538  1.00 30.18  ? 114  A   0 C2    1 
ATOM   2257  N  N3    . A   A  1  113  ? 74.945  147.794 31.325  1.00 31.12  ? 114  A   0 N3    1 
ATOM   2258  C  C4    . A   A  1  113  ? 74.578  146.768 32.112  1.00 28.71  ? 114  A   0 C4    1 
ATOM   2259  P  P     . U   A  1  114  ? 80.824  147.958 34.002  1.00 30.62  ? 115  U   0 P     1 
ATOM   2260  O  OP1   . U   A  1  114  ? 81.422  146.801 34.705  1.00 33.24  ? 115  U   0 OP1   1 
ATOM   2261  O  OP2   . U   A  1  114  ? 81.133  149.327 34.464  1.00 33.56  ? 115  U   0 OP2   1 
ATOM   2262  O  "O5'" . U   A  1  114  ? 81.216  147.833 32.467  1.00 34.99  ? 115  U   0 "O5'" 1 
ATOM   2263  C  "C5'" . U   A  1  114  ? 82.529  148.151 31.969  1.00 35.95  ? 115  U   0 "C5'" 1 
ATOM   2264  C  "C4'" . U   A  1  114  ? 82.535  148.009 30.461  1.00 35.45  ? 115  U   0 "C4'" 1 
ATOM   2265  O  "O4'" . U   A  1  114  ? 82.362  146.606 30.109  1.00 36.23  ? 115  U   0 "O4'" 1 
ATOM   2266  C  "C3'" . U   A  1  114  ? 81.388  148.742 29.774  1.00 36.88  ? 115  U   0 "C3'" 1 
ATOM   2267  O  "O3'" . U   A  1  114  ? 81.763  149.071 28.444  1.00 39.99  ? 115  U   0 "O3'" 1 
ATOM   2268  C  "C2'" . U   A  1  114  ? 80.311  147.671 29.719  1.00 35.90  ? 115  U   0 "C2'" 1 
ATOM   2269  O  "O2'" . U   A  1  114  ? 79.329  147.914 28.734  1.00 37.04  ? 115  U   0 "O2'" 1 
ATOM   2270  C  "C1'" . U   A  1  114  ? 81.153  146.440 29.390  1.00 35.88  ? 115  U   0 "C1'" 1 
ATOM   2271  N  N1    . U   A  1  114  ? 80.525  145.174 29.800  1.00 36.69  ? 115  U   0 N1    1 
ATOM   2272  C  C2    . U   A  1  114  ? 79.629  144.583 28.921  1.00 36.14  ? 115  U   0 C2    1 
ATOM   2273  O  O2    . U   A  1  114  ? 79.371  145.042 27.817  1.00 35.82  ? 115  U   0 O2    1 
ATOM   2274  N  N3    . U   A  1  114  ? 79.046  143.431 29.382  1.00 36.52  ? 115  U   0 N3    1 
ATOM   2275  C  C4    . U   A  1  114  ? 79.265  142.813 30.597  1.00 37.09  ? 115  U   0 C4    1 
ATOM   2276  O  O4    . U   A  1  114  ? 78.623  141.798 30.887  1.00 37.03  ? 115  U   0 O4    1 
ATOM   2277  C  C5    . U   A  1  114  ? 80.220  143.472 31.435  1.00 36.34  ? 115  U   0 C5    1 
ATOM   2278  C  C6    . U   A  1  114  ? 80.801  144.598 31.020  1.00 34.67  ? 115  U   0 C6    1 
ATOM   2279  P  P     . G   A  1  115  ? 82.031  150.597 28.044  1.00 39.96  ? 116  G   0 P     1 
ATOM   2280  O  OP1   . G   A  1  115  ? 81.012  151.473 28.670  1.00 41.29  ? 116  G   0 OP1   1 
ATOM   2281  O  OP2   . G   A  1  115  ? 82.206  150.601 26.569  1.00 41.25  ? 116  G   0 OP2   1 
ATOM   2282  O  "O5'" . G   A  1  115  ? 83.435  150.916 28.715  1.00 38.61  ? 116  G   0 "O5'" 1 
ATOM   2283  C  "C5'" . G   A  1  115  ? 84.641  150.396 28.153  1.00 37.55  ? 116  G   0 "C5'" 1 
ATOM   2284  C  "C4'" . G   A  1  115  ? 85.804  151.226 28.604  1.00 36.32  ? 116  G   0 "C4'" 1 
ATOM   2285  O  "O4'" . G   A  1  115  ? 85.569  152.601 28.215  1.00 36.13  ? 116  G   0 "O4'" 1 
ATOM   2286  C  "C3'" . G   A  1  115  ? 85.992  151.279 30.106  1.00 35.32  ? 116  G   0 "C3'" 1 
ATOM   2287  O  "O3'" . G   A  1  115  ? 86.786  150.177 30.507  1.00 37.16  ? 116  G   0 "O3'" 1 
ATOM   2288  C  "C2'" . G   A  1  115  ? 86.714  152.605 30.290  1.00 35.15  ? 116  G   0 "C2'" 1 
ATOM   2289  O  "O2'" . G   A  1  115  ? 88.078  152.485 29.931  1.00 34.59  ? 116  G   0 "O2'" 1 
ATOM   2290  C  "C1'" . G   A  1  115  ? 86.011  153.472 29.241  1.00 32.99  ? 116  G   0 "C1'" 1 
ATOM   2291  N  N9    . G   A  1  115  ? 84.847  154.224 29.705  1.00 30.40  ? 116  G   0 N9    1 
ATOM   2292  C  C8    . G   A  1  115  ? 83.537  153.980 29.375  1.00 30.89  ? 116  G   0 C8    1 
ATOM   2293  N  N7    . G   A  1  115  ? 82.707  154.843 29.890  1.00 31.37  ? 116  G   0 N7    1 
ATOM   2294  C  C5    . G   A  1  115  ? 83.515  155.705 30.615  1.00 30.36  ? 116  G   0 C5    1 
ATOM   2295  C  C6    . G   A  1  115  ? 83.174  156.842 31.382  1.00 30.82  ? 116  G   0 C6    1 
ATOM   2296  O  O6    . G   A  1  115  ? 82.055  157.326 31.584  1.00 31.95  ? 116  G   0 O6    1 
ATOM   2297  N  N1    . G   A  1  115  ? 84.295  157.427 31.952  1.00 31.20  ? 116  G   0 N1    1 
ATOM   2298  C  C2    . G   A  1  115  ? 85.583  156.967 31.813  1.00 33.39  ? 116  G   0 C2    1 
ATOM   2299  N  N2    . G   A  1  115  ? 86.534  157.659 32.465  1.00 33.04  ? 116  G   0 N2    1 
ATOM   2300  N  N3    . G   A  1  115  ? 85.915  155.905 31.095  1.00 31.56  ? 116  G   0 N3    1 
ATOM   2301  C  C4    . G   A  1  115  ? 84.838  155.328 30.526  1.00 30.62  ? 116  G   0 C4    1 
ATOM   2302  P  P     . A   A  1  116  ? 86.696  149.631 32.008  1.00 39.22  ? 117  A   0 P     1 
ATOM   2303  O  OP1   . A   A  1  116  ? 87.756  148.601 32.129  1.00 38.25  ? 117  A   0 OP1   1 
ATOM   2304  O  OP2   . A   A  1  116  ? 85.293  149.285 32.321  1.00 41.07  ? 117  A   0 OP2   1 
ATOM   2305  O  "O5'" . A   A  1  116  ? 87.098  150.878 32.910  1.00 39.57  ? 117  A   0 "O5'" 1 
ATOM   2306  C  "C5'" . A   A  1  116  ? 88.479  151.243 33.087  1.00 37.70  ? 117  A   0 "C5'" 1 
ATOM   2307  C  "C4'" . A   A  1  116  ? 88.595  152.358 34.094  1.00 37.33  ? 117  A   0 "C4'" 1 
ATOM   2308  O  "O4'" . A   A  1  116  ? 87.960  153.556 33.571  1.00 34.12  ? 117  A   0 "O4'" 1 
ATOM   2309  C  "C3'" . A   A  1  116  ? 87.865  152.124 35.403  1.00 37.39  ? 117  A   0 "C3'" 1 
ATOM   2310  O  "O3'" . A   A  1  116  ? 88.574  151.270 36.287  1.00 39.89  ? 117  A   0 "O3'" 1 
ATOM   2311  C  "C2'" . A   A  1  116  ? 87.713  153.540 35.927  1.00 36.06  ? 117  A   0 "C2'" 1 
ATOM   2312  O  "O2'" . A   A  1  116  ? 88.929  154.032 36.455  1.00 38.87  ? 117  A   0 "O2'" 1 
ATOM   2313  C  "C1'" . A   A  1  116  ? 87.373  154.289 34.637  1.00 33.51  ? 117  A   0 "C1'" 1 
ATOM   2314  N  N9    . A   A  1  116  ? 85.932  154.382 34.393  1.00 30.70  ? 117  A   0 N9    1 
ATOM   2315  C  C8    . A   A  1  116  ? 85.143  153.531 33.664  1.00 30.98  ? 117  A   0 C8    1 
ATOM   2316  N  N7    . A   A  1  116  ? 83.877  153.880 33.628  1.00 30.16  ? 117  A   0 N7    1 
ATOM   2317  C  C5    . A   A  1  116  ? 83.830  155.040 34.383  1.00 29.51  ? 117  A   0 C5    1 
ATOM   2318  C  C6    . A   A  1  116  ? 82.772  155.904 34.731  1.00 29.99  ? 117  A   0 C6    1 
ATOM   2319  N  N6    . A   A  1  116  ? 81.506  155.737 34.332  1.00 28.62  ? 117  A   0 N6    1 
ATOM   2320  N  N1    . A   A  1  116  ? 83.062  156.963 35.509  1.00 30.04  ? 117  A   0 N1    1 
ATOM   2321  C  C2    . A   A  1  116  ? 84.327  157.143 35.900  1.00 31.39  ? 117  A   0 C2    1 
ATOM   2322  N  N3    . A   A  1  116  ? 85.406  156.412 35.634  1.00 32.38  ? 117  A   0 N3    1 
ATOM   2323  C  C4    . A   A  1  116  ? 85.087  155.361 34.863  1.00 31.48  ? 117  A   0 C4    1 
ATOM   2324  P  P     . G   A  1  117  ? 87.753  150.314 37.289  1.00 40.61  ? 118  G   0 P     1 
ATOM   2325  O  OP1   . G   A  1  117  ? 88.751  149.415 37.918  1.00 40.04  ? 118  G   0 OP1   1 
ATOM   2326  O  OP2   . G   A  1  117  ? 86.586  149.739 36.577  1.00 39.57  ? 118  G   0 OP2   1 
ATOM   2327  O  "O5'" . G   A  1  117  ? 87.186  151.308 38.396  1.00 38.57  ? 118  G   0 "O5'" 1 
ATOM   2328  C  "C5'" . G   A  1  117  ? 88.073  151.914 39.333  1.00 35.32  ? 118  G   0 "C5'" 1 
ATOM   2329  C  "C4'" . G   A  1  117  ? 87.420  153.096 39.995  1.00 32.42  ? 118  G   0 "C4'" 1 
ATOM   2330  O  "O4'" . G   A  1  117  ? 86.927  154.022 38.992  1.00 31.72  ? 118  G   0 "O4'" 1 
ATOM   2331  C  "C3'" . G   A  1  117  ? 86.181  152.845 40.829  1.00 30.98  ? 118  G   0 "C3'" 1 
ATOM   2332  O  "O3'" . G   A  1  117  ? 86.492  152.296 42.096  1.00 32.53  ? 118  G   0 "O3'" 1 
ATOM   2333  C  "C2'" . G   A  1  117  ? 85.644  154.260 40.965  1.00 30.40  ? 118  G   0 "C2'" 1 
ATOM   2334  O  "O2'" . G   A  1  117  ? 86.426  155.032 41.861  1.00 30.00  ? 118  G   0 "O2'" 1 
ATOM   2335  C  "C1'" . G   A  1  117  ? 85.856  154.785 39.543  1.00 28.76  ? 118  G   0 "C1'" 1 
ATOM   2336  N  N9    . G   A  1  117  ? 84.652  154.582 38.738  1.00 28.21  ? 118  G   0 N9    1 
ATOM   2337  C  C8    . G   A  1  117  ? 84.457  153.674 37.724  1.00 26.03  ? 118  G   0 C8    1 
ATOM   2338  N  N7    . G   A  1  117  ? 83.249  153.716 37.230  1.00 26.99  ? 118  G   0 N7    1 
ATOM   2339  C  C5    . G   A  1  117  ? 82.614  154.717 37.951  1.00 25.48  ? 118  G   0 C5    1 
ATOM   2340  C  C6    . G   A  1  117  ? 81.281  155.214 37.873  1.00 26.16  ? 118  G   0 C6    1 
ATOM   2341  O  O6    . G   A  1  117  ? 80.364  154.856 37.134  1.00 28.16  ? 118  G   0 O6    1 
ATOM   2342  N  N1    . G   A  1  117  ? 81.059  156.227 38.792  1.00 26.54  ? 118  G   0 N1    1 
ATOM   2343  C  C2    . G   A  1  117  ? 81.988  156.701 39.681  1.00 25.68  ? 118  G   0 C2    1 
ATOM   2344  N  N2    . G   A  1  117  ? 81.579  157.681 40.487  1.00 23.49  ? 118  G   0 N2    1 
ATOM   2345  N  N3    . G   A  1  117  ? 83.222  156.247 39.771  1.00 25.57  ? 118  G   0 N3    1 
ATOM   2346  C  C4    . G   A  1  117  ? 83.466  155.264 38.880  1.00 26.00  ? 118  G   0 C4    1 
ATOM   2347  P  P     . A   A  1  118  ? 85.380  151.450 42.887  1.00 33.06  ? 119  A   0 P     1 
ATOM   2348  O  OP1   . A   A  1  118  ? 86.008  151.053 44.172  1.00 36.07  ? 119  A   0 OP1   1 
ATOM   2349  O  OP2   . A   A  1  118  ? 84.822  150.411 41.981  1.00 34.20  ? 119  A   0 OP2   1 
ATOM   2350  O  "O5'" . A   A  1  118  ? 84.215  152.492 43.196  1.00 32.58  ? 119  A   0 "O5'" 1 
ATOM   2351  C  "C5'" . A   A  1  118  ? 84.364  153.466 44.238  1.00 30.32  ? 119  A   0 "C5'" 1 
ATOM   2352  C  "C4'" . A   A  1  118  ? 83.099  154.264 44.399  1.00 30.27  ? 119  A   0 "C4'" 1 
ATOM   2353  O  "O4'" . A   A  1  118  ? 82.764  154.880 43.130  1.00 30.22  ? 119  A   0 "O4'" 1 
ATOM   2354  C  "C3'" . A   A  1  118  ? 81.837  153.502 44.775  1.00 30.67  ? 119  A   0 "C3'" 1 
ATOM   2355  O  "O3'" . A   A  1  118  ? 81.805  153.246 46.179  1.00 31.84  ? 119  A   0 "O3'" 1 
ATOM   2356  C  "C2'" . A   A  1  118  ? 80.752  154.475 44.326  1.00 29.98  ? 119  A   0 "C2'" 1 
ATOM   2357  O  "O2'" . A   A  1  118  ? 80.598  155.568 45.207  1.00 30.33  ? 119  A   0 "O2'" 1 
ATOM   2358  C  "C1'" . A   A  1  118  ? 81.353  155.004 43.022  1.00 29.24  ? 119  A   0 "C1'" 1 
ATOM   2359  N  N9    . A   A  1  118  ? 80.912  154.243 41.853  1.00 28.00  ? 119  A   0 N9    1 
ATOM   2360  C  C8    . A   A  1  118  ? 81.637  153.353 41.102  1.00 27.30  ? 119  A   0 C8    1 
ATOM   2361  N  N7    . A   A  1  118  ? 80.958  152.819 40.118  1.00 26.37  ? 119  A   0 N7    1 
ATOM   2362  C  C5    . A   A  1  118  ? 79.702  153.392 40.230  1.00 23.61  ? 119  A   0 C5    1 
ATOM   2363  C  C6    . A   A  1  118  ? 78.524  153.229 39.488  1.00 22.47  ? 119  A   0 C6    1 
ATOM   2364  N  N6    . A   A  1  118  ? 78.420  152.412 38.441  1.00 22.21  ? 119  A   0 N6    1 
ATOM   2365  N  N1    . A   A  1  118  ? 77.444  153.943 39.861  1.00 23.19  ? 119  A   0 N1    1 
ATOM   2366  C  C2    . A   A  1  118  ? 77.551  154.765 40.916  1.00 26.27  ? 119  A   0 C2    1 
ATOM   2367  N  N3    . A   A  1  118  ? 78.604  155.004 41.694  1.00 25.41  ? 119  A   0 N3    1 
ATOM   2368  C  C4    . A   A  1  118  ? 79.660  154.276 41.290  1.00 25.74  ? 119  A   0 C4    1 
ATOM   2369  P  P     . A   A  1  119  ? 80.738  152.202 46.794  1.00 27.84  ? 120  A   0 P     1 
ATOM   2370  O  OP1   . A   A  1  119  ? 81.009  152.107 48.246  1.00 31.77  ? 120  A   0 OP1   1 
ATOM   2371  O  OP2   . A   A  1  119  ? 80.787  150.985 45.971  1.00 26.57  ? 120  A   0 OP2   1 
ATOM   2372  O  "O5'" . A   A  1  119  ? 79.346  152.971 46.685  1.00 29.42  ? 120  A   0 "O5'" 1 
ATOM   2373  C  "C5'" . A   A  1  119  ? 78.334  152.547 45.787  1.00 30.01  ? 120  A   0 "C5'" 1 
ATOM   2374  C  "C4'" . A   A  1  119  ? 76.975  152.611 46.453  1.00 29.71  ? 120  A   0 "C4'" 1 
ATOM   2375  O  "O4'" . A   A  1  119  ? 77.016  151.909 47.726  1.00 28.24  ? 120  A   0 "O4'" 1 
ATOM   2376  C  "C3'" . A   A  1  119  ? 76.369  153.963 46.807  1.00 26.73  ? 120  A   0 "C3'" 1 
ATOM   2377  O  "O3'" . A   A  1  119  ? 75.768  154.561 45.655  1.00 29.20  ? 120  A   0 "O3'" 1 
ATOM   2378  C  "C2'" . A   A  1  119  ? 75.296  153.529 47.797  1.00 26.10  ? 120  A   0 "C2'" 1 
ATOM   2379  O  "O2'" . A   A  1  119  ? 74.246  152.867 47.117  1.00 23.87  ? 120  A   0 "O2'" 1 
ATOM   2380  C  "C1'" . A   A  1  119  ? 76.051  152.469 48.604  1.00 25.64  ? 120  A   0 "C1'" 1 
ATOM   2381  N  N9    . A   A  1  119  ? 76.759  153.020 49.760  1.00 23.04  ? 120  A   0 N9    1 
ATOM   2382  C  C8    . A   A  1  119  ? 78.051  152.761 50.151  1.00 21.30  ? 120  A   0 C8    1 
ATOM   2383  N  N7    . A   A  1  119  ? 78.418  153.415 51.224  1.00 20.41  ? 120  A   0 N7    1 
ATOM   2384  C  C5    . A   A  1  119  ? 77.295  154.153 51.565  1.00 21.86  ? 120  A   0 C5    1 
ATOM   2385  C  C6    . A   A  1  119  ? 77.039  155.055 52.613  1.00 22.15  ? 120  A   0 C6    1 
ATOM   2386  N  N6    . A   A  1  119  ? 77.936  155.379 53.543  1.00 22.78  ? 120  A   0 N6    1 
ATOM   2387  N  N1    . A   A  1  119  ? 75.813  155.617 52.674  1.00 21.97  ? 120  A   0 N1    1 
ATOM   2388  C  C2    . A   A  1  119  ? 74.914  155.288 51.742  1.00 22.73  ? 120  A   0 C2    1 
ATOM   2389  N  N3    . A   A  1  119  ? 75.035  154.453 50.708  1.00 24.83  ? 120  A   0 N3    1 
ATOM   2390  C  C4    . A   A  1  119  ? 76.264  153.913 50.677  1.00 21.62  ? 120  A   0 C4    1 
ATOM   2391  P  P     . U   A  1  120  ? 75.211  156.076 45.714  1.00 27.83  ? 121  U   0 P     1 
ATOM   2392  O  OP1   . U   A  1  120  ? 76.338  156.993 45.429  1.00 29.01  ? 121  U   0 OP1   1 
ATOM   2393  O  OP2   . U   A  1  120  ? 74.421  156.266 46.939  1.00 25.61  ? 121  U   0 OP2   1 
ATOM   2394  O  "O5'" . U   A  1  120  ? 74.231  156.156 44.461  1.00 28.45  ? 121  U   0 "O5'" 1 
ATOM   2395  C  "C5'" . U   A  1  120  ? 74.748  156.239 43.112  1.00 26.29  ? 121  U   0 "C5'" 1 
ATOM   2396  C  "C4'" . U   A  1  120  ? 73.661  155.911 42.119  1.00 26.94  ? 121  U   0 "C4'" 1 
ATOM   2397  O  "O4'" . U   A  1  120  ? 73.255  154.544 42.331  1.00 27.88  ? 121  U   0 "O4'" 1 
ATOM   2398  C  "C3'" . U   A  1  120  ? 72.387  156.733 42.268  1.00 26.78  ? 121  U   0 "C3'" 1 
ATOM   2399  O  "O3'" . U   A  1  120  ? 72.507  157.904 41.458  1.00 28.51  ? 121  U   0 "O3'" 1 
ATOM   2400  C  "C2'" . U   A  1  120  ? 71.296  155.800 41.744  1.00 26.51  ? 121  U   0 "C2'" 1 
ATOM   2401  O  "O2'" . U   A  1  120  ? 71.054  155.890 40.361  1.00 28.46  ? 121  U   0 "O2'" 1 
ATOM   2402  C  "C1'" . U   A  1  120  ? 71.880  154.417 42.043  1.00 28.14  ? 121  U   0 "C1'" 1 
ATOM   2403  N  N1    . U   A  1  120  ? 71.223  153.648 43.110  1.00 28.50  ? 121  U   0 N1    1 
ATOM   2404  C  C2    . U   A  1  120  ? 70.183  152.818 42.731  1.00 30.24  ? 121  U   0 C2    1 
ATOM   2405  O  O2    . U   A  1  120  ? 69.821  152.702 41.572  1.00 30.82  ? 121  U   0 O2    1 
ATOM   2406  N  N3    . U   A  1  120  ? 69.581  152.132 43.757  1.00 29.59  ? 121  U   0 N3    1 
ATOM   2407  C  C4    . U   A  1  120  ? 69.904  152.193 45.091  1.00 28.51  ? 121  U   0 C4    1 
ATOM   2408  O  O4    . U   A  1  120  ? 69.212  151.582 45.901  1.00 31.73  ? 121  U   0 O4    1 
ATOM   2409  C  C5    . U   A  1  120  ? 70.999  153.061 45.406  1.00 29.30  ? 121  U   0 C5    1 
ATOM   2410  C  C6    . U   A  1  120  ? 71.608  153.743 44.428  1.00 28.48  ? 121  U   0 C6    1 
ATOM   2411  P  P     . C   A  1  121  ? 71.613  159.209 41.762  1.00 30.87  ? 122  C   0 P     1 
ATOM   2412  O  OP1   . C   A  1  121  ? 70.636  158.883 42.831  1.00 30.98  ? 122  C   0 OP1   1 
ATOM   2413  O  OP2   . C   A  1  121  ? 71.117  159.749 40.463  1.00 28.46  ? 122  C   0 OP2   1 
ATOM   2414  O  "O5'" . C   A  1  121  ? 72.688  160.237 42.334  1.00 30.91  ? 122  C   0 "O5'" 1 
ATOM   2415  C  "C5'" . C   A  1  121  ? 73.624  160.900 41.455  1.00 30.26  ? 122  C   0 "C5'" 1 
ATOM   2416  C  "C4'" . C   A  1  121  ? 75.020  160.794 42.014  1.00 30.99  ? 122  C   0 "C4'" 1 
ATOM   2417  O  "O4'" . C   A  1  121  ? 75.402  159.392 42.067  1.00 28.58  ? 122  C   0 "O4'" 1 
ATOM   2418  C  "C3'" . C   A  1  121  ? 76.128  161.428 41.183  1.00 31.07  ? 122  C   0 "C3'" 1 
ATOM   2419  O  "O3'" . C   A  1  121  ? 76.235  162.828 41.395  1.00 34.95  ? 122  C   0 "O3'" 1 
ATOM   2420  C  "C2'" . C   A  1  121  ? 77.351  160.696 41.704  1.00 28.79  ? 122  C   0 "C2'" 1 
ATOM   2421  O  "O2'" . C   A  1  121  ? 77.715  161.169 42.984  1.00 29.17  ? 122  C   0 "O2'" 1 
ATOM   2422  C  "C1'" . C   A  1  121  ? 76.802  159.273 41.836  1.00 26.89  ? 122  C   0 "C1'" 1 
ATOM   2423  N  N1    . C   A  1  121  ? 77.033  158.458 40.619  1.00 23.84  ? 122  C   0 N1    1 
ATOM   2424  C  C2    . C   A  1  121  ? 78.345  158.046 40.325  1.00 23.54  ? 122  C   0 C2    1 
ATOM   2425  O  O2    . C   A  1  121  ? 79.260  158.378 41.087  1.00 24.25  ? 122  C   0 O2    1 
ATOM   2426  N  N3    . C   A  1  121  ? 78.581  157.305 39.222  1.00 20.29  ? 122  C   0 N3    1 
ATOM   2427  C  C4    . C   A  1  121  ? 77.573  156.974 38.417  1.00 22.65  ? 122  C   0 C4    1 
ATOM   2428  N  N4    . C   A  1  121  ? 77.855  156.237 37.335  1.00 21.27  ? 122  C   0 N4    1 
ATOM   2429  C  C5    . C   A  1  121  ? 76.228  157.380 38.683  1.00 21.69  ? 122  C   0 C5    1 
ATOM   2430  C  C6    . C   A  1  121  ? 76.006  158.110 39.787  1.00 23.06  ? 122  C   0 C6    1 
ATOM   2431  P  P     . U   A  1  122  ? 76.628  163.790 40.168  1.00 37.70  ? 123  U   0 P     1 
ATOM   2432  O  OP1   . U   A  1  122  ? 76.587  165.174 40.697  1.00 38.59  ? 123  U   0 OP1   1 
ATOM   2433  O  OP2   . U   A  1  122  ? 75.784  163.433 38.995  1.00 38.82  ? 123  U   0 OP2   1 
ATOM   2434  O  "O5'" . U   A  1  122  ? 78.139  163.406 39.824  1.00 37.51  ? 123  U   0 "O5'" 1 
ATOM   2435  C  "C5'" . U   A  1  122  ? 79.188  163.680 40.758  1.00 39.67  ? 123  U   0 "C5'" 1 
ATOM   2436  C  "C4'" . U   A  1  122  ? 80.474  162.981 40.367  1.00 40.32  ? 123  U   0 "C4'" 1 
ATOM   2437  O  "O4'" . U   A  1  122  ? 80.228  161.571 40.150  1.00 37.60  ? 123  U   0 "O4'" 1 
ATOM   2438  C  "C3'" . U   A  1  122  ? 81.200  163.378 39.085  1.00 41.13  ? 123  U   0 "C3'" 1 
ATOM   2439  O  "O3'" . U   A  1  122  ? 81.928  164.604 39.252  1.00 45.69  ? 123  U   0 "O3'" 1 
ATOM   2440  C  "C2'" . U   A  1  122  ? 82.178  162.213 38.949  1.00 39.21  ? 123  U   0 "C2'" 1 
ATOM   2441  O  "O2'" . U   A  1  122  ? 83.253  162.338 39.862  1.00 38.84  ? 123  U   0 "O2'" 1 
ATOM   2442  C  "C1'" . U   A  1  122  ? 81.313  161.030 39.405  1.00 36.58  ? 123  U   0 "C1'" 1 
ATOM   2443  N  N1    . U   A  1  122  ? 80.786  160.229 38.291  1.00 31.54  ? 123  U   0 N1    1 
ATOM   2444  C  C2    . U   A  1  122  ? 81.668  159.398 37.616  1.00 31.21  ? 123  U   0 C2    1 
ATOM   2445  O  O2    . U   A  1  122  ? 82.850  159.289 37.917  1.00 29.12  ? 123  U   0 O2    1 
ATOM   2446  N  N3    . U   A  1  122  ? 81.116  158.695 36.577  1.00 30.18  ? 123  U   0 N3    1 
ATOM   2447  C  C4    . U   A  1  122  ? 79.800  158.731 36.154  1.00 34.06  ? 123  U   0 C4    1 
ATOM   2448  O  O4    . U   A  1  122  ? 79.443  158.011 35.218  1.00 35.92  ? 123  U   0 O4    1 
ATOM   2449  C  C5    . U   A  1  122  ? 78.955  159.606 36.902  1.00 33.10  ? 123  U   0 C5    1 
ATOM   2450  C  C6    . U   A  1  122  ? 79.463  160.305 37.921  1.00 33.60  ? 123  U   0 C6    1 
ATOM   2451  P  P     . C   A  1  123  ? 82.544  165.374 37.967  1.00 47.27  ? 124  C   0 P     1 
ATOM   2452  O  OP1   . C   A  1  123  ? 83.183  166.604 38.500  1.00 49.81  ? 124  C   0 OP1   1 
ATOM   2453  O  OP2   . C   A  1  123  ? 81.512  165.479 36.899  1.00 43.02  ? 124  C   0 OP2   1 
ATOM   2454  O  "O5'" . C   A  1  123  ? 83.738  164.447 37.462  1.00 45.46  ? 124  C   0 "O5'" 1 
ATOM   2455  C  "C5'" . C   A  1  123  ? 84.954  164.341 38.227  1.00 45.47  ? 124  C   0 "C5'" 1 
ATOM   2456  C  "C4'" . C   A  1  123  ? 85.933  163.419 37.535  1.00 47.51  ? 124  C   0 "C4'" 1 
ATOM   2457  O  "O4'" . C   A  1  123  ? 85.363  162.083 37.436  1.00 43.67  ? 124  C   0 "O4'" 1 
ATOM   2458  C  "C3'" . C   A  1  123  ? 86.284  163.772 36.094  1.00 49.30  ? 124  C   0 "C3'" 1 
ATOM   2459  O  "O3'" . C   A  1  123  ? 87.275  164.794 36.012  1.00 53.38  ? 124  C   0 "O3'" 1 
ATOM   2460  C  "C2'" . C   A  1  123  ? 86.780  162.436 35.556  1.00 45.74  ? 124  C   0 "C2'" 1 
ATOM   2461  O  "O2'" . C   A  1  123  ? 88.092  162.129 35.994  1.00 46.44  ? 124  C   0 "O2'" 1 
ATOM   2462  C  "C1'" . C   A  1  123  ? 85.802  161.470 36.232  1.00 41.41  ? 124  C   0 "C1'" 1 
ATOM   2463  N  N1    . C   A  1  123  ? 84.624  161.141 35.399  1.00 35.56  ? 124  C   0 N1    1 
ATOM   2464  C  C2    . C   A  1  123  ? 84.744  160.127 34.444  1.00 33.25  ? 124  C   0 C2    1 
ATOM   2465  O  O2    . C   A  1  123  ? 85.852  159.583 34.285  1.00 33.58  ? 124  C   0 O2    1 
ATOM   2466  N  N3    . C   A  1  123  ? 83.657  159.771 33.714  1.00 30.91  ? 124  C   0 N3    1 
ATOM   2467  C  C4    . C   A  1  123  ? 82.490  160.397 33.905  1.00 30.59  ? 124  C   0 C4    1 
ATOM   2468  N  N4    . C   A  1  123  ? 81.428  159.984 33.202  1.00 24.03  ? 124  C   0 N4    1 
ATOM   2469  C  C5    . C   A  1  123  ? 82.354  161.465 34.837  1.00 28.98  ? 124  C   0 C5    1 
ATOM   2470  C  C6    . C   A  1  123  ? 83.433  161.799 35.558  1.00 33.06  ? 124  C   0 C6    1 
ATOM   2471  P  P     . U   A  1  124  ? 87.260  165.828 34.774  1.00 57.30  ? 125  U   0 P     1 
ATOM   2472  O  OP1   . U   A  1  124  ? 88.269  166.856 35.127  1.00 56.51  ? 125  U   0 OP1   1 
ATOM   2473  O  OP2   . U   A  1  124  ? 85.866  166.245 34.443  1.00 53.18  ? 125  U   0 OP2   1 
ATOM   2474  O  "O5'" . U   A  1  124  ? 87.812  164.970 33.547  1.00 58.77  ? 125  U   0 "O5'" 1 
ATOM   2475  C  "C5'" . U   A  1  124  ? 89.183  164.521 33.518  1.00 59.90  ? 125  U   0 "C5'" 1 
ATOM   2476  C  "C4'" . U   A  1  124  ? 89.459  163.749 32.248  1.00 61.90  ? 125  U   0 "C4'" 1 
ATOM   2477  O  "O4'" . U   A  1  124  ? 88.792  162.461 32.290  1.00 61.45  ? 125  U   0 "O4'" 1 
ATOM   2478  C  "C3'" . U   A  1  124  ? 88.947  164.355 30.946  1.00 63.80  ? 125  U   0 "C3'" 1 
ATOM   2479  O  "O3'" . U   A  1  124  ? 89.644  165.509 30.429  1.00 65.31  ? 125  U   0 "O3'" 1 
ATOM   2480  C  "C2'" . U   A  1  124  ? 88.988  163.152 30.013  1.00 63.82  ? 125  U   0 "C2'" 1 
ATOM   2481  O  "O2'" . U   A  1  124  ? 90.298  162.889 29.540  1.00 66.68  ? 125  U   0 "O2'" 1 
ATOM   2482  C  "C1'" . U   A  1  124  ? 88.556  162.023 30.959  1.00 61.82  ? 125  U   0 "C1'" 1 
ATOM   2483  N  N1    . U   A  1  124  ? 87.148  161.615 30.815  1.00 58.32  ? 125  U   0 N1    1 
ATOM   2484  C  C2    . U   A  1  124  ? 86.887  160.479 30.060  1.00 56.32  ? 125  U   0 C2    1 
ATOM   2485  O  O2    . U   A  1  124  ? 87.764  159.818 29.536  1.00 55.58  ? 125  U   0 O2    1 
ATOM   2486  N  N3    . U   A  1  124  ? 85.561  160.148 29.943  1.00 54.93  ? 125  U   0 N3    1 
ATOM   2487  C  C4    . U   A  1  124  ? 84.487  160.816 30.491  1.00 54.61  ? 125  U   0 C4    1 
ATOM   2488  O  O4    . U   A  1  124  ? 83.345  160.406 30.275  1.00 51.80  ? 125  U   0 O4    1 
ATOM   2489  C  C5    . U   A  1  124  ? 84.835  161.972 31.262  1.00 55.35  ? 125  U   0 C5    1 
ATOM   2490  C  C6    . U   A  1  124  ? 86.121  162.324 31.395  1.00 56.60  ? 125  U   0 C6    1 
ATOM   2491  O  "O5'" . A   A  1  127  ? 85.455  161.098 21.220  1.00 85.52  ? 128  A   0 "O5'" 1 
ATOM   2492  C  "C5'" . A   A  1  127  ? 86.431  160.134 20.790  1.00 83.92  ? 128  A   0 "C5'" 1 
ATOM   2493  C  "C4'" . A   A  1  127  ? 86.683  158.980 21.746  1.00 82.56  ? 128  A   0 "C4'" 1 
ATOM   2494  O  "O4'" . A   A  1  127  ? 86.836  159.488 23.106  1.00 81.87  ? 128  A   0 "O4'" 1 
ATOM   2495  C  "C3'" . A   A  1  127  ? 85.581  157.938 21.882  1.00 81.57  ? 128  A   0 "C3'" 1 
ATOM   2496  O  "O3'" . A   A  1  127  ? 85.526  156.992 20.815  1.00 79.61  ? 128  A   0 "O3'" 1 
ATOM   2497  C  "C2'" . A   A  1  127  ? 85.911  157.322 23.236  1.00 80.88  ? 128  A   0 "C2'" 1 
ATOM   2498  O  "O2'" . A   A  1  127  ? 87.046  156.477 23.223  1.00 81.96  ? 128  A   0 "O2'" 1 
ATOM   2499  C  "C1'" . A   A  1  127  ? 86.245  158.581 24.031  1.00 79.39  ? 128  A   0 "C1'" 1 
ATOM   2500  N  N9    . A   A  1  127  ? 85.030  159.203 24.563  1.00 76.69  ? 128  A   0 N9    1 
ATOM   2501  C  C8    . A   A  1  127  ? 83.724  158.979 24.176  1.00 75.82  ? 128  A   0 C8    1 
ATOM   2502  N  N7    . A   A  1  127  ? 82.846  159.689 24.836  1.00 75.33  ? 128  A   0 N7    1 
ATOM   2503  C  C5    . A   A  1  127  ? 83.617  160.433 25.719  1.00 74.31  ? 128  A   0 C5    1 
ATOM   2504  C  C6    . A   A  1  127  ? 83.277  161.380 26.695  1.00 72.99  ? 128  A   0 C6    1 
ATOM   2505  N  N6    . A   A  1  127  ? 82.021  161.752 26.955  1.00 72.76  ? 128  A   0 N6    1 
ATOM   2506  N  N1    . A   A  1  127  ? 84.282  161.940 27.404  1.00 72.47  ? 128  A   0 N1    1 
ATOM   2507  C  C2    . A   A  1  127  ? 85.542  161.562 27.141  1.00 72.36  ? 128  A   0 C2    1 
ATOM   2508  N  N3    . A   A  1  127  ? 85.989  160.680 26.249  1.00 72.75  ? 128  A   0 N3    1 
ATOM   2509  C  C4    . A   A  1  127  ? 84.964  160.144 25.562  1.00 74.95  ? 128  A   0 C4    1 
ATOM   2510  P  P     . A   A  1  128  ? 84.281  155.969 20.723  1.00 77.32  ? 129  A   0 P     1 
ATOM   2511  O  OP1   . A   A  1  128  ? 84.304  155.310 19.381  1.00 75.00  ? 129  A   0 OP1   1 
ATOM   2512  O  OP2   . A   A  1  128  ? 83.037  156.650 21.196  1.00 76.07  ? 129  A   0 OP2   1 
ATOM   2513  O  "O5'" . A   A  1  128  ? 84.635  154.887 21.827  1.00 72.47  ? 129  A   0 "O5'" 1 
ATOM   2514  C  "C5'" . A   A  1  128  ? 85.863  154.150 21.754  1.00 65.02  ? 129  A   0 "C5'" 1 
ATOM   2515  C  "C4'" . A   A  1  128  ? 85.960  153.208 22.917  1.00 59.48  ? 129  A   0 "C4'" 1 
ATOM   2516  O  "O4'" . A   A  1  128  ? 86.363  153.927 24.118  1.00 56.11  ? 129  A   0 "O4'" 1 
ATOM   2517  C  "C3'" . A   A  1  128  ? 84.643  152.571 23.320  1.00 57.61  ? 129  A   0 "C3'" 1 
ATOM   2518  O  "O3'" . A   A  1  128  ? 84.083  151.655 22.368  1.00 58.48  ? 129  A   0 "O3'" 1 
ATOM   2519  C  "C2'" . A   A  1  128  ? 84.920  152.156 24.758  1.00 55.05  ? 129  A   0 "C2'" 1 
ATOM   2520  O  "O2'" . A   A  1  128  ? 85.732  151.010 24.903  1.00 53.77  ? 129  A   0 "O2'" 1 
ATOM   2521  C  "C1'" . A   A  1  128  ? 85.687  153.389 25.248  1.00 50.66  ? 129  A   0 "C1'" 1 
ATOM   2522  N  N9    . A   A  1  128  ? 84.797  154.425 25.790  1.00 42.49  ? 129  A   0 N9    1 
ATOM   2523  C  C8    . A   A  1  128  ? 83.433  154.512 25.630  1.00 39.77  ? 129  A   0 C8    1 
ATOM   2524  N  N7    . A   A  1  128  ? 82.886  155.517 26.266  1.00 37.97  ? 129  A   0 N7    1 
ATOM   2525  C  C5    . A   A  1  128  ? 83.959  156.149 26.877  1.00 36.40  ? 129  A   0 C5    1 
ATOM   2526  C  C6    . A   A  1  128  ? 84.036  157.280 27.713  1.00 34.62  ? 129  A   0 C6    1 
ATOM   2527  N  N6    . A   A  1  128  ? 82.975  158.002 28.079  1.00 29.99  ? 129  A   0 N6    1 
ATOM   2528  N  N1    . A   A  1  128  ? 85.255  157.644 28.168  1.00 33.51  ? 129  A   0 N1    1 
ATOM   2529  C  C2    . A   A  1  128  ? 86.319  156.914 27.798  1.00 35.56  ? 129  A   0 C2    1 
ATOM   2530  N  N3    . A   A  1  128  ? 86.375  155.834 27.015  1.00 37.43  ? 129  A   0 N3    1 
ATOM   2531  C  C4    . A   A  1  128  ? 85.146  155.495 26.584  1.00 38.81  ? 129  A   0 C4    1 
ATOM   2532  P  P     . C   A  1  129  ? 84.906  150.370 21.869  1.00 57.91  ? 130  C   0 P     1 
ATOM   2533  O  OP1   . C   A  1  129  ? 86.200  150.287 22.600  1.00 60.10  ? 130  C   0 OP1   1 
ATOM   2534  O  OP2   . C   A  1  129  ? 84.914  150.415 20.387  1.00 57.71  ? 130  C   0 OP2   1 
ATOM   2535  O  "O5'" . C   A  1  129  ? 83.972  149.147 22.292  1.00 56.67  ? 130  C   0 "O5'" 1 
ATOM   2536  C  "C5'" . C   A  1  129  ? 83.220  149.169 23.523  1.00 50.38  ? 130  C   0 "C5'" 1 
ATOM   2537  C  "C4'" . C   A  1  129  ? 82.928  147.762 23.979  1.00 46.54  ? 130  C   0 "C4'" 1 
ATOM   2538  O  "O4'" . C   A  1  129  ? 82.072  147.095 23.014  1.00 46.79  ? 130  C   0 "O4'" 1 
ATOM   2539  C  "C3'" . C   A  1  129  ? 84.134  146.846 24.065  1.00 44.33  ? 130  C   0 "C3'" 1 
ATOM   2540  O  "O3'" . C   A  1  129  ? 84.861  147.052 25.260  1.00 40.98  ? 130  C   0 "O3'" 1 
ATOM   2541  C  "C2'" . C   A  1  129  ? 83.485  145.471 24.014  1.00 44.49  ? 130  C   0 "C2'" 1 
ATOM   2542  O  "O2'" . C   A  1  129  ? 82.852  145.113 25.224  1.00 45.12  ? 130  C   0 "O2'" 1 
ATOM   2543  C  "C1'" . C   A  1  129  ? 82.387  145.707 22.982  1.00 45.65  ? 130  C   0 "C1'" 1 
ATOM   2544  N  N1    . C   A  1  129  ? 82.795  145.322 21.615  1.00 47.45  ? 130  C   0 N1    1 
ATOM   2545  C  C2    . C   A  1  129  ? 82.937  143.948 21.310  1.00 47.69  ? 130  C   0 C2    1 
ATOM   2546  O  O2    . C   A  1  129  ? 82.732  143.104 22.198  1.00 46.15  ? 130  C   0 O2    1 
ATOM   2547  N  N3    . C   A  1  129  ? 83.299  143.582 20.055  1.00 47.26  ? 130  C   0 N3    1 
ATOM   2548  C  C4    . C   A  1  129  ? 83.524  144.515 19.126  1.00 46.41  ? 130  C   0 C4    1 
ATOM   2549  N  N4    . C   A  1  129  ? 83.877  144.107 17.905  1.00 44.73  ? 130  C   0 N4    1 
ATOM   2550  C  C5    . C   A  1  129  ? 83.395  145.911 19.408  1.00 47.38  ? 130  C   0 C5    1 
ATOM   2551  C  C6    . C   A  1  129  ? 83.033  146.266 20.652  1.00 47.19  ? 130  C   0 C6    1 
ATOM   2552  P  P     . A   A  1  130  ? 86.448  147.233 25.193  1.00 39.95  ? 131  A   0 P     1 
ATOM   2553  O  OP1   . A   A  1  130  ? 86.695  148.662 24.921  1.00 40.52  ? 131  A   0 OP1   1 
ATOM   2554  O  OP2   . A   A  1  130  ? 87.037  146.200 24.297  1.00 41.58  ? 131  A   0 OP2   1 
ATOM   2555  O  "O5'" . A   A  1  130  ? 86.935  146.901 26.668  1.00 38.63  ? 131  A   0 "O5'" 1 
ATOM   2556  C  "C5'" . A   A  1  130  ? 87.316  147.936 27.589  1.00 35.10  ? 131  A   0 "C5'" 1 
ATOM   2557  C  "C4'" . A   A  1  130  ? 87.289  147.390 28.993  1.00 35.07  ? 131  A   0 "C4'" 1 
ATOM   2558  O  "O4'" . A   A  1  130  ? 85.914  147.237 29.429  1.00 34.67  ? 131  A   0 "O4'" 1 
ATOM   2559  C  "C3'" . A   A  1  130  ? 87.886  145.999 29.088  1.00 34.60  ? 131  A   0 "C3'" 1 
ATOM   2560  O  "O3'" . A   A  1  130  ? 89.292  146.040 29.239  1.00 35.09  ? 131  A   0 "O3'" 1 
ATOM   2561  C  "C2'" . A   A  1  130  ? 87.153  145.388 30.273  1.00 34.17  ? 131  A   0 "C2'" 1 
ATOM   2562  O  "O2'" . A   A  1  130  ? 87.684  145.796 31.517  1.00 32.66  ? 131  A   0 "O2'" 1 
ATOM   2563  C  "C1'" . A   A  1  130  ? 85.759  145.989 30.096  1.00 35.03  ? 131  A   0 "C1'" 1 
ATOM   2564  N  N9    . A   A  1  130  ? 84.812  145.178 29.323  1.00 34.80  ? 131  A   0 N9    1 
ATOM   2565  C  C8    . A   A  1  130  ? 84.240  145.511 28.119  1.00 33.88  ? 131  A   0 C8    1 
ATOM   2566  N  N7    . A   A  1  130  ? 83.350  144.649 27.700  1.00 36.59  ? 131  A   0 N7    1 
ATOM   2567  C  C5    . A   A  1  130  ? 83.347  143.666 28.679  1.00 35.95  ? 131  A   0 C5    1 
ATOM   2568  C  C6    . A   A  1  130  ? 82.600  142.484 28.828  1.00 34.41  ? 131  A   0 C6    1 
ATOM   2569  N  N6    . A   A  1  130  ? 81.643  142.103 27.982  1.00 33.06  ? 131  A   0 N6    1 
ATOM   2570  N  N1    . A   A  1  130  ? 82.861  141.708 29.899  1.00 34.44  ? 131  A   0 N1    1 
ATOM   2571  C  C2    . A   A  1  130  ? 83.790  142.113 30.771  1.00 34.50  ? 131  A   0 C2    1 
ATOM   2572  N  N3    . A   A  1  130  ? 84.537  143.215 30.757  1.00 37.23  ? 131  A   0 N3    1 
ATOM   2573  C  C4    . A   A  1  130  ? 84.266  143.961 29.670  1.00 36.39  ? 131  A   0 C4    1 
ATOM   2574  P  P     . A   A  1  131  ? 90.189  144.925 28.525  1.00 37.07  ? 132  A   0 P     1 
ATOM   2575  O  OP1   . A   A  1  131  ? 91.588  145.040 29.008  1.00 38.60  ? 132  A   0 OP1   1 
ATOM   2576  O  OP2   . A   A  1  131  ? 89.899  144.985 27.069  1.00 35.53  ? 132  A   0 OP2   1 
ATOM   2577  O  "O5'" . A   A  1  131  ? 89.608  143.564 29.103  1.00 36.49  ? 132  A   0 "O5'" 1 
ATOM   2578  C  "C5'" . A   A  1  131  ? 89.928  143.129 30.435  1.00 32.76  ? 132  A   0 "C5'" 1 
ATOM   2579  C  "C4'" . A   A  1  131  ? 89.272  141.802 30.707  1.00 31.78  ? 132  A   0 "C4'" 1 
ATOM   2580  O  "O4'" . A   A  1  131  ? 87.829  141.964 30.638  1.00 32.79  ? 132  A   0 "O4'" 1 
ATOM   2581  C  "C3'" . A   A  1  131  ? 89.560  140.740 29.660  1.00 31.65  ? 132  A   0 "C3'" 1 
ATOM   2582  O  "O3'" . A   A  1  131  ? 90.812  140.108 29.871  1.00 33.36  ? 132  A   0 "O3'" 1 
ATOM   2583  C  "C2'" . A   A  1  131  ? 88.375  139.806 29.822  1.00 32.31  ? 132  A   0 "C2'" 1 
ATOM   2584  O  "O2'" . A   A  1  131  ? 88.487  138.982 30.964  1.00 33.28  ? 132  A   0 "O2'" 1 
ATOM   2585  C  "C1'" . A   A  1  131  ? 87.247  140.811 30.049  1.00 32.43  ? 132  A   0 "C1'" 1 
ATOM   2586  N  N9    . A   A  1  131  ? 86.602  141.211 28.800  1.00 34.28  ? 132  A   0 N9    1 
ATOM   2587  C  C8    . A   A  1  131  ? 86.886  142.294 28.003  1.00 35.43  ? 132  A   0 C8    1 
ATOM   2588  N  N7    . A   A  1  131  ? 86.109  142.396 26.954  1.00 34.88  ? 132  A   0 N7    1 
ATOM   2589  C  C5    . A   A  1  131  ? 85.261  141.306 27.062  1.00 36.37  ? 132  A   0 C5    1 
ATOM   2590  C  C6    . A   A  1  131  ? 84.197  140.853 26.266  1.00 37.09  ? 132  A   0 C6    1 
ATOM   2591  N  N6    . A   A  1  131  ? 83.767  141.480 25.165  1.00 36.38  ? 132  A   0 N6    1 
ATOM   2592  N  N1    . A   A  1  131  ? 83.572  139.721 26.650  1.00 37.30  ? 132  A   0 N1    1 
ATOM   2593  C  C2    . A   A  1  131  ? 83.982  139.106 27.761  1.00 36.29  ? 132  A   0 C2    1 
ATOM   2594  N  N3    . A   A  1  131  ? 84.955  139.438 28.596  1.00 35.59  ? 132  A   0 N3    1 
ATOM   2595  C  C4    . A   A  1  131  ? 85.564  140.560 28.187  1.00 36.31  ? 132  A   0 C4    1 
ATOM   2596  P  P     . U   A  1  132  ? 91.673  139.623 28.610  1.00 34.96  ? 133  U   0 P     1 
ATOM   2597  O  OP1   . U   A  1  132  ? 93.014  139.225 29.107  1.00 35.81  ? 133  U   0 OP1   1 
ATOM   2598  O  OP2   . U   A  1  132  ? 91.560  140.653 27.533  1.00 36.96  ? 133  U   0 OP2   1 
ATOM   2599  O  "O5'" . U   A  1  132  ? 90.911  138.309 28.145  1.00 33.31  ? 133  U   0 "O5'" 1 
ATOM   2600  C  "C5'" . U   A  1  132  ? 90.665  137.243 29.086  1.00 34.36  ? 133  U   0 "C5'" 1 
ATOM   2601  C  "C4'" . U   A  1  132  ? 89.790  136.193 28.464  1.00 33.54  ? 133  U   0 "C4'" 1 
ATOM   2602  O  "O4'" . U   A  1  132  ? 88.420  136.663 28.364  1.00 32.39  ? 133  U   0 "O4'" 1 
ATOM   2603  C  "C3'" . U   A  1  132  ? 90.163  135.844 27.038  1.00 33.67  ? 133  U   0 "C3'" 1 
ATOM   2604  O  "O3'" . U   A  1  132  ? 91.274  134.963 26.988  1.00 35.80  ? 133  U   0 "O3'" 1 
ATOM   2605  C  "C2'" . U   A  1  132  ? 88.869  135.251 26.503  1.00 32.73  ? 133  U   0 "C2'" 1 
ATOM   2606  O  "O2'" . U   A  1  132  ? 88.655  133.921 26.917  1.00 32.05  ? 133  U   0 "O2'" 1 
ATOM   2607  C  "C1'" . U   A  1  132  ? 87.837  136.158 27.173  1.00 32.87  ? 133  U   0 "C1'" 1 
ATOM   2608  N  N1    . U   A  1  132  ? 87.440  137.293 26.325  1.00 34.49  ? 133  U   0 N1    1 
ATOM   2609  C  C2    . U   A  1  132  ? 86.378  137.097 25.465  1.00 34.16  ? 133  U   0 C2    1 
ATOM   2610  O  O2    . U   A  1  132  ? 85.798  136.036 25.367  1.00 34.59  ? 133  U   0 O2    1 
ATOM   2611  N  N3    . U   A  1  132  ? 86.025  138.189 24.718  1.00 34.54  ? 133  U   0 N3    1 
ATOM   2612  C  C4    . U   A  1  132  ? 86.619  139.428 24.732  1.00 34.71  ? 133  U   0 C4    1 
ATOM   2613  O  O4    . U   A  1  132  ? 86.135  140.331 24.051  1.00 35.74  ? 133  U   0 O4    1 
ATOM   2614  C  C5    . U   A  1  132  ? 87.728  139.551 25.632  1.00 34.65  ? 133  U   0 C5    1 
ATOM   2615  C  C6    . U   A  1  132  ? 88.090  138.508 26.381  1.00 32.76  ? 133  U   0 C6    1 
ATOM   2616  P  P     . U   A  1  133  ? 92.088  134.802 25.618  1.00 38.01  ? 134  U   0 P     1 
ATOM   2617  O  OP1   . U   A  1  133  ? 93.263  133.932 25.880  1.00 38.22  ? 134  U   0 OP1   1 
ATOM   2618  O  OP2   . U   A  1  133  ? 92.285  136.140 24.995  1.00 32.90  ? 134  U   0 OP2   1 
ATOM   2619  O  "O5'" . U   A  1  133  ? 91.059  133.974 24.744  1.00 35.92  ? 134  U   0 "O5'" 1 
ATOM   2620  C  "C5'" . U   A  1  133  ? 90.921  134.230 23.373  1.00 33.49  ? 134  U   0 "C5'" 1 
ATOM   2621  C  "C4'" . U   A  1  133  ? 89.658  133.609 22.861  1.00 32.32  ? 134  U   0 "C4'" 1 
ATOM   2622  O  "O4'" . U   A  1  133  ? 88.501  134.337 23.353  1.00 29.36  ? 134  U   0 "O4'" 1 
ATOM   2623  C  "C3'" . U   A  1  133  ? 89.568  133.750 21.363  1.00 29.93  ? 134  U   0 "C3'" 1 
ATOM   2624  O  "O3'" . U   A  1  133  ? 90.364  132.760 20.741  1.00 30.05  ? 134  U   0 "O3'" 1 
ATOM   2625  C  "C2'" . U   A  1  133  ? 88.072  133.673 21.120  1.00 29.50  ? 134  U   0 "C2'" 1 
ATOM   2626  O  "O2'" . U   A  1  133  ? 87.552  132.366 21.187  1.00 30.42  ? 134  U   0 "O2'" 1 
ATOM   2627  C  "C1'" . U   A  1  133  ? 87.559  134.498 22.299  1.00 29.79  ? 134  U   0 "C1'" 1 
ATOM   2628  N  N1    . U   A  1  133  ? 87.489  135.931 21.955  1.00 29.37  ? 134  U   0 N1    1 
ATOM   2629  C  C2    . U   A  1  133  ? 86.517  136.336 21.045  1.00 29.50  ? 134  U   0 C2    1 
ATOM   2630  O  O2    . U   A  1  133  ? 85.721  135.565 20.538  1.00 29.53  ? 134  U   0 O2    1 
ATOM   2631  N  N3    . U   A  1  133  ? 86.517  137.680 20.752  1.00 30.25  ? 134  U   0 N3    1 
ATOM   2632  C  C4    . U   A  1  133  ? 87.370  138.644 21.264  1.00 29.63  ? 134  U   0 C4    1 
ATOM   2633  O  O4    . U   A  1  133  ? 87.241  139.814 20.912  1.00 27.83  ? 134  U   0 O4    1 
ATOM   2634  C  C5    . U   A  1  133  ? 88.338  138.150 22.199  1.00 28.62  ? 134  U   0 C5    1 
ATOM   2635  C  C6    . U   A  1  133  ? 88.361  136.845 22.507  1.00 28.72  ? 134  U   0 C6    1 
ATOM   2636  P  P     . G   A  1  134  ? 91.071  133.083 19.339  1.00 30.16  ? 135  G   0 P     1 
ATOM   2637  O  OP1   . G   A  1  134  ? 92.059  132.009 19.100  1.00 29.18  ? 135  G   0 OP1   1 
ATOM   2638  O  OP2   . G   A  1  134  ? 91.516  134.502 19.325  1.00 31.08  ? 135  G   0 OP2   1 
ATOM   2639  O  "O5'" . G   A  1  134  ? 89.870  132.933 18.303  1.00 28.05  ? 135  G   0 "O5'" 1 
ATOM   2640  C  "C5'" . G   A  1  134  ? 89.192  131.672 18.141  1.00 26.69  ? 135  G   0 "C5'" 1 
ATOM   2641  C  "C4'" . G   A  1  134  ? 88.159  131.776 17.049  1.00 27.70  ? 135  G   0 "C4'" 1 
ATOM   2642  O  "O4'" . G   A  1  134