data_1S77
# 
_entry.id   1S77 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1S77         
NDB   PH0010       
RCSB  RCSB021453   
WWPDB D_1000021453 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1S77 
_pdbx_database_status.recvd_initial_deposition_date   2004-01-29 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Yin, Y.W.'    1 
'Steitz, T.A.' 2 
# 
_citation.id                        primary 
_citation.title                     'The structural mechanism of translocation and helicase activity in T7 RNA polymerase.' 
_citation.journal_abbrev            'Cell(Cambridge,Mass.)' 
_citation.journal_volume            116 
_citation.page_first                393 
_citation.page_last                 404 
_citation.year                      2004 
_citation.journal_id_ASTM           CELLB5 
_citation.country                   US 
_citation.journal_id_ISSN           0092-8674 
_citation.journal_id_CSD            0998 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15016374 
_citation.pdbx_database_id_DOI      '10.1016/S0092-8674(04)00120-5' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Yin, Y.W.'    1 
primary 'Steitz, T.A.' 2 
# 
_cell.entry_id           1S77 
_cell.length_a           127.738 
_cell.length_b           141.843 
_cell.length_c           142.856 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1S77 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 
;DNA (5'-D(*GP*CP*CP*GP*TP*GP*CP*GP*CP*AP*TP*TP*CP*GP*CP*CP*GP*TP*GP*TP*T)-3')
;
6422.119  1 ?       ? ? ? 
2 polymer     syn 
;DNA (5'-D(*TP*TP*TP*AP*CP*GP*TP*TP*GP*CP*GP*CP*AP*CP*GP*GP*C)-3')
;
5194.358  1 ?       ? ? ? 
3 polymer     syn 
;RNA (5'-R(*AP*CP*AP*CP*GP*GP*CP*GP*AP*(3DA))-3')
;
3207.030  1 ?       ? ? ? 
4 polymer     man 'DNA-directed RNA polymerase'                                                   98984.227 1 2.7.7.6 ? ? ? 
5 non-polymer syn 'MAGNESIUM ION'                                                                 24.305    2 ?       ? ? ? 
6 non-polymer syn 'PYROPHOSPHATE 2-'                                                              175.959   1 ?       ? ? ? 
7 water       nat water                                                                           18.015    1 ?       ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no  
;(DG)(DC)(DC)(DG)(DT)(DG)(DC)(DG)(DC)(DA)(DT)(DT)(DC)(DG)(DC)(DC)(DG)(DT)(DG)(DT)
(DT)
;
GCCGTGCGCATTCGCCGTGTT T ? 
2 polydeoxyribonucleotide no no  '(DT)(DT)(DT)(DA)(DC)(DG)(DT)(DT)(DG)(DC)(DG)(DC)(DA)(DC)(DG)(DG)(DC)' TTTACGTTGCGCACGGC N ? 
3 polyribonucleotide      no yes 'ACACGGCGA(3DA)' ACACGGCGAA R ? 
4 'polypeptide(L)'        no no  
;MNTINIAKNDFSDIELAAIPFNTLADHYGERLAREQLALEHESYEMGEARFRKMFERQLKAGEVADNAAAKPLITTLLPK
MIARINDWFEEVKAKRGKRPTAFQFLQEIKPEAVAYITIKTTLACLTSADNTTVQAVASAIGRAIEDEARFGRIRDLEAK
HFKKNVEEQLNKRVGHVYKKAFMQVVEADMLSKGLLGGEAWSSWHKEDSIHVGVRCIEMLIESTGMVSLHRQNAGVVGQD
SETIELAPEYAEAIATRAGALAGISPMFQPCVVPPKPWTGITGGGYWANGRRPLALVRTHSKKALMRYEDVYMPEVYKAI
NIAQNTAWKINKKVLAVANVITKWKHCPVEDIPAIEREELPMKPEDIDMNPEALTAWKRAAAAVYRKDKARKSRRISLEF
MLEQANKFANHKAIWFPYNMDWRGRVYAVSMFNPQGNDMTKGLLTLAKGKPIGKEGYYWLKIHGANCAGVDKVPFPERIK
FIEENHENIMACAKSPLENTWWAEQDSPFCFLAFCFEYAGVQHHGLSYNCSLPLAFDGSCSGIQHFSAMLRDEVGGRAVN
LLPSETVQDIYGIVAKKVNEILQADAINGTDNEVVTVTDENTGEISEKVKLGTKALAGQWLAYGVTRSVTKRSVMTLAYG
SKEFGFRQQVLEDTIQPAIDSGKGLMFTQPNQAAGYMAKLIWESVSVTVVAAVEAMNWLKSAAKLLAAEVKDKKTGEILR
KRCAVHWVTPDGFPVWQEYKKPIQTRLNLMFLGQFRLQPTINTNKDSEIDAHKQESGIAPNFVHSQDGSHLRKTVVWAHE
KYGIESFALIHDSFGTIPADAANLFKAVRETMVDTYESCDVLADFYDQFADQLHESQLDKMPALPAKGNLNLRDILESDF
AFA
;
;MNTINIAKNDFSDIELAAIPFNTLADHYGERLAREQLALEHESYEMGEARFRKMFERQLKAGEVADNAAAKPLITTLLPK
MIARINDWFEEVKAKRGKRPTAFQFLQEIKPEAVAYITIKTTLACLTSADNTTVQAVASAIGRAIEDEARFGRIRDLEAK
HFKKNVEEQLNKRVGHVYKKAFMQVVEADMLSKGLLGGEAWSSWHKEDSIHVGVRCIEMLIESTGMVSLHRQNAGVVGQD
SETIELAPEYAEAIATRAGALAGISPMFQPCVVPPKPWTGITGGGYWANGRRPLALVRTHSKKALMRYEDVYMPEVYKAI
NIAQNTAWKINKKVLAVANVITKWKHCPVEDIPAIEREELPMKPEDIDMNPEALTAWKRAAAAVYRKDKARKSRRISLEF
MLEQANKFANHKAIWFPYNMDWRGRVYAVSMFNPQGNDMTKGLLTLAKGKPIGKEGYYWLKIHGANCAGVDKVPFPERIK
FIEENHENIMACAKSPLENTWWAEQDSPFCFLAFCFEYAGVQHHGLSYNCSLPLAFDGSCSGIQHFSAMLRDEVGGRAVN
LLPSETVQDIYGIVAKKVNEILQADAINGTDNEVVTVTDENTGEISEKVKLGTKALAGQWLAYGVTRSVTKRSVMTLAYG
SKEFGFRQQVLEDTIQPAIDSGKGLMFTQPNQAAGYMAKLIWESVSVTVVAAVEAMNWLKSAAKLLAAEVKDKKTGEILR
KRCAVHWVTPDGFPVWQEYKKPIQTRLNLMFLGQFRLQPTINTNKDSEIDAHKQESGIAPNFVHSQDGSHLRKTVVWAHE
KYGIESFALIHDSFGTIPADAANLFKAVRETMVDTYESCDVLADFYDQFADQLHESQLDKMPALPAKGNLNLRDILESDF
AFA
;
D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DG  n 
1 2   DC  n 
1 3   DC  n 
1 4   DG  n 
1 5   DT  n 
1 6   DG  n 
1 7   DC  n 
1 8   DG  n 
1 9   DC  n 
1 10  DA  n 
1 11  DT  n 
1 12  DT  n 
1 13  DC  n 
1 14  DG  n 
1 15  DC  n 
1 16  DC  n 
1 17  DG  n 
1 18  DT  n 
1 19  DG  n 
1 20  DT  n 
1 21  DT  n 
2 1   DT  n 
2 2   DT  n 
2 3   DT  n 
2 4   DA  n 
2 5   DC  n 
2 6   DG  n 
2 7   DT  n 
2 8   DT  n 
2 9   DG  n 
2 10  DC  n 
2 11  DG  n 
2 12  DC  n 
2 13  DA  n 
2 14  DC  n 
2 15  DG  n 
2 16  DG  n 
2 17  DC  n 
3 1   A   n 
3 2   C   n 
3 3   A   n 
3 4   C   n 
3 5   G   n 
3 6   G   n 
3 7   C   n 
3 8   G   n 
3 9   A   n 
3 10  3DA n 
4 1   MET n 
4 2   ASN n 
4 3   THR n 
4 4   ILE n 
4 5   ASN n 
4 6   ILE n 
4 7   ALA n 
4 8   LYS n 
4 9   ASN n 
4 10  ASP n 
4 11  PHE n 
4 12  SER n 
4 13  ASP n 
4 14  ILE n 
4 15  GLU n 
4 16  LEU n 
4 17  ALA n 
4 18  ALA n 
4 19  ILE n 
4 20  PRO n 
4 21  PHE n 
4 22  ASN n 
4 23  THR n 
4 24  LEU n 
4 25  ALA n 
4 26  ASP n 
4 27  HIS n 
4 28  TYR n 
4 29  GLY n 
4 30  GLU n 
4 31  ARG n 
4 32  LEU n 
4 33  ALA n 
4 34  ARG n 
4 35  GLU n 
4 36  GLN n 
4 37  LEU n 
4 38  ALA n 
4 39  LEU n 
4 40  GLU n 
4 41  HIS n 
4 42  GLU n 
4 43  SER n 
4 44  TYR n 
4 45  GLU n 
4 46  MET n 
4 47  GLY n 
4 48  GLU n 
4 49  ALA n 
4 50  ARG n 
4 51  PHE n 
4 52  ARG n 
4 53  LYS n 
4 54  MET n 
4 55  PHE n 
4 56  GLU n 
4 57  ARG n 
4 58  GLN n 
4 59  LEU n 
4 60  LYS n 
4 61  ALA n 
4 62  GLY n 
4 63  GLU n 
4 64  VAL n 
4 65  ALA n 
4 66  ASP n 
4 67  ASN n 
4 68  ALA n 
4 69  ALA n 
4 70  ALA n 
4 71  LYS n 
4 72  PRO n 
4 73  LEU n 
4 74  ILE n 
4 75  THR n 
4 76  THR n 
4 77  LEU n 
4 78  LEU n 
4 79  PRO n 
4 80  LYS n 
4 81  MET n 
4 82  ILE n 
4 83  ALA n 
4 84  ARG n 
4 85  ILE n 
4 86  ASN n 
4 87  ASP n 
4 88  TRP n 
4 89  PHE n 
4 90  GLU n 
4 91  GLU n 
4 92  VAL n 
4 93  LYS n 
4 94  ALA n 
4 95  LYS n 
4 96  ARG n 
4 97  GLY n 
4 98  LYS n 
4 99  ARG n 
4 100 PRO n 
4 101 THR n 
4 102 ALA n 
4 103 PHE n 
4 104 GLN n 
4 105 PHE n 
4 106 LEU n 
4 107 GLN n 
4 108 GLU n 
4 109 ILE n 
4 110 LYS n 
4 111 PRO n 
4 112 GLU n 
4 113 ALA n 
4 114 VAL n 
4 115 ALA n 
4 116 TYR n 
4 117 ILE n 
4 118 THR n 
4 119 ILE n 
4 120 LYS n 
4 121 THR n 
4 122 THR n 
4 123 LEU n 
4 124 ALA n 
4 125 CYS n 
4 126 LEU n 
4 127 THR n 
4 128 SER n 
4 129 ALA n 
4 130 ASP n 
4 131 ASN n 
4 132 THR n 
4 133 THR n 
4 134 VAL n 
4 135 GLN n 
4 136 ALA n 
4 137 VAL n 
4 138 ALA n 
4 139 SER n 
4 140 ALA n 
4 141 ILE n 
4 142 GLY n 
4 143 ARG n 
4 144 ALA n 
4 145 ILE n 
4 146 GLU n 
4 147 ASP n 
4 148 GLU n 
4 149 ALA n 
4 150 ARG n 
4 151 PHE n 
4 152 GLY n 
4 153 ARG n 
4 154 ILE n 
4 155 ARG n 
4 156 ASP n 
4 157 LEU n 
4 158 GLU n 
4 159 ALA n 
4 160 LYS n 
4 161 HIS n 
4 162 PHE n 
4 163 LYS n 
4 164 LYS n 
4 165 ASN n 
4 166 VAL n 
4 167 GLU n 
4 168 GLU n 
4 169 GLN n 
4 170 LEU n 
4 171 ASN n 
4 172 LYS n 
4 173 ARG n 
4 174 VAL n 
4 175 GLY n 
4 176 HIS n 
4 177 VAL n 
4 178 TYR n 
4 179 LYS n 
4 180 LYS n 
4 181 ALA n 
4 182 PHE n 
4 183 MET n 
4 184 GLN n 
4 185 VAL n 
4 186 VAL n 
4 187 GLU n 
4 188 ALA n 
4 189 ASP n 
4 190 MET n 
4 191 LEU n 
4 192 SER n 
4 193 LYS n 
4 194 GLY n 
4 195 LEU n 
4 196 LEU n 
4 197 GLY n 
4 198 GLY n 
4 199 GLU n 
4 200 ALA n 
4 201 TRP n 
4 202 SER n 
4 203 SER n 
4 204 TRP n 
4 205 HIS n 
4 206 LYS n 
4 207 GLU n 
4 208 ASP n 
4 209 SER n 
4 210 ILE n 
4 211 HIS n 
4 212 VAL n 
4 213 GLY n 
4 214 VAL n 
4 215 ARG n 
4 216 CYS n 
4 217 ILE n 
4 218 GLU n 
4 219 MET n 
4 220 LEU n 
4 221 ILE n 
4 222 GLU n 
4 223 SER n 
4 224 THR n 
4 225 GLY n 
4 226 MET n 
4 227 VAL n 
4 228 SER n 
4 229 LEU n 
4 230 HIS n 
4 231 ARG n 
4 232 GLN n 
4 233 ASN n 
4 234 ALA n 
4 235 GLY n 
4 236 VAL n 
4 237 VAL n 
4 238 GLY n 
4 239 GLN n 
4 240 ASP n 
4 241 SER n 
4 242 GLU n 
4 243 THR n 
4 244 ILE n 
4 245 GLU n 
4 246 LEU n 
4 247 ALA n 
4 248 PRO n 
4 249 GLU n 
4 250 TYR n 
4 251 ALA n 
4 252 GLU n 
4 253 ALA n 
4 254 ILE n 
4 255 ALA n 
4 256 THR n 
4 257 ARG n 
4 258 ALA n 
4 259 GLY n 
4 260 ALA n 
4 261 LEU n 
4 262 ALA n 
4 263 GLY n 
4 264 ILE n 
4 265 SER n 
4 266 PRO n 
4 267 MET n 
4 268 PHE n 
4 269 GLN n 
4 270 PRO n 
4 271 CYS n 
4 272 VAL n 
4 273 VAL n 
4 274 PRO n 
4 275 PRO n 
4 276 LYS n 
4 277 PRO n 
4 278 TRP n 
4 279 THR n 
4 280 GLY n 
4 281 ILE n 
4 282 THR n 
4 283 GLY n 
4 284 GLY n 
4 285 GLY n 
4 286 TYR n 
4 287 TRP n 
4 288 ALA n 
4 289 ASN n 
4 290 GLY n 
4 291 ARG n 
4 292 ARG n 
4 293 PRO n 
4 294 LEU n 
4 295 ALA n 
4 296 LEU n 
4 297 VAL n 
4 298 ARG n 
4 299 THR n 
4 300 HIS n 
4 301 SER n 
4 302 LYS n 
4 303 LYS n 
4 304 ALA n 
4 305 LEU n 
4 306 MET n 
4 307 ARG n 
4 308 TYR n 
4 309 GLU n 
4 310 ASP n 
4 311 VAL n 
4 312 TYR n 
4 313 MET n 
4 314 PRO n 
4 315 GLU n 
4 316 VAL n 
4 317 TYR n 
4 318 LYS n 
4 319 ALA n 
4 320 ILE n 
4 321 ASN n 
4 322 ILE n 
4 323 ALA n 
4 324 GLN n 
4 325 ASN n 
4 326 THR n 
4 327 ALA n 
4 328 TRP n 
4 329 LYS n 
4 330 ILE n 
4 331 ASN n 
4 332 LYS n 
4 333 LYS n 
4 334 VAL n 
4 335 LEU n 
4 336 ALA n 
4 337 VAL n 
4 338 ALA n 
4 339 ASN n 
4 340 VAL n 
4 341 ILE n 
4 342 THR n 
4 343 LYS n 
4 344 TRP n 
4 345 LYS n 
4 346 HIS n 
4 347 CYS n 
4 348 PRO n 
4 349 VAL n 
4 350 GLU n 
4 351 ASP n 
4 352 ILE n 
4 353 PRO n 
4 354 ALA n 
4 355 ILE n 
4 356 GLU n 
4 357 ARG n 
4 358 GLU n 
4 359 GLU n 
4 360 LEU n 
4 361 PRO n 
4 362 MET n 
4 363 LYS n 
4 364 PRO n 
4 365 GLU n 
4 366 ASP n 
4 367 ILE n 
4 368 ASP n 
4 369 MET n 
4 370 ASN n 
4 371 PRO n 
4 372 GLU n 
4 373 ALA n 
4 374 LEU n 
4 375 THR n 
4 376 ALA n 
4 377 TRP n 
4 378 LYS n 
4 379 ARG n 
4 380 ALA n 
4 381 ALA n 
4 382 ALA n 
4 383 ALA n 
4 384 VAL n 
4 385 TYR n 
4 386 ARG n 
4 387 LYS n 
4 388 ASP n 
4 389 LYS n 
4 390 ALA n 
4 391 ARG n 
4 392 LYS n 
4 393 SER n 
4 394 ARG n 
4 395 ARG n 
4 396 ILE n 
4 397 SER n 
4 398 LEU n 
4 399 GLU n 
4 400 PHE n 
4 401 MET n 
4 402 LEU n 
4 403 GLU n 
4 404 GLN n 
4 405 ALA n 
4 406 ASN n 
4 407 LYS n 
4 408 PHE n 
4 409 ALA n 
4 410 ASN n 
4 411 HIS n 
4 412 LYS n 
4 413 ALA n 
4 414 ILE n 
4 415 TRP n 
4 416 PHE n 
4 417 PRO n 
4 418 TYR n 
4 419 ASN n 
4 420 MET n 
4 421 ASP n 
4 422 TRP n 
4 423 ARG n 
4 424 GLY n 
4 425 ARG n 
4 426 VAL n 
4 427 TYR n 
4 428 ALA n 
4 429 VAL n 
4 430 SER n 
4 431 MET n 
4 432 PHE n 
4 433 ASN n 
4 434 PRO n 
4 435 GLN n 
4 436 GLY n 
4 437 ASN n 
4 438 ASP n 
4 439 MET n 
4 440 THR n 
4 441 LYS n 
4 442 GLY n 
4 443 LEU n 
4 444 LEU n 
4 445 THR n 
4 446 LEU n 
4 447 ALA n 
4 448 LYS n 
4 449 GLY n 
4 450 LYS n 
4 451 PRO n 
4 452 ILE n 
4 453 GLY n 
4 454 LYS n 
4 455 GLU n 
4 456 GLY n 
4 457 TYR n 
4 458 TYR n 
4 459 TRP n 
4 460 LEU n 
4 461 LYS n 
4 462 ILE n 
4 463 HIS n 
4 464 GLY n 
4 465 ALA n 
4 466 ASN n 
4 467 CYS n 
4 468 ALA n 
4 469 GLY n 
4 470 VAL n 
4 471 ASP n 
4 472 LYS n 
4 473 VAL n 
4 474 PRO n 
4 475 PHE n 
4 476 PRO n 
4 477 GLU n 
4 478 ARG n 
4 479 ILE n 
4 480 LYS n 
4 481 PHE n 
4 482 ILE n 
4 483 GLU n 
4 484 GLU n 
4 485 ASN n 
4 486 HIS n 
4 487 GLU n 
4 488 ASN n 
4 489 ILE n 
4 490 MET n 
4 491 ALA n 
4 492 CYS n 
4 493 ALA n 
4 494 LYS n 
4 495 SER n 
4 496 PRO n 
4 497 LEU n 
4 498 GLU n 
4 499 ASN n 
4 500 THR n 
4 501 TRP n 
4 502 TRP n 
4 503 ALA n 
4 504 GLU n 
4 505 GLN n 
4 506 ASP n 
4 507 SER n 
4 508 PRO n 
4 509 PHE n 
4 510 CYS n 
4 511 PHE n 
4 512 LEU n 
4 513 ALA n 
4 514 PHE n 
4 515 CYS n 
4 516 PHE n 
4 517 GLU n 
4 518 TYR n 
4 519 ALA n 
4 520 GLY n 
4 521 VAL n 
4 522 GLN n 
4 523 HIS n 
4 524 HIS n 
4 525 GLY n 
4 526 LEU n 
4 527 SER n 
4 528 TYR n 
4 529 ASN n 
4 530 CYS n 
4 531 SER n 
4 532 LEU n 
4 533 PRO n 
4 534 LEU n 
4 535 ALA n 
4 536 PHE n 
4 537 ASP n 
4 538 GLY n 
4 539 SER n 
4 540 CYS n 
4 541 SER n 
4 542 GLY n 
4 543 ILE n 
4 544 GLN n 
4 545 HIS n 
4 546 PHE n 
4 547 SER n 
4 548 ALA n 
4 549 MET n 
4 550 LEU n 
4 551 ARG n 
4 552 ASP n 
4 553 GLU n 
4 554 VAL n 
4 555 GLY n 
4 556 GLY n 
4 557 ARG n 
4 558 ALA n 
4 559 VAL n 
4 560 ASN n 
4 561 LEU n 
4 562 LEU n 
4 563 PRO n 
4 564 SER n 
4 565 GLU n 
4 566 THR n 
4 567 VAL n 
4 568 GLN n 
4 569 ASP n 
4 570 ILE n 
4 571 TYR n 
4 572 GLY n 
4 573 ILE n 
4 574 VAL n 
4 575 ALA n 
4 576 LYS n 
4 577 LYS n 
4 578 VAL n 
4 579 ASN n 
4 580 GLU n 
4 581 ILE n 
4 582 LEU n 
4 583 GLN n 
4 584 ALA n 
4 585 ASP n 
4 586 ALA n 
4 587 ILE n 
4 588 ASN n 
4 589 GLY n 
4 590 THR n 
4 591 ASP n 
4 592 ASN n 
4 593 GLU n 
4 594 VAL n 
4 595 VAL n 
4 596 THR n 
4 597 VAL n 
4 598 THR n 
4 599 ASP n 
4 600 GLU n 
4 601 ASN n 
4 602 THR n 
4 603 GLY n 
4 604 GLU n 
4 605 ILE n 
4 606 SER n 
4 607 GLU n 
4 608 LYS n 
4 609 VAL n 
4 610 LYS n 
4 611 LEU n 
4 612 GLY n 
4 613 THR n 
4 614 LYS n 
4 615 ALA n 
4 616 LEU n 
4 617 ALA n 
4 618 GLY n 
4 619 GLN n 
4 620 TRP n 
4 621 LEU n 
4 622 ALA n 
4 623 TYR n 
4 624 GLY n 
4 625 VAL n 
4 626 THR n 
4 627 ARG n 
4 628 SER n 
4 629 VAL n 
4 630 THR n 
4 631 LYS n 
4 632 ARG n 
4 633 SER n 
4 634 VAL n 
4 635 MET n 
4 636 THR n 
4 637 LEU n 
4 638 ALA n 
4 639 TYR n 
4 640 GLY n 
4 641 SER n 
4 642 LYS n 
4 643 GLU n 
4 644 PHE n 
4 645 GLY n 
4 646 PHE n 
4 647 ARG n 
4 648 GLN n 
4 649 GLN n 
4 650 VAL n 
4 651 LEU n 
4 652 GLU n 
4 653 ASP n 
4 654 THR n 
4 655 ILE n 
4 656 GLN n 
4 657 PRO n 
4 658 ALA n 
4 659 ILE n 
4 660 ASP n 
4 661 SER n 
4 662 GLY n 
4 663 LYS n 
4 664 GLY n 
4 665 LEU n 
4 666 MET n 
4 667 PHE n 
4 668 THR n 
4 669 GLN n 
4 670 PRO n 
4 671 ASN n 
4 672 GLN n 
4 673 ALA n 
4 674 ALA n 
4 675 GLY n 
4 676 TYR n 
4 677 MET n 
4 678 ALA n 
4 679 LYS n 
4 680 LEU n 
4 681 ILE n 
4 682 TRP n 
4 683 GLU n 
4 684 SER n 
4 685 VAL n 
4 686 SER n 
4 687 VAL n 
4 688 THR n 
4 689 VAL n 
4 690 VAL n 
4 691 ALA n 
4 692 ALA n 
4 693 VAL n 
4 694 GLU n 
4 695 ALA n 
4 696 MET n 
4 697 ASN n 
4 698 TRP n 
4 699 LEU n 
4 700 LYS n 
4 701 SER n 
4 702 ALA n 
4 703 ALA n 
4 704 LYS n 
4 705 LEU n 
4 706 LEU n 
4 707 ALA n 
4 708 ALA n 
4 709 GLU n 
4 710 VAL n 
4 711 LYS n 
4 712 ASP n 
4 713 LYS n 
4 714 LYS n 
4 715 THR n 
4 716 GLY n 
4 717 GLU n 
4 718 ILE n 
4 719 LEU n 
4 720 ARG n 
4 721 LYS n 
4 722 ARG n 
4 723 CYS n 
4 724 ALA n 
4 725 VAL n 
4 726 HIS n 
4 727 TRP n 
4 728 VAL n 
4 729 THR n 
4 730 PRO n 
4 731 ASP n 
4 732 GLY n 
4 733 PHE n 
4 734 PRO n 
4 735 VAL n 
4 736 TRP n 
4 737 GLN n 
4 738 GLU n 
4 739 TYR n 
4 740 LYS n 
4 741 LYS n 
4 742 PRO n 
4 743 ILE n 
4 744 GLN n 
4 745 THR n 
4 746 ARG n 
4 747 LEU n 
4 748 ASN n 
4 749 LEU n 
4 750 MET n 
4 751 PHE n 
4 752 LEU n 
4 753 GLY n 
4 754 GLN n 
4 755 PHE n 
4 756 ARG n 
4 757 LEU n 
4 758 GLN n 
4 759 PRO n 
4 760 THR n 
4 761 ILE n 
4 762 ASN n 
4 763 THR n 
4 764 ASN n 
4 765 LYS n 
4 766 ASP n 
4 767 SER n 
4 768 GLU n 
4 769 ILE n 
4 770 ASP n 
4 771 ALA n 
4 772 HIS n 
4 773 LYS n 
4 774 GLN n 
4 775 GLU n 
4 776 SER n 
4 777 GLY n 
4 778 ILE n 
4 779 ALA n 
4 780 PRO n 
4 781 ASN n 
4 782 PHE n 
4 783 VAL n 
4 784 HIS n 
4 785 SER n 
4 786 GLN n 
4 787 ASP n 
4 788 GLY n 
4 789 SER n 
4 790 HIS n 
4 791 LEU n 
4 792 ARG n 
4 793 LYS n 
4 794 THR n 
4 795 VAL n 
4 796 VAL n 
4 797 TRP n 
4 798 ALA n 
4 799 HIS n 
4 800 GLU n 
4 801 LYS n 
4 802 TYR n 
4 803 GLY n 
4 804 ILE n 
4 805 GLU n 
4 806 SER n 
4 807 PHE n 
4 808 ALA n 
4 809 LEU n 
4 810 ILE n 
4 811 HIS n 
4 812 ASP n 
4 813 SER n 
4 814 PHE n 
4 815 GLY n 
4 816 THR n 
4 817 ILE n 
4 818 PRO n 
4 819 ALA n 
4 820 ASP n 
4 821 ALA n 
4 822 ALA n 
4 823 ASN n 
4 824 LEU n 
4 825 PHE n 
4 826 LYS n 
4 827 ALA n 
4 828 VAL n 
4 829 ARG n 
4 830 GLU n 
4 831 THR n 
4 832 MET n 
4 833 VAL n 
4 834 ASP n 
4 835 THR n 
4 836 TYR n 
4 837 GLU n 
4 838 SER n 
4 839 CYS n 
4 840 ASP n 
4 841 VAL n 
4 842 LEU n 
4 843 ALA n 
4 844 ASP n 
4 845 PHE n 
4 846 TYR n 
4 847 ASP n 
4 848 GLN n 
4 849 PHE n 
4 850 ALA n 
4 851 ASP n 
4 852 GLN n 
4 853 LEU n 
4 854 HIS n 
4 855 GLU n 
4 856 SER n 
4 857 GLN n 
4 858 LEU n 
4 859 ASP n 
4 860 LYS n 
4 861 MET n 
4 862 PRO n 
4 863 ALA n 
4 864 LEU n 
4 865 PRO n 
4 866 ALA n 
4 867 LYS n 
4 868 GLY n 
4 869 ASN n 
4 870 LEU n 
4 871 ASN n 
4 872 LEU n 
4 873 ARG n 
4 874 ASP n 
4 875 ILE n 
4 876 LEU n 
4 877 GLU n 
4 878 SER n 
4 879 ASP n 
4 880 PHE n 
4 881 ALA n 
4 882 PHE n 
4 883 ALA n 
# 
_entity_src_gen.entity_id                          4 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     'T7-like viruses' 
_entity_src_gen.pdbx_gene_src_gene                 1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Enterobacteria phage T7' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10760 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
1 1 sample ? ? ? ? ? 'DNA OLIGOMER IS SYNTHESIZED' 
2 1 sample ? ? ? ? ? 'DNA OLIGOMER IS SYNTHESIZED' 
3 1 sample ? ? ? ? ? 'RNA OLIGOMER IS SYNTHESIZED' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP RPOL_BPT7 P00573 4 
;MNTINIAKNDFSDIELAAIPFNTLADHYGERLAREQLALEHESYEMGEARFRKMFERQLKAGEVADNAAAKPLITTLLPK
MIARINDWFEEVKAKRGKRPTAFQFLQEIKPEAVAYITIKTTLACLTSADNTTVQAVASAIGRAIEDEARFGRIRDLEAK
HFKKNVEEQLNKRVGHVYKKAFMQVVEADMLSKGLLGGEAWSSWHKEDSIHVGVRCIEMLIESTGMVSLHRQNAGVVGQD
SETIELAPEYAEAIATRAGALAGISPMFQPCVVPPKPWTGITGGGYWANGRRPLALVRTHSKKALMRYEDVYMPEVYKAI
NIAQNTAWKINKKVLAVANVITKWKHCPVEDIPAIEREELPMKPEDIDMNPEALTAWKRAAAAVYRKDKARKSRRISLEF
MLEQANKFANHKAIWFPYNMDWRGRVYAVSMFNPQGNDMTKGLLTLAKGKPIGKEGYYWLKIHGANCAGVDKVPFPERIK
FIEENHENIMACAKSPLENTWWAEQDSPFCFLAFCFEYAGVQHHGLSYNCSLPLAFDGSCSGIQHFSAMLRDEVGGRAVN
LLPSETVQDIYGIVAKKVNEILQADAINGTDNEVVTVTDENTGEISEKVKLGTKALAGQWLAYGVTRSVTKRSVMTLAYG
SKEFGFRQQVLEDTIQPAIDSGKGLMFTQPNQAAGYMAKLIWESVSVTVVAAVEAMNWLKSAAKLLAAEVKDKKTGEILR
KRCAVHWVTPDGFPVWQEYKKPIQTRLNLMFLGQFRLQPTINTNKDSEIDAHKQESGIAPNFVHSQDGSHLRKTVVWAHE
KYGIESFALIHDSFGTIPADAANLFKAVRETMVDTYESCDVLADFYDQFADQLHESQLDKMPALPAKGNLNLRDILESDF
AFA
;
1 ? 
2 PDB 1S77      1S77   1 ? ? ? 
3 PDB 1S77      1S77   2 ? ? ? 
4 PDB 1S77      1S77   3 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1S77 D 1 ? 883 ? P00573 1   ? 883 ? 1   883 
2 2 1S77 T 1 ? 21  ? 1S77   130 ? 110 ? 130 110 
3 3 1S77 N 1 ? 17  ? 1S77   14  ? 30  ? 14  30  
4 4 1S77 R 1 ? 10  ? 1S77   10  ? 1   ? 10  1   
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
3DA 'RNA linking'       n "3'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE"         ? 'C10 H14 N5 O7 P' 347.221 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"          ? 'C9 H14 N3 O8 P'  323.197 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"         ? 'C10 H14 N5 O8 P' 363.221 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ? 'Mg 2'            24.305  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
POP non-polymer         . 'PYROPHOSPHATE 2-'                   ? 'H2 O7 P2 -2'     175.959 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1S77 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.06 
_exptl_crystal.density_percent_sol   59.52 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.2 
_exptl_crystal_grow.pdbx_details    
;T7RNAP, DNA,RNA, 3'deoxyATP, pH 7.2, VAPOR DIFFUSION, HANGING DROP, temperature 298K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2001-05-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.05 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CHESS BEAMLINE A1' 
_diffrn_source.pdbx_synchrotron_site       CHESS 
_diffrn_source.pdbx_synchrotron_beamline   A1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.05 
# 
_reflns.entry_id                     1S77 
_reflns.observed_criterion_sigma_I   2 
_reflns.observed_criterion_sigma_F   1.44 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.69 
_reflns.number_obs                   35620 
_reflns.number_all                   35620 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        24.4 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.69 
_reflns_shell.d_res_low              2.75 
_reflns_shell.percent_possible_all   0.992 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1S77 
_refine.ls_number_reflns_obs                     35620 
_refine.ls_number_reflns_all                     35620 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               4598334.23 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.00 
_refine.ls_d_res_high                            2.69 
_refine.ls_percent_reflns_obs                    99.9 
_refine.ls_R_factor_obs                          0.251 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.251 
_refine.ls_R_factor_R_free                       0.285 
_refine.ls_R_factor_R_free_error                 0.012 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 8.0 
_refine.ls_number_reflns_R_free                  2852 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               69.1 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.299966 
_refine.solvent_model_param_bsol                 32.6313 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;Residues D Gly194 is linked to D Ala200 even when the     
residues 195-199 are missing from the coordinates.
;
_refine.pdbx_starting_model                      'T7 RNAP elongation post-translocated complex' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1S77 
_refine_analyze.Luzzati_coordinate_error_obs    0.46 
_refine_analyze.Luzzati_sigma_a_obs             0.59 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.43 
_refine_analyze.Luzzati_sigma_a_free            0.47 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6546 
_refine_hist.pdbx_number_atoms_nucleic_acid   982 
_refine_hist.pdbx_number_atoms_ligand         11 
_refine_hist.number_atoms_solvent             1 
_refine_hist.number_atoms_total               7540 
_refine_hist.d_res_high                       2.69 
_refine_hist.d_res_low                        30.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.008 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.2   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      20.0  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.29  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.37  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            2.38  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             1.83  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            3.03  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.69 
_refine_ls_shell.d_res_low                        2.75 
_refine_ls_shell.number_reflns_R_work             1709 
_refine_ls_shell.R_factor_R_work                  0.462 
_refine_ls_shell.percent_reflns_obs               99.2 
_refine_ls_shell.R_factor_R_free                  0.485 
_refine_ls_shell.R_factor_R_free_error            0.059 
_refine_ls_shell.percent_reflns_R_free            8.0 
_refine_ls_shell.number_reflns_R_free             512 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 DNA-RNA_REP.PARAM DNA-RNA.TOP 'X-RAY DIFFRACTION' 
3 WATER_REP.PARAM   WATER.TOP   'X-RAY DIFFRACTION' 
4 ION.PARAM         ION.TOP     'X-RAY DIFFRACTION' 
5 PPI.PARAM         PPI.TOP     'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1S77 
_struct.title                     'T7 RNAP product pyrophosphate elongation complex' 
_struct.pdbx_descriptor           'PROTEIN/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1S77 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'T7 RNA polymerase, TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 6 ? 
H N N 7 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ILE D 19  ? LYS D 60  ? ILE D 19  LYS D 60  1 ? 42 
HELX_P HELX_P2  2  ALA D 61  ? GLY D 62  ? ALA D 61  GLY D 62  5 ? 2  
HELX_P HELX_P3  3  GLU D 63  ? ALA D 69  ? GLU D 63  ALA D 69  5 ? 7  
HELX_P HELX_P4  4  ALA D 70  ? LEU D 78  ? ALA D 70  LEU D 78  1 ? 9  
HELX_P HELX_P5  5  MET D 81  ? LYS D 93  ? MET D 81  LYS D 93  1 ? 13 
HELX_P HELX_P6  6  LYS D 110 ? THR D 127 ? LYS D 110 THR D 127 1 ? 18 
HELX_P HELX_P7  7  THR D 133 ? ALA D 149 ? THR D 133 ALA D 149 1 ? 17 
HELX_P HELX_P8  8  ALA D 149 ? ILE D 154 ? ALA D 149 ILE D 154 1 ? 6  
HELX_P HELX_P9  9  VAL D 177 ? PHE D 182 ? VAL D 177 PHE D 182 1 ? 6  
HELX_P HELX_P10 10 GLN D 184 ? ASP D 189 ? GLN D 184 ASP D 189 5 ? 6  
HELX_P HELX_P11 11 GLU D 207 ? GLU D 222 ? GLU D 207 GLU D 222 1 ? 16 
HELX_P HELX_P12 12 ALA D 247 ? GLY D 263 ? ALA D 247 GLY D 263 1 ? 17 
HELX_P HELX_P13 13 SER D 301 ? GLU D 309 ? SER D 301 GLU D 309 1 ? 9  
HELX_P HELX_P14 14 MET D 313 ? ASN D 325 ? MET D 313 ASN D 325 1 ? 13 
HELX_P HELX_P15 15 ASN D 331 ? THR D 342 ? ASN D 331 THR D 342 1 ? 12 
HELX_P HELX_P16 16 ALA D 383 ? ALA D 409 ? ALA D 383 ALA D 409 1 ? 27 
HELX_P HELX_P17 17 ASN D 437 ? LEU D 443 ? ASN D 437 LEU D 443 1 ? 7  
HELX_P HELX_P18 18 ILE D 452 ? GLY D 469 ? ILE D 452 GLY D 469 1 ? 18 
HELX_P HELX_P19 19 PRO D 474 ? GLU D 484 ? PRO D 474 GLU D 484 1 ? 11 
HELX_P HELX_P20 20 ASN D 485 ? SER D 495 ? ASN D 485 SER D 495 1 ? 11 
HELX_P HELX_P21 21 ASN D 499 ? ALA D 503 ? ASN D 499 ALA D 503 5 ? 5  
HELX_P HELX_P22 22 SER D 507 ? GLY D 525 ? SER D 507 GLY D 525 1 ? 19 
HELX_P HELX_P23 23 CYS D 540 ? ARG D 551 ? CYS D 540 ARG D 551 1 ? 12 
HELX_P HELX_P24 24 ASP D 552 ? VAL D 559 ? ASP D 552 VAL D 559 1 ? 8  
HELX_P HELX_P25 25 ASP D 569 ? GLY D 589 ? ASP D 569 GLY D 589 1 ? 21 
HELX_P HELX_P26 26 LYS D 614 ? TYR D 623 ? LYS D 614 TYR D 623 1 ? 10 
HELX_P HELX_P27 27 THR D 626 ? ALA D 638 ? THR D 626 ALA D 638 1 ? 13 
HELX_P HELX_P28 28 LYS D 642 ? THR D 654 ? LYS D 642 THR D 654 1 ? 13 
HELX_P HELX_P29 29 THR D 654 ? GLY D 662 ? THR D 654 GLY D 662 1 ? 9  
HELX_P HELX_P30 30 GLN D 669 ? VAL D 687 ? GLN D 669 VAL D 687 1 ? 19 
HELX_P HELX_P31 31 VAL D 690 ? ALA D 708 ? VAL D 690 ALA D 708 1 ? 19 
HELX_P HELX_P32 32 ASP D 770 ? GLY D 803 ? ASP D 770 GLY D 803 1 ? 34 
HELX_P HELX_P33 33 ILE D 817 ? CYS D 839 ? ILE D 817 CYS D 839 1 ? 23 
HELX_P HELX_P34 34 ASP D 840 ? ALA D 850 ? ASP D 840 ALA D 850 1 ? 11 
HELX_P HELX_P35 35 ASN D 871 ? SER D 878 ? ASN D 871 SER D 878 5 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? F MG  .  MG  ? ? ? 1_555 D ASP 537 OD2   ? ? D MG  903 D ASP 537 1_555 ? ? ? ? ? ? ?            2.482 ? 
metalc2  metalc ? ? F MG  .  MG  ? ? ? 1_555 C 3DA 10  O1P   ? ? D MG  903 R 3DA 1   1_555 ? ? ? ? ? ? ?            2.780 ? 
metalc3  metalc ? ? F MG  .  MG  ? ? ? 1_555 H HOH .   O     ? ? D MG  903 D HOH 904 1_555 ? ? ? ? ? ? ?            2.718 ? 
metalc4  metalc ? ? F MG  .  MG  ? ? ? 1_555 D ASP 812 OD2   ? ? D MG  903 D ASP 812 1_555 ? ? ? ? ? ? ?            2.208 ? 
covale1  covale ? ? C 3DA 10 P   ? ? ? 1_555 C A   9   "O3'" ? ? R 3DA 1   R A   2   1_555 ? ? ? ? ? ? ?            1.604 ? 
metalc5  metalc ? ? C 3DA 10 O2P ? ? ? 1_555 E MG  .   MG    ? ? R 3DA 1   R MG  902 1_555 ? ? ? ? ? ? ?            1.899 ? 
metalc6  metalc ? ? E MG  .  MG  ? ? ? 1_555 C A   9   "O3'" ? ? R MG  902 R A   2   1_555 ? ? ? ? ? ? ?            2.431 ? 
metalc7  metalc ? ? E MG  .  MG  ? ? ? 1_555 C 3DA 10  O1P   ? ? R MG  902 R 3DA 1   1_555 ? ? ? ? ? ? ?            2.913 ? 
hydrog1  hydrog ? ? A DG  1  N1  ? ? ? 1_555 B DC  17  N3    ? ? T DG  130 N DC  30  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? A DG  1  N2  ? ? ? 1_555 B DC  17  O2    ? ? T DG  130 N DC  30  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? A DG  1  O6  ? ? ? 1_555 B DC  17  N4    ? ? T DG  130 N DC  30  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? A DC  2  N3  ? ? ? 1_555 B DG  16  N1    ? ? T DC  129 N DG  29  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? A DC  2  N4  ? ? ? 1_555 B DG  16  O6    ? ? T DC  129 N DG  29  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? A DC  2  O2  ? ? ? 1_555 B DG  16  N2    ? ? T DC  129 N DG  29  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? A DC  3  N3  ? ? ? 1_555 B DG  15  N1    ? ? T DC  128 N DG  28  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? A DC  3  N4  ? ? ? 1_555 B DG  15  O6    ? ? T DC  128 N DG  28  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? A DC  3  O2  ? ? ? 1_555 B DG  15  N2    ? ? T DC  128 N DG  28  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? A DG  4  N1  ? ? ? 1_555 B DC  14  N3    ? ? T DG  127 N DC  27  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? A DG  4  N2  ? ? ? 1_555 B DC  14  O2    ? ? T DG  127 N DC  27  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? A DG  4  O6  ? ? ? 1_555 B DC  14  N4    ? ? T DG  127 N DC  27  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? A DT  5  N3  ? ? ? 1_555 B DA  13  N1    ? ? T DT  126 N DA  26  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? A DT  5  O4  ? ? ? 1_555 B DA  13  N6    ? ? T DT  126 N DA  26  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? A DG  6  N1  ? ? ? 1_555 B DC  12  N3    ? ? T DG  125 N DC  25  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? A DG  6  N2  ? ? ? 1_555 B DC  12  O2    ? ? T DG  125 N DC  25  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? A DG  6  O6  ? ? ? 1_555 B DC  12  N4    ? ? T DG  125 N DC  25  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? A DC  7  N3  ? ? ? 1_555 B DG  11  N1    ? ? T DC  124 N DG  24  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? A DC  7  N4  ? ? ? 1_555 B DG  11  O6    ? ? T DC  124 N DG  24  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? A DC  7  O2  ? ? ? 1_555 B DG  11  N2    ? ? T DC  124 N DG  24  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? A DG  8  N1  ? ? ? 1_555 B DC  10  N3    ? ? T DG  123 N DC  23  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? A DG  8  N2  ? ? ? 1_555 B DC  10  O2    ? ? T DG  123 N DC  23  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? A DG  8  O6  ? ? ? 1_555 B DC  10  N4    ? ? T DG  123 N DC  23  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? A DC  9  N3  ? ? ? 1_555 B DG  9   N1    ? ? T DC  122 N DG  22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? A DC  9  N4  ? ? ? 1_555 B DG  9   O6    ? ? T DC  122 N DG  22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? A DC  9  O2  ? ? ? 1_555 B DG  9   N2    ? ? T DC  122 N DG  22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? A DT  11 N3  ? ? ? 1_555 C 3DA 10  N1    ? ? T DT  120 R 3DA 1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? A DT  11 O4  ? ? ? 1_555 C 3DA 10  N6    ? ? T DT  120 R 3DA 1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? A DT  12 N3  ? ? ? 1_555 C A   9   N1    ? ? T DT  119 R A   2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? A DT  12 O4  ? ? ? 1_555 C A   9   N6    ? ? T DT  119 R A   2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? A DC  13 N3  ? ? ? 1_555 C G   8   N1    ? ? T DC  118 R G   3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? A DC  13 N4  ? ? ? 1_555 C G   8   O6    ? ? T DC  118 R G   3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? A DC  13 O2  ? ? ? 1_555 C G   8   N2    ? ? T DC  118 R G   3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? A DG  14 N1  ? ? ? 1_555 C C   7   N3    ? ? T DG  117 R C   4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? A DG  14 N2  ? ? ? 1_555 C C   7   O2    ? ? T DG  117 R C   4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? A DG  14 O6  ? ? ? 1_555 C C   7   N4    ? ? T DG  117 R C   4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? A DC  15 N3  ? ? ? 1_555 C G   6   N1    ? ? T DC  116 R G   5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? A DC  15 N4  ? ? ? 1_555 C G   6   O6    ? ? T DC  116 R G   5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ? ? A DC  15 O2  ? ? ? 1_555 C G   6   N2    ? ? T DC  116 R G   5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ? ? A DC  16 N3  ? ? ? 1_555 C G   5   N1    ? ? T DC  115 R G   6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ? ? A DC  16 N4  ? ? ? 1_555 C G   5   O6    ? ? T DC  115 R G   6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ? ? A DC  16 O2  ? ? ? 1_555 C G   5   N2    ? ? T DC  115 R G   6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ? ? A DG  17 N1  ? ? ? 1_555 C C   4   N3    ? ? T DG  114 R C   7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ? ? A DG  17 N2  ? ? ? 1_555 C C   4   O2    ? ? T DG  114 R C   7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ? ? A DG  17 O6  ? ? ? 1_555 C C   4   N4    ? ? T DG  114 R C   7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ? ? A DT  18 N3  ? ? ? 1_555 C A   3   N1    ? ? T DT  113 R A   8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47 hydrog ? ? A DT  18 O4  ? ? ? 1_555 C A   3   N6    ? ? T DT  113 R A   8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 3 ? 
C ? 2 ? 
D ? 2 ? 
E ? 3 ? 
F ? 2 ? 
G ? 2 ? 
H ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL D 227 ? SER D 228 ? VAL D 227 SER D 228 
A 2 GLU D 245 ? LEU D 246 ? GLU D 245 LEU D 246 
B 1 VAL D 297 ? ARG D 298 ? VAL D 297 ARG D 298 
B 2 TYR D 418 ? ASP D 421 ? TYR D 418 ASP D 421 
B 3 VAL D 426 ? ALA D 428 ? VAL D 426 ALA D 428 
C 1 TRP D 328 ? ILE D 330 ? TRP D 328 ILE D 330 
C 2 LEU D 444 ? LEU D 446 ? LEU D 444 LEU D 446 
D 1 LYS D 450 ? PRO D 451 ? LYS D 450 PRO D 451 
D 2 ASN D 529 ? CYS D 530 ? ASN D 529 CYS D 530 
E 1 LEU D 534 ? ASP D 537 ? LEU D 534 ASP D 537 
E 2 SER D 813 ? THR D 816 ? SER D 813 THR D 816 
E 3 ALA D 808 ? LEU D 809 ? ALA D 808 LEU D 809 
F 1 VAL D 710 ? LYS D 711 ? VAL D 710 LYS D 711 
F 2 ILE D 718 ? ARG D 720 ? ILE D 718 ARG D 720 
G 1 VAL D 725 ? VAL D 728 ? VAL D 725 VAL D 728 
G 2 PRO D 734 ? GLN D 737 ? PRO D 734 GLN D 737 
H 1 LEU D 747 ? LEU D 749 ? LEU D 747 LEU D 749 
H 2 GLY D 753 ? PHE D 755 ? GLY D 753 PHE D 755 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N SER D 228 ? N SER D 228 O GLU D 245 ? O GLU D 245 
B 1 2 N ARG D 298 ? N ARG D 298 O MET D 420 ? O MET D 420 
B 2 3 N ASN D 419 ? N ASN D 419 O TYR D 427 ? O TYR D 427 
C 1 2 N LYS D 329 ? N LYS D 329 O THR D 445 ? O THR D 445 
D 1 2 N LYS D 450 ? N LYS D 450 O CYS D 530 ? O CYS D 530 
E 1 2 N LEU D 534 ? N LEU D 534 O THR D 816 ? O THR D 816 
E 2 3 O GLY D 815 ? O GLY D 815 N ALA D 808 ? N ALA D 808 
F 1 2 N VAL D 710 ? N VAL D 710 O LEU D 719 ? O LEU D 719 
G 1 2 N TRP D 727 ? N TRP D 727 O VAL D 735 ? O VAL D 735 
H 1 2 N LEU D 747 ? N LEU D 747 O PHE D 755 ? O PHE D 755 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG R 902'  
AC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG D 903'  
AC3 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE POP D 901' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 2  3DA C 10  ? 3DA R 1   . ? 1_555 ? 
2  AC1 2  A   C 9   ? A   R 2   . ? 1_555 ? 
3  AC2 6  ASP D 537 ? ASP D 537 . ? 1_555 ? 
4  AC2 6  GLY D 538 ? GLY D 538 . ? 1_555 ? 
5  AC2 6  ASP D 812 ? ASP D 812 . ? 1_555 ? 
6  AC2 6  POP G .   ? POP D 901 . ? 1_555 ? 
7  AC2 6  HOH H .   ? HOH D 904 . ? 1_555 ? 
8  AC2 6  3DA C 10  ? 3DA R 1   . ? 1_555 ? 
9  AC3 10 LYS D 472 ? LYS D 472 . ? 1_555 ? 
10 AC3 10 ASP D 537 ? ASP D 537 . ? 1_555 ? 
11 AC3 10 GLY D 538 ? GLY D 538 . ? 1_555 ? 
12 AC3 10 SER D 539 ? SER D 539 . ? 1_555 ? 
13 AC3 10 CYS D 540 ? CYS D 540 . ? 1_555 ? 
14 AC3 10 TYR D 571 ? TYR D 571 . ? 1_555 ? 
15 AC3 10 ARG D 627 ? ARG D 627 . ? 1_555 ? 
16 AC3 10 LYS D 631 ? LYS D 631 . ? 1_555 ? 
17 AC3 10 MG  F .   ? MG  D 903 . ? 1_555 ? 
18 AC3 10 HOH H .   ? HOH D 904 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1S77 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1S77 
_atom_sites.fract_transf_matrix[1][1]   0.007829 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007050 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O  "O5'" . DG  A 1 1   ? -56.376 50.050  25.390 1.00 148.11 ? 130 DG  T "O5'" 1 
ATOM   2    C  "C5'" . DG  A 1 1   ? -57.525 50.416  26.156 1.00 148.44 ? 130 DG  T "C5'" 1 
ATOM   3    C  "C4'" . DG  A 1 1   ? -58.807 49.878  25.563 1.00 148.78 ? 130 DG  T "C4'" 1 
ATOM   4    O  "O4'" . DG  A 1 1   ? -58.864 50.269  24.170 1.00 148.94 ? 130 DG  T "O4'" 1 
ATOM   5    C  "C3'" . DG  A 1 1   ? -58.855 48.351  25.549 1.00 149.03 ? 130 DG  T "C3'" 1 
ATOM   6    O  "O3'" . DG  A 1 1   ? -60.211 47.885  25.598 1.00 149.20 ? 130 DG  T "O3'" 1 
ATOM   7    C  "C2'" . DG  A 1 1   ? -58.197 48.005  24.228 1.00 149.09 ? 130 DG  T "C2'" 1 
ATOM   8    C  "C1'" . DG  A 1 1   ? -58.668 49.136  23.330 1.00 149.00 ? 130 DG  T "C1'" 1 
ATOM   9    N  N9    . DG  A 1 1   ? -57.739 49.508  22.267 1.00 148.95 ? 130 DG  T N9    1 
ATOM   10   C  C8    . DG  A 1 1   ? -56.427 49.894  22.403 1.00 148.93 ? 130 DG  T C8    1 
ATOM   11   N  N7    . DG  A 1 1   ? -55.850 50.158  21.262 1.00 148.86 ? 130 DG  T N7    1 
ATOM   12   C  C5    . DG  A 1 1   ? -56.841 49.936  20.315 1.00 148.78 ? 130 DG  T C5    1 
ATOM   13   C  C6    . DG  A 1 1   ? -56.807 50.061  18.899 1.00 148.66 ? 130 DG  T C6    1 
ATOM   14   O  O6    . DG  A 1 1   ? -55.862 50.404  18.174 1.00 148.52 ? 130 DG  T O6    1 
ATOM   15   N  N1    . DG  A 1 1   ? -58.035 49.737  18.330 1.00 148.58 ? 130 DG  T N1    1 
ATOM   16   C  C2    . DG  A 1 1   ? -59.151 49.346  19.027 1.00 148.55 ? 130 DG  T C2    1 
ATOM   17   N  N2    . DG  A 1 1   ? -60.243 49.076  18.294 1.00 148.37 ? 130 DG  T N2    1 
ATOM   18   N  N3    . DG  A 1 1   ? -59.196 49.226  20.343 1.00 148.66 ? 130 DG  T N3    1 
ATOM   19   C  C4    . DG  A 1 1   ? -58.013 49.535  20.919 1.00 148.87 ? 130 DG  T C4    1 
ATOM   20   P  P     . DC  A 1 2   ? -60.516 46.304  25.577 1.00 149.27 ? 129 DC  T P     1 
ATOM   21   O  OP1   . DC  A 1 2   ? -61.839 46.075  26.211 1.00 149.04 ? 129 DC  T OP1   1 
ATOM   22   O  OP2   . DC  A 1 2   ? -59.318 45.605  26.108 1.00 149.36 ? 129 DC  T OP2   1 
ATOM   23   O  "O5'" . DC  A 1 2   ? -60.643 45.957  24.027 1.00 149.36 ? 129 DC  T "O5'" 1 
ATOM   24   C  "C5'" . DC  A 1 2   ? -61.794 46.358  23.287 1.00 149.47 ? 129 DC  T "C5'" 1 
ATOM   25   C  "C4'" . DC  A 1 2   ? -62.030 45.427  22.119 1.00 149.45 ? 129 DC  T "C4'" 1 
ATOM   26   O  "O4'" . DC  A 1 2   ? -61.068 45.701  21.071 1.00 149.53 ? 129 DC  T "O4'" 1 
ATOM   27   C  "C3'" . DC  A 1 2   ? -61.810 43.962  22.487 1.00 149.40 ? 129 DC  T "C3'" 1 
ATOM   28   O  "O3'" . DC  A 1 2   ? -62.615 43.125  21.656 1.00 149.37 ? 129 DC  T "O3'" 1 
ATOM   29   C  "C2'" . DC  A 1 2   ? -60.333 43.762  22.200 1.00 149.44 ? 129 DC  T "C2'" 1 
ATOM   30   C  "C1'" . DC  A 1 2   ? -60.135 44.632  20.966 1.00 149.57 ? 129 DC  T "C1'" 1 
ATOM   31   N  N1    . DC  A 1 2   ? -58.790 45.206  20.779 1.00 149.67 ? 129 DC  T N1    1 
ATOM   32   C  C2    . DC  A 1 2   ? -58.185 45.117  19.513 1.00 149.80 ? 129 DC  T C2    1 
ATOM   33   O  O2    . DC  A 1 2   ? -58.795 44.555  18.588 1.00 140.00 ? 129 DC  T O2    1 
ATOM   34   N  N3    . DC  A 1 2   ? -56.953 45.645  19.331 1.00 149.71 ? 129 DC  T N3    1 
ATOM   35   C  C4    . DC  A 1 2   ? -56.326 46.241  20.348 1.00 149.56 ? 129 DC  T C4    1 
ATOM   36   N  N4    . DC  A 1 2   ? -55.112 46.748  20.123 1.00 149.57 ? 129 DC  T N4    1 
ATOM   37   C  C5    . DC  A 1 2   ? -56.916 46.343  21.642 1.00 149.57 ? 129 DC  T C5    1 
ATOM   38   C  C6    . DC  A 1 2   ? -58.137 45.817  21.811 1.00 149.62 ? 129 DC  T C6    1 
ATOM   39   P  P     . DC  A 1 3   ? -63.039 41.664  22.169 1.00 149.53 ? 128 DC  T P     1 
ATOM   40   O  OP1   . DC  A 1 3   ? -64.272 41.818  22.982 1.00 149.24 ? 128 DC  T OP1   1 
ATOM   41   O  OP2   . DC  A 1 3   ? -61.845 41.008  22.762 1.00 149.55 ? 128 DC  T OP2   1 
ATOM   42   O  "O5'" . DC  A 1 3   ? -63.419 40.897  20.827 1.00 149.30 ? 128 DC  T "O5'" 1 
ATOM   43   C  "C5'" . DC  A 1 3   ? -62.745 39.699  20.447 1.00 148.87 ? 128 DC  T "C5'" 1 
ATOM   44   C  "C4'" . DC  A 1 3   ? -62.319 39.780  18.999 1.00 148.41 ? 128 DC  T "C4'" 1 
ATOM   45   O  "O4'" . DC  A 1 3   ? -61.280 40.784  18.880 1.00 148.61 ? 128 DC  T "O4'" 1 
ATOM   46   C  "C3'" . DC  A 1 3   ? -61.673 38.486  18.511 1.00 148.07 ? 128 DC  T "C3'" 1 
ATOM   47   O  "O3'" . DC  A 1 3   ? -61.855 38.335  17.102 1.00 146.92 ? 128 DC  T "O3'" 1 
ATOM   48   C  "C2'" . DC  A 1 3   ? -60.210 38.679  18.858 1.00 148.36 ? 128 DC  T "C2'" 1 
ATOM   49   C  "C1'" . DC  A 1 3   ? -60.022 40.167  18.619 1.00 148.80 ? 128 DC  T "C1'" 1 
ATOM   50   N  N1    . DC  A 1 3   ? -59.005 40.800  19.475 1.00 149.18 ? 128 DC  T N1    1 
ATOM   51   C  C2    . DC  A 1 3   ? -57.956 41.505  18.868 1.00 149.48 ? 128 DC  T C2    1 
ATOM   52   O  O2    . DC  A 1 3   ? -57.920 41.585  17.630 1.00 149.52 ? 128 DC  T O2    1 
ATOM   53   N  N3    . DC  A 1 3   ? -57.009 42.080  19.645 1.00 149.56 ? 128 DC  T N3    1 
ATOM   54   C  C4    . DC  A 1 3   ? -57.081 41.972  20.973 1.00 149.45 ? 128 DC  T C4    1 
ATOM   55   N  N4    . DC  A 1 3   ? -56.121 42.554  21.699 1.00 149.52 ? 128 DC  T N4    1 
ATOM   56   C  C5    . DC  A 1 3   ? -58.139 41.264  21.617 1.00 149.38 ? 128 DC  T C5    1 
ATOM   57   C  C6    . DC  A 1 3   ? -59.072 40.700  20.837 1.00 149.21 ? 128 DC  T C6    1 
ATOM   58   P  P     . DG  A 1 4   ? -61.812 36.869  16.451 1.00 146.16 ? 127 DG  T P     1 
ATOM   59   O  OP1   . DG  A 1 4   ? -63.196 36.511  16.047 1.00 146.26 ? 127 DG  T OP1   1 
ATOM   60   O  OP2   . DG  A 1 4   ? -61.060 35.973  17.367 1.00 146.13 ? 127 DG  T OP2   1 
ATOM   61   O  "O5'" . DG  A 1 4   ? -60.947 37.062  15.130 1.00 145.27 ? 127 DG  T "O5'" 1 
ATOM   62   C  "C5'" . DG  A 1 4   ? -60.039 36.051  14.709 1.00 143.43 ? 127 DG  T "C5'" 1 
ATOM   63   C  "C4'" . DG  A 1 4   ? -59.168 36.563  13.588 1.00 142.10 ? 127 DG  T "C4'" 1 
ATOM   64   O  "O4'" . DG  A 1 4   ? -58.526 37.783  14.035 1.00 141.87 ? 127 DG  T "O4'" 1 
ATOM   65   C  "C3'" . DG  A 1 4   ? -58.027 35.602  13.267 1.00 141.29 ? 127 DG  T "C3'" 1 
ATOM   66   O  "O3'" . DG  A 1 4   ? -57.641 35.671  11.893 1.00 149.71 ? 127 DG  T "O3'" 1 
ATOM   67   C  "C2'" . DG  A 1 4   ? -56.926 36.054  14.206 1.00 141.58 ? 127 DG  T "C2'" 1 
ATOM   68   C  "C1'" . DG  A 1 4   ? -57.141 37.559  14.279 1.00 141.69 ? 127 DG  T "C1'" 1 
ATOM   69   N  N9    . DG  A 1 4   ? -56.818 38.122  15.587 1.00 141.54 ? 127 DG  T N9    1 
ATOM   70   C  C8    . DG  A 1 4   ? -57.593 38.076  16.720 1.00 141.46 ? 127 DG  T C8    1 
ATOM   71   N  N7    . DG  A 1 4   ? -57.028 38.644  17.751 1.00 141.54 ? 127 DG  T N7    1 
ATOM   72   C  C5    . DG  A 1 4   ? -55.808 39.098  17.269 1.00 141.60 ? 127 DG  T C5    1 
ATOM   73   C  C6    . DG  A 1 4   ? -54.756 39.793  17.929 1.00 141.59 ? 127 DG  T C6    1 
ATOM   74   O  O6    . DG  A 1 4   ? -54.689 40.156  19.109 1.00 141.55 ? 127 DG  T O6    1 
ATOM   75   N  N1    . DG  A 1 4   ? -53.701 40.061  17.065 1.00 141.64 ? 127 DG  T N1    1 
ATOM   76   C  C2    . DG  A 1 4   ? -53.657 39.709  15.741 1.00 141.73 ? 127 DG  T C2    1 
ATOM   77   N  N2    . DG  A 1 4   ? -52.546 40.060  15.076 1.00 141.94 ? 127 DG  T N2    1 
ATOM   78   N  N3    . DG  A 1 4   ? -54.627 39.061  15.114 1.00 141.72 ? 127 DG  T N3    1 
ATOM   79   C  C4    . DG  A 1 4   ? -55.665 38.789  15.933 1.00 141.63 ? 127 DG  T C4    1 
ATOM   80   P  P     . DT  A 1 5   ? -56.864 34.432  11.227 1.00 148.54 ? 126 DT  T P     1 
ATOM   81   O  OP1   . DT  A 1 5   ? -57.284 34.356  9.805  1.00 148.60 ? 126 DT  T OP1   1 
ATOM   82   O  OP2   . DT  A 1 5   ? -57.026 33.244  12.104 1.00 148.60 ? 126 DT  T OP2   1 
ATOM   83   O  "O5'" . DT  A 1 5   ? -55.336 34.878  11.265 1.00 147.23 ? 126 DT  T "O5'" 1 
ATOM   84   C  "C5'" . DT  A 1 5   ? -54.874 35.922  10.415 1.00 145.12 ? 126 DT  T "C5'" 1 
ATOM   85   C  "C4'" . DT  A 1 5   ? -53.365 35.996  10.427 1.00 143.71 ? 126 DT  T "C4'" 1 
ATOM   86   O  "O4'" . DT  A 1 5   ? -52.915 36.479  11.716 1.00 143.45 ? 126 DT  T "O4'" 1 
ATOM   87   C  "C3'" . DT  A 1 5   ? -52.698 34.633  10.259 1.00 142.69 ? 126 DT  T "C3'" 1 
ATOM   88   O  "O3'" . DT  A 1 5   ? -51.422 34.803  9.633  1.00 141.34 ? 126 DT  T "O3'" 1 
ATOM   89   C  "C2'" . DT  A 1 5   ? -52.570 34.143  11.691 1.00 142.62 ? 126 DT  T "C2'" 1 
ATOM   90   C  "C1'" . DT  A 1 5   ? -52.268 35.436  12.434 1.00 142.95 ? 126 DT  T "C1'" 1 
ATOM   91   N  N1    . DT  A 1 5   ? -52.692 35.510  13.847 1.00 142.83 ? 126 DT  T N1    1 
ATOM   92   C  C2    . DT  A 1 5   ? -52.012 36.376  14.680 1.00 142.75 ? 126 DT  T C2    1 
ATOM   93   O  O2    . DT  A 1 5   ? -51.089 37.077  14.303 1.00 142.52 ? 126 DT  T O2    1 
ATOM   94   N  N3    . DT  A 1 5   ? -52.456 36.390  15.978 1.00 142.84 ? 126 DT  T N3    1 
ATOM   95   C  C4    . DT  A 1 5   ? -53.485 35.642  16.516 1.00 143.10 ? 126 DT  T C4    1 
ATOM   96   O  O4    . DT  A 1 5   ? -53.772 35.761  17.704 1.00 143.14 ? 126 DT  T O4    1 
ATOM   97   C  C5    . DT  A 1 5   ? -54.152 34.754  15.589 1.00 143.16 ? 126 DT  T C5    1 
ATOM   98   C  C7    . DT  A 1 5   ? -55.276 33.901  16.086 1.00 143.29 ? 126 DT  T C7    1 
ATOM   99   C  C6    . DT  A 1 5   ? -53.730 34.735  14.318 1.00 143.05 ? 126 DT  T C6    1 
ATOM   100  P  P     . DG  A 1 6   ? -50.524 33.519  9.277  1.00 140.28 ? 125 DG  T P     1 
ATOM   101  O  OP1   . DG  A 1 6   ? -50.155 33.607  7.841  1.00 140.47 ? 125 DG  T OP1   1 
ATOM   102  O  OP2   . DG  A 1 6   ? -51.207 32.303  9.787  1.00 140.52 ? 125 DG  T OP2   1 
ATOM   103  O  "O5'" . DG  A 1 6   ? -49.203 33.753  10.132 1.00 138.90 ? 125 DG  T "O5'" 1 
ATOM   104  C  "C5'" . DG  A 1 6   ? -49.285 34.286  11.449 1.00 136.35 ? 125 DG  T "C5'" 1 
ATOM   105  C  "C4'" . DG  A 1 6   ? -47.904 34.514  12.011 1.00 134.37 ? 125 DG  T "C4'" 1 
ATOM   106  O  "O4'" . DG  A 1 6   ? -48.053 35.026  13.355 1.00 134.40 ? 125 DG  T "O4'" 1 
ATOM   107  C  "C3'" . DG  A 1 6   ? -47.091 33.235  12.161 1.00 132.82 ? 125 DG  T "C3'" 1 
ATOM   108  O  "O3'" . DG  A 1 6   ? -45.695 33.522  12.069 1.00 139.71 ? 125 DG  T "O3'" 1 
ATOM   109  C  "C2'" . DG  A 1 6   ? -47.490 32.739  13.537 1.00 133.46 ? 125 DG  T "C2'" 1 
ATOM   110  C  "C1'" . DG  A 1 6   ? -47.709 34.029  14.313 1.00 134.48 ? 125 DG  T "C1'" 1 
ATOM   111  N  N9    . DG  A 1 6   ? -48.815 33.936  15.260 1.00 135.16 ? 125 DG  T N9    1 
ATOM   112  C  C8    . DG  A 1 6   ? -50.088 33.498  14.988 1.00 135.44 ? 125 DG  T C8    1 
ATOM   113  N  N7    . DG  A 1 6   ? -50.872 33.520  16.031 1.00 135.75 ? 125 DG  T N7    1 
ATOM   114  C  C5    . DG  A 1 6   ? -50.069 34.004  17.054 1.00 135.88 ? 125 DG  T C5    1 
ATOM   115  C  C6    . DG  A 1 6   ? -50.371 34.246  18.417 1.00 136.20 ? 125 DG  T C6    1 
ATOM   116  O  O6    . DG  A 1 6   ? -51.443 34.077  19.012 1.00 136.30 ? 125 DG  T O6    1 
ATOM   117  N  N1    . DG  A 1 6   ? -49.266 34.735  19.105 1.00 136.53 ? 125 DG  T N1    1 
ATOM   118  C  C2    . DG  A 1 6   ? -48.028 34.963  18.554 1.00 136.52 ? 125 DG  T C2    1 
ATOM   119  N  N2    . DG  A 1 6   ? -47.090 35.439  19.389 1.00 136.73 ? 125 DG  T N2    1 
ATOM   120  N  N3    . DG  A 1 6   ? -47.734 34.742  17.282 1.00 136.15 ? 125 DG  T N3    1 
ATOM   121  C  C4    . DG  A 1 6   ? -48.795 34.266  16.595 1.00 135.68 ? 125 DG  T C4    1 
ATOM   122  P  P     . DC  A 1 7   ? -44.627 32.435  12.572 1.00 137.41 ? 124 DC  T P     1 
ATOM   123  O  OP1   . DC  A 1 7   ? -43.330 32.756  11.925 1.00 137.59 ? 124 DC  T OP1   1 
ATOM   124  O  OP2   . DC  A 1 7   ? -45.217 31.081  12.406 1.00 137.27 ? 124 DC  T OP2   1 
ATOM   125  O  "O5'" . DC  A 1 7   ? -44.493 32.747  14.129 1.00 134.91 ? 124 DC  T "O5'" 1 
ATOM   126  C  "C5'" . DC  A 1 7   ? -43.964 33.996  14.571 1.00 130.32 ? 124 DC  T "C5'" 1 
ATOM   127  C  "C4'" . DC  A 1 7   ? -43.213 33.822  15.871 1.00 127.28 ? 124 DC  T "C4'" 1 
ATOM   128  O  "O4'" . DC  A 1 7   ? -44.162 33.698  16.960 1.00 126.65 ? 124 DC  T "O4'" 1 
ATOM   129  C  "C3'" . DC  A 1 7   ? -42.391 32.536  15.907 1.00 125.11 ? 124 DC  T "C3'" 1 
ATOM   130  O  "O3'" . DC  A 1 7   ? -41.216 32.694  16.707 1.00 121.55 ? 124 DC  T "O3'" 1 
ATOM   131  C  "C2'" . DC  A 1 7   ? -43.369 31.525  16.477 1.00 135.23 ? 124 DC  T "C2'" 1 
ATOM   132  C  "C1'" . DC  A 1 7   ? -44.179 32.364  17.459 1.00 125.75 ? 124 DC  T "C1'" 1 
ATOM   133  N  N1    . DC  A 1 7   ? -45.585 31.944  17.600 1.00 135.55 ? 124 DC  T N1    1 
ATOM   134  C  C2    . DC  A 1 7   ? -46.209 32.037  18.856 1.00 135.43 ? 124 DC  T C2    1 
ATOM   135  O  O2    . DC  A 1 7   ? -45.570 32.483  19.820 1.00 135.42 ? 124 DC  T O2    1 
ATOM   136  N  N3    . DC  A 1 7   ? -47.495 31.637  18.986 1.00 135.43 ? 124 DC  T N3    1 
ATOM   137  C  C4    . DC  A 1 7   ? -48.155 31.161  17.928 1.00 135.73 ? 124 DC  T C4    1 
ATOM   138  N  N4    . DC  A 1 7   ? -49.421 30.774  18.101 1.00 135.77 ? 124 DC  T N4    1 
ATOM   139  C  C5    . DC  A 1 7   ? -47.547 31.060  16.642 1.00 135.72 ? 124 DC  T C5    1 
ATOM   140  C  C6    . DC  A 1 7   ? -46.275 31.460  16.524 1.00 135.54 ? 124 DC  T C6    1 
ATOM   141  P  P     . DG  A 1 8   ? -40.474 31.397  17.297 1.00 128.86 ? 123 DG  T P     1 
ATOM   142  O  OP1   . DG  A 1 8   ? -39.066 31.749  17.613 1.00 128.93 ? 123 DG  T OP1   1 
ATOM   143  O  OP2   . DG  A 1 8   ? -40.759 30.251  16.396 1.00 128.76 ? 123 DG  T OP2   1 
ATOM   144  O  "O5'" . DG  A 1 8   ? -41.236 31.168  18.673 1.00 126.50 ? 123 DG  T "O5'" 1 
ATOM   145  C  "C5'" . DG  A 1 8   ? -41.427 32.261  19.565 1.00 141.64 ? 123 DG  T "C5'" 1 
ATOM   146  C  "C4'" . DG  A 1 8   ? -41.374 31.786  20.997 1.00 118.24 ? 123 DG  T "C4'" 1 
ATOM   147  O  "O4'" . DG  A 1 8   ? -42.656 31.225  21.365 1.00 117.91 ? 123 DG  T "O4'" 1 
ATOM   148  C  "C3'" . DG  A 1 8   ? -40.365 30.666  21.225 1.00 115.46 ? 123 DG  T "C3'" 1 
ATOM   149  O  "O3'" . DG  A 1 8   ? -39.829 30.752  22.549 1.00 110.43 ? 123 DG  T "O3'" 1 
ATOM   150  C  "C2'" . DG  A 1 8   ? -41.187 29.415  20.964 1.00 116.10 ? 123 DG  T "C2'" 1 
ATOM   151  C  "C1'" . DG  A 1 8   ? -42.571 29.809  21.478 1.00 117.33 ? 123 DG  T "C1'" 1 
ATOM   152  N  N9    . DG  A 1 8   ? -43.693 29.246  20.731 1.00 127.60 ? 123 DG  T N9    1 
ATOM   153  C  C8    . DG  A 1 8   ? -43.698 28.855  19.414 1.00 117.54 ? 123 DG  T C8    1 
ATOM   154  N  N7    . DG  A 1 8   ? -44.860 28.416  19.014 1.00 117.57 ? 123 DG  T N7    1 
ATOM   155  C  C5    . DG  A 1 8   ? -45.671 28.516  20.135 1.00 117.79 ? 123 DG  T C5    1 
ATOM   156  C  C6    . DG  A 1 8   ? -47.040 28.189  20.310 1.00 128.17 ? 123 DG  T C6    1 
ATOM   157  O  O6    . DG  A 1 8   ? -47.835 27.732  19.482 1.00 128.21 ? 123 DG  T O6    1 
ATOM   158  N  N1    . DG  A 1 8   ? -47.466 28.445  21.608 1.00 128.86 ? 123 DG  T N1    1 
ATOM   159  C  C2    . DG  A 1 8   ? -46.680 28.952  22.613 1.00 128.88 ? 123 DG  T C2    1 
ATOM   160  N  N2    . DG  A 1 8   ? -47.285 29.125  23.803 1.00 129.16 ? 123 DG  T N2    1 
ATOM   161  N  N3    . DG  A 1 8   ? -45.401 29.264  22.463 1.00 128.54 ? 123 DG  T N3    1 
ATOM   162  C  C4    . DG  A 1 8   ? -44.966 29.022  21.207 1.00 127.92 ? 123 DG  T C4    1 
ATOM   163  P  P     . DC  A 1 9   ? -39.061 29.497  23.184 1.00 116.17 ? 122 DC  T P     1 
ATOM   164  O  OP1   . DC  A 1 9   ? -38.092 30.026  24.176 1.00 115.72 ? 122 DC  T OP1   1 
ATOM   165  O  OP2   . DC  A 1 9   ? -38.587 28.607  22.092 1.00 106.57 ? 122 DC  T OP2   1 
ATOM   166  O  "O5'" . DC  A 1 9   ? -40.220 28.748  23.970 1.00 102.73 ? 122 DC  T "O5'" 1 
ATOM   167  C  "C5'" . DC  A 1 9   ? -41.043 29.462  24.885 1.00 115.83 ? 122 DC  T "C5'" 1 
ATOM   168  C  "C4'" . DC  A 1 9   ? -41.775 28.496  25.783 1.00 111.08 ? 122 DC  T "C4'" 1 
ATOM   169  O  "O4'" . DC  A 1 9   ? -42.886 27.919  25.051 1.00 110.15 ? 122 DC  T "O4'" 1 
ATOM   170  C  "C3'" . DC  A 1 9   ? -40.885 27.315  26.164 1.00 107.99 ? 122 DC  T "C3'" 1 
ATOM   171  O  "O3'" . DC  A 1 9   ? -41.250 26.798  27.442 1.00 102.60 ? 122 DC  T "O3'" 1 
ATOM   172  C  "C2'" . DC  A 1 9   ? -41.154 26.317  25.055 1.00 108.44 ? 122 DC  T "C2'" 1 
ATOM   173  C  "C1'" . DC  A 1 9   ? -42.627 26.549  24.767 1.00 109.09 ? 122 DC  T "C1'" 1 
ATOM   174  N  N1    . DC  A 1 9   ? -43.028 26.278  23.380 1.00 108.94 ? 122 DC  T N1    1 
ATOM   175  C  C2    . DC  A 1 9   ? -44.325 25.828  23.130 1.00 108.96 ? 122 DC  T C2    1 
ATOM   176  O  O2    . DC  A 1 9   ? -45.113 25.703  24.078 1.00 108.98 ? 122 DC  T O2    1 
ATOM   177  N  N3    . DC  A 1 9   ? -44.691 25.539  21.864 1.00 109.21 ? 122 DC  T N3    1 
ATOM   178  C  C4    . DC  A 1 9   ? -43.819 25.689  20.869 1.00 109.55 ? 122 DC  T C4    1 
ATOM   179  N  N4    . DC  A 1 9   ? -44.226 25.384  19.634 1.00 110.88 ? 122 DC  T N4    1 
ATOM   180  C  C5    . DC  A 1 9   ? -42.493 26.159  21.093 1.00 109.39 ? 122 DC  T C5    1 
ATOM   181  C  C6    . DC  A 1 9   ? -42.144 26.443  22.351 1.00 108.69 ? 122 DC  T C6    1 
ATOM   182  P  P     . DA  A 1 10  ? -40.512 25.495  28.020 1.00 97.19  ? 121 DA  T P     1 
ATOM   183  O  OP1   . DA  A 1 10  ? -39.720 25.891  29.213 1.00 98.46  ? 121 DA  T OP1   1 
ATOM   184  O  OP2   . DA  A 1 10  ? -39.845 24.765  26.909 1.00 97.07  ? 121 DA  T OP2   1 
ATOM   185  O  "O5'" . DA  A 1 10  ? -41.730 24.608  28.512 1.00 91.15  ? 121 DA  T "O5'" 1 
ATOM   186  C  "C5'" . DA  A 1 10  ? -41.613 23.207  28.557 1.00 84.35  ? 121 DA  T "C5'" 1 
ATOM   187  C  "C4'" . DA  A 1 10  ? -42.979 22.572  28.580 1.00 79.52  ? 121 DA  T "C4'" 1 
ATOM   188  O  "O4'" . DA  A 1 10  ? -43.625 22.814  27.308 1.00 79.76  ? 121 DA  T "O4'" 1 
ATOM   189  C  "C3'" . DA  A 1 10  ? -42.851 21.061  28.673 1.00 77.06  ? 121 DA  T "C3'" 1 
ATOM   190  O  "O3'" . DA  A 1 10  ? -43.944 20.493  29.357 1.00 70.20  ? 121 DA  T "O3'" 1 
ATOM   191  C  "C2'" . DA  A 1 10  ? -42.781 20.611  27.232 1.00 78.15  ? 121 DA  T "C2'" 1 
ATOM   192  C  "C1'" . DA  A 1 10  ? -43.693 21.606  26.550 1.00 80.54  ? 121 DA  T "C1'" 1 
ATOM   193  N  N9    . DA  A 1 10  ? -43.264 21.899  25.188 1.00 81.69  ? 121 DA  T N9    1 
ATOM   194  C  C8    . DA  A 1 10  ? -41.978 22.075  24.751 1.00 83.05  ? 121 DA  T C8    1 
ATOM   195  N  N7    . DA  A 1 10  ? -41.884 22.307  23.468 1.00 84.88  ? 121 DA  T N7    1 
ATOM   196  C  C5    . DA  A 1 10  ? -43.200 22.286  23.030 1.00 84.35  ? 121 DA  T C5    1 
ATOM   197  C  C6    . DA  A 1 10  ? -43.769 22.470  21.766 1.00 84.48  ? 121 DA  T C6    1 
ATOM   198  N  N6    . DA  A 1 10  ? -43.051 22.723  20.666 1.00 83.60  ? 121 DA  T N6    1 
ATOM   199  N  N1    . DA  A 1 10  ? -45.117 22.387  21.666 1.00 84.87  ? 121 DA  T N1    1 
ATOM   200  C  C2    . DA  A 1 10  ? -45.828 22.140  22.774 1.00 84.11  ? 121 DA  T C2    1 
ATOM   201  N  N3    . DA  A 1 10  ? -45.404 21.952  24.021 1.00 83.82  ? 121 DA  T N3    1 
ATOM   202  C  C4    . DA  A 1 10  ? -44.062 22.038  24.080 1.00 83.63  ? 121 DA  T C4    1 
ATOM   203  P  P     . DT  A 1 11  ? -43.651 19.468  30.533 1.00 65.16  ? 120 DT  T P     1 
ATOM   204  O  OP1   . DT  A 1 11  ? -42.417 18.740  30.165 1.00 65.42  ? 120 DT  T OP1   1 
ATOM   205  O  OP2   . DT  A 1 11  ? -44.906 18.714  30.783 1.00 67.87  ? 120 DT  T OP2   1 
ATOM   206  O  "O5'" . DT  A 1 11  ? -43.325 20.416  31.765 1.00 62.52  ? 120 DT  T "O5'" 1 
ATOM   207  C  "C5'" . DT  A 1 11  ? -44.365 21.093  32.475 1.00 57.25  ? 120 DT  T "C5'" 1 
ATOM   208  C  "C4'" . DT  A 1 11  ? -43.828 21.638  33.778 1.00 54.32  ? 120 DT  T "C4'" 1 
ATOM   209  O  "O4'" . DT  A 1 11  ? -43.761 20.543  34.740 1.00 52.37  ? 120 DT  T "O4'" 1 
ATOM   210  C  "C3'" . DT  A 1 11  ? -42.378 22.060  33.530 1.00 54.51  ? 120 DT  T "C3'" 1 
ATOM   211  O  "O3'" . DT  A 1 11  ? -41.879 23.113  34.336 1.00 54.70  ? 120 DT  T "O3'" 1 
ATOM   212  C  "C2'" . DT  A 1 11  ? -41.596 20.816  33.857 1.00 54.25  ? 120 DT  T "C2'" 1 
ATOM   213  C  "C1'" . DT  A 1 11  ? -42.399 20.236  35.004 1.00 52.46  ? 120 DT  T "C1'" 1 
ATOM   214  N  N1    . DT  A 1 11  ? -42.182 18.778  35.073 1.00 50.54  ? 120 DT  T N1    1 
ATOM   215  C  C2    . DT  A 1 11  ? -41.953 18.197  36.298 1.00 47.96  ? 120 DT  T C2    1 
ATOM   216  O  O2    . DT  A 1 11  ? -42.125 18.779  37.357 1.00 48.47  ? 120 DT  T O2    1 
ATOM   217  N  N3    . DT  A 1 11  ? -41.498 16.907  36.234 1.00 44.02  ? 120 DT  T N3    1 
ATOM   218  C  C4    . DT  A 1 11  ? -41.280 16.158  35.102 1.00 45.79  ? 120 DT  T C4    1 
ATOM   219  O  O4    . DT  A 1 11  ? -40.824 15.028  35.195 1.00 48.51  ? 120 DT  T O4    1 
ATOM   220  C  C5    . DT  A 1 11  ? -41.618 16.800  33.863 1.00 47.32  ? 120 DT  T C5    1 
ATOM   221  C  C7    . DT  A 1 11  ? -41.422 16.055  32.583 1.00 47.00  ? 120 DT  T C7    1 
ATOM   222  C  C6    . DT  A 1 11  ? -42.078 18.050  33.909 1.00 48.12  ? 120 DT  T C6    1 
ATOM   223  P  P     . DT  A 1 12  ? -40.295 23.398  34.334 1.00 53.21  ? 119 DT  T P     1 
ATOM   224  O  OP1   . DT  A 1 12  ? -40.073 24.857  34.268 1.00 56.00  ? 119 DT  T OP1   1 
ATOM   225  O  OP2   . DT  A 1 12  ? -39.641 22.512  33.341 1.00 48.59  ? 119 DT  T OP2   1 
ATOM   226  O  "O5'" . DT  A 1 12  ? -39.840 22.897  35.761 1.00 50.80  ? 119 DT  T "O5'" 1 
ATOM   227  C  "C5'" . DT  A 1 12  ? -40.596 23.208  36.916 1.00 50.08  ? 119 DT  T "C5'" 1 
ATOM   228  C  "C4'" . DT  A 1 12  ? -39.733 22.999  38.131 1.00 50.40  ? 119 DT  T "C4'" 1 
ATOM   229  O  "O4'" . DT  A 1 12  ? -39.731 21.575  38.462 1.00 48.00  ? 119 DT  T "O4'" 1 
ATOM   230  C  "C3'" . DT  A 1 12  ? -38.318 23.314  37.654 1.00 49.09  ? 119 DT  T "C3'" 1 
ATOM   231  O  "O3'" . DT  A 1 12  ? -37.442 23.809  38.637 1.00 50.56  ? 119 DT  T "O3'" 1 
ATOM   232  C  "C2'" . DT  A 1 12  ? -37.802 21.979  37.197 1.00 50.93  ? 119 DT  T "C2'" 1 
ATOM   233  C  "C1'" . DT  A 1 12  ? -38.448 21.041  38.197 1.00 48.16  ? 119 DT  T "C1'" 1 
ATOM   234  N  N1    . DT  A 1 12  ? -38.544 19.689  37.604 1.00 45.48  ? 119 DT  T N1    1 
ATOM   235  C  C2    . DT  A 1 12  ? -38.295 18.592  38.396 1.00 44.01  ? 119 DT  T C2    1 
ATOM   236  O  O2    . DT  A 1 12  ? -38.238 18.649  39.616 1.00 45.57  ? 119 DT  T O2    1 
ATOM   237  N  N3    . DT  A 1 12  ? -38.113 17.421  37.699 1.00 40.70  ? 119 DT  T N3    1 
ATOM   238  C  C4    . DT  A 1 12  ? -38.202 17.252  36.330 1.00 41.72  ? 119 DT  T C4    1 
ATOM   239  O  O4    . DT  A 1 12  ? -37.989 16.164  35.829 1.00 43.45  ? 119 DT  T O4    1 
ATOM   240  C  C5    . DT  A 1 12  ? -38.554 18.422  35.584 1.00 40.96  ? 119 DT  T C5    1 
ATOM   241  C  C7    . DT  A 1 12  ? -38.675 18.317  34.101 1.00 38.93  ? 119 DT  T C7    1 
ATOM   242  C  C6    . DT  A 1 12  ? -38.739 19.560  36.248 1.00 40.02  ? 119 DT  T C6    1 
ATOM   243  P  P     . DC  A 1 13  ? -35.880 23.919  38.293 1.00 44.88  ? 118 DC  T P     1 
ATOM   244  O  OP1   . DC  A 1 13  ? -35.468 25.318  38.532 1.00 46.40  ? 118 DC  T OP1   1 
ATOM   245  O  OP2   . DC  A 1 13  ? -35.607 23.296  36.979 1.00 44.06  ? 118 DC  T OP2   1 
ATOM   246  O  "O5'" . DC  A 1 13  ? -35.247 22.981  39.401 1.00 45.11  ? 118 DC  T "O5'" 1 
ATOM   247  C  "C5'" . DC  A 1 13  ? -35.895 22.805  40.661 1.00 46.75  ? 118 DC  T "C5'" 1 
ATOM   248  C  "C4'" . DC  A 1 13  ? -34.973 22.065  41.598 1.00 47.01  ? 118 DC  T "C4'" 1 
ATOM   249  O  "O4'" . DC  A 1 13  ? -35.193 20.629  41.427 1.00 44.15  ? 118 DC  T "O4'" 1 
ATOM   250  C  "C3'" . DC  A 1 13  ? -33.559 22.343  41.092 1.00 45.39  ? 118 DC  T "C3'" 1 
ATOM   251  O  "O3'" . DC  A 1 13  ? -32.534 22.363  42.051 1.00 46.09  ? 118 DC  T "O3'" 1 
ATOM   252  C  "C2'" . DC  A 1 13  ? -33.315 21.216  40.130 1.00 46.17  ? 118 DC  T "C2'" 1 
ATOM   253  C  "C1'" . DC  A 1 13  ? -34.073 20.068  40.770 1.00 43.63  ? 118 DC  T "C1'" 1 
ATOM   254  N  N1    . DC  A 1 13  ? -34.502 19.172  39.690 1.00 41.72  ? 118 DC  T N1    1 
ATOM   255  C  C2    . DC  A 1 13  ? -34.290 17.819  39.849 1.00 38.28  ? 118 DC  T C2    1 
ATOM   256  O  O2    . DC  A 1 13  ? -34.031 17.405  40.980 1.00 36.44  ? 118 DC  T O2    1 
ATOM   257  N  N3    . DC  A 1 13  ? -34.382 17.002  38.774 1.00 36.32  ? 118 DC  T N3    1 
ATOM   258  C  C4    . DC  A 1 13  ? -34.750 17.502  37.587 1.00 39.97  ? 118 DC  T C4    1 
ATOM   259  N  N4    . DC  A 1 13  ? -34.807 16.669  36.542 1.00 39.44  ? 118 DC  T N4    1 
ATOM   260  C  C5    . DC  A 1 13  ? -35.081 18.879  37.422 1.00 39.80  ? 118 DC  T C5    1 
ATOM   261  C  C6    . DC  A 1 13  ? -34.965 19.669  38.499 1.00 39.23  ? 118 DC  T C6    1 
ATOM   262  P  P     . DG  A 1 14  ? -31.019 22.612  41.565 1.00 46.01  ? 117 DG  T P     1 
ATOM   263  O  OP1   . DG  A 1 14  ? -30.624 23.977  42.005 1.00 45.48  ? 117 DG  T OP1   1 
ATOM   264  O  OP2   . DG  A 1 14  ? -30.820 22.218  40.161 1.00 43.38  ? 117 DG  T OP2   1 
ATOM   265  O  "O5'" . DG  A 1 14  ? -30.229 21.547  42.425 1.00 47.56  ? 117 DG  T "O5'" 1 
ATOM   266  C  "C5'" . DG  A 1 14  ? -30.739 20.239  42.589 1.00 50.87  ? 117 DG  T "C5'" 1 
ATOM   267  C  "C4'" . DG  A 1 14  ? -29.653 19.380  43.170 1.00 53.89  ? 117 DG  T "C4'" 1 
ATOM   268  O  "O4'" . DG  A 1 14  ? -29.947 18.024  42.743 1.00 56.49  ? 117 DG  T "O4'" 1 
ATOM   269  C  "C3'" . DG  A 1 14  ? -28.365 19.762  42.460 1.00 55.81  ? 117 DG  T "C3'" 1 
ATOM   270  O  "O3'" . DG  A 1 14  ? -27.165 19.811  43.192 1.00 57.50  ? 117 DG  T "O3'" 1 
ATOM   271  C  "C2'" . DG  A 1 14  ? -28.302 18.846  41.274 1.00 58.45  ? 117 DG  T "C2'" 1 
ATOM   272  C  "C1'" . DG  A 1 14  ? -29.048 17.606  41.724 1.00 55.95  ? 117 DG  T "C1'" 1 
ATOM   273  N  N9    . DG  A 1 14  ? -29.818 17.255  40.539 1.00 54.72  ? 117 DG  T N9    1 
ATOM   274  C  C8    . DG  A 1 14  ? -30.736 18.049  39.894 1.00 51.44  ? 117 DG  T C8    1 
ATOM   275  N  N7    . DG  A 1 14  ? -31.062 17.591  38.718 1.00 53.01  ? 117 DG  T N7    1 
ATOM   276  C  C5    . DG  A 1 14  ? -30.370 16.393  38.612 1.00 51.79  ? 117 DG  T C5    1 
ATOM   277  C  C6    . DG  A 1 14  ? -30.323 15.448  37.558 1.00 50.45  ? 117 DG  T C6    1 
ATOM   278  O  O6    . DG  A 1 14  ? -30.894 15.487  36.469 1.00 49.97  ? 117 DG  T O6    1 
ATOM   279  N  N1    . DG  A 1 14  ? -29.502 14.368  37.873 1.00 50.97  ? 117 DG  T N1    1 
ATOM   280  C  C2    . DG  A 1 14  ? -28.818 14.221  39.054 1.00 54.44  ? 117 DG  T C2    1 
ATOM   281  N  N2    . DG  A 1 14  ? -28.086 13.113  39.198 1.00 55.60  ? 117 DG  T N2    1 
ATOM   282  N  N3    . DG  A 1 14  ? -28.849 15.101  40.038 1.00 55.42  ? 117 DG  T N3    1 
ATOM   283  C  C4    . DG  A 1 14  ? -29.638 16.151  39.751 1.00 53.81  ? 117 DG  T C4    1 
ATOM   284  P  P     . DC  A 1 15  ? -25.856 20.373  42.456 1.00 55.69  ? 116 DC  T P     1 
ATOM   285  O  OP1   . DC  A 1 15  ? -24.915 20.880  43.480 1.00 57.11  ? 116 DC  T OP1   1 
ATOM   286  O  OP2   . DC  A 1 15  ? -26.303 21.264  41.362 1.00 53.41  ? 116 DC  T OP2   1 
ATOM   287  O  "O5'" . DC  A 1 15  ? -25.268 19.056  41.799 1.00 55.90  ? 116 DC  T "O5'" 1 
ATOM   288  C  "C5'" . DC  A 1 15  ? -25.294 17.835  42.527 1.00 62.90  ? 116 DC  T "C5'" 1 
ATOM   289  C  "C4'" . DC  A 1 15  ? -24.376 16.833  41.878 1.00 68.04  ? 116 DC  T "C4'" 1 
ATOM   290  O  "O4'" . DC  A 1 15  ? -25.106 16.132  40.834 1.00 69.81  ? 116 DC  T "O4'" 1 
ATOM   291  C  "C3'" . DC  A 1 15  ? -23.264 17.595  41.161 1.00 70.81  ? 116 DC  T "C3'" 1 
ATOM   292  O  "O3'" . DC  A 1 15  ? -22.062 16.856  41.088 1.00 74.22  ? 116 DC  T "O3'" 1 
ATOM   293  C  "C2'" . DC  A 1 15  ? -23.836 17.811  39.781 1.00 71.77  ? 116 DC  T "C2'" 1 
ATOM   294  C  "C1'" . DC  A 1 15  ? -24.605 16.526  39.566 1.00 70.78  ? 116 DC  T "C1'" 1 
ATOM   295  N  N1    . DC  A 1 15  ? -25.714 16.669  38.607 1.00 71.29  ? 116 DC  T N1    1 
ATOM   296  C  C2    . DC  A 1 15  ? -26.125 15.553  37.896 1.00 69.32  ? 116 DC  T C2    1 
ATOM   297  O  O2    . DC  A 1 15  ? -25.659 14.452  38.204 1.00 68.96  ? 116 DC  T O2    1 
ATOM   298  N  N3    . DC  A 1 15  ? -27.013 15.703  36.889 1.00 68.85  ? 116 DC  T N3    1 
ATOM   299  C  C4    . DC  A 1 15  ? -27.498 16.913  36.602 1.00 70.49  ? 116 DC  T C4    1 
ATOM   300  N  N4    . DC  A 1 15  ? -28.331 17.026  35.566 1.00 71.80  ? 116 DC  T N4    1 
ATOM   301  C  C5    . DC  A 1 15  ? -27.146 18.062  37.359 1.00 70.34  ? 116 DC  T C5    1 
ATOM   302  C  C6    . DC  A 1 15  ? -26.272 17.895  38.355 1.00 70.88  ? 116 DC  T C6    1 
ATOM   303  P  P     . DC  A 1 16  ? -20.933 17.286  40.037 1.00 76.75  ? 115 DC  T P     1 
ATOM   304  O  OP1   . DC  A 1 16  ? -19.682 17.406  40.821 1.00 78.55  ? 115 DC  T OP1   1 
ATOM   305  O  OP2   . DC  A 1 16  ? -21.377 18.425  39.215 1.00 77.25  ? 115 DC  T OP2   1 
ATOM   306  O  "O5'" . DC  A 1 16  ? -20.858 16.003  39.100 1.00 83.96  ? 115 DC  T "O5'" 1 
ATOM   307  C  "C5'" . DC  A 1 16  ? -20.923 14.697  39.673 1.00 94.89  ? 115 DC  T "C5'" 1 
ATOM   308  C  "C4'" . DC  A 1 16  ? -20.344 13.676  38.724 1.00 93.75  ? 115 DC  T "C4'" 1 
ATOM   309  O  "O4'" . DC  A 1 16  ? -21.310 13.414  37.680 1.00 95.87  ? 115 DC  T "O4'" 1 
ATOM   310  C  "C3'" . DC  A 1 16  ? -19.107 14.215  38.008 1.00 99.51  ? 115 DC  T "C3'" 1 
ATOM   311  O  "O3'" . DC  A 1 16  ? -18.201 13.173  37.643 1.00 96.92  ? 115 DC  T "O3'" 1 
ATOM   312  C  "C2'" . DC  A 1 16  ? -19.689 14.884  36.781 1.00 99.67  ? 115 DC  T "C2'" 1 
ATOM   313  C  "C1'" . DC  A 1 16  ? -20.860 13.972  36.451 1.00 99.12  ? 115 DC  T "C1'" 1 
ATOM   314  N  N1    . DC  A 1 16  ? -21.985 14.666  35.815 1.00 90.29  ? 115 DC  T N1    1 
ATOM   315  C  C2    . DC  A 1 16  ? -22.326 14.310  34.515 1.00 90.46  ? 115 DC  T C2    1 
ATOM   316  O  O2    . DC  A 1 16  ? -21.689 13.396  33.963 1.00 91.28  ? 115 DC  T O2    1 
ATOM   317  N  N3    . DC  A 1 16  ? -23.332 14.964  33.893 1.00 90.55  ? 115 DC  T N3    1 
ATOM   318  C  C4    . DC  A 1 16  ? -23.988 15.937  34.529 1.00 91.02  ? 115 DC  T C4    1 
ATOM   319  N  N4    . DC  A 1 16  ? -24.968 16.560  33.873 1.00 92.47  ? 115 DC  T N4    1 
ATOM   320  C  C5    . DC  A 1 16  ? -23.668 16.312  35.865 1.00 90.59  ? 115 DC  T C5    1 
ATOM   321  C  C6    . DC  A 1 16  ? -22.672 15.653  36.467 1.00 90.44  ? 115 DC  T C6    1 
ATOM   322  P  P     . DG  A 1 17  ? -16.825 13.545  36.902 1.00 92.32  ? 114 DG  T P     1 
ATOM   323  O  OP1   . DG  A 1 17  ? -15.718 12.862  37.621 1.00 91.19  ? 114 DG  T OP1   1 
ATOM   324  O  OP2   . DG  A 1 17  ? -16.783 15.018  36.713 1.00 91.67  ? 114 DG  T OP2   1 
ATOM   325  O  "O5'" . DG  A 1 17  ? -16.994 12.897  35.459 1.00 97.19  ? 114 DG  T "O5'" 1 
ATOM   326  C  "C5'" . DG  A 1 17  ? -17.220 11.500  35.314 1.00 106.01 ? 114 DG  T "C5'" 1 
ATOM   327  C  "C4'" . DG  A 1 17  ? -17.066 11.094  33.868 1.00 102.74 ? 114 DG  T "C4'" 1 
ATOM   328  O  "O4'" . DG  A 1 17  ? -18.174 11.642  33.109 1.00 104.42 ? 114 DG  T "O4'" 1 
ATOM   329  C  "C3'" . DG  A 1 17  ? -15.810 11.702  33.240 1.00 106.72 ? 114 DG  T "C3'" 1 
ATOM   330  O  "O3'" . DG  A 1 17  ? -15.300 10.863  32.197 1.00 111.64 ? 114 DG  T "O3'" 1 
ATOM   331  C  "C2'" . DG  A 1 17  ? -16.307 13.032  32.708 1.00 107.09 ? 114 DG  T "C2'" 1 
ATOM   332  C  "C1'" . DG  A 1 17  ? -17.711 12.678  32.249 1.00 106.78 ? 114 DG  T "C1'" 1 
ATOM   333  N  N9    . DG  A 1 17  ? -18.667 13.781  32.280 1.00 108.10 ? 114 DG  T N9    1 
ATOM   334  C  C8    . DG  A 1 17  ? -18.662 14.860  33.132 1.00 108.83 ? 114 DG  T C8    1 
ATOM   335  N  N7    . DG  A 1 17  ? -19.621 15.712  32.885 1.00 109.26 ? 114 DG  T N7    1 
ATOM   336  C  C5    . DG  A 1 17  ? -20.309 15.159  31.813 1.00 109.04 ? 114 DG  T C5    1 
ATOM   337  C  C6    . DG  A 1 17  ? -21.448 15.634  31.107 1.00 108.90 ? 114 DG  T C6    1 
ATOM   338  O  O6    . DG  A 1 17  ? -22.094 16.674  31.295 1.00 108.86 ? 114 DG  T O6    1 
ATOM   339  N  N1    . DG  A 1 17  ? -21.820 14.758  30.090 1.00 108.82 ? 114 DG  T N1    1 
ATOM   340  C  C2    . DG  A 1 17  ? -21.182 13.577  29.787 1.00 108.72 ? 114 DG  T C2    1 
ATOM   341  N  N2    . DG  A 1 17  ? -21.696 12.868  28.767 1.00 107.59 ? 114 DG  T N2    1 
ATOM   342  N  N3    . DG  A 1 17  ? -20.119 13.125  30.437 1.00 108.86 ? 114 DG  T N3    1 
ATOM   343  C  C4    . DG  A 1 17  ? -19.740 13.961  31.432 1.00 108.82 ? 114 DG  T C4    1 
ATOM   344  P  P     . DT  A 1 18  ? -14.412 11.503  31.017 1.00 115.54 ? 113 DT  T P     1 
ATOM   345  O  OP1   . DT  A 1 18  ? -13.519 10.429  30.507 1.00 115.57 ? 113 DT  T OP1   1 
ATOM   346  O  OP2   . DT  A 1 18  ? -13.820 12.778  31.499 1.00 115.20 ? 113 DT  T OP2   1 
ATOM   347  O  "O5'" . DT  A 1 18  ? -15.490 11.829  29.889 1.00 118.59 ? 113 DT  T "O5'" 1 
ATOM   348  C  "C5'" . DT  A 1 18  ? -16.491 10.867  29.553 1.00 133.76 ? 113 DT  T "C5'" 1 
ATOM   349  C  "C4'" . DT  A 1 18  ? -16.965 11.056  28.130 1.00 137.51 ? 113 DT  T "C4'" 1 
ATOM   350  O  "O4'" . DT  A 1 18  ? -17.899 12.160  28.055 1.00 138.40 ? 113 DT  T "O4'" 1 
ATOM   351  C  "C3'" . DT  A 1 18  ? -15.828 11.432  27.184 1.00 139.85 ? 113 DT  T "C3'" 1 
ATOM   352  O  "O3'" . DT  A 1 18  ? -16.133 10.975  25.864 1.00 123.28 ? 113 DT  T "O3'" 1 
ATOM   353  C  "C2'" . DT  A 1 18  ? -15.818 12.949  27.259 1.00 139.73 ? 113 DT  T "C2'" 1 
ATOM   354  C  "C1'" . DT  A 1 18  ? -17.305 13.250  27.361 1.00 139.69 ? 113 DT  T "C1'" 1 
ATOM   355  N  N1    . DT  A 1 18  ? -17.704 14.504  28.031 1.00 120.58 ? 113 DT  T N1    1 
ATOM   356  C  C2    . DT  A 1 18  ? -18.808 15.160  27.529 1.00 121.13 ? 113 DT  T C2    1 
ATOM   357  O  O2    . DT  A 1 18  ? -19.441 14.752  26.569 1.00 121.45 ? 113 DT  T O2    1 
ATOM   358  N  N3    . DT  A 1 18  ? -19.145 16.314  28.194 1.00 121.46 ? 113 DT  T N3    1 
ATOM   359  C  C4    . DT  A 1 18  ? -18.498 16.865  29.284 1.00 121.42 ? 113 DT  T C4    1 
ATOM   360  O  O4    . DT  A 1 18  ? -18.918 17.908  29.779 1.00 121.80 ? 113 DT  T O4    1 
ATOM   361  C  C5    . DT  A 1 18  ? -17.343 16.127  29.755 1.00 121.11 ? 113 DT  T C5    1 
ATOM   362  C  C7    . DT  A 1 18  ? -16.578 16.649  30.929 1.00 121.16 ? 113 DT  T C7    1 
ATOM   363  C  C6    . DT  A 1 18  ? -17.008 14.999  29.113 1.00 120.76 ? 113 DT  T C6    1 
ATOM   364  P  P     . DG  A 1 19  ? -14.958 10.821  24.781 1.00 125.75 ? 112 DG  T P     1 
ATOM   365  O  OP1   . DG  A 1 19  ? -15.082 9.461   24.196 1.00 125.69 ? 112 DG  T OP1   1 
ATOM   366  O  OP2   . DG  A 1 19  ? -13.681 11.235  25.418 1.00 125.74 ? 112 DG  T OP2   1 
ATOM   367  O  "O5'" . DG  A 1 19  ? -15.332 11.890  23.658 1.00 127.57 ? 112 DG  T "O5'" 1 
ATOM   368  C  "C5'" . DG  A 1 19  ? -16.119 13.037  23.977 1.00 140.48 ? 112 DG  T "C5'" 1 
ATOM   369  C  "C4'" . DG  A 1 19  ? -16.445 13.818  22.725 1.00 142.49 ? 112 DG  T "C4'" 1 
ATOM   370  O  "O4'" . DG  A 1 19  ? -17.350 14.886  23.083 1.00 142.96 ? 112 DG  T "O4'" 1 
ATOM   371  C  "C3'" . DG  A 1 19  ? -15.235 14.511  22.108 1.00 143.87 ? 112 DG  T "C3'" 1 
ATOM   372  O  "O3'" . DG  A 1 19  ? -15.434 14.699  20.704 1.00 145.96 ? 112 DG  T "O3'" 1 
ATOM   373  C  "C2'" . DG  A 1 19  ? -15.203 15.841  22.836 1.00 143.75 ? 112 DG  T "C2'" 1 
ATOM   374  C  "C1'" . DG  A 1 19  ? -16.681 16.141  23.035 1.00 143.60 ? 112 DG  T "C1'" 1 
ATOM   375  N  N9    . DG  A 1 19  ? -16.983 16.848  24.274 1.00 134.06 ? 112 DG  T N9    1 
ATOM   376  C  C8    . DG  A 1 19  ? -16.429 16.626  25.511 1.00 144.21 ? 112 DG  T C8    1 
ATOM   377  N  N7    . DG  A 1 19  ? -16.900 17.420  26.434 1.00 134.46 ? 112 DG  T N7    1 
ATOM   378  C  C5    . DG  A 1 19  ? -17.822 18.214  25.766 1.00 134.48 ? 112 DG  T C5    1 
ATOM   379  C  C6    . DG  A 1 19  ? -18.653 19.261  26.245 1.00 134.57 ? 112 DG  T C6    1 
ATOM   380  O  O6    . DG  A 1 19  ? -18.742 19.711  27.395 1.00 134.25 ? 112 DG  T O6    1 
ATOM   381  N  N1    . DG  A 1 19  ? -19.437 19.796  25.227 1.00 134.71 ? 112 DG  T N1    1 
ATOM   382  C  C2    . DG  A 1 19  ? -19.425 19.381  23.917 1.00 134.63 ? 112 DG  T C2    1 
ATOM   383  N  N2    . DG  A 1 19  ? -20.255 20.024  23.083 1.00 134.62 ? 112 DG  T N2    1 
ATOM   384  N  N3    . DG  A 1 19  ? -18.655 18.407  23.459 1.00 134.54 ? 112 DG  T N3    1 
ATOM   385  C  C4    . DG  A 1 19  ? -17.885 17.872  24.431 1.00 134.39 ? 112 DG  T C4    1 
ATOM   386  P  P     . DT  A 1 20  ? -14.163 14.837  19.731 1.00 147.70 ? 111 DT  T P     1 
ATOM   387  O  OP1   . DT  A 1 20  ? -12.952 14.946  20.585 1.00 147.77 ? 111 DT  T OP1   1 
ATOM   388  O  OP2   . DT  A 1 20  ? -14.452 15.893  18.729 1.00 147.87 ? 111 DT  T OP2   1 
ATOM   389  O  "O5'" . DT  A 1 20  ? -14.107 13.439  18.973 1.00 148.93 ? 111 DT  T "O5'" 1 
ATOM   390  C  "C5'" . DT  A 1 20  ? -14.265 12.216  19.684 1.00 141.10 ? 111 DT  T "C5'" 1 
ATOM   391  C  "C4'" . DT  A 1 20  ? -13.610 11.090  18.921 1.00 142.63 ? 111 DT  T "C4'" 1 
ATOM   392  O  "O4'" . DT  A 1 20  ? -13.830 9.861   19.652 1.00 143.25 ? 111 DT  T "O4'" 1 
ATOM   393  C  "C3'" . DT  A 1 20  ? -14.244 10.861  17.554 1.00 143.46 ? 111 DT  T "C3'" 1 
ATOM   394  O  "O3'" . DT  A 1 20  ? -13.291 10.323  16.634 1.00 144.49 ? 111 DT  T "O3'" 1 
ATOM   395  C  "C2'" . DT  A 1 20  ? -15.365 9.888   17.857 1.00 143.76 ? 111 DT  T "C2'" 1 
ATOM   396  C  "C1'" . DT  A 1 20  ? -14.780 9.041   18.979 1.00 143.95 ? 111 DT  T "C1'" 1 
ATOM   397  N  N1    . DT  A 1 20  ? -15.780 8.607   19.971 1.00 144.46 ? 111 DT  T N1    1 
ATOM   398  C  C2    . DT  A 1 20  ? -15.726 7.314   20.446 1.00 144.68 ? 111 DT  T C2    1 
ATOM   399  O  O2    . DT  A 1 20  ? -14.886 6.505   20.088 1.00 144.69 ? 111 DT  T O2    1 
ATOM   400  N  N3    . DT  A 1 20  ? -16.700 7.002   21.362 1.00 144.92 ? 111 DT  T N3    1 
ATOM   401  C  C4    . DT  A 1 20  ? -17.697 7.833   21.837 1.00 145.22 ? 111 DT  T C4    1 
ATOM   402  O  O4    . DT  A 1 20  ? -18.505 7.411   22.661 1.00 145.50 ? 111 DT  T O4    1 
ATOM   403  C  C5    . DT  A 1 20  ? -17.692 9.174   21.296 1.00 145.12 ? 111 DT  T C5    1 
ATOM   404  C  C7    . DT  A 1 20  ? -18.735 10.146  21.748 1.00 145.09 ? 111 DT  T C7    1 
ATOM   405  C  C6    . DT  A 1 20  ? -16.746 9.487   20.405 1.00 144.76 ? 111 DT  T C6    1 
ATOM   406  P  P     . DT  A 1 21  ? -13.642 10.275  15.068 1.00 145.30 ? 110 DT  T P     1 
ATOM   407  O  OP1   . DT  A 1 21  ? -12.377 10.114  14.304 1.00 145.26 ? 110 DT  T OP1   1 
ATOM   408  O  OP2   . DT  A 1 21  ? -14.525 11.435  14.786 1.00 145.14 ? 110 DT  T OP2   1 
ATOM   409  O  "O5'" . DT  A 1 21  ? -14.501 8.939   14.915 1.00 145.36 ? 110 DT  T "O5'" 1 
ATOM   410  C  "C5'" . DT  A 1 21  ? -13.867 7.659   14.828 1.00 145.16 ? 110 DT  T "C5'" 1 
ATOM   411  C  "C4'" . DT  A 1 21  ? -14.875 6.556   15.059 1.00 144.87 ? 110 DT  T "C4'" 1 
ATOM   412  O  "O4'" . DT  A 1 21  ? -14.254 5.284   14.755 1.00 144.72 ? 110 DT  T "O4'" 1 
ATOM   413  C  "C3'" . DT  A 1 21  ? -15.334 6.438   16.511 1.00 144.69 ? 110 DT  T "C3'" 1 
ATOM   414  O  "O3'" . DT  A 1 21  ? -16.563 5.708   16.576 1.00 144.42 ? 110 DT  T "O3'" 1 
ATOM   415  C  "C2'" . DT  A 1 21  ? -14.287 5.517   17.109 1.00 144.50 ? 110 DT  T "C2'" 1 
ATOM   416  C  "C1'" . DT  A 1 21  ? -14.010 4.561   15.955 1.00 144.32 ? 110 DT  T "C1'" 1 
ATOM   417  N  N1    . DT  A 1 21  ? -12.636 4.031   15.895 1.00 143.88 ? 110 DT  T N1    1 
ATOM   418  C  C2    . DT  A 1 21  ? -12.467 2.671   16.016 1.00 143.64 ? 110 DT  T C2    1 
ATOM   419  O  O2    . DT  A 1 21  ? -13.398 1.896   16.170 1.00 143.48 ? 110 DT  T O2    1 
ATOM   420  N  N3    . DT  A 1 21  ? -11.161 2.248   15.949 1.00 143.37 ? 110 DT  T N3    1 
ATOM   421  C  C4    . DT  A 1 21  ? -10.037 3.031   15.776 1.00 143.24 ? 110 DT  T C4    1 
ATOM   422  O  O4    . DT  A 1 21  ? -8.926  2.508   15.733 1.00 142.59 ? 110 DT  T O4    1 
ATOM   423  C  C5    . DT  A 1 21  ? -10.288 4.450   15.656 1.00 143.41 ? 110 DT  T C5    1 
ATOM   424  C  C7    . DT  A 1 21  ? -9.131  5.379   15.466 1.00 143.51 ? 110 DT  T C7    1 
ATOM   425  C  C6    . DT  A 1 21  ? -11.558 4.873   15.722 1.00 143.65 ? 110 DT  T C6    1 
ATOM   426  O  "O5'" . DT  B 2 1   ? -12.589 6.826   5.246  1.00 148.63 ? 14  DT  N "O5'" 1 
ATOM   427  C  "C5'" . DT  B 2 1   ? -11.761 7.353   6.286  1.00 148.68 ? 14  DT  N "C5'" 1 
ATOM   428  C  "C4'" . DT  B 2 1   ? -12.370 7.149   7.654  1.00 148.78 ? 14  DT  N "C4'" 1 
ATOM   429  O  "O4'" . DT  B 2 1   ? -11.493 7.740   8.640  1.00 148.79 ? 14  DT  N "O4'" 1 
ATOM   430  C  "C3'" . DT  B 2 1   ? -13.707 7.863   7.829  1.00 148.82 ? 14  DT  N "C3'" 1 
ATOM   431  O  "O3'" . DT  B 2 1   ? -14.513 7.184   8.800  1.00 149.00 ? 14  DT  N "O3'" 1 
ATOM   432  C  "C2'" . DT  B 2 1   ? -13.290 9.239   8.313  1.00 148.77 ? 14  DT  N "C2'" 1 
ATOM   433  C  "C1'" . DT  B 2 1   ? -12.070 8.928   9.170  1.00 148.75 ? 14  DT  N "C1'" 1 
ATOM   434  N  N1    . DT  B 2 1   ? -11.026 9.970   9.170  1.00 148.84 ? 14  DT  N N1    1 
ATOM   435  C  C2    . DT  B 2 1   ? -10.717 10.585  10.364 1.00 148.88 ? 14  DT  N C2    1 
ATOM   436  O  O2    . DT  B 2 1   ? -11.270 10.312  11.418 1.00 148.76 ? 14  DT  N O2    1 
ATOM   437  N  N3    . DT  B 2 1   ? -9.730  11.536  10.279 1.00 148.89 ? 14  DT  N N3    1 
ATOM   438  C  C4    . DT  B 2 1   ? -9.039  11.925  9.146  1.00 148.87 ? 14  DT  N C4    1 
ATOM   439  O  O4    . DT  B 2 1   ? -8.175  12.795  9.225  1.00 148.54 ? 14  DT  N O4    1 
ATOM   440  C  C5    . DT  B 2 1   ? -9.417  11.241  7.930  1.00 148.90 ? 14  DT  N C5    1 
ATOM   441  C  C7    . DT  B 2 1   ? -8.724  11.595  6.652  1.00 148.95 ? 14  DT  N C7    1 
ATOM   442  C  C6    . DT  B 2 1   ? -10.379 10.311  8.002  1.00 148.87 ? 14  DT  N C6    1 
ATOM   443  P  P     . DT  B 2 2   ? -15.814 6.368   8.324  1.00 149.08 ? 15  DT  N P     1 
ATOM   444  O  OP1   . DT  B 2 2   ? -15.357 5.025   7.884  1.00 149.04 ? 15  DT  N OP1   1 
ATOM   445  O  OP2   . DT  B 2 2   ? -16.577 7.227   7.384  1.00 149.06 ? 15  DT  N OP2   1 
ATOM   446  O  "O5'" . DT  B 2 2   ? -16.675 6.187   9.654  1.00 149.38 ? 15  DT  N "O5'" 1 
ATOM   447  C  "C5'" . DT  B 2 2   ? -17.526 5.050   9.831  1.00 149.69 ? 15  DT  N "C5'" 1 
ATOM   448  C  "C4'" . DT  B 2 2   ? -18.978 5.470   9.787  1.00 149.80 ? 15  DT  N "C4'" 1 
ATOM   449  O  "O4'" . DT  B 2 2   ? -19.195 6.195   8.555  1.00 149.94 ? 15  DT  N "O4'" 1 
ATOM   450  C  "C3'" . DT  B 2 2   ? -19.956 4.298   9.740  1.00 149.78 ? 15  DT  N "C3'" 1 
ATOM   451  O  "O3'" . DT  B 2 2   ? -21.223 4.651   10.318 1.00 149.49 ? 15  DT  N "O3'" 1 
ATOM   452  C  "C2'" . DT  B 2 2   ? -20.070 4.018   8.253  1.00 149.95 ? 15  DT  N "C2'" 1 
ATOM   453  C  "C1'" . DT  B 2 2   ? -19.947 5.406   7.638  1.00 149.84 ? 15  DT  N "C1'" 1 
ATOM   454  N  N1    . DT  B 2 2   ? -19.232 5.426   6.349  1.00 149.63 ? 15  DT  N N1    1 
ATOM   455  C  C2    . DT  B 2 2   ? -19.846 6.013   5.268  1.00 149.54 ? 15  DT  N C2    1 
ATOM   456  O  O2    . DT  B 2 2   ? -20.957 6.513   5.321  1.00 149.33 ? 15  DT  N O2    1 
ATOM   457  N  N3    . DT  B 2 2   ? -19.105 5.993   4.112  1.00 149.62 ? 15  DT  N N3    1 
ATOM   458  C  C4    . DT  B 2 2   ? -17.842 5.457   3.937  1.00 149.58 ? 15  DT  N C4    1 
ATOM   459  O  O4    . DT  B 2 2   ? -17.300 5.515   2.838  1.00 149.71 ? 15  DT  N O4    1 
ATOM   460  C  C5    . DT  B 2 2   ? -17.261 4.855   5.114  1.00 149.50 ? 15  DT  N C5    1 
ATOM   461  C  C7    . DT  B 2 2   ? -15.896 4.249   5.022  1.00 149.41 ? 15  DT  N C7    1 
ATOM   462  C  C6    . DT  B 2 2   ? -17.976 4.869   6.245  1.00 149.50 ? 15  DT  N C6    1 
ATOM   463  P  P     . DT  B 2 3   ? -22.244 3.491   10.777 1.00 148.98 ? 16  DT  N P     1 
ATOM   464  O  OP1   . DT  B 2 3   ? -21.454 2.454   11.486 1.00 148.99 ? 16  DT  N OP1   1 
ATOM   465  O  OP2   . DT  B 2 3   ? -23.083 3.105   9.613  1.00 148.94 ? 16  DT  N OP2   1 
ATOM   466  O  "O5'" . DT  B 2 3   ? -23.190 4.199   11.844 1.00 148.48 ? 16  DT  N "O5'" 1 
ATOM   467  C  "C5'" . DT  B 2 3   ? -24.386 4.860   11.440 1.00 147.93 ? 16  DT  N "C5'" 1 
ATOM   468  C  "C4'" . DT  B 2 3   ? -25.504 4.540   12.405 1.00 147.63 ? 16  DT  N "C4'" 1 
ATOM   469  O  "O4'" . DT  B 2 3   ? -25.078 4.909   13.737 1.00 147.62 ? 16  DT  N "O4'" 1 
ATOM   470  C  "C3'" . DT  B 2 3   ? -26.769 5.353   12.151 1.00 147.51 ? 16  DT  N "C3'" 1 
ATOM   471  O  "O3'" . DT  B 2 3   ? -27.913 4.633   12.616 1.00 147.52 ? 16  DT  N "O3'" 1 
ATOM   472  C  "C2'" . DT  B 2 3   ? -26.532 6.605   12.972 1.00 147.47 ? 16  DT  N "C2'" 1 
ATOM   473  C  "C1'" . DT  B 2 3   ? -25.782 6.063   14.178 1.00 147.51 ? 16  DT  N "C1'" 1 
ATOM   474  N  N1    . DT  B 2 3   ? -24.803 6.995   14.759 1.00 147.48 ? 16  DT  N N1    1 
ATOM   475  C  C2    . DT  B 2 3   ? -25.051 7.492   16.016 1.00 147.46 ? 16  DT  N C2    1 
ATOM   476  O  O2    . DT  B 2 3   ? -26.036 7.191   16.668 1.00 147.40 ? 16  DT  N O2    1 
ATOM   477  N  N3    . DT  B 2 3   ? -24.098 8.359   16.486 1.00 147.56 ? 16  DT  N N3    1 
ATOM   478  C  C4    . DT  B 2 3   ? -22.950 8.768   15.839 1.00 147.74 ? 16  DT  N C4    1 
ATOM   479  O  O4    . DT  B 2 3   ? -22.186 9.557   16.387 1.00 147.72 ? 16  DT  N O4    1 
ATOM   480  C  C5    . DT  B 2 3   ? -22.752 8.205   14.523 1.00 147.84 ? 16  DT  N C5    1 
ATOM   481  C  C7    . DT  B 2 3   ? -21.534 8.589   13.744 1.00 148.11 ? 16  DT  N C7    1 
ATOM   482  C  C6    . DT  B 2 3   ? -23.676 7.357   14.056 1.00 147.71 ? 16  DT  N C6    1 
ATOM   483  P  P     . DA  B 2 4   ? -29.342 4.869   11.921 1.00 147.59 ? 17  DA  N P     1 
ATOM   484  O  OP1   . DA  B 2 4   ? -30.251 3.793   12.392 1.00 147.48 ? 17  DA  N OP1   1 
ATOM   485  O  OP2   . DA  B 2 4   ? -29.118 5.054   10.467 1.00 147.65 ? 17  DA  N OP2   1 
ATOM   486  O  "O5'" . DA  B 2 4   ? -29.851 6.251   12.528 1.00 148.05 ? 17  DA  N "O5'" 1 
ATOM   487  C  "C5'" . DA  B 2 4   ? -29.568 7.488   11.875 1.00 148.76 ? 17  DA  N "C5'" 1 
ATOM   488  C  "C4'" . DA  B 2 4   ? -30.642 8.503   12.191 1.00 149.25 ? 17  DA  N "C4'" 1 
ATOM   489  O  "O4'" . DA  B 2 4   ? -30.643 8.741   13.621 1.00 149.24 ? 17  DA  N "O4'" 1 
ATOM   490  C  "C3'" . DA  B 2 4   ? -30.364 9.867   11.562 1.00 149.54 ? 17  DA  N "C3'" 1 
ATOM   491  O  "O3'" . DA  B 2 4   ? -31.586 10.571  11.301 1.00 149.84 ? 17  DA  N "O3'" 1 
ATOM   492  C  "C2'" . DA  B 2 4   ? -29.524 10.563  12.614 1.00 149.63 ? 17  DA  N "C2'" 1 
ATOM   493  C  "C1'" . DA  B 2 4   ? -30.127 10.039  13.908 1.00 149.45 ? 17  DA  N "C1'" 1 
ATOM   494  N  N9    . DA  B 2 4   ? -29.180 9.922   15.018 1.00 149.30 ? 17  DA  N N9    1 
ATOM   495  C  C8    . DA  B 2 4   ? -27.906 9.411   14.995 1.00 149.23 ? 17  DA  N C8    1 
ATOM   496  N  N7    . DA  B 2 4   ? -27.300 9.449   16.156 1.00 149.04 ? 17  DA  N N7    1 
ATOM   497  C  C5    . DA  B 2 4   ? -28.237 10.022  17.003 1.00 149.06 ? 17  DA  N C5    1 
ATOM   498  C  C6    . DA  B 2 4   ? -28.208 10.336  18.374 1.00 148.94 ? 17  DA  N C6    1 
ATOM   499  N  N6    . DA  B 2 4   ? -27.157 10.107  19.163 1.00 148.95 ? 17  DA  N N6    1 
ATOM   500  N  N1    . DA  B 2 4   ? -29.310 10.902  18.913 1.00 148.81 ? 17  DA  N N1    1 
ATOM   501  C  C2    . DA  B 2 4   ? -30.363 11.131  18.120 1.00 148.86 ? 17  DA  N C2    1 
ATOM   502  N  N3    . DA  B 2 4   ? -30.512 10.880  16.821 1.00 149.03 ? 17  DA  N N3    1 
ATOM   503  C  C4    . DA  B 2 4   ? -29.400 10.319  16.316 1.00 149.15 ? 17  DA  N C4    1 
ATOM   504  P  P     . DC  B 2 5   ? -31.571 11.859  10.337 1.00 140.00 ? 18  DC  N P     1 
ATOM   505  O  OP1   . DC  B 2 5   ? -30.462 11.672  9.366  1.00 140.00 ? 18  DC  N OP1   1 
ATOM   506  O  OP2   . DC  B 2 5   ? -31.605 13.077  11.189 1.00 140.00 ? 18  DC  N OP2   1 
ATOM   507  O  "O5'" . DC  B 2 5   ? -32.948 11.772  9.541  1.00 149.60 ? 18  DC  N "O5'" 1 
ATOM   508  C  "C5'" . DC  B 2 5   ? -34.162 12.251  10.116 1.00 148.94 ? 18  DC  N "C5'" 1 
ATOM   509  C  "C4'" . DC  B 2 5   ? -35.329 11.435  9.612  1.00 148.72 ? 18  DC  N "C4'" 1 
ATOM   510  O  "O4'" . DC  B 2 5   ? -35.063 10.045  9.906  1.00 148.38 ? 18  DC  N "O4'" 1 
ATOM   511  C  "C3'" . DC  B 2 5   ? -36.642 11.752  10.320 1.00 148.92 ? 18  DC  N "C3'" 1 
ATOM   512  O  "O3'" . DC  B 2 5   ? -37.755 11.477  9.461  1.00 149.48 ? 18  DC  N "O3'" 1 
ATOM   513  C  "C2'" . DC  B 2 5   ? -36.610 10.821  11.516 1.00 148.65 ? 18  DC  N "C2'" 1 
ATOM   514  C  "C1'" . DC  B 2 5   ? -35.898 9.591   10.965 1.00 148.32 ? 18  DC  N "C1'" 1 
ATOM   515  N  N1    . DC  B 2 5   ? -35.042 8.897   11.942 1.00 147.95 ? 18  DC  N N1    1 
ATOM   516  C  C2    . DC  B 2 5   ? -34.804 7.528   11.777 1.00 147.63 ? 18  DC  N C2    1 
ATOM   517  O  O2    . DC  B 2 5   ? -35.318 6.941   10.813 1.00 147.36 ? 18  DC  N O2    1 
ATOM   518  N  N3    . DC  B 2 5   ? -34.020 6.882   12.670 1.00 147.30 ? 18  DC  N N3    1 
ATOM   519  C  C4    . DC  B 2 5   ? -33.483 7.550   13.693 1.00 147.20 ? 18  DC  N C4    1 
ATOM   520  N  N4    . DC  B 2 5   ? -32.716 6.873   14.548 1.00 146.84 ? 18  DC  N N4    1 
ATOM   521  C  C5    . DC  B 2 5   ? -33.707 8.944   13.884 1.00 147.39 ? 18  DC  N C5    1 
ATOM   522  C  C6    . DC  B 2 5   ? -34.485 9.572   12.994 1.00 147.73 ? 18  DC  N C6    1 
ATOM   523  P  P     . DG  B 2 6   ? -38.945 12.552  9.327  1.00 149.97 ? 19  DG  N P     1 
ATOM   524  O  OP1   . DG  B 2 6   ? -39.813 12.148  8.191  1.00 149.98 ? 19  DG  N OP1   1 
ATOM   525  O  OP2   . DG  B 2 6   ? -38.325 13.901  9.330  1.00 150.00 ? 19  DG  N OP2   1 
ATOM   526  O  "O5'" . DG  B 2 6   ? -39.782 12.387  10.675 1.00 150.00 ? 19  DG  N "O5'" 1 
ATOM   527  C  "C5'" . DG  B 2 6   ? -41.181 12.097  10.635 1.00 149.70 ? 19  DG  N "C5'" 1 
ATOM   528  C  "C4'" . DG  B 2 6   ? -41.857 12.547  11.911 1.00 149.41 ? 19  DG  N "C4'" 1 
ATOM   529  O  "O4'" . DG  B 2 6   ? -41.348 11.767  13.019 1.00 149.17 ? 19  DG  N "O4'" 1 
ATOM   530  C  "C3'" . DG  B 2 6   ? -41.562 13.999  12.278 1.00 149.38 ? 19  DG  N "C3'" 1 
ATOM   531  O  "O3'" . DG  B 2 6   ? -42.650 14.548  13.030 1.00 149.61 ? 19  DG  N "O3'" 1 
ATOM   532  C  "C2'" . DG  B 2 6   ? -40.296 13.884  13.108 1.00 149.06 ? 19  DG  N "C2'" 1 
ATOM   533  C  "C1'" . DG  B 2 6   ? -40.509 12.567  13.845 1.00 148.67 ? 19  DG  N "C1'" 1 
ATOM   534  N  N9    . DG  B 2 6   ? -39.292 11.805  14.112 1.00 147.96 ? 19  DG  N N9    1 
ATOM   535  C  C8    . DG  B 2 6   ? -38.010 12.290  14.205 1.00 147.76 ? 19  DG  N C8    1 
ATOM   536  N  N7    . DG  B 2 6   ? -37.129 11.363  14.462 1.00 147.50 ? 19  DG  N N7    1 
ATOM   537  C  C5    . DG  B 2 6   ? -37.873 10.195  14.541 1.00 147.38 ? 19  DG  N C5    1 
ATOM   538  C  C6    . DG  B 2 6   ? -37.464 8.862   14.796 1.00 147.21 ? 19  DG  N C6    1 
ATOM   539  O  O6    . DG  B 2 6   ? -36.326 8.433   15.013 1.00 147.03 ? 19  DG  N O6    1 
ATOM   540  N  N1    . DG  B 2 6   ? -38.544 7.986   14.786 1.00 147.08 ? 19  DG  N N1    1 
ATOM   541  C  C2    . DG  B 2 6   ? -39.850 8.344   14.560 1.00 147.18 ? 19  DG  N C2    1 
ATOM   542  N  N2    . DG  B 2 6   ? -40.749 7.351   14.591 1.00 146.99 ? 19  DG  N N2    1 
ATOM   543  N  N3    . DG  B 2 6   ? -40.244 9.583   14.321 1.00 147.36 ? 19  DG  N N3    1 
ATOM   544  C  C4    . DG  B 2 6   ? -39.210 10.451  14.327 1.00 147.58 ? 19  DG  N C4    1 
ATOM   545  P  P     . DT  B 2 7   ? -43.328 15.928  12.560 1.00 149.50 ? 20  DT  N P     1 
ATOM   546  O  OP1   . DT  B 2 7   ? -43.317 15.976  11.077 1.00 149.57 ? 20  DT  N OP1   1 
ATOM   547  O  OP2   . DT  B 2 7   ? -42.687 17.020  13.335 1.00 149.45 ? 20  DT  N OP2   1 
ATOM   548  O  "O5'" . DT  B 2 7   ? -44.840 15.796  13.044 1.00 149.39 ? 20  DT  N "O5'" 1 
ATOM   549  C  "C5'" . DT  B 2 7   ? -45.626 14.662  12.681 1.00 149.30 ? 20  DT  N "C5'" 1 
ATOM   550  C  "C4'" . DT  B 2 7   ? -46.731 14.445  13.690 1.00 149.31 ? 20  DT  N "C4'" 1 
ATOM   551  O  "O4'" . DT  B 2 7   ? -46.124 14.292  14.996 1.00 149.16 ? 20  DT  N "O4'" 1 
ATOM   552  C  "C3'" . DT  B 2 7   ? -47.674 15.637  13.829 1.00 149.38 ? 20  DT  N "C3'" 1 
ATOM   553  O  "O3'" . DT  B 2 7   ? -48.974 15.202  14.248 1.00 149.62 ? 20  DT  N "O3'" 1 
ATOM   554  C  "C2'" . DT  B 2 7   ? -46.995 16.487  14.884 1.00 149.23 ? 20  DT  N "C2'" 1 
ATOM   555  C  "C1'" . DT  B 2 7   ? -46.374 15.443  15.798 1.00 149.00 ? 20  DT  N "C1'" 1 
ATOM   556  N  N1    . DT  B 2 7   ? -45.098 15.863  16.403 1.00 148.77 ? 20  DT  N N1    1 
ATOM   557  C  C2    . DT  B 2 7   ? -45.148 16.676  17.511 1.00 148.67 ? 20  DT  N C2    1 
ATOM   558  O  O2    . DT  B 2 7   ? -46.193 17.053  18.013 1.00 148.49 ? 20  DT  N O2    1 
ATOM   559  N  N3    . DT  B 2 7   ? -43.922 17.033  18.014 1.00 148.73 ? 20  DT  N N3    1 
ATOM   560  C  C4    . DT  B 2 7   ? -42.681 16.663  17.532 1.00 148.77 ? 20  DT  N C4    1 
ATOM   561  O  O4    . DT  B 2 7   ? -41.663 17.060  18.092 1.00 148.75 ? 20  DT  N O4    1 
ATOM   562  C  C5    . DT  B 2 7   ? -42.703 15.808  16.370 1.00 148.79 ? 20  DT  N C5    1 
ATOM   563  C  C7    . DT  B 2 7   ? -41.404 15.359  15.778 1.00 148.64 ? 20  DT  N C7    1 
ATOM   564  C  C6    . DT  B 2 7   ? -43.894 15.454  15.870 1.00 148.85 ? 20  DT  N C6    1 
ATOM   565  P  P     . DT  B 2 8   ? -50.105 16.289  14.604 1.00 149.74 ? 21  DT  N P     1 
ATOM   566  O  OP1   . DT  B 2 8   ? -51.414 15.588  14.604 1.00 149.71 ? 21  DT  N OP1   1 
ATOM   567  O  OP2   . DT  B 2 8   ? -49.910 17.480  13.739 1.00 149.86 ? 21  DT  N OP2   1 
ATOM   568  O  "O5'" . DT  B 2 8   ? -49.773 16.698  16.107 1.00 149.64 ? 21  DT  N "O5'" 1 
ATOM   569  C  "C5'" . DT  B 2 8   ? -49.692 15.701  17.122 1.00 149.77 ? 21  DT  N "C5'" 1 
ATOM   570  C  "C4'" . DT  B 2 8   ? -50.162 16.253  18.448 1.00 149.92 ? 21  DT  N "C4'" 1 
ATOM   571  O  "O4'" . DT  B 2 8   ? -49.164 17.160  18.973 1.00 140.00 ? 21  DT  N "O4'" 1 
ATOM   572  C  "C3'" . DT  B 2 8   ? -51.432 17.089  18.318 1.00 149.83 ? 21  DT  N "C3'" 1 
ATOM   573  O  "O3'" . DT  B 2 8   ? -52.185 17.030  19.533 1.00 140.00 ? 21  DT  N "O3'" 1 
ATOM   574  C  "C2'" . DT  B 2 8   ? -50.893 18.483  18.052 1.00 149.88 ? 21  DT  N "C2'" 1 
ATOM   575  C  "C1'" . DT  B 2 8   ? -49.637 18.501  18.912 1.00 149.99 ? 21  DT  N "C1'" 1 
ATOM   576  N  N1    . DT  B 2 8   ? -48.536 19.359  18.434 1.00 149.93 ? 21  DT  N N1    1 
ATOM   577  C  C2    . DT  B 2 8   ? -48.085 20.350  19.277 1.00 149.82 ? 21  DT  N C2    1 
ATOM   578  O  O2    . DT  B 2 8   ? -48.555 20.545  20.386 1.00 149.90 ? 21  DT  N O2    1 
ATOM   579  N  N3    . DT  B 2 8   ? -47.058 21.108  18.773 1.00 149.60 ? 21  DT  N N3    1 
ATOM   580  C  C4    . DT  B 2 8   ? -46.452 20.977  17.539 1.00 149.61 ? 21  DT  N C4    1 
ATOM   581  O  O4    . DT  B 2 8   ? -45.538 21.734  17.224 1.00 149.49 ? 21  DT  N O4    1 
ATOM   582  C  C5    . DT  B 2 8   ? -46.973 19.919  16.705 1.00 149.71 ? 21  DT  N C5    1 
ATOM   583  C  C7    . DT  B 2 8   ? -46.376 19.703  15.350 1.00 149.66 ? 21  DT  N C7    1 
ATOM   584  C  C6    . DT  B 2 8   ? -47.977 19.172  17.187 1.00 149.87 ? 21  DT  N C6    1 
ATOM   585  P  P     . DG  B 2 9   ? -53.551 17.864  19.665 1.00 140.00 ? 22  DG  N P     1 
ATOM   586  O  OP1   . DG  B 2 9   ? -54.357 17.234  20.743 1.00 140.00 ? 22  DG  N OP1   1 
ATOM   587  O  OP2   . DG  B 2 9   ? -54.132 18.020  18.307 1.00 140.00 ? 22  DG  N OP2   1 
ATOM   588  O  "O5'" . DG  B 2 9   ? -53.070 19.292  20.177 1.00 149.93 ? 22  DG  N "O5'" 1 
ATOM   589  C  "C5'" . DG  B 2 9   ? -53.979 20.386  20.272 1.00 149.42 ? 22  DG  N "C5'" 1 
ATOM   590  C  "C4'" . DG  B 2 9   ? -53.767 21.118  21.576 1.00 149.02 ? 22  DG  N "C4'" 1 
ATOM   591  O  "O4'" . DG  B 2 9   ? -52.360 21.425  21.708 1.00 148.78 ? 22  DG  N "O4'" 1 
ATOM   592  C  "C3'" . DG  B 2 9   ? -54.476 22.468  21.622 1.00 148.84 ? 22  DG  N "C3'" 1 
ATOM   593  O  "O3'" . DG  B 2 9   ? -54.744 22.824  22.981 1.00 148.64 ? 22  DG  N "O3'" 1 
ATOM   594  C  "C2'" . DG  B 2 9   ? -53.447 23.403  21.016 1.00 148.77 ? 22  DG  N "C2'" 1 
ATOM   595  C  "C1'" . DG  B 2 9   ? -52.147 22.820  21.542 1.00 148.58 ? 22  DG  N "C1'" 1 
ATOM   596  N  N9    . DG  B 2 9   ? -50.982 22.998  20.683 1.00 148.39 ? 22  DG  N N9    1 
ATOM   597  C  C8    . DG  B 2 9   ? -50.818 22.558  19.392 1.00 148.11 ? 22  DG  N C8    1 
ATOM   598  N  N7    . DG  B 2 9   ? -49.648 22.856  18.895 1.00 148.17 ? 22  DG  N N7    1 
ATOM   599  C  C5    . DG  B 2 9   ? -49.004 23.538  19.920 1.00 148.23 ? 22  DG  N C5    1 
ATOM   600  C  C6    . DG  B 2 9   ? -47.701 24.108  19.975 1.00 148.01 ? 22  DG  N C6    1 
ATOM   601  O  O6    . DG  B 2 9   ? -46.827 24.124  19.102 1.00 147.67 ? 22  DG  N O6    1 
ATOM   602  N  N1    . DG  B 2 9   ? -47.458 24.706  21.207 1.00 147.96 ? 22  DG  N N1    1 
ATOM   603  C  C2    . DG  B 2 9   ? -48.345 24.751  22.253 1.00 148.08 ? 22  DG  N C2    1 
ATOM   604  N  N2    . DG  B 2 9   ? -47.922 25.374  23.362 1.00 148.01 ? 22  DG  N N2    1 
ATOM   605  N  N3    . DG  B 2 9   ? -49.557 24.224  22.215 1.00 148.26 ? 22  DG  N N3    1 
ATOM   606  C  C4    . DG  B 2 9   ? -49.817 23.638  21.027 1.00 148.39 ? 22  DG  N C4    1 
ATOM   607  P  P     . DC  B 2 10  ? -55.697 24.075  23.304 1.00 148.44 ? 23  DC  N P     1 
ATOM   608  O  OP1   . DC  B 2 10  ? -57.078 23.553  23.453 1.00 148.73 ? 23  DC  N OP1   1 
ATOM   609  O  OP2   . DC  B 2 10  ? -55.422 25.153  22.321 1.00 148.53 ? 23  DC  N OP2   1 
ATOM   610  O  "O5'" . DC  B 2 10  ? -55.205 24.573  24.733 1.00 147.97 ? 23  DC  N "O5'" 1 
ATOM   611  C  "C5'" . DC  B 2 10  ? -55.444 25.911  25.156 1.00 147.25 ? 23  DC  N "C5'" 1 
ATOM   612  C  "C4'" . DC  B 2 10  ? -54.406 26.329  26.170 1.00 146.74 ? 23  DC  N "C4'" 1 
ATOM   613  O  "O4'" . DC  B 2 10  ? -53.095 26.133  25.592 1.00 146.46 ? 23  DC  N "O4'" 1 
ATOM   614  C  "C3'" . DC  B 2 10  ? -54.471 27.811  26.514 1.00 146.58 ? 23  DC  N "C3'" 1 
ATOM   615  O  "O3'" . DC  B 2 10  ? -54.008 28.033  27.847 1.00 146.92 ? 23  DC  N "O3'" 1 
ATOM   616  C  "C2'" . DC  B 2 10  ? -53.571 28.442  25.468 1.00 146.30 ? 23  DC  N "C2'" 1 
ATOM   617  C  "C1'" . DC  B 2 10  ? -52.496 27.384  25.267 1.00 146.09 ? 23  DC  N "C1'" 1 
ATOM   618  N  N1    . DC  B 2 10  ? -52.006 27.289  23.883 1.00 145.74 ? 23  DC  N N1    1 
ATOM   619  C  C2    . DC  B 2 10  ? -50.791 27.900  23.541 1.00 145.61 ? 23  DC  N C2    1 
ATOM   620  O  O2    . DC  B 2 10  ? -50.153 28.511  24.411 1.00 145.49 ? 23  DC  N O2    1 
ATOM   621  N  N3    . DC  B 2 10  ? -50.342 27.806  22.268 1.00 145.56 ? 23  DC  N N3    1 
ATOM   622  C  C4    . DC  B 2 10  ? -51.055 27.140  21.358 1.00 145.51 ? 23  DC  N C4    1 
ATOM   623  N  N4    . DC  B 2 10  ? -50.575 27.073  20.115 1.00 145.49 ? 23  DC  N N4    1 
ATOM   624  C  C5    . DC  B 2 10  ? -52.292 26.512  21.680 1.00 145.55 ? 23  DC  N C5    1 
ATOM   625  C  C6    . DC  B 2 10  ? -52.726 26.611  22.941 1.00 145.56 ? 23  DC  N C6    1 
ATOM   626  P  P     . DG  B 2 11  ? -54.291 29.443  28.559 1.00 147.27 ? 24  DG  N P     1 
ATOM   627  O  OP1   . DG  B 2 11  ? -54.072 29.287  30.020 1.00 147.32 ? 24  DG  N OP1   1 
ATOM   628  O  OP2   . DG  B 2 11  ? -55.596 29.947  28.062 1.00 147.36 ? 24  DG  N OP2   1 
ATOM   629  O  "O5'" . DG  B 2 11  ? -53.143 30.378  27.979 1.00 147.33 ? 24  DG  N "O5'" 1 
ATOM   630  C  "C5'" . DG  B 2 11  ? -53.164 31.785  28.187 1.00 147.27 ? 24  DG  N "C5'" 1 
ATOM   631  C  "C4'" . DG  B 2 11  ? -51.753 32.298  28.340 1.00 147.27 ? 24  DG  N "C4'" 1 
ATOM   632  O  "O4'" . DG  B 2 11  ? -50.957 31.785  27.247 1.00 147.51 ? 24  DG  N "O4'" 1 
ATOM   633  C  "C3'" . DG  B 2 11  ? -51.644 33.813  28.237 1.00 147.13 ? 24  DG  N "C3'" 1 
ATOM   634  O  "O3'" . DG  B 2 11  ? -50.520 34.273  28.989 1.00 146.78 ? 24  DG  N "O3'" 1 
ATOM   635  C  "C2'" . DG  B 2 11  ? -51.471 34.033  26.747 1.00 147.42 ? 24  DG  N "C2'" 1 
ATOM   636  C  "C1'" . DG  B 2 11  ? -50.654 32.820  26.317 1.00 147.55 ? 24  DG  N "C1'" 1 
ATOM   637  N  N9    . DG  B 2 11  ? -50.977 32.319  24.984 1.00 147.63 ? 24  DG  N N9    1 
ATOM   638  C  C8    . DG  B 2 11  ? -52.205 31.882  24.551 1.00 147.63 ? 24  DG  N C8    1 
ATOM   639  N  N7    . DG  B 2 11  ? -52.198 31.475  23.311 1.00 147.56 ? 24  DG  N N7    1 
ATOM   640  C  C5    . DG  B 2 11  ? -50.886 31.656  22.896 1.00 147.75 ? 24  DG  N C5    1 
ATOM   641  C  C6    . DG  B 2 11  ? -50.277 31.391  21.642 1.00 147.94 ? 24  DG  N C6    1 
ATOM   642  O  O6    . DG  B 2 11  ? -50.789 30.927  20.620 1.00 148.37 ? 24  DG  N O6    1 
ATOM   643  N  N1    . DG  B 2 11  ? -48.928 31.723  21.648 1.00 147.90 ? 24  DG  N N1    1 
ATOM   644  C  C2    . DG  B 2 11  ? -48.248 32.242  22.718 1.00 147.82 ? 24  DG  N C2    1 
ATOM   645  N  N2    . DG  B 2 11  ? -46.945 32.496  22.512 1.00 147.90 ? 24  DG  N N2    1 
ATOM   646  N  N3    . DG  B 2 11  ? -48.803 32.495  23.897 1.00 147.79 ? 24  DG  N N3    1 
ATOM   647  C  C4    . DG  B 2 11  ? -50.117 32.179  23.914 1.00 147.72 ? 24  DG  N C4    1 
ATOM   648  P  P     . DC  B 2 12  ? -50.129 35.828  28.962 1.00 146.50 ? 25  DC  N P     1 
ATOM   649  O  OP1   . DC  B 2 12  ? -49.463 36.161  30.246 1.00 146.43 ? 25  DC  N OP1   1 
ATOM   650  O  OP2   . DC  B 2 12  ? -51.338 36.581  28.546 1.00 146.50 ? 25  DC  N OP2   1 
ATOM   651  O  "O5'" . DC  B 2 12  ? -49.047 35.920  27.796 1.00 146.90 ? 25  DC  N "O5'" 1 
ATOM   652  C  "C5'" . DC  B 2 12  ? -47.769 35.304  27.947 1.00 147.56 ? 25  DC  N "C5'" 1 
ATOM   653  C  "C4'" . DC  B 2 12  ? -46.781 35.875  26.956 1.00 148.09 ? 25  DC  N "C4'" 1 
ATOM   654  O  "O4'" . DC  B 2 12  ? -47.108 35.406  25.625 1.00 148.31 ? 25  DC  N "O4'" 1 
ATOM   655  C  "C3'" . DC  B 2 12  ? -46.852 37.398  26.870 1.00 148.40 ? 25  DC  N "C3'" 1 
ATOM   656  O  "O3'" . DC  B 2 12  ? -45.582 37.932  26.485 1.00 148.65 ? 25  DC  N "O3'" 1 
ATOM   657  C  "C2'" . DC  B 2 12  ? -47.899 37.626  25.797 1.00 148.64 ? 25  DC  N "C2'" 1 
ATOM   658  C  "C1'" . DC  B 2 12  ? -47.619 36.477  24.840 1.00 148.80 ? 25  DC  N "C1'" 1 
ATOM   659  N  N1    . DC  B 2 12  ? -48.776 35.983  24.076 1.00 149.13 ? 25  DC  N N1    1 
ATOM   660  C  C2    . DC  B 2 12  ? -48.573 35.531  22.768 1.00 149.26 ? 25  DC  N C2    1 
ATOM   661  O  O2    . DC  B 2 12  ? -47.425 35.557  22.295 1.00 149.20 ? 25  DC  N O2    1 
ATOM   662  N  N3    . DC  B 2 12  ? -49.629 35.077  22.053 1.00 149.35 ? 25  DC  N N3    1 
ATOM   663  C  C4    . DC  B 2 12  ? -50.849 35.067  22.598 1.00 149.28 ? 25  DC  N C4    1 
ATOM   664  N  N4    . DC  B 2 12  ? -51.862 34.610  21.859 1.00 149.29 ? 25  DC  N N4    1 
ATOM   665  C  C5    . DC  B 2 12  ? -51.083 35.523  23.927 1.00 149.23 ? 25  DC  N C5    1 
ATOM   666  C  C6    . DC  B 2 12  ? -50.029 35.967  24.624 1.00 149.26 ? 25  DC  N C6    1 
ATOM   667  P  P     . DA  B 2 13  ? -45.393 39.522  26.341 1.00 148.84 ? 26  DA  N P     1 
ATOM   668  O  OP1   . DA  B 2 13  ? -44.217 39.929  27.152 1.00 148.98 ? 26  DA  N OP1   1 
ATOM   669  O  OP2   . DA  B 2 13  ? -46.711 40.162  26.589 1.00 148.65 ? 26  DA  N OP2   1 
ATOM   670  O  "O5'" . DA  B 2 13  ? -45.033 39.716  24.802 1.00 149.01 ? 26  DA  N "O5'" 1 
ATOM   671  C  "C5'" . DA  B 2 13  ? -45.800 39.067  23.791 1.00 149.13 ? 26  DA  N "C5'" 1 
ATOM   672  C  "C4'" . DA  B 2 13  ? -45.220 39.350  22.426 1.00 149.10 ? 26  DA  N "C4'" 1 
ATOM   673  O  "O4'" . DA  B 2 13  ? -46.034 38.659  21.448 1.00 148.86 ? 26  DA  N "O4'" 1 
ATOM   674  C  "C3'" . DA  B 2 13  ? -45.294 40.824  22.039 1.00 149.34 ? 26  DA  N "C3'" 1 
ATOM   675  O  "O3'" . DA  B 2 13  ? -44.233 41.178  21.144 1.00 149.84 ? 26  DA  N "O3'" 1 
ATOM   676  C  "C2'" . DA  B 2 13  ? -46.662 40.936  21.394 1.00 149.18 ? 26  DA  N "C2'" 1 
ATOM   677  C  "C1'" . DA  B 2 13  ? -46.828 39.585  20.713 1.00 148.92 ? 26  DA  N "C1'" 1 
ATOM   678  N  N9    . DA  B 2 13  ? -48.208 39.100  20.725 1.00 148.87 ? 26  DA  N N9    1 
ATOM   679  C  C8    . DA  B 2 13  ? -49.042 38.992  21.811 1.00 148.83 ? 26  DA  N C8    1 
ATOM   680  N  N7    . DA  B 2 13  ? -50.237 38.542  21.517 1.00 148.94 ? 26  DA  N N7    1 
ATOM   681  C  C5    . DA  B 2 13  ? -50.188 38.335  20.145 1.00 149.07 ? 26  DA  N C5    1 
ATOM   682  C  C6    . DA  B 2 13  ? -51.145 37.866  19.223 1.00 149.11 ? 26  DA  N C6    1 
ATOM   683  N  N6    . DA  B 2 13  ? -52.385 37.509  19.561 1.00 149.02 ? 26  DA  N N6    1 
ATOM   684  N  N1    . DA  B 2 13  ? -50.777 37.776  17.925 1.00 149.13 ? 26  DA  N N1    1 
ATOM   685  C  C2    . DA  B 2 13  ? -49.531 38.138  17.588 1.00 149.15 ? 26  DA  N C2    1 
ATOM   686  N  N3    . DA  B 2 13  ? -48.545 38.595  18.362 1.00 149.18 ? 26  DA  N N3    1 
ATOM   687  C  C4    . DA  B 2 13  ? -48.943 38.671  19.644 1.00 149.05 ? 26  DA  N C4    1 
ATOM   688  P  P     . DC  B 2 14  ? -44.133 42.682  20.582 1.00 140.00 ? 27  DC  N P     1 
ATOM   689  O  OP1   . DC  B 2 14  ? -42.828 42.822  19.885 1.00 149.99 ? 27  DC  N OP1   1 
ATOM   690  O  OP2   . DC  B 2 14  ? -44.482 43.620  21.680 1.00 149.99 ? 27  DC  N OP2   1 
ATOM   691  O  "O5'" . DC  B 2 14  ? -45.288 42.738  19.486 1.00 149.86 ? 27  DC  N "O5'" 1 
ATOM   692  C  "C5'" . DC  B 2 14  ? -45.652 43.961  18.854 1.00 149.61 ? 27  DC  N "C5'" 1 
ATOM   693  C  "C4'" . DC  B 2 14  ? -45.967 43.707  17.400 1.00 149.60 ? 27  DC  N "C4'" 1 
ATOM   694  O  "O4'" . DC  B 2 14  ? -46.934 42.630  17.333 1.00 149.63 ? 27  DC  N "O4'" 1 
ATOM   695  C  "C3'" . DC  B 2 14  ? -46.639 44.886  16.706 1.00 149.65 ? 27  DC  N "C3'" 1 
ATOM   696  O  "O3'" . DC  B 2 14  ? -46.246 44.960  15.323 1.00 149.53 ? 27  DC  N "O3'" 1 
ATOM   697  C  "C2'" . DC  B 2 14  ? -48.113 44.647  16.969 1.00 149.71 ? 27  DC  N "C2'" 1 
ATOM   698  C  "C1'" . DC  B 2 14  ? -48.212 43.129  16.945 1.00 149.77 ? 27  DC  N "C1'" 1 
ATOM   699  N  N1    . DC  B 2 14  ? -49.221 42.575  17.862 1.00 149.75 ? 27  DC  N N1    1 
ATOM   700  C  C2    . DC  B 2 14  ? -50.343 41.931  17.323 1.00 149.77 ? 27  DC  N C2    1 
ATOM   701  O  O2    . DC  B 2 14  ? -50.451 41.837  16.090 1.00 149.65 ? 27  DC  N O2    1 
ATOM   702  N  N3    . DC  B 2 14  ? -51.281 41.428  18.158 1.00 149.86 ? 27  DC  N N3    1 
ATOM   703  C  C4    . DC  B 2 14  ? -51.131 41.547  19.479 1.00 149.84 ? 27  DC  N C4    1 
ATOM   704  N  N4    . DC  B 2 14  ? -52.085 41.035  20.262 1.00 149.96 ? 27  DC  N N4    1 
ATOM   705  C  C5    . DC  B 2 14  ? -49.998 42.196  20.054 1.00 149.78 ? 27  DC  N C5    1 
ATOM   706  C  C6    . DC  B 2 14  ? -49.076 42.690  19.217 1.00 149.69 ? 27  DC  N C6    1 
ATOM   707  P  P     . DG  B 2 15  ? -47.116 44.230  14.179 1.00 149.49 ? 28  DG  N P     1 
ATOM   708  O  OP1   . DG  B 2 15  ? -47.004 42.762  14.373 1.00 149.49 ? 28  DG  N OP1   1 
ATOM   709  O  OP2   . DG  B 2 15  ? -46.701 44.830  12.886 1.00 149.55 ? 28  DG  N OP2   1 
ATOM   710  O  "O5'" . DG  B 2 15  ? -48.629 44.655  14.443 1.00 149.55 ? 28  DG  N "O5'" 1 
ATOM   711  C  "C5'" . DG  B 2 15  ? -49.668 44.183  13.585 1.00 149.73 ? 28  DG  N "C5'" 1 
ATOM   712  C  "C4'" . DG  B 2 15  ? -50.743 45.234  13.424 1.00 149.90 ? 28  DG  N "C4'" 1 
ATOM   713  O  "O4'" . DG  B 2 15  ? -51.736 45.094  14.467 1.00 149.94 ? 28  DG  N "O4'" 1 
ATOM   714  C  "C3'" . DG  B 2 15  ? -50.184 46.647  13.583 1.00 149.96 ? 28  DG  N "C3'" 1 
ATOM   715  O  "O3'" . DG  B 2 15  ? -50.986 47.573  12.846 1.00 149.80 ? 28  DG  N "O3'" 1 
ATOM   716  C  "C2'" . DG  B 2 15  ? -50.326 46.889  15.076 1.00 140.00 ? 28  DG  N "C2'" 1 
ATOM   717  C  "C1'" . DG  B 2 15  ? -51.645 46.187  15.368 1.00 140.00 ? 28  DG  N "C1'" 1 
ATOM   718  N  N9    . DG  B 2 15  ? -51.864 45.689  16.724 1.00 140.00 ? 28  DG  N N9    1 
ATOM   719  C  C8    . DG  B 2 15  ? -51.131 45.974  17.851 1.00 149.98 ? 28  DG  N C8    1 
ATOM   720  N  N7    . DG  B 2 15  ? -51.603 45.401  18.927 1.00 149.97 ? 28  DG  N N7    1 
ATOM   721  C  C5    . DG  B 2 15  ? -52.709 44.689  18.481 1.00 140.00 ? 28  DG  N C5    1 
ATOM   722  C  C6    . DG  B 2 15  ? -53.629 43.869  19.193 1.00 140.00 ? 28  DG  N C6    1 
ATOM   723  O  O6    . DG  B 2 15  ? -53.652 43.602  20.401 1.00 140.00 ? 28  DG  N O6    1 
ATOM   724  N  N1    . DG  B 2 15  ? -54.599 43.337  18.349 1.00 140.00 ? 28  DG  N N1    1 
ATOM   725  C  C2    . DG  B 2 15  ? -54.680 43.561  16.997 1.00 149.97 ? 28  DG  N C2    1 
ATOM   726  N  N2    . DG  B 2 15  ? -55.692 42.954  16.358 1.00 149.77 ? 28  DG  N N2    1 
ATOM   727  N  N3    . DG  B 2 15  ? -53.833 44.322  16.322 1.00 149.94 ? 28  DG  N N3    1 
ATOM   728  C  C4    . DG  B 2 15  ? -52.879 44.850  17.122 1.00 140.00 ? 28  DG  N C4    1 
ATOM   729  P  P     . DG  B 2 16  ? -50.642 47.880  11.308 1.00 149.70 ? 29  DG  N P     1 
ATOM   730  O  OP1   . DG  B 2 16  ? -49.592 46.928  10.864 1.00 149.52 ? 29  DG  N OP1   1 
ATOM   731  O  OP2   . DG  B 2 16  ? -50.408 49.341  11.180 1.00 149.60 ? 29  DG  N OP2   1 
ATOM   732  O  "O5'" . DG  B 2 16  ? -51.997 47.516  10.552 1.00 140.00 ? 29  DG  N "O5'" 1 
ATOM   733  C  "C5'" . DG  B 2 16  ? -52.202 46.209  10.018 1.00 140.00 ? 29  DG  N "C5'" 1 
ATOM   734  C  "C4'" . DG  B 2 16  ? -53.678 45.898  9.901  1.00 140.00 ? 29  DG  N "C4'" 1 
ATOM   735  O  "O4'" . DG  B 2 16  ? -54.245 45.723  11.225 1.00 140.00 ? 29  DG  N "O4'" 1 
ATOM   736  C  "C3'" . DG  B 2 16  ? -54.489 47.027  9.269  1.00 149.93 ? 29  DG  N "C3'" 1 
ATOM   737  O  "O3'" . DG  B 2 16  ? -55.613 46.498  8.559  1.00 149.84 ? 29  DG  N "O3'" 1 
ATOM   738  C  "C2'" . DG  B 2 16  ? -54.895 47.866  10.468 1.00 140.00 ? 29  DG  N "C2'" 1 
ATOM   739  C  "C1'" . DG  B 2 16  ? -55.109 46.812  11.548 1.00 140.00 ? 29  DG  N "C1'" 1 
ATOM   740  N  N9    . DG  B 2 16  ? -54.794 47.262  12.903 1.00 140.00 ? 29  DG  N N9    1 
ATOM   741  C  C8    . DG  B 2 16  ? -53.849 48.196  13.254 1.00 140.00 ? 29  DG  N C8    1 
ATOM   742  N  N7    . DG  B 2 16  ? -53.793 48.413  14.539 1.00 140.00 ? 29  DG  N N7    1 
ATOM   743  C  C5    . DG  B 2 16  ? -54.756 47.570  15.075 1.00 140.00 ? 29  DG  N C5    1 
ATOM   744  C  C6    . DG  B 2 16  ? -55.149 47.369  16.425 1.00 140.00 ? 29  DG  N C6    1 
ATOM   745  O  O6    . DG  B 2 16  ? -54.710 47.914  17.447 1.00 140.00 ? 29  DG  N O6    1 
ATOM   746  N  N1    . DG  B 2 16  ? -56.163 46.424  16.527 1.00 149.88 ? 29  DG  N N1    1 
ATOM   747  C  C2    . DG  B 2 16  ? -56.728 45.755  15.472 1.00 149.60 ? 29  DG  N C2    1 
ATOM   748  N  N2    . DG  B 2 16  ? -57.696 44.880  15.790 1.00 149.44 ? 29  DG  N N2    1 
ATOM   749  N  N3    . DG  B 2 16  ? -56.372 45.932  14.204 1.00 149.64 ? 29  DG  N N3    1 
ATOM   750  C  C4    . DG  B 2 16  ? -55.385 46.849  14.081 1.00 149.91 ? 29  DG  N C4    1 
ATOM   751  P  P     . DC  B 2 17  ? -56.903 47.420  8.302  1.00 149.74 ? 30  DC  N P     1 
ATOM   752  O  OP1   . DC  B 2 17  ? -57.626 46.860  7.132  1.00 149.87 ? 30  DC  N OP1   1 
ATOM   753  O  OP2   . DC  B 2 17  ? -56.467 48.839  8.283  1.00 149.81 ? 30  DC  N OP2   1 
ATOM   754  O  "O5'" . DC  B 2 17  ? -57.786 47.176  9.606  1.00 149.55 ? 30  DC  N "O5'" 1 
ATOM   755  C  "C5'" . DC  B 2 17  ? -59.156 47.573  9.662  1.00 149.38 ? 30  DC  N "C5'" 1 
ATOM   756  C  "C4'" . DC  B 2 17  ? -59.904 46.711  10.653 1.00 149.14 ? 30  DC  N "C4'" 1 
ATOM   757  O  "O4'" . DC  B 2 17  ? -59.191 46.738  11.911 1.00 149.19 ? 30  DC  N "O4'" 1 
ATOM   758  C  "C3'" . DC  B 2 17  ? -61.309 47.209  10.979 1.00 149.01 ? 30  DC  N "C3'" 1 
ATOM   759  O  "O3'" . DC  B 2 17  ? -62.085 46.140  11.527 1.00 148.65 ? 30  DC  N "O3'" 1 
ATOM   760  C  "C2'" . DC  B 2 17  ? -61.051 48.186  12.112 1.00 148.95 ? 30  DC  N "C2'" 1 
ATOM   761  C  "C1'" . DC  B 2 17  ? -59.903 47.520  12.863 1.00 148.97 ? 30  DC  N "C1'" 1 
ATOM   762  N  N1    . DC  B 2 17  ? -58.946 48.454  13.480 1.00 148.74 ? 30  DC  N N1    1 
ATOM   763  C  C2    . DC  B 2 17  ? -59.050 48.722  14.847 1.00 148.68 ? 30  DC  N C2    1 
ATOM   764  O  O2    . DC  B 2 17  ? -59.949 48.170  15.500 1.00 148.74 ? 30  DC  N O2    1 
ATOM   765  N  N3    . DC  B 2 17  ? -58.172 49.575  15.422 1.00 148.60 ? 30  DC  N N3    1 
ATOM   766  C  C4    . DC  B 2 17  ? -57.220 50.150  14.686 1.00 148.49 ? 30  DC  N C4    1 
ATOM   767  N  N4    . DC  B 2 17  ? -56.376 50.982  15.300 1.00 148.48 ? 30  DC  N N4    1 
ATOM   768  C  C5    . DC  B 2 17  ? -57.091 49.896  13.290 1.00 148.51 ? 30  DC  N C5    1 
ATOM   769  C  C6    . DC  B 2 17  ? -57.968 49.050  12.733 1.00 148.64 ? 30  DC  N C6    1 
ATOM   770  O  "O5'" . A   C 3 1   ? -30.022 31.856  33.178 1.00 135.30 ? 10  A   R "O5'" 1 
ATOM   771  C  "C5'" . A   C 3 1   ? -29.886 30.494  32.760 1.00 135.34 ? 10  A   R "C5'" 1 
ATOM   772  C  "C4'" . A   C 3 1   ? -28.965 30.353  31.571 1.00 135.09 ? 10  A   R "C4'" 1 
ATOM   773  O  "O4'" . A   C 3 1   ? -27.640 30.819  31.936 1.00 135.45 ? 10  A   R "O4'" 1 
ATOM   774  C  "C3'" . A   C 3 1   ? -28.743 28.928  31.091 1.00 134.69 ? 10  A   R "C3'" 1 
ATOM   775  O  "O3'" . A   C 3 1   ? -29.785 28.550  30.194 1.00 133.32 ? 10  A   R "O3'" 1 
ATOM   776  C  "C2'" . A   C 3 1   ? -27.392 29.028  30.390 1.00 135.02 ? 10  A   R "C2'" 1 
ATOM   777  O  "O2'" . A   C 3 1   ? -27.485 29.537  29.075 1.00 134.98 ? 10  A   R "O2'" 1 
ATOM   778  C  "C1'" . A   C 3 1   ? -26.656 30.034  31.283 1.00 135.35 ? 10  A   R "C1'" 1 
ATOM   779  N  N9    . A   C 3 1   ? -25.800 29.425  32.303 1.00 135.56 ? 10  A   R N9    1 
ATOM   780  C  C8    . A   C 3 1   ? -24.919 28.383  32.148 1.00 135.42 ? 10  A   R C8    1 
ATOM   781  N  N7    . A   C 3 1   ? -24.268 28.074  33.242 1.00 135.57 ? 10  A   R N7    1 
ATOM   782  C  C5    . A   C 3 1   ? -24.755 28.969  34.185 1.00 135.79 ? 10  A   R C5    1 
ATOM   783  C  C6    . A   C 3 1   ? -24.466 29.159  35.549 1.00 135.99 ? 10  A   R C6    1 
ATOM   784  N  N6    . A   C 3 1   ? -23.575 28.430  36.227 1.00 136.08 ? 10  A   R N6    1 
ATOM   785  N  N1    . A   C 3 1   ? -25.131 30.138  36.202 1.00 135.83 ? 10  A   R N1    1 
ATOM   786  C  C2    . A   C 3 1   ? -26.021 30.869  35.523 1.00 135.49 ? 10  A   R C2    1 
ATOM   787  N  N3    . A   C 3 1   ? -26.379 30.788  34.243 1.00 135.60 ? 10  A   R N3    1 
ATOM   788  C  C4    . A   C 3 1   ? -25.701 29.806  33.621 1.00 135.68 ? 10  A   R C4    1 
ATOM   789  P  P     . C   C 3 2   ? -30.215 27.006  30.072 1.00 132.14 ? 9   C   R P     1 
ATOM   790  O  OP1   . C   C 3 2   ? -31.697 26.973  29.975 1.00 131.94 ? 9   C   R OP1   1 
ATOM   791  O  OP2   . C   C 3 2   ? -29.533 26.240  31.147 1.00 132.00 ? 9   C   R OP2   1 
ATOM   792  O  "O5'" . C   C 3 2   ? -29.614 26.558  28.663 1.00 130.79 ? 9   C   R "O5'" 1 
ATOM   793  C  "C5'" . C   C 3 2   ? -29.979 27.248  27.470 1.00 127.87 ? 9   C   R "C5'" 1 
ATOM   794  C  "C4'" . C   C 3 2   ? -29.040 26.899  26.335 1.00 125.94 ? 9   C   R "C4'" 1 
ATOM   795  O  "O4'" . C   C 3 2   ? -27.681 27.265  26.704 1.00 125.97 ? 9   C   R "O4'" 1 
ATOM   796  C  "C3'" . C   C 3 2   ? -28.935 25.421  25.992 1.00 124.50 ? 9   C   R "C3'" 1 
ATOM   797  O  "O3'" . C   C 3 2   ? -29.972 24.988  25.121 1.00 121.62 ? 9   C   R "O3'" 1 
ATOM   798  C  "C2'" . C   C 3 2   ? -27.576 25.344  25.311 1.00 125.01 ? 9   C   R "C2'" 1 
ATOM   799  O  "O2'" . C   C 3 2   ? -27.607 25.750  23.958 1.00 124.94 ? 9   C   R "O2'" 1 
ATOM   800  C  "C1'" . C   C 3 2   ? -26.766 26.336  26.140 1.00 125.73 ? 9   C   R "C1'" 1 
ATOM   801  N  N1    . C   C 3 2   ? -26.015 25.678  27.221 1.00 126.06 ? 9   C   R N1    1 
ATOM   802  C  C2    . C   C 3 2   ? -25.017 24.758  26.875 1.00 126.13 ? 9   C   R C2    1 
ATOM   803  O  O2    . C   C 3 2   ? -24.798 24.532  25.675 1.00 125.94 ? 9   C   R O2    1 
ATOM   804  N  N3    . C   C 3 2   ? -24.319 24.140  27.852 1.00 126.22 ? 9   C   R N3    1 
ATOM   805  C  C4    . C   C 3 2   ? -24.583 24.409  29.131 1.00 126.35 ? 9   C   R C4    1 
ATOM   806  N  N4    . C   C 3 2   ? -23.868 23.773  30.060 1.00 126.66 ? 9   C   R N4    1 
ATOM   807  C  C5    . C   C 3 2   ? -25.593 25.342  29.513 1.00 126.25 ? 9   C   R C5    1 
ATOM   808  C  C6    . C   C 3 2   ? -26.278 25.948  28.535 1.00 126.11 ? 9   C   R C6    1 
ATOM   809  P  P     . A   C 3 3   ? -30.623 23.530  25.320 1.00 129.30 ? 8   A   R P     1 
ATOM   810  O  OP1   . A   C 3 3   ? -31.717 23.405  24.323 1.00 129.25 ? 8   A   R OP1   1 
ATOM   811  O  OP2   . A   C 3 3   ? -30.924 23.352  26.764 1.00 129.22 ? 8   A   R OP2   1 
ATOM   812  O  "O5'" . A   C 3 3   ? -29.468 22.506  24.907 1.00 126.80 ? 8   A   R "O5'" 1 
ATOM   813  C  "C5'" . A   C 3 3   ? -28.233 22.448  25.621 1.00 122.43 ? 8   A   R "C5'" 1 
ATOM   814  C  "C4'" . A   C 3 3   ? -27.151 21.868  24.741 1.00 129.38 ? 8   A   R "C4'" 1 
ATOM   815  O  "O4'" . A   C 3 3   ? -25.848 22.143  25.319 1.00 129.24 ? 8   A   R "O4'" 1 
ATOM   816  C  "C3'" . A   C 3 3   ? -27.193 20.355  24.610 1.00 127.44 ? 8   A   R "C3'" 1 
ATOM   817  O  "O3'" . A   C 3 3   ? -28.104 19.975  23.584 1.00 123.29 ? 8   A   R "O3'" 1 
ATOM   818  C  "C2'" . A   C 3 3   ? -25.752 20.016  24.245 1.00 128.09 ? 8   A   R "C2'" 1 
ATOM   819  O  "O2'" . A   C 3 3   ? -25.487 20.181  22.867 1.00 127.83 ? 8   A   R "O2'" 1 
ATOM   820  C  "C1'" . A   C 3 3   ? -24.973 21.058  25.053 1.00 128.95 ? 8   A   R "C1'" 1 
ATOM   821  N  N9    . A   C 3 3   ? -24.389 20.601  26.317 1.00 129.19 ? 8   A   R N9    1 
ATOM   822  C  C8    . A   C 3 3   ? -24.653 21.079  27.578 1.00 129.25 ? 8   A   R C8    1 
ATOM   823  N  N7    . A   C 3 3   ? -23.947 20.503  28.522 1.00 129.61 ? 8   A   R N7    1 
ATOM   824  C  C5    . A   C 3 3   ? -23.169 19.575  27.840 1.00 129.42 ? 8   A   R C5    1 
ATOM   825  C  C6    . A   C 3 3   ? -22.201 18.644  28.277 1.00 129.14 ? 8   A   R C6    1 
ATOM   826  N  N6    . A   C 3 3   ? -21.843 18.493  29.555 1.00 128.36 ? 8   A   R N6    1 
ATOM   827  N  N1    . A   C 3 3   ? -21.610 17.865  27.342 1.00 128.95 ? 8   A   R N1    1 
ATOM   828  C  C2    . A   C 3 3   ? -21.974 18.020  26.058 1.00 129.02 ? 8   A   R C2    1 
ATOM   829  N  N3    . A   C 3 3   ? -22.868 18.859  25.525 1.00 128.90 ? 8   A   R N3    1 
ATOM   830  C  C4    . A   C 3 3   ? -23.436 19.619  26.481 1.00 129.29 ? 8   A   R C4    1 
ATOM   831  P  P     . C   C 3 4   ? -29.074 18.715  23.809 1.00 120.07 ? 7   C   R P     1 
ATOM   832  O  OP1   . C   C 3 4   ? -30.230 18.824  22.890 1.00 120.66 ? 7   C   R OP1   1 
ATOM   833  O  OP2   . C   C 3 4   ? -29.313 18.589  25.267 1.00 120.55 ? 7   C   R OP2   1 
ATOM   834  O  "O5'" . C   C 3 4   ? -28.196 17.469  23.355 1.00 117.20 ? 7   C   R "O5'" 1 
ATOM   835  C  "C5'" . C   C 3 4   ? -28.402 16.197  23.949 1.00 112.59 ? 7   C   R "C5'" 1 
ATOM   836  C  "C4'" . C   C 3 4   ? -27.162 15.351  23.824 1.00 119.10 ? 7   C   R "C4'" 1 
ATOM   837  O  "O4'" . C   C 3 4   ? -26.005 16.121  24.246 1.00 108.95 ? 7   C   R "O4'" 1 
ATOM   838  C  "C3'" . C   C 3 4   ? -27.139 14.120  24.709 1.00 106.45 ? 7   C   R "C3'" 1 
ATOM   839  O  "O3'" . C   C 3 4   ? -27.858 13.042  24.132 1.00 101.76 ? 7   C   R "O3'" 1 
ATOM   840  C  "C2'" . C   C 3 4   ? -25.648 13.851  24.840 1.00 106.82 ? 7   C   R "C2'" 1 
ATOM   841  O  "O2'" . C   C 3 4   ? -25.112 13.214  23.699 1.00 105.95 ? 7   C   R "O2'" 1 
ATOM   842  C  "C1'" . C   C 3 4   ? -25.102 15.277  24.943 1.00 107.80 ? 7   C   R "C1'" 1 
ATOM   843  N  N1    . C   C 3 4   ? -25.043 15.749  26.336 1.00 108.13 ? 7   C   R N1    1 
ATOM   844  C  C2    . C   C 3 4   ? -24.180 15.109  27.236 1.00 108.35 ? 7   C   R C2    1 
ATOM   845  O  O2    . C   C 3 4   ? -23.491 14.153  26.836 1.00 108.53 ? 7   C   R O2    1 
ATOM   846  N  N3    . C   C 3 4   ? -24.123 15.548  28.519 1.00 108.15 ? 7   C   R N3    1 
ATOM   847  C  C4    . C   C 3 4   ? -24.882 16.575  28.910 1.00 107.49 ? 7   C   R C4    1 
ATOM   848  N  N4    . C   C 3 4   ? -24.788 16.975  30.179 1.00 106.93 ? 7   C   R N4    1 
ATOM   849  C  C5    . C   C 3 4   ? -25.771 17.238  28.015 1.00 107.51 ? 7   C   R C5    1 
ATOM   850  C  C6    . C   C 3 4   ? -25.818 16.798  26.751 1.00 107.76 ? 7   C   R C6    1 
ATOM   851  P  P     . G   C 3 5   ? -29.010 12.325  24.984 1.00 97.48  ? 6   G   R P     1 
ATOM   852  O  OP1   . G   C 3 5   ? -29.832 11.511  24.058 1.00 97.54  ? 6   G   R OP1   1 
ATOM   853  O  OP2   . G   C 3 5   ? -29.652 13.382  25.807 1.00 96.58  ? 6   G   R OP2   1 
ATOM   854  O  "O5'" . G   C 3 5   ? -28.218 11.341  25.955 1.00 95.59  ? 6   G   R "O5'" 1 
ATOM   855  C  "C5'" . G   C 3 5   ? -27.713 10.100  25.470 1.00 91.81  ? 6   G   R "C5'" 1 
ATOM   856  C  "C4'" . G   C 3 5   ? -26.756 9.484   26.468 1.00 98.99  ? 6   G   R "C4'" 1 
ATOM   857  O  "O4'" . G   C 3 5   ? -25.624 10.378  26.656 1.00 98.30  ? 6   G   R "O4'" 1 
ATOM   858  C  "C3'" . G   C 3 5   ? -27.278 9.268   27.878 1.00 96.98  ? 6   G   R "C3'" 1 
ATOM   859  O  "O3'" . G   C 3 5   ? -28.072 8.104   28.027 1.00 95.07  ? 6   G   R "O3'" 1 
ATOM   860  C  "C2'" . G   C 3 5   ? -25.991 9.227   28.689 1.00 96.47  ? 6   G   R "C2'" 1 
ATOM   861  O  "O2'" . G   C 3 5   ? -25.288 8.005   28.573 1.00 94.91  ? 6   G   R "O2'" 1 
ATOM   862  C  "C1'" . G   C 3 5   ? -25.195 10.334  28.009 1.00 96.21  ? 6   G   R "C1'" 1 
ATOM   863  N  N9    . G   C 3 5   ? -25.564 11.593  28.638 1.00 94.71  ? 6   G   R N9    1 
ATOM   864  C  C8    . G   C 3 5   ? -26.382 12.570  28.130 1.00 94.30  ? 6   G   R C8    1 
ATOM   865  N  N7    . G   C 3 5   ? -26.583 13.552  28.965 1.00 94.45  ? 6   G   R N7    1 
ATOM   866  C  C5    . G   C 3 5   ? -25.839 13.208  30.083 1.00 93.89  ? 6   G   R C5    1 
ATOM   867  C  C6    . G   C 3 5   ? -25.669 13.885  31.311 1.00 93.27  ? 6   G   R C6    1 
ATOM   868  O  O6    . G   C 3 5   ? -26.168 14.959  31.673 1.00 93.25  ? 6   G   R O6    1 
ATOM   869  N  N1    . G   C 3 5   ? -24.825 13.183  32.168 1.00 92.41  ? 6   G   R N1    1 
ATOM   870  C  C2    . G   C 3 5   ? -24.223 11.978  31.877 1.00 92.33  ? 6   G   R C2    1 
ATOM   871  N  N2    . G   C 3 5   ? -23.440 11.450  32.830 1.00 90.61  ? 6   G   R N2    1 
ATOM   872  N  N3    . G   C 3 5   ? -24.379 11.339  30.733 1.00 93.39  ? 6   G   R N3    1 
ATOM   873  C  C4    . G   C 3 5   ? -25.193 12.007  29.889 1.00 94.19  ? 6   G   R C4    1 
ATOM   874  P  P     . G   C 3 6   ? -29.158 8.051   29.205 1.00 92.73  ? 5   G   R P     1 
ATOM   875  O  OP1   . G   C 3 6   ? -29.858 6.745   29.167 1.00 93.66  ? 5   G   R OP1   1 
ATOM   876  O  OP2   . G   C 3 6   ? -29.940 9.309   29.145 1.00 93.16  ? 5   G   R OP2   1 
ATOM   877  O  "O5'" . G   C 3 6   ? -28.274 8.105   30.522 1.00 93.52  ? 5   G   R "O5'" 1 
ATOM   878  C  "C5'" . G   C 3 6   ? -27.307 7.100   30.787 1.00 93.75  ? 5   G   R "C5'" 1 
ATOM   879  C  "C4'" . G   C 3 6   ? -26.819 7.230   32.199 1.00 94.08  ? 5   G   R "C4'" 1 
ATOM   880  O  "O4'" . G   C 3 6   ? -26.142 8.502   32.345 1.00 94.32  ? 5   G   R "O4'" 1 
ATOM   881  C  "C3'" . G   C 3 6   ? -27.923 7.276   33.237 1.00 94.67  ? 5   G   R "C3'" 1 
ATOM   882  O  "O3'" . G   C 3 6   ? -28.353 5.973   33.597 1.00 94.24  ? 5   G   R "O3'" 1 
ATOM   883  C  "C2'" . G   C 3 6   ? -27.247 8.007   34.385 1.00 95.74  ? 5   G   R "C2'" 1 
ATOM   884  O  "O2'" . G   C 3 6   ? -26.402 7.160   35.140 1.00 96.47  ? 5   G   R "O2'" 1 
ATOM   885  C  "C1'" . G   C 3 6   ? -26.412 9.039   33.626 1.00 95.95  ? 5   G   R "C1'" 1 
ATOM   886  N  N9    . G   C 3 6   ? -27.108 10.306  33.438 1.00 97.41  ? 5   G   R N9    1 
ATOM   887  C  C8    . G   C 3 6   ? -28.247 10.531  32.707 1.00 98.47  ? 5   G   R C8    1 
ATOM   888  N  N7    . G   C 3 6   ? -28.621 11.783  32.710 1.00 99.48  ? 5   G   R N7    1 
ATOM   889  C  C5    . G   C 3 6   ? -27.672 12.419  33.496 1.00 99.92  ? 5   G   R C5    1 
ATOM   890  C  C6    . G   C 3 6   ? -27.542 13.789  33.864 1.00 90.49  ? 5   G   R C6    1 
ATOM   891  O  O6    . G   C 3 6   ? -28.269 14.749  33.556 1.00 99.39  ? 5   G   R O6    1 
ATOM   892  N  N1    . G   C 3 6   ? -26.427 13.993  34.673 1.00 91.29  ? 5   G   R N1    1 
ATOM   893  C  C2    . G   C 3 6   ? -25.552 13.010  35.081 1.00 91.93  ? 5   G   R C2    1 
ATOM   894  N  N2    . G   C 3 6   ? -24.534 13.393  35.869 1.00 91.91  ? 5   G   R N2    1 
ATOM   895  N  N3    . G   C 3 6   ? -25.666 11.738  34.743 1.00 91.24  ? 5   G   R N3    1 
ATOM   896  C  C4    . G   C 3 6   ? -26.736 11.517  33.958 1.00 99.14  ? 5   G   R C4    1 
ATOM   897  P  P     . C   C 3 7   ? -29.817 5.773   34.213 1.00 92.95  ? 4   C   R P     1 
ATOM   898  O  OP1   . C   C 3 7   ? -30.098 4.319   34.280 1.00 92.88  ? 4   C   R OP1   1 
ATOM   899  O  OP2   . C   C 3 7   ? -30.741 6.671   33.484 1.00 93.01  ? 4   C   R OP2   1 
ATOM   900  O  "O5'" . C   C 3 7   ? -29.668 6.315   35.696 1.00 95.26  ? 4   C   R "O5'" 1 
ATOM   901  C  "C5'" . C   C 3 7   ? -28.722 5.735   36.575 1.00 99.64  ? 4   C   R "C5'" 1 
ATOM   902  C  "C4'" . C   C 3 7   ? -28.460 6.653   37.737 1.00 92.78  ? 4   C   R "C4'" 1 
ATOM   903  O  "O4'" . C   C 3 7   ? -27.821 7.866   37.248 1.00 94.55  ? 4   C   R "O4'" 1 
ATOM   904  C  "C3'" . C   C 3 7   ? -29.703 7.173   38.439 1.00 93.82  ? 4   C   R "C3'" 1 
ATOM   905  O  "O3'" . C   C 3 7   ? -30.271 6.243   39.348 1.00 92.99  ? 4   C   R "O3'" 1 
ATOM   906  C  "C2'" . C   C 3 7   ? -29.176 8.434   39.104 1.00 95.50  ? 4   C   R "C2'" 1 
ATOM   907  O  "O2'" . C   C 3 7   ? -28.411 8.129   40.254 1.00 96.02  ? 4   C   R "O2'" 1 
ATOM   908  C  "C1'" . C   C 3 7   ? -28.253 8.980   38.014 1.00 96.22  ? 4   C   R "C1'" 1 
ATOM   909  N  N1    . C   C 3 7   ? -28.963 9.935   37.135 1.00 98.83  ? 4   C   R N1    1 
ATOM   910  C  C2    . C   C 3 7   ? -28.365 11.165  36.864 1.00 90.26  ? 4   C   R C2    1 
ATOM   911  O  O2    . C   C 3 7   ? -27.233 11.389  37.314 1.00 91.88  ? 4   C   R O2    1 
ATOM   912  N  N3    . C   C 3 7   ? -29.032 12.081  36.118 1.00 90.44  ? 4   C   R N3    1 
ATOM   913  C  C4    . C   C 3 7   ? -30.247 11.803  35.648 1.00 90.73  ? 4   C   R C4    1 
ATOM   914  N  N4    . C   C 3 7   ? -30.872 12.749  34.940 1.00 91.26  ? 4   C   R N4    1 
ATOM   915  C  C5    . C   C 3 7   ? -30.875 10.546  35.888 1.00 90.52  ? 4   C   R C5    1 
ATOM   916  C  C6    . C   C 3 7   ? -30.200 9.646   36.623 1.00 99.91  ? 4   C   R C6    1 
ATOM   917  P  P     . G   C 3 8   ? -31.854 6.287   39.640 1.00 92.32  ? 3   G   R P     1 
ATOM   918  O  OP1   . G   C 3 8   ? -32.288 4.909   39.984 1.00 92.11  ? 3   G   R OP1   1 
ATOM   919  O  OP2   . G   C 3 8   ? -32.536 7.025   38.545 1.00 91.23  ? 3   G   R OP2   1 
ATOM   920  O  "O5'" . G   C 3 8   ? -31.959 7.165   40.957 1.00 91.89  ? 3   G   R "O5'" 1 
ATOM   921  C  "C5'" . G   C 3 8   ? -30.932 7.119   41.944 1.00 99.55  ? 3   G   R "C5'" 1 
ATOM   922  C  "C4'" . G   C 3 8   ? -30.797 8.469   42.592 1.00 97.46  ? 3   G   R "C4'" 1 
ATOM   923  O  "O4'" . G   C 3 8   ? -30.270 9.408   41.620 1.00 96.63  ? 3   G   R "O4'" 1 
ATOM   924  C  "C3'" . G   C 3 8   ? -32.124 9.075   43.010 1.00 96.27  ? 3   G   R "C3'" 1 
ATOM   925  O  "O3'" . G   C 3 8   ? -32.505 8.580   44.290 1.00 96.05  ? 3   G   R "O3'" 1 
ATOM   926  C  "C2'" . G   C 3 8   ? -31.804 10.565  43.020 1.00 95.21  ? 3   G   R "C2'" 1 
ATOM   927  O  "O2'" . G   C 3 8   ? -31.145 10.972  44.203 1.00 93.08  ? 3   G   R "O2'" 1 
ATOM   928  C  "C1'" . G   C 3 8   ? -30.854 10.680  41.823 1.00 94.89  ? 3   G   R "C1'" 1 
ATOM   929  N  N9    . G   C 3 8   ? -31.460 11.126  40.567 1.00 93.71  ? 3   G   R N9    1 
ATOM   930  C  C8    . G   C 3 8   ? -31.703 10.390  39.430 1.00 92.62  ? 3   G   R C8    1 
ATOM   931  N  N7    . G   C 3 8   ? -32.226 11.099  38.461 1.00 91.65  ? 3   G   R N7    1 
ATOM   932  C  C5    . G   C 3 8   ? -32.343 12.376  38.995 1.00 90.36  ? 3   G   R C5    1 
ATOM   933  C  C6    . G   C 3 8   ? -32.847 13.584  38.425 1.00 98.10  ? 3   G   R C6    1 
ATOM   934  O  O6    . G   C 3 8   ? -33.305 13.783  37.282 1.00 95.72  ? 3   G   R O6    1 
ATOM   935  N  N1    . G   C 3 8   ? -32.780 14.634  39.333 1.00 97.59  ? 3   G   R N1    1 
ATOM   936  C  C2    . G   C 3 8   ? -32.288 14.542  40.614 1.00 99.90  ? 3   G   R C2    1 
ATOM   937  N  N2    . G   C 3 8   ? -32.279 15.657  41.342 1.00 91.08  ? 3   G   R N2    1 
ATOM   938  N  N3    . G   C 3 8   ? -31.826 13.438  41.150 1.00 91.19  ? 3   G   R N3    1 
ATOM   939  C  C4    . G   C 3 8   ? -31.881 12.403  40.296 1.00 92.11  ? 3   G   R C4    1 
ATOM   940  P  P     . A   C 3 9   ? -33.461 7.285   44.393 1.00 95.14  ? 2   A   R P     1 
ATOM   941  O  OP1   . A   C 3 9   ? -33.212 6.631   45.710 1.00 94.55  ? 2   A   R OP1   1 
ATOM   942  O  OP2   . A   C 3 9   ? -33.299 6.501   43.142 1.00 95.92  ? 2   A   R OP2   1 
ATOM   943  O  "O5'" . A   C 3 9   ? -34.938 7.880   44.368 1.00 98.84  ? 2   A   R "O5'" 1 
ATOM   944  C  "C5'" . A   C 3 9   ? -35.347 8.734   43.312 1.00 89.98  ? 2   A   R "C5'" 1 
ATOM   945  C  "C4'" . A   C 3 9   ? -35.376 10.160  43.794 1.00 84.29  ? 2   A   R "C4'" 1 
ATOM   946  O  "O4'" . A   C 3 9   ? -34.544 10.962  42.924 1.00 81.04  ? 2   A   R "O4'" 1 
ATOM   947  C  "C3'" . A   C 3 9   ? -36.731 10.844  43.762 1.00 81.80  ? 2   A   R "C3'" 1 
ATOM   948  O  "O3'" . A   C 3 9   ? -37.467 10.557  44.942 1.00 80.46  ? 2   A   R "O3'" 1 
ATOM   949  C  "C2'" . A   C 3 9   ? -36.340 12.312  43.681 1.00 79.34  ? 2   A   R "C2'" 1 
ATOM   950  O  "O2'" . A   C 3 9   ? -35.937 12.816  44.933 1.00 80.81  ? 2   A   R "O2'" 1 
ATOM   951  C  "C1'" . A   C 3 9   ? -35.113 12.244  42.773 1.00 75.86  ? 2   A   R "C1'" 1 
ATOM   952  N  N9    . A   C 3 9   ? -35.399 12.432  41.357 1.00 69.94  ? 2   A   R N9    1 
ATOM   953  C  C8    . A   C 3 9   ? -35.124 11.564  40.327 1.00 67.61  ? 2   A   R C8    1 
ATOM   954  N  N7    . A   C 3 9   ? -35.473 12.016  39.147 1.00 65.00  ? 2   A   R N7    1 
ATOM   955  C  C5    . A   C 3 9   ? -36.022 13.263  39.420 1.00 62.40  ? 2   A   R C5    1 
ATOM   956  C  C6    . A   C 3 9   ? -36.577 14.244  38.593 1.00 58.88  ? 2   A   R C6    1 
ATOM   957  N  N6    . A   C 3 9   ? -36.672 14.117  37.277 1.00 55.73  ? 2   A   R N6    1 
ATOM   958  N  N1    . A   C 3 9   ? -37.036 15.371  39.173 1.00 58.10  ? 2   A   R N1    1 
ATOM   959  C  C2    . A   C 3 9   ? -36.938 15.491  40.504 1.00 61.06  ? 2   A   R C2    1 
ATOM   960  N  N3    . A   C 3 9   ? -36.434 14.636  41.394 1.00 61.44  ? 2   A   R N3    1 
ATOM   961  C  C4    . A   C 3 9   ? -35.987 13.529  40.777 1.00 64.96  ? 2   A   R C4    1 
HETATM 962  P  P     . 3DA C 3 10  ? -38.973 10.018  44.822 1.00 79.97  ? 1   3DA R P     1 
HETATM 963  O  O1P   . 3DA C 3 10  ? -39.123 8.804   45.670 1.00 81.86  ? 1   3DA R O1P   1 
HETATM 964  O  O2P   . 3DA C 3 10  ? -39.319 9.947   43.381 1.00 83.15  ? 1   3DA R O2P   1 
HETATM 965  O  "O5'" . 3DA C 3 10  ? -39.847 11.170  45.479 1.00 77.50  ? 1   3DA R "O5'" 1 
HETATM 966  C  "C5'" . 3DA C 3 10  ? -41.165 11.430  45.018 1.00 70.62  ? 1   3DA R "C5'" 1 
HETATM 967  C  "C4'" . 3DA C 3 10  ? -41.388 12.915  44.925 1.00 65.37  ? 1   3DA R "C4'" 1 
HETATM 968  O  "O4'" . 3DA C 3 10  ? -40.229 13.524  44.297 1.00 62.75  ? 1   3DA R "O4'" 1 
HETATM 969  C  "C1'" . 3DA C 3 10  ? -40.648 14.579  43.455 1.00 57.46  ? 1   3DA R "C1'" 1 
HETATM 970  N  N9    . 3DA C 3 10  ? -40.321 14.192  42.079 1.00 48.55  ? 1   3DA R N9    1 
HETATM 971  C  C4    . 3DA C 3 10  ? -40.504 14.968  40.962 1.00 40.57  ? 1   3DA R C4    1 
HETATM 972  N  N3    . 3DA C 3 10  ? -40.979 16.224  40.918 1.00 39.04  ? 1   3DA R N3    1 
HETATM 973  C  C2    . 3DA C 3 10  ? -41.031 16.659  39.659 1.00 37.05  ? 1   3DA R C2    1 
HETATM 974  N  N1    . 3DA C 3 10  ? -40.691 16.023  38.531 1.00 34.26  ? 1   3DA R N1    1 
HETATM 975  C  C6    . 3DA C 3 10  ? -40.224 14.759  38.616 1.00 33.66  ? 1   3DA R C6    1 
HETATM 976  N  N6    . 3DA C 3 10  ? -39.905 14.126  37.492 1.00 32.27  ? 1   3DA R N6    1 
HETATM 977  C  C5    . 3DA C 3 10  ? -40.111 14.187  39.890 1.00 36.22  ? 1   3DA R C5    1 
HETATM 978  N  N7    . 3DA C 3 10  ? -39.671 12.941  40.322 1.00 38.14  ? 1   3DA R N7    1 
HETATM 979  C  C8    . 3DA C 3 10  ? -39.808 12.995  41.626 1.00 43.39  ? 1   3DA R C8    1 
HETATM 980  C  "C2'" . 3DA C 3 10  ? -42.160 14.763  43.684 1.00 61.24  ? 1   3DA R "C2'" 1 
HETATM 981  O  "O2'" . 3DA C 3 10  ? -42.417 15.692  44.715 1.00 62.45  ? 1   3DA R "O2'" 1 
HETATM 982  C  "C3'" . 3DA C 3 10  ? -42.581 13.358  44.097 1.00 63.68  ? 1   3DA R "C3'" 1 
ATOM   983  N  N     . SER D 4 12  ? -18.057 20.886  68.288 1.00 81.00  ? 12  SER D N     1 
ATOM   984  C  CA    . SER D 4 12  ? -19.458 21.278  68.631 1.00 82.24  ? 12  SER D CA    1 
ATOM   985  C  C     . SER D 4 12  ? -19.573 22.660  69.296 1.00 83.01  ? 12  SER D C     1 
ATOM   986  O  O     . SER D 4 12  ? -20.620 23.307  69.235 1.00 83.21  ? 12  SER D O     1 
ATOM   987  C  CB    . SER D 4 12  ? -20.092 20.218  69.545 1.00 81.97  ? 12  SER D CB    1 
ATOM   988  O  OG    . SER D 4 12  ? -19.454 20.165  70.808 1.00 78.86  ? 12  SER D OG    1 
ATOM   989  N  N     . ASP D 4 13  ? -18.499 23.116  69.927 1.00 83.39  ? 13  ASP D N     1 
ATOM   990  C  CA    . ASP D 4 13  ? -18.510 24.415  70.593 1.00 83.67  ? 13  ASP D CA    1 
ATOM   991  C  C     . ASP D 4 13  ? -18.352 25.586  69.618 1.00 82.74  ? 13  ASP D C     1 
ATOM   992  O  O     . ASP D 4 13  ? -17.439 25.593  68.792 1.00 82.81  ? 13  ASP D O     1 
ATOM   993  C  CB    . ASP D 4 13  ? -17.392 24.462  71.630 1.00 85.11  ? 13  ASP D CB    1 
ATOM   994  C  CG    . ASP D 4 13  ? -17.210 25.838  72.229 1.00 85.98  ? 13  ASP D CG    1 
ATOM   995  O  OD1   . ASP D 4 13  ? -16.242 26.024  72.996 1.00 88.66  ? 13  ASP D OD1   1 
ATOM   996  O  OD2   . ASP D 4 13  ? -18.032 26.732  71.941 1.00 86.37  ? 13  ASP D OD2   1 
ATOM   997  N  N     . ILE D 4 14  ? -19.233 26.578  69.733 1.00 81.50  ? 14  ILE D N     1 
ATOM   998  C  CA    . ILE D 4 14  ? -19.207 27.763  68.867 1.00 81.07  ? 14  ILE D CA    1 
ATOM   999  C  C     . ILE D 4 14  ? -17.811 28.387  68.866 1.00 80.58  ? 14  ILE D C     1 
ATOM   1000 O  O     . ILE D 4 14  ? -17.416 29.081  67.929 1.00 79.40  ? 14  ILE D O     1 
ATOM   1001 C  CB    . ILE D 4 14  ? -20.258 28.817  69.336 1.00 81.60  ? 14  ILE D CB    1 
ATOM   1002 C  CG1   . ILE D 4 14  ? -20.613 29.759  68.183 1.00 80.90  ? 14  ILE D CG1   1 
ATOM   1003 C  CG2   . ILE D 4 14  ? -19.723 29.603  70.530 1.00 81.44  ? 14  ILE D CG2   1 
ATOM   1004 C  CD1   . ILE D 4 14  ? -21.807 30.646  68.467 1.00 81.00  ? 14  ILE D CD1   1 
ATOM   1005 N  N     . GLU D 4 15  ? -17.073 28.116  69.934 1.00 81.32  ? 15  GLU D N     1 
ATOM   1006 C  CA    . GLU D 4 15  ? -15.713 28.602  70.108 1.00 80.83  ? 15  GLU D CA    1 
ATOM   1007 C  C     . GLU D 4 15  ? -14.769 27.659  69.358 1.00 80.19  ? 15  GLU D C     1 
ATOM   1008 O  O     . GLU D 4 15  ? -13.813 28.091  68.709 1.00 78.73  ? 15  GLU D O     1 
ATOM   1009 C  CB    . GLU D 4 15  ? -15.368 28.599  71.592 1.00 81.85  ? 15  GLU D CB    1 
ATOM   1010 C  CG    . GLU D 4 15  ? -14.137 29.371  71.923 1.00 84.29  ? 15  GLU D CG    1 
ATOM   1011 C  CD    . GLU D 4 15  ? -14.260 30.809  71.494 1.00 86.25  ? 15  GLU D CD    1 
ATOM   1012 O  OE1   . GLU D 4 15  ? -14.245 31.056  70.269 1.00 87.75  ? 15  GLU D OE1   1 
ATOM   1013 O  OE2   . GLU D 4 15  ? -14.388 31.689  72.377 1.00 87.39  ? 15  GLU D OE2   1 
ATOM   1014 N  N     . LEU D 4 16  ? -15.061 26.363  69.457 1.00 79.84  ? 16  LEU D N     1 
ATOM   1015 C  CA    . LEU D 4 16  ? -14.274 25.326  68.804 1.00 79.05  ? 16  LEU D CA    1 
ATOM   1016 C  C     . LEU D 4 16  ? -14.240 25.474  67.277 1.00 78.86  ? 16  LEU D C     1 
ATOM   1017 O  O     . LEU D 4 16  ? -13.629 24.667  66.576 1.00 78.20  ? 16  LEU D O     1 
ATOM   1018 C  CB    . LEU D 4 16  ? -14.793 23.941  69.213 1.00 79.22  ? 16  LEU D CB    1 
ATOM   1019 C  CG    . LEU D 4 16  ? -14.224 23.332  70.504 1.00 78.28  ? 16  LEU D CG    1 
ATOM   1020 C  CD1   . LEU D 4 16  ? -14.114 24.395  71.574 1.00 80.15  ? 16  LEU D CD1   1 
ATOM   1021 C  CD2   . LEU D 4 16  ? -15.110 22.193  70.981 1.00 77.51  ? 16  LEU D CD2   1 
ATOM   1022 N  N     . ALA D 4 17  ? -14.910 26.499  66.761 1.00 79.10  ? 17  ALA D N     1 
ATOM   1023 C  CA    . ALA D 4 17  ? -14.867 26.771  65.330 1.00 78.77  ? 17  ALA D CA    1 
ATOM   1024 C  C     . ALA D 4 17  ? -13.584 27.609  65.175 1.00 78.70  ? 17  ALA D C     1 
ATOM   1025 O  O     . ALA D 4 17  ? -13.616 28.781  64.791 1.00 77.46  ? 17  ALA D O     1 
ATOM   1026 C  CB    . ALA D 4 17  ? -16.087 27.569  64.897 1.00 78.50  ? 17  ALA D CB    1 
ATOM   1027 N  N     . ALA D 4 18  ? -12.459 26.986  65.524 1.00 78.55  ? 18  ALA D N     1 
ATOM   1028 C  CA    . ALA D 4 18  ? -11.139 27.607  65.456 1.00 76.19  ? 18  ALA D CA    1 
ATOM   1029 C  C     . ALA D 4 18  ? -10.263 26.830  64.474 1.00 74.73  ? 18  ALA D C     1 
ATOM   1030 O  O     . ALA D 4 18  ? -10.696 26.521  63.363 1.00 76.06  ? 18  ALA D O     1 
ATOM   1031 C  CB    . ALA D 4 18  ? -10.502 27.607  66.837 1.00 76.34  ? 18  ALA D CB    1 
ATOM   1032 N  N     . ILE D 4 19  ? -9.035  26.519  64.878 1.00 71.81  ? 19  ILE D N     1 
ATOM   1033 C  CA    . ILE D 4 19  ? -8.127  25.771  64.017 1.00 69.81  ? 19  ILE D CA    1 
ATOM   1034 C  C     . ILE D 4 19  ? -8.554  24.304  64.000 1.00 68.31  ? 19  ILE D C     1 
ATOM   1035 O  O     . ILE D 4 19  ? -8.380  23.577  64.982 1.00 68.02  ? 19  ILE D O     1 
ATOM   1036 C  CB    . ILE D 4 19  ? -6.654  25.901  64.493 1.00 70.56  ? 19  ILE D CB    1 
ATOM   1037 C  CG1   . ILE D 4 19  ? -5.839  24.720  63.972 1.00 70.93  ? 19  ILE D CG1   1 
ATOM   1038 C  CG2   . ILE D 4 19  ? -6.589  26.001  66.013 1.00 72.31  ? 19  ILE D CG2   1 
ATOM   1039 C  CD1   . ILE D 4 19  ? -4.435  24.677  64.490 1.00 72.94  ? 19  ILE D CD1   1 
ATOM   1040 N  N     . PRO D 4 20  ? -9.118  23.853  62.865 1.00 66.54  ? 20  PRO D N     1 
ATOM   1041 C  CA    . PRO D 4 20  ? -9.629  22.505  62.570 1.00 65.74  ? 20  PRO D CA    1 
ATOM   1042 C  C     . PRO D 4 20  ? -8.951  21.314  63.241 1.00 64.79  ? 20  PRO D C     1 
ATOM   1043 O  O     . PRO D 4 20  ? -9.564  20.624  64.056 1.00 64.35  ? 20  PRO D O     1 
ATOM   1044 C  CB    . PRO D 4 20  ? -9.536  22.437  61.054 1.00 65.96  ? 20  PRO D CB    1 
ATOM   1045 C  CG    . PRO D 4 20  ? -9.902  23.830  60.675 1.00 66.51  ? 20  PRO D CG    1 
ATOM   1046 C  CD    . PRO D 4 20  ? -9.106  24.674  61.642 1.00 64.74  ? 20  PRO D CD    1 
ATOM   1047 N  N     . PHE D 4 21  ? -7.694  21.069  62.881 1.00 63.73  ? 21  PHE D N     1 
ATOM   1048 C  CA    . PHE D 4 21  ? -6.934  19.953  63.437 1.00 61.38  ? 21  PHE D CA    1 
ATOM   1049 C  C     . PHE D 4 21  ? -7.011  19.861  64.967 1.00 60.24  ? 21  PHE D C     1 
ATOM   1050 O  O     . PHE D 4 21  ? -7.186  18.783  65.525 1.00 58.80  ? 21  PHE D O     1 
ATOM   1051 C  CB    . PHE D 4 21  ? -5.469  20.064  63.008 1.00 59.79  ? 21  PHE D CB    1 
ATOM   1052 C  CG    . PHE D 4 21  ? -4.593  18.984  63.571 1.00 59.92  ? 21  PHE D CG    1 
ATOM   1053 C  CD1   . PHE D 4 21  ? -4.379  17.806  62.870 1.00 60.70  ? 21  PHE D CD1   1 
ATOM   1054 C  CD2   . PHE D 4 21  ? -4.009  19.129  64.824 1.00 59.88  ? 21  PHE D CD2   1 
ATOM   1055 C  CE1   . PHE D 4 21  ? -3.597  16.786  63.408 1.00 61.25  ? 21  PHE D CE1   1 
ATOM   1056 C  CE2   . PHE D 4 21  ? -3.230  18.117  65.367 1.00 60.41  ? 21  PHE D CE2   1 
ATOM   1057 C  CZ    . PHE D 4 21  ? -3.025  16.943  64.657 1.00 60.29  ? 21  PHE D CZ    1 
ATOM   1058 N  N     . ASN D 4 22  ? -6.869  21.000  65.635 1.00 60.36  ? 22  ASN D N     1 
ATOM   1059 C  CA    . ASN D 4 22  ? -6.894  21.058  67.094 1.00 60.24  ? 22  ASN D CA    1 
ATOM   1060 C  C     . ASN D 4 22  ? -8.222  20.601  67.644 1.00 59.26  ? 22  ASN D C     1 
ATOM   1061 O  O     . ASN D 4 22  ? -8.277  19.785  68.561 1.00 59.28  ? 22  ASN D O     1 
ATOM   1062 C  CB    . ASN D 4 22  ? -6.625  22.489  67.575 1.00 63.03  ? 22  ASN D CB    1 
ATOM   1063 C  CG    . ASN D 4 22  ? -5.236  22.991  67.195 1.00 65.77  ? 22  ASN D CG    1 
ATOM   1064 O  OD1   . ASN D 4 22  ? -4.914  24.160  67.408 1.00 66.98  ? 22  ASN D OD1   1 
ATOM   1065 N  ND2   . ASN D 4 22  ? -4.406  22.108  66.637 1.00 66.41  ? 22  ASN D ND2   1 
ATOM   1066 N  N     . THR D 4 23  ? -9.295  21.147  67.085 1.00 57.95  ? 23  THR D N     1 
ATOM   1067 C  CA    . THR D 4 23  ? -10.639 20.809  67.520 1.00 55.57  ? 23  THR D CA    1 
ATOM   1068 C  C     . THR D 4 23  ? -10.994 19.357  67.241 1.00 54.05  ? 23  THR D C     1 
ATOM   1069 O  O     . THR D 4 23  ? -11.542 18.671  68.105 1.00 54.11  ? 23  THR D O     1 
ATOM   1070 C  CB    . THR D 4 23  ? -11.665 21.724  66.849 1.00 55.93  ? 23  THR D CB    1 
ATOM   1071 O  OG1   . THR D 4 23  ? -11.417 23.071  67.267 1.00 57.26  ? 23  THR D OG1   1 
ATOM   1072 C  CG2   . THR D 4 23  ? -13.091 21.325  67.232 1.00 55.68  ? 23  THR D CG2   1 
ATOM   1073 N  N     . LEU D 4 24  ? -10.680 18.887  66.041 1.00 51.51  ? 24  LEU D N     1 
ATOM   1074 C  CA    . LEU D 4 24  ? -10.982 17.515  65.691 1.00 52.03  ? 24  LEU D CA    1 
ATOM   1075 C  C     . LEU D 4 24  ? -10.312 16.530  66.627 1.00 53.70  ? 24  LEU D C     1 
ATOM   1076 O  O     . LEU D 4 24  ? -10.978 15.719  67.264 1.00 54.63  ? 24  LEU D O     1 
ATOM   1077 C  CB    . LEU D 4 24  ? -10.557 17.211  64.250 1.00 50.17  ? 24  LEU D CB    1 
ATOM   1078 C  CG    . LEU D 4 24  ? -11.434 17.753  63.116 1.00 49.45  ? 24  LEU D CG    1 
ATOM   1079 C  CD1   . LEU D 4 24  ? -10.961 17.124  61.814 1.00 46.48  ? 24  LEU D CD1   1 
ATOM   1080 C  CD2   . LEU D 4 24  ? -12.919 17.429  63.370 1.00 45.46  ? 24  LEU D CD2   1 
ATOM   1081 N  N     . ALA D 4 25  ? -8.987  16.606  66.702 1.00 56.43  ? 25  ALA D N     1 
ATOM   1082 C  CA    . ALA D 4 25  ? -8.193  15.712  67.539 1.00 57.34  ? 25  ALA D CA    1 
ATOM   1083 C  C     . ALA D 4 25  ? -8.671  15.791  68.973 1.00 58.00  ? 25  ALA D C     1 
ATOM   1084 O  O     . ALA D 4 25  ? -8.832  14.779  69.650 1.00 57.75  ? 25  ALA D O     1 
ATOM   1085 C  CB    . ALA D 4 25  ? -6.714  16.093  67.455 1.00 56.77  ? 25  ALA D CB    1 
ATOM   1086 N  N     . ASP D 4 26  ? -8.899  17.009  69.429 1.00 59.43  ? 26  ASP D N     1 
ATOM   1087 C  CA    . ASP D 4 26  ? -9.362  17.237  70.781 1.00 62.42  ? 26  ASP D CA    1 
ATOM   1088 C  C     . ASP D 4 26  ? -10.607 16.388  71.023 1.00 62.69  ? 26  ASP D C     1 
ATOM   1089 O  O     . ASP D 4 26  ? -10.772 15.803  72.089 1.00 63.40  ? 26  ASP D O     1 
ATOM   1090 C  CB    . ASP D 4 26  ? -9.669  18.727  70.945 1.00 66.14  ? 26  ASP D CB    1 
ATOM   1091 C  CG    . ASP D 4 26  ? -9.991  19.114  72.374 1.00 70.00  ? 26  ASP D CG    1 
ATOM   1092 O  OD1   . ASP D 4 26  ? -9.854  20.321  72.685 1.00 71.92  ? 26  ASP D OD1   1 
ATOM   1093 O  OD2   . ASP D 4 26  ? -10.390 18.233  73.176 1.00 70.94  ? 26  ASP D OD2   1 
ATOM   1094 N  N     . HIS D 4 27  ? -11.459 16.303  70.006 1.00 62.96  ? 27  HIS D N     1 
ATOM   1095 C  CA    . HIS D 4 27  ? -12.705 15.545  70.074 1.00 62.58  ? 27  HIS D CA    1 
ATOM   1096 C  C     . HIS D 4 27  ? -12.644 14.093  69.597 1.00 61.91  ? 27  HIS D C     1 
ATOM   1097 O  O     . HIS D 4 27  ? -13.330 13.230  70.150 1.00 62.60  ? 27  HIS D O     1 
ATOM   1098 C  CB    . HIS D 4 27  ? -13.777 16.253  69.252 1.00 63.91  ? 27  HIS D CB    1 
ATOM   1099 C  CG    . HIS D 4 27  ? -14.544 17.295  70.003 1.00 64.72  ? 27  HIS D CG    1 
ATOM   1100 N  ND1   . HIS D 4 27  ? -15.683 17.004  70.721 1.00 64.90  ? 27  HIS D ND1   1 
ATOM   1101 C  CD2   . HIS D 4 27  ? -14.377 18.637  70.089 1.00 65.41  ? 27  HIS D CD2   1 
ATOM   1102 C  CE1   . HIS D 4 27  ? -16.190 18.122  71.211 1.00 65.26  ? 27  HIS D CE1   1 
ATOM   1103 N  NE2   . HIS D 4 27  ? -15.417 19.127  70.841 1.00 65.05  ? 27  HIS D NE2   1 
ATOM   1104 N  N     . TYR D 4 28  ? -11.840 13.820  68.574 1.00 59.84  ? 28  TYR D N     1 
ATOM   1105 C  CA    . TYR D 4 28  ? -11.774 12.473  68.020 1.00 58.05  ? 28  TYR D CA    1 
ATOM   1106 C  C     . TYR D 4 28  ? -10.395 11.849  67.940 1.00 59.37  ? 28  TYR D C     1 
ATOM   1107 O  O     . TYR D 4 28  ? -10.224 10.792  67.327 1.00 60.37  ? 28  TYR D O     1 
ATOM   1108 C  CB    . TYR D 4 28  ? -12.382 12.483  66.627 1.00 55.21  ? 28  TYR D CB    1 
ATOM   1109 C  CG    . TYR D 4 28  ? -13.730 13.168  66.563 1.00 53.27  ? 28  TYR D CG    1 
ATOM   1110 C  CD1   . TYR D 4 28  ? -14.822 12.668  67.265 1.00 51.04  ? 28  TYR D CD1   1 
ATOM   1111 C  CD2   . TYR D 4 28  ? -13.918 14.304  65.780 1.00 52.03  ? 28  TYR D CD2   1 
ATOM   1112 C  CE1   . TYR D 4 28  ? -16.057 13.270  67.185 1.00 48.78  ? 28  TYR D CE1   1 
ATOM   1113 C  CE2   . TYR D 4 28  ? -15.154 14.911  65.695 1.00 50.62  ? 28  TYR D CE2   1 
ATOM   1114 C  CZ    . TYR D 4 28  ? -16.214 14.384  66.399 1.00 49.52  ? 28  TYR D CZ    1 
ATOM   1115 O  OH    . TYR D 4 28  ? -17.444 14.967  66.299 1.00 50.96  ? 28  TYR D OH    1 
ATOM   1116 N  N     . GLY D 4 29  ? -9.406  12.489  68.546 1.00 59.69  ? 29  GLY D N     1 
ATOM   1117 C  CA    . GLY D 4 29  ? -8.067  11.941  68.495 1.00 60.39  ? 29  GLY D CA    1 
ATOM   1118 C  C     . GLY D 4 29  ? -7.307  12.368  67.255 1.00 60.90  ? 29  GLY D C     1 
ATOM   1119 O  O     . GLY D 4 29  ? -7.840  12.377  66.144 1.00 61.08  ? 29  GLY D O     1 
ATOM   1120 N  N     . GLU D 4 30  ? -6.040  12.711  67.455 1.00 60.72  ? 30  GLU D N     1 
ATOM   1121 C  CA    . GLU D 4 30  ? -5.172  13.154  66.377 1.00 59.43  ? 30  GLU D CA    1 
ATOM   1122 C  C     . GLU D 4 30  ? -5.165  12.246  65.142 1.00 56.98  ? 30  GLU D C     1 
ATOM   1123 O  O     . GLU D 4 30  ? -4.984  12.734  64.026 1.00 56.53  ? 30  GLU D O     1 
ATOM   1124 C  CB    . GLU D 4 30  ? -3.747  13.310  66.904 1.00 62.78  ? 30  GLU D CB    1 
ATOM   1125 C  CG    . GLU D 4 30  ? -2.777  13.876  65.884 1.00 67.82  ? 30  GLU D CG    1 
ATOM   1126 C  CD    . GLU D 4 30  ? -1.327  13.683  66.282 1.00 70.64  ? 30  GLU D CD    1 
ATOM   1127 O  OE1   . GLU D 4 30  ? -0.930  14.150  67.379 1.00 71.51  ? 30  GLU D OE1   1 
ATOM   1128 O  OE2   . GLU D 4 30  ? -0.587  13.056  65.489 1.00 72.97  ? 30  GLU D OE2   1 
ATOM   1129 N  N     . ARG D 4 31  ? -5.355  10.941  65.320 1.00 53.61  ? 31  ARG D N     1 
ATOM   1130 C  CA    . ARG D 4 31  ? -5.343  10.053  64.160 1.00 52.86  ? 31  ARG D CA    1 
ATOM   1131 C  C     . ARG D 4 31  ? -6.430  10.392  63.158 1.00 52.02  ? 31  ARG D C     1 
ATOM   1132 O  O     . ARG D 4 31  ? -6.128  10.706  62.007 1.00 53.43  ? 31  ARG D O     1 
ATOM   1133 C  CB    . ARG D 4 31  ? -5.500  8.588   64.550 1.00 54.45  ? 31  ARG D CB    1 
ATOM   1134 C  CG    . ARG D 4 31  ? -5.538  7.668   63.324 1.00 56.72  ? 31  ARG D CG    1 
ATOM   1135 C  CD    . ARG D 4 31  ? -5.804  6.220   63.694 1.00 59.10  ? 31  ARG D CD    1 
ATOM   1136 N  NE    . ARG D 4 31  ? -7.141  6.017   64.260 1.00 62.11  ? 31  ARG D NE    1 
ATOM   1137 C  CZ    . ARG D 4 31  ? -8.220  5.674   63.559 1.00 62.21  ? 31  ARG D CZ    1 
ATOM   1138 N  NH1   . ARG D 4 31  ? -8.130  5.487   62.248 1.00 62.28  ? 31  ARG D NH1   1 
ATOM   1139 N  NH2   . ARG D 4 31  ? -9.389  5.514   64.172 1.00 61.58  ? 31  ARG D NH2   1 
ATOM   1140 N  N     . LEU D 4 32  ? -7.690  10.312  63.586 1.00 49.36  ? 32  LEU D N     1 
ATOM   1141 C  CA    . LEU D 4 32  ? -8.807  10.631  62.709 1.00 47.04  ? 32  LEU D CA    1 
ATOM   1142 C  C     . LEU D 4 32  ? -8.750  12.092  62.284 1.00 46.59  ? 32  LEU D C     1 
ATOM   1143 O  O     . LEU D 4 32  ? -8.985  12.416  61.121 1.00 47.36  ? 32  LEU D O     1 
ATOM   1144 C  CB    . LEU D 4 32  ? -10.147 10.343  63.393 1.00 46.66  ? 32  LEU D CB    1 
ATOM   1145 C  CG    . LEU D 4 32  ? -10.641 8.895   63.364 1.00 46.44  ? 32  LEU D CG    1 
ATOM   1146 C  CD1   . LEU D 4 32  ? -11.962 8.787   64.088 1.00 45.83  ? 32  LEU D CD1   1 
ATOM   1147 C  CD2   . LEU D 4 32  ? -10.797 8.451   61.926 1.00 45.94  ? 32  LEU D CD2   1 
ATOM   1148 N  N     . ALA D 4 33  ? -8.439  12.979  63.218 1.00 44.66  ? 33  ALA D N     1 
ATOM   1149 C  CA    . ALA D 4 33  ? -8.347  14.383  62.869 1.00 44.81  ? 33  ALA D CA    1 
ATOM   1150 C  C     . ALA D 4 33  ? -7.536  14.485  61.578 1.00 45.57  ? 33  ALA D C     1 
ATOM   1151 O  O     . ALA D 4 33  ? -7.923  15.174  60.628 1.00 45.45  ? 33  ALA D O     1 
ATOM   1152 C  CB    . ALA D 4 33  ? -7.660  15.147  63.977 1.00 45.16  ? 33  ALA D CB    1 
ATOM   1153 N  N     . ARG D 4 34  ? -6.411  13.776  61.545 1.00 46.80  ? 34  ARG D N     1 
ATOM   1154 C  CA    . ARG D 4 34  ? -5.542  13.783  60.383 1.00 46.42  ? 34  ARG D CA    1 
ATOM   1155 C  C     . ARG D 4 34  ? -6.226  13.151  59.184 1.00 45.49  ? 34  ARG D C     1 
ATOM   1156 O  O     . ARG D 4 34  ? -6.165  13.687  58.068 1.00 46.65  ? 34  ARG D O     1 
ATOM   1157 C  CB    . ARG D 4 34  ? -4.243  13.041  60.682 1.00 49.40  ? 34  ARG D CB    1 
ATOM   1158 C  CG    . ARG D 4 34  ? -3.325  13.764  61.645 1.00 54.73  ? 34  ARG D CG    1 
ATOM   1159 C  CD    . ARG D 4 34  ? -2.015  12.998  61.854 1.00 59.22  ? 34  ARG D CD    1 
ATOM   1160 N  NE    . ARG D 4 34  ? -1.263  13.537  62.985 1.00 64.23  ? 34  ARG D NE    1 
ATOM   1161 C  CZ    . ARG D 4 34  ? -0.813  14.791  63.063 1.00 67.91  ? 34  ARG D CZ    1 
ATOM   1162 N  NH1   . ARG D 4 34  ? -1.028  15.654  62.071 1.00 67.67  ? 34  ARG D NH1   1 
ATOM   1163 N  NH2   . ARG D 4 34  ? -0.153  15.191  64.145 1.00 69.61  ? 34  ARG D NH2   1 
ATOM   1164 N  N     . GLU D 4 35  ? -6.877  12.012  59.401 1.00 41.96  ? 35  GLU D N     1 
ATOM   1165 C  CA    . GLU D 4 35  ? -7.549  11.353  58.305 1.00 38.22  ? 35  GLU D CA    1 
ATOM   1166 C  C     . GLU D 4 35  ? -8.586  12.292  57.684 1.00 37.00  ? 35  GLU D C     1 
ATOM   1167 O  O     . GLU D 4 35  ? -8.642  12.439  56.473 1.00 37.24  ? 35  GLU D O     1 
ATOM   1168 C  CB    . GLU D 4 35  ? -8.187  10.041  58.766 1.00 37.21  ? 35  GLU D CB    1 
ATOM   1169 C  CG    . GLU D 4 35  ? -8.898  9.318   57.630 1.00 43.59  ? 35  GLU D CG    1 
ATOM   1170 C  CD    . GLU D 4 35  ? -9.057  7.823   57.850 1.00 46.52  ? 35  GLU D CD    1 
ATOM   1171 O  OE1   . GLU D 4 35  ? -9.167  7.401   59.024 1.00 50.25  ? 35  GLU D OE1   1 
ATOM   1172 O  OE2   . GLU D 4 35  ? -9.085  7.070   56.841 1.00 47.02  ? 35  GLU D OE2   1 
ATOM   1173 N  N     . GLN D 4 36  ? -9.395  12.953  58.497 1.00 36.23  ? 36  GLN D N     1 
ATOM   1174 C  CA    . GLN D 4 36  ? -10.381 13.866  57.936 1.00 36.41  ? 36  GLN D CA    1 
ATOM   1175 C  C     . GLN D 4 36  ? -9.706  14.844  57.004 1.00 37.59  ? 36  GLN D C     1 
ATOM   1176 O  O     . GLN D 4 36  ? -9.888  14.763  55.788 1.00 38.50  ? 36  GLN D O     1 
ATOM   1177 C  CB    . GLN D 4 36  ? -11.100 14.660  59.025 1.00 35.52  ? 36  GLN D CB    1 
ATOM   1178 C  CG    . GLN D 4 36  ? -12.566 14.336  59.133 1.00 32.03  ? 36  GLN D CG    1 
ATOM   1179 C  CD    . GLN D 4 36  ? -13.244 14.351  57.806 1.00 30.40  ? 36  GLN D CD    1 
ATOM   1180 O  OE1   . GLN D 4 36  ? -13.512 15.403  57.235 1.00 32.56  ? 36  GLN D OE1   1 
ATOM   1181 N  NE2   . GLN D 4 36  ? -13.511 13.181  57.289 1.00 30.22  ? 36  GLN D NE2   1 
ATOM   1182 N  N     . LEU D 4 37  ? -8.919  15.760  57.578 1.00 38.08  ? 37  LEU D N     1 
ATOM   1183 C  CA    . LEU D 4 37  ? -8.207  16.781  56.803 1.00 36.64  ? 37  LEU D CA    1 
ATOM   1184 C  C     . LEU D 4 37  ? -7.473  16.190  55.608 1.00 36.08  ? 37  LEU D C     1 
ATOM   1185 O  O     . LEU D 4 37  ? -7.530  16.717  54.489 1.00 35.18  ? 37  LEU D O     1 
ATOM   1186 C  CB    . LEU D 4 37  ? -7.238  17.545  57.708 1.00 36.79  ? 37  LEU D CB    1 
ATOM   1187 C  CG    . LEU D 4 37  ? -7.937  18.138  58.943 1.00 39.83  ? 37  LEU D CG    1 
ATOM   1188 C  CD1   . LEU D 4 37  ? -6.966  18.945  59.751 1.00 38.27  ? 37  LEU D CD1   1 
ATOM   1189 C  CD2   . LEU D 4 37  ? -9.125  19.020  58.512 1.00 41.74  ? 37  LEU D CD2   1 
ATOM   1190 N  N     . ALA D 4 38  ? -6.785  15.087  55.828 1.00 35.26  ? 38  ALA D N     1 
ATOM   1191 C  CA    . ALA D 4 38  ? -6.088  14.457  54.729 1.00 37.35  ? 38  ALA D CA    1 
ATOM   1192 C  C     . ALA D 4 38  ? -7.127  14.174  53.636 1.00 40.06  ? 38  ALA D C     1 
ATOM   1193 O  O     . ALA D 4 38  ? -6.909  14.435  52.443 1.00 42.03  ? 38  ALA D O     1 
ATOM   1194 C  CB    . ALA D 4 38  ? -5.468  13.171  55.205 1.00 36.46  ? 38  ALA D CB    1 
ATOM   1195 N  N     . LEU D 4 39  ? -8.271  13.657  54.074 1.00 39.82  ? 39  LEU D N     1 
ATOM   1196 C  CA    . LEU D 4 39  ? -9.378  13.295  53.201 1.00 38.45  ? 39  LEU D CA    1 
ATOM   1197 C  C     . LEU D 4 39  ? -10.008 14.495  52.512 1.00 38.87  ? 39  LEU D C     1 
ATOM   1198 O  O     . LEU D 4 39  ? -10.277 14.459  51.301 1.00 39.61  ? 39  LEU D O     1 
ATOM   1199 C  CB    . LEU D 4 39  ? -10.430 12.561  54.023 1.00 39.10  ? 39  LEU D CB    1 
ATOM   1200 C  CG    . LEU D 4 39  ? -11.227 11.431  53.397 1.00 38.91  ? 39  LEU D CG    1 
ATOM   1201 C  CD1   . LEU D 4 39  ? -10.317 10.492  52.645 1.00 40.41  ? 39  LEU D CD1   1 
ATOM   1202 C  CD2   . LEU D 4 39  ? -11.929 10.683  54.509 1.00 41.36  ? 39  LEU D CD2   1 
ATOM   1203 N  N     . GLU D 4 40  ? -10.270 15.553  53.271 1.00 36.79  ? 40  GLU D N     1 
ATOM   1204 C  CA    . GLU D 4 40  ? -10.866 16.730  52.669 1.00 38.42  ? 40  GLU D CA    1 
ATOM   1205 C  C     . GLU D 4 40  ? -9.905  17.228  51.626 1.00 39.90  ? 40  GLU D C     1 
ATOM   1206 O  O     . GLU D 4 40  ? -10.287 17.553  50.513 1.00 39.46  ? 40  GLU D O     1 
ATOM   1207 C  CB    . GLU D 4 40  ? -11.122 17.808  53.718 1.00 38.59  ? 40  GLU D CB    1 
ATOM   1208 C  CG    . GLU D 4 40  ? -12.377 17.537  54.543 1.00 42.31  ? 40  GLU D CG    1 
ATOM   1209 C  CD    . GLU D 4 40  ? -12.645 18.576  55.617 1.00 43.55  ? 40  GLU D CD    1 
ATOM   1210 O  OE1   . GLU D 4 40  ? -12.519 19.786  55.335 1.00 41.72  ? 40  GLU D OE1   1 
ATOM   1211 O  OE2   . GLU D 4 40  ? -13.002 18.175  56.747 1.00 46.45  ? 40  GLU D OE2   1 
ATOM   1212 N  N     . HIS D 4 41  ? -8.633  17.252  51.985 1.00 43.03  ? 41  HIS D N     1 
ATOM   1213 C  CA    . HIS D 4 41  ? -7.621  17.717  51.072 1.00 44.23  ? 41  HIS D CA    1 
ATOM   1214 C  C     . HIS D 4 41  ? -7.533  16.832  49.843 1.00 42.78  ? 41  HIS D C     1 
ATOM   1215 O  O     . HIS D 4 41  ? -7.338  17.310  48.724 1.00 42.57  ? 41  HIS D O     1 
ATOM   1216 C  CB    . HIS D 4 41  ? -6.273  17.767  51.767 1.00 49.78  ? 41  HIS D CB    1 
ATOM   1217 C  CG    . HIS D 4 41  ? -5.131  17.907  50.819 1.00 56.57  ? 41  HIS D CG    1 
ATOM   1218 N  ND1   . HIS D 4 41  ? -4.266  16.869  50.541 1.00 60.09  ? 41  HIS D ND1   1 
ATOM   1219 C  CD2   . HIS D 4 41  ? -4.773  18.928  50.005 1.00 59.07  ? 41  HIS D CD2   1 
ATOM   1220 C  CE1   . HIS D 4 41  ? -3.428  17.245  49.590 1.00 63.10  ? 41  HIS D CE1   1 
ATOM   1221 N  NE2   . HIS D 4 41  ? -3.714  18.489  49.247 1.00 62.89  ? 41  HIS D NE2   1 
ATOM   1222 N  N     . GLU D 4 42  ? -7.671  15.534  50.032 1.00 40.93  ? 42  GLU D N     1 
ATOM   1223 C  CA    . GLU D 4 42  ? -7.585  14.673  48.873 1.00 41.39  ? 42  GLU D CA    1 
ATOM   1224 C  C     . GLU D 4 42  ? -8.681  15.021  47.872 1.00 41.61  ? 42  GLU D C     1 
ATOM   1225 O  O     . GLU D 4 42  ? -8.451  15.004  46.664 1.00 40.16  ? 42  GLU D O     1 
ATOM   1226 C  CB    . GLU D 4 42  ? -7.707  13.196  49.260 1.00 39.34  ? 42  GLU D CB    1 
ATOM   1227 C  CG    . GLU D 4 42  ? -7.787  12.334  48.023 1.00 42.11  ? 42  GLU D CG    1 
ATOM   1228 C  CD    . GLU D 4 42  ? -8.012  10.880  48.310 1.00 45.27  ? 42  GLU D CD    1 
ATOM   1229 O  OE1   . GLU D 4 42  ? -7.988  10.084  47.340 1.00 49.33  ? 42  GLU D OE1   1 
ATOM   1230 O  OE2   . GLU D 4 42  ? -8.212  10.525  49.491 1.00 47.29  ? 42  GLU D OE2   1 
ATOM   1231 N  N     . SER D 4 43  ? -9.872  15.320  48.390 1.00 42.42  ? 43  SER D N     1 
ATOM   1232 C  CA    . SER D 4 43  ? -11.028 15.653  47.563 1.00 43.28  ? 43  SER D CA    1 
ATOM   1233 C  C     . SER D 4 43  ? -10.724 16.834  46.658 1.00 43.11  ? 43  SER D C     1 
ATOM   1234 O  O     . SER D 4 43  ? -11.118 16.867  45.500 1.00 41.44  ? 43  SER D O     1 
ATOM   1235 C  CB    . SER D 4 43  ? -12.240 15.968  48.455 1.00 44.25  ? 43  SER D CB    1 
ATOM   1236 O  OG    . SER D 4 43  ? -12.610 14.856  49.263 1.00 44.19  ? 43  SER D OG    1 
ATOM   1237 N  N     . TYR D 4 44  ? -10.011 17.806  47.200 1.00 45.98  ? 44  TYR D N     1 
ATOM   1238 C  CA    . TYR D 4 44  ? -9.616  18.996  46.459 1.00 49.55  ? 44  TYR D CA    1 
ATOM   1239 C  C     . TYR D 4 44  ? -8.646  18.542  45.368 1.00 50.62  ? 44  TYR D C     1 
ATOM   1240 O  O     . TYR D 4 44  ? -8.804  18.844  44.188 1.00 51.00  ? 44  TYR D O     1 
ATOM   1241 C  CB    . TYR D 4 44  ? -8.925  19.945  47.418 1.00 52.97  ? 44  TYR D CB    1 
ATOM   1242 C  CG    . TYR D 4 44  ? -8.578  21.279  46.844 1.00 58.49  ? 44  TYR D CG    1 
ATOM   1243 C  CD1   . TYR D 4 44  ? -9.481  22.336  46.897 1.00 60.01  ? 44  TYR D CD1   1 
ATOM   1244 C  CD2   . TYR D 4 44  ? -7.317  21.506  46.289 1.00 60.39  ? 44  TYR D CD2   1 
ATOM   1245 C  CE1   . TYR D 4 44  ? -9.130  23.593  46.416 1.00 63.09  ? 44  TYR D CE1   1 
ATOM   1246 C  CE2   . TYR D 4 44  ? -6.958  22.747  45.806 1.00 62.04  ? 44  TYR D CE2   1 
ATOM   1247 C  CZ    . TYR D 4 44  ? -7.862  23.787  45.872 1.00 63.54  ? 44  TYR D CZ    1 
ATOM   1248 O  OH    . TYR D 4 44  ? -7.488  25.023  45.396 1.00 67.25  ? 44  TYR D OH    1 
ATOM   1249 N  N     . GLU D 4 45  ? -7.634  17.803  45.794 1.00 51.83  ? 45  GLU D N     1 
ATOM   1250 C  CA    . GLU D 4 45  ? -6.629  17.252  44.907 1.00 51.21  ? 45  GLU D CA    1 
ATOM   1251 C  C     . GLU D 4 45  ? -7.318  16.481  43.775 1.00 49.99  ? 45  GLU D C     1 
ATOM   1252 O  O     . GLU D 4 45  ? -7.142  16.806  42.613 1.00 50.46  ? 45  GLU D O     1 
ATOM   1253 C  CB    . GLU D 4 45  ? -5.711  16.345  45.738 1.00 55.12  ? 45  GLU D CB    1 
ATOM   1254 C  CG    . GLU D 4 45  ? -4.828  15.374  44.981 1.00 60.81  ? 45  GLU D CG    1 
ATOM   1255 C  CD    . GLU D 4 45  ? -4.723  14.020  45.692 1.00 64.88  ? 45  GLU D CD    1 
ATOM   1256 O  OE1   . GLU D 4 45  ? -4.440  14.012  46.919 1.00 66.32  ? 45  GLU D OE1   1 
ATOM   1257 O  OE2   . GLU D 4 45  ? -4.926  12.969  45.024 1.00 64.80  ? 45  GLU D OE2   1 
ATOM   1258 N  N     . MET D 4 46  ? -8.116  15.472  44.108 1.00 50.32  ? 46  MET D N     1 
ATOM   1259 C  CA    . MET D 4 46  ? -8.812  14.680  43.087 1.00 50.47  ? 46  MET D CA    1 
ATOM   1260 C  C     . MET D 4 46  ? -9.611  15.548  42.144 1.00 49.45  ? 46  MET D C     1 
ATOM   1261 O  O     . MET D 4 46  ? -9.618  15.319  40.940 1.00 48.16  ? 46  MET D O     1 
ATOM   1262 C  CB    . MET D 4 46  ? -9.773  13.680  43.721 1.00 53.03  ? 46  MET D CB    1 
ATOM   1263 C  CG    . MET D 4 46  ? -9.114  12.625  44.573 1.00 58.96  ? 46  MET D CG    1 
ATOM   1264 S  SD    . MET D 4 46  ? -10.356 11.672  45.459 1.00 67.50  ? 46  MET D SD    1 
ATOM   1265 C  CE    . MET D 4 46  ? -11.170 10.843  44.068 1.00 64.13  ? 46  MET D CE    1 
ATOM   1266 N  N     . GLY D 4 47  ? -10.308 16.531  42.702 1.00 49.83  ? 47  GLY D N     1 
ATOM   1267 C  CA    . GLY D 4 47  ? -11.109 17.415  41.884 1.00 50.67  ? 47  GLY D CA    1 
ATOM   1268 C  C     . GLY D 4 47  ? -10.239 18.154  40.896 1.00 53.46  ? 47  GLY D C     1 
ATOM   1269 O  O     . GLY D 4 47  ? -10.557 18.222  39.706 1.00 53.78  ? 47  GLY D O     1 
ATOM   1270 N  N     . GLU D 4 48  ? -9.128  18.697  41.397 1.00 55.48  ? 48  GLU D N     1 
ATOM   1271 C  CA    . GLU D 4 48  ? -8.180  19.448  40.589 1.00 56.07  ? 48  GLU D CA    1 
ATOM   1272 C  C     . GLU D 4 48  ? -7.634  18.572  39.468 1.00 55.83  ? 48  GLU D C     1 
ATOM   1273 O  O     . GLU D 4 48  ? -7.449  19.024  38.342 1.00 55.73  ? 48  GLU D O     1 
ATOM   1274 C  CB    . GLU D 4 48  ? -7.051  19.957  41.476 1.00 58.58  ? 48  GLU D CB    1 
ATOM   1275 C  CG    . GLU D 4 48  ? -6.292  21.131  40.894 1.00 66.23  ? 48  GLU D CG    1 
ATOM   1276 C  CD    . GLU D 4 48  ? -5.644  22.006  41.968 1.00 70.40  ? 48  GLU D CD    1 
ATOM   1277 O  OE1   . GLU D 4 48  ? -6.367  22.534  42.843 1.00 71.47  ? 48  GLU D OE1   1 
ATOM   1278 O  OE2   . GLU D 4 48  ? -4.407  22.170  41.935 1.00 74.06  ? 48  GLU D OE2   1 
ATOM   1279 N  N     . ALA D 4 49  ? -7.385  17.310  39.777 1.00 55.63  ? 49  ALA D N     1 
ATOM   1280 C  CA    . ALA D 4 49  ? -6.883  16.392  38.776 1.00 57.07  ? 49  ALA D CA    1 
ATOM   1281 C  C     . ALA D 4 49  ? -7.921  16.298  37.679 1.00 59.14  ? 49  ALA D C     1 
ATOM   1282 O  O     . ALA D 4 49  ? -7.652  16.631  36.526 1.00 60.38  ? 49  ALA D O     1 
ATOM   1283 C  CB    . ALA D 4 49  ? -6.653  15.020  39.386 1.00 56.06  ? 49  ALA D CB    1 
ATOM   1284 N  N     . ARG D 4 50  ? -9.117  15.853  38.059 1.00 61.22  ? 50  ARG D N     1 
ATOM   1285 C  CA    . ARG D 4 50  ? -10.232 15.674  37.134 1.00 62.25  ? 50  ARG D CA    1 
ATOM   1286 C  C     . ARG D 4 50  ? -10.394 16.868  36.205 1.00 63.39  ? 50  ARG D C     1 
ATOM   1287 O  O     . ARG D 4 50  ? -10.807 16.726  35.058 1.00 62.60  ? 50  ARG D O     1 
ATOM   1288 C  CB    . ARG D 4 50  ? -11.527 15.439  37.917 1.00 60.38  ? 50  ARG D CB    1 
ATOM   1289 C  CG    . ARG D 4 50  ? -12.422 16.634  37.997 1.00 59.75  ? 50  ARG D CG    1 
ATOM   1290 C  CD    . ARG D 4 50  ? -13.750 16.325  37.366 1.00 58.88  ? 50  ARG D CD    1 
ATOM   1291 N  NE    . ARG D 4 50  ? -14.688 15.743  38.321 1.00 58.63  ? 50  ARG D NE    1 
ATOM   1292 C  CZ    . ARG D 4 50  ? -15.139 16.370  39.405 1.00 57.66  ? 50  ARG D CZ    1 
ATOM   1293 N  NH1   . ARG D 4 50  ? -14.735 17.611  39.690 1.00 55.36  ? 50  ARG D NH1   1 
ATOM   1294 N  NH2   . ARG D 4 50  ? -16.007 15.759  40.196 1.00 57.05  ? 50  ARG D NH2   1 
ATOM   1295 N  N     . PHE D 4 51  ? -10.076 18.048  36.715 1.00 65.73  ? 51  PHE D N     1 
ATOM   1296 C  CA    . PHE D 4 51  ? -10.168 19.249  35.913 1.00 69.00  ? 51  PHE D CA    1 
ATOM   1297 C  C     . PHE D 4 51  ? -9.030  19.196  34.908 1.00 71.84  ? 51  PHE D C     1 
ATOM   1298 O  O     . PHE D 4 51  ? -9.267  19.189  33.702 1.00 74.45  ? 51  PHE D O     1 
ATOM   1299 C  CB    . PHE D 4 51  ? -10.022 20.491  36.786 1.00 68.50  ? 51  PHE D CB    1 
ATOM   1300 C  CG    . PHE D 4 51  ? -10.081 21.775  36.019 1.00 68.84  ? 51  PHE D CG    1 
ATOM   1301 C  CD1   . PHE D 4 51  ? -11.291 22.260  35.543 1.00 68.00  ? 51  PHE D CD1   1 
ATOM   1302 C  CD2   . PHE D 4 51  ? -8.924  22.506  35.773 1.00 69.17  ? 51  PHE D CD2   1 
ATOM   1303 C  CE1   . PHE D 4 51  ? -11.349 23.456  34.837 1.00 67.76  ? 51  PHE D CE1   1 
ATOM   1304 C  CE2   . PHE D 4 51  ? -8.972  23.702  35.070 1.00 68.89  ? 51  PHE D CE2   1 
ATOM   1305 C  CZ    . PHE D 4 51  ? -10.189 24.178  34.601 1.00 68.52  ? 51  PHE D CZ    1 
ATOM   1306 N  N     . ARG D 4 52  ? -7.796  19.148  35.412 1.00 73.56  ? 52  ARG D N     1 
ATOM   1307 C  CA    . ARG D 4 52  ? -6.615  19.092  34.560 1.00 74.89  ? 52  ARG D CA    1 
ATOM   1308 C  C     . ARG D 4 52  ? -6.777  18.097  33.424 1.00 75.09  ? 52  ARG D C     1 
ATOM   1309 O  O     . ARG D 4 52  ? -6.774  18.486  32.259 1.00 75.41  ? 52  ARG D O     1 
ATOM   1310 C  CB    . ARG D 4 52  ? -5.371  18.752  35.384 1.00 77.01  ? 52  ARG D CB    1 
ATOM   1311 C  CG    . ARG D 4 52  ? -4.818  19.942  36.158 1.00 80.22  ? 52  ARG D CG    1 
ATOM   1312 C  CD    . ARG D 4 52  ? -4.437  21.068  35.199 1.00 83.33  ? 52  ARG D CD    1 
ATOM   1313 N  NE    . ARG D 4 52  ? -4.146  22.329  35.879 1.00 84.83  ? 52  ARG D NE    1 
ATOM   1314 C  CZ    . ARG D 4 52  ? -3.879  23.469  35.249 1.00 85.84  ? 52  ARG D CZ    1 
ATOM   1315 N  NH1   . ARG D 4 52  ? -3.864  23.509  33.921 1.00 86.29  ? 52  ARG D NH1   1 
ATOM   1316 N  NH2   . ARG D 4 52  ? -3.627  24.571  35.944 1.00 85.93  ? 52  ARG D NH2   1 
ATOM   1317 N  N     . LYS D 4 53  ? -6.925  16.819  33.749 1.00 75.86  ? 53  LYS D N     1 
ATOM   1318 C  CA    . LYS D 4 53  ? -7.098  15.810  32.711 1.00 77.53  ? 53  LYS D CA    1 
ATOM   1319 C  C     . LYS D 4 53  ? -7.988  16.370  31.600 1.00 78.99  ? 53  LYS D C     1 
ATOM   1320 O  O     . LYS D 4 53  ? -7.639  16.331  30.418 1.00 79.26  ? 53  LYS D O     1 
ATOM   1321 C  CB    . LYS D 4 53  ? -7.713  14.537  33.308 1.00 76.50  ? 53  LYS D CB    1 
ATOM   1322 C  CG    . LYS D 4 53  ? -8.387  13.612  32.301 1.00 78.01  ? 53  LYS D CG    1 
ATOM   1323 C  CD    . LYS D 4 53  ? -9.827  14.055  32.026 1.00 79.94  ? 53  LYS D CD    1 
ATOM   1324 C  CE    . LYS D 4 53  ? -10.512 13.224  30.939 1.00 81.11  ? 53  LYS D CE    1 
ATOM   1325 N  NZ    . LYS D 4 53  ? -9.974  13.497  29.575 1.00 80.97  ? 53  LYS D NZ    1 
ATOM   1326 N  N     . MET D 4 54  ? -9.132  16.913  31.995 1.00 80.75  ? 54  MET D N     1 
ATOM   1327 C  CA    . MET D 4 54  ? -10.079 17.477  31.051 1.00 82.25  ? 54  MET D CA    1 
ATOM   1328 C  C     . MET D 4 54  ? -9.483  18.681  30.345 1.00 83.03  ? 54  MET D C     1 
ATOM   1329 O  O     . MET D 4 54  ? -9.357  18.692  29.125 1.00 83.41  ? 54  MET D O     1 
ATOM   1330 C  CB    . MET D 4 54  ? -11.351 17.895  31.775 1.00 82.44  ? 54  MET D CB    1 
ATOM   1331 C  CG    . MET D 4 54  ? -12.321 18.633  30.896 1.00 84.67  ? 54  MET D CG    1 
ATOM   1332 S  SD    . MET D 4 54  ? -13.280 19.802  31.844 1.00 87.71  ? 54  MET D SD    1 
ATOM   1333 C  CE    . MET D 4 54  ? -12.067 21.126  32.044 1.00 86.24  ? 54  MET D CE    1 
ATOM   1334 N  N     . PHE D 4 55  ? -9.122  19.698  31.115 1.00 84.25  ? 55  PHE D N     1 
ATOM   1335 C  CA    . PHE D 4 55  ? -8.541  20.906  30.546 1.00 86.13  ? 55  PHE D CA    1 
ATOM   1336 C  C     . PHE D 4 55  ? -7.393  20.593  29.598 1.00 88.13  ? 55  PHE D C     1 
ATOM   1337 O  O     . PHE D 4 55  ? -7.090  21.374  28.701 1.00 88.28  ? 55  PHE D O     1 
ATOM   1338 C  CB    . PHE D 4 55  ? -8.053  21.841  31.653 1.00 84.97  ? 55  PHE D CB    1 
ATOM   1339 C  CG    . PHE D 4 55  ? -7.290  23.024  31.145 1.00 84.28  ? 55  PHE D CG    1 
ATOM   1340 C  CD1   . PHE D 4 55  ? -5.900  23.000  31.091 1.00 84.48  ? 55  PHE D CD1   1 
ATOM   1341 C  CD2   . PHE D 4 55  ? -7.960  24.150  30.684 1.00 83.77  ? 55  PHE D CD2   1 
ATOM   1342 C  CE1   . PHE D 4 55  ? -5.188  24.077  30.583 1.00 83.91  ? 55  PHE D CE1   1 
ATOM   1343 C  CE2   . PHE D 4 55  ? -7.258  25.234  30.174 1.00 83.87  ? 55  PHE D CE2   1 
ATOM   1344 C  CZ    . PHE D 4 55  ? -5.868  25.197  30.123 1.00 84.23  ? 55  PHE D CZ    1 
ATOM   1345 N  N     . GLU D 4 56  ? -6.743  19.455  29.802 1.00 90.54  ? 56  GLU D N     1 
ATOM   1346 C  CA    . GLU D 4 56  ? -5.652  19.069  28.928 1.00 93.19  ? 56  GLU D CA    1 
ATOM   1347 C  C     . GLU D 4 56  ? -6.240  18.463  27.664 1.00 95.07  ? 56  GLU D C     1 
ATOM   1348 O  O     . GLU D 4 56  ? -5.981  18.937  26.558 1.00 95.44  ? 56  GLU D O     1 
ATOM   1349 C  CB    . GLU D 4 56  ? -4.729  18.076  29.635 1.00 93.77  ? 56  GLU D CB    1 
ATOM   1350 C  CG    . GLU D 4 56  ? -3.742  18.755  30.581 1.00 95.05  ? 56  GLU D CG    1 
ATOM   1351 C  CD    . GLU D 4 56  ? -2.914  17.771  31.388 1.00 95.25  ? 56  GLU D CD    1 
ATOM   1352 O  OE1   . GLU D 4 56  ? -2.365  16.818  30.794 1.00 96.05  ? 56  GLU D OE1   1 
ATOM   1353 O  OE2   . GLU D 4 56  ? -2.805  17.963  32.618 1.00 95.67  ? 56  GLU D OE2   1 
ATOM   1354 N  N     . ARG D 4 57  ? -7.054  17.428  27.829 1.00 97.27  ? 57  ARG D N     1 
ATOM   1355 C  CA    . ARG D 4 57  ? -7.680  16.783  26.683 1.00 99.41  ? 57  ARG D CA    1 
ATOM   1356 C  C     . ARG D 4 57  ? -8.437  17.823  25.867 1.00 99.44  ? 57  ARG D C     1 
ATOM   1357 O  O     . ARG D 4 57  ? -8.773  17.588  24.713 1.00 99.78  ? 57  ARG D O     1 
ATOM   1358 C  CB    . ARG D 4 57  ? -8.646  15.687  27.145 1.00 101.54 ? 57  ARG D CB    1 
ATOM   1359 C  CG    . ARG D 4 57  ? -9.896  16.198  27.861 1.00 104.94 ? 57  ARG D CG    1 
ATOM   1360 C  CD    . ARG D 4 57  ? -10.975 16.683  26.890 1.00 106.71 ? 57  ARG D CD    1 
ATOM   1361 N  NE    . ARG D 4 57  ? -11.632 15.575  26.200 1.00 108.28 ? 57  ARG D NE    1 
ATOM   1362 C  CZ    . ARG D 4 57  ? -12.635 15.717  25.337 1.00 109.52 ? 57  ARG D CZ    1 
ATOM   1363 N  NH1   . ARG D 4 57  ? -13.104 16.927  25.049 1.00 109.48 ? 57  ARG D NH1   1 
ATOM   1364 N  NH2   . ARG D 4 57  ? -13.176 14.645  24.769 1.00 110.02 ? 57  ARG D NH2   1 
ATOM   1365 N  N     . GLN D 4 58  ? -8.713  18.968  26.480 1.00 100.17 ? 58  GLN D N     1 
ATOM   1366 C  CA    . GLN D 4 58  ? -9.431  20.038  25.802 1.00 101.30 ? 58  GLN D CA    1 
ATOM   1367 C  C     . GLN D 4 58  ? -8.545  20.728  24.786 1.00 101.59 ? 58  GLN D C     1 
ATOM   1368 O  O     . GLN D 4 58  ? -8.929  20.896  23.632 1.00 101.52 ? 58  GLN D O     1 
ATOM   1369 C  CB    . GLN D 4 58  ? -9.945  21.066  26.812 1.00 102.31 ? 58  GLN D CB    1 
ATOM   1370 C  CG    . GLN D 4 58  ? -11.136 20.595  27.628 1.00 103.36 ? 58  GLN D CG    1 
ATOM   1371 C  CD    . GLN D 4 58  ? -12.315 20.219  26.755 1.00 103.75 ? 58  GLN D CD    1 
ATOM   1372 O  OE1   . GLN D 4 58  ? -12.250 19.266  25.973 1.00 103.16 ? 58  GLN D OE1   1 
ATOM   1373 N  NE2   . GLN D 4 58  ? -13.403 20.972  26.879 1.00 103.92 ? 58  GLN D NE2   1 
ATOM   1374 N  N     . LEU D 4 59  ? -7.358  21.133  25.219 1.00 102.48 ? 59  LEU D N     1 
ATOM   1375 C  CA    . LEU D 4 59  ? -6.428  21.798  24.322 1.00 103.96 ? 59  LEU D CA    1 
ATOM   1376 C  C     . LEU D 4 59  ? -5.671  20.762  23.501 1.00 104.67 ? 59  LEU D C     1 
ATOM   1377 O  O     . LEU D 4 59  ? -5.235  21.043  22.384 1.00 104.88 ? 59  LEU D O     1 
ATOM   1378 C  CB    . LEU D 4 59  ? -5.461  22.680  25.115 1.00 103.71 ? 59  LEU D CB    1 
ATOM   1379 C  CG    . LEU D 4 59  ? -4.655  22.054  26.249 1.00 104.61 ? 59  LEU D CG    1 
ATOM   1380 C  CD1   . LEU D 4 59  ? -3.475  21.269  25.685 1.00 105.45 ? 59  LEU D CD1   1 
ATOM   1381 C  CD2   . LEU D 4 59  ? -4.163  23.161  27.169 1.00 104.89 ? 59  LEU D CD2   1 
ATOM   1382 N  N     . LYS D 4 60  ? -5.527  19.559  24.050 1.00 105.31 ? 60  LYS D N     1 
ATOM   1383 C  CA    . LYS D 4 60  ? -4.840  18.487  23.340 1.00 106.66 ? 60  LYS D CA    1 
ATOM   1384 C  C     . LYS D 4 60  ? -5.734  18.015  22.196 1.00 107.07 ? 60  LYS D C     1 
ATOM   1385 O  O     . LYS D 4 60  ? -5.499  16.965  21.595 1.00 107.65 ? 60  LYS D O     1 
ATOM   1386 C  CB    . LYS D 4 60  ? -4.533  17.319  24.286 1.00 107.79 ? 60  LYS D CB    1 
ATOM   1387 C  CG    . LYS D 4 60  ? -3.478  17.632  25.349 1.00 109.56 ? 60  LYS D CG    1 
ATOM   1388 C  CD    . LYS D 4 60  ? -3.206  16.429  26.250 1.00 110.15 ? 60  LYS D CD    1 
ATOM   1389 C  CE    . LYS D 4 60  ? -2.104  16.726  27.264 1.00 110.42 ? 60  LYS D CE    1 
ATOM   1390 N  NZ    . LYS D 4 60  ? -1.832  15.565  28.166 1.00 109.94 ? 60  LYS D NZ    1 
ATOM   1391 N  N     . ALA D 4 61  ? -6.765  18.809  21.915 1.00 106.63 ? 61  ALA D N     1 
ATOM   1392 C  CA    . ALA D 4 61  ? -7.722  18.534  20.848 1.00 105.37 ? 61  ALA D CA    1 
ATOM   1393 C  C     . ALA D 4 61  ? -8.320  19.865  20.397 1.00 104.76 ? 61  ALA D C     1 
ATOM   1394 O  O     . ALA D 4 61  ? -9.511  19.959  20.098 1.00 104.38 ? 61  ALA D O     1 
ATOM   1395 C  CB    . ALA D 4 61  ? -8.817  17.604  21.348 1.00 104.67 ? 61  ALA D CB    1 
ATOM   1396 N  N     . GLY D 4 62  ? -7.470  20.890  20.367 1.00 103.83 ? 62  GLY D N     1 
ATOM   1397 C  CA    . GLY D 4 62  ? -7.882  22.220  19.954 1.00 103.22 ? 62  GLY D CA    1 
ATOM   1398 C  C     . GLY D 4 62  ? -9.304  22.592  20.315 1.00 102.76 ? 62  GLY D C     1 
ATOM   1399 O  O     . GLY D 4 62  ? -10.209 22.479  19.490 1.00 102.63 ? 62  GLY D O     1 
ATOM   1400 N  N     . GLU D 4 63  ? -9.499  23.039  21.550 1.00 102.59 ? 63  GLU D N     1 
ATOM   1401 C  CA    . GLU D 4 63  ? -10.820 23.438  22.030 1.00 102.04 ? 63  GLU D CA    1 
ATOM   1402 C  C     . GLU D 4 63  ? -10.728 24.205  23.347 1.00 99.99  ? 63  GLU D C     1 
ATOM   1403 O  O     . GLU D 4 63  ? -11.610 24.113  24.200 1.00 98.76  ? 63  GLU D O     1 
ATOM   1404 C  CB    . GLU D 4 63  ? -11.725 22.209  22.197 1.00 103.62 ? 63  GLU D CB    1 
ATOM   1405 C  CG    . GLU D 4 63  ? -12.558 21.885  20.957 1.00 106.28 ? 63  GLU D CG    1 
ATOM   1406 C  CD    . GLU D 4 63  ? -13.486 20.694  21.150 1.00 108.00 ? 63  GLU D CD    1 
ATOM   1407 O  OE1   . GLU D 4 63  ? -14.401 20.515  20.315 1.00 108.82 ? 63  GLU D OE1   1 
ATOM   1408 O  OE2   . GLU D 4 63  ? -13.298 19.936  22.127 1.00 108.37 ? 63  GLU D OE2   1 
ATOM   1409 N  N     . VAL D 4 64  ? -9.655  24.973  23.492 1.00 98.26  ? 64  VAL D N     1 
ATOM   1410 C  CA    . VAL D 4 64  ? -9.425  25.760  24.693 1.00 96.76  ? 64  VAL D CA    1 
ATOM   1411 C  C     . VAL D 4 64  ? -10.516 26.798  24.904 1.00 95.49  ? 64  VAL D C     1 
ATOM   1412 O  O     . VAL D 4 64  ? -11.103 26.881  25.979 1.00 95.43  ? 64  VAL D O     1 
ATOM   1413 C  CB    . VAL D 4 64  ? -8.072  26.487  24.618 1.00 96.74  ? 64  VAL D CB    1 
ATOM   1414 C  CG1   . VAL D 4 64  ? -7.853  27.325  25.865 1.00 96.50  ? 64  VAL D CG1   1 
ATOM   1415 C  CG2   . VAL D 4 64  ? -6.965  25.477  24.459 1.00 97.17  ? 64  VAL D CG2   1 
ATOM   1416 N  N     . ALA D 4 65  ? -10.778 27.590  23.873 1.00 94.01  ? 65  ALA D N     1 
ATOM   1417 C  CA    . ALA D 4 65  ? -11.787 28.637  23.947 1.00 92.23  ? 65  ALA D CA    1 
ATOM   1418 C  C     . ALA D 4 65  ? -13.039 28.201  24.709 1.00 91.16  ? 65  ALA D C     1 
ATOM   1419 O  O     . ALA D 4 65  ? -13.683 29.017  25.365 1.00 91.03  ? 65  ALA D O     1 
ATOM   1420 C  CB    . ALA D 4 65  ? -12.156 29.091  22.544 1.00 92.23  ? 65  ALA D CB    1 
ATOM   1421 N  N     . ASP D 4 66  ? -13.379 26.917  24.627 1.00 89.32  ? 66  ASP D N     1 
ATOM   1422 C  CA    . ASP D 4 66  ? -14.559 26.401  25.314 1.00 86.99  ? 66  ASP D CA    1 
ATOM   1423 C  C     . ASP D 4 66  ? -14.384 26.397  26.826 1.00 84.62  ? 66  ASP D C     1 
ATOM   1424 O  O     . ASP D 4 66  ? -15.256 26.851  27.560 1.00 85.39  ? 66  ASP D O     1 
ATOM   1425 C  CB    . ASP D 4 66  ? -14.874 24.977  24.850 1.00 88.39  ? 66  ASP D CB    1 
ATOM   1426 C  CG    . ASP D 4 66  ? -15.110 24.887  23.354 1.00 90.59  ? 66  ASP D CG    1 
ATOM   1427 O  OD1   . ASP D 4 66  ? -15.880 25.712  22.812 1.00 92.34  ? 66  ASP D OD1   1 
ATOM   1428 O  OD2   . ASP D 4 66  ? -14.532 23.982  22.718 1.00 91.43  ? 66  ASP D OD2   1 
ATOM   1429 N  N     . ASN D 4 67  ? -13.252 25.885  27.289 1.00 81.55  ? 67  ASN D N     1 
ATOM   1430 C  CA    . ASN D 4 67  ? -12.979 25.807  28.720 1.00 78.66  ? 67  ASN D CA    1 
ATOM   1431 C  C     . ASN D 4 67  ? -13.174 27.122  29.471 1.00 77.01  ? 67  ASN D C     1 
ATOM   1432 O  O     . ASN D 4 67  ? -12.793 28.196  29.007 1.00 75.80  ? 67  ASN D O     1 
ATOM   1433 C  CB    . ASN D 4 67  ? -11.559 25.282  28.956 1.00 77.33  ? 67  ASN D CB    1 
ATOM   1434 C  CG    . ASN D 4 67  ? -11.262 25.033  30.423 1.00 75.17  ? 67  ASN D CG    1 
ATOM   1435 O  OD1   . ASN D 4 67  ? -11.156 25.968  31.217 1.00 72.89  ? 67  ASN D OD1   1 
ATOM   1436 N  ND2   . ASN D 4 67  ? -11.131 23.763  30.788 1.00 73.67  ? 67  ASN D ND2   1 
ATOM   1437 N  N     . ALA D 4 68  ? -13.776 27.014  30.646 1.00 75.54  ? 68  ALA D N     1 
ATOM   1438 C  CA    . ALA D 4 68  ? -14.031 28.167  31.480 1.00 74.42  ? 68  ALA D CA    1 
ATOM   1439 C  C     . ALA D 4 68  ? -12.835 29.107  31.514 1.00 74.26  ? 68  ALA D C     1 
ATOM   1440 O  O     . ALA D 4 68  ? -12.985 30.310  31.335 1.00 74.06  ? 68  ALA D O     1 
ATOM   1441 C  CB    . ALA D 4 68  ? -14.375 27.711  32.881 1.00 73.45  ? 68  ALA D CB    1 
ATOM   1442 N  N     . ALA D 4 69  ? -11.649 28.546  31.730 1.00 75.48  ? 69  ALA D N     1 
ATOM   1443 C  CA    . ALA D 4 69  ? -10.405 29.319  31.824 1.00 76.04  ? 69  ALA D CA    1 
ATOM   1444 C  C     . ALA D 4 69  ? -10.179 30.405  30.768 1.00 76.61  ? 69  ALA D C     1 
ATOM   1445 O  O     . ALA D 4 69  ? -9.609  31.459  31.064 1.00 75.10  ? 69  ALA D O     1 
ATOM   1446 C  CB    . ALA D 4 69  ? -9.219  28.370  31.837 1.00 75.44  ? 69  ALA D CB    1 
ATOM   1447 N  N     . ALA D 4 70  ? -10.619 30.152  29.542 1.00 77.83  ? 70  ALA D N     1 
ATOM   1448 C  CA    . ALA D 4 70  ? -10.438 31.115  28.465 1.00 79.36  ? 70  ALA D CA    1 
ATOM   1449 C  C     . ALA D 4 70  ? -11.651 32.010  28.232 1.00 80.36  ? 70  ALA D C     1 
ATOM   1450 O  O     . ALA D 4 70  ? -11.544 33.027  27.548 1.00 81.18  ? 70  ALA D O     1 
ATOM   1451 C  CB    . ALA D 4 70  ? -10.083 30.387  27.178 1.00 79.76  ? 70  ALA D CB    1 
ATOM   1452 N  N     . LYS D 4 71  ? -12.795 31.636  28.800 1.00 80.88  ? 71  LYS D N     1 
ATOM   1453 C  CA    . LYS D 4 71  ? -14.031 32.405  28.633 1.00 80.95  ? 71  LYS D CA    1 
ATOM   1454 C  C     . LYS D 4 71  ? -13.891 33.868  29.059 1.00 80.39  ? 71  LYS D C     1 
ATOM   1455 O  O     . LYS D 4 71  ? -14.327 34.769  28.350 1.00 80.18  ? 71  LYS D O     1 
ATOM   1456 C  CB    . LYS D 4 71  ? -15.171 31.746  29.419 1.00 81.49  ? 71  LYS D CB    1 
ATOM   1457 C  CG    . LYS D 4 71  ? -16.569 32.024  28.877 1.00 82.45  ? 71  LYS D CG    1 
ATOM   1458 C  CD    . LYS D 4 71  ? -16.960 33.493  28.982 1.00 83.90  ? 71  LYS D CD    1 
ATOM   1459 C  CE    . LYS D 4 71  ? -17.016 33.960  30.427 1.00 83.93  ? 71  LYS D CE    1 
ATOM   1460 N  NZ    . LYS D 4 71  ? -18.013 33.175  31.204 1.00 85.02  ? 71  LYS D NZ    1 
ATOM   1461 N  N     . PRO D 4 72  ? -13.287 34.124  30.224 1.00 80.24  ? 72  PRO D N     1 
ATOM   1462 C  CA    . PRO D 4 72  ? -13.129 35.508  30.672 1.00 81.27  ? 72  PRO D CA    1 
ATOM   1463 C  C     . PRO D 4 72  ? -12.203 36.310  29.761 1.00 82.49  ? 72  PRO D C     1 
ATOM   1464 O  O     . PRO D 4 72  ? -12.268 37.536  29.727 1.00 82.86  ? 72  PRO D O     1 
ATOM   1465 C  CB    . PRO D 4 72  ? -12.570 35.348  32.077 1.00 80.13  ? 72  PRO D CB    1 
ATOM   1466 C  CG    . PRO D 4 72  ? -11.758 34.118  31.956 1.00 80.66  ? 72  PRO D CG    1 
ATOM   1467 C  CD    . PRO D 4 72  ? -12.666 33.198  31.181 1.00 79.94  ? 72  PRO D CD    1 
ATOM   1468 N  N     . LEU D 4 73  ? -11.329 35.614  29.038 1.00 83.74  ? 73  LEU D N     1 
ATOM   1469 C  CA    . LEU D 4 73  ? -10.418 36.272  28.107 1.00 84.11  ? 73  LEU D CA    1 
ATOM   1470 C  C     . LEU D 4 73  ? -11.241 36.618  26.873 1.00 84.33  ? 73  LEU D C     1 
ATOM   1471 O  O     . LEU D 4 73  ? -11.303 37.777  26.456 1.00 84.57  ? 73  LEU D O     1 
ATOM   1472 C  CB    . LEU D 4 73  ? -9.275  35.335  27.707 1.00 85.11  ? 73  LEU D CB    1 
ATOM   1473 C  CG    . LEU D 4 73  ? -8.353  35.849  26.593 1.00 84.91  ? 73  LEU D CG    1 
ATOM   1474 C  CD1   . LEU D 4 73  ? -7.507  37.010  27.106 1.00 84.28  ? 73  LEU D CD1   1 
ATOM   1475 C  CD2   . LEU D 4 73  ? -7.466  34.720  26.109 1.00 85.09  ? 73  LEU D CD2   1 
ATOM   1476 N  N     . ILE D 4 74  ? -11.874 35.596  26.300 1.00 83.66  ? 74  ILE D N     1 
ATOM   1477 C  CA    . ILE D 4 74  ? -12.719 35.756  25.126 1.00 84.18  ? 74  ILE D CA    1 
ATOM   1478 C  C     . ILE D 4 74  ? -13.658 36.958  25.264 1.00 85.97  ? 74  ILE D C     1 
ATOM   1479 O  O     . ILE D 4 74  ? -13.651 37.854  24.420 1.00 87.11  ? 74  ILE D O     1 
ATOM   1480 C  CB    . ILE D 4 74  ? -13.557 34.483  24.877 1.00 82.90  ? 74  ILE D CB    1 
ATOM   1481 C  CG1   . ILE D 4 74  ? -12.630 33.338  24.475 1.00 81.95  ? 74  ILE D CG1   1 
ATOM   1482 C  CG2   . ILE D 4 74  ? -14.606 34.729  23.801 1.00 82.30  ? 74  ILE D CG2   1 
ATOM   1483 C  CD1   . ILE D 4 74  ? -13.359 32.059  24.108 1.00 82.21  ? 74  ILE D CD1   1 
ATOM   1484 N  N     . THR D 4 75  ? -14.457 36.986  26.327 1.00 86.83  ? 75  THR D N     1 
ATOM   1485 C  CA    . THR D 4 75  ? -15.390 38.090  26.534 1.00 88.25  ? 75  THR D CA    1 
ATOM   1486 C  C     . THR D 4 75  ? -14.689 39.443  26.599 1.00 88.31  ? 75  THR D C     1 
ATOM   1487 O  O     . THR D 4 75  ? -15.294 40.474  26.314 1.00 88.71  ? 75  THR D O     1 
ATOM   1488 C  CB    . THR D 4 75  ? -16.217 37.922  27.838 1.00 88.70  ? 75  THR D CB    1 
ATOM   1489 O  OG1   . THR D 4 75  ? -15.340 37.926  28.972 1.00 90.38  ? 75  THR D OG1   1 
ATOM   1490 C  CG2   . THR D 4 75  ? -17.013 36.623  27.807 1.00 88.88  ? 75  THR D CG2   1 
ATOM   1491 N  N     . THR D 4 76  ? -13.418 39.443  26.978 1.00 88.43  ? 76  THR D N     1 
ATOM   1492 C  CA    . THR D 4 76  ? -12.672 40.688  27.079 1.00 89.35  ? 76  THR D CA    1 
ATOM   1493 C  C     . THR D 4 76  ? -12.216 41.174  25.710 1.00 89.57  ? 76  THR D C     1 
ATOM   1494 O  O     . THR D 4 76  ? -11.976 42.363  25.515 1.00 89.85  ? 76  THR D O     1 
ATOM   1495 C  CB    . THR D 4 76  ? -11.428 40.527  27.976 1.00 90.10  ? 76  THR D CB    1 
ATOM   1496 O  OG1   . THR D 4 76  ? -11.818 40.017  29.257 1.00 90.80  ? 76  THR D OG1   1 
ATOM   1497 C  CG2   . THR D 4 76  ? -10.738 41.870  28.170 1.00 90.40  ? 76  THR D CG2   1 
ATOM   1498 N  N     . LEU D 4 77  ? -12.099 40.253  24.760 1.00 89.78  ? 77  LEU D N     1 
ATOM   1499 C  CA    . LEU D 4 77  ? -11.655 40.614  23.422 1.00 90.18  ? 77  LEU D CA    1 
ATOM   1500 C  C     . LEU D 4 77  ? -12.753 40.506  22.369 1.00 90.70  ? 77  LEU D C     1 
ATOM   1501 O  O     . LEU D 4 77  ? -12.904 41.401  21.538 1.00 90.96  ? 77  LEU D O     1 
ATOM   1502 C  CB    . LEU D 4 77  ? -10.460 39.746  23.010 1.00 89.40  ? 77  LEU D CB    1 
ATOM   1503 C  CG    . LEU D 4 77  ? -9.267  39.722  23.970 1.00 89.32  ? 77  LEU D CG    1 
ATOM   1504 C  CD1   . LEU D 4 77  ? -8.109  39.000  23.301 1.00 88.52  ? 77  LEU D CD1   1 
ATOM   1505 C  CD2   . LEU D 4 77  ? -8.860  41.140  24.357 1.00 88.53  ? 77  LEU D CD2   1 
ATOM   1506 N  N     . LEU D 4 78  ? -13.515 39.416  22.404 1.00 90.24  ? 78  LEU D N     1 
ATOM   1507 C  CA    . LEU D 4 78  ? -14.590 39.199  21.445 1.00 90.52  ? 78  LEU D CA    1 
ATOM   1508 C  C     . LEU D 4 78  ? -15.238 40.512  21.003 1.00 91.93  ? 78  LEU D C     1 
ATOM   1509 O  O     . LEU D 4 78  ? -15.410 40.748  19.809 1.00 92.56  ? 78  LEU D O     1 
ATOM   1510 C  CB    . LEU D 4 78  ? -15.645 38.267  22.041 1.00 90.15  ? 78  LEU D CB    1 
ATOM   1511 C  CG    . LEU D 4 78  ? -16.786 37.790  21.140 1.00 89.90  ? 78  LEU D CG    1 
ATOM   1512 C  CD1   . LEU D 4 78  ? -16.232 37.014  19.959 1.00 90.06  ? 78  LEU D CD1   1 
ATOM   1513 C  CD2   . LEU D 4 78  ? -17.724 36.910  21.945 1.00 89.49  ? 78  LEU D CD2   1 
ATOM   1514 N  N     . PRO D 4 79  ? -15.609 41.385  21.960 1.00 92.66  ? 79  PRO D N     1 
ATOM   1515 C  CA    . PRO D 4 79  ? -16.234 42.671  21.622 1.00 93.01  ? 79  PRO D CA    1 
ATOM   1516 C  C     . PRO D 4 79  ? -15.318 43.631  20.858 1.00 93.87  ? 79  PRO D C     1 
ATOM   1517 O  O     . PRO D 4 79  ? -15.747 44.269  19.902 1.00 93.82  ? 79  PRO D O     1 
ATOM   1518 C  CB    . PRO D 4 79  ? -16.631 43.226  22.988 1.00 91.95  ? 79  PRO D CB    1 
ATOM   1519 C  CG    . PRO D 4 79  ? -16.932 41.999  23.761 1.00 91.81  ? 79  PRO D CG    1 
ATOM   1520 C  CD    . PRO D 4 79  ? -15.761 41.116  23.400 1.00 92.79  ? 79  PRO D CD    1 
ATOM   1521 N  N     . LYS D 4 80  ? -14.062 43.733  21.286 1.00 94.95  ? 80  LYS D N     1 
ATOM   1522 C  CA    . LYS D 4 80  ? -13.095 44.620  20.641 1.00 96.26  ? 80  LYS D CA    1 
ATOM   1523 C  C     . LYS D 4 80  ? -12.895 44.365  19.147 1.00 97.02  ? 80  LYS D C     1 
ATOM   1524 O  O     . LYS D 4 80  ? -12.310 45.193  18.452 1.00 96.50  ? 80  LYS D O     1 
ATOM   1525 C  CB    . LYS D 4 80  ? -11.739 44.537  21.354 1.00 96.67  ? 80  LYS D CB    1 
ATOM   1526 C  CG    . LYS D 4 80  ? -11.691 45.263  22.693 1.00 96.16  ? 80  LYS D CG    1 
ATOM   1527 C  CD    . LYS D 4 80  ? -10.291 45.254  23.286 1.00 96.16  ? 80  LYS D CD    1 
ATOM   1528 C  CE    . LYS D 4 80  ? -10.203 46.148  24.519 1.00 96.38  ? 80  LYS D CE    1 
ATOM   1529 N  NZ    . LYS D 4 80  ? -8.829  46.190  25.100 1.00 95.34  ? 80  LYS D NZ    1 
ATOM   1530 N  N     . MET D 4 81  ? -13.372 43.223  18.658 1.00 98.74  ? 81  MET D N     1 
ATOM   1531 C  CA    . MET D 4 81  ? -13.241 42.887  17.243 1.00 100.27 ? 81  MET D CA    1 
ATOM   1532 C  C     . MET D 4 81  ? -14.087 43.795  16.364 1.00 101.75 ? 81  MET D C     1 
ATOM   1533 O  O     . MET D 4 81  ? -13.599 44.291  15.351 1.00 102.31 ? 81  MET D O     1 
ATOM   1534 C  CB    . MET D 4 81  ? -13.617 41.424  16.988 1.00 100.04 ? 81  MET D CB    1 
ATOM   1535 C  CG    . MET D 4 81  ? -12.473 40.437  17.227 1.00 99.81  ? 81  MET D CG    1 
ATOM   1536 S  SD    . MET D 4 81  ? -11.046 40.685  16.128 1.00 99.84  ? 81  MET D SD    1 
ATOM   1537 C  CE    . MET D 4 81  ? -11.403 39.497  14.820 1.00 98.12  ? 81  MET D CE    1 
ATOM   1538 N  N     . ILE D 4 82  ? -15.349 44.010  16.733 1.00 103.09 ? 82  ILE D N     1 
ATOM   1539 C  CA    . ILE D 4 82  ? -16.201 44.902  15.948 1.00 104.11 ? 82  ILE D CA    1 
ATOM   1540 C  C     . ILE D 4 82  ? -15.520 46.266  15.899 1.00 104.60 ? 82  ILE D C     1 
ATOM   1541 O  O     . ILE D 4 82  ? -15.563 46.956  14.878 1.00 105.63 ? 82  ILE D O     1 
ATOM   1542 C  CB    . ILE D 4 82  ? -17.597 45.094  16.579 1.00 104.60 ? 82  ILE D CB    1 
ATOM   1543 C  CG1   . ILE D 4 82  ? -18.381 46.156  15.794 1.00 104.88 ? 82  ILE D CG1   1 
ATOM   1544 C  CG2   . ILE D 4 82  ? -17.461 45.514  18.034 1.00 105.81 ? 82  ILE D CG2   1 
ATOM   1545 C  CD1   . ILE D 4 82  ? -19.742 46.507  16.389 1.00 104.34 ? 82  ILE D CD1   1 
ATOM   1546 N  N     . ALA D 4 83  ? -14.890 46.643  17.013 1.00 104.42 ? 83  ALA D N     1 
ATOM   1547 C  CA    . ALA D 4 83  ? -14.181 47.919  17.122 1.00 103.89 ? 83  ALA D CA    1 
ATOM   1548 C  C     . ALA D 4 83  ? -12.982 47.926  16.177 1.00 103.37 ? 83  ALA D C     1 
ATOM   1549 O  O     . ALA D 4 83  ? -12.029 48.692  16.363 1.00 104.19 ? 83  ALA D O     1 
ATOM   1550 C  CB    . ALA D 4 83  ? -13.714 48.143  18.561 1.00 103.61 ? 83  ALA D CB    1 
ATOM   1551 N  N     . ARG D 4 84  ? -13.041 47.058  15.171 1.00 101.15 ? 84  ARG D N     1 
ATOM   1552 C  CA    . ARG D 4 84  ? -11.987 46.939  14.180 1.00 99.30  ? 84  ARG D CA    1 
ATOM   1553 C  C     . ARG D 4 84  ? -12.594 46.313  12.940 1.00 97.46  ? 84  ARG D C     1 
ATOM   1554 O  O     . ARG D 4 84  ? -12.472 46.850  11.850 1.00 96.74  ? 84  ARG D O     1 
ATOM   1555 C  CB    . ARG D 4 84  ? -10.856 46.056  14.703 1.00 100.13 ? 84  ARG D CB    1 
ATOM   1556 C  CG    . ARG D 4 84  ? -9.526  46.281  14.004 1.00 100.79 ? 84  ARG D CG    1 
ATOM   1557 C  CD    . ARG D 4 84  ? -8.925  47.635  14.378 1.00 101.93 ? 84  ARG D CD    1 
ATOM   1558 N  NE    . ARG D 4 84  ? -9.690  48.775  13.872 1.00 102.34 ? 84  ARG D NE    1 
ATOM   1559 C  CZ    . ARG D 4 84  ? -9.835  49.070  12.582 1.00 102.46 ? 84  ARG D CZ    1 
ATOM   1560 N  NH1   . ARG D 4 84  ? -9.270  48.310  11.652 1.00 102.39 ? 84  ARG D NH1   1 
ATOM   1561 N  NH2   . ARG D 4 84  ? -10.536 50.134  12.220 1.00 102.88 ? 84  ARG D NH2   1 
ATOM   1562 N  N     . ILE D 4 85  ? -13.245 45.170  13.119 1.00 96.74  ? 85  ILE D N     1 
ATOM   1563 C  CA    . ILE D 4 85  ? -13.894 44.472  12.015 1.00 96.37  ? 85  ILE D CA    1 
ATOM   1564 C  C     . ILE D 4 85  ? -14.789 45.456  11.275 1.00 96.75  ? 85  ILE D C     1 
ATOM   1565 O  O     . ILE D 4 85  ? -14.596 45.730  10.086 1.00 96.51  ? 85  ILE D O     1 
ATOM   1566 C  CB    . ILE D 4 85  ? -14.767 43.294  12.529 1.00 95.65  ? 85  ILE D CB    1 
ATOM   1567 C  CG1   . ILE D 4 85  ? -13.884 42.082  12.831 1.00 94.00  ? 85  ILE D CG1   1 
ATOM   1568 C  CG2   . ILE D 4 85  ? -15.849 42.950  11.509 1.00 95.28  ? 85  ILE D CG2   1 
ATOM   1569 C  CD1   . ILE D 4 85  ? -14.643 40.880  13.354 1.00 92.54  ? 85  ILE D CD1   1 
ATOM   1570 N  N     . ASN D 4 86  ? -15.771 45.987  11.994 1.00 97.05  ? 86  ASN D N     1 
ATOM   1571 C  CA    . ASN D 4 86  ? -16.707 46.942  11.423 1.00 97.07  ? 86  ASN D CA    1 
ATOM   1572 C  C     . ASN D 4 86  ? -16.019 48.282  11.222 1.00 96.63  ? 86  ASN D C     1 
ATOM   1573 O  O     . ASN D 4 86  ? -16.229 48.955  10.215 1.00 96.08  ? 86  ASN D O     1 
ATOM   1574 C  CB    . ASN D 4 86  ? -17.921 47.072  12.339 1.00 96.28  ? 86  ASN D CB    1 
ATOM   1575 C  CG    . ASN D 4 86  ? -18.645 45.755  12.514 1.00 95.77  ? 86  ASN D CG    1 
ATOM   1576 O  OD1   . ASN D 4 86  ? -18.083 44.792  13.030 1.00 97.53  ? 86  ASN D OD1   1 
ATOM   1577 N  ND2   . ASN D 4 86  ? -19.891 45.700  12.071 1.00 95.94  ? 86  ASN D ND2   1 
ATOM   1578 N  N     . ASP D 4 87  ? -15.182 48.650  12.185 1.00 97.37  ? 87  ASP D N     1 
ATOM   1579 C  CA    . ASP D 4 87  ? -14.424 49.892  12.129 1.00 98.07  ? 87  ASP D CA    1 
ATOM   1580 C  C     . ASP D 4 87  ? -13.542 49.829  10.874 1.00 98.64  ? 87  ASP D C     1 
ATOM   1581 O  O     . ASP D 4 87  ? -12.963 50.828  10.446 1.00 98.19  ? 87  ASP D O     1 
ATOM   1582 C  CB    . ASP D 4 87  ? -13.562 50.010  13.389 1.00 98.71  ? 87  ASP D CB    1 
ATOM   1583 C  CG    . ASP D 4 87  ? -13.175 51.440  13.710 1.00 99.57  ? 87  ASP D CG    1 
ATOM   1584 O  OD1   . ASP D 4 87  ? -14.081 52.262  13.964 1.00 100.01 ? 87  ASP D OD1   1 
ATOM   1585 O  OD2   . ASP D 4 87  ? -11.962 51.743  13.719 1.00 100.42 ? 87  ASP D OD2   1 
ATOM   1586 N  N     . TRP D 4 88  ? -13.454 48.635  10.291 1.00 99.60  ? 88  TRP D N     1 
ATOM   1587 C  CA    . TRP D 4 88  ? -12.667 48.394  9.085  1.00 99.93  ? 88  TRP D CA    1 
ATOM   1588 C  C     . TRP D 4 88  ? -13.572 48.615  7.880  1.00 101.37 ? 88  TRP D C     1 
ATOM   1589 O  O     . TRP D 4 88  ? -13.245 49.395  6.988  1.00 101.66 ? 88  TRP D O     1 
ATOM   1590 C  CB    . TRP D 4 88  ? -12.136 46.952  9.084  1.00 98.74  ? 88  TRP D CB    1 
ATOM   1591 C  CG    . TRP D 4 88  ? -11.230 46.586  7.928  1.00 97.21  ? 88  TRP D CG    1 
ATOM   1592 C  CD1   . TRP D 4 88  ? -10.010 47.131  7.632  1.00 96.04  ? 88  TRP D CD1   1 
ATOM   1593 C  CD2   . TRP D 4 88  ? -11.470 45.576  6.933  1.00 95.65  ? 88  TRP D CD2   1 
ATOM   1594 N  NE1   . TRP D 4 88  ? -9.477  46.523  6.519  1.00 95.33  ? 88  TRP D NE1   1 
ATOM   1595 C  CE2   . TRP D 4 88  ? -10.352 45.567  6.070  1.00 95.43  ? 88  TRP D CE2   1 
ATOM   1596 C  CE3   . TRP D 4 88  ? -12.521 44.680  6.689  1.00 94.41  ? 88  TRP D CE3   1 
ATOM   1597 C  CZ2   . TRP D 4 88  ? -10.255 44.695  4.977  1.00 94.55  ? 88  TRP D CZ2   1 
ATOM   1598 C  CZ3   . TRP D 4 88  ? -12.423 43.813  5.604  1.00 93.76  ? 88  TRP D CZ3   1 
ATOM   1599 C  CH2   . TRP D 4 88  ? -11.297 43.829  4.763  1.00 93.86  ? 88  TRP D CH2   1 
ATOM   1600 N  N     . PHE D 4 89  ? -14.715 47.929  7.865  1.00 103.04 ? 89  PHE D N     1 
ATOM   1601 C  CA    . PHE D 4 89  ? -15.673 48.057  6.768  1.00 104.55 ? 89  PHE D CA    1 
ATOM   1602 C  C     . PHE D 4 89  ? -16.041 49.515  6.511  1.00 105.73 ? 89  PHE D C     1 
ATOM   1603 O  O     . PHE D 4 89  ? -15.870 50.024  5.404  1.00 104.72 ? 89  PHE D O     1 
ATOM   1604 C  CB    . PHE D 4 89  ? -16.951 47.269  7.072  1.00 104.00 ? 89  PHE D CB    1 
ATOM   1605 C  CG    . PHE D 4 89  ? -16.741 45.792  7.205  1.00 103.58 ? 89  PHE D CG    1 
ATOM   1606 C  CD1   . PHE D 4 89  ? -15.971 45.097  6.275  1.00 103.95 ? 89  PHE D CD1   1 
ATOM   1607 C  CD2   . PHE D 4 89  ? -17.344 45.085  8.237  1.00 103.04 ? 89  PHE D CD2   1 
ATOM   1608 C  CE1   . PHE D 4 89  ? -15.807 43.717  6.371  1.00 103.03 ? 89  PHE D CE1   1 
ATOM   1609 C  CE2   . PHE D 4 89  ? -17.187 43.707  8.343  1.00 103.33 ? 89  PHE D CE2   1 
ATOM   1610 C  CZ    . PHE D 4 89  ? -16.417 43.021  7.406  1.00 103.16 ? 89  PHE D CZ    1 
ATOM   1611 N  N     . GLU D 4 90  ? -16.554 50.183  7.540  1.00 108.00 ? 90  GLU D N     1 
ATOM   1612 C  CA    . GLU D 4 90  ? -16.941 51.581  7.417  1.00 90.91  ? 90  GLU D CA    1 
ATOM   1613 C  C     . GLU D 4 90  ? -15.711 52.455  7.188  1.00 92.16  ? 90  GLU D C     1 
ATOM   1614 O  O     . GLU D 4 90  ? -15.742 53.666  7.421  1.00 92.54  ? 90  GLU D O     1 
ATOM   1615 C  CB    . GLU D 4 90  ? -17.692 52.047  8.672  1.00 91.81  ? 90  GLU D CB    1 
ATOM   1616 C  CG    . GLU D 4 90  ? -19.037 51.347  8.899  1.00 93.50  ? 90  GLU D CG    1 
ATOM   1617 C  CD    . GLU D 4 90  ? -19.864 51.976  10.021 1.00 94.33  ? 90  GLU D CD    1 
ATOM   1618 O  OE1   . GLU D 4 90  ? -20.955 51.446  10.330 1.00 93.88  ? 90  GLU D OE1   1 
ATOM   1619 O  OE2   . GLU D 4 90  ? -19.427 53.002  10.591 1.00 94.69  ? 90  GLU D OE2   1 
ATOM   1620 N  N     . GLU D 4 91  ? -14.628 51.825  6.735  1.00 92.98  ? 91  GLU D N     1 
ATOM   1621 C  CA    . GLU D 4 91  ? -13.378 52.519  6.449  1.00 93.62  ? 91  GLU D CA    1 
ATOM   1622 C  C     . GLU D 4 91  ? -12.874 52.057  5.087  1.00 93.17  ? 91  GLU D C     1 
ATOM   1623 O  O     . GLU D 4 91  ? -12.192 52.797  4.375  1.00 92.98  ? 91  GLU D O     1 
ATOM   1624 C  CB    . GLU D 4 91  ? -12.329 52.214  7.522  1.00 95.16  ? 91  GLU D CB    1 
ATOM   1625 C  CG    . GLU D 4 91  ? -11.033 52.988  7.337  1.00 97.09  ? 91  GLU D CG    1 
ATOM   1626 C  CD    . GLU D 4 91  ? -11.234 54.493  7.424  1.00 98.35  ? 91  GLU D CD    1 
ATOM   1627 O  OE1   . GLU D 4 91  ? -10.300 55.241  7.060  1.00 98.26  ? 91  GLU D OE1   1 
ATOM   1628 O  OE2   . GLU D 4 91  ? -12.326 54.924  7.862  1.00 98.74  ? 91  GLU D OE2   1 
ATOM   1629 N  N     . VAL D 4 92  ? -13.206 50.819  4.737  1.00 92.49  ? 92  VAL D N     1 
ATOM   1630 C  CA    . VAL D 4 92  ? -12.824 50.267  3.446  1.00 92.28  ? 92  VAL D CA    1 
ATOM   1631 C  C     . VAL D 4 92  ? -13.720 50.959  2.425  1.00 92.81  ? 92  VAL D C     1 
ATOM   1632 O  O     . VAL D 4 92  ? -13.394 51.040  1.240  1.00 93.38  ? 92  VAL D O     1 
ATOM   1633 C  CB    . VAL D 4 92  ? -13.058 48.736  3.391  1.00 91.56  ? 92  VAL D CB    1 
ATOM   1634 C  CG1   . VAL D 4 92  ? -12.974 48.238  1.963  1.00 91.35  ? 92  VAL D CG1   1 
ATOM   1635 C  CG2   . VAL D 4 92  ? -12.020 48.024  4.235  1.00 91.19  ? 92  VAL D CG2   1 
ATOM   1636 N  N     . LYS D 4 93  ? -14.848 51.471  2.913  1.00 92.71  ? 93  LYS D N     1 
ATOM   1637 C  CA    . LYS D 4 93  ? -15.821 52.170  2.083  1.00 92.09  ? 93  LYS D CA    1 
ATOM   1638 C  C     . LYS D 4 93  ? -15.350 53.579  1.733  1.00 91.94  ? 93  LYS D C     1 
ATOM   1639 O  O     . LYS D 4 93  ? -15.990 54.284  0.954  1.00 91.31  ? 93  LYS D O     1 
ATOM   1640 C  CB    . LYS D 4 93  ? -17.166 52.242  2.811  1.00 91.94  ? 93  LYS D CB    1 
ATOM   1641 C  CG    . LYS D 4 93  ? -17.838 50.897  3.006  1.00 91.46  ? 93  LYS D CG    1 
ATOM   1642 C  CD    . LYS D 4 93  ? -19.123 51.042  3.800  1.00 91.45  ? 93  LYS D CD    1 
ATOM   1643 C  CE    . LYS D 4 93  ? -19.995 49.803  3.672  1.00 91.54  ? 93  LYS D CE    1 
ATOM   1644 N  NZ    . LYS D 4 93  ? -20.449 49.594  2.264  1.00 91.56  ? 93  LYS D NZ    1 
ATOM   1645 N  N     . ALA D 4 94  ? -14.228 53.986  2.314  1.00 92.31  ? 94  ALA D N     1 
ATOM   1646 C  CA    . ALA D 4 94  ? -13.677 55.308  2.057  1.00 93.22  ? 94  ALA D CA    1 
ATOM   1647 C  C     . ALA D 4 94  ? -12.737 55.262  0.864  1.00 93.85  ? 94  ALA D C     1 
ATOM   1648 O  O     . ALA D 4 94  ? -12.413 56.295  0.282  1.00 94.36  ? 94  ALA D O     1 
ATOM   1649 C  CB    . ALA D 4 94  ? -12.939 55.814  3.284  1.00 93.75  ? 94  ALA D CB    1 
ATOM   1650 N  N     . LYS D 4 95  ? -12.297 54.059  0.508  1.00 94.58  ? 95  LYS D N     1 
ATOM   1651 C  CA    . LYS D 4 95  ? -11.399 53.871  -0.628 1.00 95.49  ? 95  LYS D CA    1 
ATOM   1652 C  C     . LYS D 4 95  ? -12.189 53.920  -1.938 1.00 95.66  ? 95  LYS D C     1 
ATOM   1653 O  O     . LYS D 4 95  ? -13.249 53.301  -2.055 1.00 95.88  ? 95  LYS D O     1 
ATOM   1654 C  CB    . LYS D 4 95  ? -10.678 52.522  -0.517 1.00 95.99  ? 95  LYS D CB    1 
ATOM   1655 C  CG    . LYS D 4 95  ? -9.696  52.413  0.641  1.00 95.62  ? 95  LYS D CG    1 
ATOM   1656 C  CD    . LYS D 4 95  ? -9.136  50.998  0.757  1.00 95.60  ? 95  LYS D CD    1 
ATOM   1657 C  CE    . LYS D 4 95  ? -8.467  50.545  -0.535 1.00 95.74  ? 95  LYS D CE    1 
ATOM   1658 N  NZ    . LYS D 4 95  ? -7.884  49.178  -0.420 1.00 95.86  ? 95  LYS D NZ    1 
ATOM   1659 N  N     . ARG D 4 96  ? -11.670 54.648  -2.923 1.00 95.47  ? 96  ARG D N     1 
ATOM   1660 C  CA    . ARG D 4 96  ? -12.343 54.772  -4.212 1.00 95.48  ? 96  ARG D CA    1 
ATOM   1661 C  C     . ARG D 4 96  ? -11.813 53.807  -5.267 1.00 96.12  ? 96  ARG D C     1 
ATOM   1662 O  O     . ARG D 4 96  ? -11.462 54.222  -6.369 1.00 96.72  ? 96  ARG D O     1 
ATOM   1663 C  CB    . ARG D 4 96  ? -12.220 56.211  -4.719 1.00 94.40  ? 96  ARG D CB    1 
ATOM   1664 C  CG    . ARG D 4 96  ? -13.067 57.191  -3.936 1.00 93.00  ? 96  ARG D CG    1 
ATOM   1665 C  CD    . ARG D 4 96  ? -14.545 57.003  -4.248 1.00 91.34  ? 96  ARG D CD    1 
ATOM   1666 N  NE    . ARG D 4 96  ? -15.387 57.423  -3.133 1.00 90.00  ? 96  ARG D NE    1 
ATOM   1667 C  CZ    . ARG D 4 96  ? -15.708 56.644  -2.104 1.00 109.43 ? 96  ARG D CZ    1 
ATOM   1668 N  NH1   . ARG D 4 96  ? -15.265 55.396  -2.047 1.00 108.29 ? 96  ARG D NH1   1 
ATOM   1669 N  NH2   . ARG D 4 96  ? -16.465 57.116  -1.122 1.00 108.81 ? 96  ARG D NH2   1 
ATOM   1670 N  N     . GLY D 4 97  ? -11.765 52.521  -4.936 1.00 96.62  ? 97  GLY D N     1 
ATOM   1671 C  CA    . GLY D 4 97  ? -11.267 51.542  -5.887 1.00 96.83  ? 97  GLY D CA    1 
ATOM   1672 C  C     . GLY D 4 97  ? -11.648 50.112  -5.559 1.00 97.29  ? 97  GLY D C     1 
ATOM   1673 O  O     . GLY D 4 97  ? -12.786 49.837  -5.175 1.00 97.08  ? 97  GLY D O     1 
ATOM   1674 N  N     . LYS D 4 98  ? -10.693 49.198  -5.712 1.00 97.64  ? 98  LYS D N     1 
ATOM   1675 C  CA    . LYS D 4 98  ? -10.931 47.787  -5.435 1.00 98.40  ? 98  LYS D CA    1 
ATOM   1676 C  C     . LYS D 4 98  ? -10.836 47.480  -3.945 1.00 99.25  ? 98  LYS D C     1 
ATOM   1677 O  O     . LYS D 4 98  ? -10.089 48.129  -3.209 1.00 99.13  ? 98  LYS D O     1 
ATOM   1678 C  CB    . LYS D 4 98  ? -9.934  46.920  -6.213 1.00 98.37  ? 98  LYS D CB    1 
ATOM   1679 C  CG    . LYS D 4 98  ? -10.032 45.423  -5.922 1.00 98.67  ? 98  LYS D CG    1 
ATOM   1680 C  CD    . LYS D 4 98  ? -11.439 44.888  -6.172 1.00 99.16  ? 98  LYS D CD    1 
ATOM   1681 C  CE    . LYS D 4 98  ? -11.583 43.452  -5.686 1.00 98.78  ? 98  LYS D CE    1 
ATOM   1682 N  NZ    . LYS D 4 98  ? -12.982 42.954  -5.806 1.00 98.41  ? 98  LYS D NZ    1 
ATOM   1683 N  N     . ARG D 4 99  ? -11.605 46.483  -3.514 1.00 80.26  ? 99  ARG D N     1 
ATOM   1684 C  CA    . ARG D 4 99  ? -11.643 46.056  -2.118 1.00 81.54  ? 99  ARG D CA    1 
ATOM   1685 C  C     . ARG D 4 99  ? -10.638 44.933  -1.836 1.00 82.45  ? 99  ARG D C     1 
ATOM   1686 O  O     . ARG D 4 99  ? -10.500 43.999  -2.628 1.00 82.76  ? 99  ARG D O     1 
ATOM   1687 C  CB    . ARG D 4 99  ? -13.060 45.599  -1.765 1.00 81.94  ? 99  ARG D CB    1 
ATOM   1688 C  CG    . ARG D 4 99  ? -14.076 46.730  -1.771 1.00 82.26  ? 99  ARG D CG    1 
ATOM   1689 C  CD    . ARG D 4 99  ? -15.502 46.214  -1.704 1.00 82.36  ? 99  ARG D CD    1 
ATOM   1690 N  NE    . ARG D 4 99  ? -16.440 47.286  -1.382 1.00 82.93  ? 99  ARG D NE    1 
ATOM   1691 C  CZ    . ARG D 4 99  ? -17.761 47.149  -1.371 1.00 82.95  ? 99  ARG D CZ    1 
ATOM   1692 N  NH1   . ARG D 4 99  ? -18.313 45.981  -1.672 1.00 82.35  ? 99  ARG D NH1   1 
ATOM   1693 N  NH2   . ARG D 4 99  ? -18.531 48.179  -1.046 1.00 83.37  ? 99  ARG D NH2   1 
ATOM   1694 N  N     . PRO D 4 100 ? -9.930  45.015  -0.692 1.00 82.90  ? 100 PRO D N     1 
ATOM   1695 C  CA    . PRO D 4 100 ? -8.912  44.072  -0.207 1.00 82.99  ? 100 PRO D CA    1 
ATOM   1696 C  C     . PRO D 4 100 ? -9.237  42.575  -0.222 1.00 83.12  ? 100 PRO D C     1 
ATOM   1697 O  O     . PRO D 4 100 ? -8.699  41.820  0.588  1.00 83.32  ? 100 PRO D O     1 
ATOM   1698 C  CB    . PRO D 4 100 ? -8.627  44.580  1.204  1.00 83.40  ? 100 PRO D CB    1 
ATOM   1699 C  CG    . PRO D 4 100 ? -8.798  46.060  1.054  1.00 83.07  ? 100 PRO D CG    1 
ATOM   1700 C  CD    . PRO D 4 100 ? -10.072 46.144  0.249  1.00 82.83  ? 100 PRO D CD    1 
ATOM   1701 N  N     . THR D 4 101 ? -10.101 42.150  -1.139 1.00 83.32  ? 101 THR D N     1 
ATOM   1702 C  CA    . THR D 4 101 ? -10.485 40.742  -1.273 1.00 83.76  ? 101 THR D CA    1 
ATOM   1703 C  C     . THR D 4 101 ? -11.171 40.158  -0.043 1.00 83.99  ? 101 THR D C     1 
ATOM   1704 O  O     . THR D 4 101 ? -12.214 39.514  -0.154 1.00 83.86  ? 101 THR D O     1 
ATOM   1705 C  CB    . THR D 4 101 ? -9.268  39.851  -1.603 1.00 83.67  ? 101 THR D CB    1 
ATOM   1706 O  OG1   . THR D 4 101 ? -8.662  40.299  -2.821 1.00 83.92  ? 101 THR D OG1   1 
ATOM   1707 C  CG2   . THR D 4 101 ? -9.698  38.400  -1.769 1.00 83.20  ? 101 THR D CG2   1 
ATOM   1708 N  N     . ALA D 4 102 ? -10.573 40.369  1.125  1.00 84.31  ? 102 ALA D N     1 
ATOM   1709 C  CA    . ALA D 4 102 ? -11.133 39.864  2.372  1.00 84.40  ? 102 ALA D CA    1 
ATOM   1710 C  C     . ALA D 4 102 ? -12.518 40.456  2.601  1.00 84.39  ? 102 ALA D C     1 
ATOM   1711 O  O     . ALA D 4 102 ? -13.445 39.750  2.994  1.00 84.50  ? 102 ALA D O     1 
ATOM   1712 C  CB    . ALA D 4 102 ? -10.215 40.216  3.536  1.00 84.47  ? 102 ALA D CB    1 
ATOM   1713 N  N     . PHE D 4 103 ? -12.649 41.754  2.344  1.00 84.45  ? 103 PHE D N     1 
ATOM   1714 C  CA    . PHE D 4 103 ? -13.913 42.459  2.520  1.00 84.16  ? 103 PHE D CA    1 
ATOM   1715 C  C     . PHE D 4 103 ? -15.117 41.592  2.177  1.00 83.93  ? 103 PHE D C     1 
ATOM   1716 O  O     . PHE D 4 103 ? -15.869 41.181  3.057  1.00 84.45  ? 103 PHE D O     1 
ATOM   1717 C  CB    . PHE D 4 103 ? -13.951 43.710  1.645  1.00 84.26  ? 103 PHE D CB    1 
ATOM   1718 C  CG    . PHE D 4 103 ? -15.228 44.488  1.766  1.00 84.71  ? 103 PHE D CG    1 
ATOM   1719 C  CD1   . PHE D 4 103 ? -15.352 45.503  2.707  1.00 85.05  ? 103 PHE D CD1   1 
ATOM   1720 C  CD2   . PHE D 4 103 ? -16.320 44.186  0.958  1.00 84.87  ? 103 PHE D CD2   1 
ATOM   1721 C  CE1   . PHE D 4 103 ? -16.547 46.206  2.843  1.00 85.18  ? 103 PHE D CE1   1 
ATOM   1722 C  CE2   . PHE D 4 103 ? -17.517 44.881  1.087  1.00 84.98  ? 103 PHE D CE2   1 
ATOM   1723 C  CZ    . PHE D 4 103 ? -17.631 45.893  2.031  1.00 85.02  ? 103 PHE D CZ    1 
ATOM   1724 N  N     . GLN D 4 104 ? -15.296 41.322  0.889  1.00 83.55  ? 104 GLN D N     1 
ATOM   1725 C  CA    . GLN D 4 104 ? -16.421 40.522  0.428  1.00 83.01  ? 104 GLN D CA    1 
ATOM   1726 C  C     . GLN D 4 104 ? -16.456 39.125  1.036  1.00 82.33  ? 104 GLN D C     1 
ATOM   1727 O  O     . GLN D 4 104 ? -17.533 38.569  1.255  1.00 82.08  ? 104 GLN D O     1 
ATOM   1728 C  CB    . GLN D 4 104 ? -16.415 40.417  -1.104 1.00 83.75  ? 104 GLN D CB    1 
ATOM   1729 C  CG    . GLN D 4 104 ? -15.206 39.706  -1.713 1.00 83.85  ? 104 GLN D CG    1 
ATOM   1730 C  CD    . GLN D 4 104 ? -14.019 40.626  -1.949 1.00 83.85  ? 104 GLN D CD    1 
ATOM   1731 O  OE1   . GLN D 4 104 ? -13.005 40.209  -2.510 1.00 83.87  ? 104 GLN D OE1   1 
ATOM   1732 N  NE2   . GLN D 4 104 ? -14.140 41.880  -1.524 1.00 83.62  ? 104 GLN D NE2   1 
ATOM   1733 N  N     . PHE D 4 105 ? -15.285 38.560  1.308  1.00 81.63  ? 105 PHE D N     1 
ATOM   1734 C  CA    . PHE D 4 105 ? -15.214 37.223  1.886  1.00 81.12  ? 105 PHE D CA    1 
ATOM   1735 C  C     . PHE D 4 105 ? -15.223 37.192  3.409  1.00 80.46  ? 105 PHE D C     1 
ATOM   1736 O  O     . PHE D 4 105 ? -14.426 36.486  4.029  1.00 81.06  ? 105 PHE D O     1 
ATOM   1737 C  CB    . PHE D 4 105 ? -13.981 36.479  1.369  1.00 81.34  ? 105 PHE D CB    1 
ATOM   1738 C  CG    . PHE D 4 105 ? -14.238 35.670  0.132  1.00 81.82  ? 105 PHE D CG    1 
ATOM   1739 C  CD1   . PHE D 4 105 ? -15.370 34.866  0.037  1.00 81.63  ? 105 PHE D CD1   1 
ATOM   1740 C  CD2   . PHE D 4 105 ? -13.338 35.683  -0.925 1.00 82.17  ? 105 PHE D CD2   1 
ATOM   1741 C  CE1   . PHE D 4 105 ? -15.601 34.086  -1.090 1.00 81.67  ? 105 PHE D CE1   1 
ATOM   1742 C  CE2   . PHE D 4 105 ? -13.560 34.904  -2.059 1.00 82.08  ? 105 PHE D CE2   1 
ATOM   1743 C  CZ    . PHE D 4 105 ? -14.694 34.104  -2.140 1.00 81.78  ? 105 PHE D CZ    1 
ATOM   1744 N  N     . LEU D 4 106 ? -16.136 37.956  4.000  1.00 99.07  ? 106 LEU D N     1 
ATOM   1745 C  CA    . LEU D 4 106 ? -16.297 38.034  5.451  1.00 97.52  ? 106 LEU D CA    1 
ATOM   1746 C  C     . LEU D 4 106 ? -17.604 38.758  5.752  1.00 96.81  ? 106 LEU D C     1 
ATOM   1747 O  O     . LEU D 4 106 ? -18.108 38.728  6.877  1.00 97.30  ? 106 LEU D O     1 
ATOM   1748 C  CB    . LEU D 4 106 ? -15.123 38.784  6.097  1.00 96.69  ? 106 LEU D CB    1 
ATOM   1749 C  CG    . LEU D 4 106 ? -13.824 38.008  6.349  1.00 95.92  ? 106 LEU D CG    1 
ATOM   1750 C  CD1   . LEU D 4 106 ? -12.764 38.940  6.907  1.00 96.02  ? 106 LEU D CD1   1 
ATOM   1751 C  CD2   . LEU D 4 106 ? -14.087 36.865  7.317  1.00 95.61  ? 106 LEU D CD2   1 
ATOM   1752 N  N     . GLN D 4 107 ? -18.151 39.402  4.727  1.00 95.32  ? 107 GLN D N     1 
ATOM   1753 C  CA    . GLN D 4 107 ? -19.397 40.138  4.857  1.00 93.75  ? 107 GLN D CA    1 
ATOM   1754 C  C     . GLN D 4 107 ? -20.575 39.167  4.733  1.00 93.24  ? 107 GLN D C     1 
ATOM   1755 O  O     . GLN D 4 107 ? -21.732 39.545  4.912  1.00 92.90  ? 107 GLN D O     1 
ATOM   1756 C  CB    . GLN D 4 107 ? -19.470 41.208  3.766  1.00 92.83  ? 107 GLN D CB    1 
ATOM   1757 C  CG    . GLN D 4 107 ? -20.123 42.503  4.206  1.00 92.36  ? 107 GLN D CG    1 
ATOM   1758 C  CD    . GLN D 4 107 ? -19.407 43.141  5.379  1.00 92.14  ? 107 GLN D CD    1 
ATOM   1759 O  OE1   . GLN D 4 107 ? -19.379 42.591  6.480  1.00 92.34  ? 107 GLN D OE1   1 
ATOM   1760 N  NE2   . GLN D 4 107 ? -18.819 44.307  5.147  1.00 91.72  ? 107 GLN D NE2   1 
ATOM   1761 N  N     . GLU D 4 108 ? -20.261 37.908  4.439  1.00 92.73  ? 108 GLU D N     1 
ATOM   1762 C  CA    . GLU D 4 108 ? -21.273 36.869  4.278  1.00 91.82  ? 108 GLU D CA    1 
ATOM   1763 C  C     . GLU D 4 108 ? -21.894 36.421  5.597  1.00 91.16  ? 108 GLU D C     1 
ATOM   1764 O  O     . GLU D 4 108 ? -22.883 35.687  5.603  1.00 91.39  ? 108 GLU D O     1 
ATOM   1765 C  CB    . GLU D 4 108 ? -20.670 35.650  3.571  1.00 92.08  ? 108 GLU D CB    1 
ATOM   1766 C  CG    . GLU D 4 108 ? -20.269 35.891  2.121  1.00 93.06  ? 108 GLU D CG    1 
ATOM   1767 C  CD    . GLU D 4 108 ? -19.751 34.632  1.437  1.00 93.80  ? 108 GLU D CD    1 
ATOM   1768 O  OE1   . GLU D 4 108 ? -20.480 33.616  1.415  1.00 93.96  ? 108 GLU D OE1   1 
ATOM   1769 O  OE2   . GLU D 4 108 ? -18.615 34.659  0.917  1.00 94.09  ? 108 GLU D OE2   1 
ATOM   1770 N  N     . ILE D 4 109 ? -21.319 36.860  6.713  1.00 90.19  ? 109 ILE D N     1 
ATOM   1771 C  CA    . ILE D 4 109 ? -21.832 36.481  8.028  1.00 88.71  ? 109 ILE D CA    1 
ATOM   1772 C  C     . ILE D 4 109 ? -21.693 37.586  9.072  1.00 87.97  ? 109 ILE D C     1 
ATOM   1773 O  O     . ILE D 4 109 ? -20.941 38.546  8.883  1.00 87.96  ? 109 ILE D O     1 
ATOM   1774 C  CB    . ILE D 4 109 ? -21.121 35.216  8.550  1.00 88.59  ? 109 ILE D CB    1 
ATOM   1775 C  CG1   . ILE D 4 109 ? -19.606 35.365  8.377  1.00 88.20  ? 109 ILE D CG1   1 
ATOM   1776 C  CG2   . ILE D 4 109 ? -21.648 33.992  7.820  1.00 88.33  ? 109 ILE D CG2   1 
ATOM   1777 C  CD1   . ILE D 4 109 ? -18.809 34.176  8.854  1.00 88.06  ? 109 ILE D CD1   1 
ATOM   1778 N  N     . LYS D 4 110 ? -22.425 37.436  10.175 1.00 86.89  ? 110 LYS D N     1 
ATOM   1779 C  CA    . LYS D 4 110 ? -22.407 38.410  11.262 1.00 85.37  ? 110 LYS D CA    1 
ATOM   1780 C  C     . LYS D 4 110 ? -20.980 38.763  11.649 1.00 84.29  ? 110 LYS D C     1 
ATOM   1781 O  O     . LYS D 4 110 ? -20.137 37.886  11.813 1.00 83.82  ? 110 LYS D O     1 
ATOM   1782 C  CB    . LYS D 4 110 ? -23.159 37.856  12.474 1.00 85.64  ? 110 LYS D CB    1 
ATOM   1783 C  CG    . LYS D 4 110 ? -24.631 37.577  12.208 1.00 86.13  ? 110 LYS D CG    1 
ATOM   1784 C  CD    . LYS D 4 110 ? -25.328 36.985  13.426 1.00 86.93  ? 110 LYS D CD    1 
ATOM   1785 C  CE    . LYS D 4 110 ? -24.769 35.615  13.778 1.00 87.73  ? 110 LYS D CE    1 
ATOM   1786 N  NZ    . LYS D 4 110 ? -25.457 35.014  14.952 1.00 87.81  ? 110 LYS D NZ    1 
ATOM   1787 N  N     . PRO D 4 111 ? -20.693 40.062  11.811 1.00 83.75  ? 111 PRO D N     1 
ATOM   1788 C  CA    . PRO D 4 111 ? -19.343 40.496  12.178 1.00 83.32  ? 111 PRO D CA    1 
ATOM   1789 C  C     . PRO D 4 111 ? -18.788 39.804  13.422 1.00 82.75  ? 111 PRO D C     1 
ATOM   1790 O  O     . PRO D 4 111 ? -17.872 38.990  13.326 1.00 83.11  ? 111 PRO D O     1 
ATOM   1791 C  CB    . PRO D 4 111 ? -19.502 42.007  12.359 1.00 82.85  ? 111 PRO D CB    1 
ATOM   1792 C  CG    . PRO D 4 111 ? -20.918 42.140  12.816 1.00 83.24  ? 111 PRO D CG    1 
ATOM   1793 C  CD    . PRO D 4 111 ? -21.646 41.182  11.904 1.00 83.41  ? 111 PRO D CD    1 
ATOM   1794 N  N     . GLU D 4 112 ? -19.341 40.118  14.587 1.00 82.01  ? 112 GLU D N     1 
ATOM   1795 C  CA    . GLU D 4 112 ? -18.858 39.511  15.819 1.00 80.76  ? 112 GLU D CA    1 
ATOM   1796 C  C     . GLU D 4 112 ? -18.918 37.988  15.753 1.00 80.18  ? 112 GLU D C     1 
ATOM   1797 O  O     . GLU D 4 112 ? -18.208 37.302  16.487 1.00 99.66  ? 112 GLU D O     1 
ATOM   1798 C  CB    . GLU D 4 112 ? -19.657 40.036  17.015 1.00 99.83  ? 112 GLU D CB    1 
ATOM   1799 C  CG    . GLU D 4 112 ? -19.624 41.558  17.149 1.00 97.71  ? 112 GLU D CG    1 
ATOM   1800 C  CD    . GLU D 4 112 ? -18.212 42.132  17.181 1.00 96.13  ? 112 GLU D CD    1 
ATOM   1801 O  OE1   . GLU D 4 112 ? -17.496 42.048  16.160 1.00 94.39  ? 112 GLU D OE1   1 
ATOM   1802 O  OE2   . GLU D 4 112 ? -17.817 42.673  18.233 1.00 95.45  ? 112 GLU D OE2   1 
ATOM   1803 N  N     . ALA D 4 113 ? -19.759 37.461  14.869 1.00 99.92  ? 113 ALA D N     1 
ATOM   1804 C  CA    . ALA D 4 113 ? -19.867 36.012  14.710 1.00 80.28  ? 113 ALA D CA    1 
ATOM   1805 C  C     . ALA D 4 113 ? -18.566 35.524  14.076 1.00 99.82  ? 113 ALA D C     1 
ATOM   1806 O  O     . ALA D 4 113 ? -18.132 34.393  14.294 1.00 80.01  ? 113 ALA D O     1 
ATOM   1807 C  CB    . ALA D 4 113 ? -21.047 35.664  13.820 1.00 81.12  ? 113 ALA D CB    1 
ATOM   1808 N  N     . VAL D 4 114 ? -17.962 36.396  13.276 1.00 98.71  ? 114 VAL D N     1 
ATOM   1809 C  CA    . VAL D 4 114 ? -16.697 36.108  12.621 1.00 96.87  ? 114 VAL D CA    1 
ATOM   1810 C  C     . VAL D 4 114 ? -15.643 36.167  13.709 1.00 95.90  ? 114 VAL D C     1 
ATOM   1811 O  O     . VAL D 4 114 ? -14.870 35.230  13.885 1.00 96.39  ? 114 VAL D O     1 
ATOM   1812 C  CB    . VAL D 4 114 ? -16.364 37.173  11.558 1.00 97.21  ? 114 VAL D CB    1 
ATOM   1813 C  CG1   . VAL D 4 114 ? -14.892 37.110  11.200 1.00 97.32  ? 114 VAL D CG1   1 
ATOM   1814 C  CG2   . VAL D 4 114 ? -17.219 36.957  10.322 1.00 97.66  ? 114 VAL D CG2   1 
ATOM   1815 N  N     . ALA D 4 115 ? -15.632 37.283  14.435 1.00 94.23  ? 115 ALA D N     1 
ATOM   1816 C  CA    . ALA D 4 115 ? -14.693 37.509  15.529 1.00 92.65  ? 115 ALA D CA    1 
ATOM   1817 C  C     . ALA D 4 115 ? -14.579 36.292  16.452 1.00 91.64  ? 115 ALA D C     1 
ATOM   1818 O  O     . ALA D 4 115 ? -13.480 35.933  16.885 1.00 91.60  ? 115 ALA D O     1 
ATOM   1819 C  CB    . ALA D 4 115 ? -15.121 38.725  16.328 1.00 92.27  ? 115 ALA D CB    1 
ATOM   1820 N  N     . TYR D 4 116 ? -15.708 35.664  16.769 1.00 89.68  ? 116 TYR D N     1 
ATOM   1821 C  CA    . TYR D 4 116 ? -15.661 34.491  17.626 1.00 88.07  ? 116 TYR D CA    1 
ATOM   1822 C  C     . TYR D 4 116 ? -15.011 33.366  16.832 1.00 87.33  ? 116 TYR D C     1 
ATOM   1823 O  O     . TYR D 4 116 ? -14.042 32.764  17.282 1.00 87.56  ? 116 TYR D O     1 
ATOM   1824 C  CB    . TYR D 4 116 ? -17.063 34.073  18.078 1.00 87.60  ? 116 TYR D CB    1 
ATOM   1825 C  CG    . TYR D 4 116 ? -17.077 32.791  18.888 1.00 87.01  ? 116 TYR D CG    1 
ATOM   1826 C  CD1   . TYR D 4 116 ? -16.398 32.701  20.103 1.00 86.54  ? 116 TYR D CD1   1 
ATOM   1827 C  CD2   . TYR D 4 116 ? -17.745 31.655  18.421 1.00 87.13  ? 116 TYR D CD2   1 
ATOM   1828 C  CE1   . TYR D 4 116 ? -16.381 31.512  20.831 1.00 86.64  ? 116 TYR D CE1   1 
ATOM   1829 C  CE2   . TYR D 4 116 ? -17.736 30.460  19.142 1.00 86.31  ? 116 TYR D CE2   1 
ATOM   1830 C  CZ    . TYR D 4 116 ? -17.052 30.395  20.344 1.00 86.70  ? 116 TYR D CZ    1 
ATOM   1831 O  OH    . TYR D 4 116 ? -17.039 29.217  21.059 1.00 86.49  ? 116 TYR D OH    1 
ATOM   1832 N  N     . ILE D 4 117 ? -15.543 33.093  15.644 1.00 86.48  ? 117 ILE D N     1 
ATOM   1833 C  CA    . ILE D 4 117 ? -14.995 32.046  14.790 1.00 85.08  ? 117 ILE D CA    1 
ATOM   1834 C  C     . ILE D 4 117 ? -13.509 32.300  14.583 1.00 83.69  ? 117 ILE D C     1 
ATOM   1835 O  O     . ILE D 4 117 ? -12.738 31.381  14.326 1.00 84.03  ? 117 ILE D O     1 
ATOM   1836 C  CB    . ILE D 4 117 ? -15.691 32.022  13.419 1.00 86.23  ? 117 ILE D CB    1 
ATOM   1837 C  CG1   . ILE D 4 117 ? -17.175 31.693  13.593 1.00 87.27  ? 117 ILE D CG1   1 
ATOM   1838 C  CG2   . ILE D 4 117 ? -15.036 30.993  12.519 1.00 86.37  ? 117 ILE D CG2   1 
ATOM   1839 C  CD1   . ILE D 4 117 ? -17.960 31.727  12.294 1.00 87.08  ? 117 ILE D CD1   1 
ATOM   1840 N  N     . THR D 4 118 ? -13.116 33.560  14.696 1.00 82.39  ? 118 THR D N     1 
ATOM   1841 C  CA    . THR D 4 118 ? -11.723 33.943  14.546 1.00 81.47  ? 118 THR D CA    1 
ATOM   1842 C  C     . THR D 4 118 ? -10.947 33.475  15.761 1.00 81.16  ? 118 THR D C     1 
ATOM   1843 O  O     . THR D 4 118 ? -10.197 32.504  15.689 1.00 81.05  ? 118 THR D O     1 
ATOM   1844 C  CB    . THR D 4 118 ? -11.575 35.462  14.443 1.00 81.62  ? 118 THR D CB    1 
ATOM   1845 O  OG1   . THR D 4 118 ? -12.142 35.911  13.207 1.00 83.24  ? 118 THR D OG1   1 
ATOM   1846 C  CG2   . THR D 4 118 ? -10.110 35.867  14.524 1.00 81.49  ? 118 THR D CG2   1 
ATOM   1847 N  N     . ILE D 4 119 ? -11.148 34.178  16.874 1.00 80.97  ? 119 ILE D N     1 
ATOM   1848 C  CA    . ILE D 4 119 ? -10.487 33.887  18.143 1.00 81.19  ? 119 ILE D CA    1 
ATOM   1849 C  C     . ILE D 4 119 ? -10.619 32.425  18.574 1.00 81.67  ? 119 ILE D C     1 
ATOM   1850 O  O     . ILE D 4 119 ? -9.636  31.784  18.946 1.00 81.37  ? 119 ILE D O     1 
ATOM   1851 C  CB    . ILE D 4 119 ? -11.053 34.786  19.256 1.00 80.70  ? 119 ILE D CB    1 
ATOM   1852 C  CG1   . ILE D 4 119 ? -11.090 36.236  18.775 1.00 80.18  ? 119 ILE D CG1   1 
ATOM   1853 C  CG2   . ILE D 4 119 ? -10.186 34.690  20.496 1.00 80.00  ? 119 ILE D CG2   1 
ATOM   1854 C  CD1   . ILE D 4 119 ? -11.726 37.192  19.752 1.00 80.32  ? 119 ILE D CD1   1 
ATOM   1855 N  N     . LYS D 4 120 ? -11.834 31.896  18.520 1.00 82.95  ? 120 LYS D N     1 
ATOM   1856 C  CA    . LYS D 4 120 ? -12.079 30.512  18.907 1.00 84.97  ? 120 LYS D CA    1 
ATOM   1857 C  C     . LYS D 4 120 ? -11.278 29.548  18.035 1.00 86.51  ? 120 LYS D C     1 
ATOM   1858 O  O     . LYS D 4 120 ? -11.210 28.349  18.315 1.00 87.21  ? 120 LYS D O     1 
ATOM   1859 C  CB    . LYS D 4 120 ? -13.581 30.199  18.814 1.00 84.80  ? 120 LYS D CB    1 
ATOM   1860 C  CG    . LYS D 4 120 ? -13.978 28.792  19.244 1.00 84.32  ? 120 LYS D CG    1 
ATOM   1861 C  CD    . LYS D 4 120 ? -13.934 27.815  18.081 1.00 84.19  ? 120 LYS D CD    1 
ATOM   1862 C  CE    . LYS D 4 120 ? -14.198 26.392  18.546 1.00 85.79  ? 120 LYS D CE    1 
ATOM   1863 N  NZ    . LYS D 4 120 ? -15.526 26.245  19.209 1.00 85.81  ? 120 LYS D NZ    1 
ATOM   1864 N  N     . THR D 4 121 ? -10.668 30.077  16.979 1.00 88.09  ? 121 THR D N     1 
ATOM   1865 C  CA    . THR D 4 121 ? -9.868  29.259  16.073 1.00 89.05  ? 121 THR D CA    1 
ATOM   1866 C  C     . THR D 4 121 ? -8.386  29.617  16.139 1.00 89.82  ? 121 THR D C     1 
ATOM   1867 O  O     . THR D 4 121 ? -7.534  28.748  15.981 1.00 90.12  ? 121 THR D O     1 
ATOM   1868 C  CB    . THR D 4 121 ? -10.354 29.394  14.617 1.00 89.12  ? 121 THR D CB    1 
ATOM   1869 O  OG1   . THR D 4 121 ? -11.663 28.824  14.491 1.00 88.93  ? 121 THR D OG1   1 
ATOM   1870 C  CG2   . THR D 4 121 ? -9.410  28.674  13.678 1.00 89.39  ? 121 THR D CG2   1 
ATOM   1871 N  N     . THR D 4 122 ? -8.076  30.891  16.367 1.00 90.90  ? 122 THR D N     1 
ATOM   1872 C  CA    . THR D 4 122 ? -6.683  31.312  16.461 1.00 92.43  ? 122 THR D CA    1 
ATOM   1873 C  C     . THR D 4 122 ? -6.037  30.589  17.634 1.00 93.82  ? 122 THR D C     1 
ATOM   1874 O  O     . THR D 4 122 ? -4.840  30.306  17.620 1.00 94.47  ? 122 THR D O     1 
ATOM   1875 C  CB    . THR D 4 122 ? -6.542  32.829  16.702 1.00 92.32  ? 122 THR D CB    1 
ATOM   1876 O  OG1   . THR D 4 122 ? -7.099  33.170  17.978 1.00 93.36  ? 122 THR D OG1   1 
ATOM   1877 C  CG2   . THR D 4 122 ? -7.253  33.605  15.620 1.00 92.84  ? 122 THR D CG2   1 
ATOM   1878 N  N     . LEU D 4 123 ? -6.842  30.293  18.651 1.00 95.27  ? 123 LEU D N     1 
ATOM   1879 C  CA    . LEU D 4 123 ? -6.354  29.597  19.837 1.00 96.18  ? 123 LEU D CA    1 
ATOM   1880 C  C     . LEU D 4 123 ? -6.504  28.087  19.676 1.00 96.81  ? 123 LEU D C     1 
ATOM   1881 O  O     . LEU D 4 123 ? -5.681  27.322  20.176 1.00 96.55  ? 123 LEU D O     1 
ATOM   1882 C  CB    . LEU D 4 123 ? -7.113  30.066  21.084 1.00 96.05  ? 123 LEU D CB    1 
ATOM   1883 C  CG    . LEU D 4 123 ? -6.966  31.541  21.464 1.00 96.00  ? 123 LEU D CG    1 
ATOM   1884 C  CD1   . LEU D 4 123 ? -7.673  31.808  22.780 1.00 95.87  ? 123 LEU D CD1   1 
ATOM   1885 C  CD2   . LEU D 4 123 ? -5.497  31.894  21.580 1.00 96.70  ? 123 LEU D CD2   1 
ATOM   1886 N  N     . ALA D 4 124 ? -7.557  27.665  18.975 1.00 97.70  ? 124 ALA D N     1 
ATOM   1887 C  CA    . ALA D 4 124 ? -7.808  26.244  18.734 1.00 98.31  ? 124 ALA D CA    1 
ATOM   1888 C  C     . ALA D 4 124 ? -6.704  25.693  17.839 1.00 98.99  ? 124 ALA D C     1 
ATOM   1889 O  O     . ALA D 4 124 ? -6.807  24.588  17.306 1.00 99.06  ? 124 ALA D O     1 
ATOM   1890 C  CB    . ALA D 4 124 ? -9.170  26.049  18.071 1.00 97.63  ? 124 ALA D CB    1 
ATOM   1891 N  N     . CYS D 4 125 ? -5.654  26.491  17.676 1.00 99.41  ? 125 CYS D N     1 
ATOM   1892 C  CA    . CYS D 4 125 ? -4.504  26.123  16.871 1.00 99.68  ? 125 CYS D CA    1 
ATOM   1893 C  C     . CYS D 4 125 ? -3.253  26.509  17.646 1.00 100.69 ? 125 CYS D C     1 
ATOM   1894 O  O     . CYS D 4 125 ? -2.269  25.776  17.646 1.00 101.20 ? 125 CYS D O     1 
ATOM   1895 C  CB    . CYS D 4 125 ? -4.550  26.839  15.521 1.00 99.26  ? 125 CYS D CB    1 
ATOM   1896 S  SG    . CYS D 4 125 ? -5.904  26.294  14.446 1.00 96.48  ? 125 CYS D SG    1 
ATOM   1897 N  N     . LEU D 4 126 ? -3.298  27.659  18.312 1.00 102.00 ? 126 LEU D N     1 
ATOM   1898 C  CA    . LEU D 4 126 ? -2.170  28.123  19.119 1.00 103.89 ? 126 LEU D CA    1 
ATOM   1899 C  C     . LEU D 4 126 ? -2.036  27.245  20.357 1.00 104.77 ? 126 LEU D C     1 
ATOM   1900 O  O     . LEU D 4 126 ? -1.097  27.387  21.138 1.00 104.71 ? 126 LEU D O     1 
ATOM   1901 C  CB    . LEU D 4 126 ? -2.378  29.572  19.569 1.00 104.48 ? 126 LEU D CB    1 
ATOM   1902 C  CG    . LEU D 4 126 ? -1.886  30.725  18.697 1.00 104.78 ? 126 LEU D CG    1 
ATOM   1903 C  CD1   . LEU D 4 126 ? -2.209  32.041  19.390 1.00 104.91 ? 126 LEU D CD1   1 
ATOM   1904 C  CD2   . LEU D 4 126 ? -0.389  30.602  18.478 1.00 105.36 ? 126 LEU D CD2   1 
ATOM   1905 N  N     . THR D 4 127 ? -3.000  26.350  20.538 1.00 106.44 ? 127 THR D N     1 
ATOM   1906 C  CA    . THR D 4 127 ? -3.006  25.443  21.677 1.00 107.94 ? 127 THR D CA    1 
ATOM   1907 C  C     . THR D 4 127 ? -3.253  24.018  21.187 1.00 90.14  ? 127 THR D C     1 
ATOM   1908 O  O     . THR D 4 127 ? -3.286  23.074  21.975 1.00 90.89  ? 127 THR D O     1 
ATOM   1909 C  CB    . THR D 4 127 ? -4.101  25.831  22.700 1.00 106.47 ? 127 THR D CB    1 
ATOM   1910 O  OG1   . THR D 4 127 ? -5.397  25.634  22.120 1.00 104.85 ? 127 THR D OG1   1 
ATOM   1911 C  CG2   . THR D 4 127 ? -3.951  27.285  23.112 1.00 104.49 ? 127 THR D CG2   1 
ATOM   1912 N  N     . SER D 4 128 ? -3.437  23.873  19.879 1.00 92.06  ? 128 SER D N     1 
ATOM   1913 C  CA    . SER D 4 128 ? -3.658  22.567  19.278 1.00 94.48  ? 128 SER D CA    1 
ATOM   1914 C  C     . SER D 4 128 ? -2.300  21.969  18.935 1.00 96.58  ? 128 SER D C     1 
ATOM   1915 O  O     . SER D 4 128 ? -1.900  20.950  19.497 1.00 96.90  ? 128 SER D O     1 
ATOM   1916 C  CB    . SER D 4 128 ? -4.495  22.697  18.006 1.00 94.64  ? 128 SER D CB    1 
ATOM   1917 O  OG    . SER D 4 128 ? -4.599  21.448  17.343 1.00 94.56  ? 128 SER D OG    1 
ATOM   1918 N  N     . ALA D 4 129 ? -1.595  22.613  18.010 1.00 98.93  ? 129 ALA D N     1 
ATOM   1919 C  CA    . ALA D 4 129 ? -0.273  22.159  17.593 1.00 81.02  ? 129 ALA D CA    1 
ATOM   1920 C  C     . ALA D 4 129 ? 0.803   23.034  18.235 1.00 82.40  ? 129 ALA D C     1 
ATOM   1921 O  O     . ALA D 4 129 ? 0.498   24.038  18.880 1.00 81.99  ? 129 ALA D O     1 
ATOM   1922 C  CB    . ALA D 4 129 ? -0.157  22.208  16.075 1.00 81.25  ? 129 ALA D CB    1 
ATOM   1923 N  N     . ASP D 4 130 ? 2.063   22.653  18.052 1.00 84.33  ? 130 ASP D N     1 
ATOM   1924 C  CA    . ASP D 4 130 ? 3.171   23.403  18.632 1.00 86.30  ? 130 ASP D CA    1 
ATOM   1925 C  C     . ASP D 4 130 ? 3.873   24.298  17.612 1.00 87.12  ? 130 ASP D C     1 
ATOM   1926 O  O     . ASP D 4 130 ? 4.467   25.319  17.970 1.00 87.22  ? 130 ASP D O     1 
ATOM   1927 C  CB    . ASP D 4 130 ? 4.171   22.435  19.264 1.00 86.71  ? 130 ASP D CB    1 
ATOM   1928 C  CG    . ASP D 4 130 ? 3.508   21.467  20.223 1.00 86.95  ? 130 ASP D CG    1 
ATOM   1929 O  OD1   . ASP D 4 130 ? 2.783   20.561  19.753 1.00 86.46  ? 130 ASP D OD1   1 
ATOM   1930 O  OD2   . ASP D 4 130 ? 3.705   21.620  21.448 1.00 87.39  ? 130 ASP D OD2   1 
ATOM   1931 N  N     . ASN D 4 131 ? 3.807   23.907  16.343 1.00 87.67  ? 131 ASN D N     1 
ATOM   1932 C  CA    . ASN D 4 131 ? 4.414   24.684  15.269 1.00 88.00  ? 131 ASN D CA    1 
ATOM   1933 C  C     . ASN D 4 131 ? 3.316   25.143  14.314 1.00 87.71  ? 131 ASN D C     1 
ATOM   1934 O  O     . ASN D 4 131 ? 2.903   24.402  13.419 1.00 87.36  ? 131 ASN D O     1 
ATOM   1935 C  CB    . ASN D 4 131 ? 5.454   23.845  14.517 1.00 88.93  ? 131 ASN D CB    1 
ATOM   1936 C  CG    . ASN D 4 131 ? 6.647   23.474  15.384 1.00 89.24  ? 131 ASN D CG    1 
ATOM   1937 O  OD1   . ASN D 4 131 ? 7.349   24.343  15.903 1.00 89.18  ? 131 ASN D OD1   1 
ATOM   1938 N  ND2   . ASN D 4 131 ? 6.880   22.175  15.542 1.00 89.19  ? 131 ASN D ND2   1 
ATOM   1939 N  N     . THR D 4 132 ? 2.841   26.368  14.525 1.00 87.32  ? 132 THR D N     1 
ATOM   1940 C  CA    . THR D 4 132 ? 1.783   26.943  13.701 1.00 86.82  ? 132 THR D CA    1 
ATOM   1941 C  C     . THR D 4 132 ? 2.096   28.388  13.302 1.00 86.59  ? 132 THR D C     1 
ATOM   1942 O  O     . THR D 4 132 ? 2.489   29.206  14.139 1.00 86.53  ? 132 THR D O     1 
ATOM   1943 C  CB    . THR D 4 132 ? 0.425   26.893  14.441 1.00 86.67  ? 132 THR D CB    1 
ATOM   1944 O  OG1   . THR D 4 132 ? 0.577   27.418  15.767 1.00 86.19  ? 132 THR D OG1   1 
ATOM   1945 C  CG2   . THR D 4 132 ? -0.082  25.459  14.522 1.00 86.24  ? 132 THR D CG2   1 
ATOM   1946 N  N     . THR D 4 133 ? 1.924   28.688  12.016 1.00 85.97  ? 133 THR D N     1 
ATOM   1947 C  CA    . THR D 4 133 ? 2.192   30.022  11.481 1.00 84.96  ? 133 THR D CA    1 
ATOM   1948 C  C     . THR D 4 133 ? 0.920   30.670  10.957 1.00 84.24  ? 133 THR D C     1 
ATOM   1949 O  O     . THR D 4 133 ? -0.186  30.203  11.225 1.00 84.66  ? 133 THR D O     1 
ATOM   1950 C  CB    . THR D 4 133 ? 3.190   29.973  10.313 1.00 84.90  ? 133 THR D CB    1 
ATOM   1951 O  OG1   . THR D 4 133 ? 2.601   29.266  9.214  1.00 84.70  ? 133 THR D OG1   1 
ATOM   1952 C  CG2   . THR D 4 133 ? 4.465   29.274  10.731 1.00 84.83  ? 133 THR D CG2   1 
ATOM   1953 N  N     . VAL D 4 134 ? 1.091   31.741  10.190 1.00 82.91  ? 134 VAL D N     1 
ATOM   1954 C  CA    . VAL D 4 134 ? -0.035  32.465  9.623  1.00 81.34  ? 134 VAL D CA    1 
ATOM   1955 C  C     . VAL D 4 134 ? -0.839  31.619  8.639  1.00 80.57  ? 134 VAL D C     1 
ATOM   1956 O  O     . VAL D 4 134 ? -2.067  31.637  8.660  1.00 80.89  ? 134 VAL D O     1 
ATOM   1957 C  CB    . VAL D 4 134 ? 0.442   33.747  8.918  1.00 81.11  ? 134 VAL D CB    1 
ATOM   1958 C  CG1   . VAL D 4 134 ? 1.151   34.646  9.917  1.00 80.53  ? 134 VAL D CG1   1 
ATOM   1959 C  CG2   . VAL D 4 134 ? 1.369   33.398  7.764  1.00 81.64  ? 134 VAL D CG2   1 
ATOM   1960 N  N     . GLN D 4 135 ? -0.152  30.876  7.778  1.00 99.76  ? 135 GLN D N     1 
ATOM   1961 C  CA    . GLN D 4 135 ? -0.843  30.035  6.807  1.00 99.10  ? 135 GLN D CA    1 
ATOM   1962 C  C     . GLN D 4 135 ? -1.753  29.058  7.534  1.00 97.77  ? 135 GLN D C     1 
ATOM   1963 O  O     . GLN D 4 135 ? -2.894  28.838  7.131  1.00 97.02  ? 135 GLN D O     1 
ATOM   1964 C  CB    . GLN D 4 135 ? 0.156   29.246  5.955  1.00 90.13  ? 135 GLN D CB    1 
ATOM   1965 C  CG    . GLN D 4 135 ? 1.077   30.097  5.099  1.00 91.31  ? 135 GLN D CG    1 
ATOM   1966 C  CD    . GLN D 4 135 ? 1.945   29.260  4.177  1.00 92.00  ? 135 GLN D CD    1 
ATOM   1967 O  OE1   . GLN D 4 135 ? 1.437   28.544  3.314  1.00 92.62  ? 135 GLN D OE1   1 
ATOM   1968 N  NE2   . GLN D 4 135 ? 3.261   29.345  4.355  1.00 91.97  ? 135 GLN D NE2   1 
ATOM   1969 N  N     . ALA D 4 136 ? -1.233  28.477  8.611  1.00 96.52  ? 136 ALA D N     1 
ATOM   1970 C  CA    . ALA D 4 136 ? -1.978  27.513  9.409  1.00 95.19  ? 136 ALA D CA    1 
ATOM   1971 C  C     . ALA D 4 136 ? -3.257  28.127  9.957  1.00 94.12  ? 136 ALA D C     1 
ATOM   1972 O  O     . ALA D 4 136 ? -4.351  27.608  9.730  1.00 93.98  ? 136 ALA D O     1 
ATOM   1973 C  CB    . ALA D 4 136 ? -1.113  27.008  10.557 1.00 95.57  ? 136 ALA D CB    1 
ATOM   1974 N  N     . VAL D 4 137 ? -3.110  29.233  10.682 1.00 92.39  ? 137 VAL D N     1 
ATOM   1975 C  CA    . VAL D 4 137 ? -4.249  29.928  11.271 1.00 90.58  ? 137 VAL D CA    1 
ATOM   1976 C  C     . VAL D 4 137 ? -5.253  30.333  10.197 1.00 89.02  ? 137 VAL D C     1 
ATOM   1977 O  O     . VAL D 4 137 ? -6.411  29.912  10.221 1.00 88.20  ? 137 VAL D O     1 
ATOM   1978 C  CB    . VAL D 4 137 ? -3.796  31.198  12.024 1.00 90.85  ? 137 VAL D CB    1 
ATOM   1979 C  CG1   . VAL D 4 137 ? -4.984  31.848  12.711 1.00 91.05  ? 137 VAL D CG1   1 
ATOM   1980 C  CG2   . VAL D 4 137 ? -2.730  30.845  13.040 1.00 91.03  ? 137 VAL D CG2   1 
ATOM   1981 N  N     . ALA D 4 138 ? -4.790  31.150  9.257  1.00 87.08  ? 138 ALA D N     1 
ATOM   1982 C  CA    . ALA D 4 138 ? -5.619  31.634  8.165  1.00 85.26  ? 138 ALA D CA    1 
ATOM   1983 C  C     . ALA D 4 138 ? -6.363  30.511  7.452  1.00 84.30  ? 138 ALA D C     1 
ATOM   1984 O  O     . ALA D 4 138 ? -7.563  30.613  7.205  1.00 83.42  ? 138 ALA D O     1 
ATOM   1985 C  CB    . ALA D 4 138 ? -4.761  32.395  7.178  1.00 85.79  ? 138 ALA D CB    1 
ATOM   1986 N  N     . SER D 4 139 ? -5.647  29.442  7.116  1.00 84.04  ? 139 SER D N     1 
ATOM   1987 C  CA    . SER D 4 139 ? -6.252  28.306  6.423  1.00 83.19  ? 139 SER D CA    1 
ATOM   1988 C  C     . SER D 4 139 ? -7.321  27.659  7.288  1.00 82.38  ? 139 SER D C     1 
ATOM   1989 O  O     . SER D 4 139 ? -8.091  26.825  6.820  1.00 82.27  ? 139 SER D O     1 
ATOM   1990 C  CB    . SER D 4 139 ? -5.182  27.275  6.052  1.00 83.00  ? 139 SER D CB    1 
ATOM   1991 O  OG    . SER D 4 139 ? -4.455  26.852  7.191  1.00 83.61  ? 139 SER D OG    1 
ATOM   1992 N  N     . ALA D 4 140 ? -7.354  28.050  8.557  1.00 82.16  ? 140 ALA D N     1 
ATOM   1993 C  CA    . ALA D 4 140 ? -8.331  27.534  9.506  1.00 81.57  ? 140 ALA D CA    1 
ATOM   1994 C  C     . ALA D 4 140 ? -9.416  28.590  9.696  1.00 81.02  ? 140 ALA D C     1 
ATOM   1995 O  O     . ALA D 4 140 ? -10.602 28.306  9.539  1.00 80.13  ? 140 ALA D O     1 
ATOM   1996 C  CB    . ALA D 4 140 ? -7.658  27.222  10.837 1.00 81.78  ? 140 ALA D CB    1 
ATOM   1997 N  N     . ILE D 4 141 ? -9.002  29.808  10.035 1.00 80.64  ? 141 ILE D N     1 
ATOM   1998 C  CA    . ILE D 4 141 ? -9.945  30.903  10.223 1.00 80.79  ? 141 ILE D CA    1 
ATOM   1999 C  C     . ILE D 4 141 ? -10.819 31.008  8.980  1.00 81.77  ? 141 ILE D C     1 
ATOM   2000 O  O     . ILE D 4 141 ? -12.033 30.823  9.049  1.00 82.06  ? 141 ILE D O     1 
ATOM   2001 C  CB    . ILE D 4 141 ? -9.217  32.253  10.438 1.00 99.81  ? 141 ILE D CB    1 
ATOM   2002 C  CG1   . ILE D 4 141 ? -8.511  32.255  11.795 1.00 98.69  ? 141 ILE D CG1   1 
ATOM   2003 C  CG2   . ILE D 4 141 ? -10.209 33.405  10.348 1.00 99.47  ? 141 ILE D CG2   1 
ATOM   2004 C  CD1   . ILE D 4 141 ? -7.822  33.560  12.114 1.00 97.22  ? 141 ILE D CD1   1 
ATOM   2005 N  N     . GLY D 4 142 ? -10.193 31.301  7.843  1.00 82.67  ? 142 GLY D N     1 
ATOM   2006 C  CA    . GLY D 4 142 ? -10.937 31.409  6.602  1.00 83.74  ? 142 GLY D CA    1 
ATOM   2007 C  C     . GLY D 4 142 ? -11.754 30.155  6.371  1.00 84.95  ? 142 GLY D C     1 
ATOM   2008 O  O     . GLY D 4 142 ? -12.918 30.220  5.976  1.00 84.08  ? 142 GLY D O     1 
ATOM   2009 N  N     . ARG D 4 143 ? -11.141 29.004  6.629  1.00 86.99  ? 143 ARG D N     1 
ATOM   2010 C  CA    . ARG D 4 143 ? -11.813 27.724  6.456  1.00 89.06  ? 143 ARG D CA    1 
ATOM   2011 C  C     . ARG D 4 143 ? -13.009 27.679  7.396  1.00 90.18  ? 143 ARG D C     1 
ATOM   2012 O  O     . ARG D 4 143 ? -14.067 27.141  7.060  1.00 109.92 ? 143 ARG D O     1 
ATOM   2013 C  CB    . ARG D 4 143 ? -10.856 26.579  6.789  1.00 89.48  ? 143 ARG D CB    1 
ATOM   2014 C  CG    . ARG D 4 143 ? -11.028 25.359  5.911  1.00 91.32  ? 143 ARG D CG    1 
ATOM   2015 C  CD    . ARG D 4 143 ? -12.440 24.796  5.994  1.00 93.35  ? 143 ARG D CD    1 
ATOM   2016 N  NE    . ARG D 4 143 ? -12.686 23.799  4.955  1.00 94.63  ? 143 ARG D NE    1 
ATOM   2017 C  CZ    . ARG D 4 143 ? -11.971 22.689  4.797  1.00 95.55  ? 143 ARG D CZ    1 
ATOM   2018 N  NH1   . ARG D 4 143 ? -10.960 22.425  5.617  1.00 95.58  ? 143 ARG D NH1   1 
ATOM   2019 N  NH2   . ARG D 4 143 ? -12.260 21.847  3.813  1.00 96.06  ? 143 ARG D NH2   1 
ATOM   2020 N  N     . ALA D 4 144 ? -12.824 28.259  8.577  1.00 91.42  ? 144 ALA D N     1 
ATOM   2021 C  CA    . ALA D 4 144 ? -13.859 28.306  9.597  1.00 92.60  ? 144 ALA D CA    1 
ATOM   2022 C  C     . ALA D 4 144 ? -14.921 29.339  9.250  1.00 93.82  ? 144 ALA D C     1 
ATOM   2023 O  O     . ALA D 4 144 ? -16.100 29.138  9.537  1.00 93.61  ? 144 ALA D O     1 
ATOM   2024 C  CB    . ALA D 4 144 ? -13.239 28.626  10.950 1.00 92.47  ? 144 ALA D CB    1 
ATOM   2025 N  N     . ILE D 4 145 ? -14.502 30.447  8.642  1.00 95.54  ? 145 ILE D N     1 
ATOM   2026 C  CA    . ILE D 4 145 ? -15.436 31.499  8.256  1.00 97.76  ? 145 ILE D CA    1 
ATOM   2027 C  C     . ILE D 4 145 ? -16.496 30.878  7.359  1.00 99.63  ? 145 ILE D C     1 
ATOM   2028 O  O     . ILE D 4 145 ? -17.657 31.285  7.376  1.00 99.23  ? 145 ILE D O     1 
ATOM   2029 C  CB    . ILE D 4 145 ? -14.724 32.639  7.496  1.00 97.64  ? 145 ILE D CB    1 
ATOM   2030 C  CG1   . ILE D 4 145 ? -13.617 33.233  8.367  1.00 97.38  ? 145 ILE D CG1   1 
ATOM   2031 C  CG2   . ILE D 4 145 ? -15.723 33.727  7.131  1.00 97.53  ? 145 ILE D CG2   1 
ATOM   2032 C  CD1   . ILE D 4 145 ? -14.107 33.823  9.668  1.00 97.49  ? 145 ILE D CD1   1 
ATOM   2033 N  N     . GLU D 4 146 ? -16.082 29.888  6.573  1.00 92.43  ? 146 GLU D N     1 
ATOM   2034 C  CA    . GLU D 4 146 ? -16.996 29.177  5.690  1.00 95.21  ? 146 GLU D CA    1 
ATOM   2035 C  C     . GLU D 4 146 ? -17.698 28.183  6.602  1.00 96.90  ? 146 GLU D C     1 
ATOM   2036 O  O     . GLU D 4 146 ? -17.523 28.240  7.818  1.00 97.04  ? 146 GLU D O     1 
ATOM   2037 C  CB    . GLU D 4 146 ? -16.226 28.429  4.601  1.00 96.20  ? 146 GLU D CB    1 
ATOM   2038 C  CG    . GLU D 4 146 ? -15.151 29.258  3.913  1.00 97.43  ? 146 GLU D CG    1 
ATOM   2039 C  CD    . GLU D 4 146 ? -14.431 28.494  2.814  1.00 97.92  ? 146 GLU D CD    1 
ATOM   2040 O  OE1   . GLU D 4 146 ? -13.346 28.947  2.391  1.00 97.72  ? 146 GLU D OE1   1 
ATOM   2041 O  OE2   . GLU D 4 146 ? -14.951 27.448  2.367  1.00 98.55  ? 146 GLU D OE2   1 
ATOM   2042 N  N     . ASP D 4 147 ? -18.466 27.261  6.029  1.00 98.91  ? 147 ASP D N     1 
ATOM   2043 C  CA    . ASP D 4 147 ? -19.198 26.282  6.833  1.00 90.72  ? 147 ASP D CA    1 
ATOM   2044 C  C     . ASP D 4 147 ? -20.193 27.095  7.652  1.00 92.00  ? 147 ASP D C     1 
ATOM   2045 O  O     . ASP D 4 147 ? -21.405 26.973  7.474  1.00 92.30  ? 147 ASP D O     1 
ATOM   2046 C  CB    . ASP D 4 147 ? -18.240 25.517  7.752  1.00 90.30  ? 147 ASP D CB    1 
ATOM   2047 C  CG    . ASP D 4 147 ? -17.149 24.796  6.983  1.00 99.93  ? 147 ASP D CG    1 
ATOM   2048 O  OD1   . ASP D 4 147 ? -17.484 23.911  6.168  1.00 99.76  ? 147 ASP D OD1   1 
ATOM   2049 O  OD2   . ASP D 4 147 ? -15.960 25.118  7.188  1.00 99.66  ? 147 ASP D OD2   1 
ATOM   2050 N  N     . GLU D 4 148 ? -19.668 27.925  8.548  1.00 93.32  ? 148 GLU D N     1 
ATOM   2051 C  CA    . GLU D 4 148 ? -20.496 28.807  9.356  1.00 94.92  ? 148 GLU D CA    1 
ATOM   2052 C  C     . GLU D 4 148 ? -21.116 29.781  8.366  1.00 95.45  ? 148 GLU D C     1 
ATOM   2053 O  O     . GLU D 4 148 ? -22.244 30.233  8.538  1.00 95.47  ? 148 GLU D O     1 
ATOM   2054 C  CB    . GLU D 4 148 ? -19.635 29.574  10.359 1.00 95.72  ? 148 GLU D CB    1 
ATOM   2055 C  CG    . GLU D 4 148 ? -19.460 28.892  11.704 1.00 96.35  ? 148 GLU D CG    1 
ATOM   2056 C  CD    . GLU D 4 148 ? -20.642 29.117  12.628 1.00 96.44  ? 148 GLU D CD    1 
ATOM   2057 O  OE1   . GLU D 4 148 ? -20.574 28.666  13.790 1.00 96.86  ? 148 GLU D OE1   1 
ATOM   2058 O  OE2   . GLU D 4 148 ? -21.633 29.745  12.195 1.00 95.85  ? 148 GLU D OE2   1 
ATOM   2059 N  N     . ALA D 4 149 ? -20.356 30.106  7.327  1.00 96.13  ? 149 ALA D N     1 
ATOM   2060 C  CA    . ALA D 4 149 ? -20.836 31.007  6.297  1.00 97.13  ? 149 ALA D CA    1 
ATOM   2061 C  C     . ALA D 4 149 ? -21.869 30.239  5.492  1.00 98.26  ? 149 ALA D C     1 
ATOM   2062 O  O     . ALA D 4 149 ? -22.921 30.765  5.143  1.00 98.27  ? 149 ALA D O     1 
ATOM   2063 C  CB    . ALA D 4 149 ? -19.689 31.439  5.400  1.00 96.39  ? 149 ALA D CB    1 
ATOM   2064 N  N     . ARG D 4 150 ? -21.560 28.977  5.217  1.00 99.95  ? 150 ARG D N     1 
ATOM   2065 C  CA    . ARG D 4 150 ? -22.445 28.113  4.447  1.00 91.73  ? 150 ARG D CA    1 
ATOM   2066 C  C     . ARG D 4 150 ? -23.645 27.667  5.274  1.00 92.78  ? 150 ARG D C     1 
ATOM   2067 O  O     . ARG D 4 150 ? -24.677 28.339  5.308  1.00 92.73  ? 150 ARG D O     1 
ATOM   2068 C  CB    . ARG D 4 150 ? -21.672 26.887  3.954  1.00 92.12  ? 150 ARG D CB    1 
ATOM   2069 C  CG    . ARG D 4 150 ? -20.391 27.235  3.214  1.00 93.03  ? 150 ARG D CG    1 
ATOM   2070 C  CD    . ARG D 4 150 ? -19.651 26.002  2.718  1.00 93.66  ? 150 ARG D CD    1 
ATOM   2071 N  NE    . ARG D 4 150 ? -18.413 26.364  2.028  1.00 93.82  ? 150 ARG D NE    1 
ATOM   2072 C  CZ    . ARG D 4 150 ? -17.555 25.487  1.517  1.00 93.69  ? 150 ARG D CZ    1 
ATOM   2073 N  NH1   . ARG D 4 150 ? -17.795 24.187  1.615  1.00 93.86  ? 150 ARG D NH1   1 
ATOM   2074 N  NH2   . ARG D 4 150 ? -16.458 25.911  0.906  1.00 93.39  ? 150 ARG D NH2   1 
ATOM   2075 N  N     . PHE D 4 151 ? -23.494 26.530  5.943  1.00 94.15  ? 151 PHE D N     1 
ATOM   2076 C  CA    . PHE D 4 151 ? -24.550 25.963  6.771  1.00 95.63  ? 151 PHE D CA    1 
ATOM   2077 C  C     . PHE D 4 151 ? -25.000 26.952  7.839  1.00 96.74  ? 151 PHE D C     1 
ATOM   2078 O  O     . PHE D 4 151 ? -25.950 26.690  8.575  1.00 96.76  ? 151 PHE D O     1 
ATOM   2079 C  CB    . PHE D 4 151 ? -24.056 24.683  7.450  1.00 95.72  ? 151 PHE D CB    1 
ATOM   2080 C  CG    . PHE D 4 151 ? -23.230 23.798  6.559  1.00 96.14  ? 151 PHE D CG    1 
ATOM   2081 C  CD1   . PHE D 4 151 ? -21.944 24.176  6.178  1.00 96.26  ? 151 PHE D CD1   1 
ATOM   2082 C  CD2   . PHE D 4 151 ? -23.737 22.589  6.096  1.00 96.30  ? 151 PHE D CD2   1 
ATOM   2083 C  CE1   . PHE D 4 151 ? -21.174 23.364  5.350  1.00 96.28  ? 151 PHE D CE1   1 
ATOM   2084 C  CE2   . PHE D 4 151 ? -22.975 21.768  5.267  1.00 96.53  ? 151 PHE D CE2   1 
ATOM   2085 C  CZ    . PHE D 4 151 ? -21.690 22.157  4.893  1.00 96.44  ? 151 PHE D CZ    1 
ATOM   2086 N  N     . GLY D 4 152 ? -24.313 28.088  7.919  1.00 98.00  ? 152 GLY D N     1 
ATOM   2087 C  CA    . GLY D 4 152 ? -24.655 29.088  8.913  1.00 99.73  ? 152 GLY D CA    1 
ATOM   2088 C  C     . GLY D 4 152 ? -25.435 30.276  8.384  1.00 90.89  ? 152 GLY D C     1 
ATOM   2089 O  O     . GLY D 4 152 ? -26.294 30.813  9.086  1.00 91.31  ? 152 GLY D O     1 
ATOM   2090 N  N     . ARG D 4 153 ? -25.143 30.702  7.158  1.00 91.77  ? 153 ARG D N     1 
ATOM   2091 C  CA    . ARG D 4 153 ? -25.855 31.835  6.577  1.00 92.55  ? 153 ARG D CA    1 
ATOM   2092 C  C     . ARG D 4 153 ? -27.312 31.451  6.334  1.00 92.68  ? 153 ARG D C     1 
ATOM   2093 O  O     . ARG D 4 153 ? -28.128 32.279  5.934  1.00 92.81  ? 153 ARG D O     1 
ATOM   2094 C  CB    . ARG D 4 153 ? -25.198 32.269  5.262  1.00 92.83  ? 153 ARG D CB    1 
ATOM   2095 C  CG    . ARG D 4 153 ? -25.851 33.478  4.610  1.00 93.24  ? 153 ARG D CG    1 
ATOM   2096 C  CD    . ARG D 4 153 ? -25.903 34.659  5.565  1.00 93.49  ? 153 ARG D CD    1 
ATOM   2097 N  NE    . ARG D 4 153 ? -26.667 35.773  5.012  1.00 93.62  ? 153 ARG D NE    1 
ATOM   2098 C  CZ    . ARG D 4 153 ? -26.949 36.888  5.677  1.00 93.64  ? 153 ARG D CZ    1 
ATOM   2099 N  NH1   . ARG D 4 153 ? -26.531 37.041  6.926  1.00 93.62  ? 153 ARG D NH1   1 
ATOM   2100 N  NH2   . ARG D 4 153 ? -27.653 37.849  5.094  1.00 93.59  ? 153 ARG D NH2   1 
ATOM   2101 N  N     . ILE D 4 154 ? -27.628 30.185  6.588  1.00 92.70  ? 154 ILE D N     1 
ATOM   2102 C  CA    . ILE D 4 154 ? -28.981 29.678  6.416  1.00 92.89  ? 154 ILE D CA    1 
ATOM   2103 C  C     . ILE D 4 154 ? -29.862 30.212  7.550  1.00 93.44  ? 154 ILE D C     1 
ATOM   2104 O  O     . ILE D 4 154 ? -31.050 29.898  7.629  1.00 93.53  ? 154 ILE D O     1 
ATOM   2105 C  CB    . ILE D 4 154 ? -28.991 28.130  6.435  1.00 92.50  ? 154 ILE D CB    1 
ATOM   2106 C  CG1   . ILE D 4 154 ? -30.373 27.605  6.048  1.00 91.98  ? 154 ILE D CG1   1 
ATOM   2107 C  CG2   . ILE D 4 154 ? -28.607 27.624  7.815  1.00 92.82  ? 154 ILE D CG2   1 
ATOM   2108 C  CD1   . ILE D 4 154 ? -30.480 26.096  6.052  1.00 91.21  ? 154 ILE D CD1   1 
ATOM   2109 N  N     . ARG D 4 155 ? -29.266 31.019  8.425  1.00 94.00  ? 155 ARG D N     1 
ATOM   2110 C  CA    . ARG D 4 155 ? -29.981 31.609  9.555  1.00 94.72  ? 155 ARG D CA    1 
ATOM   2111 C  C     . ARG D 4 155 ? -31.270 32.251  9.055  1.00 95.31  ? 155 ARG D C     1 
ATOM   2112 O  O     . ARG D 4 155 ? -32.354 31.981  9.573  1.00 95.41  ? 155 ARG D O     1 
ATOM   2113 C  CB    . ARG D 4 155 ? -29.097 32.657  10.247 1.00 94.46  ? 155 ARG D CB    1 
ATOM   2114 C  CG    . ARG D 4 155 ? -29.700 33.289  11.502 1.00 94.41  ? 155 ARG D CG    1 
ATOM   2115 C  CD    . ARG D 4 155 ? -30.705 34.388  11.172 1.00 94.30  ? 155 ARG D CD    1 
ATOM   2116 N  NE    . ARG D 4 155 ? -31.271 35.006  12.372 1.00 94.11  ? 155 ARG D NE    1 
ATOM   2117 C  CZ    . ARG D 4 155 ? -32.131 34.411  13.194 1.00 93.91  ? 155 ARG D CZ    1 
ATOM   2118 N  NH1   . ARG D 4 155 ? -32.537 33.171  12.954 1.00 93.85  ? 155 ARG D NH1   1 
ATOM   2119 N  NH2   . ARG D 4 155 ? -32.584 35.055  14.261 1.00 93.51  ? 155 ARG D NH2   1 
ATOM   2120 N  N     . ASP D 4 156 ? -31.143 33.107  8.047  1.00 96.04  ? 156 ASP D N     1 
ATOM   2121 C  CA    . ASP D 4 156 ? -32.299 33.769  7.458  1.00 96.74  ? 156 ASP D CA    1 
ATOM   2122 C  C     . ASP D 4 156 ? -32.715 32.988  6.214  1.00 97.16  ? 156 ASP D C     1 
ATOM   2123 O  O     . ASP D 4 156 ? -32.114 31.960  5.898  1.00 97.18  ? 156 ASP D O     1 
ATOM   2124 C  CB    . ASP D 4 156 ? -31.959 35.222  7.101  1.00 96.88  ? 156 ASP D CB    1 
ATOM   2125 C  CG    . ASP D 4 156 ? -30.683 35.347  6.288  1.00 96.91  ? 156 ASP D CG    1 
ATOM   2126 O  OD1   . ASP D 4 156 ? -29.625 34.877  6.759  1.00 97.15  ? 156 ASP D OD1   1 
ATOM   2127 O  OD2   . ASP D 4 156 ? -30.735 35.924  5.181  1.00 96.76  ? 156 ASP D OD2   1 
ATOM   2128 N  N     . LEU D 4 157 ? -33.739 33.467  5.513  1.00 97.66  ? 157 LEU D N     1 
ATOM   2129 C  CA    . LEU D 4 157 ? -34.229 32.784  4.315  1.00 98.15  ? 157 LEU D CA    1 
ATOM   2130 C  C     . LEU D 4 157 ? -34.383 31.286  4.570  1.00 98.52  ? 157 LEU D C     1 
ATOM   2131 O  O     . LEU D 4 157 ? -34.281 30.470  3.652  1.00 98.45  ? 157 LEU D O     1 
ATOM   2132 C  CB    . LEU D 4 157 ? -33.281 33.015  3.131  1.00 97.87  ? 157 LEU D CB    1 
ATOM   2133 C  CG    . LEU D 4 157 ? -33.407 34.336  2.361  1.00 97.68  ? 157 LEU D CG    1 
ATOM   2134 C  CD1   . LEU D 4 157 ? -34.781 34.416  1.710  1.00 97.55  ? 157 LEU D CD1   1 
ATOM   2135 C  CD2   . LEU D 4 157 ? -33.187 35.513  3.296  1.00 97.56  ? 157 LEU D CD2   1 
ATOM   2136 N  N     . GLU D 4 158 ? -34.627 30.938  5.829  1.00 98.97  ? 158 GLU D N     1 
ATOM   2137 C  CA    . GLU D 4 158 ? -34.809 29.552  6.234  1.00 99.39  ? 158 GLU D CA    1 
ATOM   2138 C  C     . GLU D 4 158 ? -35.324 29.490  7.668  1.00 100.26 ? 158 GLU D C     1 
ATOM   2139 O  O     . GLU D 4 158 ? -35.757 28.438  8.139  1.00 100.10 ? 158 GLU D O     1 
ATOM   2140 C  CB    . GLU D 4 158 ? -33.493 28.787  6.126  1.00 98.66  ? 158 GLU D CB    1 
ATOM   2141 C  CG    . GLU D 4 158 ? -33.625 27.327  6.483  1.00 98.07  ? 158 GLU D CG    1 
ATOM   2142 C  CD    . GLU D 4 158 ? -34.781 26.674  5.762  1.00 97.83  ? 158 GLU D CD    1 
ATOM   2143 O  OE1   . GLU D 4 158 ? -34.783 26.681  4.514  1.00 97.57  ? 158 GLU D OE1   1 
ATOM   2144 O  OE2   . GLU D 4 158 ? -35.690 26.160  6.443  1.00 97.76  ? 158 GLU D OE2   1 
ATOM   2145 N  N     . ALA D 4 159 ? -35.270 30.629  8.354  1.00 101.53 ? 159 ALA D N     1 
ATOM   2146 C  CA    . ALA D 4 159 ? -35.737 30.723  9.733  1.00 102.62 ? 159 ALA D CA    1 
ATOM   2147 C  C     . ALA D 4 159 ? -37.205 30.314  9.788  1.00 103.31 ? 159 ALA D C     1 
ATOM   2148 O  O     . ALA D 4 159 ? -37.883 30.276  8.758  1.00 103.47 ? 159 ALA D O     1 
ATOM   2149 C  CB    . ALA D 4 159 ? -35.566 32.152  10.251 1.00 102.36 ? 159 ALA D CB    1 
ATOM   2150 N  N     . LYS D 4 160 ? -37.690 30.006  10.989 1.00 103.90 ? 160 LYS D N     1 
ATOM   2151 C  CA    . LYS D 4 160 ? -39.076 29.587  11.171 1.00 104.15 ? 160 LYS D CA    1 
ATOM   2152 C  C     . LYS D 4 160 ? -39.285 28.255  10.452 1.00 104.39 ? 160 LYS D C     1 
ATOM   2153 O  O     . LYS D 4 160 ? -40.343 27.632  10.553 1.00 104.29 ? 160 LYS D O     1 
ATOM   2154 C  CB    . LYS D 4 160 ? -40.021 30.657  10.613 1.00 104.13 ? 160 LYS D CB    1 
ATOM   2155 C  CG    . LYS D 4 160 ? -39.924 31.994  11.340 1.00 104.07 ? 160 LYS D CG    1 
ATOM   2156 C  CD    . LYS D 4 160 ? -40.598 33.120  10.567 1.00 103.84 ? 160 LYS D CD    1 
ATOM   2157 C  CE    . LYS D 4 160 ? -39.749 33.587  9.390  1.00 103.63 ? 160 LYS D CE    1 
ATOM   2158 N  NZ    . LYS D 4 160 ? -39.501 32.515  8.388  1.00 103.56 ? 160 LYS D NZ    1 
ATOM   2159 N  N     . HIS D 4 161 ? -38.253 27.830  9.730  1.00 104.60 ? 161 HIS D N     1 
ATOM   2160 C  CA    . HIS D 4 161 ? -38.269 26.579  8.988  1.00 104.86 ? 161 HIS D CA    1 
ATOM   2161 C  C     . HIS D 4 161 ? -36.987 25.821  9.305  1.00 104.58 ? 161 HIS D C     1 
ATOM   2162 O  O     . HIS D 4 161 ? -36.823 24.666  8.919  1.00 104.58 ? 161 HIS D O     1 
ATOM   2163 C  CB    . HIS D 4 161 ? -38.357 26.854  7.484  1.00 105.84 ? 161 HIS D CB    1 
ATOM   2164 C  CG    . HIS D 4 161 ? -39.666 27.440  7.049  1.00 106.92 ? 161 HIS D CG    1 
ATOM   2165 N  ND1   . HIS D 4 161 ? -40.863 26.768  7.182  1.00 107.34 ? 161 HIS D ND1   1 
ATOM   2166 C  CD2   . HIS D 4 161 ? -39.965 28.631  6.480  1.00 107.18 ? 161 HIS D CD2   1 
ATOM   2167 C  CE1   . HIS D 4 161 ? -41.843 27.520  6.713  1.00 107.34 ? 161 HIS D CE1   1 
ATOM   2168 N  NE2   . HIS D 4 161 ? -41.325 28.656  6.281  1.00 107.44 ? 161 HIS D NE2   1 
ATOM   2169 N  N     . PHE D 4 162 ? -36.074 26.488  10.004 1.00 104.35 ? 162 PHE D N     1 
ATOM   2170 C  CA    . PHE D 4 162 ? -34.810 25.875  10.395 1.00 104.26 ? 162 PHE D CA    1 
ATOM   2171 C  C     . PHE D 4 162 ? -35.080 25.051  11.651 1.00 104.19 ? 162 PHE D C     1 
ATOM   2172 O  O     . PHE D 4 162 ? -34.618 23.915  11.777 1.00 104.23 ? 162 PHE D O     1 
ATOM   2173 C  CB    . PHE D 4 162 ? -33.761 26.954  10.689 1.00 104.20 ? 162 PHE D CB    1 
ATOM   2174 C  CG    . PHE D 4 162 ? -32.402 26.407  11.044 1.00 103.74 ? 162 PHE D CG    1 
ATOM   2175 C  CD1   . PHE D 4 162 ? -31.667 25.673  10.119 1.00 103.37 ? 162 PHE D CD1   1 
ATOM   2176 C  CD2   . PHE D 4 162 ? -31.857 26.629  12.305 1.00 103.40 ? 162 PHE D CD2   1 
ATOM   2177 C  CE1   . PHE D 4 162 ? -30.410 25.169  10.445 1.00 102.97 ? 162 PHE D CE1   1 
ATOM   2178 C  CE2   . PHE D 4 162 ? -30.601 26.129  12.639 1.00 102.87 ? 162 PHE D CE2   1 
ATOM   2179 C  CZ    . PHE D 4 162 ? -29.878 25.398  11.707 1.00 102.85 ? 162 PHE D CZ    1 
ATOM   2180 N  N     . LYS D 4 163 ? -35.841 25.638  12.573 1.00 103.83 ? 163 LYS D N     1 
ATOM   2181 C  CA    . LYS D 4 163 ? -36.206 24.971  13.817 1.00 103.25 ? 163 LYS D CA    1 
ATOM   2182 C  C     . LYS D 4 163 ? -37.220 23.890  13.475 1.00 103.55 ? 163 LYS D C     1 
ATOM   2183 O  O     . LYS D 4 163 ? -37.847 23.311  14.360 1.00 103.42 ? 163 LYS D O     1 
ATOM   2184 C  CB    . LYS D 4 163 ? -36.846 25.961  14.792 1.00 102.25 ? 163 LYS D CB    1 
ATOM   2185 C  CG    . LYS D 4 163 ? -36.004 27.180  15.110 1.00 101.35 ? 163 LYS D CG    1 
ATOM   2186 C  CD    . LYS D 4 163 ? -36.743 28.105  16.065 1.00 100.61 ? 163 LYS D CD    1 
ATOM   2187 C  CE    . LYS D 4 163 ? -35.919 29.332  16.409 1.00 100.09 ? 163 LYS D CE    1 
ATOM   2188 N  NZ    . LYS D 4 163 ? -36.625 30.209  17.382 1.00 109.57 ? 163 LYS D NZ    1 
ATOM   2189 N  N     . LYS D 4 164 ? -37.378 23.636  12.178 1.00 104.03 ? 164 LYS D N     1 
ATOM   2190 C  CA    . LYS D 4 164 ? -38.316 22.638  11.680 1.00 104.46 ? 164 LYS D CA    1 
ATOM   2191 C  C     . LYS D 4 164 ? -38.113 21.267  12.304 1.00 104.64 ? 164 LYS D C     1 
ATOM   2192 O  O     . LYS D 4 164 ? -38.767 20.301  11.913 1.00 104.69 ? 164 LYS D O     1 
ATOM   2193 C  CB    . LYS D 4 164 ? -38.208 22.523  10.158 1.00 104.60 ? 164 LYS D CB    1 
ATOM   2194 C  CG    . LYS D 4 164 ? -39.351 23.179  9.397  1.00 104.62 ? 164 LYS D CG    1 
ATOM   2195 C  CD    . LYS D 4 164 ? -40.677 22.475  9.666  1.00 104.62 ? 164 LYS D CD    1 
ATOM   2196 C  CE    . LYS D 4 164 ? -40.649 21.026  9.193  1.00 104.63 ? 164 LYS D CE    1 
ATOM   2197 N  NZ    . LYS D 4 164 ? -41.941 20.321  9.429  1.00 104.37 ? 164 LYS D NZ    1 
ATOM   2198 N  N     . ASN D 4 165 ? -37.202 21.182  13.266 1.00 104.80 ? 165 ASN D N     1 
ATOM   2199 C  CA    . ASN D 4 165 ? -36.934 19.926  13.947 1.00 105.21 ? 165 ASN D CA    1 
ATOM   2200 C  C     . ASN D 4 165 ? -36.744 18.809  12.924 1.00 105.49 ? 165 ASN D C     1 
ATOM   2201 O  O     . ASN D 4 165 ? -36.857 17.628  13.251 1.00 105.55 ? 165 ASN D O     1 
ATOM   2202 C  CB    . ASN D 4 165 ? -38.098 19.595  14.889 1.00 105.30 ? 165 ASN D CB    1 
ATOM   2203 C  CG    . ASN D 4 165 ? -37.802 18.419  15.802 1.00 105.46 ? 165 ASN D CG    1 
ATOM   2204 O  OD1   . ASN D 4 165 ? -36.833 18.434  16.562 1.00 105.46 ? 165 ASN D OD1   1 
ATOM   2205 N  ND2   . ASN D 4 165 ? -38.646 17.393  15.737 1.00 105.31 ? 165 ASN D ND2   1 
ATOM   2206 N  N     . VAL D 4 166 ? -36.467 19.192  11.680 1.00 105.68 ? 166 VAL D N     1 
ATOM   2207 C  CA    . VAL D 4 166 ? -36.243 18.220  10.616 1.00 105.90 ? 166 VAL D CA    1 
ATOM   2208 C  C     . VAL D 4 166 ? -34.854 17.645  10.855 1.00 106.08 ? 166 VAL D C     1 
ATOM   2209 O  O     . VAL D 4 166 ? -34.421 16.704  10.188 1.00 106.20 ? 166 VAL D O     1 
ATOM   2210 C  CB    . VAL D 4 166 ? -36.289 18.886  9.222  1.00 105.82 ? 166 VAL D CB    1 
ATOM   2211 C  CG1   . VAL D 4 166 ? -36.088 17.841  8.132  1.00 105.62 ? 166 VAL D CG1   1 
ATOM   2212 C  CG2   . VAL D 4 166 ? -37.615 19.588  9.030  1.00 105.72 ? 166 VAL D CG2   1 
ATOM   2213 N  N     . GLU D 4 167 ? -34.168 18.230  11.830 1.00 106.21 ? 167 GLU D N     1 
ATOM   2214 C  CA    . GLU D 4 167 ? -32.827 17.813  12.204 1.00 106.29 ? 167 GLU D CA    1 
ATOM   2215 C  C     . GLU D 4 167 ? -32.881 17.259  13.628 1.00 106.66 ? 167 GLU D C     1 
ATOM   2216 O  O     . GLU D 4 167 ? -31.875 16.792  14.165 1.00 106.50 ? 167 GLU D O     1 
ATOM   2217 C  CB    . GLU D 4 167 ? -31.874 19.011  12.150 1.00 105.71 ? 167 GLU D CB    1 
ATOM   2218 C  CG    . GLU D 4 167 ? -32.166 20.006  11.032 1.00 104.69 ? 167 GLU D CG    1 
ATOM   2219 C  CD    . GLU D 4 167 ? -33.390 20.866  11.310 1.00 104.17 ? 167 GLU D CD    1 
ATOM   2220 O  OE1   . GLU D 4 167 ? -33.760 21.676  10.436 1.00 103.82 ? 167 GLU D OE1   1 
ATOM   2221 O  OE2   . GLU D 4 167 ? -33.981 20.738  12.402 1.00 103.96 ? 167 GLU D OE2   1 
ATOM   2222 N  N     . GLU D 4 168 ? -34.072 17.312  14.224 1.00 107.04 ? 168 GLU D N     1 
ATOM   2223 C  CA    . GLU D 4 168 ? -34.294 16.844  15.591 1.00 107.13 ? 168 GLU D CA    1 
ATOM   2224 C  C     . GLU D 4 168 ? -33.204 17.379  16.503 1.00 106.95 ? 168 GLU D C     1 
ATOM   2225 O  O     . GLU D 4 168 ? -32.109 16.819  16.584 1.00 106.86 ? 168 GLU D O     1 
ATOM   2226 C  CB    . GLU D 4 168 ? -34.333 15.313  15.635 1.00 107.41 ? 168 GLU D CB    1 
ATOM   2227 C  CG    . GLU D 4 168 ? -35.586 14.723  14.999 1.00 107.87 ? 168 GLU D CG    1 
ATOM   2228 C  CD    . GLU D 4 168 ? -36.864 15.150  15.710 1.00 108.20 ? 168 GLU D CD    1 
ATOM   2229 O  OE1   . GLU D 4 168 ? -37.960 14.944  15.145 1.00 108.24 ? 168 GLU D OE1   1 
ATOM   2230 O  OE2   . GLU D 4 168 ? -36.775 15.685  16.837 1.00 108.10 ? 168 GLU D OE2   1 
ATOM   2231 N  N     . GLN D 4 169 ? -33.516 18.471  17.193 1.00 106.84 ? 169 GLN D N     1 
ATOM   2232 C  CA    . GLN D 4 169 ? -32.556 19.108  18.077 1.00 106.87 ? 169 GLN D CA    1 
ATOM   2233 C  C     . GLN D 4 169 ? -31.337 19.356  17.200 1.00 106.84 ? 169 GLN D C     1 
ATOM   2234 O  O     . GLN D 4 169 ? -30.198 19.154  17.620 1.00 107.19 ? 169 GLN D O     1 
ATOM   2235 C  CB    . GLN D 4 169 ? -32.191 18.178  19.236 1.00 106.92 ? 169 GLN D CB    1 
ATOM   2236 C  CG    . GLN D 4 169 ? -31.623 18.882  20.462 1.00 106.95 ? 169 GLN D CG    1 
ATOM   2237 C  CD    . GLN D 4 169 ? -30.415 19.751  20.154 1.00 107.00 ? 169 GLN D CD    1 
ATOM   2238 O  OE1   . GLN D 4 169 ? -30.537 20.817  19.548 1.00 106.70 ? 169 GLN D OE1   1 
ATOM   2239 N  NE2   . GLN D 4 169 ? -29.239 19.294  20.565 1.00 107.28 ? 169 GLN D NE2   1 
ATOM   2240 N  N     . LEU D 4 170 ? -31.602 19.775  15.965 1.00 106.60 ? 170 LEU D N     1 
ATOM   2241 C  CA    . LEU D 4 170 ? -30.551 20.047  14.994 1.00 106.27 ? 170 LEU D CA    1 
ATOM   2242 C  C     . LEU D 4 170 ? -29.410 19.050  15.175 1.00 106.33 ? 170 LEU D C     1 
ATOM   2243 O  O     . LEU D 4 170 ? -29.615 17.839  15.080 1.00 105.97 ? 170 LEU D O     1 
ATOM   2244 C  CB    . LEU D 4 170 ? -30.040 21.483  15.156 1.00 105.63 ? 170 LEU D CB    1 
ATOM   2245 C  CG    . LEU D 4 170 ? -31.027 22.630  14.901 1.00 105.16 ? 170 LEU D CG    1 
ATOM   2246 C  CD1   . LEU D 4 170 ? -31.592 22.509  13.496 1.00 105.11 ? 170 LEU D CD1   1 
ATOM   2247 C  CD2   . LEU D 4 170 ? -32.146 22.604  15.928 1.00 104.71 ? 170 LEU D CD2   1 
ATOM   2248 N  N     . ASN D 4 171 ? -28.215 19.561  15.448 1.00 106.44 ? 171 ASN D N     1 
ATOM   2249 C  CA    . ASN D 4 171 ? -27.054 18.706  15.652 1.00 106.66 ? 171 ASN D CA    1 
ATOM   2250 C  C     . ASN D 4 171 ? -27.174 17.984  16.986 1.00 106.95 ? 171 ASN D C     1 
ATOM   2251 O  O     . ASN D 4 171 ? -26.341 18.163  17.875 1.00 106.79 ? 171 ASN D O     1 
ATOM   2252 C  CB    . ASN D 4 171 ? -25.771 19.540  15.631 1.00 106.55 ? 171 ASN D CB    1 
ATOM   2253 C  CG    . ASN D 4 171 ? -25.564 20.257  14.311 1.00 106.50 ? 171 ASN D CG    1 
ATOM   2254 O  OD1   . ASN D 4 171 ? -24.597 20.997  14.139 1.00 106.57 ? 171 ASN D OD1   1 
ATOM   2255 N  ND2   . ASN D 4 171 ? -26.473 20.038  13.370 1.00 106.49 ? 171 ASN D ND2   1 
ATOM   2256 N  N     . LYS D 4 172 ? -28.219 17.172  17.121 1.00 107.35 ? 172 LYS D N     1 
ATOM   2257 C  CA    . LYS D 4 172 ? -28.451 16.421  18.347 1.00 108.06 ? 172 LYS D CA    1 
ATOM   2258 C  C     . LYS D 4 172 ? -27.184 15.698  18.790 1.00 108.59 ? 172 LYS D C     1 
ATOM   2259 O  O     . LYS D 4 172 ? -26.651 15.973  19.865 1.00 108.77 ? 172 LYS D O     1 
ATOM   2260 C  CB    . LYS D 4 172 ? -29.582 15.410  18.144 1.00 108.06 ? 172 LYS D CB    1 
ATOM   2261 C  CG    . LYS D 4 172 ? -29.825 14.496  19.340 1.00 108.17 ? 172 LYS D CG    1 
ATOM   2262 C  CD    . LYS D 4 172 ? -30.190 15.285  20.589 1.00 108.14 ? 172 LYS D CD    1 
ATOM   2263 C  CE    . LYS D 4 172 ? -30.349 14.370  21.794 1.00 108.08 ? 172 LYS D CE    1 
ATOM   2264 N  NZ    . LYS D 4 172 ? -31.425 13.361  21.597 1.00 108.01 ? 172 LYS D NZ    1 
ATOM   2265 N  N     . ARG D 4 173 ? -26.702 14.774  17.962 1.00 109.06 ? 173 ARG D N     1 
ATOM   2266 C  CA    . ARG D 4 173 ? -25.491 14.029  18.289 1.00 109.30 ? 173 ARG D CA    1 
ATOM   2267 C  C     . ARG D 4 173 ? -24.247 14.880  18.068 1.00 109.55 ? 173 ARG D C     1 
ATOM   2268 O  O     . ARG D 4 173 ? -23.795 15.064  16.939 1.00 109.46 ? 173 ARG D O     1 
ATOM   2269 C  CB    . ARG D 4 173 ? -25.396 12.737  17.461 1.00 109.36 ? 173 ARG D CB    1 
ATOM   2270 C  CG    . ARG D 4 173 ? -25.586 12.896  15.958 1.00 109.30 ? 173 ARG D CG    1 
ATOM   2271 C  CD    . ARG D 4 173 ? -27.055 13.040  15.595 1.00 109.16 ? 173 ARG D CD    1 
ATOM   2272 N  NE    . ARG D 4 173 ? -27.254 13.171  14.156 1.00 108.79 ? 173 ARG D NE    1 
ATOM   2273 C  CZ    . ARG D 4 173 ? -28.436 13.365  13.581 1.00 108.68 ? 173 ARG D CZ    1 
ATOM   2274 N  NH1   . ARG D 4 173 ? -29.531 13.451  14.325 1.00 108.51 ? 173 ARG D NH1   1 
ATOM   2275 N  NH2   . ARG D 4 173 ? -28.522 13.476  12.263 1.00 108.58 ? 173 ARG D NH2   1 
ATOM   2276 N  N     . VAL D 4 174 ? -23.706 15.400  19.165 1.00 100.06 ? 174 VAL D N     1 
ATOM   2277 C  CA    . VAL D 4 174 ? -22.515 16.239  19.128 1.00 100.51 ? 174 VAL D CA    1 
ATOM   2278 C  C     . VAL D 4 174 ? -21.427 15.618  18.262 1.00 100.72 ? 174 VAL D C     1 
ATOM   2279 O  O     . VAL D 4 174 ? -21.495 14.441  17.909 1.00 100.63 ? 174 VAL D O     1 
ATOM   2280 C  CB    . VAL D 4 174 ? -21.946 16.461  20.550 1.00 100.72 ? 174 VAL D CB    1 
ATOM   2281 C  CG1   . VAL D 4 174 ? -22.922 17.276  21.384 1.00 100.79 ? 174 VAL D CG1   1 
ATOM   2282 C  CG2   . VAL D 4 174 ? -21.680 15.120  21.219 1.00 100.77 ? 174 VAL D CG2   1 
ATOM   2283 N  N     . GLY D 4 175 ? -20.423 16.419  17.923 1.00 101.12 ? 175 GLY D N     1 
ATOM   2284 C  CA    . GLY D 4 175 ? -19.333 15.926  17.104 1.00 101.66 ? 175 GLY D CA    1 
ATOM   2285 C  C     . GLY D 4 175 ? -18.579 17.034  16.398 1.00 101.93 ? 175 GLY D C     1 
ATOM   2286 O  O     . GLY D 4 175 ? -19.182 17.916  15.786 1.00 102.24 ? 175 GLY D O     1 
ATOM   2287 N  N     . HIS D 4 176 ? -17.253 16.988  16.485 1.00 101.98 ? 176 HIS D N     1 
ATOM   2288 C  CA    . HIS D 4 176 ? -16.409 17.990  15.851 1.00 101.99 ? 176 HIS D CA    1 
ATOM   2289 C  C     . HIS D 4 176 ? -16.837 18.163  14.400 1.00 102.07 ? 176 HIS D C     1 
ATOM   2290 O  O     . HIS D 4 176 ? -17.367 19.207  14.021 1.00 101.94 ? 176 HIS D O     1 
ATOM   2291 C  CB    . HIS D 4 176 ? -14.941 17.559  15.918 1.00 101.78 ? 176 HIS D CB    1 
ATOM   2292 C  CG    . HIS D 4 176 ? -13.983 18.578  15.382 1.00 101.33 ? 176 HIS D CG    1 
ATOM   2293 N  ND1   . HIS D 4 176 ? -13.935 19.873  15.852 1.00 101.09 ? 176 HIS D ND1   1 
ATOM   2294 C  CD2   . HIS D 4 176 ? -13.026 18.488  14.428 1.00 101.14 ? 176 HIS D CD2   1 
ATOM   2295 C  CE1   . HIS D 4 176 ? -12.989 20.536  15.211 1.00 101.02 ? 176 HIS D CE1   1 
ATOM   2296 N  NE2   . HIS D 4 176 ? -12.423 19.719  14.342 1.00 101.05 ? 176 HIS D NE2   1 
ATOM   2297 N  N     . VAL D 4 177 ? -16.611 17.129  13.596 1.00 102.24 ? 177 VAL D N     1 
ATOM   2298 C  CA    . VAL D 4 177 ? -16.981 17.163  12.187 1.00 102.34 ? 177 VAL D CA    1 
ATOM   2299 C  C     . VAL D 4 177 ? -18.353 16.523  12.013 1.00 102.06 ? 177 VAL D C     1 
ATOM   2300 O  O     . VAL D 4 177 ? -18.970 16.636  10.954 1.00 102.36 ? 177 VAL D O     1 
ATOM   2301 C  CB    . VAL D 4 177 ? -15.954 16.400  11.313 1.00 102.53 ? 177 VAL D CB    1 
ATOM   2302 C  CG1   . VAL D 4 177 ? -16.308 16.548  9.836  1.00 102.33 ? 177 VAL D CG1   1 
ATOM   2303 C  CG2   . VAL D 4 177 ? -14.552 16.928  11.577 1.00 102.63 ? 177 VAL D CG2   1 
ATOM   2304 N  N     . TYR D 4 178 ? -18.826 15.851  13.059 1.00 101.50 ? 178 TYR D N     1 
ATOM   2305 C  CA    . TYR D 4 178 ? -20.128 15.195  13.019 1.00 101.09 ? 178 TYR D CA    1 
ATOM   2306 C  C     . TYR D 4 178 ? -21.225 16.198  12.697 1.00 100.46 ? 178 TYR D C     1 
ATOM   2307 O  O     . TYR D 4 178 ? -22.094 15.938  11.864 1.00 100.42 ? 178 TYR D O     1 
ATOM   2308 C  CB    . TYR D 4 178 ? -20.429 14.519  14.358 1.00 101.62 ? 178 TYR D CB    1 
ATOM   2309 C  CG    . TYR D 4 178 ? -19.537 13.338  14.659 1.00 102.12 ? 178 TYR D CG    1 
ATOM   2310 C  CD1   . TYR D 4 178 ? -18.157 13.496  14.789 1.00 102.41 ? 178 TYR D CD1   1 
ATOM   2311 C  CD2   . TYR D 4 178 ? -20.071 12.057  14.800 1.00 102.11 ? 178 TYR D CD2   1 
ATOM   2312 C  CE1   . TYR D 4 178 ? -17.331 12.408  15.050 1.00 102.63 ? 178 TYR D CE1   1 
ATOM   2313 C  CE2   . TYR D 4 178 ? -19.255 10.963  15.061 1.00 102.36 ? 178 TYR D CE2   1 
ATOM   2314 C  CZ    . TYR D 4 178 ? -17.887 11.145  15.184 1.00 102.64 ? 178 TYR D CZ    1 
ATOM   2315 O  OH    . TYR D 4 178 ? -17.073 10.066  15.436 1.00 102.87 ? 178 TYR D OH    1 
ATOM   2316 N  N     . LYS D 4 179 ? -21.182 17.346  13.364 1.00 109.54 ? 179 LYS D N     1 
ATOM   2317 C  CA    . LYS D 4 179 ? -22.167 18.392  13.137 1.00 108.60 ? 179 LYS D CA    1 
ATOM   2318 C  C     . LYS D 4 179 ? -22.097 18.813  11.672 1.00 108.08 ? 179 LYS D C     1 
ATOM   2319 O  O     . LYS D 4 179 ? -23.029 19.411  11.137 1.00 107.98 ? 179 LYS D O     1 
ATOM   2320 C  CB    . LYS D 4 179 ? -21.879 19.588  14.046 1.00 108.30 ? 179 LYS D CB    1 
ATOM   2321 C  CG    . LYS D 4 179 ? -21.939 19.262  15.531 1.00 107.77 ? 179 LYS D CG    1 
ATOM   2322 C  CD    . LYS D 4 179 ? -21.554 20.460  16.388 1.00 107.81 ? 179 LYS D CD    1 
ATOM   2323 C  CE    . LYS D 4 179 ? -22.510 21.628  16.189 1.00 107.91 ? 179 LYS D CE    1 
ATOM   2324 N  NZ    . LYS D 4 179 ? -22.142 22.810  17.020 1.00 107.81 ? 179 LYS D NZ    1 
ATOM   2325 N  N     . LYS D 4 180 ? -20.956 18.379  11.081 1.00 99.22  ? 180 LYS D N     1 
ATOM   2326 C  CA    . LYS D 4 180 ? -20.925 18.859  9.705  1.00 98.59  ? 180 LYS D CA    1 
ATOM   2327 C  C     . LYS D 4 180 ? -21.200 17.697  8.758  1.00 98.10  ? 180 LYS D C     1 
ATOM   2328 O  O     . LYS D 4 180 ? -21.236 17.867  7.540  1.00 98.11  ? 180 LYS D O     1 
ATOM   2329 C  CB    . LYS D 4 180 ? -19.570 19.479  9.397  1.00 97.42  ? 180 LYS D CB    1 
ATOM   2330 C  CG    . LYS D 4 180 ? -19.158 19.396  7.932  1.00 97.78  ? 180 LYS D CG    1 
ATOM   2331 C  CD    . LYS D 4 180 ? -18.462 20.761  7.581  1.00 97.99  ? 180 LYS D CD    1 
ATOM   2332 C  CE    . LYS D 4 180 ? -18.482 21.007  6.095  1.00 98.12  ? 180 LYS D CE    1 
ATOM   2333 N  NZ    . LYS D 4 180 ? -17.586 22.190  5.772  1.00 98.31  ? 180 LYS D NZ    1 
ATOM   2334 N  N     . ALA D 4 181 ? -21.006 16.401  9.402  1.00 106.03 ? 181 ALA D N     1 
ATOM   2335 C  CA    . ALA D 4 181 ? -21.201 15.143  8.692  1.00 105.44 ? 181 ALA D CA    1 
ATOM   2336 C  C     . ALA D 4 181 ? -22.688 14.916  8.454  1.00 105.16 ? 181 ALA D C     1 
ATOM   2337 O  O     . ALA D 4 181 ? -23.170 15.046  7.330  1.00 105.01 ? 181 ALA D O     1 
ATOM   2338 C  CB    . ALA D 4 181 ? -20.616 13.992  9.496  1.00 105.38 ? 181 ALA D CB    1 
ATOM   2339 N  N     . PHE D 4 182 ? -23.414 14.576  9.516  1.00 104.97 ? 182 PHE D N     1 
ATOM   2340 C  CA    . PHE D 4 182 ? -24.851 14.346  9.409  1.00 104.60 ? 182 PHE D CA    1 
ATOM   2341 C  C     . PHE D 4 182 ? -25.585 15.662  9.181  1.00 104.21 ? 182 PHE D C     1 
ATOM   2342 O  O     . PHE D 4 182 ? -26.651 15.897  9.746  1.00 103.99 ? 182 PHE D O     1 
ATOM   2343 C  CB    . PHE D 4 182 ? -25.389 13.658  10.673 1.00 104.59 ? 182 PHE D CB    1 
ATOM   2344 C  CG    . PHE D 4 182 ? -25.510 12.159  10.545 1.00 104.63 ? 182 PHE D CG    1 
ATOM   2345 C  CD1   . PHE D 4 182 ? -24.383 11.364  10.355 1.00 104.65 ? 182 PHE D CD1   1 
ATOM   2346 C  CD2   . PHE D 4 182 ? -26.758 11.543  10.597 1.00 104.38 ? 182 PHE D CD2   1 
ATOM   2347 C  CE1   . PHE D 4 182 ? -24.498 9.979   10.217 1.00 104.40 ? 182 PHE D CE1   1 
ATOM   2348 C  CE2   . PHE D 4 182 ? -26.882 10.160  10.459 1.00 104.14 ? 182 PHE D CE2   1 
ATOM   2349 C  CZ    . PHE D 4 182 ? -25.751 9.378   10.269 1.00 104.12 ? 182 PHE D CZ    1 
ATOM   2350 N  N     . MET D 4 183 ? -24.992 16.511  8.346  1.00 103.88 ? 183 MET D N     1 
ATOM   2351 C  CA    . MET D 4 183 ? -25.550 17.813  8.002  1.00 103.63 ? 183 MET D CA    1 
ATOM   2352 C  C     . MET D 4 183 ? -24.825 18.406  6.798  1.00 103.48 ? 183 MET D C     1 
ATOM   2353 O  O     . MET D 4 183 ? -24.934 19.603  6.528  1.00 103.33 ? 183 MET D O     1 
ATOM   2354 C  CB    . MET D 4 183 ? -25.446 18.776  9.188  1.00 103.54 ? 183 MET D CB    1 
ATOM   2355 C  CG    . MET D 4 183 ? -26.596 18.684  10.178 1.00 103.42 ? 183 MET D CG    1 
ATOM   2356 S  SD    . MET D 4 183 ? -28.184 19.152  9.449  1.00 103.26 ? 183 MET D SD    1 
ATOM   2357 C  CE    . MET D 4 183 ? -28.974 17.561  9.264  1.00 103.52 ? 183 MET D CE    1 
ATOM   2358 N  N     . GLN D 4 184 ? -24.083 17.565  6.080  1.00 103.36 ? 184 GLN D N     1 
ATOM   2359 C  CA    . GLN D 4 184 ? -23.349 18.007  4.897  1.00 103.19 ? 184 GLN D CA    1 
ATOM   2360 C  C     . GLN D 4 184 ? -24.109 17.634  3.629  1.00 103.28 ? 184 GLN D C     1 
ATOM   2361 O  O     . GLN D 4 184 ? -24.440 18.501  2.818  1.00 103.07 ? 184 GLN D O     1 
ATOM   2362 C  CB    . GLN D 4 184 ? -21.943 17.389  4.867  1.00 102.84 ? 184 GLN D CB    1 
ATOM   2363 C  CG    . GLN D 4 184 ? -21.903 15.869  4.810  1.00 102.07 ? 184 GLN D CG    1 
ATOM   2364 C  CD    . GLN D 4 184 ? -20.488 15.320  4.834  1.00 101.61 ? 184 GLN D CD    1 
ATOM   2365 O  OE1   . GLN D 4 184 ? -19.760 15.490  5.813  1.00 101.26 ? 184 GLN D OE1   1 
ATOM   2366 N  NE2   . GLN D 4 184 ? -20.090 14.658  3.753  1.00 101.31 ? 184 GLN D NE2   1 
ATOM   2367 N  N     . VAL D 4 185 ? -24.381 16.343  3.460  1.00 103.52 ? 185 VAL D N     1 
ATOM   2368 C  CA    . VAL D 4 185 ? -25.117 15.868  2.295  1.00 103.62 ? 185 VAL D CA    1 
ATOM   2369 C  C     . VAL D 4 185 ? -26.583 16.225  2.514  1.00 103.59 ? 185 VAL D C     1 
ATOM   2370 O  O     . VAL D 4 185 ? -27.413 16.099  1.615  1.00 103.49 ? 185 VAL D O     1 
ATOM   2371 C  CB    . VAL D 4 185 ? -24.972 14.335  2.116  1.00 103.61 ? 185 VAL D CB    1 
ATOM   2372 C  CG1   . VAL D 4 185 ? -25.686 13.885  0.849  1.00 103.60 ? 185 VAL D CG1   1 
ATOM   2373 C  CG2   . VAL D 4 185 ? -23.499 13.956  2.049  1.00 103.47 ? 185 VAL D CG2   1 
ATOM   2374 N  N     . VAL D 4 186 ? -26.887 16.672  3.729  1.00 103.63 ? 186 VAL D N     1 
ATOM   2375 C  CA    . VAL D 4 186 ? -28.238 17.080  4.081  1.00 103.83 ? 186 VAL D CA    1 
ATOM   2376 C  C     . VAL D 4 186 ? -28.483 18.408  3.373  1.00 104.13 ? 186 VAL D C     1 
ATOM   2377 O  O     . VAL D 4 186 ? -29.621 18.853  3.225  1.00 104.37 ? 186 VAL D O     1 
ATOM   2378 C  CB    . VAL D 4 186 ? -28.381 17.274  5.605  1.00 103.63 ? 186 VAL D CB    1 
ATOM   2379 C  CG1   . VAL D 4 186 ? -29.799 17.696  5.949  1.00 103.46 ? 186 VAL D CG1   1 
ATOM   2380 C  CG2   . VAL D 4 186 ? -28.021 15.985  6.323  1.00 103.34 ? 186 VAL D CG2   1 
ATOM   2381 N  N     . GLU D 4 187 ? -27.392 19.030  2.938  1.00 104.19 ? 187 GLU D N     1 
ATOM   2382 C  CA    . GLU D 4 187 ? -27.445 20.299  2.225  1.00 104.28 ? 187 GLU D CA    1 
ATOM   2383 C  C     . GLU D 4 187 ? -27.981 20.032  0.822  1.00 104.72 ? 187 GLU D C     1 
ATOM   2384 O  O     . GLU D 4 187 ? -28.412 20.949  0.122  1.00 104.87 ? 187 GLU D O     1 
ATOM   2385 C  CB    . GLU D 4 187 ? -26.040 20.905  2.141  1.00 103.83 ? 187 GLU D CB    1 
ATOM   2386 C  CG    . GLU D 4 187 ? -25.957 22.241  1.416  1.00 103.30 ? 187 GLU D CG    1 
ATOM   2387 C  CD    . GLU D 4 187 ? -24.530 22.753  1.292  1.00 102.84 ? 187 GLU D CD    1 
ATOM   2388 O  OE1   . GLU D 4 187 ? -24.337 23.863  0.753  1.00 102.41 ? 187 GLU D OE1   1 
ATOM   2389 O  OE2   . GLU D 4 187 ? -23.600 22.045  1.733  1.00 102.61 ? 187 GLU D OE2   1 
ATOM   2390 N  N     . ALA D 4 188 ? -27.952 18.760  0.428  1.00 105.12 ? 188 ALA D N     1 
ATOM   2391 C  CA    . ALA D 4 188 ? -28.417 18.328  -0.887 1.00 105.37 ? 188 ALA D CA    1 
ATOM   2392 C  C     . ALA D 4 188 ? -29.746 18.961  -1.278 1.00 105.55 ? 188 ALA D C     1 
ATOM   2393 O  O     . ALA D 4 188 ? -29.852 19.599  -2.325 1.00 105.65 ? 188 ALA D O     1 
ATOM   2394 C  CB    . ALA D 4 188 ? -28.536 16.808  -0.922 1.00 105.26 ? 188 ALA D CB    1 
ATOM   2395 N  N     . ASP D 4 189 ? -30.758 18.774  -0.435 1.00 105.57 ? 189 ASP D N     1 
ATOM   2396 C  CA    . ASP D 4 189 ? -32.084 19.324  -0.691 1.00 105.66 ? 189 ASP D CA    1 
ATOM   2397 C  C     . ASP D 4 189 ? -32.002 20.717  -1.309 1.00 105.78 ? 189 ASP D C     1 
ATOM   2398 O  O     . ASP D 4 189 ? -31.328 21.602  -0.779 1.00 105.81 ? 189 ASP D O     1 
ATOM   2399 C  CB    . ASP D 4 189 ? -32.883 19.381  0.611  1.00 105.54 ? 189 ASP D CB    1 
ATOM   2400 C  CG    . ASP D 4 189 ? -33.165 18.006  1.176  1.00 105.34 ? 189 ASP D CG    1 
ATOM   2401 O  OD1   . ASP D 4 189 ? -33.887 17.231  0.516  1.00 105.37 ? 189 ASP D OD1   1 
ATOM   2402 O  OD2   . ASP D 4 189 ? -32.662 17.699  2.276  1.00 105.20 ? 189 ASP D OD2   1 
ATOM   2403 N  N     . MET D 4 190 ? -32.689 20.902  -2.434 1.00 105.85 ? 190 MET D N     1 
ATOM   2404 C  CA    . MET D 4 190 ? -32.692 22.183  -3.133 1.00 105.71 ? 190 MET D CA    1 
ATOM   2405 C  C     . MET D 4 190 ? -33.191 23.317  -2.242 1.00 105.70 ? 190 MET D C     1 
ATOM   2406 O  O     . MET D 4 190 ? -32.557 24.371  -2.156 1.00 105.94 ? 190 MET D O     1 
ATOM   2407 C  CB    . MET D 4 190 ? -33.561 22.104  -4.395 1.00 105.32 ? 190 MET D CB    1 
ATOM   2408 C  CG    . MET D 4 190 ? -35.025 21.771  -4.137 1.00 104.84 ? 190 MET D CG    1 
ATOM   2409 S  SD    . MET D 4 190 ? -36.042 21.892  -5.625 1.00 104.21 ? 190 MET D SD    1 
ATOM   2410 C  CE    . MET D 4 190 ? -36.642 23.571  -5.488 1.00 104.15 ? 190 MET D CE    1 
ATOM   2411 N  N     . LEU D 4 191 ? -34.325 23.097  -1.582 1.00 105.27 ? 191 LEU D N     1 
ATOM   2412 C  CA    . LEU D 4 191 ? -34.911 24.102  -0.700 1.00 104.69 ? 191 LEU D CA    1 
ATOM   2413 C  C     . LEU D 4 191 ? -34.971 25.446  -1.420 1.00 104.42 ? 191 LEU D C     1 
ATOM   2414 O  O     . LEU D 4 191 ? -35.089 25.498  -2.645 1.00 104.39 ? 191 LEU D O     1 
ATOM   2415 C  CB    . LEU D 4 191 ? -34.076 24.230  0.577  1.00 104.31 ? 191 LEU D CB    1 
ATOM   2416 C  CG    . LEU D 4 191 ? -33.926 22.955  1.411  1.00 103.99 ? 191 LEU D CG    1 
ATOM   2417 C  CD1   . LEU D 4 191 ? -32.915 23.182  2.523  1.00 104.01 ? 191 LEU D CD1   1 
ATOM   2418 C  CD2   . LEU D 4 191 ? -35.277 22.554  1.979  1.00 103.71 ? 191 LEU D CD2   1 
ATOM   2419 N  N     . SER D 4 192 ? -34.891 26.530  -0.656 1.00 103.92 ? 192 SER D N     1 
ATOM   2420 C  CA    . SER D 4 192 ? -34.926 27.868  -1.234 1.00 103.41 ? 192 SER D CA    1 
ATOM   2421 C  C     . SER D 4 192 ? -33.631 28.131  -2.002 1.00 102.89 ? 192 SER D C     1 
ATOM   2422 O  O     . SER D 4 192 ? -32.541 28.085  -1.431 1.00 102.75 ? 192 SER D O     1 
ATOM   2423 C  CB    . SER D 4 192 ? -35.099 28.914  -0.128 1.00 103.52 ? 192 SER D CB    1 
ATOM   2424 O  OG    . SER D 4 192 ? -35.126 30.227  -0.661 1.00 103.79 ? 192 SER D OG    1 
ATOM   2425 N  N     . LYS D 4 193 ? -33.757 28.399  -3.300 1.00 102.23 ? 193 LYS D N     1 
ATOM   2426 C  CA    . LYS D 4 193 ? -32.602 28.671  -4.151 1.00 101.25 ? 193 LYS D CA    1 
ATOM   2427 C  C     . LYS D 4 193 ? -31.698 27.441  -4.232 1.00 100.42 ? 193 LYS D C     1 
ATOM   2428 O  O     . LYS D 4 193 ? -32.093 26.407  -4.772 1.00 100.10 ? 193 LYS D O     1 
ATOM   2429 C  CB    . LYS D 4 193 ? -31.819 29.869  -3.599 1.00 101.45 ? 193 LYS D CB    1 
ATOM   2430 C  CG    . LYS D 4 193 ? -32.677 31.107  -3.353 1.00 101.60 ? 193 LYS D CG    1 
ATOM   2431 C  CD    . LYS D 4 193 ? -31.902 32.199  -2.626 1.00 101.61 ? 193 LYS D CD    1 
ATOM   2432 C  CE    . LYS D 4 193 ? -32.793 33.392  -2.307 1.00 101.45 ? 193 LYS D CE    1 
ATOM   2433 N  NZ    . LYS D 4 193 ? -33.945 33.018  -1.438 1.00 101.19 ? 193 LYS D NZ    1 
ATOM   2434 N  N     . GLY D 4 194 ? -30.487 27.559  -3.696 1.00 99.56  ? 194 GLY D N     1 
ATOM   2435 C  CA    . GLY D 4 194 ? -29.559 26.442  -3.713 1.00 98.53  ? 194 GLY D CA    1 
ATOM   2436 C  C     . GLY D 4 194 ? -28.211 26.765  -4.329 1.00 97.69  ? 194 GLY D C     1 
ATOM   2437 O  O     . GLY D 4 194 ? -27.947 27.906  -4.710 1.00 97.59  ? 194 GLY D O     1 
ATOM   2438 N  N     . ALA D 4 200 ? -27.355 25.749  -4.417 1.00 96.81  ? 200 ALA D N     1 
ATOM   2439 C  CA    . ALA D 4 200 ? -26.020 25.885  -4.994 1.00 95.75  ? 200 ALA D CA    1 
ATOM   2440 C  C     . ALA D 4 200 ? -25.095 26.781  -4.174 1.00 95.04  ? 200 ALA D C     1 
ATOM   2441 O  O     . ALA D 4 200 ? -25.519 27.800  -3.625 1.00 94.86  ? 200 ALA D O     1 
ATOM   2442 C  CB    . ALA D 4 200 ? -26.121 26.410  -6.425 1.00 95.78  ? 200 ALA D CB    1 
ATOM   2443 N  N     . TRP D 4 201 ? -23.826 26.390  -4.098 1.00 93.99  ? 201 TRP D N     1 
ATOM   2444 C  CA    . TRP D 4 201 ? -22.826 27.150  -3.358 1.00 93.01  ? 201 TRP D CA    1 
ATOM   2445 C  C     . TRP D 4 201 ? -21.455 27.066  -4.023 1.00 92.39  ? 201 TRP D C     1 
ATOM   2446 O  O     . TRP D 4 201 ? -20.909 25.979  -4.216 1.00 92.20  ? 201 TRP D O     1 
ATOM   2447 C  CB    . TRP D 4 201 ? -22.739 26.650  -1.910 1.00 92.86  ? 201 TRP D CB    1 
ATOM   2448 C  CG    . TRP D 4 201 ? -21.580 27.226  -1.141 1.00 92.60  ? 201 TRP D CG    1 
ATOM   2449 C  CD1   . TRP D 4 201 ? -20.291 26.769  -1.131 1.00 92.48  ? 201 TRP D CD1   1 
ATOM   2450 C  CD2   . TRP D 4 201 ? -21.594 28.400  -0.318 1.00 92.24  ? 201 TRP D CD2   1 
ATOM   2451 N  NE1   . TRP D 4 201 ? -19.503 27.585  -0.356 1.00 92.16  ? 201 TRP D NE1   1 
ATOM   2452 C  CE2   . TRP D 4 201 ? -20.276 28.594  0.155  1.00 91.98  ? 201 TRP D CE2   1 
ATOM   2453 C  CE3   . TRP D 4 201 ? -22.590 29.308  0.064  1.00 92.04  ? 201 TRP D CE3   1 
ATOM   2454 C  CZ2   . TRP D 4 201 ? -19.930 29.660  0.991  1.00 91.71  ? 201 TRP D CZ2   1 
ATOM   2455 C  CZ3   . TRP D 4 201 ? -22.244 30.370  0.897  1.00 91.82  ? 201 TRP D CZ3   1 
ATOM   2456 C  CH2   . TRP D 4 201 ? -20.923 30.535  1.350  1.00 91.72  ? 201 TRP D CH2   1 
ATOM   2457 N  N     . SER D 4 202 ? -20.907 28.227  -4.368 1.00 91.75  ? 202 SER D N     1 
ATOM   2458 C  CA    . SER D 4 202 ? -19.599 28.313  -5.009 1.00 91.08  ? 202 SER D CA    1 
ATOM   2459 C  C     . SER D 4 202 ? -18.496 28.337  -3.958 1.00 90.51  ? 202 SER D C     1 
ATOM   2460 O  O     . SER D 4 202 ? -18.090 29.404  -3.499 1.00 90.48  ? 202 SER D O     1 
ATOM   2461 C  CB    . SER D 4 202 ? -19.519 29.577  -5.871 1.00 91.05  ? 202 SER D CB    1 
ATOM   2462 O  OG    . SER D 4 202 ? -18.256 29.691  -6.506 1.00 90.88  ? 202 SER D OG    1 
ATOM   2463 N  N     . SER D 4 203 ? -18.019 27.153  -3.581 1.00 99.83  ? 203 SER D N     1 
ATOM   2464 C  CA    . SER D 4 203 ? -16.964 27.022  -2.581 1.00 99.10  ? 203 SER D CA    1 
ATOM   2465 C  C     . SER D 4 203 ? -15.907 28.109  -2.732 1.00 98.65  ? 203 SER D C     1 
ATOM   2466 O  O     . SER D 4 203 ? -15.566 28.505  -3.845 1.00 98.38  ? 203 SER D O     1 
ATOM   2467 C  CB    . SER D 4 203 ? -16.304 25.646  -2.694 1.00 99.03  ? 203 SER D CB    1 
ATOM   2468 O  OG    . SER D 4 203 ? -17.260 24.613  -2.537 1.00 98.97  ? 203 SER D OG    1 
ATOM   2469 N  N     . TRP D 4 204 ? -15.396 28.584  -1.600 1.00 98.51  ? 204 TRP D N     1 
ATOM   2470 C  CA    . TRP D 4 204 ? -14.378 29.635  -1.566 1.00 98.17  ? 204 TRP D CA    1 
ATOM   2471 C  C     . TRP D 4 204 ? -13.066 29.172  -2.188 1.00 97.67  ? 204 TRP D C     1 
ATOM   2472 O  O     . TRP D 4 204 ? -11.999 29.700  -1.865 1.00 97.48  ? 204 TRP D O     1 
ATOM   2473 C  CB    . TRP D 4 204 ? -14.105 30.056  -0.119 1.00 98.48  ? 204 TRP D CB    1 
ATOM   2474 C  CG    . TRP D 4 204 ? -15.280 30.636  0.612  1.00 98.63  ? 204 TRP D CG    1 
ATOM   2475 C  CD1   . TRP D 4 204 ? -16.583 30.230  0.536  1.00 98.86  ? 204 TRP D CD1   1 
ATOM   2476 C  CD2   . TRP D 4 204 ? -15.247 31.695  1.576  1.00 98.52  ? 204 TRP D CD2   1 
ATOM   2477 N  NE1   . TRP D 4 204 ? -17.361 30.970  1.393  1.00 98.87  ? 204 TRP D NE1   1 
ATOM   2478 C  CE2   . TRP D 4 204 ? -16.567 31.876  2.044  1.00 98.55  ? 204 TRP D CE2   1 
ATOM   2479 C  CE3   . TRP D 4 204 ? -14.229 32.507  2.092  1.00 98.42  ? 204 TRP D CE3   1 
ATOM   2480 C  CZ2   . TRP D 4 204 ? -16.896 32.836  3.003  1.00 98.40  ? 204 TRP D CZ2   1 
ATOM   2481 C  CZ3   . TRP D 4 204 ? -14.557 33.462  3.047  1.00 98.32  ? 204 TRP D CZ3   1 
ATOM   2482 C  CH2   . TRP D 4 204 ? -15.880 33.618  3.491  1.00 98.28  ? 204 TRP D CH2   1 
ATOM   2483 N  N     . HIS D 4 205 ? -13.142 28.187  -3.076 1.00 97.15  ? 205 HIS D N     1 
ATOM   2484 C  CA    . HIS D 4 205 ? -11.945 27.659  -3.715 1.00 96.56  ? 205 HIS D CA    1 
ATOM   2485 C  C     . HIS D 4 205 ? -10.985 27.159  -2.643 1.00 95.49  ? 205 HIS D C     1 
ATOM   2486 O  O     . HIS D 4 205 ? -11.361 26.360  -1.784 1.00 95.39  ? 205 HIS D O     1 
ATOM   2487 C  CB    . HIS D 4 205 ? -11.264 28.740  -4.567 1.00 97.27  ? 205 HIS D CB    1 
ATOM   2488 C  CG    . HIS D 4 205 ? -11.712 28.756  -5.996 1.00 97.50  ? 205 HIS D CG    1 
ATOM   2489 N  ND1   . HIS D 4 205 ? -11.436 27.728  -6.872 1.00 97.67  ? 205 HIS D ND1   1 
ATOM   2490 C  CD2   . HIS D 4 205 ? -12.421 29.670  -6.699 1.00 97.57  ? 205 HIS D CD2   1 
ATOM   2491 C  CE1   . HIS D 4 205 ? -11.957 28.009  -8.054 1.00 97.83  ? 205 HIS D CE1   1 
ATOM   2492 N  NE2   . HIS D 4 205 ? -12.560 29.181  -7.976 1.00 97.80  ? 205 HIS D NE2   1 
ATOM   2493 N  N     . LYS D 4 206 ? -9.748  27.640  -2.696 1.00 94.00  ? 206 LYS D N     1 
ATOM   2494 C  CA    . LYS D 4 206 ? -8.731  27.239  -1.734 1.00 92.40  ? 206 LYS D CA    1 
ATOM   2495 C  C     . LYS D 4 206 ? -7.602  28.268  -1.703 1.00 91.48  ? 206 LYS D C     1 
ATOM   2496 O  O     . LYS D 4 206 ? -6.481  27.971  -1.286 1.00 91.41  ? 206 LYS D O     1 
ATOM   2497 C  CB    . LYS D 4 206 ? -8.179  25.851  -2.098 1.00 91.79  ? 206 LYS D CB    1 
ATOM   2498 C  CG    . LYS D 4 206 ? -7.469  25.759  -3.453 1.00 91.08  ? 206 LYS D CG    1 
ATOM   2499 C  CD    . LYS D 4 206 ? -8.317  25.075  -4.527 1.00 99.99  ? 206 LYS D CD    1 
ATOM   2500 C  CE    . LYS D 4 206 ? -9.354  26.004  -5.146 1.00 98.96  ? 206 LYS D CE    1 
ATOM   2501 N  NZ    . LYS D 4 206 ? -8.744  27.134  -5.903 1.00 97.59  ? 206 LYS D NZ    1 
ATOM   2502 N  N     . GLU D 4 207 ? -7.912  29.484  -2.140 1.00 90.14  ? 207 GLU D N     1 
ATOM   2503 C  CA    . GLU D 4 207 ? -6.932  30.562  -2.181 1.00 98.66  ? 207 GLU D CA    1 
ATOM   2504 C  C     . GLU D 4 207 ? -7.468  31.841  -1.548 1.00 97.50  ? 207 GLU D C     1 
ATOM   2505 O  O     . GLU D 4 207 ? -6.731  32.805  -1.349 1.00 96.99  ? 207 GLU D O     1 
ATOM   2506 C  CB    . GLU D 4 207 ? -6.514  30.811  -3.634 1.00 98.84  ? 207 GLU D CB    1 
ATOM   2507 C  CG    . GLU D 4 207 ? -7.663  30.697  -4.629 1.00 98.90  ? 207 GLU D CG    1 
ATOM   2508 C  CD    . GLU D 4 207 ? -7.190  30.471  -6.052 1.00 98.80  ? 207 GLU D CD    1 
ATOM   2509 O  OE1   . GLU D 4 207 ? -8.049  30.281  -6.941 1.00 98.80  ? 207 GLU D OE1   1 
ATOM   2510 O  OE2   . GLU D 4 207 ? -5.962  30.482  -6.280 1.00 98.63  ? 207 GLU D OE2   1 
ATOM   2511 N  N     . ASP D 4 208 ? -8.757  31.838  -1.228 1.00 96.41  ? 208 ASP D N     1 
ATOM   2512 C  CA    . ASP D 4 208 ? -9.395  32.987  -0.601 1.00 95.15  ? 208 ASP D CA    1 
ATOM   2513 C  C     . ASP D 4 208 ? -9.324  32.807  0.909  1.00 94.03  ? 208 ASP D C     1 
ATOM   2514 O  O     . ASP D 4 208 ? -9.073  33.756  1.651  1.00 93.66  ? 208 ASP D O     1 
ATOM   2515 C  CB    . ASP D 4 208 ? -10.858 33.079  -1.031 1.00 95.42  ? 208 ASP D CB    1 
ATOM   2516 C  CG    . ASP D 4 208 ? -11.033 32.924  -2.522 1.00 95.36  ? 208 ASP D CG    1 
ATOM   2517 O  OD1   . ASP D 4 208 ? -10.353 33.651  -3.276 1.00 95.19  ? 208 ASP D OD1   1 
ATOM   2518 O  OD2   . ASP D 4 208 ? -11.851 32.077  -2.939 1.00 95.36  ? 208 ASP D OD2   1 
ATOM   2519 N  N     . SER D 4 209 ? -9.553  31.573  1.350  1.00 92.51  ? 209 SER D N     1 
ATOM   2520 C  CA    . SER D 4 209 ? -9.517  31.231  2.763  1.00 91.28  ? 209 SER D CA    1 
ATOM   2521 C  C     . SER D 4 209 ? -8.330  31.886  3.461  1.00 90.87  ? 209 SER D C     1 
ATOM   2522 O  O     . SER D 4 209 ? -8.503  32.616  4.437  1.00 91.22  ? 209 SER D O     1 
ATOM   2523 C  CB    . SER D 4 209 ? -9.438  29.713  2.931  1.00 90.81  ? 209 SER D CB    1 
ATOM   2524 O  OG    . SER D 4 209 ? -10.547 29.078  2.327  1.00 99.76  ? 209 SER D OG    1 
ATOM   2525 N  N     . ILE D 4 210 ? -7.125  31.624  2.962  1.00 90.13  ? 210 ILE D N     1 
ATOM   2526 C  CA    . ILE D 4 210 ? -5.924  32.204  3.553  1.00 99.36  ? 210 ILE D CA    1 
ATOM   2527 C  C     . ILE D 4 210 ? -6.082  33.713  3.666  1.00 98.42  ? 210 ILE D C     1 
ATOM   2528 O  O     . ILE D 4 210 ? -5.909  34.285  4.741  1.00 98.29  ? 210 ILE D O     1 
ATOM   2529 C  CB    . ILE D 4 210 ? -4.650  31.887  2.717  1.00 99.59  ? 210 ILE D CB    1 
ATOM   2530 C  CG1   . ILE D 4 210 ? -4.907  32.165  1.233  1.00 90.09  ? 210 ILE D CG1   1 
ATOM   2531 C  CG2   . ILE D 4 210 ? -4.223  30.442  2.943  1.00 99.34  ? 210 ILE D CG2   1 
ATOM   2532 C  CD1   . ILE D 4 210 ? -3.707  31.903  0.335  1.00 90.21  ? 210 ILE D CD1   1 
ATOM   2533 N  N     . HIS D 4 211 ? -6.426  34.354  2.554  1.00 97.42  ? 211 HIS D N     1 
ATOM   2534 C  CA    . HIS D 4 211 ? -6.609  35.799  2.542  1.00 96.49  ? 211 HIS D CA    1 
ATOM   2535 C  C     . HIS D 4 211 ? -7.656  36.215  3.574  1.00 94.87  ? 211 HIS D C     1 
ATOM   2536 O  O     . HIS D 4 211 ? -7.450  37.163  4.335  1.00 94.69  ? 211 HIS D O     1 
ATOM   2537 C  CB    . HIS D 4 211 ? -7.020  36.265  1.141  1.00 97.61  ? 211 HIS D CB    1 
ATOM   2538 C  CG    . HIS D 4 211 ? -5.968  36.041  0.100  1.00 98.51  ? 211 HIS D CG    1 
ATOM   2539 N  ND1   . HIS D 4 211 ? -5.543  34.782  -0.271 1.00 99.11  ? 211 HIS D ND1   1 
ATOM   2540 C  CD2   . HIS D 4 211 ? -5.238  36.914  -0.633 1.00 99.06  ? 211 HIS D CD2   1 
ATOM   2541 C  CE1   . HIS D 4 211 ? -4.597  34.891  -1.186 1.00 99.54  ? 211 HIS D CE1   1 
ATOM   2542 N  NE2   . HIS D 4 211 ? -4.392  36.174  -1.424 1.00 99.72  ? 211 HIS D NE2   1 
ATOM   2543 N  N     . VAL D 4 212 ? -8.776  35.498  3.595  1.00 92.96  ? 212 VAL D N     1 
ATOM   2544 C  CA    . VAL D 4 212 ? -9.849  35.778  4.543  1.00 90.72  ? 212 VAL D CA    1 
ATOM   2545 C  C     . VAL D 4 212 ? -9.266  35.787  5.950  1.00 88.40  ? 212 VAL D C     1 
ATOM   2546 O  O     . VAL D 4 212 ? -9.443  36.745  6.705  1.00 87.62  ? 212 VAL D O     1 
ATOM   2547 C  CB    . VAL D 4 212 ? -10.952 34.696  4.465  1.00 91.30  ? 212 VAL D CB    1 
ATOM   2548 C  CG1   . VAL D 4 212 ? -12.015 34.947  5.522  1.00 91.09  ? 212 VAL D CG1   1 
ATOM   2549 C  CG2   . VAL D 4 212 ? -11.569 34.692  3.077  1.00 91.19  ? 212 VAL D CG2   1 
ATOM   2550 N  N     . GLY D 4 213 ? -8.560  34.711  6.283  1.00 85.94  ? 213 GLY D N     1 
ATOM   2551 C  CA    . GLY D 4 213 ? -7.946  34.594  7.590  1.00 83.24  ? 213 GLY D CA    1 
ATOM   2552 C  C     . GLY D 4 213 ? -6.876  35.636  7.852  1.00 81.31  ? 213 GLY D C     1 
ATOM   2553 O  O     . GLY D 4 213 ? -6.811  36.192  8.947  1.00 82.26  ? 213 GLY D O     1 
ATOM   2554 N  N     . VAL D 4 214 ? -6.039  35.911  6.857  1.00 88.78  ? 214 VAL D N     1 
ATOM   2555 C  CA    . VAL D 4 214 ? -4.967  36.891  7.017  1.00 86.26  ? 214 VAL D CA    1 
ATOM   2556 C  C     . VAL D 4 214 ? -5.452  38.215  7.601  1.00 85.17  ? 214 VAL D C     1 
ATOM   2557 O  O     . VAL D 4 214 ? -4.877  38.712  8.568  1.00 84.08  ? 214 VAL D O     1 
ATOM   2558 C  CB    . VAL D 4 214 ? -4.255  37.183  5.675  1.00 85.49  ? 214 VAL D CB    1 
ATOM   2559 C  CG1   . VAL D 4 214 ? -3.168  38.220  5.883  1.00 84.83  ? 214 VAL D CG1   1 
ATOM   2560 C  CG2   . VAL D 4 214 ? -3.654  35.915  5.119  1.00 84.22  ? 214 VAL D CG2   1 
ATOM   2561 N  N     . ARG D 4 215 ? -6.505  38.786  7.020  1.00 84.53  ? 215 ARG D N     1 
ATOM   2562 C  CA    . ARG D 4 215 ? -7.028  40.056  7.513  1.00 83.77  ? 215 ARG D CA    1 
ATOM   2563 C  C     . ARG D 4 215 ? -7.617  39.857  8.901  1.00 82.68  ? 215 ARG D C     1 
ATOM   2564 O  O     . ARG D 4 215 ? -7.464  40.706  9.776  1.00 81.39  ? 215 ARG D O     1 
ATOM   2565 C  CB    . ARG D 4 215 ? -8.094  40.622  6.566  1.00 84.72  ? 215 ARG D CB    1 
ATOM   2566 C  CG    . ARG D 4 215 ? -8.393  42.109  6.800  1.00 85.45  ? 215 ARG D CG    1 
ATOM   2567 C  CD    . ARG D 4 215 ? -7.189  42.989  6.432  1.00 86.54  ? 215 ARG D CD    1 
ATOM   2568 N  NE    . ARG D 4 215 ? -7.340  44.388  6.843  1.00 86.93  ? 215 ARG D NE    1 
ATOM   2569 C  CZ    . ARG D 4 215 ? -7.134  44.841  8.079  1.00 86.92  ? 215 ARG D CZ    1 
ATOM   2570 N  NH1   . ARG D 4 215 ? -6.763  44.011  9.043  1.00 87.13  ? 215 ARG D NH1   1 
ATOM   2571 N  NH2   . ARG D 4 215 ? -7.299  46.128  8.355  1.00 87.07  ? 215 ARG D NH2   1 
ATOM   2572 N  N     . CYS D 4 216 ? -8.296  38.732  9.100  1.00 82.38  ? 216 CYS D N     1 
ATOM   2573 C  CA    . CYS D 4 216 ? -8.871  38.429  10.401 1.00 82.08  ? 216 CYS D CA    1 
ATOM   2574 C  C     . CYS D 4 216 ? -7.743  38.480  11.423 1.00 82.55  ? 216 CYS D C     1 
ATOM   2575 O  O     . CYS D 4 216 ? -7.820  39.215  12.408 1.00 83.28  ? 216 CYS D O     1 
ATOM   2576 C  CB    . CYS D 4 216 ? -9.501  37.032  10.406 1.00 81.63  ? 216 CYS D CB    1 
ATOM   2577 S  SG    . CYS D 4 216 ? -11.076 36.880  9.519  1.00 82.15  ? 216 CYS D SG    1 
ATOM   2578 N  N     . ILE D 4 217 ? -6.690  37.706  11.168 1.00 82.41  ? 217 ILE D N     1 
ATOM   2579 C  CA    . ILE D 4 217 ? -5.534  37.639  12.056 1.00 82.55  ? 217 ILE D CA    1 
ATOM   2580 C  C     . ILE D 4 217 ? -4.862  38.995  12.225 1.00 82.84  ? 217 ILE D C     1 
ATOM   2581 O  O     . ILE D 4 217 ? -4.323  39.304  13.287 1.00 82.49  ? 217 ILE D O     1 
ATOM   2582 C  CB    . ILE D 4 217 ? -4.480  36.648  11.523 1.00 82.96  ? 217 ILE D CB    1 
ATOM   2583 C  CG1   . ILE D 4 217 ? -5.132  35.294  11.234 1.00 83.48  ? 217 ILE D CG1   1 
ATOM   2584 C  CG2   . ILE D 4 217 ? -3.361  36.477  12.546 1.00 82.84  ? 217 ILE D CG2   1 
ATOM   2585 C  CD1   . ILE D 4 217 ? -4.202  34.289  10.560 1.00 83.51  ? 217 ILE D CD1   1 
ATOM   2586 N  N     . GLU D 4 218 ? -4.889  39.802  11.172 1.00 83.86  ? 218 GLU D N     1 
ATOM   2587 C  CA    . GLU D 4 218 ? -4.272  41.121  11.218 1.00 85.50  ? 218 GLU D CA    1 
ATOM   2588 C  C     . GLU D 4 218 ? -5.128  42.116  11.993 1.00 86.22  ? 218 GLU D C     1 
ATOM   2589 O  O     . GLU D 4 218 ? -4.603  42.925  12.759 1.00 85.93  ? 218 GLU D O     1 
ATOM   2590 C  CB    . GLU D 4 218 ? -4.017  41.629  9.798  1.00 85.72  ? 218 GLU D CB    1 
ATOM   2591 C  CG    . GLU D 4 218 ? -3.001  40.797  9.042  1.00 86.06  ? 218 GLU D CG    1 
ATOM   2592 C  CD    . GLU D 4 218 ? -3.013  41.072  7.559  1.00 86.99  ? 218 GLU D CD    1 
ATOM   2593 O  OE1   . GLU D 4 218 ? -4.077  40.887  6.933  1.00 87.50  ? 218 GLU D OE1   1 
ATOM   2594 O  OE2   . GLU D 4 218 ? -1.962  41.470  7.017  1.00 87.91  ? 218 GLU D OE2   1 
ATOM   2595 N  N     . MET D 4 219 ? -6.444  42.065  11.794 1.00 87.03  ? 219 MET D N     1 
ATOM   2596 C  CA    . MET D 4 219 ? -7.332  42.967  12.515 1.00 88.34  ? 219 MET D CA    1 
ATOM   2597 C  C     . MET D 4 219 ? -7.626  42.348  13.870 1.00 88.70  ? 219 MET D C     1 
ATOM   2598 O  O     . MET D 4 219 ? -8.563  42.738  14.568 1.00 89.12  ? 219 MET D O     1 
ATOM   2599 C  CB    . MET D 4 219 ? -8.631  43.217  11.740 1.00 88.65  ? 219 MET D CB    1 
ATOM   2600 C  CG    . MET D 4 219 ? -9.420  41.981  11.367 1.00 89.05  ? 219 MET D CG    1 
ATOM   2601 S  SD    . MET D 4 219 ? -10.958 42.439  10.539 1.00 89.39  ? 219 MET D SD    1 
ATOM   2602 C  CE    . MET D 4 219 ? -10.333 43.384  9.172  1.00 89.45  ? 219 MET D CE    1 
ATOM   2603 N  N     . LEU D 4 220 ? -6.807  41.364  14.221 1.00 89.12  ? 220 LEU D N     1 
ATOM   2604 C  CA    . LEU D 4 220 ? -6.906  40.676  15.495 1.00 89.18  ? 220 LEU D CA    1 
ATOM   2605 C  C     . LEU D 4 220 ? -5.771  41.279  16.314 1.00 88.99  ? 220 LEU D C     1 
ATOM   2606 O  O     . LEU D 4 220 ? -5.954  41.684  17.461 1.00 88.85  ? 220 LEU D O     1 
ATOM   2607 C  CB    . LEU D 4 220 ? -6.672  39.178  15.310 1.00 80.10  ? 220 LEU D CB    1 
ATOM   2608 C  CG    . LEU D 4 220 ? -7.073  38.269  16.473 1.00 81.64  ? 220 LEU D CG    1 
ATOM   2609 C  CD1   . LEU D 4 220 ? -8.589  38.116  16.476 1.00 82.03  ? 220 LEU D CD1   1 
ATOM   2610 C  CD2   . LEU D 4 220 ? -6.404  36.903  16.332 1.00 81.98  ? 220 LEU D CD2   1 
ATOM   2611 N  N     . ILE D 4 221 ? -4.595  41.344  15.695 1.00 88.97  ? 221 ILE D N     1 
ATOM   2612 C  CA    . ILE D 4 221 ? -3.410  41.914  16.327 1.00 88.59  ? 221 ILE D CA    1 
ATOM   2613 C  C     . ILE D 4 221 ? -3.627  43.419  16.378 1.00 88.28  ? 221 ILE D C     1 
ATOM   2614 O  O     . ILE D 4 221 ? -3.042  44.128  17.194 1.00 87.27  ? 221 ILE D O     1 
ATOM   2615 C  CB    . ILE D 4 221 ? -2.143  41.635  15.492 1.00 87.98  ? 221 ILE D CB    1 
ATOM   2616 C  CG1   . ILE D 4 221 ? -2.091  40.156  15.101 1.00 88.17  ? 221 ILE D CG1   1 
ATOM   2617 C  CG2   . ILE D 4 221 ? -0.904  42.017  16.287 1.00 87.78  ? 221 ILE D CG2   1 
ATOM   2618 C  CD1   . ILE D 4 221 ? -0.905  39.783  14.232 1.00 87.72  ? 221 ILE D CD1   1 
ATOM   2619 N  N     . GLU D 4 222 ? -4.490  43.885  15.486 1.00 88.85  ? 222 GLU D N     1 
ATOM   2620 C  CA    . GLU D 4 222 ? -4.822  45.293  15.370 1.00 89.67  ? 222 GLU D CA    1 
ATOM   2621 C  C     . GLU D 4 222 ? -5.791  45.706  16.476 1.00 80.04  ? 222 GLU D C     1 
ATOM   2622 O  O     . GLU D 4 222 ? -5.757  46.842  16.951 1.00 89.31  ? 222 GLU D O     1 
ATOM   2623 C  CB    . GLU D 4 222 ? -5.440  45.549  13.989 1.00 80.27  ? 222 GLU D CB    1 
ATOM   2624 C  CG    . GLU D 4 222 ? -5.560  47.014  13.584 1.00 80.86  ? 222 GLU D CG    1 
ATOM   2625 C  CD    . GLU D 4 222 ? -5.975  47.188  12.127 1.00 80.89  ? 222 GLU D CD    1 
ATOM   2626 O  OE1   . GLU D 4 222 ? -6.075  48.348  11.673 1.00 80.87  ? 222 GLU D OE1   1 
ATOM   2627 O  OE2   . GLU D 4 222 ? -6.199  46.171  11.434 1.00 80.60  ? 222 GLU D OE2   1 
ATOM   2628 N  N     . SER D 4 223 ? -6.646  44.775  16.892 1.00 80.65  ? 223 SER D N     1 
ATOM   2629 C  CA    . SER D 4 223 ? -7.628  45.056  17.935 1.00 81.26  ? 223 SER D CA    1 
ATOM   2630 C  C     . SER D 4 223 ? -7.227  44.534  19.314 1.00 82.15  ? 223 SER D C     1 
ATOM   2631 O  O     . SER D 4 223 ? -7.086  45.308  20.264 1.00 82.38  ? 223 SER D O     1 
ATOM   2632 C  CB    . SER D 4 223 ? -8.997  44.475  17.544 1.00 80.81  ? 223 SER D CB    1 
ATOM   2633 O  OG    . SER D 4 223 ? -8.955  43.065  17.397 1.00 89.64  ? 223 SER D OG    1 
ATOM   2634 N  N     . THR D 4 224 ? -7.040  43.222  19.419 1.00 82.93  ? 224 THR D N     1 
ATOM   2635 C  CA    . THR D 4 224 ? -6.676  42.593  20.684 1.00 83.27  ? 224 THR D CA    1 
ATOM   2636 C  C     . THR D 4 224 ? -5.200  42.772  21.030 1.00 83.37  ? 224 THR D C     1 
ATOM   2637 O  O     . THR D 4 224 ? -4.705  43.892  21.150 1.00 82.98  ? 224 THR D O     1 
ATOM   2638 C  CB    . THR D 4 224 ? -6.996  41.085  20.654 1.00 83.44  ? 224 THR D CB    1 
ATOM   2639 O  OG1   . THR D 4 224 ? -6.112  40.424  19.740 1.00 83.99  ? 224 THR D OG1   1 
ATOM   2640 C  CG2   . THR D 4 224 ? -8.433  40.856  20.200 1.00 83.74  ? 224 THR D CG2   1 
ATOM   2641 N  N     . GLY D 4 225 ? -4.511  41.650  21.197 1.00 83.98  ? 225 GLY D N     1 
ATOM   2642 C  CA    . GLY D 4 225 ? -3.099  41.669  21.526 1.00 84.69  ? 225 GLY D CA    1 
ATOM   2643 C  C     . GLY D 4 225 ? -2.580  40.246  21.563 1.00 85.12  ? 225 GLY D C     1 
ATOM   2644 O  O     . GLY D 4 225 ? -1.374  40.013  21.633 1.00 84.67  ? 225 GLY D O     1 
ATOM   2645 N  N     . MET D 4 226 ? -3.508  39.295  21.515 1.00 86.00  ? 226 MET D N     1 
ATOM   2646 C  CA    . MET D 4 226 ? -3.174  37.878  21.541 1.00 87.12  ? 226 MET D CA    1 
ATOM   2647 C  C     . MET D 4 226 ? -1.962  37.570  20.684 1.00 87.82  ? 226 MET D C     1 
ATOM   2648 O  O     . MET D 4 226 ? -0.827  37.612  21.151 1.00 88.21  ? 226 MET D O     1 
ATOM   2649 C  CB    . MET D 4 226 ? -4.341  37.036  21.025 1.00 86.97  ? 226 MET D CB    1 
ATOM   2650 C  CG    . MET D 4 226 ? -5.534  36.935  21.942 1.00 86.40  ? 226 MET D CG    1 
ATOM   2651 S  SD    . MET D 4 226 ? -6.671  35.712  21.268 1.00 85.84  ? 226 MET D SD    1 
ATOM   2652 C  CE    . MET D 4 226 ? -7.541  36.705  20.058 1.00 87.08  ? 226 MET D CE    1 
ATOM   2653 N  N     . VAL D 4 227 ? -2.228  37.256  19.421 1.00 88.77  ? 227 VAL D N     1 
ATOM   2654 C  CA    . VAL D 4 227 ? -1.189  36.919  18.463 1.00 80.08  ? 227 VAL D CA    1 
ATOM   2655 C  C     . VAL D 4 227 ? -0.119  38.001  18.358 1.00 81.05  ? 227 VAL D C     1 
ATOM   2656 O  O     . VAL D 4 227 ? -0.381  39.113  17.896 1.00 80.86  ? 227 VAL D O     1 
ATOM   2657 C  CB    . VAL D 4 227 ? -1.790  36.675  17.068 1.00 80.12  ? 227 VAL D CB    1 
ATOM   2658 C  CG1   . VAL D 4 227 ? -0.728  36.118  16.137 1.00 81.09  ? 227 VAL D CG1   1 
ATOM   2659 C  CG2   . VAL D 4 227 ? -2.969  35.720  17.171 1.00 80.24  ? 227 VAL D CG2   1 
ATOM   2660 N  N     . SER D 4 228 ? 1.089   37.658  18.798 1.00 82.36  ? 228 SER D N     1 
ATOM   2661 C  CA    . SER D 4 228 ? 2.229   38.567  18.760 1.00 83.16  ? 228 SER D CA    1 
ATOM   2662 C  C     . SER D 4 228 ? 3.332   37.936  17.920 1.00 83.74  ? 228 SER D C     1 
ATOM   2663 O  O     . SER D 4 228 ? 3.150   36.857  17.354 1.00 83.58  ? 228 SER D O     1 
ATOM   2664 C  CB    . SER D 4 228 ? 2.750   38.835  20.177 1.00 82.93  ? 228 SER D CB    1 
ATOM   2665 O  OG    . SER D 4 228 ? 1.788   39.522  20.960 1.00 82.20  ? 228 SER D OG    1 
ATOM   2666 N  N     . LEU D 4 229 ? 4.470   38.618  17.836 1.00 84.57  ? 229 LEU D N     1 
ATOM   2667 C  CA    . LEU D 4 229 ? 5.610   38.126  17.069 1.00 85.43  ? 229 LEU D CA    1 
ATOM   2668 C  C     . LEU D 4 229 ? 6.899   38.264  17.877 1.00 86.18  ? 229 LEU D C     1 
ATOM   2669 O  O     . LEU D 4 229 ? 7.000   37.752  18.994 1.00 86.30  ? 229 LEU D O     1 
ATOM   2670 C  CB    . LEU D 4 229 ? 5.746   38.895  15.746 1.00 84.87  ? 229 LEU D CB    1 
ATOM   2671 C  CG    . LEU D 4 229 ? 4.686   38.720  14.653 1.00 84.39  ? 229 LEU D CG    1 
ATOM   2672 C  CD1   . LEU D 4 229 ? 4.594   37.253  14.270 1.00 84.12  ? 229 LEU D CD1   1 
ATOM   2673 C  CD2   . LEU D 4 229 ? 3.339   39.238  15.130 1.00 84.05  ? 229 LEU D CD2   1 
ATOM   2674 N  N     . HIS D 4 230 ? 7.876   38.963  17.305 1.00 86.97  ? 230 HIS D N     1 
ATOM   2675 C  CA    . HIS D 4 230 ? 9.172   39.180  17.943 1.00 87.29  ? 230 HIS D CA    1 
ATOM   2676 C  C     . HIS D 4 230 ? 9.017   39.875  19.293 1.00 87.37  ? 230 HIS D C     1 
ATOM   2677 O  O     . HIS D 4 230 ? 8.657   39.247  20.290 1.00 87.42  ? 230 HIS D O     1 
ATOM   2678 C  CB    . HIS D 4 230 ? 10.064  40.027  17.029 1.00 87.59  ? 230 HIS D CB    1 
ATOM   2679 C  CG    . HIS D 4 230 ? 10.117  39.534  15.616 1.00 87.99  ? 230 HIS D CG    1 
ATOM   2680 N  ND1   . HIS D 4 230 ? 10.715  38.343  15.264 1.00 88.10  ? 230 HIS D ND1   1 
ATOM   2681 C  CD2   . HIS D 4 230 ? 9.617   40.056  14.471 1.00 88.11  ? 230 HIS D CD2   1 
ATOM   2682 C  CE1   . HIS D 4 230 ? 10.581  38.153  13.964 1.00 88.39  ? 230 HIS D CE1   1 
ATOM   2683 N  NE2   . HIS D 4 230 ? 9.918   39.178  13.459 1.00 88.21  ? 230 HIS D NE2   1 
ATOM   2684 N  N     . SER D 4 241 ? 7.248   34.810  5.397  1.00 89.20  ? 241 SER D N     1 
ATOM   2685 C  CA    . SER D 4 241 ? 6.426   33.955  6.245  1.00 89.00  ? 241 SER D CA    1 
ATOM   2686 C  C     . SER D 4 241 ? 6.935   33.960  7.685  1.00 89.01  ? 241 SER D C     1 
ATOM   2687 O  O     . SER D 4 241 ? 8.137   33.834  7.927  1.00 88.91  ? 241 SER D O     1 
ATOM   2688 C  CB    . SER D 4 241 ? 6.420   32.524  5.699  1.00 89.00  ? 241 SER D CB    1 
ATOM   2689 O  OG    . SER D 4 241 ? 5.890   32.480  4.384  1.00 88.11  ? 241 SER D OG    1 
ATOM   2690 N  N     . GLU D 4 242 ? 6.010   34.109  8.633  1.00 88.83  ? 242 GLU D N     1 
ATOM   2691 C  CA    . GLU D 4 242 ? 6.336   34.134  10.060 1.00 88.73  ? 242 GLU D CA    1 
ATOM   2692 C  C     . GLU D 4 242 ? 5.506   33.086  10.799 1.00 89.00  ? 242 GLU D C     1 
ATOM   2693 O  O     . GLU D 4 242 ? 4.760   32.326  10.181 1.00 88.80  ? 242 GLU D O     1 
ATOM   2694 C  CB    . GLU D 4 242 ? 6.044   35.522  10.641 1.00 88.08  ? 242 GLU D CB    1 
ATOM   2695 C  CG    . GLU D 4 242 ? 7.255   36.257  11.208 1.00 87.56  ? 242 GLU D CG    1 
ATOM   2696 C  CD    . GLU D 4 242 ? 7.730   35.692  12.534 1.00 87.30  ? 242 GLU D CD    1 
ATOM   2697 O  OE1   . GLU D 4 242 ? 6.925   35.643  13.488 1.00 86.93  ? 242 GLU D OE1   1 
ATOM   2698 O  OE2   . GLU D 4 242 ? 8.913   35.303  12.622 1.00 86.96  ? 242 GLU D OE2   1 
ATOM   2699 N  N     . THR D 4 243 ? 5.638   33.049  12.121 1.00 89.48  ? 243 THR D N     1 
ATOM   2700 C  CA    . THR D 4 243 ? 4.894   32.094  12.939 1.00 90.06  ? 243 THR D CA    1 
ATOM   2701 C  C     . THR D 4 243 ? 4.054   32.831  13.980 1.00 90.03  ? 243 THR D C     1 
ATOM   2702 O  O     . THR D 4 243 ? 4.472   33.866  14.506 1.00 89.90  ? 243 THR D O     1 
ATOM   2703 C  CB    . THR D 4 243 ? 5.843   31.126  13.678 1.00 90.30  ? 243 THR D CB    1 
ATOM   2704 O  OG1   . THR D 4 243 ? 6.650   31.862  14.606 1.00 90.79  ? 243 THR D OG1   1 
ATOM   2705 C  CG2   . THR D 4 243 ? 6.751   30.409  12.692 1.00 90.67  ? 243 THR D CG2   1 
ATOM   2706 N  N     . ILE D 4 244 ? 2.872   32.296  14.277 1.00 89.66  ? 244 ILE D N     1 
ATOM   2707 C  CA    . ILE D 4 244 ? 1.984   32.914  15.257 1.00 89.27  ? 244 ILE D CA    1 
ATOM   2708 C  C     . ILE D 4 244 ? 2.164   32.336  16.660 1.00 88.36  ? 244 ILE D C     1 
ATOM   2709 O  O     . ILE D 4 244 ? 2.315   31.126  16.837 1.00 88.17  ? 244 ILE D O     1 
ATOM   2710 C  CB    . ILE D 4 244 ? 0.499   32.788  14.826 1.00 89.64  ? 244 ILE D CB    1 
ATOM   2711 C  CG1   . ILE D 4 244 ? 0.226   31.396  14.259 1.00 90.16  ? 244 ILE D CG1   1 
ATOM   2712 C  CG2   . ILE D 4 244 ? 0.166   33.849  13.795 1.00 89.87  ? 244 ILE D CG2   1 
ATOM   2713 C  CD1   . ILE D 4 244 ? 0.088   30.313  15.301 1.00 91.22  ? 244 ILE D CD1   1 
ATOM   2714 N  N     . GLU D 4 245 ? 2.153   33.220  17.654 1.00 87.00  ? 245 GLU D N     1 
ATOM   2715 C  CA    . GLU D 4 245 ? 2.324   32.827  19.048 1.00 85.13  ? 245 GLU D CA    1 
ATOM   2716 C  C     . GLU D 4 245 ? 1.421   33.660  19.958 1.00 93.87  ? 245 GLU D C     1 
ATOM   2717 O  O     . GLU D 4 245 ? 1.337   34.880  19.811 1.00 94.20  ? 245 GLU D O     1 
ATOM   2718 C  CB    . GLU D 4 245 ? 3.778   33.040  19.475 1.00 95.20  ? 245 GLU D CB    1 
ATOM   2719 C  CG    . GLU D 4 245 ? 4.188   34.512  19.495 1.00 95.01  ? 245 GLU D CG    1 
ATOM   2720 C  CD    . GLU D 4 245 ? 5.528   34.745  20.158 1.00 94.86  ? 245 GLU D CD    1 
ATOM   2721 O  OE1   . GLU D 4 245 ? 5.690   34.341  21.327 1.00 94.79  ? 245 GLU D OE1   1 
ATOM   2722 O  OE2   . GLU D 4 245 ? 6.416   35.339  19.512 1.00 94.88  ? 245 GLU D OE2   1 
ATOM   2723 N  N     . LEU D 4 246 ? 0.751   33.004  20.900 1.00 91.67  ? 246 LEU D N     1 
ATOM   2724 C  CA    . LEU D 4 246 ? -0.114  33.710  21.833 1.00 89.52  ? 246 LEU D CA    1 
ATOM   2725 C  C     . LEU D 4 246 ? 0.738   34.591  22.745 1.00 88.22  ? 246 LEU D C     1 
ATOM   2726 O  O     . LEU D 4 246 ? 1.763   34.154  23.267 1.00 87.91  ? 246 LEU D O     1 
ATOM   2727 C  CB    . LEU D 4 246 ? -0.916  32.710  22.665 1.00 89.37  ? 246 LEU D CB    1 
ATOM   2728 C  CG    . LEU D 4 246 ? -1.673  33.272  23.869 1.00 89.31  ? 246 LEU D CG    1 
ATOM   2729 C  CD1   . LEU D 4 246 ? -2.561  34.432  23.444 1.00 89.46  ? 246 LEU D CD1   1 
ATOM   2730 C  CD2   . LEU D 4 246 ? -2.494  32.161  24.499 1.00 89.08  ? 246 LEU D CD2   1 
ATOM   2731 N  N     . ALA D 4 247 ? 0.314   35.835  22.928 1.00 86.81  ? 247 ALA D N     1 
ATOM   2732 C  CA    . ALA D 4 247 ? 1.046   36.774  23.767 1.00 85.80  ? 247 ALA D CA    1 
ATOM   2733 C  C     . ALA D 4 247 ? 1.400   36.158  25.115 1.00 84.75  ? 247 ALA D C     1 
ATOM   2734 O  O     . ALA D 4 247 ? 0.833   35.142  25.508 1.00 84.88  ? 247 ALA D O     1 
ATOM   2735 C  CB    . ALA D 4 247 ? 0.219   38.033  23.973 1.00 86.03  ? 247 ALA D CB    1 
ATOM   2736 N  N     . PRO D 4 248 ? 2.356   36.766  25.837 1.00 83.83  ? 248 PRO D N     1 
ATOM   2737 C  CA    . PRO D 4 248 ? 2.801   36.293  27.153 1.00 82.84  ? 248 PRO D CA    1 
ATOM   2738 C  C     . PRO D 4 248 ? 1.740   36.469  28.241 1.00 82.10  ? 248 PRO D C     1 
ATOM   2739 O  O     . PRO D 4 248 ? 1.476   35.550  29.015 1.00 82.35  ? 248 PRO D O     1 
ATOM   2740 C  CB    . PRO D 4 248 ? 4.033   37.155  27.433 1.00 82.86  ? 248 PRO D CB    1 
ATOM   2741 C  CG    . PRO D 4 248 ? 4.539   37.484  26.075 1.00 83.83  ? 248 PRO D CG    1 
ATOM   2742 C  CD    . PRO D 4 248 ? 3.272   37.800  25.329 1.00 83.77  ? 248 PRO D CD    1 
ATOM   2743 N  N     . GLU D 4 249 ? 1.140   37.657  28.290 1.00 80.95  ? 249 GLU D N     1 
ATOM   2744 C  CA    . GLU D 4 249 ? 0.122   37.986  29.289 1.00 89.42  ? 249 GLU D CA    1 
ATOM   2745 C  C     . GLU D 4 249 ? -1.270  37.406  29.036 1.00 87.74  ? 249 GLU D C     1 
ATOM   2746 O  O     . GLU D 4 249 ? -2.084  37.308  29.957 1.00 87.20  ? 249 GLU D O     1 
ATOM   2747 C  CB    . GLU D 4 249 ? 0.021   39.510  29.453 1.00 80.25  ? 249 GLU D CB    1 
ATOM   2748 C  CG    . GLU D 4 249 ? -0.105  40.300  28.150 1.00 81.17  ? 249 GLU D CG    1 
ATOM   2749 C  CD    . GLU D 4 249 ? 1.147   40.228  27.283 1.00 81.68  ? 249 GLU D CD    1 
ATOM   2750 O  OE1   . GLU D 4 249 ? 2.259   40.453  27.813 1.00 81.16  ? 249 GLU D OE1   1 
ATOM   2751 O  OE2   . GLU D 4 249 ? 1.017   39.953  26.069 1.00 81.35  ? 249 GLU D OE2   1 
ATOM   2752 N  N     . TYR D 4 250 ? -1.550  37.024  27.797 1.00 85.35  ? 250 TYR D N     1 
ATOM   2753 C  CA    . TYR D 4 250 ? -2.849  36.452  27.484 1.00 83.32  ? 250 TYR D CA    1 
ATOM   2754 C  C     . TYR D 4 250 ? -2.828  34.928  27.568 1.00 81.44  ? 250 TYR D C     1 
ATOM   2755 O  O     . TYR D 4 250 ? -3.873  34.276  27.567 1.00 81.26  ? 250 TYR D O     1 
ATOM   2756 C  CB    . TYR D 4 250 ? -3.308  36.919  26.103 1.00 84.57  ? 250 TYR D CB    1 
ATOM   2757 C  CG    . TYR D 4 250 ? -3.740  38.367  26.103 1.00 86.15  ? 250 TYR D CG    1 
ATOM   2758 C  CD1   . TYR D 4 250 ? -4.715  38.819  26.993 1.00 86.62  ? 250 TYR D CD1   1 
ATOM   2759 C  CD2   . TYR D 4 250 ? -3.166  39.290  25.232 1.00 86.61  ? 250 TYR D CD2   1 
ATOM   2760 C  CE1   . TYR D 4 250 ? -5.108  40.152  27.019 1.00 87.09  ? 250 TYR D CE1   1 
ATOM   2761 C  CE2   . TYR D 4 250 ? -3.553  40.630  25.248 1.00 87.34  ? 250 TYR D CE2   1 
ATOM   2762 C  CZ    . TYR D 4 250 ? -4.523  41.052  26.145 1.00 87.72  ? 250 TYR D CZ    1 
ATOM   2763 O  OH    . TYR D 4 250 ? -4.907  42.372  26.171 1.00 88.54  ? 250 TYR D OH    1 
ATOM   2764 N  N     . ALA D 4 251 ? -1.628  34.365  27.653 1.00 98.70  ? 251 ALA D N     1 
ATOM   2765 C  CA    . ALA D 4 251 ? -1.470  32.922  27.764 1.00 95.27  ? 251 ALA D CA    1 
ATOM   2766 C  C     . ALA D 4 251 ? -1.336  32.616  29.247 1.00 93.10  ? 251 ALA D C     1 
ATOM   2767 O  O     . ALA D 4 251 ? -1.983  31.714  29.775 1.00 91.61  ? 251 ALA D O     1 
ATOM   2768 C  CB    . ALA D 4 251 ? -0.226  32.474  27.018 1.00 95.32  ? 251 ALA D CB    1 
ATOM   2769 N  N     . GLU D 4 252 ? -0.489  33.391  29.914 1.00 91.19  ? 252 GLU D N     1 
ATOM   2770 C  CA    . GLU D 4 252 ? -0.289  33.204  31.334 1.00 89.25  ? 252 GLU D CA    1 
ATOM   2771 C  C     . GLU D 4 252 ? -1.581  33.503  32.057 1.00 87.93  ? 252 GLU D C     1 
ATOM   2772 O  O     . GLU D 4 252 ? -1.704  33.240  33.252 1.00 88.78  ? 252 GLU D O     1 
ATOM   2773 C  CB    . GLU D 4 252 ? 0.870   34.070  31.830 1.00 88.00  ? 252 GLU D CB    1 
ATOM   2774 C  CG    . GLU D 4 252 ? 2.202   33.767  31.162 1.00 87.00  ? 252 GLU D CG    1 
ATOM   2775 C  CD    . GLU D 4 252 ? 3.326   34.644  31.679 1.00 85.00  ? 252 GLU D CD    1 
ATOM   2776 O  OE1   . GLU D 4 252 ? 3.063   35.489  32.560 1.00 84.67  ? 252 GLU D OE1   1 
ATOM   2777 O  OE2   . GLU D 4 252 ? 4.469   34.485  31.203 1.00 84.81  ? 252 GLU D OE2   1 
ATOM   2778 N  N     . ALA D 4 253 ? -2.546  34.054  31.324 1.00 85.62  ? 253 ALA D N     1 
ATOM   2779 C  CA    . ALA D 4 253 ? -3.850  34.396  31.883 1.00 82.27  ? 253 ALA D CA    1 
ATOM   2780 C  C     . ALA D 4 253 ? -4.770  33.183  31.863 1.00 79.70  ? 253 ALA D C     1 
ATOM   2781 O  O     . ALA D 4 253 ? -5.284  32.769  32.900 1.00 79.29  ? 253 ALA D O     1 
ATOM   2782 C  CB    . ALA D 4 253 ? -4.471  35.545  31.098 1.00 82.11  ? 253 ALA D CB    1 
ATOM   2783 N  N     . ILE D 4 254 ? -4.981  32.613  30.682 1.00 76.88  ? 254 ILE D N     1 
ATOM   2784 C  CA    . ILE D 4 254 ? -5.829  31.437  30.572 1.00 75.07  ? 254 ILE D CA    1 
ATOM   2785 C  C     . ILE D 4 254 ? -5.277  30.389  31.518 1.00 76.09  ? 254 ILE D C     1 
ATOM   2786 O  O     . ILE D 4 254 ? -6.021  29.627  32.121 1.00 75.90  ? 254 ILE D O     1 
ATOM   2787 C  CB    . ILE D 4 254 ? -5.805  30.843  29.154 1.00 73.20  ? 254 ILE D CB    1 
ATOM   2788 C  CG1   . ILE D 4 254 ? -6.411  31.830  28.157 1.00 72.96  ? 254 ILE D CG1   1 
ATOM   2789 C  CG2   . ILE D 4 254 ? -6.553  29.528  29.134 1.00 72.05  ? 254 ILE D CG2   1 
ATOM   2790 C  CD1   . ILE D 4 254 ? -6.481  31.308  26.732 1.00 71.24  ? 254 ILE D CD1   1 
ATOM   2791 N  N     . ALA D 4 255 ? -3.954  30.370  31.638 1.00 77.73  ? 255 ALA D N     1 
ATOM   2792 C  CA    . ALA D 4 255 ? -3.250  29.420  32.484 1.00 77.73  ? 255 ALA D CA    1 
ATOM   2793 C  C     . ALA D 4 255 ? -3.468  29.701  33.958 1.00 78.54  ? 255 ALA D C     1 
ATOM   2794 O  O     . ALA D 4 255 ? -3.608  28.774  34.756 1.00 79.42  ? 255 ALA D O     1 
ATOM   2795 C  CB    . ALA D 4 255 ? -1.772  29.447  32.165 1.00 78.11  ? 255 ALA D CB    1 
ATOM   2796 N  N     . THR D 4 256 ? -3.482  30.974  34.330 1.00 78.58  ? 256 THR D N     1 
ATOM   2797 C  CA    . THR D 4 256 ? -3.702  31.317  35.725 1.00 79.80  ? 256 THR D CA    1 
ATOM   2798 C  C     . THR D 4 256 ? -5.151  30.983  36.030 1.00 80.19  ? 256 THR D C     1 
ATOM   2799 O  O     . THR D 4 256 ? -5.458  30.344  37.038 1.00 80.07  ? 256 THR D O     1 
ATOM   2800 C  CB    . THR D 4 256 ? -3.454  32.812  35.992 1.00 79.63  ? 256 THR D CB    1 
ATOM   2801 O  OG1   . THR D 4 256 ? -2.100  33.134  35.654 1.00 80.77  ? 256 THR D OG1   1 
ATOM   2802 C  CG2   . THR D 4 256 ? -3.681  33.138  37.458 1.00 78.37  ? 256 THR D CG2   1 
ATOM   2803 N  N     . ARG D 4 257 ? -6.034  31.409  35.134 1.00 80.79  ? 257 ARG D N     1 
ATOM   2804 C  CA    . ARG D 4 257 ? -7.463  31.162  35.275 1.00 81.47  ? 257 ARG D CA    1 
ATOM   2805 C  C     . ARG D 4 257 ? -7.723  29.690  35.576 1.00 81.22  ? 257 ARG D C     1 
ATOM   2806 O  O     . ARG D 4 257 ? -8.575  29.354  36.400 1.00 80.33  ? 257 ARG D O     1 
ATOM   2807 C  CB    . ARG D 4 257 ? -8.187  31.557  33.990 1.00 82.43  ? 257 ARG D CB    1 
ATOM   2808 C  CG    . ARG D 4 257 ? -9.690  31.422  34.056 1.00 82.63  ? 257 ARG D CG    1 
ATOM   2809 C  CD    . ARG D 4 257 ? -10.277 32.376  35.069 1.00 83.52  ? 257 ARG D CD    1 
ATOM   2810 N  NE    . ARG D 4 257 ? -11.732 32.384  35.003 1.00 84.53  ? 257 ARG D NE    1 
ATOM   2811 C  CZ    . ARG D 4 257 ? -12.501 33.222  35.686 1.00 85.38  ? 257 ARG D CZ    1 
ATOM   2812 N  NH1   . ARG D 4 257 ? -11.948 34.123  36.493 1.00 85.28  ? 257 ARG D NH1   1 
ATOM   2813 N  NH2   . ARG D 4 257 ? -13.821 33.167  35.554 1.00 85.31  ? 257 ARG D NH2   1 
ATOM   2814 N  N     . ALA D 4 258 ? -6.983  28.817  34.901 1.00 81.19  ? 258 ALA D N     1 
ATOM   2815 C  CA    . ALA D 4 258 ? -7.126  27.379  35.098 1.00 81.54  ? 258 ALA D CA    1 
ATOM   2816 C  C     . ALA D 4 258 ? -6.767  27.022  36.535 1.00 81.09  ? 258 ALA D C     1 
ATOM   2817 O  O     . ALA D 4 258 ? -7.615  26.562  37.296 1.00 82.36  ? 258 ALA D O     1 
ATOM   2818 C  CB    . ALA D 4 258 ? -6.226  26.617  34.125 1.00 80.82  ? 258 ALA D CB    1 
ATOM   2819 N  N     . GLY D 4 259 ? -5.510  27.239  36.904 1.00 80.19  ? 259 GLY D N     1 
ATOM   2820 C  CA    . GLY D 4 259 ? -5.086  26.931  38.255 1.00 78.70  ? 259 GLY D CA    1 
ATOM   2821 C  C     . GLY D 4 259 ? -6.082  27.484  39.250 1.00 77.46  ? 259 GLY D C     1 
ATOM   2822 O  O     . GLY D 4 259 ? -6.441  26.825  40.218 1.00 77.69  ? 259 GLY D O     1 
ATOM   2823 N  N     . ALA D 4 260 ? -6.542  28.700  38.995 1.00 76.60  ? 260 ALA D N     1 
ATOM   2824 C  CA    . ALA D 4 260 ? -7.507  29.346  39.871 1.00 76.11  ? 260 ALA D CA    1 
ATOM   2825 C  C     . ALA D 4 260 ? -8.933  28.972  39.482 1.00 74.69  ? 260 ALA D C     1 
ATOM   2826 O  O     . ALA D 4 260 ? -9.840  29.794  39.575 1.00 75.49  ? 260 ALA D O     1 
ATOM   2827 C  CB    . ALA D 4 260 ? -7.330  30.862  39.809 1.00 76.44  ? 260 ALA D CB    1 
ATOM   2828 N  N     . LEU D 4 261 ? -9.126  27.729  39.057 1.00 72.27  ? 261 LEU D N     1 
ATOM   2829 C  CA    . LEU D 4 261 ? -10.440 27.260  38.640 1.00 70.28  ? 261 LEU D CA    1 
ATOM   2830 C  C     . LEU D 4 261 ? -10.502 25.762  38.869 1.00 70.31  ? 261 LEU D C     1 
ATOM   2831 O  O     . LEU D 4 261 ? -11.576 25.186  39.038 1.00 70.23  ? 261 LEU D O     1 
ATOM   2832 C  CB    . LEU D 4 261 ? -10.651 27.559  37.155 1.00 69.38  ? 261 LEU D CB    1 
ATOM   2833 C  CG    . LEU D 4 261 ? -12.079 27.607  36.610 1.00 69.30  ? 261 LEU D CG    1 
ATOM   2834 C  CD1   . LEU D 4 261 ? -12.853 28.719  37.293 1.00 67.16  ? 261 LEU D CD1   1 
ATOM   2835 C  CD2   . LEU D 4 261 ? -12.043 27.846  35.118 1.00 67.99  ? 261 LEU D CD2   1 
ATOM   2836 N  N     . ALA D 4 262 ? -9.329  25.139  38.871 1.00 70.06  ? 262 ALA D N     1 
ATOM   2837 C  CA    . ALA D 4 262 ? -9.216  23.705  39.078 1.00 69.71  ? 262 ALA D CA    1 
ATOM   2838 C  C     . ALA D 4 262 ? -9.453  23.376  40.544 1.00 69.56  ? 262 ALA D C     1 
ATOM   2839 O  O     . ALA D 4 262 ? -9.811  22.246  40.891 1.00 70.12  ? 262 ALA D O     1 
ATOM   2840 C  CB    . ALA D 4 262 ? -7.844  23.235  38.668 1.00 70.31  ? 262 ALA D CB    1 
ATOM   2841 N  N     . GLY D 4 263 ? -9.255  24.371  41.399 1.00 67.88  ? 263 GLY D N     1 
ATOM   2842 C  CA    . GLY D 4 263 ? -9.433  24.151  42.816 1.00 66.17  ? 263 GLY D CA    1 
ATOM   2843 C  C     . GLY D 4 263 ? -10.785 24.545  43.365 1.00 65.71  ? 263 GLY D C     1 
ATOM   2844 O  O     . GLY D 4 263 ? -10.843 25.134  44.443 1.00 67.30  ? 263 GLY D O     1 
ATOM   2845 N  N     . ILE D 4 264 ? -11.870 24.240  42.654 1.00 63.56  ? 264 ILE D N     1 
ATOM   2846 C  CA    . ILE D 4 264 ? -13.195 24.593  43.159 1.00 61.89  ? 264 ILE D CA    1 
ATOM   2847 C  C     . ILE D 4 264 ? -14.287 23.561  42.898 1.00 60.79  ? 264 ILE D C     1 
ATOM   2848 O  O     . ILE D 4 264 ? -15.448 23.796  43.221 1.00 61.96  ? 264 ILE D O     1 
ATOM   2849 C  CB    . ILE D 4 264 ? -13.698 25.924  42.591 1.00 63.16  ? 264 ILE D CB    1 
ATOM   2850 C  CG1   . ILE D 4 264 ? -14.115 25.731  41.133 1.00 64.81  ? 264 ILE D CG1   1 
ATOM   2851 C  CG2   . ILE D 4 264 ? -12.628 26.995  42.748 1.00 62.07  ? 264 ILE D CG2   1 
ATOM   2852 C  CD1   . ILE D 4 264 ? -14.957 26.863  40.585 1.00 65.98  ? 264 ILE D CD1   1 
ATOM   2853 N  N     . SER D 4 265 ? -13.928 22.428  42.306 1.00 59.12  ? 265 SER D N     1 
ATOM   2854 C  CA    . SER D 4 265 ? -14.902 21.375  42.038 1.00 55.01  ? 265 SER D CA    1 
ATOM   2855 C  C     . SER D 4 265 ? -14.393 20.091  42.685 1.00 50.87  ? 265 SER D C     1 
ATOM   2856 O  O     . SER D 4 265 ? -14.214 19.063  42.022 1.00 49.72  ? 265 SER D O     1 
ATOM   2857 C  CB    . SER D 4 265 ? -15.066 21.163  40.529 1.00 57.55  ? 265 SER D CB    1 
ATOM   2858 O  OG    . SER D 4 265 ? -13.937 20.498  39.968 1.00 60.87  ? 265 SER D OG    1 
ATOM   2859 N  N     . PRO D 4 266 ? -14.138 20.137  43.995 1.00 46.64  ? 266 PRO D N     1 
ATOM   2860 C  CA    . PRO D 4 266 ? -13.647 18.937  44.665 1.00 44.37  ? 266 PRO D CA    1 
ATOM   2861 C  C     . PRO D 4 266 ? -14.578 17.756  44.558 1.00 43.97  ? 266 PRO D C     1 
ATOM   2862 O  O     . PRO D 4 266 ? -15.801 17.902  44.466 1.00 45.56  ? 266 PRO D O     1 
ATOM   2863 C  CB    . PRO D 4 266 ? -13.465 19.390  46.106 1.00 42.55  ? 266 PRO D CB    1 
ATOM   2864 C  CG    . PRO D 4 266 ? -14.434 20.490  46.252 1.00 44.15  ? 266 PRO D CG    1 
ATOM   2865 C  CD    . PRO D 4 266 ? -14.319 21.233  44.956 1.00 45.37  ? 266 PRO D CD    1 
ATOM   2866 N  N     . MET D 4 267 ? -13.982 16.576  44.530 1.00 42.70  ? 267 MET D N     1 
ATOM   2867 C  CA    . MET D 4 267 ? -14.744 15.365  44.490 1.00 42.78  ? 267 MET D CA    1 
ATOM   2868 C  C     . MET D 4 267 ? -14.953 15.030  45.959 1.00 42.87  ? 267 MET D C     1 
ATOM   2869 O  O     . MET D 4 267 ? -14.267 14.182  46.522 1.00 46.04  ? 267 MET D O     1 
ATOM   2870 C  CB    . MET D 4 267 ? -13.966 14.259  43.801 1.00 45.49  ? 267 MET D CB    1 
ATOM   2871 C  CG    . MET D 4 267 ? -13.667 14.520  42.337 1.00 47.95  ? 267 MET D CG    1 
ATOM   2872 S  SD    . MET D 4 267 ? -13.358 12.931  41.536 1.00 51.43  ? 267 MET D SD    1 
ATOM   2873 C  CE    . MET D 4 267 ? -13.257 13.444  39.846 1.00 54.09  ? 267 MET D CE    1 
ATOM   2874 N  N     . PHE D 4 268 ? -15.883 15.744  46.579 1.00 41.21  ? 268 PHE D N     1 
ATOM   2875 C  CA    . PHE D 4 268 ? -16.232 15.560  47.974 1.00 38.83  ? 268 PHE D CA    1 
ATOM   2876 C  C     . PHE D 4 268 ? -16.426 14.083  48.295 1.00 38.23  ? 268 PHE D C     1 
ATOM   2877 O  O     . PHE D 4 268 ? -17.006 13.343  47.502 1.00 37.46  ? 268 PHE D O     1 
ATOM   2878 C  CB    . PHE D 4 268 ? -17.510 16.340  48.275 1.00 37.89  ? 268 PHE D CB    1 
ATOM   2879 C  CG    . PHE D 4 268 ? -17.341 17.824  48.179 1.00 36.65  ? 268 PHE D CG    1 
ATOM   2880 C  CD1   . PHE D 4 268 ? -16.464 18.495  49.031 1.00 36.42  ? 268 PHE D CD1   1 
ATOM   2881 C  CD2   . PHE D 4 268 ? -18.073 18.564  47.258 1.00 36.13  ? 268 PHE D CD2   1 
ATOM   2882 C  CE1   . PHE D 4 268 ? -16.319 19.895  48.972 1.00 34.70  ? 268 PHE D CE1   1 
ATOM   2883 C  CE2   . PHE D 4 268 ? -17.933 19.953  47.190 1.00 35.88  ? 268 PHE D CE2   1 
ATOM   2884 C  CZ    . PHE D 4 268 ? -17.055 20.619  48.051 1.00 34.74  ? 268 PHE D CZ    1 
ATOM   2885 N  N     . GLN D 4 269 ? -15.937 13.668  49.460 1.00 37.41  ? 269 GLN D N     1 
ATOM   2886 C  CA    . GLN D 4 269 ? -16.031 12.280  49.894 1.00 38.86  ? 269 GLN D CA    1 
ATOM   2887 C  C     . GLN D 4 269 ? -16.633 12.282  51.282 1.00 38.22  ? 269 GLN D C     1 
ATOM   2888 O  O     . GLN D 4 269 ? -16.710 13.326  51.916 1.00 40.01  ? 269 GLN D O     1 
ATOM   2889 C  CB    . GLN D 4 269 ? -14.641 11.641  49.979 1.00 40.43  ? 269 GLN D CB    1 
ATOM   2890 C  CG    . GLN D 4 269 ? -13.743 11.892  48.794 1.00 44.73  ? 269 GLN D CG    1 
ATOM   2891 C  CD    . GLN D 4 269 ? -12.432 11.108  48.881 1.00 48.57  ? 269 GLN D CD    1 
ATOM   2892 O  OE1   . GLN D 4 269 ? -12.414 9.874   48.784 1.00 46.01  ? 269 GLN D OE1   1 
ATOM   2893 N  NE2   . GLN D 4 269 ? -11.327 11.829  49.065 1.00 50.78  ? 269 GLN D NE2   1 
ATOM   2894 N  N     . PRO D 4 270 ? -17.070 11.115  51.775 1.00 38.55  ? 270 PRO D N     1 
ATOM   2895 C  CA    . PRO D 4 270 ? -17.655 11.057  53.116 1.00 39.32  ? 270 PRO D CA    1 
ATOM   2896 C  C     . PRO D 4 270 ? -16.628 11.406  54.177 1.00 39.73  ? 270 PRO D C     1 
ATOM   2897 O  O     . PRO D 4 270 ? -15.441 11.525  53.881 1.00 41.16  ? 270 PRO D O     1 
ATOM   2898 C  CB    . PRO D 4 270 ? -18.135 9.615   53.225 1.00 39.55  ? 270 PRO D CB    1 
ATOM   2899 C  CG    . PRO D 4 270 ? -17.237 8.884   52.303 1.00 39.54  ? 270 PRO D CG    1 
ATOM   2900 C  CD    . PRO D 4 270 ? -17.162 9.802   51.119 1.00 39.20  ? 270 PRO D CD    1 
ATOM   2901 N  N     . CYS D 4 271 ? -17.085 11.576  55.412 1.00 38.66  ? 271 CYS D N     1 
ATOM   2902 C  CA    . CYS D 4 271 ? -16.190 11.918  56.501 1.00 37.32  ? 271 CYS D CA    1 
ATOM   2903 C  C     . CYS D 4 271 ? -15.914 10.741  57.412 1.00 36.58  ? 271 CYS D C     1 
ATOM   2904 O  O     . CYS D 4 271 ? -16.747 9.845   57.572 1.00 37.06  ? 271 CYS D O     1 
ATOM   2905 C  CB    . CYS D 4 271 ? -16.789 13.043  57.327 1.00 37.60  ? 271 CYS D CB    1 
ATOM   2906 S  SG    . CYS D 4 271 ? -17.213 14.467  56.344 1.00 45.30  ? 271 CYS D SG    1 
ATOM   2907 N  N     . VAL D 4 272 ? -14.738 10.748  58.017 1.00 34.66  ? 272 VAL D N     1 
ATOM   2908 C  CA    . VAL D 4 272 ? -14.381 9.691   58.930 1.00 34.15  ? 272 VAL D CA    1 
ATOM   2909 C  C     . VAL D 4 272 ? -14.674 10.154  60.345 1.00 33.84  ? 272 VAL D C     1 
ATOM   2910 O  O     . VAL D 4 272 ? -14.331 9.483   61.302 1.00 36.21  ? 272 VAL D O     1 
ATOM   2911 C  CB    . VAL D 4 272 ? -12.891 9.238   58.753 1.00 34.80  ? 272 VAL D CB    1 
ATOM   2912 C  CG1   . VAL D 4 272 ? -12.749 8.502   57.402 1.00 33.46  ? 272 VAL D CG1   1 
ATOM   2913 C  CG2   . VAL D 4 272 ? -11.930 10.444  58.806 1.00 30.83  ? 272 VAL D CG2   1 
ATOM   2914 N  N     . VAL D 4 273 ? -15.310 11.313  60.469 1.00 32.71  ? 273 VAL D N     1 
ATOM   2915 C  CA    . VAL D 4 273 ? -15.729 11.836  61.780 1.00 33.32  ? 273 VAL D CA    1 
ATOM   2916 C  C     . VAL D 4 273 ? -17.039 12.604  61.549 1.00 34.17  ? 273 VAL D C     1 
ATOM   2917 O  O     . VAL D 4 273 ? -17.340 12.987  60.428 1.00 35.29  ? 273 VAL D O     1 
ATOM   2918 C  CB    . VAL D 4 273 ? -14.687 12.794  62.441 1.00 31.07  ? 273 VAL D CB    1 
ATOM   2919 C  CG1   . VAL D 4 273 ? -13.340 12.116  62.541 1.00 30.82  ? 273 VAL D CG1   1 
ATOM   2920 C  CG2   . VAL D 4 273 ? -14.612 14.098  61.697 1.00 26.68  ? 273 VAL D CG2   1 
ATOM   2921 N  N     . PRO D 4 274 ? -17.835 12.832  62.600 1.00 34.31  ? 274 PRO D N     1 
ATOM   2922 C  CA    . PRO D 4 274 ? -19.077 13.563  62.331 1.00 34.43  ? 274 PRO D CA    1 
ATOM   2923 C  C     . PRO D 4 274 ? -18.836 14.875  61.601 1.00 34.36  ? 274 PRO D C     1 
ATOM   2924 O  O     . PRO D 4 274 ? -17.834 15.539  61.815 1.00 35.55  ? 274 PRO D O     1 
ATOM   2925 C  CB    . PRO D 4 274 ? -19.677 13.748  63.718 1.00 32.54  ? 274 PRO D CB    1 
ATOM   2926 C  CG    . PRO D 4 274 ? -19.263 12.499  64.403 1.00 33.99  ? 274 PRO D CG    1 
ATOM   2927 C  CD    . PRO D 4 274 ? -17.796 12.354  63.990 1.00 32.63  ? 274 PRO D CD    1 
ATOM   2928 N  N     . PRO D 4 275 ? -19.765 15.264  60.721 1.00 34.20  ? 275 PRO D N     1 
ATOM   2929 C  CA    . PRO D 4 275 ? -19.609 16.509  59.966 1.00 34.20  ? 275 PRO D CA    1 
ATOM   2930 C  C     . PRO D 4 275 ? -19.547 17.730  60.850 1.00 33.78  ? 275 PRO D C     1 
ATOM   2931 O  O     . PRO D 4 275 ? -20.005 17.696  61.978 1.00 37.07  ? 275 PRO D O     1 
ATOM   2932 C  CB    . PRO D 4 275 ? -20.835 16.517  59.061 1.00 32.81  ? 275 PRO D CB    1 
ATOM   2933 C  CG    . PRO D 4 275 ? -21.128 15.061  58.874 1.00 33.05  ? 275 PRO D CG    1 
ATOM   2934 C  CD    . PRO D 4 275 ? -20.938 14.508  60.260 1.00 31.86  ? 275 PRO D CD    1 
ATOM   2935 N  N     . LYS D 4 276 ? -18.960 18.804  60.336 1.00 34.54  ? 276 LYS D N     1 
ATOM   2936 C  CA    . LYS D 4 276 ? -18.875 20.065  61.066 1.00 35.89  ? 276 LYS D CA    1 
ATOM   2937 C  C     . LYS D 4 276 ? -20.339 20.594  61.108 1.00 36.72  ? 276 LYS D C     1 
ATOM   2938 O  O     . LYS D 4 276 ? -20.958 20.839  60.068 1.00 36.33  ? 276 LYS D O     1 
ATOM   2939 C  CB    . LYS D 4 276 ? -17.968 21.018  60.287 1.00 35.68  ? 276 LYS D CB    1 
ATOM   2940 C  CG    . LYS D 4 276 ? -17.198 22.038  61.119 1.00 38.25  ? 276 LYS D CG    1 
ATOM   2941 C  CD    . LYS D 4 276 ? -17.884 23.389  61.174 1.00 39.39  ? 276 LYS D CD    1 
ATOM   2942 C  CE    . LYS D 4 276 ? -16.908 24.511  61.554 1.00 40.91  ? 276 LYS D CE    1 
ATOM   2943 N  NZ    . LYS D 4 276 ? -15.880 24.823  60.508 1.00 39.85  ? 276 LYS D NZ    1 
ATOM   2944 N  N     . PRO D 4 277 ? -20.908 20.759  62.310 1.00 35.82  ? 277 PRO D N     1 
ATOM   2945 C  CA    . PRO D 4 277 ? -22.288 21.244  62.453 1.00 35.29  ? 277 PRO D CA    1 
ATOM   2946 C  C     . PRO D 4 277 ? -22.444 22.585  61.765 1.00 36.38  ? 277 PRO D C     1 
ATOM   2947 O  O     . PRO D 4 277 ? -21.503 23.371  61.740 1.00 37.32  ? 277 PRO D O     1 
ATOM   2948 C  CB    . PRO D 4 277 ? -22.464 21.395  63.964 1.00 32.28  ? 277 PRO D CB    1 
ATOM   2949 C  CG    . PRO D 4 277 ? -21.387 20.521  64.549 1.00 36.04  ? 277 PRO D CG    1 
ATOM   2950 C  CD    . PRO D 4 277 ? -20.229 20.692  63.614 1.00 35.65  ? 277 PRO D CD    1 
ATOM   2951 N  N     . TRP D 4 278 ? -23.617 22.857  61.208 1.00 35.64  ? 278 TRP D N     1 
ATOM   2952 C  CA    . TRP D 4 278 ? -23.813 24.149  60.588 1.00 35.50  ? 278 TRP D CA    1 
ATOM   2953 C  C     . TRP D 4 278 ? -24.286 25.152  61.624 1.00 37.54  ? 278 TRP D C     1 
ATOM   2954 O  O     . TRP D 4 278 ? -25.160 24.860  62.446 1.00 37.18  ? 278 TRP D O     1 
ATOM   2955 C  CB    . TRP D 4 278 ? -24.813 24.083  59.461 1.00 32.61  ? 278 TRP D CB    1 
ATOM   2956 C  CG    . TRP D 4 278 ? -24.372 23.239  58.332 1.00 31.70  ? 278 TRP D CG    1 
ATOM   2957 C  CD1   . TRP D 4 278 ? -24.378 21.878  58.276 1.00 33.53  ? 278 TRP D CD1   1 
ATOM   2958 C  CD2   . TRP D 4 278 ? -23.949 23.692  57.049 1.00 30.71  ? 278 TRP D CD2   1 
ATOM   2959 N  NE1   . TRP D 4 278 ? -23.997 21.452  57.027 1.00 33.40  ? 278 TRP D NE1   1 
ATOM   2960 C  CE2   . TRP D 4 278 ? -23.729 22.548  56.253 1.00 30.18  ? 278 TRP D CE2   1 
ATOM   2961 C  CE3   . TRP D 4 278 ? -23.741 24.958  56.489 1.00 28.92  ? 278 TRP D CE3   1 
ATOM   2962 C  CZ2   . TRP D 4 278 ? -23.313 22.629  54.932 1.00 29.89  ? 278 TRP D CZ2   1 
ATOM   2963 C  CZ3   . TRP D 4 278 ? -23.335 25.039  55.188 1.00 29.55  ? 278 TRP D CZ3   1 
ATOM   2964 C  CH2   . TRP D 4 278 ? -23.125 23.881  54.414 1.00 29.81  ? 278 TRP D CH2   1 
ATOM   2965 N  N     . THR D 4 279 ? -23.692 26.343  61.574 1.00 40.03  ? 279 THR D N     1 
ATOM   2966 C  CA    . THR D 4 279 ? -24.019 27.416  62.502 1.00 39.74  ? 279 THR D CA    1 
ATOM   2967 C  C     . THR D 4 279 ? -24.093 28.695  61.712 1.00 40.80  ? 279 THR D C     1 
ATOM   2968 O  O     . THR D 4 279 ? -23.944 29.777  62.274 1.00 44.47  ? 279 THR D O     1 
ATOM   2969 C  CB    . THR D 4 279 ? -22.929 27.596  63.553 1.00 38.21  ? 279 THR D CB    1 
ATOM   2970 O  OG1   . THR D 4 279 ? -21.715 27.938  62.886 1.00 41.22  ? 279 THR D OG1   1 
ATOM   2971 C  CG2   . THR D 4 279 ? -22.708 26.302  64.359 1.00 37.26  ? 279 THR D CG2   1 
ATOM   2972 N  N     . GLY D 4 280 ? -24.292 28.563  60.404 1.00 40.09  ? 280 GLY D N     1 
ATOM   2973 C  CA    . GLY D 4 280 ? -24.386 29.715  59.528 1.00 37.63  ? 280 GLY D CA    1 
ATOM   2974 C  C     . GLY D 4 280 ? -24.611 29.216  58.117 1.00 38.75  ? 280 GLY D C     1 
ATOM   2975 O  O     . GLY D 4 280 ? -24.581 28.012  57.889 1.00 40.93  ? 280 GLY D O     1 
ATOM   2976 N  N     . ILE D 4 281 ? -24.825 30.116  57.164 1.00 39.02  ? 281 ILE D N     1 
ATOM   2977 C  CA    . ILE D 4 281 ? -25.074 29.705  55.791 1.00 39.06  ? 281 ILE D CA    1 
ATOM   2978 C  C     . ILE D 4 281 ? -23.877 29.122  55.078 1.00 38.69  ? 281 ILE D C     1 
ATOM   2979 O  O     . ILE D 4 281 ? -24.013 28.632  53.959 1.00 39.27  ? 281 ILE D O     1 
ATOM   2980 C  CB    . ILE D 4 281 ? -25.577 30.864  54.932 1.00 40.82  ? 281 ILE D CB    1 
ATOM   2981 C  CG1   . ILE D 4 281 ? -24.474 31.910  54.796 1.00 41.69  ? 281 ILE D CG1   1 
ATOM   2982 C  CG2   . ILE D 4 281 ? -26.844 31.447  55.538 1.00 39.60  ? 281 ILE D CG2   1 
ATOM   2983 C  CD1   . ILE D 4 281 ? -24.885 33.111  53.996 1.00 46.16  ? 281 ILE D CD1   1 
ATOM   2984 N  N     . THR D 4 282 ? -22.704 29.175  55.694 1.00 38.10  ? 282 THR D N     1 
ATOM   2985 C  CA    . THR D 4 282 ? -21.529 28.622  55.029 1.00 39.46  ? 282 THR D CA    1 
ATOM   2986 C  C     . THR D 4 282 ? -20.556 28.010  56.022 1.00 39.87  ? 282 THR D C     1 
ATOM   2987 O  O     . THR D 4 282 ? -20.553 28.364  57.203 1.00 39.14  ? 282 THR D O     1 
ATOM   2988 C  CB    . THR D 4 282 ? -20.744 29.715  54.193 1.00 40.60  ? 282 THR D CB    1 
ATOM   2989 O  OG1   . THR D 4 282 ? -20.069 30.612  55.087 1.00 43.16  ? 282 THR D OG1   1 
ATOM   2990 C  CG2   . THR D 4 282 ? -21.689 30.539  53.310 1.00 36.79  ? 282 THR D CG2   1 
ATOM   2991 N  N     . GLY D 4 283 ? -19.740 27.080  55.530 1.00 41.22  ? 283 GLY D N     1 
ATOM   2992 C  CA    . GLY D 4 283 ? -18.722 26.448  56.355 1.00 41.29  ? 283 GLY D CA    1 
ATOM   2993 C  C     . GLY D 4 283 ? -19.088 25.234  57.181 1.00 41.58  ? 283 GLY D C     1 
ATOM   2994 O  O     . GLY D 4 283 ? -18.395 24.919  58.143 1.00 41.05  ? 283 GLY D O     1 
ATOM   2995 N  N     . GLY D 4 284 ? -20.173 24.558  56.817 1.00 42.32  ? 284 GLY D N     1 
ATOM   2996 C  CA    . GLY D 4 284 ? -20.589 23.384  57.554 1.00 41.11  ? 284 GLY D CA    1 
ATOM   2997 C  C     . GLY D 4 284 ? -20.178 22.165  56.762 1.00 41.86  ? 284 GLY D C     1 
ATOM   2998 O  O     . GLY D 4 284 ? -19.652 22.287  55.659 1.00 43.83  ? 284 GLY D O     1 
ATOM   2999 N  N     . GLY D 4 285 ? -20.403 20.984  57.318 1.00 40.30  ? 285 GLY D N     1 
ATOM   3000 C  CA    . GLY D 4 285 ? -20.030 19.788  56.606 1.00 38.37  ? 285 GLY D CA    1 
ATOM   3001 C  C     . GLY D 4 285 ? -18.586 19.414  56.830 1.00 38.18  ? 285 GLY D C     1 
ATOM   3002 O  O     . GLY D 4 285 ? -18.262 18.667  57.759 1.00 37.48  ? 285 GLY D O     1 
ATOM   3003 N  N     . TYR D 4 286 ? -17.706 19.929  55.981 1.00 38.96  ? 286 TYR D N     1 
ATOM   3004 C  CA    . TYR D 4 286 ? -16.288 19.618  56.105 1.00 39.17  ? 286 TYR D CA    1 
ATOM   3005 C  C     . TYR D 4 286 ? -15.563 20.555  57.044 1.00 41.53  ? 286 TYR D C     1 
ATOM   3006 O  O     . TYR D 4 286 ? -15.920 21.718  57.193 1.00 45.93  ? 286 TYR D O     1 
ATOM   3007 C  CB    . TYR D 4 286 ? -15.647 19.626  54.736 1.00 35.82  ? 286 TYR D CB    1 
ATOM   3008 C  CG    . TYR D 4 286 ? -16.318 18.643  53.827 1.00 34.83  ? 286 TYR D CG    1 
ATOM   3009 C  CD1   . TYR D 4 286 ? -17.189 19.071  52.825 1.00 33.79  ? 286 TYR D CD1   1 
ATOM   3010 C  CD2   . TYR D 4 286 ? -16.127 17.276  54.002 1.00 33.57  ? 286 TYR D CD2   1 
ATOM   3011 C  CE1   . TYR D 4 286 ? -17.847 18.157  52.019 1.00 32.78  ? 286 TYR D CE1   1 
ATOM   3012 C  CE2   . TYR D 4 286 ? -16.782 16.352  53.208 1.00 32.78  ? 286 TYR D CE2   1 
ATOM   3013 C  CZ    . TYR D 4 286 ? -17.640 16.801  52.216 1.00 34.51  ? 286 TYR D CZ    1 
ATOM   3014 O  OH    . TYR D 4 286 ? -18.301 15.889  51.434 1.00 36.18  ? 286 TYR D OH    1 
ATOM   3015 N  N     . TRP D 4 287 ? -14.527 20.047  57.677 1.00 42.26  ? 287 TRP D N     1 
ATOM   3016 C  CA    . TRP D 4 287 ? -13.797 20.845  58.629 1.00 45.89  ? 287 TRP D CA    1 
ATOM   3017 C  C     . TRP D 4 287 ? -12.695 21.779  58.137 1.00 49.57  ? 287 TRP D C     1 
ATOM   3018 O  O     . TRP D 4 287 ? -12.549 22.887  58.660 1.00 51.51  ? 287 TRP D O     1 
ATOM   3019 C  CB    . TRP D 4 287 ? -13.241 19.925  59.699 1.00 44.41  ? 287 TRP D CB    1 
ATOM   3020 C  CG    . TRP D 4 287 ? -14.299 19.307  60.494 1.00 39.45  ? 287 TRP D CG    1 
ATOM   3021 C  CD1   . TRP D 4 287 ? -15.027 18.186  60.189 1.00 36.93  ? 287 TRP D CD1   1 
ATOM   3022 C  CD2   . TRP D 4 287 ? -14.749 19.753  61.756 1.00 37.88  ? 287 TRP D CD2   1 
ATOM   3023 N  NE1   . TRP D 4 287 ? -15.905 17.906  61.204 1.00 34.58  ? 287 TRP D NE1   1 
ATOM   3024 C  CE2   . TRP D 4 287 ? -15.755 18.854  62.182 1.00 38.13  ? 287 TRP D CE2   1 
ATOM   3025 C  CE3   . TRP D 4 287 ? -14.402 20.825  62.578 1.00 38.12  ? 287 TRP D CE3   1 
ATOM   3026 C  CZ2   . TRP D 4 287 ? -16.412 18.999  63.399 1.00 38.36  ? 287 TRP D CZ2   1 
ATOM   3027 C  CZ3   . TRP D 4 287 ? -15.054 20.971  63.788 1.00 40.73  ? 287 TRP D CZ3   1 
ATOM   3028 C  CH2   . TRP D 4 287 ? -16.051 20.060  64.190 1.00 38.69  ? 287 TRP D CH2   1 
ATOM   3029 N  N     . ALA D 4 288 ? -11.905 21.342  57.164 1.00 52.39  ? 288 ALA D N     1 
ATOM   3030 C  CA    . ALA D 4 288 ? -10.836 22.187  56.658 1.00 56.20  ? 288 ALA D CA    1 
ATOM   3031 C  C     . ALA D 4 288 ? -11.404 23.523  56.225 1.00 60.12  ? 288 ALA D C     1 
ATOM   3032 O  O     . ALA D 4 288 ? -12.267 23.580  55.357 1.00 61.91  ? 288 ALA D O     1 
ATOM   3033 C  CB    . ALA D 4 288 ? -10.160 21.524  55.495 1.00 54.30  ? 288 ALA D CB    1 
ATOM   3034 N  N     . ASN D 4 289 ? -10.931 24.603  56.831 1.00 65.18  ? 289 ASN D N     1 
ATOM   3035 C  CA    . ASN D 4 289 ? -11.418 25.926  56.464 1.00 70.10  ? 289 ASN D CA    1 
ATOM   3036 C  C     . ASN D 4 289 ? -10.754 26.386  55.171 1.00 71.61  ? 289 ASN D C     1 
ATOM   3037 O  O     . ASN D 4 289 ? -9.619  26.857  55.186 1.00 72.32  ? 289 ASN D O     1 
ATOM   3038 C  CB    . ASN D 4 289 ? -11.133 26.926  57.587 1.00 73.57  ? 289 ASN D CB    1 
ATOM   3039 C  CG    . ASN D 4 289 ? -12.114 26.799  58.747 1.00 76.82  ? 289 ASN D CG    1 
ATOM   3040 O  OD1   . ASN D 4 289 ? -13.326 26.965  58.570 1.00 78.17  ? 289 ASN D OD1   1 
ATOM   3041 N  ND2   . ASN D 4 289 ? -11.593 26.511  59.942 1.00 77.74  ? 289 ASN D ND2   1 
ATOM   3042 N  N     . GLY D 4 290 ? -11.467 26.251  54.053 1.00 73.17  ? 290 GLY D N     1 
ATOM   3043 C  CA    . GLY D 4 290 ? -10.915 26.646  52.765 1.00 73.75  ? 290 GLY D CA    1 
ATOM   3044 C  C     . GLY D 4 290 ? -11.418 27.962  52.193 1.00 73.81  ? 290 GLY D C     1 
ATOM   3045 O  O     . GLY D 4 290 ? -12.341 28.576  52.735 1.00 73.57  ? 290 GLY D O     1 
ATOM   3046 N  N     . ARG D 4 291 ? -10.807 28.388  51.086 1.00 73.62  ? 291 ARG D N     1 
ATOM   3047 C  CA    . ARG D 4 291 ? -11.171 29.638  50.420 1.00 72.59  ? 291 ARG D CA    1 
ATOM   3048 C  C     . ARG D 4 291 ? -12.625 29.611  49.974 1.00 71.62  ? 291 ARG D C     1 
ATOM   3049 O  O     . ARG D 4 291 ? -13.303 30.647  49.967 1.00 72.52  ? 291 ARG D O     1 
ATOM   3050 C  CB    . ARG D 4 291 ? -10.247 29.899  49.229 1.00 72.84  ? 291 ARG D CB    1 
ATOM   3051 C  CG    . ARG D 4 291 ? -8.777  30.017  49.597 1.00 71.80  ? 291 ARG D CG    1 
ATOM   3052 C  CD    . ARG D 4 291 ? -7.952  30.515  48.422 1.00 71.00  ? 291 ARG D CD    1 
ATOM   3053 N  NE    . ARG D 4 291 ? -6.536  30.634  48.760 1.00 70.45  ? 291 ARG D NE    1 
ATOM   3054 C  CZ    . ARG D 4 291 ? -5.599  31.047  47.913 1.00 68.06  ? 291 ARG D CZ    1 
ATOM   3055 N  NH1   . ARG D 4 291 ? -5.926  31.382  46.672 1.00 70.10  ? 291 ARG D NH1   1 
ATOM   3056 N  NH2   . ARG D 4 291 ? -4.336  31.124  48.309 1.00 68.00  ? 291 ARG D NH2   1 
ATOM   3057 N  N     . ARG D 4 292 ? -13.097 28.426  49.596 1.00 69.21  ? 292 ARG D N     1 
ATOM   3058 C  CA    . ARG D 4 292 ? -14.477 28.265  49.160 1.00 65.98  ? 292 ARG D CA    1 
ATOM   3059 C  C     . ARG D 4 292 ? -15.159 27.259  50.077 1.00 61.58  ? 292 ARG D C     1 
ATOM   3060 O  O     . ARG D 4 292 ? -15.191 26.067  49.781 1.00 61.69  ? 292 ARG D O     1 
ATOM   3061 C  CB    . ARG D 4 292 ? -14.545 27.744  47.716 1.00 69.93  ? 292 ARG D CB    1 
ATOM   3062 C  CG    . ARG D 4 292 ? -13.405 28.178  46.794 1.00 75.56  ? 292 ARG D CG    1 
ATOM   3063 C  CD    . ARG D 4 292 ? -13.412 29.672  46.511 1.00 79.99  ? 292 ARG D CD    1 
ATOM   3064 N  NE    . ARG D 4 292 ? -12.095 30.267  46.736 1.00 83.77  ? 292 ARG D NE    1 
ATOM   3065 C  CZ    . ARG D 4 292 ? -11.787 31.533  46.469 1.00 85.65  ? 292 ARG D CZ    1 
ATOM   3066 N  NH1   . ARG D 4 292 ? -12.704 32.350  45.958 1.00 86.31  ? 292 ARG D NH1   1 
ATOM   3067 N  NH2   . ARG D 4 292 ? -10.562 31.984  46.714 1.00 85.68  ? 292 ARG D NH2   1 
ATOM   3068 N  N     . PRO D 4 293 ? -15.691 27.714  51.219 1.00 57.63  ? 293 PRO D N     1 
ATOM   3069 C  CA    . PRO D 4 293 ? -16.356 26.751  52.098 1.00 54.78  ? 293 PRO D CA    1 
ATOM   3070 C  C     . PRO D 4 293 ? -17.654 26.225  51.472 1.00 51.63  ? 293 PRO D C     1 
ATOM   3071 O  O     . PRO D 4 293 ? -17.986 26.542  50.336 1.00 50.66  ? 293 PRO D O     1 
ATOM   3072 C  CB    . PRO D 4 293 ? -16.594 27.554  53.373 1.00 54.77  ? 293 PRO D CB    1 
ATOM   3073 C  CG    . PRO D 4 293 ? -16.749 28.939  52.871 1.00 55.99  ? 293 PRO D CG    1 
ATOM   3074 C  CD    . PRO D 4 293 ? -15.661 29.049  51.835 1.00 56.61  ? 293 PRO D CD    1 
ATOM   3075 N  N     . LEU D 4 294 ? -18.382 25.410  52.217 1.00 49.82  ? 294 LEU D N     1 
ATOM   3076 C  CA    . LEU D 4 294 ? -19.623 24.827  51.719 1.00 46.93  ? 294 LEU D CA    1 
ATOM   3077 C  C     . LEU D 4 294 ? -20.802 25.726  52.059 1.00 44.70  ? 294 LEU D C     1 
ATOM   3078 O  O     . LEU D 4 294 ? -20.810 26.363  53.104 1.00 45.89  ? 294 LEU D O     1 
ATOM   3079 C  CB    . LEU D 4 294 ? -19.807 23.459  52.358 1.00 44.92  ? 294 LEU D CB    1 
ATOM   3080 C  CG    . LEU D 4 294 ? -20.105 22.271  51.459 1.00 45.37  ? 294 LEU D CG    1 
ATOM   3081 C  CD1   . LEU D 4 294 ? -19.093 22.164  50.355 1.00 44.03  ? 294 LEU D CD1   1 
ATOM   3082 C  CD2   . LEU D 4 294 ? -20.098 21.019  52.315 1.00 46.31  ? 294 LEU D CD2   1 
ATOM   3083 N  N     . ALA D 4 295 ? -21.792 25.796  51.180 1.00 43.47  ? 295 ALA D N     1 
ATOM   3084 C  CA    . ALA D 4 295 ? -22.967 26.624  51.460 1.00 42.79  ? 295 ALA D CA    1 
ATOM   3085 C  C     . ALA D 4 295 ? -24.122 25.758  51.948 1.00 41.91  ? 295 ALA D C     1 
ATOM   3086 O  O     . ALA D 4 295 ? -24.237 24.593  51.572 1.00 38.53  ? 295 ALA D O     1 
ATOM   3087 C  CB    . ALA D 4 295 ? -23.386 27.386  50.225 1.00 41.52  ? 295 ALA D CB    1 
ATOM   3088 N  N     . LEU D 4 296 ? -24.977 26.338  52.785 1.00 43.16  ? 296 LEU D N     1 
ATOM   3089 C  CA    . LEU D 4 296 ? -26.120 25.608  53.322 1.00 44.01  ? 296 LEU D CA    1 
ATOM   3090 C  C     . LEU D 4 296 ? -27.131 25.403  52.215 1.00 43.68  ? 296 LEU D C     1 
ATOM   3091 O  O     . LEU D 4 296 ? -27.585 24.285  51.991 1.00 45.86  ? 296 LEU D O     1 
ATOM   3092 C  CB    . LEU D 4 296 ? -26.765 26.364  54.485 1.00 43.22  ? 296 LEU D CB    1 
ATOM   3093 C  CG    . LEU D 4 296 ? -27.763 25.576  55.349 1.00 42.37  ? 296 LEU D CG    1 
ATOM   3094 C  CD1   . LEU D 4 296 ? -27.174 24.261  55.814 1.00 40.54  ? 296 LEU D CD1   1 
ATOM   3095 C  CD2   . LEU D 4 296 ? -28.137 26.428  56.545 1.00 43.45  ? 296 LEU D CD2   1 
ATOM   3096 N  N     . VAL D 4 297 ? -27.480 26.477  51.522 1.00 42.35  ? 297 VAL D N     1 
ATOM   3097 C  CA    . VAL D 4 297 ? -28.426 26.372  50.422 1.00 43.28  ? 297 VAL D CA    1 
ATOM   3098 C  C     . VAL D 4 297 ? -27.628 26.370  49.136 1.00 45.71  ? 297 VAL D C     1 
ATOM   3099 O  O     . VAL D 4 297 ? -26.594 27.022  49.050 1.00 47.60  ? 297 VAL D O     1 
ATOM   3100 C  CB    . VAL D 4 297 ? -29.391 27.555  50.376 1.00 41.40  ? 297 VAL D CB    1 
ATOM   3101 C  CG1   . VAL D 4 297 ? -30.401 27.333  49.275 1.00 43.23  ? 297 VAL D CG1   1 
ATOM   3102 C  CG2   . VAL D 4 297 ? -30.091 27.726  51.715 1.00 40.23  ? 297 VAL D CG2   1 
ATOM   3103 N  N     . ARG D 4 298 ? -28.083 25.637  48.130 1.00 46.35  ? 298 ARG D N     1 
ATOM   3104 C  CA    . ARG D 4 298 ? -27.336 25.619  46.889 1.00 46.35  ? 298 ARG D CA    1 
ATOM   3105 C  C     . ARG D 4 298 ? -27.886 26.670  45.951 1.00 50.05  ? 298 ARG D C     1 
ATOM   3106 O  O     . ARG D 4 298 ? -28.560 26.381  44.962 1.00 51.24  ? 298 ARG D O     1 
ATOM   3107 C  CB    . ARG D 4 298 ? -27.372 24.233  46.265 1.00 41.09  ? 298 ARG D CB    1 
ATOM   3108 C  CG    . ARG D 4 298 ? -26.760 23.227  47.177 1.00 37.73  ? 298 ARG D CG    1 
ATOM   3109 C  CD    . ARG D 4 298 ? -26.632 21.866  46.560 1.00 34.94  ? 298 ARG D CD    1 
ATOM   3110 N  NE    . ARG D 4 298 ? -26.138 20.912  47.551 1.00 30.15  ? 298 ARG D NE    1 
ATOM   3111 C  CZ    . ARG D 4 298 ? -25.926 19.632  47.289 1.00 28.91  ? 298 ARG D CZ    1 
ATOM   3112 N  NH1   . ARG D 4 298 ? -26.158 19.185  46.069 1.00 26.86  ? 298 ARG D NH1   1 
ATOM   3113 N  NH2   . ARG D 4 298 ? -25.524 18.797  48.244 1.00 26.59  ? 298 ARG D NH2   1 
ATOM   3114 N  N     . THR D 4 299 ? -27.597 27.914  46.302 1.00 53.78  ? 299 THR D N     1 
ATOM   3115 C  CA    . THR D 4 299 ? -28.009 29.058  45.519 1.00 56.61  ? 299 THR D CA    1 
ATOM   3116 C  C     . THR D 4 299 ? -27.019 29.169  44.385 1.00 59.29  ? 299 THR D C     1 
ATOM   3117 O  O     . THR D 4 299 ? -25.885 28.711  44.489 1.00 60.02  ? 299 THR D O     1 
ATOM   3118 C  CB    . THR D 4 299 ? -27.911 30.331  46.326 1.00 55.29  ? 299 THR D CB    1 
ATOM   3119 O  OG1   . THR D 4 299 ? -26.543 30.534  46.691 1.00 57.83  ? 299 THR D OG1   1 
ATOM   3120 C  CG2   . THR D 4 299 ? -28.759 30.230  47.587 1.00 55.92  ? 299 THR D CG2   1 
ATOM   3121 N  N     . HIS D 4 300 ? -27.442 29.788  43.300 1.00 63.29  ? 300 HIS D N     1 
ATOM   3122 C  CA    . HIS D 4 300 ? -26.559 29.945  42.168 1.00 66.31  ? 300 HIS D CA    1 
ATOM   3123 C  C     . HIS D 4 300 ? -25.776 31.250  42.312 1.00 67.06  ? 300 HIS D C     1 
ATOM   3124 O  O     . HIS D 4 300 ? -24.636 31.353  41.863 1.00 67.19  ? 300 HIS D O     1 
ATOM   3125 C  CB    . HIS D 4 300 ? -27.398 29.932  40.904 1.00 69.13  ? 300 HIS D CB    1 
ATOM   3126 C  CG    . HIS D 4 300 ? -28.491 28.912  40.941 1.00 72.16  ? 300 HIS D CG    1 
ATOM   3127 N  ND1   . HIS D 4 300 ? -28.315 27.663  41.495 1.00 72.86  ? 300 HIS D ND1   1 
ATOM   3128 C  CD2   . HIS D 4 300 ? -29.774 28.956  40.508 1.00 73.30  ? 300 HIS D CD2   1 
ATOM   3129 C  CE1   . HIS D 4 300 ? -29.443 26.980  41.404 1.00 73.08  ? 300 HIS D CE1   1 
ATOM   3130 N  NE2   . HIS D 4 300 ? -30.344 27.742  40.809 1.00 73.82  ? 300 HIS D NE2   1 
ATOM   3131 N  N     . SER D 4 301 ? -26.383 32.228  42.980 1.00 66.62  ? 301 SER D N     1 
ATOM   3132 C  CA    . SER D 4 301 ? -25.756 33.523  43.167 1.00 66.72  ? 301 SER D CA    1 
ATOM   3133 C  C     . SER D 4 301 ? -25.534 33.889  44.626 1.00 67.34  ? 301 SER D C     1 
ATOM   3134 O  O     . SER D 4 301 ? -26.407 33.679  45.463 1.00 67.89  ? 301 SER D O     1 
ATOM   3135 C  CB    . SER D 4 301 ? -26.614 34.605  42.518 1.00 67.29  ? 301 SER D CB    1 
ATOM   3136 O  OG    . SER D 4 301 ? -27.838 34.760  43.214 1.00 66.37  ? 301 SER D OG    1 
ATOM   3137 N  N     . LYS D 4 302 ? -24.365 34.457  44.916 1.00 67.11  ? 302 LYS D N     1 
ATOM   3138 C  CA    . LYS D 4 302 ? -24.035 34.882  46.266 1.00 66.59  ? 302 LYS D CA    1 
ATOM   3139 C  C     . LYS D 4 302 ? -25.177 35.724  46.823 1.00 65.59  ? 302 LYS D C     1 
ATOM   3140 O  O     . LYS D 4 302 ? -25.499 35.656  48.005 1.00 65.46  ? 302 LYS D O     1 
ATOM   3141 C  CB    . LYS D 4 302 ? -22.751 35.717  46.270 1.00 67.53  ? 302 LYS D CB    1 
ATOM   3142 C  CG    . LYS D 4 302 ? -21.504 34.962  45.833 1.00 72.55  ? 302 LYS D CG    1 
ATOM   3143 C  CD    . LYS D 4 302 ? -20.229 35.771  46.093 1.00 74.19  ? 302 LYS D CD    1 
ATOM   3144 C  CE    . LYS D 4 302 ? -19.921 35.902  47.598 1.00 76.80  ? 302 LYS D CE    1 
ATOM   3145 N  NZ    . LYS D 4 302 ? -20.962 36.628  48.402 1.00 75.68  ? 302 LYS D NZ    1 
ATOM   3146 N  N     . LYS D 4 303 ? -25.790 36.527  45.969 1.00 63.98  ? 303 LYS D N     1 
ATOM   3147 C  CA    . LYS D 4 303 ? -26.883 37.361  46.423 1.00 64.15  ? 303 LYS D CA    1 
ATOM   3148 C  C     . LYS D 4 303 ? -28.005 36.481  46.972 1.00 61.53  ? 303 LYS D C     1 
ATOM   3149 O  O     . LYS D 4 303 ? -28.616 36.807  47.980 1.00 62.49  ? 303 LYS D O     1 
ATOM   3150 C  CB    . LYS D 4 303 ? -27.375 38.253  45.277 1.00 66.85  ? 303 LYS D CB    1 
ATOM   3151 C  CG    . LYS D 4 303 ? -26.485 39.483  45.016 1.00 71.22  ? 303 LYS D CG    1 
ATOM   3152 C  CD    . LYS D 4 303 ? -24.974 39.166  44.998 1.00 72.25  ? 303 LYS D CD    1 
ATOM   3153 C  CE    . LYS D 4 303 ? -24.577 38.245  43.842 1.00 72.83  ? 303 LYS D CE    1 
ATOM   3154 N  NZ    . LYS D 4 303 ? -23.106 37.972  43.818 1.00 71.48  ? 303 LYS D NZ    1 
ATOM   3155 N  N     . ALA D 4 304 ? -28.266 35.356  46.320 1.00 57.84  ? 304 ALA D N     1 
ATOM   3156 C  CA    . ALA D 4 304 ? -29.305 34.458  46.793 1.00 54.62  ? 304 ALA D CA    1 
ATOM   3157 C  C     . ALA D 4 304 ? -28.862 33.912  48.140 1.00 54.10  ? 304 ALA D C     1 
ATOM   3158 O  O     . ALA D 4 304 ? -29.553 34.061  49.144 1.00 53.51  ? 304 ALA D O     1 
ATOM   3159 C  CB    . ALA D 4 304 ? -29.493 33.337  45.820 1.00 53.98  ? 304 ALA D CB    1 
ATOM   3160 N  N     . LEU D 4 305 ? -27.690 33.290  48.156 1.00 53.00  ? 305 LEU D N     1 
ATOM   3161 C  CA    . LEU D 4 305 ? -27.145 32.722  49.379 1.00 52.36  ? 305 LEU D CA    1 
ATOM   3162 C  C     . LEU D 4 305 ? -27.140 33.746  50.491 1.00 53.37  ? 305 LEU D C     1 
ATOM   3163 O  O     . LEU D 4 305 ? -27.620 33.491  51.590 1.00 54.27  ? 305 LEU D O     1 
ATOM   3164 C  CB    . LEU D 4 305 ? -25.709 32.240  49.155 1.00 50.81  ? 305 LEU D CB    1 
ATOM   3165 C  CG    . LEU D 4 305 ? -25.103 31.489  50.343 1.00 50.48  ? 305 LEU D CG    1 
ATOM   3166 C  CD1   . LEU D 4 305 ? -25.938 30.228  50.572 1.00 49.63  ? 305 LEU D CD1   1 
ATOM   3167 C  CD2   . LEU D 4 305 ? -23.635 31.133  50.087 1.00 47.08  ? 305 LEU D CD2   1 
ATOM   3168 N  N     . MET D 4 306 ? -26.592 34.915  50.190 1.00 55.17  ? 306 MET D N     1 
ATOM   3169 C  CA    . MET D 4 306 ? -26.480 35.986  51.166 1.00 55.11  ? 306 MET D CA    1 
ATOM   3170 C  C     . MET D 4 306 ? -27.826 36.352  51.760 1.00 53.63  ? 306 MET D C     1 
ATOM   3171 O  O     . MET D 4 306 ? -27.902 36.957  52.822 1.00 53.74  ? 306 MET D O     1 
ATOM   3172 C  CB    . MET D 4 306 ? -25.828 37.205  50.517 1.00 56.98  ? 306 MET D CB    1 
ATOM   3173 C  CG    . MET D 4 306 ? -25.057 38.088  51.490 1.00 61.45  ? 306 MET D CG    1 
ATOM   3174 S  SD    . MET D 4 306 ? -23.966 37.149  52.603 1.00 68.50  ? 306 MET D SD    1 
ATOM   3175 C  CE    . MET D 4 306 ? -23.123 35.979  51.452 1.00 64.36  ? 306 MET D CE    1 
ATOM   3176 N  N     . ARG D 4 307 ? -28.896 35.966  51.083 1.00 52.30  ? 307 ARG D N     1 
ATOM   3177 C  CA    . ARG D 4 307 ? -30.222 36.272  51.575 1.00 51.48  ? 307 ARG D CA    1 
ATOM   3178 C  C     . ARG D 4 307 ? -30.510 35.526  52.881 1.00 51.42  ? 307 ARG D C     1 
ATOM   3179 O  O     . ARG D 4 307 ? -31.186 36.059  53.752 1.00 51.82  ? 307 ARG D O     1 
ATOM   3180 C  CB    . ARG D 4 307 ? -31.245 35.924  50.503 1.00 51.65  ? 307 ARG D CB    1 
ATOM   3181 C  CG    . ARG D 4 307 ? -32.616 36.515  50.714 1.00 53.96  ? 307 ARG D CG    1 
ATOM   3182 C  CD    . ARG D 4 307 ? -33.108 37.119  49.409 1.00 54.52  ? 307 ARG D CD    1 
ATOM   3183 N  NE    . ARG D 4 307 ? -32.800 36.238  48.292 1.00 57.57  ? 307 ARG D NE    1 
ATOM   3184 C  CZ    . ARG D 4 307 ? -32.894 36.594  47.019 1.00 59.70  ? 307 ARG D CZ    1 
ATOM   3185 N  NH1   . ARG D 4 307 ? -33.291 37.820  46.714 1.00 61.15  ? 307 ARG D NH1   1 
ATOM   3186 N  NH2   . ARG D 4 307 ? -32.587 35.729  46.056 1.00 60.23  ? 307 ARG D NH2   1 
ATOM   3187 N  N     . TYR D 4 308 ? -29.992 34.302  53.023 1.00 51.49  ? 308 TYR D N     1 
ATOM   3188 C  CA    . TYR D 4 308 ? -30.190 33.514  54.248 1.00 51.38  ? 308 TYR D CA    1 
ATOM   3189 C  C     . TYR D 4 308 ? -29.235 33.996  55.346 1.00 53.27  ? 308 TYR D C     1 
ATOM   3190 O  O     . TYR D 4 308 ? -29.389 33.654  56.514 1.00 51.85  ? 308 TYR D O     1 
ATOM   3191 C  CB    . TYR D 4 308 ? -29.946 32.006  53.995 1.00 49.59  ? 308 TYR D CB    1 
ATOM   3192 C  CG    . TYR D 4 308 ? -30.874 31.361  52.974 1.00 45.75  ? 308 TYR D CG    1 
ATOM   3193 C  CD1   . TYR D 4 308 ? -30.509 31.270  51.641 1.00 43.59  ? 308 TYR D CD1   1 
ATOM   3194 C  CD2   . TYR D 4 308 ? -32.153 30.920  53.335 1.00 44.44  ? 308 TYR D CD2   1 
ATOM   3195 C  CE1   . TYR D 4 308 ? -31.388 30.771  50.690 1.00 43.12  ? 308 TYR D CE1   1 
ATOM   3196 C  CE2   . TYR D 4 308 ? -33.043 30.424  52.386 1.00 40.78  ? 308 TYR D CE2   1 
ATOM   3197 C  CZ    . TYR D 4 308 ? -32.656 30.360  51.070 1.00 42.42  ? 308 TYR D CZ    1 
ATOM   3198 O  OH    . TYR D 4 308 ? -33.544 29.953  50.097 1.00 45.62  ? 308 TYR D OH    1 
ATOM   3199 N  N     . GLU D 4 309 ? -28.253 34.801  54.947 1.00 57.80  ? 309 GLU D N     1 
ATOM   3200 C  CA    . GLU D 4 309 ? -27.231 35.348  55.841 1.00 60.62  ? 309 GLU D CA    1 
ATOM   3201 C  C     . GLU D 4 309 ? -27.690 35.707  57.248 1.00 61.06  ? 309 GLU D C     1 
ATOM   3202 O  O     . GLU D 4 309 ? -26.912 35.615  58.195 1.00 61.78  ? 309 GLU D O     1 
ATOM   3203 C  CB    . GLU D 4 309 ? -26.581 36.573  55.180 1.00 63.12  ? 309 GLU D CB    1 
ATOM   3204 C  CG    . GLU D 4 309 ? -25.750 37.477  56.096 1.00 69.33  ? 309 GLU D CG    1 
ATOM   3205 C  CD    . GLU D 4 309 ? -24.441 36.847  56.565 1.00 72.60  ? 309 GLU D CD    1 
ATOM   3206 O  OE1   . GLU D 4 309 ? -23.597 36.494  55.712 1.00 73.32  ? 309 GLU D OE1   1 
ATOM   3207 O  OE2   . GLU D 4 309 ? -24.252 36.717  57.795 1.00 74.88  ? 309 GLU D OE2   1 
ATOM   3208 N  N     . ASP D 4 310 ? -28.944 36.105  57.408 1.00 61.55  ? 310 ASP D N     1 
ATOM   3209 C  CA    . ASP D 4 310 ? -29.405 36.482  58.738 1.00 61.67  ? 310 ASP D CA    1 
ATOM   3210 C  C     . ASP D 4 310 ? -30.746 35.915  59.147 1.00 59.18  ? 310 ASP D C     1 
ATOM   3211 O  O     . ASP D 4 310 ? -31.293 36.287  60.185 1.00 60.11  ? 310 ASP D O     1 
ATOM   3212 C  CB    . ASP D 4 310 ? -29.441 38.005  58.846 1.00 66.08  ? 310 ASP D CB    1 
ATOM   3213 C  CG    . ASP D 4 310 ? -28.216 38.563  59.547 1.00 69.86  ? 310 ASP D CG    1 
ATOM   3214 O  OD1   . ASP D 4 310 ? -28.199 38.523  60.804 1.00 71.71  ? 310 ASP D OD1   1 
ATOM   3215 O  OD2   . ASP D 4 310 ? -27.275 39.021  58.845 1.00 70.68  ? 310 ASP D OD2   1 
ATOM   3216 N  N     . VAL D 4 311 ? -31.262 35.005  58.333 1.00 56.10  ? 311 VAL D N     1 
ATOM   3217 C  CA    . VAL D 4 311 ? -32.546 34.373  58.575 1.00 52.98  ? 311 VAL D CA    1 
ATOM   3218 C  C     . VAL D 4 311 ? -32.555 33.460  59.805 1.00 52.74  ? 311 VAL D C     1 
ATOM   3219 O  O     . VAL D 4 311 ? -31.712 32.576  59.949 1.00 52.96  ? 311 VAL D O     1 
ATOM   3220 C  CB    . VAL D 4 311 ? -32.960 33.568  57.342 1.00 51.62  ? 311 VAL D CB    1 
ATOM   3221 C  CG1   . VAL D 4 311 ? -34.276 32.850  57.591 1.00 49.62  ? 311 VAL D CG1   1 
ATOM   3222 C  CG2   . VAL D 4 311 ? -33.050 34.502  56.146 1.00 50.02  ? 311 VAL D CG2   1 
ATOM   3223 N  N     . TYR D 4 312 ? -33.515 33.688  60.693 1.00 51.00  ? 312 TYR D N     1 
ATOM   3224 C  CA    . TYR D 4 312 ? -33.643 32.874  61.889 1.00 50.22  ? 312 TYR D CA    1 
ATOM   3225 C  C     . TYR D 4 312 ? -34.432 31.614  61.532 1.00 49.30  ? 312 TYR D C     1 
ATOM   3226 O  O     . TYR D 4 312 ? -35.636 31.674  61.229 1.00 48.75  ? 312 TYR D O     1 
ATOM   3227 C  CB    . TYR D 4 312 ? -34.375 33.640  62.986 1.00 50.38  ? 312 TYR D CB    1 
ATOM   3228 C  CG    . TYR D 4 312 ? -34.415 32.902  64.301 1.00 52.25  ? 312 TYR D CG    1 
ATOM   3229 C  CD1   . TYR D 4 312 ? -33.232 32.582  64.975 1.00 53.39  ? 312 TYR D CD1   1 
ATOM   3230 C  CD2   . TYR D 4 312 ? -35.629 32.507  64.868 1.00 51.40  ? 312 TYR D CD2   1 
ATOM   3231 C  CE1   . TYR D 4 312 ? -33.257 31.884  66.184 1.00 54.74  ? 312 TYR D CE1   1 
ATOM   3232 C  CE2   . TYR D 4 312 ? -35.665 31.812  66.077 1.00 53.11  ? 312 TYR D CE2   1 
ATOM   3233 C  CZ    . TYR D 4 312 ? -34.476 31.503  66.729 1.00 55.21  ? 312 TYR D CZ    1 
ATOM   3234 O  OH    . TYR D 4 312 ? -34.502 30.808  67.922 1.00 57.68  ? 312 TYR D OH    1 
ATOM   3235 N  N     . MET D 4 313 ? -33.743 30.477  61.563 1.00 46.13  ? 313 MET D N     1 
ATOM   3236 C  CA    . MET D 4 313 ? -34.364 29.206  61.233 1.00 44.47  ? 313 MET D CA    1 
ATOM   3237 C  C     . MET D 4 313 ? -33.729 28.065  62.007 1.00 42.96  ? 313 MET D C     1 
ATOM   3238 O  O     . MET D 4 313 ? -33.210 27.118  61.428 1.00 42.78  ? 313 MET D O     1 
ATOM   3239 C  CB    . MET D 4 313 ? -34.272 28.940  59.721 1.00 45.17  ? 313 MET D CB    1 
ATOM   3240 C  CG    . MET D 4 313 ? -32.917 29.253  59.087 1.00 44.50  ? 313 MET D CG    1 
ATOM   3241 S  SD    . MET D 4 313 ? -32.904 28.866  57.330 1.00 44.21  ? 313 MET D SD    1 
ATOM   3242 C  CE    . MET D 4 313 ? -31.185 28.419  57.062 1.00 43.43  ? 313 MET D CE    1 
ATOM   3243 N  N     . PRO D 4 314 ? -33.759 28.152  63.340 1.00 41.50  ? 314 PRO D N     1 
ATOM   3244 C  CA    . PRO D 4 314 ? -33.196 27.133  64.222 1.00 40.45  ? 314 PRO D CA    1 
ATOM   3245 C  C     . PRO D 4 314 ? -33.622 25.720  63.869 1.00 40.23  ? 314 PRO D C     1 
ATOM   3246 O  O     . PRO D 4 314 ? -32.819 24.797  63.852 1.00 40.38  ? 314 PRO D O     1 
ATOM   3247 C  CB    . PRO D 4 314 ? -33.706 27.551  65.608 1.00 41.20  ? 314 PRO D CB    1 
ATOM   3248 C  CG    . PRO D 4 314 ? -34.864 28.476  65.319 1.00 39.92  ? 314 PRO D CG    1 
ATOM   3249 C  CD    . PRO D 4 314 ? -34.388 29.226  64.127 1.00 41.04  ? 314 PRO D CD    1 
ATOM   3250 N  N     . GLU D 4 315 ? -34.898 25.561  63.577 1.00 40.80  ? 315 GLU D N     1 
ATOM   3251 C  CA    . GLU D 4 315 ? -35.437 24.263  63.266 1.00 41.52  ? 315 GLU D CA    1 
ATOM   3252 C  C     . GLU D 4 315 ? -34.839 23.648  61.992 1.00 41.91  ? 315 GLU D C     1 
ATOM   3253 O  O     . GLU D 4 315 ? -34.798 22.423  61.853 1.00 42.99  ? 315 GLU D O     1 
ATOM   3254 C  CB    . GLU D 4 315 ? -36.960 24.373  63.183 1.00 43.56  ? 315 GLU D CB    1 
ATOM   3255 C  CG    . GLU D 4 315 ? -37.673 23.240  63.902 1.00 52.02  ? 315 GLU D CG    1 
ATOM   3256 C  CD    . GLU D 4 315 ? -37.372 23.195  65.400 1.00 53.95  ? 315 GLU D CD    1 
ATOM   3257 O  OE1   . GLU D 4 315 ? -37.639 22.140  66.050 1.00 53.44  ? 315 GLU D OE1   1 
ATOM   3258 O  OE2   . GLU D 4 315 ? -36.879 24.219  65.927 1.00 54.93  ? 315 GLU D OE2   1 
ATOM   3259 N  N     . VAL D 4 316 ? -34.355 24.486  61.079 1.00 40.16  ? 316 VAL D N     1 
ATOM   3260 C  CA    . VAL D 4 316 ? -33.749 24.009  59.831 1.00 40.02  ? 316 VAL D CA    1 
ATOM   3261 C  C     . VAL D 4 316 ? -32.297 23.550  60.024 1.00 40.07  ? 316 VAL D C     1 
ATOM   3262 O  O     . VAL D 4 316 ? -31.848 22.583  59.409 1.00 38.86  ? 316 VAL D O     1 
ATOM   3263 C  CB    . VAL D 4 316 ? -33.753 25.117  58.733 1.00 40.47  ? 316 VAL D CB    1 
ATOM   3264 C  CG1   . VAL D 4 316 ? -32.888 24.684  57.539 1.00 40.04  ? 316 VAL D CG1   1 
ATOM   3265 C  CG2   . VAL D 4 316 ? -35.172 25.391  58.272 1.00 40.62  ? 316 VAL D CG2   1 
ATOM   3266 N  N     . TYR D 4 317 ? -31.565 24.271  60.864 1.00 40.36  ? 317 TYR D N     1 
ATOM   3267 C  CA    . TYR D 4 317 ? -30.172 23.957  61.141 1.00 39.89  ? 317 TYR D CA    1 
ATOM   3268 C  C     . TYR D 4 317 ? -30.130 22.694  61.953 1.00 38.89  ? 317 TYR D C     1 
ATOM   3269 O  O     . TYR D 4 317 ? -29.197 21.904  61.856 1.00 38.47  ? 317 TYR D O     1 
ATOM   3270 C  CB    . TYR D 4 317 ? -29.512 25.075  61.956 1.00 39.97  ? 317 TYR D CB    1 
ATOM   3271 C  CG    . TYR D 4 317 ? -28.975 26.211  61.132 1.00 40.72  ? 317 TYR D CG    1 
ATOM   3272 C  CD1   . TYR D 4 317 ? -29.725 27.365  60.920 1.00 40.22  ? 317 TYR D CD1   1 
ATOM   3273 C  CD2   . TYR D 4 317 ? -27.735 26.105  60.511 1.00 41.06  ? 317 TYR D CD2   1 
ATOM   3274 C  CE1   . TYR D 4 317 ? -29.256 28.374  60.109 1.00 39.81  ? 317 TYR D CE1   1 
ATOM   3275 C  CE2   . TYR D 4 317 ? -27.261 27.107  59.699 1.00 41.46  ? 317 TYR D CE2   1 
ATOM   3276 C  CZ    . TYR D 4 317 ? -28.024 28.235  59.499 1.00 40.34  ? 317 TYR D CZ    1 
ATOM   3277 O  OH    . TYR D 4 317 ? -27.556 29.206  58.656 1.00 42.39  ? 317 TYR D OH    1 
ATOM   3278 N  N     . LYS D 4 318 ? -31.160 22.530  62.767 1.00 37.49  ? 318 LYS D N     1 
ATOM   3279 C  CA    . LYS D 4 318 ? -31.272 21.387  63.637 1.00 38.33  ? 318 LYS D CA    1 
ATOM   3280 C  C     . LYS D 4 318 ? -31.429 20.111  62.793 1.00 39.15  ? 318 LYS D C     1 
ATOM   3281 O  O     . LYS D 4 318 ? -30.790 19.092  63.051 1.00 39.20  ? 318 LYS D O     1 
ATOM   3282 C  CB    . LYS D 4 318 ? -32.464 21.605  64.576 1.00 37.86  ? 318 LYS D CB    1 
ATOM   3283 C  CG    . LYS D 4 318 ? -32.308 20.988  65.944 1.00 41.44  ? 318 LYS D CG    1 
ATOM   3284 C  CD    . LYS D 4 318 ? -32.569 22.000  67.058 1.00 43.24  ? 318 LYS D CD    1 
ATOM   3285 C  CE    . LYS D 4 318 ? -34.035 22.078  67.414 1.00 44.59  ? 318 LYS D CE    1 
ATOM   3286 N  NZ    . LYS D 4 318 ? -34.833 21.765  66.206 1.00 49.15  ? 318 LYS D NZ    1 
ATOM   3287 N  N     . ALA D 4 319 ? -32.260 20.172  61.762 1.00 39.55  ? 319 ALA D N     1 
ATOM   3288 C  CA    . ALA D 4 319 ? -32.468 19.004  60.920 1.00 39.66  ? 319 ALA D CA    1 
ATOM   3289 C  C     . ALA D 4 319 ? -31.175 18.598  60.211 1.00 40.11  ? 319 ALA D C     1 
ATOM   3290 O  O     . ALA D 4 319 ? -30.724 17.445  60.315 1.00 41.64  ? 319 ALA D O     1 
ATOM   3291 C  CB    . ALA D 4 319 ? -33.574 19.285  59.893 1.00 38.72  ? 319 ALA D CB    1 
ATOM   3292 N  N     . ILE D 4 320 ? -30.586 19.548  59.492 1.00 38.40  ? 320 ILE D N     1 
ATOM   3293 C  CA    . ILE D 4 320 ? -29.366 19.307  58.742 1.00 36.65  ? 320 ILE D CA    1 
ATOM   3294 C  C     . ILE D 4 320 ? -28.250 18.761  59.622 1.00 37.43  ? 320 ILE D C     1 
ATOM   3295 O  O     . ILE D 4 320 ? -27.472 17.883  59.206 1.00 37.52  ? 320 ILE D O     1 
ATOM   3296 C  CB    . ILE D 4 320 ? -28.910 20.587  58.059 1.00 36.51  ? 320 ILE D CB    1 
ATOM   3297 C  CG1   . ILE D 4 320 ? -29.952 20.987  57.025 1.00 34.20  ? 320 ILE D CG1   1 
ATOM   3298 C  CG2   . ILE D 4 320 ? -27.545 20.397  57.419 1.00 36.12  ? 320 ILE D CG2   1 
ATOM   3299 C  CD1   . ILE D 4 320 ? -30.107 19.987  55.941 1.00 36.05  ? 320 ILE D CD1   1 
ATOM   3300 N  N     . ASN D 4 321 ? -28.174 19.260  60.844 1.00 34.14  ? 321 ASN D N     1 
ATOM   3301 C  CA    . ASN D 4 321 ? -27.153 18.773  61.741 1.00 35.01  ? 321 ASN D CA    1 
ATOM   3302 C  C     . ASN D 4 321 ? -27.505 17.348  62.200 1.00 36.74  ? 321 ASN D C     1 
ATOM   3303 O  O     . ASN D 4 321 ? -26.683 16.441  62.090 1.00 38.09  ? 321 ASN D O     1 
ATOM   3304 C  CB    . ASN D 4 321 ? -27.005 19.739  62.919 1.00 32.74  ? 321 ASN D CB    1 
ATOM   3305 C  CG    . ASN D 4 321 ? -26.351 21.066  62.502 1.00 32.86  ? 321 ASN D CG    1 
ATOM   3306 O  OD1   . ASN D 4 321 ? -26.684 22.123  63.031 1.00 29.84  ? 321 ASN D OD1   1 
ATOM   3307 N  ND2   . ASN D 4 321 ? -25.413 21.002  61.554 1.00 28.86  ? 321 ASN D ND2   1 
ATOM   3308 N  N     . ILE D 4 322 ? -28.731 17.135  62.682 1.00 36.44  ? 322 ILE D N     1 
ATOM   3309 C  CA    . ILE D 4 322 ? -29.137 15.809  63.124 1.00 33.78  ? 322 ILE D CA    1 
ATOM   3310 C  C     . ILE D 4 322 ? -28.910 14.782  62.015 1.00 34.99  ? 322 ILE D C     1 
ATOM   3311 O  O     . ILE D 4 322 ? -28.330 13.708  62.235 1.00 34.71  ? 322 ILE D O     1 
ATOM   3312 C  CB    . ILE D 4 322 ? -30.620 15.771  63.481 1.00 34.05  ? 322 ILE D CB    1 
ATOM   3313 C  CG1   . ILE D 4 322 ? -30.904 16.690  64.663 1.00 33.74  ? 322 ILE D CG1   1 
ATOM   3314 C  CG2   . ILE D 4 322 ? -31.032 14.337  63.821 1.00 32.78  ? 322 ILE D CG2   1 
ATOM   3315 C  CD1   . ILE D 4 322 ? -32.393 16.878  64.921 1.00 36.92  ? 322 ILE D CD1   1 
ATOM   3316 N  N     . ALA D 4 323 ? -29.383 15.111  60.822 1.00 33.36  ? 323 ALA D N     1 
ATOM   3317 C  CA    . ALA D 4 323 ? -29.245 14.205  59.710 1.00 33.59  ? 323 ALA D CA    1 
ATOM   3318 C  C     . ALA D 4 323 ? -27.786 13.869  59.442 1.00 35.36  ? 323 ALA D C     1 
ATOM   3319 O  O     . ALA D 4 323 ? -27.405 12.689  59.379 1.00 35.25  ? 323 ALA D O     1 
ATOM   3320 C  CB    . ALA D 4 323 ? -29.875 14.807  58.470 1.00 31.77  ? 323 ALA D CB    1 
ATOM   3321 N  N     . GLN D 4 324 ? -26.962 14.899  59.293 1.00 34.65  ? 324 GLN D N     1 
ATOM   3322 C  CA    . GLN D 4 324 ? -25.576 14.643  58.984 1.00 34.88  ? 324 GLN D CA    1 
ATOM   3323 C  C     . GLN D 4 324 ? -24.769 13.982  60.096 1.00 33.21  ? 324 GLN D C     1 
ATOM   3324 O  O     . GLN D 4 324 ? -23.679 13.507  59.850 1.00 37.04  ? 324 GLN D O     1 
ATOM   3325 C  CB    . GLN D 4 324 ? -24.912 15.919  58.411 1.00 34.57  ? 324 GLN D CB    1 
ATOM   3326 C  CG    . GLN D 4 324 ? -23.993 16.716  59.280 1.00 29.26  ? 324 GLN D CG    1 
ATOM   3327 C  CD    . GLN D 4 324 ? -23.834 18.141  58.759 1.00 29.33  ? 324 GLN D CD    1 
ATOM   3328 O  OE1   . GLN D 4 324 ? -23.782 18.380  57.545 1.00 28.59  ? 324 GLN D OE1   1 
ATOM   3329 N  NE2   . GLN D 4 324 ? -23.758 19.094  59.677 1.00 27.23  ? 324 GLN D NE2   1 
ATOM   3330 N  N     . ASN D 4 325 ? -25.306 13.897  61.300 1.00 31.79  ? 325 ASN D N     1 
ATOM   3331 C  CA    . ASN D 4 325 ? -24.587 13.198  62.357 1.00 32.18  ? 325 ASN D CA    1 
ATOM   3332 C  C     . ASN D 4 325 ? -24.933 11.709  62.383 1.00 32.33  ? 325 ASN D C     1 
ATOM   3333 O  O     . ASN D 4 325 ? -24.624 11.017  63.347 1.00 34.41  ? 325 ASN D O     1 
ATOM   3334 C  CB    . ASN D 4 325 ? -24.878 13.806  63.722 1.00 34.39  ? 325 ASN D CB    1 
ATOM   3335 C  CG    . ASN D 4 325 ? -24.064 15.061  63.978 1.00 42.45  ? 325 ASN D CG    1 
ATOM   3336 O  OD1   . ASN D 4 325 ? -24.617 16.127  64.279 1.00 46.76  ? 325 ASN D OD1   1 
ATOM   3337 N  ND2   . ASN D 4 325 ? -22.740 14.947  63.854 1.00 42.37  ? 325 ASN D ND2   1 
ATOM   3338 N  N     . THR D 4 326 ? -25.584 11.211  61.337 1.00 31.24  ? 326 THR D N     1 
ATOM   3339 C  CA    . THR D 4 326 ? -25.940 9.803   61.272 1.00 29.14  ? 326 THR D CA    1 
ATOM   3340 C  C     . THR D 4 326 ? -24.711 9.033   60.814 1.00 31.28  ? 326 THR D C     1 
ATOM   3341 O  O     . THR D 4 326 ? -24.167 9.307   59.744 1.00 32.77  ? 326 THR D O     1 
ATOM   3342 C  CB    . THR D 4 326 ? -27.058 9.541   60.254 1.00 28.80  ? 326 THR D CB    1 
ATOM   3343 O  OG1   . THR D 4 326 ? -28.222 10.286  60.608 1.00 30.73  ? 326 THR D OG1   1 
ATOM   3344 C  CG2   . THR D 4 326 ? -27.413 8.075   60.230 1.00 26.93  ? 326 THR D CG2   1 
ATOM   3345 N  N     . ALA D 4 327 ? -24.280 8.071   61.622 1.00 30.66  ? 327 ALA D N     1 
ATOM   3346 C  CA    . ALA D 4 327 ? -23.121 7.262   61.300 1.00 30.48  ? 327 ALA D CA    1 
ATOM   3347 C  C     . ALA D 4 327 ? -23.511 6.107   60.387 1.00 31.13  ? 327 ALA D C     1 
ATOM   3348 O  O     . ALA D 4 327 ? -24.498 5.433   60.611 1.00 34.64  ? 327 ALA D O     1 
ATOM   3349 C  CB    . ALA D 4 327 ? -22.489 6.722   62.576 1.00 27.37  ? 327 ALA D CB    1 
ATOM   3350 N  N     . TRP D 4 328 ? -22.729 5.892   59.344 1.00 31.34  ? 328 TRP D N     1 
ATOM   3351 C  CA    . TRP D 4 328 ? -22.964 4.810   58.419 1.00 29.58  ? 328 TRP D CA    1 
ATOM   3352 C  C     . TRP D 4 328 ? -21.676 3.980   58.374 1.00 31.01  ? 328 TRP D C     1 
ATOM   3353 O  O     . TRP D 4 328 ? -20.588 4.443   58.746 1.00 32.05  ? 328 TRP D O     1 
ATOM   3354 C  CB    . TRP D 4 328 ? -23.262 5.349   57.015 1.00 29.05  ? 328 TRP D CB    1 
ATOM   3355 C  CG    . TRP D 4 328 ? -24.527 6.135   56.903 1.00 29.92  ? 328 TRP D CG    1 
ATOM   3356 C  CD1   . TRP D 4 328 ? -24.729 7.421   57.304 1.00 31.49  ? 328 TRP D CD1   1 
ATOM   3357 C  CD2   . TRP D 4 328 ? -25.766 5.698   56.326 1.00 28.31  ? 328 TRP D CD2   1 
ATOM   3358 N  NE1   . TRP D 4 328 ? -26.016 7.818   57.009 1.00 29.34  ? 328 TRP D NE1   1 
ATOM   3359 C  CE2   . TRP D 4 328 ? -26.672 6.779   56.410 1.00 28.99  ? 328 TRP D CE2   1 
ATOM   3360 C  CE3   . TRP D 4 328 ? -26.197 4.498   55.746 1.00 28.30  ? 328 TRP D CE3   1 
ATOM   3361 C  CZ2   . TRP D 4 328 ? -27.980 6.698   55.934 1.00 28.73  ? 328 TRP D CZ2   1 
ATOM   3362 C  CZ3   . TRP D 4 328 ? -27.487 4.411   55.277 1.00 25.60  ? 328 TRP D CZ3   1 
ATOM   3363 C  CH2   . TRP D 4 328 ? -28.369 5.505   55.372 1.00 29.60  ? 328 TRP D CH2   1 
ATOM   3364 N  N     . LYS D 4 329 ? -21.810 2.736   57.953 1.00 29.59  ? 329 LYS D N     1 
ATOM   3365 C  CA    . LYS D 4 329 ? -20.666 1.875   57.807 1.00 30.43  ? 329 LYS D CA    1 
ATOM   3366 C  C     . LYS D 4 329 ? -20.905 1.183   56.477 1.00 31.44  ? 329 LYS D C     1 
ATOM   3367 O  O     . LYS D 4 329 ? -22.016 1.189   55.943 1.00 31.31  ? 329 LYS D O     1 
ATOM   3368 C  CB    . LYS D 4 329 ? -20.557 0.860   58.962 1.00 30.12  ? 329 LYS D CB    1 
ATOM   3369 C  CG    . LYS D 4 329 ? -21.855 0.166   59.290 1.00 34.07  ? 329 LYS D CG    1 
ATOM   3370 C  CD    . LYS D 4 329 ? -21.692 -1.343  59.414 1.00 32.16  ? 329 LYS D CD    1 
ATOM   3371 C  CE    . LYS D 4 329 ? -21.125 -1.749  60.734 1.00 29.70  ? 329 LYS D CE    1 
ATOM   3372 N  NZ    . LYS D 4 329 ? -22.200 -1.893  61.733 1.00 32.05  ? 329 LYS D NZ    1 
ATOM   3373 N  N     . ILE D 4 330 ? -19.845 0.652   55.896 1.00 32.63  ? 330 ILE D N     1 
ATOM   3374 C  CA    . ILE D 4 330 ? -19.991 -0.056  54.647 1.00 31.73  ? 330 ILE D CA    1 
ATOM   3375 C  C     . ILE D 4 330 ? -20.528 -1.422  55.055 1.00 33.31  ? 330 ILE D C     1 
ATOM   3376 O  O     . ILE D 4 330 ? -20.217 -1.921  56.139 1.00 31.92  ? 330 ILE D O     1 
ATOM   3377 C  CB    . ILE D 4 330 ? -18.634 -0.222  53.965 1.00 29.91  ? 330 ILE D CB    1 
ATOM   3378 C  CG1   . ILE D 4 330 ? -18.066 1.160   53.636 1.00 26.87  ? 330 ILE D CG1   1 
ATOM   3379 C  CG2   . ILE D 4 330 ? -18.766 -1.120  52.764 1.00 23.96  ? 330 ILE D CG2   1 
ATOM   3380 C  CD1   . ILE D 4 330 ? -18.870 1.924   52.664 1.00 26.24  ? 330 ILE D CD1   1 
ATOM   3381 N  N     . ASN D 4 331 ? -21.365 -2.002  54.210 1.00 34.12  ? 331 ASN D N     1 
ATOM   3382 C  CA    . ASN D 4 331 ? -21.908 -3.318  54.487 1.00 35.43  ? 331 ASN D CA    1 
ATOM   3383 C  C     . ASN D 4 331 ? -20.915 -4.332  53.892 1.00 37.01  ? 331 ASN D C     1 
ATOM   3384 O  O     . ASN D 4 331 ? -21.045 -4.715  52.729 1.00 37.71  ? 331 ASN D O     1 
ATOM   3385 C  CB    . ASN D 4 331 ? -23.267 -3.453  53.810 1.00 34.23  ? 331 ASN D CB    1 
ATOM   3386 C  CG    . ASN D 4 331 ? -23.973 -4.726  54.180 1.00 33.77  ? 331 ASN D CG    1 
ATOM   3387 O  OD1   . ASN D 4 331 ? -23.354 -5.796  54.278 1.00 35.32  ? 331 ASN D OD1   1 
ATOM   3388 N  ND2   . ASN D 4 331 ? -25.281 -4.631  54.373 1.00 31.01  ? 331 ASN D ND2   1 
ATOM   3389 N  N     . LYS D 4 332 ? -19.922 -4.748  54.674 1.00 36.52  ? 332 LYS D N     1 
ATOM   3390 C  CA    . LYS D 4 332 ? -18.916 -5.697  54.194 1.00 38.40  ? 332 LYS D CA    1 
ATOM   3391 C  C     . LYS D 4 332 ? -19.440 -6.892  53.369 1.00 39.42  ? 332 LYS D C     1 
ATOM   3392 O  O     . LYS D 4 332 ? -18.842 -7.244  52.355 1.00 40.15  ? 332 LYS D O     1 
ATOM   3393 C  CB    . LYS D 4 332 ? -18.096 -6.224  55.368 1.00 40.65  ? 332 LYS D CB    1 
ATOM   3394 C  CG    . LYS D 4 332 ? -17.148 -5.232  55.993 1.00 41.14  ? 332 LYS D CG    1 
ATOM   3395 C  CD    . LYS D 4 332 ? -15.885 -5.100  55.183 1.00 46.63  ? 332 LYS D CD    1 
ATOM   3396 C  CE    . LYS D 4 332 ? -14.808 -4.369  55.987 1.00 51.68  ? 332 LYS D CE    1 
ATOM   3397 N  NZ    . LYS D 4 332 ? -14.631 -4.929  57.377 1.00 51.25  ? 332 LYS D NZ    1 
ATOM   3398 N  N     . LYS D 4 333 ? -20.541 -7.519  53.785 1.00 39.38  ? 333 LYS D N     1 
ATOM   3399 C  CA    . LYS D 4 333 ? -21.076 -8.665  53.034 1.00 38.38  ? 333 LYS D CA    1 
ATOM   3400 C  C     . LYS D 4 333 ? -21.636 -8.241  51.663 1.00 39.16  ? 333 LYS D C     1 
ATOM   3401 O  O     . LYS D 4 333 ? -21.388 -8.901  50.661 1.00 40.30  ? 333 LYS D O     1 
ATOM   3402 C  CB    . LYS D 4 333 ? -22.180 -9.371  53.827 1.00 38.92  ? 333 LYS D CB    1 
ATOM   3403 C  CG    . LYS D 4 333 ? -21.855 -9.633  55.286 1.00 38.54  ? 333 LYS D CG    1 
ATOM   3404 C  CD    . LYS D 4 333 ? -21.484 -11.068 55.528 1.00 40.46  ? 333 LYS D CD    1 
ATOM   3405 C  CE    . LYS D 4 333 ? -22.493 -11.753 56.443 1.00 43.31  ? 333 LYS D CE    1 
ATOM   3406 N  NZ    . LYS D 4 333 ? -22.498 -11.190 57.823 1.00 45.74  ? 333 LYS D NZ    1 
ATOM   3407 N  N     . VAL D 4 334 ? -22.402 -7.156  51.608 1.00 37.20  ? 334 VAL D N     1 
ATOM   3408 C  CA    . VAL D 4 334 ? -22.933 -6.712  50.325 1.00 35.36  ? 334 VAL D CA    1 
ATOM   3409 C  C     . VAL D 4 334 ? -21.785 -6.262  49.432 1.00 34.50  ? 334 VAL D C     1 
ATOM   3410 O  O     . VAL D 4 334 ? -21.824 -6.457  48.221 1.00 34.57  ? 334 VAL D O     1 
ATOM   3411 C  CB    . VAL D 4 334 ? -23.957 -5.545  50.486 1.00 36.28  ? 334 VAL D CB    1 
ATOM   3412 C  CG1   . VAL D 4 334 ? -24.471 -5.083  49.108 1.00 28.69  ? 334 VAL D CG1   1 
ATOM   3413 C  CG2   . VAL D 4 334 ? -25.129 -6.005  51.378 1.00 35.52  ? 334 VAL D CG2   1 
ATOM   3414 N  N     . LEU D 4 335 ? -20.756 -5.669  50.032 1.00 35.35  ? 335 LEU D N     1 
ATOM   3415 C  CA    . LEU D 4 335 ? -19.590 -5.215  49.269 1.00 35.54  ? 335 LEU D CA    1 
ATOM   3416 C  C     . LEU D 4 335 ? -18.951 -6.461  48.695 1.00 35.67  ? 335 LEU D C     1 
ATOM   3417 O  O     . LEU D 4 335 ? -18.590 -6.504  47.523 1.00 36.43  ? 335 LEU D O     1 
ATOM   3418 C  CB    . LEU D 4 335 ? -18.584 -4.489  50.165 1.00 33.52  ? 335 LEU D CB    1 
ATOM   3419 C  CG    . LEU D 4 335 ? -17.338 -3.961  49.451 1.00 30.52  ? 335 LEU D CG    1 
ATOM   3420 C  CD1   . LEU D 4 335 ? -17.735 -3.071  48.292 1.00 29.82  ? 335 LEU D CD1   1 
ATOM   3421 C  CD2   . LEU D 4 335 ? -16.488 -3.197  50.427 1.00 28.54  ? 335 LEU D CD2   1 
ATOM   3422 N  N     . ALA D 4 336 ? -18.851 -7.489  49.528 1.00 36.56  ? 336 ALA D N     1 
ATOM   3423 C  CA    . ALA D 4 336 ? -18.281 -8.765  49.105 1.00 37.35  ? 336 ALA D CA    1 
ATOM   3424 C  C     . ALA D 4 336 ? -18.901 -9.281  47.808 1.00 38.89  ? 336 ALA D C     1 
ATOM   3425 O  O     . ALA D 4 336 ? -18.182 -9.596  46.873 1.00 42.28  ? 336 ALA D O     1 
ATOM   3426 C  CB    . ALA D 4 336 ? -18.461 -9.793  50.194 1.00 34.17  ? 336 ALA D CB    1 
ATOM   3427 N  N     . VAL D 4 337 ? -20.226 -9.378  47.730 1.00 40.51  ? 337 VAL D N     1 
ATOM   3428 C  CA    . VAL D 4 337 ? -20.812 -9.882  46.499 1.00 42.82  ? 337 VAL D CA    1 
ATOM   3429 C  C     . VAL D 4 337 ? -20.721 -8.850  45.379 1.00 44.87  ? 337 VAL D C     1 
ATOM   3430 O  O     . VAL D 4 337 ? -20.351 -9.192  44.250 1.00 44.90  ? 337 VAL D O     1 
ATOM   3431 C  CB    . VAL D 4 337 ? -22.306 -10.321 46.670 1.00 42.72  ? 337 VAL D CB    1 
ATOM   3432 C  CG1   . VAL D 4 337 ? -22.519 -10.927 48.033 1.00 41.06  ? 337 VAL D CG1   1 
ATOM   3433 C  CG2   . VAL D 4 337 ? -23.243 -9.154  46.418 1.00 45.46  ? 337 VAL D CG2   1 
ATOM   3434 N  N     . ALA D 4 338 ? -21.047 -7.592  45.694 1.00 45.83  ? 338 ALA D N     1 
ATOM   3435 C  CA    . ALA D 4 338 ? -21.014 -6.514  44.701 1.00 45.59  ? 338 ALA D CA    1 
ATOM   3436 C  C     . ALA D 4 338 ? -19.657 -6.376  44.011 1.00 45.23  ? 338 ALA D C     1 
ATOM   3437 O  O     . ALA D 4 338 ? -19.599 -6.074  42.821 1.00 46.63  ? 338 ALA D O     1 
ATOM   3438 C  CB    . ALA D 4 338 ? -21.412 -5.184  45.338 1.00 42.76  ? 338 ALA D CB    1 
ATOM   3439 N  N     . ASN D 4 339 ? -18.568 -6.599  44.735 1.00 43.87  ? 339 ASN D N     1 
ATOM   3440 C  CA    . ASN D 4 339 ? -17.252 -6.483  44.110 1.00 44.88  ? 339 ASN D CA    1 
ATOM   3441 C  C     . ASN D 4 339 ? -17.042 -7.468  42.965 1.00 46.28  ? 339 ASN D C     1 
ATOM   3442 O  O     . ASN D 4 339 ? -16.609 -7.078  41.879 1.00 47.35  ? 339 ASN D O     1 
ATOM   3443 C  CB    . ASN D 4 339 ? -16.151 -6.659  45.144 1.00 44.62  ? 339 ASN D CB    1 
ATOM   3444 C  CG    . ASN D 4 339 ? -15.592 -5.337  45.609 1.00 46.39  ? 339 ASN D CG    1 
ATOM   3445 O  OD1   . ASN D 4 339 ? -15.192 -5.184  46.769 1.00 46.96  ? 339 ASN D OD1   1 
ATOM   3446 N  ND2   . ASN D 4 339 ? -15.551 -4.368  44.700 1.00 46.36  ? 339 ASN D ND2   1 
ATOM   3447 N  N     . VAL D 4 340 ? -17.354 -8.740  43.205 1.00 46.57  ? 340 VAL D N     1 
ATOM   3448 C  CA    . VAL D 4 340 ? -17.206 -9.782  42.192 1.00 45.09  ? 340 VAL D CA    1 
ATOM   3449 C  C     . VAL D 4 340 ? -18.297 -9.743  41.116 1.00 47.07  ? 340 VAL D C     1 
ATOM   3450 O  O     . VAL D 4 340 ? -18.024 -9.450  39.949 1.00 48.78  ? 340 VAL D O     1 
ATOM   3451 C  CB    . VAL D 4 340 ? -17.232 -11.157 42.841 1.00 43.31  ? 340 VAL D CB    1 
ATOM   3452 C  CG1   . VAL D 4 340 ? -16.016 -11.339 43.699 1.00 44.64  ? 340 VAL D CG1   1 
ATOM   3453 C  CG2   . VAL D 4 340 ? -18.467 -11.292 43.701 1.00 45.24  ? 340 VAL D CG2   1 
ATOM   3454 N  N     . ILE D 4 341 ? -19.532 -10.022 41.518 1.00 46.51  ? 341 ILE D N     1 
ATOM   3455 C  CA    . ILE D 4 341 ? -20.664 -10.065 40.604 1.00 46.78  ? 341 ILE D CA    1 
ATOM   3456 C  C     . ILE D 4 341 ? -20.766 -8.943  39.558 1.00 48.18  ? 341 ILE D C     1 
ATOM   3457 O  O     . ILE D 4 341 ? -21.323 -9.155  38.473 1.00 47.44  ? 341 ILE D O     1 
ATOM   3458 C  CB    . ILE D 4 341 ? -21.981 -10.150 41.402 1.00 45.23  ? 341 ILE D CB    1 
ATOM   3459 C  CG1   . ILE D 4 341 ? -22.796 -11.329 40.912 1.00 44.69  ? 341 ILE D CG1   1 
ATOM   3460 C  CG2   . ILE D 4 341 ? -22.796 -8.888  41.234 1.00 46.40  ? 341 ILE D CG2   1 
ATOM   3461 C  CD1   . ILE D 4 341 ? -24.074 -11.516 41.659 1.00 46.43  ? 341 ILE D CD1   1 
ATOM   3462 N  N     . THR D 4 342 ? -20.246 -7.757  39.868 1.00 49.23  ? 342 THR D N     1 
ATOM   3463 C  CA    . THR D 4 342 ? -20.310 -6.652  38.911 1.00 51.00  ? 342 THR D CA    1 
ATOM   3464 C  C     . THR D 4 342 ? -19.285 -6.853  37.811 1.00 53.04  ? 342 THR D C     1 
ATOM   3465 O  O     . THR D 4 342 ? -19.296 -6.140  36.804 1.00 53.41  ? 342 THR D O     1 
ATOM   3466 C  CB    . THR D 4 342 ? -20.019 -5.290  39.557 1.00 51.02  ? 342 THR D CB    1 
ATOM   3467 O  OG1   . THR D 4 342 ? -18.789 -5.370  40.289 1.00 52.73  ? 342 THR D OG1   1 
ATOM   3468 C  CG2   . THR D 4 342 ? -21.156 -4.869  40.463 1.00 48.26  ? 342 THR D CG2   1 
ATOM   3469 N  N     . LYS D 4 343 ? -18.387 -7.810  38.025 1.00 53.95  ? 343 LYS D N     1 
ATOM   3470 C  CA    . LYS D 4 343 ? -17.355 -8.134  37.049 1.00 56.09  ? 343 LYS D CA    1 
ATOM   3471 C  C     . LYS D 4 343 ? -17.790 -9.273  36.115 1.00 55.65  ? 343 LYS D C     1 
ATOM   3472 O  O     . LYS D 4 343 ? -17.381 -9.330  34.958 1.00 56.28  ? 343 LYS D O     1 
ATOM   3473 C  CB    . LYS D 4 343 ? -16.059 -8.501  37.772 1.00 57.91  ? 343 LYS D CB    1 
ATOM   3474 C  CG    . LYS D 4 343 ? -15.355 -7.303  38.376 1.00 60.15  ? 343 LYS D CG    1 
ATOM   3475 C  CD    . LYS D 4 343 ? -14.121 -7.714  39.154 1.00 62.15  ? 343 LYS D CD    1 
ATOM   3476 C  CE    . LYS D 4 343 ? -13.436 -6.503  39.760 1.00 64.33  ? 343 LYS D CE    1 
ATOM   3477 N  NZ    . LYS D 4 343 ? -12.948 -5.568  38.700 1.00 65.52  ? 343 LYS D NZ    1 
ATOM   3478 N  N     . TRP D 4 344 ? -18.615 -10.174 36.634 1.00 55.37  ? 344 TRP D N     1 
ATOM   3479 C  CA    . TRP D 4 344 ? -19.143 -11.308 35.877 1.00 56.34  ? 344 TRP D CA    1 
ATOM   3480 C  C     . TRP D 4 344 ? -19.547 -10.916 34.454 1.00 60.36  ? 344 TRP D C     1 
ATOM   3481 O  O     . TRP D 4 344 ? -20.224 -9.903  34.255 1.00 60.54  ? 344 TRP D O     1 
ATOM   3482 C  CB    . TRP D 4 344 ? -20.386 -11.867 36.585 1.00 51.50  ? 344 TRP D CB    1 
ATOM   3483 C  CG    . TRP D 4 344 ? -20.117 -12.686 37.796 1.00 43.09  ? 344 TRP D CG    1 
ATOM   3484 C  CD1   . TRP D 4 344 ? -18.948 -12.776 38.492 1.00 42.48  ? 344 TRP D CD1   1 
ATOM   3485 C  CD2   . TRP D 4 344 ? -21.045 -13.538 38.457 1.00 39.88  ? 344 TRP D CD2   1 
ATOM   3486 N  NE1   . TRP D 4 344 ? -19.090 -13.639 39.546 1.00 39.84  ? 344 TRP D NE1   1 
ATOM   3487 C  CE2   . TRP D 4 344 ? -20.373 -14.122 39.546 1.00 40.02  ? 344 TRP D CE2   1 
ATOM   3488 C  CE3   . TRP D 4 344 ? -22.383 -13.870 38.230 1.00 37.95  ? 344 TRP D CE3   1 
ATOM   3489 C  CZ2   . TRP D 4 344 ? -20.997 -15.022 40.411 1.00 38.67  ? 344 TRP D CZ2   1 
ATOM   3490 C  CZ3   . TRP D 4 344 ? -23.001 -14.761 39.083 1.00 37.29  ? 344 TRP D CZ3   1 
ATOM   3491 C  CH2   . TRP D 4 344 ? -22.307 -15.331 40.161 1.00 38.56  ? 344 TRP D CH2   1 
ATOM   3492 N  N     . LYS D 4 345 ? -19.157 -11.719 33.465 1.00 64.24  ? 345 LYS D N     1 
ATOM   3493 C  CA    . LYS D 4 345 ? -19.535 -11.396 32.095 1.00 67.01  ? 345 LYS D CA    1 
ATOM   3494 C  C     . LYS D 4 345 ? -21.035 -11.158 32.164 1.00 67.75  ? 345 LYS D C     1 
ATOM   3495 O  O     . LYS D 4 345 ? -21.500 -10.044 31.935 1.00 68.09  ? 345 LYS D O     1 
ATOM   3496 C  CB    . LYS D 4 345 ? -19.239 -12.554 31.134 1.00 69.11  ? 345 LYS D CB    1 
ATOM   3497 C  CG    . LYS D 4 345 ? -18.939 -12.088 29.711 1.00 72.16  ? 345 LYS D CG    1 
ATOM   3498 C  CD    . LYS D 4 345 ? -19.570 -12.975 28.645 1.00 74.86  ? 345 LYS D CD    1 
ATOM   3499 C  CE    . LYS D 4 345 ? -19.102 -14.423 28.731 1.00 77.01  ? 345 LYS D CE    1 
ATOM   3500 N  NZ    . LYS D 4 345 ? -19.701 -15.256 27.631 1.00 77.24  ? 345 LYS D NZ    1 
ATOM   3501 N  N     . HIS D 4 346 ? -21.778 -12.204 32.520 1.00 68.68  ? 346 HIS D N     1 
ATOM   3502 C  CA    . HIS D 4 346 ? -23.229 -12.109 32.640 1.00 70.37  ? 346 HIS D CA    1 
ATOM   3503 C  C     . HIS D 4 346 ? -23.645 -11.926 34.095 1.00 70.35  ? 346 HIS D C     1 
ATOM   3504 O  O     . HIS D 4 346 ? -23.764 -12.905 34.837 1.00 71.12  ? 346 HIS D O     1 
ATOM   3505 C  CB    . HIS D 4 346 ? -23.916 -13.370 32.110 1.00 71.52  ? 346 HIS D CB    1 
ATOM   3506 C  CG    . HIS D 4 346 ? -23.452 -13.786 30.753 1.00 75.33  ? 346 HIS D CG    1 
ATOM   3507 N  ND1   . HIS D 4 346 ? -23.205 -12.882 29.742 1.00 76.45  ? 346 HIS D ND1   1 
ATOM   3508 C  CD2   . HIS D 4 346 ? -23.188 -15.011 30.238 1.00 75.85  ? 346 HIS D CD2   1 
ATOM   3509 C  CE1   . HIS D 4 346 ? -22.807 -13.533 28.662 1.00 76.71  ? 346 HIS D CE1   1 
ATOM   3510 N  NE2   . HIS D 4 346 ? -22.788 -14.825 28.937 1.00 76.78  ? 346 HIS D NE2   1 
ATOM   3511 N  N     . CYS D 4 347 ? -23.872 -10.681 34.505 1.00 68.66  ? 347 CYS D N     1 
ATOM   3512 C  CA    . CYS D 4 347 ? -24.301 -10.423 35.876 1.00 66.57  ? 347 CYS D CA    1 
ATOM   3513 C  C     . CYS D 4 347 ? -25.761 -10.857 36.031 1.00 64.49  ? 347 CYS D C     1 
ATOM   3514 O  O     . CYS D 4 347 ? -26.567 -10.678 35.118 1.00 64.78  ? 347 CYS D O     1 
ATOM   3515 C  CB    . CYS D 4 347 ? -24.163 -8.936  36.213 1.00 64.98  ? 347 CYS D CB    1 
ATOM   3516 S  SG    . CYS D 4 347 ? -24.553 -8.549  37.925 1.00 62.25  ? 347 CYS D SG    1 
ATOM   3517 N  N     . PRO D 4 348 ? -26.113 -11.457 37.180 1.00 63.07  ? 348 PRO D N     1 
ATOM   3518 C  CA    . PRO D 4 348 ? -27.496 -11.895 37.399 1.00 62.68  ? 348 PRO D CA    1 
ATOM   3519 C  C     . PRO D 4 348 ? -28.389 -10.727 37.822 1.00 63.16  ? 348 PRO D C     1 
ATOM   3520 O  O     . PRO D 4 348 ? -29.611 -10.846 37.869 1.00 62.27  ? 348 PRO D O     1 
ATOM   3521 C  CB    . PRO D 4 348 ? -27.347 -12.939 38.498 1.00 60.55  ? 348 PRO D CB    1 
ATOM   3522 C  CG    . PRO D 4 348 ? -26.240 -12.372 39.315 1.00 60.67  ? 348 PRO D CG    1 
ATOM   3523 C  CD    . PRO D 4 348 ? -25.243 -11.910 38.280 1.00 61.33  ? 348 PRO D CD    1 
ATOM   3524 N  N     . VAL D 4 349 ? -27.764 -9.596  38.131 1.00 64.55  ? 349 VAL D N     1 
ATOM   3525 C  CA    . VAL D 4 349 ? -28.504 -8.429  38.553 1.00 66.04  ? 349 VAL D CA    1 
ATOM   3526 C  C     . VAL D 4 349 ? -29.111 -7.763  37.340 1.00 70.47  ? 349 VAL D C     1 
ATOM   3527 O  O     . VAL D 4 349 ? -28.399 -7.313  36.448 1.00 69.31  ? 349 VAL D O     1 
ATOM   3528 C  CB    . VAL D 4 349 ? -27.613 -7.416  39.272 1.00 63.58  ? 349 VAL D CB    1 
ATOM   3529 C  CG1   . VAL D 4 349 ? -28.465 -6.303  39.829 1.00 61.62  ? 349 VAL D CG1   1 
ATOM   3530 C  CG2   . VAL D 4 349 ? -26.838 -8.092  40.386 1.00 62.07  ? 349 VAL D CG2   1 
ATOM   3531 N  N     . GLU D 4 350 ? -30.439 -7.717  37.331 1.00 76.18  ? 350 GLU D N     1 
ATOM   3532 C  CA    . GLU D 4 350 ? -31.219 -7.116  36.259 1.00 81.69  ? 350 GLU D CA    1 
ATOM   3533 C  C     . GLU D 4 350 ? -30.450 -6.126  35.398 1.00 83.39  ? 350 GLU D C     1 
ATOM   3534 O  O     . GLU D 4 350 ? -29.893 -6.489  34.365 1.00 84.94  ? 350 GLU D O     1 
ATOM   3535 C  CB    . GLU D 4 350 ? -32.439 -6.399  36.841 1.00 85.77  ? 350 GLU D CB    1 
ATOM   3536 C  CG    . GLU D 4 350 ? -33.329 -7.254  37.736 1.00 90.08  ? 350 GLU D CG    1 
ATOM   3537 C  CD    . GLU D 4 350 ? -34.493 -6.456  38.310 1.00 92.03  ? 350 GLU D CD    1 
ATOM   3538 O  OE1   . GLU D 4 350 ? -34.227 -5.400  38.928 1.00 92.50  ? 350 GLU D OE1   1 
ATOM   3539 O  OE2   . GLU D 4 350 ? -35.662 -6.879  38.144 1.00 92.01  ? 350 GLU D OE2   1 
ATOM   3540 N  N     . ASP D 4 351 ? -30.414 -4.872  35.835 1.00 84.96  ? 351 ASP D N     1 
ATOM   3541 C  CA    . ASP D 4 351 ? -29.755 -3.825  35.070 1.00 86.43  ? 351 ASP D CA    1 
ATOM   3542 C  C     . ASP D 4 351 ? -28.447 -3.287  35.650 1.00 86.09  ? 351 ASP D C     1 
ATOM   3543 O  O     . ASP D 4 351 ? -28.416 -2.222  36.262 1.00 86.26  ? 351 ASP D O     1 
ATOM   3544 C  CB    . ASP D 4 351 ? -30.744 -2.671  34.858 1.00 90.03  ? 351 ASP D CB    1 
ATOM   3545 C  CG    . ASP D 4 351 ? -30.732 -2.138  33.428 1.00 93.75  ? 351 ASP D CG    1 
ATOM   3546 O  OD1   . ASP D 4 351 ? -29.741 -1.470  33.046 1.00 94.95  ? 351 ASP D OD1   1 
ATOM   3547 O  OD2   . ASP D 4 351 ? -31.716 -2.391  32.687 1.00 94.15  ? 351 ASP D OD2   1 
ATOM   3548 N  N     . ILE D 4 352 ? -27.368 -4.036  35.460 1.00 85.85  ? 352 ILE D N     1 
ATOM   3549 C  CA    . ILE D 4 352 ? -26.045 -3.615  35.910 1.00 85.10  ? 352 ILE D CA    1 
ATOM   3550 C  C     . ILE D 4 352 ? -25.195 -3.473  34.651 1.00 85.68  ? 352 ILE D C     1 
ATOM   3551 O  O     . ILE D 4 352 ? -25.074 -4.409  33.862 1.00 84.98  ? 352 ILE D O     1 
ATOM   3552 C  CB    . ILE D 4 352 ? -25.381 -4.656  36.855 1.00 84.55  ? 352 ILE D CB    1 
ATOM   3553 C  CG1   . ILE D 4 352 ? -25.743 -4.354  38.308 1.00 83.29  ? 352 ILE D CG1   1 
ATOM   3554 C  CG2   . ILE D 4 352 ? -23.862 -4.631  36.692 1.00 84.13  ? 352 ILE D CG2   1 
ATOM   3555 C  CD1   . ILE D 4 352 ? -25.206 -3.032  38.812 1.00 82.83  ? 352 ILE D CD1   1 
ATOM   3556 N  N     . PRO D 4 353 ? -24.604 -2.292  34.441 1.00 86.26  ? 353 PRO D N     1 
ATOM   3557 C  CA    . PRO D 4 353 ? -23.778 -2.099  33.252 1.00 87.38  ? 353 PRO D CA    1 
ATOM   3558 C  C     . PRO D 4 353 ? -22.672 -3.139  33.169 1.00 89.02  ? 353 PRO D C     1 
ATOM   3559 O  O     . PRO D 4 353 ? -21.827 -3.234  34.057 1.00 88.35  ? 353 PRO D O     1 
ATOM   3560 C  CB    . PRO D 4 353 ? -23.242 -0.685  33.436 1.00 86.92  ? 353 PRO D CB    1 
ATOM   3561 C  CG    . PRO D 4 353 ? -23.158 -0.556  34.915 1.00 86.74  ? 353 PRO D CG    1 
ATOM   3562 C  CD    . PRO D 4 353 ? -24.475 -1.146  35.352 1.00 86.25  ? 353 PRO D CD    1 
ATOM   3563 N  N     . ALA D 4 354 ? -22.691 -3.918  32.095 1.00 91.56  ? 354 ALA D N     1 
ATOM   3564 C  CA    . ALA D 4 354 ? -21.698 -4.956  31.878 1.00 94.81  ? 354 ALA D CA    1 
ATOM   3565 C  C     . ALA D 4 354 ? -20.317 -4.364  31.612 1.00 97.08  ? 354 ALA D C     1 
ATOM   3566 O  O     . ALA D 4 354 ? -20.193 -3.204  31.213 1.00 96.93  ? 354 ALA D O     1 
ATOM   3567 C  CB    . ALA D 4 354 ? -22.123 -5.836  30.715 1.00 94.68  ? 354 ALA D CB    1 
ATOM   3568 N  N     . ILE D 4 355 ? -19.286 -5.176  31.832 1.00 100.26 ? 355 ILE D N     1 
ATOM   3569 C  CA    . ILE D 4 355 ? -17.899 -4.763  31.626 1.00 104.13 ? 355 ILE D CA    1 
ATOM   3570 C  C     . ILE D 4 355 ? -17.637 -4.194  30.233 1.00 107.10 ? 355 ILE D C     1 
ATOM   3571 O  O     . ILE D 4 355 ? -17.293 -3.019  30.094 1.00 107.62 ? 355 ILE D O     1 
ATOM   3572 C  CB    . ILE D 4 355 ? -16.922 -5.940  31.838 1.00 104.01 ? 355 ILE D CB    1 
ATOM   3573 C  CG1   . ILE D 4 355 ? -17.014 -6.454  33.278 1.00 103.73 ? 355 ILE D CG1   1 
ATOM   3574 C  CG2   . ILE D 4 355 ? -15.495 -5.494  31.513 1.00 104.34 ? 355 ILE D CG2   1 
ATOM   3575 C  CD1   . ILE D 4 355 ? -16.466 -5.500  34.314 1.00 102.71 ? 355 ILE D CD1   1 
ATOM   3576 N  N     . GLU D 4 356 ? -17.786 -5.033  29.209 1.00 90.49  ? 356 GLU D N     1 
ATOM   3577 C  CA    . GLU D 4 356 ? -17.551 -4.613  27.830 1.00 93.72  ? 356 GLU D CA    1 
ATOM   3578 C  C     . GLU D 4 356 ? -18.810 -4.267  27.051 1.00 95.59  ? 356 GLU D C     1 
ATOM   3579 O  O     . GLU D 4 356 ? -19.916 -4.270  27.593 1.00 95.43  ? 356 GLU D O     1 
ATOM   3580 C  CB    . GLU D 4 356 ? -16.766 -5.684  27.066 1.00 94.69  ? 356 GLU D CB    1 
ATOM   3581 C  CG    . GLU D 4 356 ? -17.191 -7.113  27.359 1.00 96.74  ? 356 GLU D CG    1 
ATOM   3582 C  CD    . GLU D 4 356 ? -16.650 -7.617  28.687 1.00 97.80  ? 356 GLU D CD    1 
ATOM   3583 O  OE1   . GLU D 4 356 ? -15.413 -7.589  28.874 1.00 98.34  ? 356 GLU D OE1   1 
ATOM   3584 O  OE2   . GLU D 4 356 ? -17.458 -8.040  29.541 1.00 98.33  ? 356 GLU D OE2   1 
ATOM   3585 N  N     . ARG D 4 357 ? -18.622 -3.979  25.767 1.00 98.40  ? 357 ARG D N     1 
ATOM   3586 C  CA    . ARG D 4 357 ? -19.715 -3.599  24.879 1.00 91.31  ? 357 ARG D CA    1 
ATOM   3587 C  C     . ARG D 4 357 ? -20.537 -4.777  24.363 1.00 92.94  ? 357 ARG D C     1 
ATOM   3588 O  O     . ARG D 4 357 ? -20.796 -5.738  25.088 1.00 93.46  ? 357 ARG D O     1 
ATOM   3589 C  CB    . ARG D 4 357 ? -19.160 -2.810  23.690 1.00 91.96  ? 357 ARG D CB    1 
ATOM   3590 C  CG    . ARG D 4 357 ? -18.189 -1.700  24.073 1.00 93.16  ? 357 ARG D CG    1 
ATOM   3591 C  CD    . ARG D 4 357 ? -17.898 -0.800  22.883 1.00 94.57  ? 357 ARG D CD    1 
ATOM   3592 N  NE    . ARG D 4 357 ? -17.550 -1.571  21.691 1.00 95.77  ? 357 ARG D NE    1 
ATOM   3593 C  CZ    . ARG D 4 357 ? -17.381 -1.043  20.482 1.00 96.14  ? 357 ARG D CZ    1 
ATOM   3594 N  NH1   . ARG D 4 357 ? -17.526 0.262   20.298 1.00 96.00  ? 357 ARG D NH1   1 
ATOM   3595 N  NH2   . ARG D 4 357 ? -17.076 -1.823  19.453 1.00 96.78  ? 357 ARG D NH2   1 
ATOM   3596 N  N     . GLU D 4 358 ? -20.947 -4.687  23.102 1.00 94.81  ? 358 GLU D N     1 
ATOM   3597 C  CA    . GLU D 4 358 ? -21.751 -5.722  22.460 1.00 96.81  ? 358 GLU D CA    1 
ATOM   3598 C  C     . GLU D 4 358 ? -21.215 -6.023  21.060 1.00 98.12  ? 358 GLU D C     1 
ATOM   3599 O  O     . GLU D 4 358 ? -21.945 -6.494  20.185 1.00 98.03  ? 358 GLU D O     1 
ATOM   3600 C  CB    . GLU D 4 358 ? -23.212 -5.272  22.381 1.00 96.71  ? 358 GLU D CB    1 
ATOM   3601 C  CG    . GLU D 4 358 ? -23.392 -3.895  21.770 1.00 97.28  ? 358 GLU D CG    1 
ATOM   3602 C  CD    . GLU D 4 358 ? -22.629 -2.823  22.527 1.00 97.36  ? 358 GLU D CD    1 
ATOM   3603 O  OE1   . GLU D 4 358 ? -22.964 -2.570  23.704 1.00 97.25  ? 358 GLU D OE1   1 
ATOM   3604 O  OE2   . GLU D 4 358 ? -21.686 -2.241  21.948 1.00 97.09  ? 358 GLU D OE2   1 
ATOM   3605 N  N     . GLU D 4 359 ? -19.930 -5.733  20.869 1.00 99.63  ? 359 GLU D N     1 
ATOM   3606 C  CA    . GLU D 4 359 ? -19.228 -5.966  19.609 1.00 90.57  ? 359 GLU D CA    1 
ATOM   3607 C  C     . GLU D 4 359 ? -20.005 -5.678  18.324 1.00 91.16  ? 359 GLU D C     1 
ATOM   3608 O  O     . GLU D 4 359 ? -20.715 -6.543  17.807 1.00 91.16  ? 359 GLU D O     1 
ATOM   3609 C  CB    . GLU D 4 359 ? -18.696 -7.405  19.569 1.00 90.54  ? 359 GLU D CB    1 
ATOM   3610 C  CG    . GLU D 4 359 ? -17.474 -7.650  20.450 1.00 90.53  ? 359 GLU D CG    1 
ATOM   3611 C  CD    . GLU D 4 359 ? -17.748 -7.431  21.927 1.00 90.28  ? 359 GLU D CD    1 
ATOM   3612 O  OE1   . GLU D 4 359 ? -18.564 -8.184  22.499 1.00 99.74  ? 359 GLU D OE1   1 
ATOM   3613 O  OE2   . GLU D 4 359 ? -17.145 -6.507  22.514 1.00 99.97  ? 359 GLU D OE2   1 
ATOM   3614 N  N     . LEU D 4 360 ? -19.847 -4.456  17.819 1.00 91.61  ? 360 LEU D N     1 
ATOM   3615 C  CA    . LEU D 4 360 ? -20.478 -4.002  16.579 1.00 91.55  ? 360 LEU D CA    1 
ATOM   3616 C  C     . LEU D 4 360 ? -21.988 -4.231  16.476 1.00 91.34  ? 360 LEU D C     1 
ATOM   3617 O  O     . LEU D 4 360 ? -22.489 -5.312  16.784 1.00 91.55  ? 360 LEU D O     1 
ATOM   3618 C  CB    . LEU D 4 360 ? -19.791 -4.666  15.377 1.00 92.04  ? 360 LEU D CB    1 
ATOM   3619 C  CG    . LEU D 4 360 ? -18.260 -4.610  15.282 1.00 92.25  ? 360 LEU D CG    1 
ATOM   3620 C  CD1   . LEU D 4 360 ? -17.812 -5.322  14.014 1.00 92.19  ? 360 LEU D CD1   1 
ATOM   3621 C  CD2   . LEU D 4 360 ? -17.779 -3.167  15.280 1.00 92.31  ? 360 LEU D CD2   1 
ATOM   3622 N  N     . PRO D 4 361 ? -22.734 -3.203  16.033 1.00 91.04  ? 361 PRO D N     1 
ATOM   3623 C  CA    . PRO D 4 361 ? -24.190 -3.304  15.884 1.00 90.89  ? 361 PRO D CA    1 
ATOM   3624 C  C     . PRO D 4 361 ? -24.571 -4.323  14.806 1.00 90.78  ? 361 PRO D C     1 
ATOM   3625 O  O     . PRO D 4 361 ? -25.704 -4.804  14.766 1.00 90.41  ? 361 PRO D O     1 
ATOM   3626 C  CB    . PRO D 4 361 ? -24.597 -1.883  15.493 1.00 90.90  ? 361 PRO D CB    1 
ATOM   3627 C  CG    . PRO D 4 361 ? -23.552 -1.038  16.147 1.00 90.82  ? 361 PRO D CG    1 
ATOM   3628 C  CD    . PRO D 4 361 ? -22.290 -1.810  15.854 1.00 90.81  ? 361 PRO D CD    1 
ATOM   3629 N  N     . TRP D 4 377 ? -28.610 -3.659  8.131  1.00 130.95 ? 377 TRP D N     1 
ATOM   3630 C  CA    . TRP D 4 377 ? -28.642 -4.084  9.534  1.00 129.92 ? 377 TRP D CA    1 
ATOM   3631 C  C     . TRP D 4 377 ? -28.611 -2.902  10.493 1.00 129.31 ? 377 TRP D C     1 
ATOM   3632 O  O     . TRP D 4 377 ? -29.513 -2.733  11.311 1.00 129.34 ? 377 TRP D O     1 
ATOM   3633 C  CB    . TRP D 4 377 ? -27.463 -5.024  9.829  1.00 124.25 ? 377 TRP D CB    1 
ATOM   3634 C  CG    . TRP D 4 377 ? -27.834 -6.400  10.288 1.00 126.02 ? 377 TRP D CG    1 
ATOM   3635 C  CD1   . TRP D 4 377 ? -27.785 -6.873  11.584 1.00 124.27 ? 377 TRP D CD1   1 
ATOM   3636 C  CD2   . TRP D 4 377 ? -28.304 -7.477  9.501  1.00 125.72 ? 377 TRP D CD2   1 
ATOM   3637 N  NE1   . TRP D 4 377 ? -28.210 -8.167  11.640 1.00 125.97 ? 377 TRP D NE1   1 
ATOM   3638 C  CE2   . TRP D 4 377 ? -28.537 -8.557  10.357 1.00 126.03 ? 377 TRP D CE2   1 
ATOM   3639 C  CE3   . TRP D 4 377 ? -28.575 -7.616  8.125  1.00 126.03 ? 377 TRP D CE3   1 
ATOM   3640 C  CZ2   . TRP D 4 377 ? -29.034 -9.785  9.918  1.00 127.33 ? 377 TRP D CZ2   1 
ATOM   3641 C  CZ3   . TRP D 4 377 ? -29.058 -8.830  7.662  1.00 126.73 ? 377 TRP D CZ3   1 
ATOM   3642 C  CH2   . TRP D 4 377 ? -29.236 -9.895  8.571  1.00 127.69 ? 377 TRP D CH2   1 
ATOM   3643 N  N     . LYS D 4 378 ? -27.735 -2.092  10.686 1.00 128.56 ? 378 LYS D N     1 
ATOM   3644 C  CA    . LYS D 4 378 ? -27.578 -0.671  11.007 1.00 127.64 ? 378 LYS D CA    1 
ATOM   3645 C  C     . LYS D 4 378 ? -28.904 0.023   11.324 1.00 126.94 ? 378 LYS D C     1 
ATOM   3646 O  O     . LYS D 4 378 ? -29.004 0.765   12.295 1.00 126.92 ? 378 LYS D O     1 
ATOM   3647 C  CB    . LYS D 4 378 ? -26.879 0.055   9.851  1.00 127.38 ? 378 LYS D CB    1 
ATOM   3648 C  CG    . LYS D 4 378 ? -26.111 1.310   10.253 1.00 122.45 ? 378 LYS D CG    1 
ATOM   3649 C  CD    . LYS D 4 378 ? -27.021 2.415   10.777 1.00 123.90 ? 378 LYS D CD    1 
ATOM   3650 C  CE    . LYS D 4 378 ? -27.997 2.893   9.716  1.00 123.93 ? 378 LYS D CE    1 
ATOM   3651 N  NZ    . LYS D 4 378 ? -27.276 3.432   8.531  1.00 125.02 ? 378 LYS D NZ    1 
ATOM   3652 N  N     . ARG D 4 379 ? -29.065 -1.225  10.953 1.00 119.65 ? 379 ARG D N     1 
ATOM   3653 C  CA    . ARG D 4 379 ? -30.361 -0.745  10.479 1.00 114.16 ? 379 ARG D CA    1 
ATOM   3654 C  C     . ARG D 4 379 ? -31.063 -0.100  11.665 1.00 104.12 ? 379 ARG D C     1 
ATOM   3655 O  O     . ARG D 4 379 ? -30.719 1.008   12.079 1.00 104.48 ? 379 ARG D O     1 
ATOM   3656 C  CB    . ARG D 4 379 ? -31.206 -1.908  9.956  1.00 113.67 ? 379 ARG D CB    1 
ATOM   3657 C  CG    . ARG D 4 379 ? -32.510 -1.475  9.309  1.00 103.44 ? 379 ARG D CG    1 
ATOM   3658 C  CD    . ARG D 4 379 ? -32.229 -0.622  8.090  1.00 102.91 ? 379 ARG D CD    1 
ATOM   3659 N  NE    . ARG D 4 379 ? -31.358 -1.323  7.151  1.00 102.40 ? 379 ARG D NE    1 
ATOM   3660 C  CZ    . ARG D 4 379 ? -30.789 -0.759  6.092  1.00 102.11 ? 379 ARG D CZ    1 
ATOM   3661 N  NH1   . ARG D 4 379 ? -30.996 0.524   5.829  1.00 101.78 ? 379 ARG D NH1   1 
ATOM   3662 N  NH2   . ARG D 4 379 ? -30.006 -1.478  5.299  1.00 105.89 ? 379 ARG D NH2   1 
ATOM   3663 N  N     . ALA D 4 380 ? -32.054 -0.798  12.207 1.00 113.78 ? 380 ALA D N     1 
ATOM   3664 C  CA    . ALA D 4 380 ? -32.773 -0.308  13.372 1.00 113.47 ? 380 ALA D CA    1 
ATOM   3665 C  C     . ALA D 4 380 ? -32.005 -0.856  14.570 1.00 112.96 ? 380 ALA D C     1 
ATOM   3666 O  O     . ALA D 4 380 ? -32.331 -0.576  15.724 1.00 113.07 ? 380 ALA D O     1 
ATOM   3667 C  CB    . ALA D 4 380 ? -34.201 -0.832  13.372 1.00 113.34 ? 380 ALA D CB    1 
ATOM   3668 N  N     . ALA D 4 381 ? -30.976 -1.643  14.264 1.00 111.86 ? 381 ALA D N     1 
ATOM   3669 C  CA    . ALA D 4 381 ? -30.126 -2.262  15.272 1.00 113.61 ? 381 ALA D CA    1 
ATOM   3670 C  C     . ALA D 4 381 ? -28.748 -1.608  15.294 1.00 119.43 ? 381 ALA D C     1 
ATOM   3671 O  O     . ALA D 4 381 ? -27.721 -2.285  15.349 1.00 119.16 ? 381 ALA D O     1 
ATOM   3672 C  CB    . ALA D 4 381 ? -29.993 -3.753  14.993 1.00 114.22 ? 381 ALA D CB    1 
ATOM   3673 N  N     . ALA D 4 382 ? -28.738 -0.284  15.238 1.00 117.97 ? 382 ALA D N     1 
ATOM   3674 C  CA    . ALA D 4 382 ? -27.498 0.471   15.274 1.00 116.41 ? 382 ALA D CA    1 
ATOM   3675 C  C     . ALA D 4 382 ? -27.611 1.434   16.441 1.00 115.49 ? 382 ALA D C     1 
ATOM   3676 O  O     . ALA D 4 382 ? -26.734 2.265   16.664 1.00 115.21 ? 382 ALA D O     1 
ATOM   3677 C  CB    . ALA D 4 382 ? -27.309 1.233   13.979 1.00 117.20 ? 382 ALA D CB    1 
ATOM   3678 N  N     . ALA D 4 383 ? -28.709 1.313   17.180 1.00 114.46 ? 383 ALA D N     1 
ATOM   3679 C  CA    . ALA D 4 383 ? -28.962 2.157   18.339 1.00 113.33 ? 383 ALA D CA    1 
ATOM   3680 C  C     . ALA D 4 383 ? -27.890 1.914   19.396 1.00 112.61 ? 383 ALA D C     1 
ATOM   3681 O  O     . ALA D 4 383 ? -27.800 2.643   20.383 1.00 112.59 ? 383 ALA D O     1 
ATOM   3682 C  CB    . ALA D 4 383 ? -30.336 1.855   18.911 1.00 113.14 ? 383 ALA D CB    1 
ATOM   3683 N  N     . VAL D 4 384 ? -27.084 0.879   19.178 1.00 111.00 ? 384 VAL D N     1 
ATOM   3684 C  CA    . VAL D 4 384 ? -26.004 0.524   20.090 1.00 109.13 ? 384 VAL D CA    1 
ATOM   3685 C  C     . VAL D 4 384 ? -25.208 1.759   20.511 1.00 108.18 ? 384 VAL D C     1 
ATOM   3686 O  O     . VAL D 4 384 ? -24.948 1.969   21.695 1.00 107.91 ? 384 VAL D O     1 
ATOM   3687 C  CB    . VAL D 4 384 ? -25.060 -0.497  19.430 1.00 109.12 ? 384 VAL D CB    1 
ATOM   3688 C  CG1   . VAL D 4 384 ? -23.863 -0.759  20.320 1.00 109.14 ? 384 VAL D CG1   1 
ATOM   3689 C  CG2   . VAL D 4 384 ? -25.816 -1.790  19.159 1.00 108.26 ? 384 VAL D CG2   1 
ATOM   3690 N  N     . TYR D 4 385 ? -24.822 2.573   19.535 1.00 107.19 ? 385 TYR D N     1 
ATOM   3691 C  CA    . TYR D 4 385 ? -24.075 3.798   19.806 1.00 106.30 ? 385 TYR D CA    1 
ATOM   3692 C  C     . TYR D 4 385 ? -24.770 4.576   20.923 1.00 105.36 ? 385 TYR D C     1 
ATOM   3693 O  O     . TYR D 4 385 ? -24.140 5.329   21.665 1.00 105.19 ? 385 TYR D O     1 
ATOM   3694 C  CB    . TYR D 4 385 ? -24.013 4.662   18.541 1.00 106.70 ? 385 TYR D CB    1 
ATOM   3695 C  CG    . TYR D 4 385 ? -23.148 4.095   17.436 1.00 107.27 ? 385 TYR D CG    1 
ATOM   3696 C  CD1   . TYR D 4 385 ? -23.217 2.743   17.091 1.00 107.56 ? 385 TYR D CD1   1 
ATOM   3697 C  CD2   . TYR D 4 385 ? -22.259 4.910   16.735 1.00 107.43 ? 385 TYR D CD2   1 
ATOM   3698 C  CE1   . TYR D 4 385 ? -22.419 2.218   16.079 1.00 107.72 ? 385 TYR D CE1   1 
ATOM   3699 C  CE2   . TYR D 4 385 ? -21.458 4.396   15.722 1.00 107.55 ? 385 TYR D CE2   1 
ATOM   3700 C  CZ    . TYR D 4 385 ? -21.542 3.050   15.401 1.00 108.10 ? 385 TYR D CZ    1 
ATOM   3701 O  OH    . TYR D 4 385 ? -20.740 2.532   14.409 1.00 108.69 ? 385 TYR D OH    1 
ATOM   3702 N  N     . ARG D 4 386 ? -26.080 4.386   21.025 1.00 104.07 ? 386 ARG D N     1 
ATOM   3703 C  CA    . ARG D 4 386 ? -26.896 5.049   22.035 1.00 102.84 ? 386 ARG D CA    1 
ATOM   3704 C  C     . ARG D 4 386 ? -26.815 4.287   23.359 1.00 100.76 ? 386 ARG D C     1 
ATOM   3705 O  O     . ARG D 4 386 ? -26.400 4.833   24.382 1.00 99.78  ? 386 ARG D O     1 
ATOM   3706 C  CB    . ARG D 4 386 ? -28.352 5.112   21.548 1.00 104.19 ? 386 ARG D CB    1 
ATOM   3707 C  CG    . ARG D 4 386 ? -29.363 5.565   22.588 1.00 105.69 ? 386 ARG D CG    1 
ATOM   3708 C  CD    . ARG D 4 386 ? -29.228 7.044   22.914 1.00 107.12 ? 386 ARG D CD    1 
ATOM   3709 N  NE    . ARG D 4 386 ? -30.041 7.421   24.070 1.00 108.53 ? 386 ARG D NE    1 
ATOM   3710 C  CZ    . ARG D 4 386 ? -31.360 7.255   24.156 1.00 109.22 ? 386 ARG D CZ    1 
ATOM   3711 N  NH1   . ARG D 4 386 ? -32.041 6.713   23.150 1.00 108.93 ? 386 ARG D NH1   1 
ATOM   3712 N  NH2   . ARG D 4 386 ? -32.001 7.630   25.256 1.00 109.08 ? 386 ARG D NH2   1 
ATOM   3713 N  N     . LYS D 4 387 ? -27.211 3.019   23.313 1.00 98.28  ? 387 LYS D N     1 
ATOM   3714 C  CA    . LYS D 4 387 ? -27.219 2.131   24.471 1.00 95.55  ? 387 LYS D CA    1 
ATOM   3715 C  C     . LYS D 4 387 ? -25.855 1.958   25.152 1.00 94.07  ? 387 LYS D C     1 
ATOM   3716 O  O     . LYS D 4 387 ? -25.772 1.932   26.379 1.00 94.03  ? 387 LYS D O     1 
ATOM   3717 C  CB    . LYS D 4 387 ? -27.755 0.762   24.045 1.00 95.26  ? 387 LYS D CB    1 
ATOM   3718 C  CG    . LYS D 4 387 ? -27.730 -0.294  25.130 1.00 95.80  ? 387 LYS D CG    1 
ATOM   3719 C  CD    . LYS D 4 387 ? -27.656 -1.694  24.532 1.00 95.84  ? 387 LYS D CD    1 
ATOM   3720 C  CE    . LYS D 4 387 ? -26.355 -1.887  23.759 1.00 95.50  ? 387 LYS D CE    1 
ATOM   3721 N  NZ    . LYS D 4 387 ? -26.244 -3.240  23.146 1.00 96.32  ? 387 LYS D NZ    1 
ATOM   3722 N  N     . ASP D 4 388 ? -24.789 1.828   24.369 1.00 92.14  ? 388 ASP D N     1 
ATOM   3723 C  CA    . ASP D 4 388 ? -23.461 1.650   24.945 1.00 90.28  ? 388 ASP D CA    1 
ATOM   3724 C  C     . ASP D 4 388 ? -22.942 2.952   25.537 1.00 88.41  ? 388 ASP D C     1 
ATOM   3725 O  O     . ASP D 4 388 ? -22.085 2.954   26.420 1.00 87.21  ? 388 ASP D O     1 
ATOM   3726 C  CB    . ASP D 4 388 ? -22.481 1.145   23.889 1.00 92.04  ? 388 ASP D CB    1 
ATOM   3727 C  CG    . ASP D 4 388 ? -21.139 0.756   24.484 1.00 93.75  ? 388 ASP D CG    1 
ATOM   3728 O  OD1   . ASP D 4 388 ? -20.442 1.638   25.027 1.00 95.27  ? 388 ASP D OD1   1 
ATOM   3729 O  OD2   . ASP D 4 388 ? -20.782 -0.437  24.414 1.00 94.74  ? 388 ASP D OD2   1 
ATOM   3730 N  N     . LYS D 4 389 ? -23.462 4.063   25.036 1.00 86.90  ? 389 LYS D N     1 
ATOM   3731 C  CA    . LYS D 4 389 ? -23.067 5.374   25.530 1.00 85.29  ? 389 LYS D CA    1 
ATOM   3732 C  C     . LYS D 4 389 ? -23.463 5.388   27.004 1.00 83.56  ? 389 LYS D C     1 
ATOM   3733 O  O     . LYS D 4 389 ? -22.657 5.707   27.886 1.00 83.16  ? 389 LYS D O     1 
ATOM   3734 C  CB    . LYS D 4 389 ? -23.828 6.468   24.764 1.00 86.77  ? 389 LYS D CB    1 
ATOM   3735 C  CG    . LYS D 4 389 ? -23.333 7.889   24.998 1.00 88.39  ? 389 LYS D CG    1 
ATOM   3736 C  CD    . LYS D 4 389 ? -21.921 8.066   24.468 1.00 90.68  ? 389 LYS D CD    1 
ATOM   3737 C  CE    . LYS D 4 389 ? -21.387 9.464   24.731 1.00 91.56  ? 389 LYS D CE    1 
ATOM   3738 N  NZ    . LYS D 4 389 ? -19.952 9.576   24.327 1.00 92.37  ? 389 LYS D NZ    1 
ATOM   3739 N  N     . ALA D 4 390 ? -24.718 5.014   27.248 1.00 80.43  ? 390 ALA D N     1 
ATOM   3740 C  CA    . ALA D 4 390 ? -25.282 4.960   28.588 1.00 77.11  ? 390 ALA D CA    1 
ATOM   3741 C  C     . ALA D 4 390 ? -24.524 3.969   29.470 1.00 74.83  ? 390 ALA D C     1 
ATOM   3742 O  O     . ALA D 4 390 ? -24.142 4.293   30.589 1.00 74.48  ? 390 ALA D O     1 
ATOM   3743 C  CB    . ALA D 4 390 ? -26.760 4.576   28.510 1.00 76.55  ? 390 ALA D CB    1 
ATOM   3744 N  N     . ARG D 4 391 ? -24.311 2.764   28.956 1.00 72.01  ? 391 ARG D N     1 
ATOM   3745 C  CA    . ARG D 4 391 ? -23.606 1.730   29.693 1.00 69.00  ? 391 ARG D CA    1 
ATOM   3746 C  C     . ARG D 4 391 ? -22.249 2.198   30.203 1.00 68.39  ? 391 ARG D C     1 
ATOM   3747 O  O     . ARG D 4 391 ? -21.956 2.106   31.387 1.00 68.27  ? 391 ARG D O     1 
ATOM   3748 C  CB    . ARG D 4 391 ? -23.408 0.499   28.807 1.00 68.28  ? 391 ARG D CB    1 
ATOM   3749 C  CG    . ARG D 4 391 ? -22.499 -0.543  29.436 1.00 67.76  ? 391 ARG D CG    1 
ATOM   3750 C  CD    . ARG D 4 391 ? -21.883 -1.469  28.419 1.00 65.99  ? 391 ARG D CD    1 
ATOM   3751 N  NE    . ARG D 4 391 ? -20.485 -1.722  28.747 1.00 66.28  ? 391 ARG D NE    1 
ATOM   3752 C  CZ    . ARG D 4 391 ? -19.490 -0.880  28.473 1.00 67.32  ? 391 ARG D CZ    1 
ATOM   3753 N  NH1   . ARG D 4 391 ? -19.738 0.274   27.860 1.00 66.40  ? 391 ARG D NH1   1 
ATOM   3754 N  NH2   . ARG D 4 391 ? -18.241 -1.187  28.808 1.00 66.45  ? 391 ARG D NH2   1 
ATOM   3755 N  N     . LYS D 4 392 ? -21.418 2.693   29.297 1.00 68.51  ? 392 LYS D N     1 
ATOM   3756 C  CA    . LYS D 4 392 ? -20.080 3.155   29.642 1.00 68.46  ? 392 LYS D CA    1 
ATOM   3757 C  C     . LYS D 4 392 ? -20.080 4.242   30.727 1.00 67.23  ? 392 LYS D C     1 
ATOM   3758 O  O     . LYS D 4 392 ? -19.145 4.325   31.526 1.00 67.73  ? 392 LYS D O     1 
ATOM   3759 C  CB    . LYS D 4 392 ? -19.386 3.646   28.363 1.00 70.76  ? 392 LYS D CB    1 
ATOM   3760 C  CG    . LYS D 4 392 ? -17.894 3.919   28.469 1.00 72.38  ? 392 LYS D CG    1 
ATOM   3761 C  CD    . LYS D 4 392 ? -17.610 5.374   28.810 1.00 75.01  ? 392 LYS D CD    1 
ATOM   3762 C  CE    . LYS D 4 392 ? -16.200 5.775   28.369 1.00 76.98  ? 392 LYS D CE    1 
ATOM   3763 N  NZ    . LYS D 4 392 ? -16.031 5.681   26.879 1.00 76.46  ? 392 LYS D NZ    1 
ATOM   3764 N  N     . SER D 4 393 ? -21.125 5.069   30.752 1.00 65.54  ? 393 SER D N     1 
ATOM   3765 C  CA    . SER D 4 393 ? -21.254 6.139   31.748 1.00 64.38  ? 393 SER D CA    1 
ATOM   3766 C  C     . SER D 4 393 ? -21.900 5.611   33.035 1.00 62.62  ? 393 SER D C     1 
ATOM   3767 O  O     . SER D 4 393 ? -21.569 6.026   34.146 1.00 61.23  ? 393 SER D O     1 
ATOM   3768 C  CB    . SER D 4 393 ? -22.098 7.285   31.187 1.00 64.65  ? 393 SER D CB    1 
ATOM   3769 O  OG    . SER D 4 393 ? -21.299 8.437   30.952 1.00 65.77  ? 393 SER D OG    1 
ATOM   3770 N  N     . ARG D 4 394 ? -22.835 4.692   32.862 1.00 60.93  ? 394 ARG D N     1 
ATOM   3771 C  CA    . ARG D 4 394 ? -23.520 4.075   33.978 1.00 59.07  ? 394 ARG D CA    1 
ATOM   3772 C  C     . ARG D 4 394 ? -22.473 3.232   34.676 1.00 56.70  ? 394 ARG D C     1 
ATOM   3773 O  O     . ARG D 4 394 ? -22.528 3.028   35.883 1.00 57.49  ? 394 ARG D O     1 
ATOM   3774 C  CB    . ARG D 4 394 ? -24.654 3.197   33.464 1.00 59.11  ? 394 ARG D CB    1 
ATOM   3775 C  CG    . ARG D 4 394 ? -25.629 2.776   34.513 1.00 62.46  ? 394 ARG D CG    1 
ATOM   3776 C  CD    . ARG D 4 394 ? -26.761 2.001   33.887 1.00 65.64  ? 394 ARG D CD    1 
ATOM   3777 N  NE    . ARG D 4 394 ? -27.426 2.800   32.869 1.00 70.32  ? 394 ARG D NE    1 
ATOM   3778 C  CZ    . ARG D 4 394 ? -28.462 2.381   32.150 1.00 73.86  ? 394 ARG D CZ    1 
ATOM   3779 N  NH1   . ARG D 4 394 ? -28.952 1.158   32.337 1.00 75.71  ? 394 ARG D NH1   1 
ATOM   3780 N  NH2   . ARG D 4 394 ? -29.017 3.189   31.251 1.00 74.50  ? 394 ARG D NH2   1 
ATOM   3781 N  N     . ARG D 4 395 ? -21.505 2.765   33.895 1.00 54.73  ? 395 ARG D N     1 
ATOM   3782 C  CA    . ARG D 4 395 ? -20.413 1.945   34.399 1.00 52.92  ? 395 ARG D CA    1 
ATOM   3783 C  C     . ARG D 4 395 ? -19.376 2.788   35.150 1.00 52.59  ? 395 ARG D C     1 
ATOM   3784 O  O     . ARG D 4 395 ? -18.808 2.341   36.148 1.00 52.33  ? 395 ARG D O     1 
ATOM   3785 C  CB    . ARG D 4 395 ? -19.734 1.211   33.244 1.00 53.06  ? 395 ARG D CB    1 
ATOM   3786 C  CG    . ARG D 4 395 ? -18.651 0.235   33.677 1.00 52.99  ? 395 ARG D CG    1 
ATOM   3787 C  CD    . ARG D 4 395 ? -19.251 -1.053  34.189 1.00 54.56  ? 395 ARG D CD    1 
ATOM   3788 N  NE    . ARG D 4 395 ? -18.354 -1.735  35.113 1.00 55.09  ? 395 ARG D NE    1 
ATOM   3789 C  CZ    . ARG D 4 395 ? -18.637 -2.894  35.696 1.00 55.73  ? 395 ARG D CZ    1 
ATOM   3790 N  NH1   . ARG D 4 395 ? -19.792 -3.498  35.442 1.00 53.90  ? 395 ARG D NH1   1 
ATOM   3791 N  NH2   . ARG D 4 395 ? -17.770 -3.445  36.534 1.00 56.48  ? 395 ARG D NH2   1 
ATOM   3792 N  N     . ILE D 4 396 ? -19.121 3.999   34.666 1.00 51.00  ? 396 ILE D N     1 
ATOM   3793 C  CA    . ILE D 4 396 ? -18.163 4.885   35.314 1.00 52.13  ? 396 ILE D CA    1 
ATOM   3794 C  C     . ILE D 4 396 ? -18.520 5.132   36.786 1.00 52.50  ? 396 ILE D C     1 
ATOM   3795 O  O     . ILE D 4 396 ? -17.669 5.036   37.681 1.00 51.96  ? 396 ILE D O     1 
ATOM   3796 C  CB    . ILE D 4 396 ? -18.095 6.264   34.591 1.00 53.25  ? 396 ILE D CB    1 
ATOM   3797 C  CG1   . ILE D 4 396 ? -17.228 6.157   33.332 1.00 55.32  ? 396 ILE D CG1   1 
ATOM   3798 C  CG2   . ILE D 4 396 ? -17.523 7.320   35.523 1.00 50.61  ? 396 ILE D CG2   1 
ATOM   3799 C  CD1   . ILE D 4 396 ? -15.790 5.674   33.618 1.00 56.10  ? 396 ILE D CD1   1 
ATOM   3800 N  N     . SER D 4 397 ? -19.782 5.463   37.028 1.00 51.30  ? 397 SER D N     1 
ATOM   3801 C  CA    . SER D 4 397 ? -20.231 5.748   38.375 1.00 51.44  ? 397 SER D CA    1 
ATOM   3802 C  C     . SER D 4 397 ? -20.232 4.511   39.251 1.00 51.20  ? 397 SER D C     1 
ATOM   3803 O  O     . SER D 4 397 ? -19.945 4.588   40.447 1.00 51.23  ? 397 SER D O     1 
ATOM   3804 C  CB    . SER D 4 397 ? -21.624 6.363   38.334 1.00 51.95  ? 397 SER D CB    1 
ATOM   3805 O  OG    . SER D 4 397 ? -22.460 5.629   37.463 1.00 56.97  ? 397 SER D OG    1 
ATOM   3806 N  N     . LEU D 4 398 ? -20.554 3.371   38.651 1.00 49.99  ? 398 LEU D N     1 
ATOM   3807 C  CA    . LEU D 4 398 ? -20.606 2.122   39.384 1.00 48.27  ? 398 LEU D CA    1 
ATOM   3808 C  C     . LEU D 4 398 ? -19.234 1.808   39.913 1.00 48.08  ? 398 LEU D C     1 
ATOM   3809 O  O     . LEU D 4 398 ? -19.097 1.385   41.047 1.00 48.26  ? 398 LEU D O     1 
ATOM   3810 C  CB    . LEU D 4 398 ? -21.113 0.994   38.479 1.00 47.67  ? 398 LEU D CB    1 
ATOM   3811 C  CG    . LEU D 4 398 ? -21.041 -0.478  38.901 1.00 47.93  ? 398 LEU D CG    1 
ATOM   3812 C  CD1   . LEU D 4 398 ? -21.970 -1.279  38.018 1.00 47.57  ? 398 LEU D CD1   1 
ATOM   3813 C  CD2   . LEU D 4 398 ? -19.617 -1.025  38.777 1.00 46.82  ? 398 LEU D CD2   1 
ATOM   3814 N  N     . GLU D 4 399 ? -18.208 2.028   39.101 1.00 50.55  ? 399 GLU D N     1 
ATOM   3815 C  CA    . GLU D 4 399 ? -16.852 1.734   39.551 1.00 52.41  ? 399 GLU D CA    1 
ATOM   3816 C  C     . GLU D 4 399 ? -16.383 2.767   40.558 1.00 51.95  ? 399 GLU D C     1 
ATOM   3817 O  O     . GLU D 4 399 ? -15.582 2.461   41.443 1.00 51.84  ? 399 GLU D O     1 
ATOM   3818 C  CB    . GLU D 4 399 ? -15.886 1.648   38.366 1.00 55.42  ? 399 GLU D CB    1 
ATOM   3819 C  CG    . GLU D 4 399 ? -15.928 0.294   37.648 1.00 62.28  ? 399 GLU D CG    1 
ATOM   3820 C  CD    . GLU D 4 399 ? -14.926 0.182   36.498 1.00 67.90  ? 399 GLU D CD    1 
ATOM   3821 O  OE1   . GLU D 4 399 ? -13.720 0.448   36.728 1.00 70.46  ? 399 GLU D OE1   1 
ATOM   3822 O  OE2   . GLU D 4 399 ? -15.342 -0.180  35.366 1.00 70.22  ? 399 GLU D OE2   1 
ATOM   3823 N  N     . PHE D 4 400 ? -16.898 3.988   40.439 1.00 50.86  ? 400 PHE D N     1 
ATOM   3824 C  CA    . PHE D 4 400 ? -16.532 5.047   41.374 1.00 49.21  ? 400 PHE D CA    1 
ATOM   3825 C  C     . PHE D 4 400 ? -17.184 4.779   42.719 1.00 47.99  ? 400 PHE D C     1 
ATOM   3826 O  O     . PHE D 4 400 ? -16.562 4.919   43.760 1.00 49.07  ? 400 PHE D O     1 
ATOM   3827 C  CB    . PHE D 4 400 ? -16.978 6.420   40.854 1.00 48.46  ? 400 PHE D CB    1 
ATOM   3828 C  CG    . PHE D 4 400 ? -16.942 7.499   41.900 1.00 48.27  ? 400 PHE D CG    1 
ATOM   3829 C  CD1   . PHE D 4 400 ? -18.064 7.775   42.668 1.00 48.10  ? 400 PHE D CD1   1 
ATOM   3830 C  CD2   . PHE D 4 400 ? -15.771 8.210   42.147 1.00 49.19  ? 400 PHE D CD2   1 
ATOM   3831 C  CE1   . PHE D 4 400 ? -18.020 8.739   43.666 1.00 49.89  ? 400 PHE D CE1   1 
ATOM   3832 C  CE2   . PHE D 4 400 ? -15.711 9.178   43.143 1.00 47.76  ? 400 PHE D CE2   1 
ATOM   3833 C  CZ    . PHE D 4 400 ? -16.835 9.444   43.904 1.00 50.12  ? 400 PHE D CZ    1 
ATOM   3834 N  N     . MET D 4 401 ? -18.453 4.403   42.687 1.00 47.77  ? 401 MET D N     1 
ATOM   3835 C  CA    . MET D 4 401 ? -19.193 4.115   43.900 1.00 47.99  ? 401 MET D CA    1 
ATOM   3836 C  C     . MET D 4 401 ? -18.547 2.917   44.585 1.00 48.38  ? 401 MET D C     1 
ATOM   3837 O  O     . MET D 4 401 ? -18.365 2.884   45.802 1.00 47.47  ? 401 MET D O     1 
ATOM   3838 C  CB    . MET D 4 401 ? -20.648 3.809   43.539 1.00 49.12  ? 401 MET D CB    1 
ATOM   3839 C  CG    . MET D 4 401 ? -21.684 4.750   44.151 1.00 51.90  ? 401 MET D CG    1 
ATOM   3840 S  SD    . MET D 4 401 ? -21.288 6.522   44.066 1.00 52.51  ? 401 MET D SD    1 
ATOM   3841 C  CE    . MET D 4 401 ? -21.422 6.826   42.306 1.00 52.37  ? 401 MET D CE    1 
ATOM   3842 N  N     . LEU D 4 402 ? -18.183 1.932   43.776 1.00 49.37  ? 402 LEU D N     1 
ATOM   3843 C  CA    . LEU D 4 402 ? -17.569 0.723   44.283 1.00 48.93  ? 402 LEU D CA    1 
ATOM   3844 C  C     . LEU D 4 402 ? -16.187 0.994   44.856 1.00 49.09  ? 402 LEU D C     1 
ATOM   3845 O  O     . LEU D 4 402 ? -15.792 0.389   45.845 1.00 49.59  ? 402 LEU D O     1 
ATOM   3846 C  CB    . LEU D 4 402 ? -17.492 -0.306  43.166 1.00 47.88  ? 402 LEU D CB    1 
ATOM   3847 C  CG    . LEU D 4 402 ? -17.650 -1.758  43.593 1.00 47.53  ? 402 LEU D CG    1 
ATOM   3848 C  CD1   . LEU D 4 402 ? -18.686 -1.858  44.678 1.00 46.38  ? 402 LEU D CD1   1 
ATOM   3849 C  CD2   . LEU D 4 402 ? -18.055 -2.586  42.392 1.00 47.07  ? 402 LEU D CD2   1 
ATOM   3850 N  N     . GLU D 4 403 ? -15.451 1.911   44.245 1.00 49.84  ? 403 GLU D N     1 
ATOM   3851 C  CA    . GLU D 4 403 ? -14.123 2.232   44.741 1.00 50.94  ? 403 GLU D CA    1 
ATOM   3852 C  C     . GLU D 4 403 ? -14.220 2.978   46.072 1.00 50.72  ? 403 GLU D C     1 
ATOM   3853 O  O     . GLU D 4 403 ? -13.402 2.773   46.975 1.00 51.76  ? 403 GLU D O     1 
ATOM   3854 C  CB    . GLU D 4 403 ? -13.365 3.034   43.692 1.00 52.27  ? 403 GLU D CB    1 
ATOM   3855 C  CG    . GLU D 4 403 ? -12.535 2.163   42.712 1.00 60.12  ? 403 GLU D CG    1 
ATOM   3856 C  CD    . GLU D 4 403 ? -13.130 0.756   42.401 1.00 62.43  ? 403 GLU D CD    1 
ATOM   3857 O  OE1   . GLU D 4 403 ? -13.100 -0.135  43.290 1.00 62.19  ? 403 GLU D OE1   1 
ATOM   3858 O  OE2   . GLU D 4 403 ? -13.612 0.539   41.262 1.00 61.19  ? 403 GLU D OE2   1 
ATOM   3859 N  N     . GLN D 4 404 ? -15.234 3.824   46.200 1.00 48.62  ? 404 GLN D N     1 
ATOM   3860 C  CA    . GLN D 4 404 ? -15.463 4.562   47.434 1.00 46.96  ? 404 GLN D CA    1 
ATOM   3861 C  C     . GLN D 4 404 ? -15.858 3.580   48.534 1.00 45.89  ? 404 GLN D C     1 
ATOM   3862 O  O     . GLN D 4 404 ? -15.387 3.662   49.666 1.00 45.13  ? 404 GLN D O     1 
ATOM   3863 C  CB    . GLN D 4 404 ? -16.576 5.593   47.223 1.00 49.15  ? 404 GLN D CB    1 
ATOM   3864 C  CG    . GLN D 4 404 ? -16.115 6.834   46.475 1.00 48.55  ? 404 GLN D CG    1 
ATOM   3865 C  CD    . GLN D 4 404 ? -15.230 7.695   47.337 1.00 49.29  ? 404 GLN D CD    1 
ATOM   3866 O  OE1   . GLN D 4 404 ? -15.711 8.442   48.183 1.00 52.20  ? 404 GLN D OE1   1 
ATOM   3867 N  NE2   . GLN D 4 404 ? -13.927 7.577   47.151 1.00 51.45  ? 404 GLN D NE2   1 
ATOM   3868 N  N     . ALA D 4 405 ? -16.731 2.642   48.197 1.00 44.60  ? 405 ALA D N     1 
ATOM   3869 C  CA    . ALA D 4 405 ? -17.154 1.655   49.166 1.00 43.54  ? 405 ALA D CA    1 
ATOM   3870 C  C     . ALA D 4 405 ? -15.958 0.883   49.702 1.00 43.82  ? 405 ALA D C     1 
ATOM   3871 O  O     . ALA D 4 405 ? -15.817 0.722   50.910 1.00 46.16  ? 405 ALA D O     1 
ATOM   3872 C  CB    . ALA D 4 405 ? -18.161 0.693   48.541 1.00 44.00  ? 405 ALA D CB    1 
ATOM   3873 N  N     . ASN D 4 406 ? -15.086 0.399   48.821 1.00 43.88  ? 406 ASN D N     1 
ATOM   3874 C  CA    . ASN D 4 406 ? -13.926 -0.364  49.295 1.00 41.73  ? 406 ASN D CA    1 
ATOM   3875 C  C     . ASN D 4 406 ? -12.946 0.528   50.002 1.00 40.47  ? 406 ASN D C     1 
ATOM   3876 O  O     . ASN D 4 406 ? -12.233 0.096   50.894 1.00 42.43  ? 406 ASN D O     1 
ATOM   3877 C  CB    . ASN D 4 406 ? -13.213 -1.064  48.152 1.00 39.68  ? 406 ASN D CB    1 
ATOM   3878 C  CG    . ASN D 4 406 ? -13.925 -2.303  47.709 1.00 39.33  ? 406 ASN D CG    1 
ATOM   3879 O  OD1   . ASN D 4 406 ? -14.066 -3.265  48.478 1.00 40.91  ? 406 ASN D OD1   1 
ATOM   3880 N  ND2   . ASN D 4 406 ? -14.386 -2.300  46.464 1.00 36.29  ? 406 ASN D ND2   1 
ATOM   3881 N  N     . LYS D 4 407 ? -12.899 1.782   49.596 1.00 38.25  ? 407 LYS D N     1 
ATOM   3882 C  CA    . LYS D 4 407 ? -11.997 2.704   50.241 1.00 37.46  ? 407 LYS D CA    1 
ATOM   3883 C  C     . LYS D 4 407 ? -12.435 2.932   51.674 1.00 39.14  ? 407 LYS D C     1 
ATOM   3884 O  O     . LYS D 4 407 ? -11.603 3.118   52.562 1.00 41.82  ? 407 LYS D O     1 
ATOM   3885 C  CB    . LYS D 4 407 ? -11.987 4.018   49.485 1.00 37.02  ? 407 LYS D CB    1 
ATOM   3886 C  CG    . LYS D 4 407 ? -11.227 5.115   50.159 1.00 38.60  ? 407 LYS D CG    1 
ATOM   3887 C  CD    . LYS D 4 407 ? -11.133 6.295   49.209 1.00 41.61  ? 407 LYS D CD    1 
ATOM   3888 C  CE    . LYS D 4 407 ? -10.171 7.352   49.714 1.00 40.90  ? 407 LYS D CE    1 
ATOM   3889 N  NZ    . LYS D 4 407 ? -10.046 8.379   48.666 1.00 43.71  ? 407 LYS D NZ    1 
ATOM   3890 N  N     . PHE D 4 408 ? -13.744 2.892   51.913 1.00 39.34  ? 408 PHE D N     1 
ATOM   3891 C  CA    . PHE D 4 408 ? -14.245 3.141   53.251 1.00 38.55  ? 408 PHE D CA    1 
ATOM   3892 C  C     . PHE D 4 408 ? -14.721 1.959   54.054 1.00 38.90  ? 408 PHE D C     1 
ATOM   3893 O  O     . PHE D 4 408 ? -15.258 2.123   55.146 1.00 39.22  ? 408 PHE D O     1 
ATOM   3894 C  CB    . PHE D 4 408 ? -15.300 4.228   53.197 1.00 38.18  ? 408 PHE D CB    1 
ATOM   3895 C  CG    . PHE D 4 408 ? -14.733 5.562   52.850 1.00 36.51  ? 408 PHE D CG    1 
ATOM   3896 C  CD1   . PHE D 4 408 ? -13.879 6.205   53.723 1.00 37.03  ? 408 PHE D CD1   1 
ATOM   3897 C  CD2   . PHE D 4 408 ? -15.001 6.152   51.631 1.00 37.90  ? 408 PHE D CD2   1 
ATOM   3898 C  CE1   . PHE D 4 408 ? -13.298 7.420   53.383 1.00 37.86  ? 408 PHE D CE1   1 
ATOM   3899 C  CE2   . PHE D 4 408 ? -14.417 7.367   51.284 1.00 37.39  ? 408 PHE D CE2   1 
ATOM   3900 C  CZ    . PHE D 4 408 ? -13.569 7.996   52.162 1.00 36.02  ? 408 PHE D CZ    1 
ATOM   3901 N  N     . ALA D 4 409 ? -14.517 0.760   53.520 1.00 39.90  ? 409 ALA D N     1 
ATOM   3902 C  CA    . ALA D 4 409 ? -14.852 -0.451  54.261 1.00 41.23  ? 409 ALA D CA    1 
ATOM   3903 C  C     . ALA D 4 409 ? -13.849 -0.426  55.415 1.00 42.72  ? 409 ALA D C     1 
ATOM   3904 O  O     . ALA D 4 409 ? -12.875 0.330   55.386 1.00 48.15  ? 409 ALA D O     1 
ATOM   3905 C  CB    . ALA D 4 409 ? -14.620 -1.658  53.399 1.00 38.87  ? 409 ALA D CB    1 
ATOM   3906 N  N     . ASN D 4 410 ? -14.059 -1.218  56.441 1.00 42.66  ? 410 ASN D N     1 
ATOM   3907 C  CA    . ASN D 4 410 ? -13.099 -1.210  57.545 1.00 44.46  ? 410 ASN D CA    1 
ATOM   3908 C  C     . ASN D 4 410 ? -13.191 -0.022  58.489 1.00 44.45  ? 410 ASN D C     1 
ATOM   3909 O  O     . ASN D 4 410 ? -12.866 -0.165  59.680 1.00 46.14  ? 410 ASN D O     1 
ATOM   3910 C  CB    . ASN D 4 410 ? -11.661 -1.323  57.026 1.00 46.11  ? 410 ASN D CB    1 
ATOM   3911 C  CG    . ASN D 4 410 ? -11.410 -2.634  56.310 1.00 50.18  ? 410 ASN D CG    1 
ATOM   3912 O  OD1   . ASN D 4 410 ? -11.902 -3.684  56.731 1.00 51.86  ? 410 ASN D OD1   1 
ATOM   3913 N  ND2   . ASN D 4 410 ? -10.639 -2.585  55.229 1.00 50.87  ? 410 ASN D ND2   1 
ATOM   3914 N  N     . HIS D 4 411 ? -13.592 1.151   57.998 1.00 41.83  ? 411 HIS D N     1 
ATOM   3915 C  CA    . HIS D 4 411 ? -13.733 2.271   58.924 1.00 40.49  ? 411 HIS D CA    1 
ATOM   3916 C  C     . HIS D 4 411 ? -14.899 1.931   59.850 1.00 39.78  ? 411 HIS D C     1 
ATOM   3917 O  O     . HIS D 4 411 ? -15.919 1.410   59.403 1.00 37.17  ? 411 HIS D O     1 
ATOM   3918 C  CB    . HIS D 4 411 ? -14.062 3.573   58.208 1.00 42.24  ? 411 HIS D CB    1 
ATOM   3919 C  CG    . HIS D 4 411 ? -12.875 4.279   57.641 1.00 42.67  ? 411 HIS D CG    1 
ATOM   3920 N  ND1   . HIS D 4 411 ? -12.352 3.979   56.404 1.00 44.69  ? 411 HIS D ND1   1 
ATOM   3921 C  CD2   . HIS D 4 411 ? -12.140 5.307   58.122 1.00 43.45  ? 411 HIS D CD2   1 
ATOM   3922 C  CE1   . HIS D 4 411 ? -11.349 4.797   56.144 1.00 44.58  ? 411 HIS D CE1   1 
ATOM   3923 N  NE2   . HIS D 4 411 ? -11.200 5.613   57.170 1.00 43.94  ? 411 HIS D NE2   1 
ATOM   3924 N  N     . LYS D 4 412 ? -14.746 2.216   61.139 1.00 41.20  ? 412 LYS D N     1 
ATOM   3925 C  CA    . LYS D 4 412 ? -15.801 1.941   62.103 1.00 41.76  ? 412 LYS D CA    1 
ATOM   3926 C  C     . LYS D 4 412 ? -17.100 2.632   61.702 1.00 40.59  ? 412 LYS D C     1 
ATOM   3927 O  O     . LYS D 4 412 ? -18.193 2.146   61.996 1.00 40.31  ? 412 LYS D O     1 
ATOM   3928 C  CB    . LYS D 4 412 ? -15.387 2.393   63.505 1.00 43.58  ? 412 LYS D CB    1 
ATOM   3929 C  CG    . LYS D 4 412 ? -14.353 1.504   64.166 1.00 48.51  ? 412 LYS D CG    1 
ATOM   3930 C  CD    . LYS D 4 412 ? -14.746 0.022   64.081 1.00 54.61  ? 412 LYS D CD    1 
ATOM   3931 C  CE    . LYS D 4 412 ? -13.968 -0.840  65.080 1.00 55.95  ? 412 LYS D CE    1 
ATOM   3932 N  NZ    . LYS D 4 412 ? -12.498 -0.651  64.933 1.00 56.93  ? 412 LYS D NZ    1 
ATOM   3933 N  N     . ALA D 4 413 ? -16.975 3.757   61.013 1.00 39.71  ? 413 ALA D N     1 
ATOM   3934 C  CA    . ALA D 4 413 ? -18.146 4.497   60.576 1.00 40.37  ? 413 ALA D CA    1 
ATOM   3935 C  C     . ALA D 4 413 ? -17.742 5.631   59.653 1.00 41.01  ? 413 ALA D C     1 
ATOM   3936 O  O     . ALA D 4 413 ? -16.581 6.046   59.641 1.00 42.32  ? 413 ALA D O     1 
ATOM   3937 C  CB    . ALA D 4 413 ? -18.882 5.066   61.789 1.00 39.66  ? 413 ALA D CB    1 
ATOM   3938 N  N     . ILE D 4 414 ? -18.705 6.130   58.881 1.00 39.67  ? 414 ILE D N     1 
ATOM   3939 C  CA    . ILE D 4 414 ? -18.465 7.255   57.985 1.00 36.42  ? 414 ILE D CA    1 
ATOM   3940 C  C     . ILE D 4 414 ? -19.710 8.139   58.036 1.00 35.39  ? 414 ILE D C     1 
ATOM   3941 O  O     . ILE D 4 414 ? -20.774 7.663   58.405 1.00 33.30  ? 414 ILE D O     1 
ATOM   3942 C  CB    . ILE D 4 414 ? -18.196 6.781   56.567 1.00 35.74  ? 414 ILE D CB    1 
ATOM   3943 C  CG1   . ILE D 4 414 ? -19.398 6.008   56.043 1.00 34.93  ? 414 ILE D CG1   1 
ATOM   3944 C  CG2   . ILE D 4 414 ? -16.933 5.914   56.553 1.00 34.33  ? 414 ILE D CG2   1 
ATOM   3945 C  CD1   . ILE D 4 414 ? -19.223 5.556   54.598 1.00 37.18  ? 414 ILE D CD1   1 
ATOM   3946 N  N     . TRP D 4 415 ? -19.558 9.423   57.704 1.00 33.24  ? 415 TRP D N     1 
ATOM   3947 C  CA    . TRP D 4 415 ? -20.654 10.377  57.748 1.00 31.01  ? 415 TRP D CA    1 
ATOM   3948 C  C     . TRP D 4 415 ? -20.695 11.148  56.462 1.00 32.77  ? 415 TRP D C     1 
ATOM   3949 O  O     . TRP D 4 415 ? -19.720 11.183  55.721 1.00 36.42  ? 415 TRP D O     1 
ATOM   3950 C  CB    . TRP D 4 415 ? -20.482 11.369  58.895 1.00 30.53  ? 415 TRP D CB    1 
ATOM   3951 C  CG    . TRP D 4 415 ? -20.615 10.766  60.264 1.00 31.86  ? 415 TRP D CG    1 
ATOM   3952 C  CD1   . TRP D 4 415 ? -21.715 10.805  61.098 1.00 30.21  ? 415 TRP D CD1   1 
ATOM   3953 C  CD2   . TRP D 4 415 ? -19.606 10.040  60.966 1.00 30.33  ? 415 TRP D CD2   1 
ATOM   3954 N  NE1   . TRP D 4 415 ? -21.439 10.144  62.271 1.00 29.53  ? 415 TRP D NE1   1 
ATOM   3955 C  CE2   . TRP D 4 415 ? -20.153 9.666   62.218 1.00 30.54  ? 415 TRP D CE2   1 
ATOM   3956 C  CE3   . TRP D 4 415 ? -18.290 9.666   60.662 1.00 27.30  ? 415 TRP D CE3   1 
ATOM   3957 C  CZ2   . TRP D 4 415 ? -19.422 8.936   63.158 1.00 28.45  ? 415 TRP D CZ2   1 
ATOM   3958 C  CZ3   . TRP D 4 415 ? -17.569 8.934   61.602 1.00 27.99  ? 415 TRP D CZ3   1 
ATOM   3959 C  CH2   . TRP D 4 415 ? -18.134 8.579   62.828 1.00 25.69  ? 415 TRP D CH2   1 
ATOM   3960 N  N     . PHE D 4 416 ? -21.829 11.783  56.209 1.00 32.37  ? 416 PHE D N     1 
ATOM   3961 C  CA    . PHE D 4 416 ? -22.026 12.544  54.995 1.00 30.90  ? 416 PHE D CA    1 
ATOM   3962 C  C     . PHE D 4 416 ? -22.476 13.955  55.307 1.00 32.39  ? 416 PHE D C     1 
ATOM   3963 O  O     . PHE D 4 416 ? -23.535 14.162  55.893 1.00 32.63  ? 416 PHE D O     1 
ATOM   3964 C  CB    . PHE D 4 416 ? -23.099 11.871  54.137 1.00 26.97  ? 416 PHE D CB    1 
ATOM   3965 C  CG    . PHE D 4 416 ? -22.763 10.475  53.747 1.00 23.19  ? 416 PHE D CG    1 
ATOM   3966 C  CD1   . PHE D 4 416 ? -22.009 10.222  52.615 1.00 24.82  ? 416 PHE D CD1   1 
ATOM   3967 C  CD2   . PHE D 4 416 ? -23.210 9.410   54.507 1.00 22.45  ? 416 PHE D CD2   1 
ATOM   3968 C  CE1   . PHE D 4 416 ? -21.705 8.931   52.245 1.00 25.17  ? 416 PHE D CE1   1 
ATOM   3969 C  CE2   . PHE D 4 416 ? -22.920 8.119   54.161 1.00 21.82  ? 416 PHE D CE2   1 
ATOM   3970 C  CZ    . PHE D 4 416 ? -22.170 7.865   53.028 1.00 26.42  ? 416 PHE D CZ    1 
ATOM   3971 N  N     . PRO D 4 417 ? -21.671 14.955  54.942 1.00 32.97  ? 417 PRO D N     1 
ATOM   3972 C  CA    . PRO D 4 417 ? -22.173 16.292  55.261 1.00 33.22  ? 417 PRO D CA    1 
ATOM   3973 C  C     . PRO D 4 417 ? -23.452 16.505  54.439 1.00 32.02  ? 417 PRO D C     1 
ATOM   3974 O  O     . PRO D 4 417 ? -23.652 15.843  53.425 1.00 29.93  ? 417 PRO D O     1 
ATOM   3975 C  CB    . PRO D 4 417 ? -21.015 17.195  54.836 1.00 30.85  ? 417 PRO D CB    1 
ATOM   3976 C  CG    . PRO D 4 417 ? -20.431 16.454  53.704 1.00 32.34  ? 417 PRO D CG    1 
ATOM   3977 C  CD    . PRO D 4 417 ? -20.393 15.033  54.222 1.00 31.82  ? 417 PRO D CD    1 
ATOM   3978 N  N     . TYR D 4 418 ? -24.326 17.396  54.890 1.00 32.53  ? 418 TYR D N     1 
ATOM   3979 C  CA    . TYR D 4 418 ? -25.561 17.660  54.155 1.00 33.33  ? 418 TYR D CA    1 
ATOM   3980 C  C     . TYR D 4 418 ? -25.803 19.156  53.954 1.00 35.18  ? 418 TYR D C     1 
ATOM   3981 O  O     . TYR D 4 418 ? -25.317 20.001  54.723 1.00 35.02  ? 418 TYR D O     1 
ATOM   3982 C  CB    . TYR D 4 418 ? -26.788 17.080  54.881 1.00 31.32  ? 418 TYR D CB    1 
ATOM   3983 C  CG    . TYR D 4 418 ? -26.948 15.586  54.791 1.00 33.73  ? 418 TYR D CG    1 
ATOM   3984 C  CD1   . TYR D 4 418 ? -26.430 14.738  55.778 1.00 34.60  ? 418 TYR D CD1   1 
ATOM   3985 C  CD2   . TYR D 4 418 ? -27.577 15.011  53.702 1.00 35.31  ? 418 TYR D CD2   1 
ATOM   3986 C  CE1   . TYR D 4 418 ? -26.530 13.364  55.668 1.00 35.37  ? 418 TYR D CE1   1 
ATOM   3987 C  CE2   . TYR D 4 418 ? -27.687 13.631  53.581 1.00 37.91  ? 418 TYR D CE2   1 
ATOM   3988 C  CZ    . TYR D 4 418 ? -27.159 12.807  54.559 1.00 37.73  ? 418 TYR D CZ    1 
ATOM   3989 O  OH    . TYR D 4 418 ? -27.236 11.431  54.396 1.00 37.41  ? 418 TYR D OH    1 
ATOM   3990 N  N     . ASN D 4 419 ? -26.536 19.472  52.893 1.00 34.71  ? 419 ASN D N     1 
ATOM   3991 C  CA    . ASN D 4 419 ? -26.932 20.843  52.619 1.00 34.60  ? 419 ASN D CA    1 
ATOM   3992 C  C     . ASN D 4 419 ? -28.226 20.778  51.810 1.00 32.87  ? 419 ASN D C     1 
ATOM   3993 O  O     . ASN D 4 419 ? -28.811 19.705  51.681 1.00 30.13  ? 419 ASN D O     1 
ATOM   3994 C  CB    . ASN D 4 419 ? -25.818 21.655  51.941 1.00 33.40  ? 419 ASN D CB    1 
ATOM   3995 C  CG    . ASN D 4 419 ? -25.562 21.259  50.513 1.00 38.65  ? 419 ASN D CG    1 
ATOM   3996 O  OD1   . ASN D 4 419 ? -24.868 21.976  49.792 1.00 40.95  ? 419 ASN D OD1   1 
ATOM   3997 N  ND2   . ASN D 4 419 ? -26.099 20.125  50.091 1.00 38.54  ? 419 ASN D ND2   1 
ATOM   3998 N  N     . MET D 4 420 ? -28.681 21.897  51.275 1.00 31.61  ? 420 MET D N     1 
ATOM   3999 C  CA    . MET D 4 420 ? -29.955 21.889  50.572 1.00 34.40  ? 420 MET D CA    1 
ATOM   4000 C  C     . MET D 4 420 ? -29.948 22.644  49.267 1.00 35.34  ? 420 MET D C     1 
ATOM   4001 O  O     . MET D 4 420 ? -29.117 23.537  49.061 1.00 37.99  ? 420 MET D O     1 
ATOM   4002 C  CB    . MET D 4 420 ? -31.048 22.537  51.441 1.00 34.74  ? 420 MET D CB    1 
ATOM   4003 C  CG    . MET D 4 420 ? -31.249 21.978  52.846 1.00 36.26  ? 420 MET D CG    1 
ATOM   4004 S  SD    . MET D 4 420 ? -32.313 23.079  53.864 1.00 41.12  ? 420 MET D SD    1 
ATOM   4005 C  CE    . MET D 4 420 ? -31.125 24.121  54.721 1.00 41.75  ? 420 MET D CE    1 
ATOM   4006 N  N     . ASP D 4 421 ? -30.876 22.288  48.383 1.00 31.22  ? 421 ASP D N     1 
ATOM   4007 C  CA    . ASP D 4 421 ? -31.002 23.028  47.158 1.00 32.31  ? 421 ASP D CA    1 
ATOM   4008 C  C     . ASP D 4 421 ? -31.886 24.221  47.563 1.00 32.28  ? 421 ASP D C     1 
ATOM   4009 O  O     . ASP D 4 421 ? -32.383 24.266  48.682 1.00 30.92  ? 421 ASP D O     1 
ATOM   4010 C  CB    . ASP D 4 421 ? -31.625 22.171  46.056 1.00 33.40  ? 421 ASP D CB    1 
ATOM   4011 C  CG    . ASP D 4 421 ? -33.041 21.716  46.362 1.00 33.77  ? 421 ASP D CG    1 
ATOM   4012 O  OD1   . ASP D 4 421 ? -33.412 20.694  45.746 1.00 34.48  ? 421 ASP D OD1   1 
ATOM   4013 O  OD2   . ASP D 4 421 ? -33.775 22.350  47.166 1.00 29.84  ? 421 ASP D OD2   1 
ATOM   4014 N  N     . TRP D 4 422 ? -32.105 25.180  46.680 1.00 32.64  ? 422 TRP D N     1 
ATOM   4015 C  CA    . TRP D 4 422 ? -32.873 26.348  47.091 1.00 31.93  ? 422 TRP D CA    1 
ATOM   4016 C  C     . TRP D 4 422 ? -34.334 26.166  47.543 1.00 32.79  ? 422 TRP D C     1 
ATOM   4017 O  O     . TRP D 4 422 ? -34.917 27.088  48.107 1.00 32.28  ? 422 TRP D O     1 
ATOM   4018 C  CB    . TRP D 4 422 ? -32.767 27.437  46.014 1.00 30.44  ? 422 TRP D CB    1 
ATOM   4019 C  CG    . TRP D 4 422 ? -33.393 27.079  44.735 1.00 28.41  ? 422 TRP D CG    1 
ATOM   4020 C  CD1   . TRP D 4 422 ? -32.845 26.345  43.723 1.00 28.01  ? 422 TRP D CD1   1 
ATOM   4021 C  CD2   . TRP D 4 422 ? -34.727 27.395  44.333 1.00 30.56  ? 422 TRP D CD2   1 
ATOM   4022 N  NE1   . TRP D 4 422 ? -33.759 26.180  42.710 1.00 28.53  ? 422 TRP D NE1   1 
ATOM   4023 C  CE2   . TRP D 4 422 ? -34.926 26.812  43.060 1.00 31.24  ? 422 TRP D CE2   1 
ATOM   4024 C  CE3   . TRP D 4 422 ? -35.780 28.112  44.928 1.00 28.94  ? 422 TRP D CE3   1 
ATOM   4025 C  CZ2   . TRP D 4 422 ? -36.139 26.929  42.366 1.00 30.30  ? 422 TRP D CZ2   1 
ATOM   4026 C  CZ3   . TRP D 4 422 ? -36.979 28.227  44.245 1.00 27.59  ? 422 TRP D CZ3   1 
ATOM   4027 C  CH2   . TRP D 4 422 ? -37.150 27.637  42.975 1.00 30.40  ? 422 TRP D CH2   1 
ATOM   4028 N  N     . ARG D 4 423 ? -34.937 25.005  47.306 1.00 34.70  ? 423 ARG D N     1 
ATOM   4029 C  CA    . ARG D 4 423 ? -36.315 24.777  47.775 1.00 35.10  ? 423 ARG D CA    1 
ATOM   4030 C  C     . ARG D 4 423 ? -36.195 24.227  49.187 1.00 35.55  ? 423 ARG D C     1 
ATOM   4031 O  O     . ARG D 4 423 ? -37.171 24.134  49.931 1.00 37.22  ? 423 ARG D O     1 
ATOM   4032 C  CB    . ARG D 4 423 ? -37.052 23.757  46.902 1.00 34.48  ? 423 ARG D CB    1 
ATOM   4033 C  CG    . ARG D 4 423 ? -37.511 24.294  45.578 1.00 34.47  ? 423 ARG D CG    1 
ATOM   4034 C  CD    . ARG D 4 423 ? -36.720 23.753  44.408 1.00 36.08  ? 423 ARG D CD    1 
ATOM   4035 N  NE    . ARG D 4 423 ? -37.175 22.428  43.979 1.00 38.77  ? 423 ARG D NE    1 
ATOM   4036 C  CZ    . ARG D 4 423 ? -36.559 21.305  44.330 1.00 42.16  ? 423 ARG D CZ    1 
ATOM   4037 N  NH1   . ARG D 4 423 ? -35.485 21.378  45.092 1.00 42.05  ? 423 ARG D NH1   1 
ATOM   4038 N  NH2   . ARG D 4 423 ? -37.008 20.119  43.942 1.00 43.11  ? 423 ARG D NH2   1 
ATOM   4039 N  N     . GLY D 4 424 ? -34.972 23.847  49.542 1.00 35.59  ? 424 GLY D N     1 
ATOM   4040 C  CA    . GLY D 4 424 ? -34.709 23.317  50.864 1.00 32.66  ? 424 GLY D CA    1 
ATOM   4041 C  C     . GLY D 4 424 ? -34.641 21.811  50.962 1.00 32.24  ? 424 GLY D C     1 
ATOM   4042 O  O     . GLY D 4 424 ? -34.555 21.293  52.067 1.00 32.84  ? 424 GLY D O     1 
ATOM   4043 N  N     . ARG D 4 425 ? -34.695 21.089  49.846 1.00 31.98  ? 425 ARG D N     1 
ATOM   4044 C  CA    . ARG D 4 425 ? -34.609 19.640  49.951 1.00 32.53  ? 425 ARG D CA    1 
ATOM   4045 C  C     . ARG D 4 425 ? -33.191 19.290  50.407 1.00 33.27  ? 425 ARG D C     1 
ATOM   4046 O  O     . ARG D 4 425 ? -32.254 20.031  50.139 1.00 34.40  ? 425 ARG D O     1 
ATOM   4047 C  CB    . ARG D 4 425 ? -35.016 18.972  48.625 1.00 32.38  ? 425 ARG D CB    1 
ATOM   4048 C  CG    . ARG D 4 425 ? -36.531 19.157  48.391 1.00 33.89  ? 425 ARG D CG    1 
ATOM   4049 C  CD    . ARG D 4 425 ? -37.311 17.903  48.063 1.00 32.08  ? 425 ARG D CD    1 
ATOM   4050 N  NE    . ARG D 4 425 ? -37.110 17.533  46.671 1.00 38.72  ? 425 ARG D NE    1 
ATOM   4051 C  CZ    . ARG D 4 425 ? -37.871 16.683  45.992 1.00 38.33  ? 425 ARG D CZ    1 
ATOM   4052 N  NH1   . ARG D 4 425 ? -38.905 16.096  46.567 1.00 39.18  ? 425 ARG D NH1   1 
ATOM   4053 N  NH2   . ARG D 4 425 ? -37.593 16.430  44.724 1.00 41.79  ? 425 ARG D NH2   1 
ATOM   4054 N  N     . VAL D 4 426 ? -33.042 18.183  51.128 1.00 32.41  ? 426 VAL D N     1 
ATOM   4055 C  CA    . VAL D 4 426 ? -31.756 17.797  51.677 1.00 31.93  ? 426 VAL D CA    1 
ATOM   4056 C  C     . VAL D 4 426 ? -30.960 16.837  50.837 1.00 31.37  ? 426 VAL D C     1 
ATOM   4057 O  O     . VAL D 4 426 ? -31.464 15.820  50.406 1.00 34.67  ? 426 VAL D O     1 
ATOM   4058 C  CB    . VAL D 4 426 ? -31.964 17.225  53.086 1.00 34.09  ? 426 VAL D CB    1 
ATOM   4059 C  CG1   . VAL D 4 426 ? -30.650 16.723  53.667 1.00 38.62  ? 426 VAL D CG1   1 
ATOM   4060 C  CG2   . VAL D 4 426 ? -32.537 18.315  53.984 1.00 33.62  ? 426 VAL D CG2   1 
ATOM   4061 N  N     . TYR D 4 427 ? -29.702 17.170  50.585 1.00 34.25  ? 427 TYR D N     1 
ATOM   4062 C  CA    . TYR D 4 427 ? -28.839 16.306  49.768 1.00 34.85  ? 427 TYR D CA    1 
ATOM   4063 C  C     . TYR D 4 427 ? -27.507 16.114  50.438 1.00 35.77  ? 427 TYR D C     1 
ATOM   4064 O  O     . TYR D 4 427 ? -26.964 17.035  51.063 1.00 34.29  ? 427 TYR D O     1 
ATOM   4065 C  CB    . TYR D 4 427 ? -28.537 16.903  48.383 1.00 33.44  ? 427 TYR D CB    1 
ATOM   4066 C  CG    . TYR D 4 427 ? -29.719 17.268  47.521 1.00 32.08  ? 427 TYR D CG    1 
ATOM   4067 C  CD1   . TYR D 4 427 ? -30.516 18.371  47.828 1.00 33.21  ? 427 TYR D CD1   1 
ATOM   4068 C  CD2   . TYR D 4 427 ? -30.013 16.537  46.374 1.00 29.83  ? 427 TYR D CD2   1 
ATOM   4069 C  CE1   . TYR D 4 427 ? -31.580 18.742  47.010 1.00 33.49  ? 427 TYR D CE1   1 
ATOM   4070 C  CE2   . TYR D 4 427 ? -31.068 16.892  45.543 1.00 32.31  ? 427 TYR D CE2   1 
ATOM   4071 C  CZ    . TYR D 4 427 ? -31.849 18.001  45.865 1.00 34.85  ? 427 TYR D CZ    1 
ATOM   4072 O  OH    . TYR D 4 427 ? -32.875 18.382  45.033 1.00 34.48  ? 427 TYR D OH    1 
ATOM   4073 N  N     . ALA D 4 428 ? -26.977 14.907  50.295 1.00 37.71  ? 428 ALA D N     1 
ATOM   4074 C  CA    . ALA D 4 428 ? -25.678 14.599  50.849 1.00 38.02  ? 428 ALA D CA    1 
ATOM   4075 C  C     . ALA D 4 428 ? -24.767 15.321  49.896 1.00 39.09  ? 428 ALA D C     1 
ATOM   4076 O  O     . ALA D 4 428 ? -25.084 15.449  48.719 1.00 38.94  ? 428 ALA D O     1 
ATOM   4077 C  CB    . ALA D 4 428 ? -25.421 13.125  50.798 1.00 38.90  ? 428 ALA D CB    1 
ATOM   4078 N  N     . VAL D 4 429 ? -23.646 15.802  50.406 1.00 41.23  ? 429 VAL D N     1 
ATOM   4079 C  CA    . VAL D 4 429 ? -22.702 16.529  49.590 1.00 43.26  ? 429 VAL D CA    1 
ATOM   4080 C  C     . VAL D 4 429 ? -21.763 15.639  48.792 1.00 44.16  ? 429 VAL D C     1 
ATOM   4081 O  O     . VAL D 4 429 ? -21.450 15.956  47.645 1.00 48.70  ? 429 VAL D O     1 
ATOM   4082 C  CB    . VAL D 4 429 ? -21.854 17.476  50.456 1.00 45.37  ? 429 VAL D CB    1 
ATOM   4083 C  CG1   . VAL D 4 429 ? -20.761 18.124  49.613 1.00 46.37  ? 429 VAL D CG1   1 
ATOM   4084 C  CG2   . VAL D 4 429 ? -22.737 18.540  51.062 1.00 45.86  ? 429 VAL D CG2   1 
ATOM   4085 N  N     . SER D 4 430 ? -21.312 14.534  49.374 1.00 42.09  ? 430 SER D N     1 
ATOM   4086 C  CA    . SER D 4 430 ? -20.372 13.672  48.672 1.00 41.60  ? 430 SER D CA    1 
ATOM   4087 C  C     . SER D 4 430 ? -21.007 12.803  47.607 1.00 42.61  ? 430 SER D C     1 
ATOM   4088 O  O     . SER D 4 430 ? -22.096 12.281  47.788 1.00 44.28  ? 430 SER D O     1 
ATOM   4089 C  CB    . SER D 4 430 ? -19.607 12.793  49.659 1.00 40.16  ? 430 SER D CB    1 
ATOM   4090 O  OG    . SER D 4 430 ? -20.474 11.976  50.404 1.00 36.37  ? 430 SER D OG    1 
ATOM   4091 N  N     . MET D 4 431 ? -20.299 12.655  46.493 1.00 43.25  ? 431 MET D N     1 
ATOM   4092 C  CA    . MET D 4 431 ? -20.750 11.860  45.357 1.00 43.30  ? 431 MET D CA    1 
ATOM   4093 C  C     . MET D 4 431 ? -21.291 10.496  45.789 1.00 41.34  ? 431 MET D C     1 
ATOM   4094 O  O     . MET D 4 431 ? -22.299 10.023  45.274 1.00 43.63  ? 431 MET D O     1 
ATOM   4095 C  CB    . MET D 4 431 ? -19.588 11.707  44.371 1.00 45.44  ? 431 MET D CB    1 
ATOM   4096 C  CG    . MET D 4 431 ? -18.921 13.054  44.034 1.00 49.23  ? 431 MET D CG    1 
ATOM   4097 S  SD    . MET D 4 431 ? -17.366 12.984  43.076 1.00 55.24  ? 431 MET D SD    1 
ATOM   4098 C  CE    . MET D 4 431 ? -17.972 12.407  41.469 1.00 50.81  ? 431 MET D CE    1 
ATOM   4099 N  N     . PHE D 4 432 ? -20.627 9.873   46.747 1.00 39.40  ? 432 PHE D N     1 
ATOM   4100 C  CA    . PHE D 4 432 ? -21.046 8.571   47.275 1.00 37.14  ? 432 PHE D CA    1 
ATOM   4101 C  C     . PHE D 4 432 ? -21.910 8.905   48.500 1.00 36.85  ? 432 PHE D C     1 
ATOM   4102 O  O     . PHE D 4 432 ? -21.483 9.664   49.384 1.00 34.53  ? 432 PHE D O     1 
ATOM   4103 C  CB    . PHE D 4 432 ? -19.794 7.760   47.671 1.00 33.56  ? 432 PHE D CB    1 
ATOM   4104 C  CG    . PHE D 4 432 ? -20.080 6.418   48.258 1.00 31.09  ? 432 PHE D CG    1 
ATOM   4105 C  CD1   . PHE D 4 432 ? -20.711 5.433   47.512 1.00 30.54  ? 432 PHE D CD1   1 
ATOM   4106 C  CD2   . PHE D 4 432 ? -19.682 6.118   49.557 1.00 30.49  ? 432 PHE D CD2   1 
ATOM   4107 C  CE1   . PHE D 4 432 ? -20.936 4.160   48.055 1.00 26.88  ? 432 PHE D CE1   1 
ATOM   4108 C  CE2   . PHE D 4 432 ? -19.904 4.845   50.107 1.00 28.17  ? 432 PHE D CE2   1 
ATOM   4109 C  CZ    . PHE D 4 432 ? -20.532 3.868   49.349 1.00 26.17  ? 432 PHE D CZ    1 
ATOM   4110 N  N     . ASN D 4 433 ? -23.132 8.379   48.549 1.00 35.56  ? 433 ASN D N     1 
ATOM   4111 C  CA    . ASN D 4 433 ? -23.988 8.684   49.696 1.00 34.72  ? 433 ASN D CA    1 
ATOM   4112 C  C     . ASN D 4 433 ? -25.206 7.811   49.813 1.00 33.42  ? 433 ASN D C     1 
ATOM   4113 O  O     . ASN D 4 433 ? -25.578 7.112   48.873 1.00 33.87  ? 433 ASN D O     1 
ATOM   4114 C  CB    . ASN D 4 433 ? -24.437 10.137  49.664 1.00 34.02  ? 433 ASN D CB    1 
ATOM   4115 C  CG    . ASN D 4 433 ? -25.173 10.473  48.412 1.00 34.07  ? 433 ASN D CG    1 
ATOM   4116 O  OD1   . ASN D 4 433 ? -24.683 11.237  47.586 1.00 36.33  ? 433 ASN D OD1   1 
ATOM   4117 N  ND2   . ASN D 4 433 ? -26.352 9.895   48.246 1.00 32.03  ? 433 ASN D ND2   1 
ATOM   4118 N  N     . PRO D 4 434 ? -25.861 7.855   50.979 1.00 32.40  ? 434 PRO D N     1 
ATOM   4119 C  CA    . PRO D 4 434 ? -27.058 7.043   51.224 1.00 32.45  ? 434 PRO D CA    1 
ATOM   4120 C  C     . PRO D 4 434 ? -28.235 7.321   50.290 1.00 32.17  ? 434 PRO D C     1 
ATOM   4121 O  O     . PRO D 4 434 ? -29.249 6.683   50.399 1.00 36.23  ? 434 PRO D O     1 
ATOM   4122 C  CB    . PRO D 4 434 ? -27.397 7.360   52.684 1.00 30.50  ? 434 PRO D CB    1 
ATOM   4123 C  CG    . PRO D 4 434 ? -26.071 7.781   53.272 1.00 30.19  ? 434 PRO D CG    1 
ATOM   4124 C  CD    . PRO D 4 434 ? -25.485 8.615   52.182 1.00 29.44  ? 434 PRO D CD    1 
ATOM   4125 N  N     . GLN D 4 435 ? -28.095 8.248   49.365 1.00 31.50  ? 435 GLN D N     1 
ATOM   4126 C  CA    . GLN D 4 435 ? -29.190 8.580   48.478 1.00 33.84  ? 435 GLN D CA    1 
ATOM   4127 C  C     . GLN D 4 435 ? -28.961 8.059   47.067 1.00 35.33  ? 435 GLN D C     1 
ATOM   4128 O  O     . GLN D 4 435 ? -29.718 8.377   46.153 1.00 37.14  ? 435 GLN D O     1 
ATOM   4129 C  CB    . GLN D 4 435 ? -29.367 10.112  48.432 1.00 34.61  ? 435 GLN D CB    1 
ATOM   4130 C  CG    . GLN D 4 435 ? -29.460 10.780  49.808 1.00 38.33  ? 435 GLN D CG    1 
ATOM   4131 C  CD    . GLN D 4 435 ? -29.551 12.308  49.739 1.00 44.35  ? 435 GLN D CD    1 
ATOM   4132 O  OE1   . GLN D 4 435 ? -28.705 12.975  49.116 1.00 46.89  ? 435 GLN D OE1   1 
ATOM   4133 N  NE2   . GLN D 4 435 ? -30.571 12.872  50.391 1.00 43.14  ? 435 GLN D NE2   1 
ATOM   4134 N  N     . GLY D 4 436 ? -27.920 7.257   46.887 1.00 35.85  ? 436 GLY D N     1 
ATOM   4135 C  CA    . GLY D 4 436 ? -27.608 6.740   45.568 1.00 35.39  ? 436 GLY D CA    1 
ATOM   4136 C  C     . GLY D 4 436 ? -28.519 5.636   45.088 1.00 37.28  ? 436 GLY D C     1 
ATOM   4137 O  O     . GLY D 4 436 ? -29.583 5.418   45.652 1.00 39.78  ? 436 GLY D O     1 
ATOM   4138 N  N     . ASN D 4 437 ? -28.099 4.933   44.043 1.00 37.38  ? 437 ASN D N     1 
ATOM   4139 C  CA    . ASN D 4 437 ? -28.894 3.854   43.488 1.00 36.94  ? 437 ASN D CA    1 
ATOM   4140 C  C     . ASN D 4 437 ? -28.948 2.631   44.393 1.00 39.28  ? 437 ASN D C     1 
ATOM   4141 O  O     . ASN D 4 437 ? -28.468 2.658   45.524 1.00 38.55  ? 437 ASN D O     1 
ATOM   4142 C  CB    . ASN D 4 437 ? -28.356 3.447   42.122 1.00 36.07  ? 437 ASN D CB    1 
ATOM   4143 C  CG    . ASN D 4 437 ? -26.888 3.093   42.154 1.00 38.59  ? 437 ASN D CG    1 
ATOM   4144 O  OD1   . ASN D 4 437 ? -26.338 2.709   43.192 1.00 41.22  ? 437 ASN D OD1   1 
ATOM   4145 N  ND2   . ASN D 4 437 ? -26.242 3.204   41.007 1.00 39.01  ? 437 ASN D ND2   1 
ATOM   4146 N  N     . ASP D 4 438 ? -29.524 1.548   43.869 1.00 42.07  ? 438 ASP D N     1 
ATOM   4147 C  CA    . ASP D 4 438 ? -29.676 0.316   44.624 1.00 41.91  ? 438 ASP D CA    1 
ATOM   4148 C  C     . ASP D 4 438 ? -28.355 -0.233  45.111 1.00 41.07  ? 438 ASP D C     1 
ATOM   4149 O  O     . ASP D 4 438 ? -28.216 -0.576  46.293 1.00 39.82  ? 438 ASP D O     1 
ATOM   4150 C  CB    . ASP D 4 438 ? -30.383 -0.748  43.791 1.00 43.71  ? 438 ASP D CB    1 
ATOM   4151 C  CG    . ASP D 4 438 ? -30.541 -2.061  44.548 1.00 49.78  ? 438 ASP D CG    1 
ATOM   4152 O  OD1   . ASP D 4 438 ? -31.133 -2.033  45.647 1.00 51.21  ? 438 ASP D OD1   1 
ATOM   4153 O  OD2   . ASP D 4 438 ? -30.073 -3.121  44.059 1.00 53.29  ? 438 ASP D OD2   1 
ATOM   4154 N  N     . MET D 4 439 ? -27.379 -0.316  44.216 1.00 39.32  ? 439 MET D N     1 
ATOM   4155 C  CA    . MET D 4 439 ? -26.097 -0.856  44.627 1.00 41.00  ? 439 MET D CA    1 
ATOM   4156 C  C     . MET D 4 439 ? -25.453 0.023   45.690 1.00 40.59  ? 439 MET D C     1 
ATOM   4157 O  O     . MET D 4 439 ? -24.874 -0.470  46.653 1.00 40.63  ? 439 MET D O     1 
ATOM   4158 C  CB    . MET D 4 439 ? -25.156 -0.993  43.445 1.00 43.13  ? 439 MET D CB    1 
ATOM   4159 C  CG    . MET D 4 439 ? -23.938 -1.793  43.802 1.00 44.94  ? 439 MET D CG    1 
ATOM   4160 S  SD    . MET D 4 439 ? -22.599 -1.516  42.681 1.00 50.03  ? 439 MET D SD    1 
ATOM   4161 C  CE    . MET D 4 439 ? -21.840 -0.043  43.408 1.00 44.43  ? 439 MET D CE    1 
ATOM   4162 N  N     . THR D 4 440 ? -25.565 1.330   45.522 1.00 39.27  ? 440 THR D N     1 
ATOM   4163 C  CA    . THR D 4 440 ? -25.000 2.227   46.503 1.00 38.75  ? 440 THR D CA    1 
ATOM   4164 C  C     . THR D 4 440 ? -25.670 2.022   47.842 1.00 38.06  ? 440 THR D C     1 
ATOM   4165 O  O     . THR D 4 440 ? -24.992 1.857   48.866 1.00 37.83  ? 440 THR D O     1 
ATOM   4166 C  CB    . THR D 4 440 ? -25.213 3.674   46.139 1.00 39.26  ? 440 THR D CB    1 
ATOM   4167 O  OG1   . THR D 4 440 ? -24.696 3.928   44.823 1.00 44.82  ? 440 THR D OG1   1 
ATOM   4168 C  CG2   . THR D 4 440 ? -24.526 4.550   47.158 1.00 37.52  ? 440 THR D CG2   1 
ATOM   4169 N  N     . LYS D 4 441 ? -27.005 2.054   47.826 1.00 35.94  ? 441 LYS D N     1 
ATOM   4170 C  CA    . LYS D 4 441 ? -27.788 1.894   49.039 1.00 33.55  ? 441 LYS D CA    1 
ATOM   4171 C  C     . LYS D 4 441 ? -27.474 0.574   49.709 1.00 35.21  ? 441 LYS D C     1 
ATOM   4172 O  O     . LYS D 4 441 ? -27.488 0.490   50.932 1.00 36.16  ? 441 LYS D O     1 
ATOM   4173 C  CB    . LYS D 4 441 ? -29.287 1.954   48.755 1.00 32.62  ? 441 LYS D CB    1 
ATOM   4174 C  CG    . LYS D 4 441 ? -29.872 3.321   48.418 1.00 31.58  ? 441 LYS D CG    1 
ATOM   4175 C  CD    . LYS D 4 441 ? -31.380 3.222   48.674 1.00 36.86  ? 441 LYS D CD    1 
ATOM   4176 C  CE    . LYS D 4 441 ? -32.245 4.038   47.724 1.00 37.52  ? 441 LYS D CE    1 
ATOM   4177 N  NZ    . LYS D 4 441 ? -32.353 3.392   46.374 1.00 40.15  ? 441 LYS D NZ    1 
ATOM   4178 N  N     . GLY D 4 442 ? -27.194 -0.455  48.910 1.00 34.96  ? 442 GLY D N     1 
ATOM   4179 C  CA    . GLY D 4 442 ? -26.883 -1.755  49.470 1.00 33.76  ? 442 GLY D CA    1 
ATOM   4180 C  C     . GLY D 4 442 ? -25.483 -1.841  50.052 1.00 33.89  ? 442 GLY D C     1 
ATOM   4181 O  O     . GLY D 4 442 ? -25.198 -2.691  50.887 1.00 33.21  ? 442 GLY D O     1 
ATOM   4182 N  N     . LEU D 4 443 ? -24.591 -0.978  49.592 1.00 33.71  ? 443 LEU D N     1 
ATOM   4183 C  CA    . LEU D 4 443 ? -23.229 -0.969  50.108 1.00 34.20  ? 443 LEU D CA    1 
ATOM   4184 C  C     . LEU D 4 443 ? -23.203 -0.230  51.449 1.00 35.39  ? 443 LEU D C     1 
ATOM   4185 O  O     . LEU D 4 443 ? -22.293 -0.413  52.273 1.00 35.99  ? 443 LEU D O     1 
ATOM   4186 C  CB    . LEU D 4 443 ? -22.296 -0.258  49.127 1.00 32.30  ? 443 LEU D CB    1 
ATOM   4187 C  CG    . LEU D 4 443 ? -21.503 -1.090  48.125 1.00 33.20  ? 443 LEU D CG    1 
ATOM   4188 C  CD1   . LEU D 4 443 ? -21.761 -2.567  48.337 1.00 33.53  ? 443 LEU D CD1   1 
ATOM   4189 C  CD2   . LEU D 4 443 ? -21.859 -0.660  46.712 1.00 30.49  ? 443 LEU D CD2   1 
ATOM   4190 N  N     . LEU D 4 444 ? -24.215 0.596   51.669 1.00 33.36  ? 444 LEU D N     1 
ATOM   4191 C  CA    . LEU D 4 444 ? -24.269 1.380   52.877 1.00 34.10  ? 444 LEU D CA    1 
ATOM   4192 C  C     . LEU D 4 444 ? -25.278 0.895   53.888 1.00 35.19  ? 444 LEU D C     1 
ATOM   4193 O  O     . LEU D 4 444 ? -26.403 0.561   53.547 1.00 37.61  ? 444 LEU D O     1 
ATOM   4194 C  CB    . LEU D 4 444 ? -24.568 2.833   52.526 1.00 32.91  ? 444 LEU D CB    1 
ATOM   4195 C  CG    . LEU D 4 444 ? -23.387 3.602   51.957 1.00 35.18  ? 444 LEU D CG    1 
ATOM   4196 C  CD1   . LEU D 4 444 ? -23.850 4.969   51.458 1.00 36.58  ? 444 LEU D CD1   1 
ATOM   4197 C  CD2   . LEU D 4 444 ? -22.314 3.750   53.033 1.00 36.05  ? 444 LEU D CD2   1 
ATOM   4198 N  N     . THR D 4 445 ? -24.870 0.870   55.145 1.00 34.88  ? 445 THR D N     1 
ATOM   4199 C  CA    . THR D 4 445 ? -25.754 0.458   56.217 1.00 35.50  ? 445 THR D CA    1 
ATOM   4200 C  C     . THR D 4 445 ? -25.427 1.361   57.389 1.00 34.80  ? 445 THR D C     1 
ATOM   4201 O  O     . THR D 4 445 ? -24.363 1.963   57.423 1.00 35.07  ? 445 THR D O     1 
ATOM   4202 C  CB    . THR D 4 445 ? -25.506 -0.987  56.612 1.00 36.42  ? 445 THR D CB    1 
ATOM   4203 O  OG1   . THR D 4 445 ? -26.389 -1.342  57.680 1.00 41.68  ? 445 THR D OG1   1 
ATOM   4204 C  CG2   . THR D 4 445 ? -24.070 -1.167  57.082 1.00 38.39  ? 445 THR D CG2   1 
ATOM   4205 N  N     . LEU D 4 446 ? -26.334 1.469   58.346 1.00 34.62  ? 446 LEU D N     1 
ATOM   4206 C  CA    . LEU D 4 446 ? -26.085 2.330   59.494 1.00 34.70  ? 446 LEU D CA    1 
ATOM   4207 C  C     . LEU D 4 446 ? -25.093 1.699   60.463 1.00 35.19  ? 446 LEU D C     1 
ATOM   4208 O  O     . LEU D 4 446 ? -25.102 0.493   60.690 1.00 35.59  ? 446 LEU D O     1 
ATOM   4209 C  CB    . LEU D 4 446 ? -27.396 2.647   60.205 1.00 33.53  ? 446 LEU D CB    1 
ATOM   4210 C  CG    . LEU D 4 446 ? -28.400 3.393   59.319 1.00 35.39  ? 446 LEU D CG    1 
ATOM   4211 C  CD1   . LEU D 4 446 ? -29.812 3.360   59.936 1.00 31.54  ? 446 LEU D CD1   1 
ATOM   4212 C  CD2   . LEU D 4 446 ? -27.889 4.819   59.109 1.00 33.87  ? 446 LEU D CD2   1 
ATOM   4213 N  N     . ALA D 4 447 ? -24.238 2.536   61.036 1.00 34.90  ? 447 ALA D N     1 
ATOM   4214 C  CA    . ALA D 4 447 ? -23.231 2.082   61.971 1.00 35.09  ? 447 ALA D CA    1 
ATOM   4215 C  C     . ALA D 4 447 ? -23.791 1.755   63.365 1.00 36.56  ? 447 ALA D C     1 
ATOM   4216 O  O     . ALA D 4 447 ? -23.358 0.787   63.982 1.00 39.38  ? 447 ALA D O     1 
ATOM   4217 C  CB    . ALA D 4 447 ? -22.123 3.126   62.074 1.00 33.35  ? 447 ALA D CB    1 
ATOM   4218 N  N     . LYS D 4 448 ? -24.740 2.544   63.867 1.00 34.95  ? 448 LYS D N     1 
ATOM   4219 C  CA    . LYS D 4 448 ? -25.285 2.278   65.195 1.00 34.40  ? 448 LYS D CA    1 
ATOM   4220 C  C     . LYS D 4 448 ? -26.562 1.444   65.176 1.00 32.54  ? 448 LYS D C     1 
ATOM   4221 O  O     . LYS D 4 448 ? -27.659 1.972   65.031 1.00 33.30  ? 448 LYS D O     1 
ATOM   4222 C  CB    . LYS D 4 448 ? -25.560 3.588   65.949 1.00 35.18  ? 448 LYS D CB    1 
ATOM   4223 C  CG    . LYS D 4 448 ? -24.341 4.432   66.206 1.00 37.10  ? 448 LYS D CG    1 
ATOM   4224 C  CD    . LYS D 4 448 ? -24.676 5.689   66.968 1.00 41.78  ? 448 LYS D CD    1 
ATOM   4225 C  CE    . LYS D 4 448 ? -25.085 5.382   68.420 1.00 46.40  ? 448 LYS D CE    1 
ATOM   4226 N  NZ    . LYS D 4 448 ? -25.164 6.650   69.250 1.00 47.86  ? 448 LYS D NZ    1 
ATOM   4227 N  N     . GLY D 4 449 ? -26.406 0.139   65.339 1.00 30.99  ? 449 GLY D N     1 
ATOM   4228 C  CA    . GLY D 4 449 ? -27.549 -0.746  65.355 1.00 28.25  ? 449 GLY D CA    1 
ATOM   4229 C  C     . GLY D 4 449 ? -27.977 -0.997  66.785 1.00 28.97  ? 449 GLY D C     1 
ATOM   4230 O  O     . GLY D 4 449 ? -27.421 -0.442  67.731 1.00 28.76  ? 449 GLY D O     1 
ATOM   4231 N  N     . LYS D 4 450 ? -28.985 -1.841  66.942 1.00 29.31  ? 450 LYS D N     1 
ATOM   4232 C  CA    . LYS D 4 450 ? -29.510 -2.179  68.254 1.00 27.47  ? 450 LYS D CA    1 
ATOM   4233 C  C     . LYS D 4 450 ? -30.141 -3.540  68.123 1.00 24.78  ? 450 LYS D C     1 
ATOM   4234 O  O     . LYS D 4 450 ? -30.401 -3.987  67.030 1.00 25.08  ? 450 LYS D O     1 
ATOM   4235 C  CB    . LYS D 4 450 ? -30.613 -1.186  68.666 1.00 28.52  ? 450 LYS D CB    1 
ATOM   4236 C  CG    . LYS D 4 450 ? -30.310 0.291   68.439 1.00 32.53  ? 450 LYS D CG    1 
ATOM   4237 C  CD    . LYS D 4 450 ? -30.806 1.144   69.604 1.00 36.70  ? 450 LYS D CD    1 
ATOM   4238 C  CE    . LYS D 4 450 ? -32.239 1.654   69.458 1.00 39.59  ? 450 LYS D CE    1 
ATOM   4239 N  NZ    . LYS D 4 450 ? -32.351 2.937   68.699 1.00 38.04  ? 450 LYS D NZ    1 
ATOM   4240 N  N     . PRO D 4 451 ? -30.350 -4.244  69.238 1.00 26.24  ? 451 PRO D N     1 
ATOM   4241 C  CA    . PRO D 4 451 ? -31.000 -5.562  69.139 1.00 25.27  ? 451 PRO D CA    1 
ATOM   4242 C  C     . PRO D 4 451 ? -32.264 -5.297  68.315 1.00 25.54  ? 451 PRO D C     1 
ATOM   4243 O  O     . PRO D 4 451 ? -33.012 -4.362  68.606 1.00 25.30  ? 451 PRO D O     1 
ATOM   4244 C  CB    . PRO D 4 451 ? -31.334 -5.877  70.582 1.00 20.42  ? 451 PRO D CB    1 
ATOM   4245 C  CG    . PRO D 4 451 ? -30.202 -5.305  71.291 1.00 22.58  ? 451 PRO D CG    1 
ATOM   4246 C  CD    . PRO D 4 451 ? -29.898 -3.988  70.611 1.00 23.08  ? 451 PRO D CD    1 
ATOM   4247 N  N     . ILE D 4 452 ? -32.497 -6.087  67.285 1.00 25.73  ? 452 ILE D N     1 
ATOM   4248 C  CA    . ILE D 4 452 ? -33.650 -5.831  66.429 1.00 26.10  ? 452 ILE D CA    1 
ATOM   4249 C  C     . ILE D 4 452 ? -35.002 -5.896  67.124 1.00 25.30  ? 452 ILE D C     1 
ATOM   4250 O  O     . ILE D 4 452 ? -35.822 -5.018  66.932 1.00 27.74  ? 452 ILE D O     1 
ATOM   4251 C  CB    . ILE D 4 452 ? -33.624 -6.778  65.213 1.00 27.84  ? 452 ILE D CB    1 
ATOM   4252 C  CG1   . ILE D 4 452 ? -34.540 -6.238  64.118 1.00 22.80  ? 452 ILE D CG1   1 
ATOM   4253 C  CG2   . ILE D 4 452 ? -33.928 -8.225  65.671 1.00 25.05  ? 452 ILE D CG2   1 
ATOM   4254 C  CD1   . ILE D 4 452 ? -34.518 -7.110  62.871 1.00 22.90  ? 452 ILE D CD1   1 
ATOM   4255 N  N     . GLY D 4 453 ? -35.238 -6.924  67.930 1.00 25.26  ? 453 GLY D N     1 
ATOM   4256 C  CA    . GLY D 4 453 ? -36.503 -7.029  68.633 1.00 23.66  ? 453 GLY D CA    1 
ATOM   4257 C  C     . GLY D 4 453 ? -37.688 -7.451  67.793 1.00 27.63  ? 453 GLY D C     1 
ATOM   4258 O  O     . GLY D 4 453 ? -37.603 -7.531  66.553 1.00 27.90  ? 453 GLY D O     1 
ATOM   4259 N  N     . LYS D 4 454 ? -38.805 -7.713  68.480 1.00 28.50  ? 454 LYS D N     1 
ATOM   4260 C  CA    . LYS D 4 454 ? -40.052 -8.150  67.852 1.00 26.33  ? 454 LYS D CA    1 
ATOM   4261 C  C     . LYS D 4 454 ? -40.517 -7.217  66.771 1.00 26.08  ? 454 LYS D C     1 
ATOM   4262 O  O     . LYS D 4 454 ? -40.740 -7.648  65.645 1.00 24.42  ? 454 LYS D O     1 
ATOM   4263 C  CB    . LYS D 4 454 ? -41.160 -8.263  68.874 1.00 27.09  ? 454 LYS D CB    1 
ATOM   4264 C  CG    . LYS D 4 454 ? -42.457 -8.746  68.312 1.00 26.77  ? 454 LYS D CG    1 
ATOM   4265 C  CD    . LYS D 4 454 ? -43.466 -8.840  69.422 1.00 33.38  ? 454 LYS D CD    1 
ATOM   4266 C  CE    . LYS D 4 454 ? -44.624 -9.791  69.097 1.00 34.53  ? 454 LYS D CE    1 
ATOM   4267 N  NZ    . LYS D 4 454 ? -45.638 -9.180  68.217 1.00 40.91  ? 454 LYS D NZ    1 
ATOM   4268 N  N     . GLU D 4 455 ? -40.674 -5.941  67.108 1.00 28.24  ? 455 GLU D N     1 
ATOM   4269 C  CA    . GLU D 4 455 ? -41.126 -4.956  66.109 1.00 31.64  ? 455 GLU D CA    1 
ATOM   4270 C  C     . GLU D 4 455 ? -40.082 -4.755  65.020 1.00 29.52  ? 455 GLU D C     1 
ATOM   4271 O  O     . GLU D 4 455 ? -40.407 -4.737  63.830 1.00 28.99  ? 455 GLU D O     1 
ATOM   4272 C  CB    . GLU D 4 455 ? -41.446 -3.604  66.758 1.00 34.22  ? 455 GLU D CB    1 
ATOM   4273 C  CG    . GLU D 4 455 ? -42.881 -3.456  67.200 1.00 39.79  ? 455 GLU D CG    1 
ATOM   4274 C  CD    . GLU D 4 455 ? -43.320 -1.992  67.295 1.00 48.11  ? 455 GLU D CD    1 
ATOM   4275 O  OE1   . GLU D 4 455 ? -42.897 -1.296  68.272 1.00 48.60  ? 455 GLU D OE1   1 
ATOM   4276 O  OE2   . GLU D 4 455 ? -44.083 -1.543  66.379 1.00 48.37  ? 455 GLU D OE2   1 
ATOM   4277 N  N     . GLY D 4 456 ? -38.828 -4.613  65.442 1.00 28.27  ? 456 GLY D N     1 
ATOM   4278 C  CA    . GLY D 4 456 ? -37.751 -4.434  64.502 1.00 25.45  ? 456 GLY D CA    1 
ATOM   4279 C  C     . GLY D 4 456 ? -37.760 -5.540  63.474 1.00 27.41  ? 456 GLY D C     1 
ATOM   4280 O  O     . GLY D 4 456 ? -37.613 -5.273  62.272 1.00 28.16  ? 456 GLY D O     1 
ATOM   4281 N  N     . TYR D 4 457 ? -37.938 -6.781  63.930 1.00 26.91  ? 457 TYR D N     1 
ATOM   4282 C  CA    . TYR D 4 457 ? -37.955 -7.925  63.016 1.00 28.17  ? 457 TYR D CA    1 
ATOM   4283 C  C     . TYR D 4 457 ? -39.100 -7.821  62.029 1.00 28.67  ? 457 TYR D C     1 
ATOM   4284 O  O     . TYR D 4 457 ? -38.934 -8.037  60.831 1.00 29.54  ? 457 TYR D O     1 
ATOM   4285 C  CB    . TYR D 4 457 ? -38.079 -9.224  63.801 1.00 31.04  ? 457 TYR D CB    1 
ATOM   4286 C  CG    . TYR D 4 457 ? -37.935 -10.487 62.974 1.00 33.62  ? 457 TYR D CG    1 
ATOM   4287 C  CD1   . TYR D 4 457 ? -37.012 -10.560 61.940 1.00 36.96  ? 457 TYR D CD1   1 
ATOM   4288 C  CD2   . TYR D 4 457 ? -38.676 -11.620 63.269 1.00 33.07  ? 457 TYR D CD2   1 
ATOM   4289 C  CE1   . TYR D 4 457 ? -36.827 -11.723 61.228 1.00 38.27  ? 457 TYR D CE1   1 
ATOM   4290 C  CE2   . TYR D 4 457 ? -38.506 -12.783 62.569 1.00 36.29  ? 457 TYR D CE2   1 
ATOM   4291 C  CZ    . TYR D 4 457 ? -37.574 -12.839 61.547 1.00 40.35  ? 457 TYR D CZ    1 
ATOM   4292 O  OH    . TYR D 4 457 ? -37.347 -14.025 60.871 1.00 43.09  ? 457 TYR D OH    1 
ATOM   4293 N  N     . TYR D 4 458 ? -40.270 -7.485  62.548 1.00 27.89  ? 458 TYR D N     1 
ATOM   4294 C  CA    . TYR D 4 458 ? -41.447 -7.345  61.734 1.00 27.67  ? 458 TYR D CA    1 
ATOM   4295 C  C     . TYR D 4 458 ? -41.172 -6.345  60.598 1.00 30.07  ? 458 TYR D C     1 
ATOM   4296 O  O     . TYR D 4 458 ? -41.311 -6.667  59.410 1.00 29.01  ? 458 TYR D O     1 
ATOM   4297 C  CB    . TYR D 4 458 ? -42.575 -6.854  62.620 1.00 26.72  ? 458 TYR D CB    1 
ATOM   4298 C  CG    . TYR D 4 458 ? -43.815 -6.452  61.881 1.00 31.66  ? 458 TYR D CG    1 
ATOM   4299 C  CD1   . TYR D 4 458 ? -44.788 -7.389  61.561 1.00 33.28  ? 458 TYR D CD1   1 
ATOM   4300 C  CD2   . TYR D 4 458 ? -44.058 -5.109  61.565 1.00 33.92  ? 458 TYR D CD2   1 
ATOM   4301 C  CE1   . TYR D 4 458 ? -45.978 -7.008  60.964 1.00 35.30  ? 458 TYR D CE1   1 
ATOM   4302 C  CE2   . TYR D 4 458 ? -45.246 -4.718  60.962 1.00 35.54  ? 458 TYR D CE2   1 
ATOM   4303 C  CZ    . TYR D 4 458 ? -46.204 -5.678  60.673 1.00 35.47  ? 458 TYR D CZ    1 
ATOM   4304 O  OH    . TYR D 4 458 ? -47.405 -5.306  60.139 1.00 38.22  ? 458 TYR D OH    1 
ATOM   4305 N  N     . TRP D 4 459 ? -40.777 -5.130  60.966 1.00 30.58  ? 459 TRP D N     1 
ATOM   4306 C  CA    . TRP D 4 459 ? -40.503 -4.115  59.966 1.00 31.33  ? 459 TRP D CA    1 
ATOM   4307 C  C     . TRP D 4 459 ? -39.365 -4.552  59.068 1.00 31.36  ? 459 TRP D C     1 
ATOM   4308 O  O     . TRP D 4 459 ? -39.347 -4.229  57.887 1.00 31.60  ? 459 TRP D O     1 
ATOM   4309 C  CB    . TRP D 4 459 ? -40.208 -2.780  60.640 1.00 33.75  ? 459 TRP D CB    1 
ATOM   4310 C  CG    . TRP D 4 459 ? -41.460 -2.139  61.157 1.00 35.57  ? 459 TRP D CG    1 
ATOM   4311 C  CD1   . TRP D 4 459 ? -41.751 -1.807  62.448 1.00 35.12  ? 459 TRP D CD1   1 
ATOM   4312 C  CD2   . TRP D 4 459 ? -42.590 -1.738  60.376 1.00 36.21  ? 459 TRP D CD2   1 
ATOM   4313 N  NE1   . TRP D 4 459 ? -42.992 -1.217  62.518 1.00 34.35  ? 459 TRP D NE1   1 
ATOM   4314 C  CE2   . TRP D 4 459 ? -43.526 -1.162  61.259 1.00 34.12  ? 459 TRP D CE2   1 
ATOM   4315 C  CE3   . TRP D 4 459 ? -42.901 -1.809  59.010 1.00 36.28  ? 459 TRP D CE3   1 
ATOM   4316 C  CZ2   . TRP D 4 459 ? -44.746 -0.656  60.822 1.00 33.27  ? 459 TRP D CZ2   1 
ATOM   4317 C  CZ3   . TRP D 4 459 ? -44.120 -1.302  58.578 1.00 36.19  ? 459 TRP D CZ3   1 
ATOM   4318 C  CH2   . TRP D 4 459 ? -45.025 -0.731  59.485 1.00 33.21  ? 459 TRP D CH2   1 
ATOM   4319 N  N     . LEU D 4 460 ? -38.416 -5.307  59.609 1.00 31.05  ? 460 LEU D N     1 
ATOM   4320 C  CA    . LEU D 4 460 ? -37.329 -5.784  58.769 1.00 31.28  ? 460 LEU D CA    1 
ATOM   4321 C  C     . LEU D 4 460 ? -37.958 -6.627  57.644 1.00 31.41  ? 460 LEU D C     1 
ATOM   4322 O  O     . LEU D 4 460 ? -37.575 -6.521  56.475 1.00 30.95  ? 460 LEU D O     1 
ATOM   4323 C  CB    . LEU D 4 460 ? -36.353 -6.641  59.574 1.00 31.73  ? 460 LEU D CB    1 
ATOM   4324 C  CG    . LEU D 4 460 ? -35.333 -7.371  58.698 1.00 30.24  ? 460 LEU D CG    1 
ATOM   4325 C  CD1   . LEU D 4 460 ? -34.511 -6.339  57.952 1.00 28.79  ? 460 LEU D CD1   1 
ATOM   4326 C  CD2   . LEU D 4 460 ? -34.449 -8.264  59.550 1.00 29.81  ? 460 LEU D CD2   1 
ATOM   4327 N  N     . LYS D 4 461 ? -38.927 -7.464  58.000 1.00 29.93  ? 461 LYS D N     1 
ATOM   4328 C  CA    . LYS D 4 461 ? -39.587 -8.287  57.000 1.00 29.50  ? 461 LYS D CA    1 
ATOM   4329 C  C     . LYS D 4 461 ? -40.401 -7.416  56.039 1.00 29.46  ? 461 LYS D C     1 
ATOM   4330 O  O     . LYS D 4 461 ? -40.441 -7.682  54.831 1.00 27.34  ? 461 LYS D O     1 
ATOM   4331 C  CB    . LYS D 4 461 ? -40.455 -9.339  57.684 1.00 33.27  ? 461 LYS D CB    1 
ATOM   4332 C  CG    . LYS D 4 461 ? -39.615 -10.359 58.456 1.00 32.70  ? 461 LYS D CG    1 
ATOM   4333 C  CD    . LYS D 4 461 ? -40.350 -11.670 58.650 1.00 36.35  ? 461 LYS D CD    1 
ATOM   4334 C  CE    . LYS D 4 461 ? -41.560 -11.536 59.529 1.00 36.75  ? 461 LYS D CE    1 
ATOM   4335 N  NZ    . LYS D 4 461 ? -41.223 -11.410 60.981 1.00 42.95  ? 461 LYS D NZ    1 
ATOM   4336 N  N     . ILE D 4 462 ? -41.043 -6.368  56.553 1.00 27.41  ? 462 ILE D N     1 
ATOM   4337 C  CA    . ILE D 4 462 ? -41.761 -5.473  55.659 1.00 27.73  ? 462 ILE D CA    1 
ATOM   4338 C  C     . ILE D 4 462 ? -40.759 -4.873  54.671 1.00 28.81  ? 462 ILE D C     1 
ATOM   4339 O  O     . ILE D 4 462 ? -40.983 -4.859  53.457 1.00 27.99  ? 462 ILE D O     1 
ATOM   4340 C  CB    . ILE D 4 462 ? -42.453 -4.327  56.408 1.00 29.41  ? 462 ILE D CB    1 
ATOM   4341 C  CG1   . ILE D 4 462 ? -43.704 -4.842  57.124 1.00 31.84  ? 462 ILE D CG1   1 
ATOM   4342 C  CG2   . ILE D 4 462 ? -42.825 -3.240  55.439 1.00 31.05  ? 462 ILE D CG2   1 
ATOM   4343 C  CD1   . ILE D 4 462 ? -44.477 -5.932  56.328 1.00 31.65  ? 462 ILE D CD1   1 
ATOM   4344 N  N     . HIS D 4 463 ? -39.636 -4.389  55.195 1.00 29.78  ? 463 HIS D N     1 
ATOM   4345 C  CA    . HIS D 4 463 ? -38.610 -3.814  54.342 1.00 27.77  ? 463 HIS D CA    1 
ATOM   4346 C  C     . HIS D 4 463 ? -38.206 -4.800  53.254 1.00 27.08  ? 463 HIS D C     1 
ATOM   4347 O  O     . HIS D 4 463 ? -38.170 -4.457  52.079 1.00 25.19  ? 463 HIS D O     1 
ATOM   4348 C  CB    . HIS D 4 463 ? -37.398 -3.432  55.171 1.00 29.74  ? 463 HIS D CB    1 
ATOM   4349 C  CG    . HIS D 4 463 ? -36.291 -2.822  54.366 1.00 33.80  ? 463 HIS D CG    1 
ATOM   4350 N  ND1   . HIS D 4 463 ? -35.063 -3.431  54.206 1.00 33.43  ? 463 HIS D ND1   1 
ATOM   4351 C  CD2   . HIS D 4 463 ? -36.238 -1.674  53.648 1.00 31.01  ? 463 HIS D CD2   1 
ATOM   4352 C  CE1   . HIS D 4 463 ? -34.304 -2.686  53.422 1.00 31.79  ? 463 HIS D CE1   1 
ATOM   4353 N  NE2   . HIS D 4 463 ? -34.994 -1.617  53.070 1.00 29.90  ? 463 HIS D NE2   1 
ATOM   4354 N  N     . GLY D 4 464 ? -37.910 -6.031  53.652 1.00 27.74  ? 464 GLY D N     1 
ATOM   4355 C  CA    . GLY D 4 464 ? -37.514 -7.053  52.693 1.00 28.26  ? 464 GLY D CA    1 
ATOM   4356 C  C     . GLY D 4 464 ? -38.547 -7.287  51.613 1.00 29.10  ? 464 GLY D C     1 
ATOM   4357 O  O     . GLY D 4 464 ? -38.208 -7.467  50.439 1.00 28.67  ? 464 GLY D O     1 
ATOM   4358 N  N     . ALA D 4 465 ? -39.816 -7.296  52.014 1.00 30.85  ? 465 ALA D N     1 
ATOM   4359 C  CA    . ALA D 4 465 ? -40.919 -7.479  51.082 1.00 29.91  ? 465 ALA D CA    1 
ATOM   4360 C  C     . ALA D 4 465 ? -40.846 -6.299  50.116 1.00 32.17  ? 465 ALA D C     1 
ATOM   4361 O  O     . ALA D 4 465 ? -40.927 -6.460  48.903 1.00 32.38  ? 465 ALA D O     1 
ATOM   4362 C  CB    . ALA D 4 465 ? -42.231 -7.464  51.836 1.00 28.75  ? 465 ALA D CB    1 
ATOM   4363 N  N     . ASN D 4 466 ? -40.684 -5.103  50.673 1.00 34.66  ? 466 ASN D N     1 
ATOM   4364 C  CA    . ASN D 4 466 ? -40.563 -3.899  49.867 1.00 36.15  ? 466 ASN D CA    1 
ATOM   4365 C  C     . ASN D 4 466 ? -39.389 -3.981  48.911 1.00 37.37  ? 466 ASN D C     1 
ATOM   4366 O  O     . ASN D 4 466 ? -39.531 -3.624  47.756 1.00 40.01  ? 466 ASN D O     1 
ATOM   4367 C  CB    . ASN D 4 466 ? -40.370 -2.670  50.751 1.00 36.62  ? 466 ASN D CB    1 
ATOM   4368 C  CG    . ASN D 4 466 ? -41.624 -2.265  51.463 1.00 36.32  ? 466 ASN D CG    1 
ATOM   4369 O  OD1   . ASN D 4 466 ? -42.691 -2.844  51.249 1.00 40.03  ? 466 ASN D OD1   1 
ATOM   4370 N  ND2   . ASN D 4 466 ? -41.514 -1.260  52.315 1.00 35.01  ? 466 ASN D ND2   1 
ATOM   4371 N  N     . CYS D 4 467 ? -38.226 -4.428  49.377 1.00 38.43  ? 467 CYS D N     1 
ATOM   4372 C  CA    . CYS D 4 467 ? -37.062 -4.518  48.488 1.00 41.70  ? 467 CYS D CA    1 
ATOM   4373 C  C     . CYS D 4 467 ? -37.297 -5.523  47.380 1.00 44.15  ? 467 CYS D C     1 
ATOM   4374 O  O     . CYS D 4 467 ? -36.672 -5.446  46.313 1.00 44.36  ? 467 CYS D O     1 
ATOM   4375 C  CB    . CYS D 4 467 ? -35.800 -4.918  49.251 1.00 41.32  ? 467 CYS D CB    1 
ATOM   4376 S  SG    . CYS D 4 467 ? -35.280 -3.730  50.512 1.00 46.05  ? 467 CYS D SG    1 
ATOM   4377 N  N     . ALA D 4 468 ? -38.196 -6.471  47.633 1.00 46.99  ? 468 ALA D N     1 
ATOM   4378 C  CA    . ALA D 4 468 ? -38.498 -7.500  46.642 1.00 49.63  ? 468 ALA D CA    1 
ATOM   4379 C  C     . ALA D 4 468 ? -39.518 -6.989  45.643 1.00 50.13  ? 468 ALA D C     1 
ATOM   4380 O  O     . ALA D 4 468 ? -39.624 -7.522  44.536 1.00 52.43  ? 468 ALA D O     1 
ATOM   4381 C  CB    . ALA D 4 468 ? -39.022 -8.764  47.325 1.00 49.56  ? 468 ALA D CB    1 
ATOM   4382 N  N     . GLY D 4 469 ? -40.252 -5.952  46.033 1.00 48.92  ? 469 GLY D N     1 
ATOM   4383 C  CA    . GLY D 4 469 ? -41.265 -5.389  45.163 1.00 49.66  ? 469 GLY D CA    1 
ATOM   4384 C  C     . GLY D 4 469 ? -42.667 -5.704  45.651 1.00 51.43  ? 469 GLY D C     1 
ATOM   4385 O  O     . GLY D 4 469 ? -43.647 -5.122  45.191 1.00 53.23  ? 469 GLY D O     1 
ATOM   4386 N  N     . VAL D 4 470 ? -42.778 -6.638  46.581 1.00 51.57  ? 470 VAL D N     1 
ATOM   4387 C  CA    . VAL D 4 470 ? -44.078 -6.987  47.116 1.00 52.43  ? 470 VAL D CA    1 
ATOM   4388 C  C     . VAL D 4 470 ? -44.399 -5.852  48.043 1.00 54.51  ? 470 VAL D C     1 
ATOM   4389 O  O     . VAL D 4 470 ? -44.204 -5.974  49.242 1.00 57.60  ? 470 VAL D O     1 
ATOM   4390 C  CB    . VAL D 4 470 ? -44.021 -8.295  47.935 1.00 51.18  ? 470 VAL D CB    1 
ATOM   4391 C  CG1   . VAL D 4 470 ? -45.405 -8.637  48.476 1.00 49.39  ? 470 VAL D CG1   1 
ATOM   4392 C  CG2   . VAL D 4 470 ? -43.478 -9.424  47.072 1.00 49.29  ? 470 VAL D CG2   1 
ATOM   4393 N  N     . ASP D 4 471 ? -44.895 -4.747  47.506 1.00 56.32  ? 471 ASP D N     1 
ATOM   4394 C  CA    . ASP D 4 471 ? -45.179 -3.590  48.350 1.00 59.09  ? 471 ASP D CA    1 
ATOM   4395 C  C     . ASP D 4 471 ? -46.509 -2.893  48.119 1.00 60.43  ? 471 ASP D C     1 
ATOM   4396 O  O     . ASP D 4 471 ? -46.833 -1.931  48.820 1.00 61.53  ? 471 ASP D O     1 
ATOM   4397 C  CB    . ASP D 4 471 ? -44.075 -2.561  48.182 1.00 59.61  ? 471 ASP D CB    1 
ATOM   4398 C  CG    . ASP D 4 471 ? -43.736 -2.320  46.728 1.00 63.58  ? 471 ASP D CG    1 
ATOM   4399 O  OD1   . ASP D 4 471 ? -44.651 -2.431  45.877 1.00 64.36  ? 471 ASP D OD1   1 
ATOM   4400 O  OD2   . ASP D 4 471 ? -42.554 -2.012  46.434 1.00 66.74  ? 471 ASP D OD2   1 
ATOM   4401 N  N     . LYS D 4 472 ? -47.268 -3.347  47.128 1.00 60.13  ? 472 LYS D N     1 
ATOM   4402 C  CA    . LYS D 4 472 ? -48.558 -2.739  46.847 1.00 58.18  ? 472 LYS D CA    1 
ATOM   4403 C  C     . LYS D 4 472 ? -49.626 -3.669  47.387 1.00 56.80  ? 472 LYS D C     1 
ATOM   4404 O  O     . LYS D 4 472 ? -50.682 -3.869  46.778 1.00 58.36  ? 472 LYS D O     1 
ATOM   4405 C  CB    . LYS D 4 472 ? -48.720 -2.526  45.342 1.00 60.67  ? 472 LYS D CB    1 
ATOM   4406 C  CG    . LYS D 4 472 ? -47.732 -1.503  44.780 1.00 62.80  ? 472 LYS D CG    1 
ATOM   4407 C  CD    . LYS D 4 472 ? -47.860 -0.183  45.530 1.00 64.60  ? 472 LYS D CD    1 
ATOM   4408 C  CE    . LYS D 4 472 ? -46.784 0.813   45.137 1.00 65.36  ? 472 LYS D CE    1 
ATOM   4409 N  NZ    . LYS D 4 472 ? -46.897 2.053   45.963 1.00 65.60  ? 472 LYS D NZ    1 
ATOM   4410 N  N     . VAL D 4 473 ? -49.339 -4.234  48.552 1.00 52.54  ? 473 VAL D N     1 
ATOM   4411 C  CA    . VAL D 4 473 ? -50.256 -5.153  49.191 1.00 47.67  ? 473 VAL D CA    1 
ATOM   4412 C  C     . VAL D 4 473 ? -50.197 -4.924  50.710 1.00 43.17  ? 473 VAL D C     1 
ATOM   4413 O  O     . VAL D 4 473 ? -49.179 -4.509  51.239 1.00 41.00  ? 473 VAL D O     1 
ATOM   4414 C  CB    . VAL D 4 473 ? -49.882 -6.603  48.802 1.00 48.32  ? 473 VAL D CB    1 
ATOM   4415 C  CG1   . VAL D 4 473 ? -48.873 -7.176  49.780 1.00 48.82  ? 473 VAL D CG1   1 
ATOM   4416 C  CG2   . VAL D 4 473 ? -51.140 -7.444  48.702 1.00 49.48  ? 473 VAL D CG2   1 
ATOM   4417 N  N     . PRO D 4 474 ? -51.306 -5.160  51.425 1.00 40.96  ? 474 PRO D N     1 
ATOM   4418 C  CA    . PRO D 4 474 ? -51.255 -4.936  52.877 1.00 38.56  ? 474 PRO D CA    1 
ATOM   4419 C  C     . PRO D 4 474 ? -50.095 -5.655  53.570 1.00 36.92  ? 474 PRO D C     1 
ATOM   4420 O  O     . PRO D 4 474 ? -49.515 -6.606  53.022 1.00 34.19  ? 474 PRO D O     1 
ATOM   4421 C  CB    . PRO D 4 474 ? -52.650 -5.384  53.351 1.00 36.33  ? 474 PRO D CB    1 
ATOM   4422 C  CG    . PRO D 4 474 ? -53.114 -6.282  52.285 1.00 36.34  ? 474 PRO D CG    1 
ATOM   4423 C  CD    . PRO D 4 474 ? -52.622 -5.671  51.018 1.00 37.19  ? 474 PRO D CD    1 
ATOM   4424 N  N     . PHE D 4 475 ? -49.760 -5.187  54.772 1.00 36.33  ? 475 PHE D N     1 
ATOM   4425 C  CA    . PHE D 4 475 ? -48.632 -5.737  55.523 1.00 37.27  ? 475 PHE D CA    1 
ATOM   4426 C  C     . PHE D 4 475 ? -48.662 -7.233  55.753 1.00 38.61  ? 475 PHE D C     1 
ATOM   4427 O  O     . PHE D 4 475 ? -47.637 -7.909  55.592 1.00 37.43  ? 475 PHE D O     1 
ATOM   4428 C  CB    . PHE D 4 475 ? -48.465 -4.993  56.848 1.00 36.45  ? 475 PHE D CB    1 
ATOM   4429 C  CG    . PHE D 4 475 ? -48.031 -3.575  56.670 1.00 35.46  ? 475 PHE D CG    1 
ATOM   4430 C  CD1   . PHE D 4 475 ? -47.278 -3.209  55.560 1.00 35.18  ? 475 PHE D CD1   1 
ATOM   4431 C  CD2   . PHE D 4 475 ? -48.374 -2.608  57.588 1.00 35.50  ? 475 PHE D CD2   1 
ATOM   4432 C  CE1   . PHE D 4 475 ? -46.882 -1.896  55.376 1.00 36.26  ? 475 PHE D CE1   1 
ATOM   4433 C  CE2   . PHE D 4 475 ? -47.977 -1.283  57.409 1.00 35.98  ? 475 PHE D CE2   1 
ATOM   4434 C  CZ    . PHE D 4 475 ? -47.233 -0.927  56.307 1.00 34.73  ? 475 PHE D CZ    1 
ATOM   4435 N  N     . PRO D 4 476 ? -49.832 -7.776  56.136 1.00 39.48  ? 476 PRO D N     1 
ATOM   4436 C  CA    . PRO D 4 476 ? -49.908 -9.218  56.360 1.00 38.82  ? 476 PRO D CA    1 
ATOM   4437 C  C     . PRO D 4 476 ? -49.448 -10.001 55.127 1.00 39.93  ? 476 PRO D C     1 
ATOM   4438 O  O     . PRO D 4 476 ? -48.770 -11.013 55.256 1.00 39.25  ? 476 PRO D O     1 
ATOM   4439 C  CB    . PRO D 4 476 ? -51.378 -9.425  56.692 1.00 37.76  ? 476 PRO D CB    1 
ATOM   4440 C  CG    . PRO D 4 476 ? -51.714 -8.172  57.439 1.00 36.47  ? 476 PRO D CG    1 
ATOM   4441 C  CD    . PRO D 4 476 ? -51.074 -7.114  56.579 1.00 38.08  ? 476 PRO D CD    1 
ATOM   4442 N  N     . GLU D 4 477 ? -49.793 -9.532  53.930 1.00 43.17  ? 477 GLU D N     1 
ATOM   4443 C  CA    . GLU D 4 477 ? -49.375 -10.251 52.731 1.00 47.49  ? 477 GLU D CA    1 
ATOM   4444 C  C     . GLU D 4 477 ? -47.876 -10.104 52.448 1.00 47.32  ? 477 GLU D C     1 
ATOM   4445 O  O     . GLU D 4 477 ? -47.299 -10.928 51.733 1.00 48.76  ? 477 GLU D O     1 
ATOM   4446 C  CB    . GLU D 4 477 ? -50.178 -9.820  51.481 1.00 50.51  ? 477 GLU D CB    1 
ATOM   4447 C  CG    . GLU D 4 477 ? -50.308 -10.981 50.451 1.00 58.19  ? 477 GLU D CG    1 
ATOM   4448 C  CD    . GLU D 4 477 ? -50.402 -10.559 48.968 1.00 61.99  ? 477 GLU D CD    1 
ATOM   4449 O  OE1   . GLU D 4 477 ? -51.467 -10.059 48.533 1.00 62.99  ? 477 GLU D OE1   1 
ATOM   4450 O  OE2   . GLU D 4 477 ? -49.399 -10.747 48.231 1.00 64.73  ? 477 GLU D OE2   1 
ATOM   4451 N  N     . ARG D 4 478 ? -47.242 -9.068  53.001 1.00 47.14  ? 478 ARG D N     1 
ATOM   4452 C  CA    . ARG D 4 478 ? -45.810 -8.855  52.779 1.00 45.07  ? 478 ARG D CA    1 
ATOM   4453 C  C     . ARG D 4 478 ? -45.009 -9.778  53.674 1.00 44.93  ? 478 ARG D C     1 
ATOM   4454 O  O     . ARG D 4 478 ? -44.005 -10.354 53.252 1.00 43.98  ? 478 ARG D O     1 
ATOM   4455 C  CB    . ARG D 4 478 ? -45.420 -7.404  53.067 1.00 46.13  ? 478 ARG D CB    1 
ATOM   4456 C  CG    . ARG D 4 478 ? -46.238 -6.392  52.290 1.00 45.85  ? 478 ARG D CG    1 
ATOM   4457 C  CD    . ARG D 4 478 ? -45.567 -5.034  52.163 1.00 44.21  ? 478 ARG D CD    1 
ATOM   4458 N  NE    . ARG D 4 478 ? -46.583 -4.027  51.890 1.00 45.22  ? 478 ARG D NE    1 
ATOM   4459 C  CZ    . ARG D 4 478 ? -46.385 -2.716  51.933 1.00 46.01  ? 478 ARG D CZ    1 
ATOM   4460 N  NH1   . ARG D 4 478 ? -45.184 -2.232  52.228 1.00 48.29  ? 478 ARG D NH1   1 
ATOM   4461 N  NH2   . ARG D 4 478 ? -47.403 -1.891  51.732 1.00 43.56  ? 478 ARG D NH2   1 
ATOM   4462 N  N     . ILE D 4 479 ? -45.459 -9.900  54.921 1.00 44.02  ? 479 ILE D N     1 
ATOM   4463 C  CA    . ILE D 4 479 ? -44.812 -10.766 55.889 1.00 43.67  ? 479 ILE D CA    1 
ATOM   4464 C  C     . ILE D 4 479 ? -44.899 -12.191 55.365 1.00 45.35  ? 479 ILE D C     1 
ATOM   4465 O  O     . ILE D 4 479 ? -43.940 -12.957 55.434 1.00 46.26  ? 479 ILE D O     1 
ATOM   4466 C  CB    . ILE D 4 479 ? -45.526 -10.737 57.256 1.00 42.18  ? 479 ILE D CB    1 
ATOM   4467 C  CG1   . ILE D 4 479 ? -45.487 -9.327  57.864 1.00 41.87  ? 479 ILE D CG1   1 
ATOM   4468 C  CG2   . ILE D 4 479 ? -44.888 -11.772 58.184 1.00 40.69  ? 479 ILE D CG2   1 
ATOM   4469 C  CD1   . ILE D 4 479 ? -44.110 -8.816  58.222 1.00 38.71  ? 479 ILE D CD1   1 
ATOM   4470 N  N     . LYS D 4 480 ? -46.067 -12.535 54.835 1.00 46.89  ? 480 LYS D N     1 
ATOM   4471 C  CA    . LYS D 4 480 ? -46.305 -13.869 54.319 1.00 48.55  ? 480 LYS D CA    1 
ATOM   4472 C  C     . LYS D 4 480 ? -45.345 -14.132 53.177 1.00 47.39  ? 480 LYS D C     1 
ATOM   4473 O  O     . LYS D 4 480 ? -44.808 -15.231 53.035 1.00 47.09  ? 480 LYS D O     1 
ATOM   4474 C  CB    . LYS D 4 480 ? -47.745 -13.990 53.827 1.00 51.24  ? 480 LYS D CB    1 
ATOM   4475 C  CG    . LYS D 4 480 ? -48.426 -15.300 54.203 1.00 55.71  ? 480 LYS D CG    1 
ATOM   4476 C  CD    . LYS D 4 480 ? -48.967 -15.257 55.645 1.00 59.92  ? 480 LYS D CD    1 
ATOM   4477 C  CE    . LYS D 4 480 ? -47.887 -15.484 56.706 1.00 61.82  ? 480 LYS D CE    1 
ATOM   4478 N  NZ    . LYS D 4 480 ? -47.412 -16.907 56.724 1.00 63.62  ? 480 LYS D NZ    1 
ATOM   4479 N  N     . PHE D 4 481 ? -45.133 -13.110 52.362 1.00 45.15  ? 481 PHE D N     1 
ATOM   4480 C  CA    . PHE D 4 481 ? -44.235 -13.237 51.239 1.00 43.69  ? 481 PHE D CA    1 
ATOM   4481 C  C     . PHE D 4 481 ? -42.867 -13.638 51.745 1.00 45.02  ? 481 PHE D C     1 
ATOM   4482 O  O     . PHE D 4 481 ? -42.236 -14.550 51.211 1.00 45.95  ? 481 PHE D O     1 
ATOM   4483 C  CB    . PHE D 4 481 ? -44.116 -11.914 50.483 1.00 42.72  ? 481 PHE D CB    1 
ATOM   4484 C  CG    . PHE D 4 481 ? -43.049 -11.928 49.443 1.00 41.52  ? 481 PHE D CG    1 
ATOM   4485 C  CD1   . PHE D 4 481 ? -43.190 -12.706 48.304 1.00 40.60  ? 481 PHE D CD1   1 
ATOM   4486 C  CD2   . PHE D 4 481 ? -41.849 -11.264 49.655 1.00 41.81  ? 481 PHE D CD2   1 
ATOM   4487 C  CE1   . PHE D 4 481 ? -42.147 -12.834 47.396 1.00 39.01  ? 481 PHE D CE1   1 
ATOM   4488 C  CE2   . PHE D 4 481 ? -40.801 -11.385 48.751 1.00 41.44  ? 481 PHE D CE2   1 
ATOM   4489 C  CZ    . PHE D 4 481 ? -40.954 -12.178 47.619 1.00 40.93  ? 481 PHE D CZ    1 
ATOM   4490 N  N     . ILE D 4 482 ? -42.412 -12.964 52.793 1.00 45.81  ? 482 ILE D N     1 
ATOM   4491 C  CA    . ILE D 4 482 ? -41.092 -13.237 53.336 1.00 46.33  ? 482 ILE D CA    1 
ATOM   4492 C  C     . ILE D 4 482 ? -41.010 -14.589 54.016 1.00 47.46  ? 482 ILE D C     1 
ATOM   4493 O  O     . ILE D 4 482 ? -40.074 -15.354 53.770 1.00 47.36  ? 482 ILE D O     1 
ATOM   4494 C  CB    . ILE D 4 482 ? -40.654 -12.117 54.331 1.00 45.02  ? 482 ILE D CB    1 
ATOM   4495 C  CG1   . ILE D 4 482 ? -40.368 -10.826 53.567 1.00 43.81  ? 482 ILE D CG1   1 
ATOM   4496 C  CG2   . ILE D 4 482 ? -39.399 -12.523 55.087 1.00 43.92  ? 482 ILE D CG2   1 
ATOM   4497 C  CD1   . ILE D 4 482 ? -39.232 -10.931 52.595 1.00 41.63  ? 482 ILE D CD1   1 
ATOM   4498 N  N     . GLU D 4 483 ? -41.993 -14.885 54.862 1.00 48.73  ? 483 GLU D N     1 
ATOM   4499 C  CA    . GLU D 4 483 ? -42.004 -16.138 55.609 1.00 49.90  ? 483 GLU D CA    1 
ATOM   4500 C  C     . GLU D 4 483 ? -42.104 -17.327 54.689 1.00 48.69  ? 483 GLU D C     1 
ATOM   4501 O  O     . GLU D 4 483 ? -41.445 -18.346 54.886 1.00 48.40  ? 483 GLU D O     1 
ATOM   4502 C  CB    . GLU D 4 483 ? -43.152 -16.141 56.628 1.00 51.89  ? 483 GLU D CB    1 
ATOM   4503 C  CG    . GLU D 4 483 ? -42.814 -15.347 57.898 1.00 57.81  ? 483 GLU D CG    1 
ATOM   4504 C  CD    . GLU D 4 483 ? -44.032 -14.957 58.737 1.00 61.07  ? 483 GLU D CD    1 
ATOM   4505 O  OE1   . GLU D 4 483 ? -43.840 -14.270 59.773 1.00 60.91  ? 483 GLU D OE1   1 
ATOM   4506 O  OE2   . GLU D 4 483 ? -45.174 -15.327 58.365 1.00 63.10  ? 483 GLU D OE2   1 
ATOM   4507 N  N     . GLU D 4 484 ? -42.917 -17.188 53.660 1.00 48.71  ? 484 GLU D N     1 
ATOM   4508 C  CA    . GLU D 4 484 ? -43.080 -18.270 52.725 1.00 47.86  ? 484 GLU D CA    1 
ATOM   4509 C  C     . GLU D 4 484 ? -41.952 -18.332 51.732 1.00 45.88  ? 484 GLU D C     1 
ATOM   4510 O  O     . GLU D 4 484 ? -42.010 -19.079 50.775 1.00 47.45  ? 484 GLU D O     1 
ATOM   4511 C  CB    . GLU D 4 484 ? -44.430 -18.147 52.041 1.00 50.24  ? 484 GLU D CB    1 
ATOM   4512 C  CG    . GLU D 4 484 ? -45.549 -18.387 53.051 1.00 57.78  ? 484 GLU D CG    1 
ATOM   4513 C  CD    . GLU D 4 484 ? -46.904 -18.557 52.404 1.00 62.39  ? 484 GLU D CD    1 
ATOM   4514 O  OE1   . GLU D 4 484 ? -47.893 -18.773 53.150 1.00 62.95  ? 484 GLU D OE1   1 
ATOM   4515 O  OE2   . GLU D 4 484 ? -46.970 -18.472 51.152 1.00 64.44  ? 484 GLU D OE2   1 
ATOM   4516 N  N     . ASN D 4 485 ? -40.909 -17.554 51.979 1.00 44.61  ? 485 ASN D N     1 
ATOM   4517 C  CA    . ASN D 4 485 ? -39.737 -17.535 51.118 1.00 43.32  ? 485 ASN D CA    1 
ATOM   4518 C  C     . ASN D 4 485 ? -38.522 -17.712 51.992 1.00 42.79  ? 485 ASN D C     1 
ATOM   4519 O  O     . ASN D 4 485 ? -37.380 -17.543 51.561 1.00 42.02  ? 485 ASN D O     1 
ATOM   4520 C  CB    . ASN D 4 485 ? -39.649 -16.222 50.356 1.00 44.26  ? 485 ASN D CB    1 
ATOM   4521 C  CG    . ASN D 4 485 ? -40.307 -16.303 49.010 1.00 45.64  ? 485 ASN D CG    1 
ATOM   4522 O  OD1   . ASN D 4 485 ? -39.838 -17.028 48.124 1.00 46.02  ? 485 ASN D OD1   1 
ATOM   4523 N  ND2   . ASN D 4 485 ? -41.406 -15.574 48.840 1.00 44.83  ? 485 ASN D ND2   1 
ATOM   4524 N  N     . HIS D 4 486 ? -38.799 -18.065 53.236 1.00 41.65  ? 486 HIS D N     1 
ATOM   4525 C  CA    . HIS D 4 486 ? -37.768 -18.298 54.215 1.00 43.83  ? 486 HIS D CA    1 
ATOM   4526 C  C     . HIS D 4 486 ? -36.516 -18.943 53.608 1.00 43.98  ? 486 HIS D C     1 
ATOM   4527 O  O     . HIS D 4 486 ? -35.451 -18.326 53.586 1.00 43.14  ? 486 HIS D O     1 
ATOM   4528 C  CB    . HIS D 4 486 ? -38.325 -19.177 55.348 1.00 43.90  ? 486 HIS D CB    1 
ATOM   4529 C  CG    . HIS D 4 486 ? -37.307 -19.542 56.381 1.00 44.80  ? 486 HIS D CG    1 
ATOM   4530 N  ND1   . HIS D 4 486 ? -36.803 -18.629 57.282 1.00 46.43  ? 486 HIS D ND1   1 
ATOM   4531 C  CD2   . HIS D 4 486 ? -36.637 -20.698 56.602 1.00 44.89  ? 486 HIS D CD2   1 
ATOM   4532 C  CE1   . HIS D 4 486 ? -35.863 -19.207 58.011 1.00 46.97  ? 486 HIS D CE1   1 
ATOM   4533 N  NE2   . HIS D 4 486 ? -35.743 -20.461 57.618 1.00 45.50  ? 486 HIS D NE2   1 
ATOM   4534 N  N     . GLU D 4 487 ? -36.654 -20.172 53.110 1.00 45.50  ? 487 GLU D N     1 
ATOM   4535 C  CA    . GLU D 4 487 ? -35.524 -20.908 52.535 1.00 47.20  ? 487 GLU D CA    1 
ATOM   4536 C  C     . GLU D 4 487 ? -34.785 -20.202 51.413 1.00 46.25  ? 487 GLU D C     1 
ATOM   4537 O  O     . GLU D 4 487 ? -33.557 -20.305 51.309 1.00 45.99  ? 487 GLU D O     1 
ATOM   4538 C  CB    . GLU D 4 487 ? -35.962 -22.309 52.088 1.00 49.11  ? 487 GLU D CB    1 
ATOM   4539 C  CG    . GLU D 4 487 ? -36.135 -23.254 53.259 1.00 53.96  ? 487 GLU D CG    1 
ATOM   4540 C  CD    . GLU D 4 487 ? -34.868 -23.328 54.120 1.00 60.00  ? 487 GLU D CD    1 
ATOM   4541 O  OE1   . GLU D 4 487 ? -34.961 -23.761 55.299 1.00 58.72  ? 487 GLU D OE1   1 
ATOM   4542 O  OE2   . GLU D 4 487 ? -33.779 -22.953 53.605 1.00 61.17  ? 487 GLU D OE2   1 
ATOM   4543 N  N     . ASN D 4 488 ? -35.523 -19.489 50.572 1.00 45.82  ? 488 ASN D N     1 
ATOM   4544 C  CA    . ASN D 4 488 ? -34.905 -18.727 49.488 1.00 45.38  ? 488 ASN D CA    1 
ATOM   4545 C  C     . ASN D 4 488 ? -33.980 -17.675 50.092 1.00 44.15  ? 488 ASN D C     1 
ATOM   4546 O  O     . ASN D 4 488 ? -32.807 -17.565 49.711 1.00 44.03  ? 488 ASN D O     1 
ATOM   4547 C  CB    . ASN D 4 488 ? -35.978 -18.031 48.656 1.00 46.94  ? 488 ASN D CB    1 
ATOM   4548 C  CG    . ASN D 4 488 ? -36.409 -18.850 47.479 1.00 46.71  ? 488 ASN D CG    1 
ATOM   4549 O  OD1   . ASN D 4 488 ? -37.586 -18.863 47.111 1.00 44.49  ? 488 ASN D OD1   1 
ATOM   4550 N  ND2   . ASN D 4 488 ? -35.452 -19.537 46.865 1.00 47.38  ? 488 ASN D ND2   1 
ATOM   4551 N  N     . ILE D 4 489 ? -34.520 -16.914 51.045 1.00 41.62  ? 489 ILE D N     1 
ATOM   4552 C  CA    . ILE D 4 489 ? -33.764 -15.868 51.719 1.00 41.66  ? 489 ILE D CA    1 
ATOM   4553 C  C     . ILE D 4 489 ? -32.503 -16.408 52.412 1.00 43.44  ? 489 ILE D C     1 
ATOM   4554 O  O     . ILE D 4 489 ? -31.410 -15.866 52.208 1.00 44.01  ? 489 ILE D O     1 
ATOM   4555 C  CB    . ILE D 4 489 ? -34.649 -15.131 52.731 1.00 39.27  ? 489 ILE D CB    1 
ATOM   4556 C  CG1   . ILE D 4 489 ? -35.847 -14.510 52.007 1.00 37.07  ? 489 ILE D CG1   1 
ATOM   4557 C  CG2   . ILE D 4 489 ? -33.857 -14.043 53.405 1.00 38.36  ? 489 ILE D CG2   1 
ATOM   4558 C  CD1   . ILE D 4 489 ? -36.989 -14.096 52.910 1.00 34.25  ? 489 ILE D CD1   1 
ATOM   4559 N  N     . MET D 4 490 ? -32.649 -17.470 53.211 1.00 43.34  ? 490 MET D N     1 
ATOM   4560 C  CA    . MET D 4 490 ? -31.514 -18.089 53.908 1.00 43.28  ? 490 MET D CA    1 
ATOM   4561 C  C     . MET D 4 490 ? -30.458 -18.562 52.914 1.00 44.06  ? 490 MET D C     1 
ATOM   4562 O  O     . MET D 4 490 ? -29.250 -18.508 53.193 1.00 42.18  ? 490 MET D O     1 
ATOM   4563 C  CB    . MET D 4 490 ? -31.965 -19.303 54.708 1.00 43.36  ? 490 MET D CB    1 
ATOM   4564 C  CG    . MET D 4 490 ? -32.991 -19.023 55.775 1.00 45.63  ? 490 MET D CG    1 
ATOM   4565 S  SD    . MET D 4 490 ? -32.368 -17.789 56.870 1.00 49.19  ? 490 MET D SD    1 
ATOM   4566 C  CE    . MET D 4 490 ? -31.062 -18.647 57.690 1.00 47.04  ? 490 MET D CE    1 
ATOM   4567 N  N     . ALA D 4 491 ? -30.929 -19.037 51.760 1.00 44.45  ? 491 ALA D N     1 
ATOM   4568 C  CA    . ALA D 4 491 ? -30.052 -19.538 50.705 1.00 44.97  ? 491 ALA D CA    1 
ATOM   4569 C  C     . ALA D 4 491 ? -29.195 -18.431 50.134 1.00 45.08  ? 491 ALA D C     1 
ATOM   4570 O  O     . ALA D 4 491 ? -27.984 -18.578 50.017 1.00 45.11  ? 491 ALA D O     1 
ATOM   4571 C  CB    . ALA D 4 491 ? -30.879 -20.177 49.592 1.00 44.13  ? 491 ALA D CB    1 
ATOM   4572 N  N     . CYS D 4 492 ? -29.838 -17.331 49.761 1.00 46.00  ? 492 CYS D N     1 
ATOM   4573 C  CA    . CYS D 4 492 ? -29.137 -16.177 49.206 1.00 46.26  ? 492 CYS D CA    1 
ATOM   4574 C  C     . CYS D 4 492 ? -28.174 -15.658 50.254 1.00 44.07  ? 492 CYS D C     1 
ATOM   4575 O  O     . CYS D 4 492 ? -27.114 -15.140 49.932 1.00 44.37  ? 492 CYS D O     1 
ATOM   4576 C  CB    . CYS D 4 492 ? -30.139 -15.078 48.838 1.00 48.69  ? 492 CYS D CB    1 
ATOM   4577 S  SG    . CYS D 4 492 ? -31.320 -15.577 47.545 1.00 59.09  ? 492 CYS D SG    1 
ATOM   4578 N  N     . ALA D 4 493 ? -28.553 -15.808 51.515 1.00 42.44  ? 493 ALA D N     1 
ATOM   4579 C  CA    . ALA D 4 493 ? -27.725 -15.366 52.623 1.00 43.07  ? 493 ALA D CA    1 
ATOM   4580 C  C     . ALA D 4 493 ? -26.487 -16.255 52.765 1.00 44.09  ? 493 ALA D C     1 
ATOM   4581 O  O     . ALA D 4 493 ? -25.367 -15.760 52.913 1.00 42.31  ? 493 ALA D O     1 
ATOM   4582 C  CB    . ALA D 4 493 ? -28.532 -15.400 53.891 1.00 41.77  ? 493 ALA D CB    1 
ATOM   4583 N  N     . LYS D 4 494 ? -26.711 -17.569 52.716 1.00 45.65  ? 494 LYS D N     1 
ATOM   4584 C  CA    . LYS D 4 494 ? -25.657 -18.580 52.837 1.00 46.44  ? 494 LYS D CA    1 
ATOM   4585 C  C     . LYS D 4 494 ? -24.674 -18.516 51.670 1.00 47.49  ? 494 LYS D C     1 
ATOM   4586 O  O     . LYS D 4 494 ? -23.462 -18.489 51.879 1.00 48.02  ? 494 LYS D O     1 
ATOM   4587 C  CB    . LYS D 4 494 ? -26.295 -19.976 52.911 1.00 46.36  ? 494 LYS D CB    1 
ATOM   4588 C  CG    . LYS D 4 494 ? -25.332 -21.133 53.076 1.00 48.78  ? 494 LYS D CG    1 
ATOM   4589 C  CD    . LYS D 4 494 ? -24.751 -21.209 54.478 1.00 51.62  ? 494 LYS D CD    1 
ATOM   4590 C  CE    . LYS D 4 494 ? -25.770 -21.750 55.492 1.00 53.47  ? 494 LYS D CE    1 
ATOM   4591 N  NZ    . LYS D 4 494 ? -25.333 -21.562 56.923 1.00 51.84  ? 494 LYS D NZ    1 
ATOM   4592 N  N     . SER D 4 495 ? -25.194 -18.475 50.446 1.00 47.94  ? 495 SER D N     1 
ATOM   4593 C  CA    . SER D 4 495 ? -24.342 -18.430 49.259 1.00 50.68  ? 495 SER D CA    1 
ATOM   4594 C  C     . SER D 4 495 ? -24.883 -17.493 48.177 1.00 50.85  ? 495 SER D C     1 
ATOM   4595 O  O     . SER D 4 495 ? -25.419 -17.939 47.159 1.00 48.75  ? 495 SER D O     1 
ATOM   4596 C  CB    . SER D 4 495 ? -24.176 -19.842 48.671 1.00 51.86  ? 495 SER D CB    1 
ATOM   4597 O  OG    . SER D 4 495 ? -23.467 -20.706 49.552 1.00 54.57  ? 495 SER D OG    1 
ATOM   4598 N  N     . PRO D 4 496 ? -24.709 -16.177 48.367 1.00 50.99  ? 496 PRO D N     1 
ATOM   4599 C  CA    . PRO D 4 496 ? -25.191 -15.185 47.401 1.00 51.76  ? 496 PRO D CA    1 
ATOM   4600 C  C     . PRO D 4 496 ? -24.735 -15.400 45.957 1.00 52.70  ? 496 PRO D C     1 
ATOM   4601 O  O     . PRO D 4 496 ? -25.536 -15.257 45.039 1.00 51.87  ? 496 PRO D O     1 
ATOM   4602 C  CB    . PRO D 4 496 ? -24.703 -13.859 47.994 1.00 50.37  ? 496 PRO D CB    1 
ATOM   4603 C  CG    . PRO D 4 496 ? -23.452 -14.253 48.700 1.00 50.19  ? 496 PRO D CG    1 
ATOM   4604 C  CD    . PRO D 4 496 ? -23.842 -15.548 49.377 1.00 50.23  ? 496 PRO D CD    1 
ATOM   4605 N  N     . LEU D 4 497 ? -23.464 -15.741 45.746 1.00 54.19  ? 497 LEU D N     1 
ATOM   4606 C  CA    . LEU D 4 497 ? -22.981 -15.963 44.385 1.00 56.48  ? 497 LEU D CA    1 
ATOM   4607 C  C     . LEU D 4 497 ? -23.341 -17.333 43.811 1.00 57.58  ? 497 LEU D C     1 
ATOM   4608 O  O     . LEU D 4 497 ? -22.820 -17.711 42.767 1.00 59.28  ? 497 LEU D O     1 
ATOM   4609 C  CB    . LEU D 4 497 ? -21.471 -15.773 44.297 1.00 57.45  ? 497 LEU D CB    1 
ATOM   4610 C  CG    . LEU D 4 497 ? -20.721 -15.381 45.564 1.00 60.99  ? 497 LEU D CG    1 
ATOM   4611 C  CD1   . LEU D 4 497 ? -20.759 -16.545 46.600 1.00 62.16  ? 497 LEU D CD1   1 
ATOM   4612 C  CD2   . LEU D 4 497 ? -19.283 -15.027 45.181 1.00 59.33  ? 497 LEU D CD2   1 
ATOM   4613 N  N     . GLU D 4 498 ? -24.217 -18.068 44.495 1.00 57.27  ? 498 GLU D N     1 
ATOM   4614 C  CA    . GLU D 4 498 ? -24.675 -19.381 44.043 1.00 57.62  ? 498 GLU D CA    1 
ATOM   4615 C  C     . GLU D 4 498 ? -26.195 -19.390 44.049 1.00 56.86  ? 498 GLU D C     1 
ATOM   4616 O  O     . GLU D 4 498 ? -26.838 -19.989 43.194 1.00 57.85  ? 498 GLU D O     1 
ATOM   4617 C  CB    . GLU D 4 498 ? -24.190 -20.490 44.967 1.00 60.24  ? 498 GLU D CB    1 
ATOM   4618 C  CG    . GLU D 4 498 ? -22.747 -20.896 44.802 1.00 63.72  ? 498 GLU D CG    1 
ATOM   4619 C  CD    . GLU D 4 498 ? -22.407 -22.067 45.702 1.00 67.44  ? 498 GLU D CD    1 
ATOM   4620 O  OE1   . GLU D 4 498 ? -23.191 -23.043 45.718 1.00 69.88  ? 498 GLU D OE1   1 
ATOM   4621 O  OE2   . GLU D 4 498 ? -21.366 -22.020 46.397 1.00 70.30  ? 498 GLU D OE2   1 
ATOM   4622 N  N     . ASN D 4 499 ? -26.764 -18.739 45.050 1.00 55.59  ? 499 ASN D N     1 
ATOM   4623 C  CA    . ASN D 4 499 ? -28.205 -18.631 45.179 1.00 53.38  ? 499 ASN D CA    1 
ATOM   4624 C  C     . ASN D 4 499 ? -28.504 -17.171 44.923 1.00 53.31  ? 499 ASN D C     1 
ATOM   4625 O  O     . ASN D 4 499 ? -28.617 -16.372 45.855 1.00 53.82  ? 499 ASN D O     1 
ATOM   4626 C  CB    . ASN D 4 499 ? -28.626 -19.018 46.580 1.00 53.55  ? 499 ASN D CB    1 
ATOM   4627 C  CG    . ASN D 4 499 ? -28.431 -20.478 46.844 1.00 53.67  ? 499 ASN D CG    1 
ATOM   4628 O  OD1   . ASN D 4 499 ? -28.376 -20.906 47.992 1.00 55.55  ? 499 ASN D OD1   1 
ATOM   4629 N  ND2   . ASN D 4 499 ? -28.336 -21.264 45.778 1.00 52.10  ? 499 ASN D ND2   1 
ATOM   4630 N  N     . THR D 4 500 ? -28.617 -16.839 43.641 1.00 51.06  ? 500 THR D N     1 
ATOM   4631 C  CA    . THR D 4 500 ? -28.853 -15.486 43.220 1.00 48.83  ? 500 THR D CA    1 
ATOM   4632 C  C     . THR D 4 500 ? -30.318 -15.122 43.010 1.00 47.81  ? 500 THR D C     1 
ATOM   4633 O  O     . THR D 4 500 ? -30.649 -14.316 42.147 1.00 48.64  ? 500 THR D O     1 
ATOM   4634 C  CB    . THR D 4 500 ? -28.050 -15.199 41.943 1.00 50.38  ? 500 THR D CB    1 
ATOM   4635 O  OG1   . THR D 4 500 ? -28.541 -16.011 40.874 1.00 53.60  ? 500 THR D OG1   1 
ATOM   4636 C  CG2   . THR D 4 500 ? -26.576 -15.533 42.160 1.00 51.75  ? 500 THR D CG2   1 
ATOM   4637 N  N     . TRP D 4 501 ? -31.207 -15.698 43.804 1.00 46.09  ? 501 TRP D N     1 
ATOM   4638 C  CA    . TRP D 4 501 ? -32.616 -15.355 43.676 1.00 45.25  ? 501 TRP D CA    1 
ATOM   4639 C  C     . TRP D 4 501 ? -32.798 -13.859 44.040 1.00 45.92  ? 501 TRP D C     1 
ATOM   4640 O  O     . TRP D 4 501 ? -33.728 -13.186 43.570 1.00 45.29  ? 501 TRP D O     1 
ATOM   4641 C  CB    . TRP D 4 501 ? -33.437 -16.249 44.601 1.00 44.10  ? 501 TRP D CB    1 
ATOM   4642 C  CG    . TRP D 4 501 ? -34.842 -15.841 44.734 1.00 42.72  ? 501 TRP D CG    1 
ATOM   4643 C  CD1   . TRP D 4 501 ? -35.776 -15.806 43.753 1.00 42.34  ? 501 TRP D CD1   1 
ATOM   4644 C  CD2   . TRP D 4 501 ? -35.479 -15.355 45.920 1.00 42.61  ? 501 TRP D CD2   1 
ATOM   4645 N  NE1   . TRP D 4 501 ? -36.966 -15.323 44.251 1.00 41.53  ? 501 TRP D NE1   1 
ATOM   4646 C  CE2   . TRP D 4 501 ? -36.808 -15.044 45.582 1.00 42.68  ? 501 TRP D CE2   1 
ATOM   4647 C  CE3   . TRP D 4 501 ? -35.052 -15.150 47.236 1.00 43.37  ? 501 TRP D CE3   1 
ATOM   4648 C  CZ2   . TRP D 4 501 ? -37.722 -14.540 46.516 1.00 44.67  ? 501 TRP D CZ2   1 
ATOM   4649 C  CZ3   . TRP D 4 501 ? -35.957 -14.647 48.166 1.00 44.10  ? 501 TRP D CZ3   1 
ATOM   4650 C  CH2   . TRP D 4 501 ? -37.278 -14.351 47.801 1.00 44.06  ? 501 TRP D CH2   1 
ATOM   4651 N  N     . TRP D 4 502 ? -31.886 -13.343 44.861 1.00 45.22  ? 502 TRP D N     1 
ATOM   4652 C  CA    . TRP D 4 502 ? -31.917 -11.947 45.289 1.00 45.20  ? 502 TRP D CA    1 
ATOM   4653 C  C     . TRP D 4 502 ? -31.589 -10.957 44.173 1.00 46.38  ? 502 TRP D C     1 
ATOM   4654 O  O     . TRP D 4 502 ? -32.102 -9.837  44.158 1.00 47.03  ? 502 TRP D O     1 
ATOM   4655 C  CB    . TRP D 4 502 ? -30.918 -11.720 46.400 1.00 43.83  ? 502 TRP D CB    1 
ATOM   4656 C  CG    . TRP D 4 502 ? -29.528 -12.024 45.965 1.00 42.72  ? 502 TRP D CG    1 
ATOM   4657 C  CD1   . TRP D 4 502 ? -28.902 -13.231 46.022 1.00 42.07  ? 502 TRP D CD1   1 
ATOM   4658 C  CD2   . TRP D 4 502 ? -28.602 -11.121 45.359 1.00 43.04  ? 502 TRP D CD2   1 
ATOM   4659 N  NE1   . TRP D 4 502 ? -27.643 -13.140 45.494 1.00 42.62  ? 502 TRP D NE1   1 
ATOM   4660 C  CE2   . TRP D 4 502 ? -27.429 -11.856 45.074 1.00 42.76  ? 502 TRP D CE2   1 
ATOM   4661 C  CE3   . TRP D 4 502 ? -28.647 -9.763  45.024 1.00 41.06  ? 502 TRP D CE3   1 
ATOM   4662 C  CZ2   . TRP D 4 502 ? -26.308 -11.279 44.466 1.00 40.99  ? 502 TRP D CZ2   1 
ATOM   4663 C  CZ3   . TRP D 4 502 ? -27.530 -9.189  44.421 1.00 40.67  ? 502 TRP D CZ3   1 
ATOM   4664 C  CH2   . TRP D 4 502 ? -26.377 -9.949  44.148 1.00 38.90  ? 502 TRP D CH2   1 
ATOM   4665 N  N     . ALA D 4 503 ? -30.717 -11.346 43.252 1.00 46.11  ? 503 ALA D N     1 
ATOM   4666 C  CA    . ALA D 4 503 ? -30.364 -10.443 42.165 1.00 46.53  ? 503 ALA D CA    1 
ATOM   4667 C  C     . ALA D 4 503 ? -31.587 -10.253 41.282 1.00 47.18  ? 503 ALA D C     1 
ATOM   4668 O  O     . ALA D 4 503 ? -31.724 -9.268  40.571 1.00 49.68  ? 503 ALA D O     1 
ATOM   4669 C  CB    . ALA D 4 503 ? -29.213 -11.017 41.361 1.00 43.68  ? 503 ALA D CB    1 
ATOM   4670 N  N     . GLU D 4 504 ? -32.489 -11.210 41.348 1.00 49.13  ? 504 GLU D N     1 
ATOM   4671 C  CA    . GLU D 4 504 ? -33.693 -11.169 40.556 1.00 52.22  ? 504 GLU D CA    1 
ATOM   4672 C  C     . GLU D 4 504 ? -34.702 -10.123 41.042 1.00 51.94  ? 504 GLU D C     1 
ATOM   4673 O  O     . GLU D 4 504 ? -35.557 -9.689  40.282 1.00 53.36  ? 504 GLU D O     1 
ATOM   4674 C  CB    . GLU D 4 504 ? -34.314 -12.566 40.558 1.00 56.14  ? 504 GLU D CB    1 
ATOM   4675 C  CG    . GLU D 4 504 ? -35.682 -12.692 39.920 1.00 62.69  ? 504 GLU D CG    1 
ATOM   4676 C  CD    . GLU D 4 504 ? -36.230 -14.099 40.060 1.00 66.91  ? 504 GLU D CD    1 
ATOM   4677 O  OE1   . GLU D 4 504 ? -35.522 -15.042 39.637 1.00 70.37  ? 504 GLU D OE1   1 
ATOM   4678 O  OE2   . GLU D 4 504 ? -37.354 -14.267 40.592 1.00 68.92  ? 504 GLU D OE2   1 
ATOM   4679 N  N     . GLN D 4 505 ? -34.593 -9.695  42.292 1.00 51.35  ? 505 GLN D N     1 
ATOM   4680 C  CA    . GLN D 4 505 ? -35.542 -8.725  42.828 1.00 51.76  ? 505 GLN D CA    1 
ATOM   4681 C  C     . GLN D 4 505 ? -35.375 -7.273  42.331 1.00 52.23  ? 505 GLN D C     1 
ATOM   4682 O  O     . GLN D 4 505 ? -34.428 -6.952  41.617 1.00 52.48  ? 505 GLN D O     1 
ATOM   4683 C  CB    . GLN D 4 505 ? -35.500 -8.770  44.356 1.00 51.47  ? 505 GLN D CB    1 
ATOM   4684 C  CG    . GLN D 4 505 ? -35.539 -10.179 44.950 1.00 50.73  ? 505 GLN D CG    1 
ATOM   4685 C  CD    . GLN D 4 505 ? -36.683 -11.037 44.413 1.00 51.31  ? 505 GLN D CD    1 
ATOM   4686 O  OE1   . GLN D 4 505 ? -37.851 -10.608 44.367 1.00 47.52  ? 505 GLN D OE1   1 
ATOM   4687 N  NE2   . GLN D 4 505 ? -36.352 -12.268 44.017 1.00 49.06  ? 505 GLN D NE2   1 
ATOM   4688 N  N     . ASP D 4 506 ? -36.312 -6.407  42.713 1.00 51.79  ? 506 ASP D N     1 
ATOM   4689 C  CA    . ASP D 4 506 ? -36.294 -5.002  42.315 1.00 52.12  ? 506 ASP D CA    1 
ATOM   4690 C  C     . ASP D 4 506 ? -35.083 -4.257  42.846 1.00 52.16  ? 506 ASP D C     1 
ATOM   4691 O  O     . ASP D 4 506 ? -34.389 -3.582  42.088 1.00 53.76  ? 506 ASP D O     1 
ATOM   4692 C  CB    . ASP D 4 506 ? -37.562 -4.305  42.800 1.00 54.67  ? 506 ASP D CB    1 
ATOM   4693 C  CG    . ASP D 4 506 ? -38.813 -4.916  42.215 1.00 59.16  ? 506 ASP D CG    1 
ATOM   4694 O  OD1   . ASP D 4 506 ? -38.918 -6.164  42.228 1.00 62.57  ? 506 ASP D OD1   1 
ATOM   4695 O  OD2   . ASP D 4 506 ? -39.691 -4.158  41.747 1.00 60.97  ? 506 ASP D OD2   1 
ATOM   4696 N  N     . SER D 4 507 ? -34.856 -4.347  44.155 1.00 50.36  ? 507 SER D N     1 
ATOM   4697 C  CA    . SER D 4 507 ? -33.717 -3.701  44.795 1.00 47.77  ? 507 SER D CA    1 
ATOM   4698 C  C     . SER D 4 507 ? -32.868 -4.870  45.209 1.00 46.98  ? 507 SER D C     1 
ATOM   4699 O  O     . SER D 4 507 ? -32.760 -5.203  46.385 1.00 46.38  ? 507 SER D O     1 
ATOM   4700 C  CB    . SER D 4 507 ? -34.158 -2.937  46.029 1.00 47.61  ? 507 SER D CB    1 
ATOM   4701 O  OG    . SER D 4 507 ? -35.238 -2.093  45.724 1.00 50.22  ? 507 SER D OG    1 
ATOM   4702 N  N     . PRO D 4 508 ? -32.235 -5.512  44.234 1.00 46.37  ? 508 PRO D N     1 
ATOM   4703 C  CA    . PRO D 4 508 ? -31.413 -6.666  44.580 1.00 44.64  ? 508 PRO D CA    1 
ATOM   4704 C  C     . PRO D 4 508 ? -30.390 -6.471  45.692 1.00 41.94  ? 508 PRO D C     1 
ATOM   4705 O  O     . PRO D 4 508 ? -30.371 -7.253  46.645 1.00 42.98  ? 508 PRO D O     1 
ATOM   4706 C  CB    . PRO D 4 508 ? -30.806 -7.075  43.231 1.00 43.67  ? 508 PRO D CB    1 
ATOM   4707 C  CG    . PRO D 4 508 ? -30.721 -5.796  42.505 1.00 45.80  ? 508 PRO D CG    1 
ATOM   4708 C  CD    . PRO D 4 508 ? -32.015 -5.100  42.840 1.00 44.95  ? 508 PRO D CD    1 
ATOM   4709 N  N     . PHE D 4 509 ? -29.559 -5.443  45.613 1.00 39.70  ? 509 PHE D N     1 
ATOM   4710 C  CA    . PHE D 4 509 ? -28.556 -5.283  46.659 1.00 38.69  ? 509 PHE D CA    1 
ATOM   4711 C  C     . PHE D 4 509 ? -29.159 -4.930  48.009 1.00 38.23  ? 509 PHE D C     1 
ATOM   4712 O  O     . PHE D 4 509 ? -28.691 -5.376  49.043 1.00 36.98  ? 509 PHE D O     1 
ATOM   4713 C  CB    . PHE D 4 509 ? -27.520 -4.268  46.218 1.00 36.77  ? 509 PHE D CB    1 
ATOM   4714 C  CG    . PHE D 4 509 ? -26.616 -4.789  45.142 1.00 37.39  ? 509 PHE D CG    1 
ATOM   4715 C  CD1   . PHE D 4 509 ? -25.661 -5.759  45.435 1.00 35.87  ? 509 PHE D CD1   1 
ATOM   4716 C  CD2   . PHE D 4 509 ? -26.743 -4.353  43.834 1.00 35.75  ? 509 PHE D CD2   1 
ATOM   4717 C  CE1   . PHE D 4 509 ? -24.860 -6.282  44.456 1.00 32.27  ? 509 PHE D CE1   1 
ATOM   4718 C  CE2   . PHE D 4 509 ? -25.935 -4.879  42.843 1.00 33.76  ? 509 PHE D CE2   1 
ATOM   4719 C  CZ    . PHE D 4 509 ? -24.997 -5.844  43.158 1.00 33.79  ? 509 PHE D CZ    1 
ATOM   4720 N  N     . CYS D 4 510 ? -30.226 -4.149  47.998 1.00 38.80  ? 510 CYS D N     1 
ATOM   4721 C  CA    . CYS D 4 510 ? -30.868 -3.805  49.243 1.00 38.53  ? 510 CYS D CA    1 
ATOM   4722 C  C     . CYS D 4 510 ? -31.644 -5.018  49.733 1.00 37.40  ? 510 CYS D C     1 
ATOM   4723 O  O     . CYS D 4 510 ? -31.803 -5.228  50.937 1.00 37.14  ? 510 CYS D O     1 
ATOM   4724 C  CB    . CYS D 4 510 ? -31.775 -2.598  49.042 1.00 40.17  ? 510 CYS D CB    1 
ATOM   4725 S  SG    . CYS D 4 510 ? -30.824 -1.069  48.792 1.00 45.98  ? 510 CYS D SG    1 
ATOM   4726 N  N     . PHE D 4 511 ? -32.121 -5.830  48.803 1.00 36.07  ? 511 PHE D N     1 
ATOM   4727 C  CA    . PHE D 4 511 ? -32.841 -7.024  49.200 1.00 36.61  ? 511 PHE D CA    1 
ATOM   4728 C  C     . PHE D 4 511 ? -31.830 -8.005  49.791 1.00 35.96  ? 511 PHE D C     1 
ATOM   4729 O  O     . PHE D 4 511 ? -32.076 -8.609  50.844 1.00 33.41  ? 511 PHE D O     1 
ATOM   4730 C  CB    . PHE D 4 511 ? -33.541 -7.677  48.019 1.00 36.88  ? 511 PHE D CB    1 
ATOM   4731 C  CG    . PHE D 4 511 ? -34.370 -8.859  48.408 1.00 39.24  ? 511 PHE D CG    1 
ATOM   4732 C  CD1   . PHE D 4 511 ? -35.588 -8.681  49.053 1.00 39.17  ? 511 PHE D CD1   1 
ATOM   4733 C  CD2   . PHE D 4 511 ? -33.918 -10.154 48.169 1.00 39.75  ? 511 PHE D CD2   1 
ATOM   4734 C  CE1   . PHE D 4 511 ? -36.348 -9.782  49.458 1.00 41.12  ? 511 PHE D CE1   1 
ATOM   4735 C  CE2   . PHE D 4 511 ? -34.670 -11.255 48.567 1.00 40.31  ? 511 PHE D CE2   1 
ATOM   4736 C  CZ    . PHE D 4 511 ? -35.890 -11.070 49.215 1.00 40.14  ? 511 PHE D CZ    1 
ATOM   4737 N  N     . LEU D 4 512 ? -30.699 -8.165  49.101 1.00 34.63  ? 512 LEU D N     1 
ATOM   4738 C  CA    . LEU D 4 512 ? -29.630 -9.042  49.577 1.00 33.80  ? 512 LEU D CA    1 
ATOM   4739 C  C     . LEU D 4 512 ? -29.220 -8.560  50.973 1.00 34.27  ? 512 LEU D C     1 
ATOM   4740 O  O     . LEU D 4 512 ? -29.056 -9.345  51.912 1.00 36.17  ? 512 LEU D O     1 
ATOM   4741 C  CB    . LEU D 4 512 ? -28.426 -8.964  48.639 1.00 31.98  ? 512 LEU D CB    1 
ATOM   4742 C  CG    . LEU D 4 512 ? -27.198 -9.802  48.994 1.00 29.14  ? 512 LEU D CG    1 
ATOM   4743 C  CD1   . LEU D 4 512 ? -27.577 -11.260 48.992 1.00 29.88  ? 512 LEU D CD1   1 
ATOM   4744 C  CD2   . LEU D 4 512 ? -26.094 -9.547  47.999 1.00 25.60  ? 512 LEU D CD2   1 
ATOM   4745 N  N     . ALA D 4 513 ? -29.050 -7.252  51.098 1.00 34.33  ? 513 ALA D N     1 
ATOM   4746 C  CA    . ALA D 4 513 ? -28.686 -6.662  52.365 1.00 32.54  ? 513 ALA D CA    1 
ATOM   4747 C  C     . ALA D 4 513 ? -29.690 -7.186  53.379 1.00 31.86  ? 513 ALA D C     1 
ATOM   4748 O  O     . ALA D 4 513 ? -29.321 -7.601  54.480 1.00 33.81  ? 513 ALA D O     1 
ATOM   4749 C  CB    . ALA D 4 513 ? -28.742 -5.143  52.271 1.00 32.27  ? 513 ALA D CB    1 
ATOM   4750 N  N     . PHE D 4 514 ? -30.961 -7.203  53.005 1.00 31.25  ? 514 PHE D N     1 
ATOM   4751 C  CA    . PHE D 4 514 ? -31.971 -7.713  53.924 1.00 32.62  ? 514 PHE D CA    1 
ATOM   4752 C  C     . PHE D 4 514 ? -31.848 -9.217  54.180 1.00 33.68  ? 514 PHE D C     1 
ATOM   4753 O  O     . PHE D 4 514 ? -32.080 -9.667  55.290 1.00 37.34  ? 514 PHE D O     1 
ATOM   4754 C  CB    . PHE D 4 514 ? -33.378 -7.369  53.421 1.00 30.56  ? 514 PHE D CB    1 
ATOM   4755 C  CG    . PHE D 4 514 ? -34.409 -8.396  53.754 1.00 28.17  ? 514 PHE D CG    1 
ATOM   4756 C  CD1   . PHE D 4 514 ? -34.611 -9.491  52.915 1.00 28.96  ? 514 PHE D CD1   1 
ATOM   4757 C  CD2   . PHE D 4 514 ? -35.163 -8.292  54.911 1.00 28.13  ? 514 PHE D CD2   1 
ATOM   4758 C  CE1   . PHE D 4 514 ? -35.554 -10.472 53.227 1.00 27.67  ? 514 PHE D CE1   1 
ATOM   4759 C  CE2   . PHE D 4 514 ? -36.106 -9.263  55.233 1.00 28.62  ? 514 PHE D CE2   1 
ATOM   4760 C  CZ    . PHE D 4 514 ? -36.301 -10.362 54.383 1.00 27.47  ? 514 PHE D CZ    1 
ATOM   4761 N  N     . CYS D 4 515 ? -31.493 -10.002 53.175 1.00 34.09  ? 515 CYS D N     1 
ATOM   4762 C  CA    . CYS D 4 515 ? -31.356 -11.443 53.390 1.00 36.80  ? 515 CYS D CA    1 
ATOM   4763 C  C     . CYS D 4 515 ? -30.302 -11.746 54.445 1.00 37.08  ? 515 CYS D C     1 
ATOM   4764 O  O     . CYS D 4 515 ? -30.502 -12.616 55.299 1.00 34.45  ? 515 CYS D O     1 
ATOM   4765 C  CB    . CYS D 4 515 ? -30.988 -12.153 52.092 1.00 38.28  ? 515 CYS D CB    1 
ATOM   4766 S  SG    . CYS D 4 515 ? -32.329 -12.160 50.908 1.00 44.26  ? 515 CYS D SG    1 
ATOM   4767 N  N     . PHE D 4 516 ? -29.183 -11.025 54.375 1.00 36.67  ? 516 PHE D N     1 
ATOM   4768 C  CA    . PHE D 4 516 ? -28.101 -11.185 55.338 1.00 37.81  ? 516 PHE D CA    1 
ATOM   4769 C  C     . PHE D 4 516 ? -28.621 -10.908 56.753 1.00 39.62  ? 516 PHE D C     1 
ATOM   4770 O  O     . PHE D 4 516 ? -28.443 -11.715 57.664 1.00 41.29  ? 516 PHE D O     1 
ATOM   4771 C  CB    . PHE D 4 516 ? -26.976 -10.207 55.022 1.00 37.65  ? 516 PHE D CB    1 
ATOM   4772 C  CG    . PHE D 4 516 ? -26.151 -10.582 53.828 1.00 37.00  ? 516 PHE D CG    1 
ATOM   4773 C  CD1   . PHE D 4 516 ? -25.616 -9.595  53.005 1.00 36.69  ? 516 PHE D CD1   1 
ATOM   4774 C  CD2   . PHE D 4 516 ? -25.855 -11.909 53.554 1.00 33.80  ? 516 PHE D CD2   1 
ATOM   4775 C  CE1   . PHE D 4 516 ? -24.795 -9.929  51.932 1.00 36.15  ? 516 PHE D CE1   1 
ATOM   4776 C  CE2   . PHE D 4 516 ? -25.040 -12.243 52.489 1.00 33.14  ? 516 PHE D CE2   1 
ATOM   4777 C  CZ    . PHE D 4 516 ? -24.508 -11.256 51.678 1.00 33.60  ? 516 PHE D CZ    1 
ATOM   4778 N  N     . GLU D 4 517 ? -29.263 -9.757  56.934 1.00 40.82  ? 517 GLU D N     1 
ATOM   4779 C  CA    . GLU D 4 517 ? -29.810 -9.395  58.228 1.00 39.93  ? 517 GLU D CA    1 
ATOM   4780 C  C     . GLU D 4 517 ? -30.827 -10.407 58.644 1.00 38.91  ? 517 GLU D C     1 
ATOM   4781 O  O     . GLU D 4 517 ? -30.850 -10.821 59.801 1.00 41.11  ? 517 GLU D O     1 
ATOM   4782 C  CB    . GLU D 4 517 ? -30.462 -8.013  58.193 1.00 42.49  ? 517 GLU D CB    1 
ATOM   4783 C  CG    . GLU D 4 517 ? -29.453 -6.904  57.993 1.00 47.73  ? 517 GLU D CG    1 
ATOM   4784 C  CD    . GLU D 4 517 ? -28.127 -7.213  58.676 1.00 49.99  ? 517 GLU D CD    1 
ATOM   4785 O  OE1   . GLU D 4 517 ? -28.065 -7.185  59.925 1.00 49.95  ? 517 GLU D OE1   1 
ATOM   4786 O  OE2   . GLU D 4 517 ? -27.150 -7.507  57.952 1.00 53.00  ? 517 GLU D OE2   1 
ATOM   4787 N  N     . TYR D 4 518 ? -31.675 -10.815 57.710 1.00 37.28  ? 518 TYR D N     1 
ATOM   4788 C  CA    . TYR D 4 518 ? -32.702 -11.796 58.030 1.00 36.58  ? 518 TYR D CA    1 
ATOM   4789 C  C     . TYR D 4 518 ? -32.077 -13.114 58.481 1.00 35.41  ? 518 TYR D C     1 
ATOM   4790 O  O     . TYR D 4 518 ? -32.475 -13.684 59.505 1.00 33.26  ? 518 TYR D O     1 
ATOM   4791 C  CB    . TYR D 4 518 ? -33.588 -12.016 56.828 1.00 37.38  ? 518 TYR D CB    1 
ATOM   4792 C  CG    . TYR D 4 518 ? -34.656 -13.032 57.059 1.00 36.95  ? 518 TYR D CG    1 
ATOM   4793 C  CD1   . TYR D 4 518 ? -34.362 -14.389 57.012 1.00 37.21  ? 518 TYR D CD1   1 
ATOM   4794 C  CD2   . TYR D 4 518 ? -35.983 -12.639 57.272 1.00 35.83  ? 518 TYR D CD2   1 
ATOM   4795 C  CE1   . TYR D 4 518 ? -35.374 -15.343 57.158 1.00 40.35  ? 518 TYR D CE1   1 
ATOM   4796 C  CE2   . TYR D 4 518 ? -36.994 -13.574 57.423 1.00 37.24  ? 518 TYR D CE2   1 
ATOM   4797 C  CZ    . TYR D 4 518 ? -36.682 -14.922 57.356 1.00 39.82  ? 518 TYR D CZ    1 
ATOM   4798 O  OH    . TYR D 4 518 ? -37.674 -15.857 57.430 1.00 44.01  ? 518 TYR D OH    1 
ATOM   4799 N  N     . ALA D 4 519 ? -31.093 -13.586 57.717 1.00 33.77  ? 519 ALA D N     1 
ATOM   4800 C  CA    . ALA D 4 519 ? -30.385 -14.815 58.061 1.00 32.05  ? 519 ALA D CA    1 
ATOM   4801 C  C     . ALA D 4 519 ? -29.782 -14.620 59.441 1.00 32.43  ? 519 ALA D C     1 
ATOM   4802 O  O     . ALA D 4 519 ? -29.756 -15.546 60.254 1.00 32.80  ? 519 ALA D O     1 
ATOM   4803 C  CB    . ALA D 4 519 ? -29.294 -15.094 57.057 1.00 27.89  ? 519 ALA D CB    1 
ATOM   4804 N  N     . GLY D 4 520 ? -29.297 -13.406 59.696 1.00 31.77  ? 520 GLY D N     1 
ATOM   4805 C  CA    . GLY D 4 520 ? -28.714 -13.088 60.988 1.00 33.29  ? 520 GLY D CA    1 
ATOM   4806 C  C     . GLY D 4 520 ? -29.719 -13.251 62.114 1.00 35.61  ? 520 GLY D C     1 
ATOM   4807 O  O     . GLY D 4 520 ? -29.404 -13.813 63.161 1.00 38.12  ? 520 GLY D O     1 
ATOM   4808 N  N     . VAL D 4 521 ? -30.939 -12.767 61.918 1.00 36.57  ? 521 VAL D N     1 
ATOM   4809 C  CA    . VAL D 4 521 ? -31.955 -12.911 62.952 1.00 36.46  ? 521 VAL D CA    1 
ATOM   4810 C  C     . VAL D 4 521 ? -32.214 -14.396 63.181 1.00 37.17  ? 521 VAL D C     1 
ATOM   4811 O  O     . VAL D 4 521 ? -32.472 -14.802 64.302 1.00 36.66  ? 521 VAL D O     1 
ATOM   4812 C  CB    . VAL D 4 521 ? -33.282 -12.204 62.562 1.00 35.99  ? 521 VAL D CB    1 
ATOM   4813 C  CG1   . VAL D 4 521 ? -34.302 -12.384 63.643 1.00 32.66  ? 521 VAL D CG1   1 
ATOM   4814 C  CG2   . VAL D 4 521 ? -33.036 -10.715 62.334 1.00 38.06  ? 521 VAL D CG2   1 
ATOM   4815 N  N     . GLN D 4 522 ? -32.138 -15.212 62.130 1.00 38.14  ? 522 GLN D N     1 
ATOM   4816 C  CA    . GLN D 4 522 ? -32.365 -16.657 62.288 1.00 39.55  ? 522 GLN D CA    1 
ATOM   4817 C  C     . GLN D 4 522 ? -31.261 -17.295 63.133 1.00 39.31  ? 522 GLN D C     1 
ATOM   4818 O  O     . GLN D 4 522 ? -31.528 -18.067 64.048 1.00 39.09  ? 522 GLN D O     1 
ATOM   4819 C  CB    . GLN D 4 522 ? -32.421 -17.351 60.930 1.00 41.26  ? 522 GLN D CB    1 
ATOM   4820 C  CG    . GLN D 4 522 ? -33.436 -16.759 60.001 1.00 43.44  ? 522 GLN D CG    1 
ATOM   4821 C  CD    . GLN D 4 522 ? -34.811 -16.776 60.603 1.00 47.13  ? 522 GLN D CD    1 
ATOM   4822 O  OE1   . GLN D 4 522 ? -35.608 -15.847 60.399 1.00 48.06  ? 522 GLN D OE1   1 
ATOM   4823 N  NE2   . GLN D 4 522 ? -35.111 -17.834 61.352 1.00 46.75  ? 522 GLN D NE2   1 
ATOM   4824 N  N     . HIS D 4 523 ? -30.015 -16.965 62.833 1.00 39.50  ? 523 HIS D N     1 
ATOM   4825 C  CA    . HIS D 4 523 ? -28.906 -17.507 63.604 1.00 41.12  ? 523 HIS D CA    1 
ATOM   4826 C  C     . HIS D 4 523 ? -28.831 -17.000 65.043 1.00 40.52  ? 523 HIS D C     1 
ATOM   4827 O  O     . HIS D 4 523 ? -28.264 -17.680 65.883 1.00 41.17  ? 523 HIS D O     1 
ATOM   4828 C  CB    . HIS D 4 523 ? -27.569 -17.169 62.949 1.00 41.60  ? 523 HIS D CB    1 
ATOM   4829 C  CG    . HIS D 4 523 ? -27.465 -17.605 61.530 1.00 45.30  ? 523 HIS D CG    1 
ATOM   4830 N  ND1   . HIS D 4 523 ? -27.887 -18.845 61.105 1.00 43.99  ? 523 HIS D ND1   1 
ATOM   4831 C  CD2   . HIS D 4 523 ? -26.954 -16.982 60.440 1.00 46.10  ? 523 HIS D CD2   1 
ATOM   4832 C  CE1   . HIS D 4 523 ? -27.641 -18.970 59.814 1.00 44.81  ? 523 HIS D CE1   1 
ATOM   4833 N  NE2   . HIS D 4 523 ? -27.075 -17.854 59.387 1.00 48.03  ? 523 HIS D NE2   1 
ATOM   4834 N  N     . HIS D 4 524 ? -29.369 -15.813 65.332 1.00 40.12  ? 524 HIS D N     1 
ATOM   4835 C  CA    . HIS D 4 524 ? -29.258 -15.272 66.684 1.00 40.53  ? 524 HIS D CA    1 
ATOM   4836 C  C     . HIS D 4 524 ? -30.490 -14.861 67.474 1.00 38.09  ? 524 HIS D C     1 
ATOM   4837 O  O     . HIS D 4 524 ? -30.368 -14.534 68.643 1.00 39.10  ? 524 HIS D O     1 
ATOM   4838 C  CB    . HIS D 4 524 ? -28.303 -14.090 66.672 1.00 43.69  ? 524 HIS D CB    1 
ATOM   4839 C  CG    . HIS D 4 524 ? -26.985 -14.401 66.053 1.00 47.94  ? 524 HIS D CG    1 
ATOM   4840 N  ND1   . HIS D 4 524 ? -26.821 -14.536 64.692 1.00 50.03  ? 524 HIS D ND1   1 
ATOM   4841 C  CD2   . HIS D 4 524 ? -25.782 -14.673 66.608 1.00 49.57  ? 524 HIS D CD2   1 
ATOM   4842 C  CE1   . HIS D 4 524 ? -25.572 -14.879 64.434 1.00 49.84  ? 524 HIS D CE1   1 
ATOM   4843 N  NE2   . HIS D 4 524 ? -24.921 -14.970 65.580 1.00 50.06  ? 524 HIS D NE2   1 
ATOM   4844 N  N     . GLY D 4 525 ? -31.661 -14.851 66.855 1.00 37.33  ? 525 GLY D N     1 
ATOM   4845 C  CA    . GLY D 4 525 ? -32.861 -14.466 67.573 1.00 34.79  ? 525 GLY D CA    1 
ATOM   4846 C  C     . GLY D 4 525 ? -33.045 -12.962 67.645 1.00 36.44  ? 525 GLY D C     1 
ATOM   4847 O  O     . GLY D 4 525 ? -32.176 -12.185 67.251 1.00 38.46  ? 525 GLY D O     1 
ATOM   4848 N  N     . LEU D 4 526 ? -34.182 -12.557 68.180 1.00 34.76  ? 526 LEU D N     1 
ATOM   4849 C  CA    . LEU D 4 526 ? -34.542 -11.166 68.307 1.00 33.92  ? 526 LEU D CA    1 
ATOM   4850 C  C     . LEU D 4 526 ? -33.537 -10.259 68.996 1.00 34.26  ? 526 LEU D C     1 
ATOM   4851 O  O     . LEU D 4 526 ? -33.711 -9.043  69.031 1.00 34.99  ? 526 LEU D O     1 
ATOM   4852 C  CB    . LEU D 4 526 ? -35.905 -11.073 68.998 1.00 33.23  ? 526 LEU D CB    1 
ATOM   4853 C  CG    . LEU D 4 526 ? -36.973 -11.836 68.208 1.00 32.74  ? 526 LEU D CG    1 
ATOM   4854 C  CD1   . LEU D 4 526 ? -38.354 -11.312 68.561 1.00 34.38  ? 526 LEU D CD1   1 
ATOM   4855 C  CD2   . LEU D 4 526 ? -36.718 -11.658 66.708 1.00 31.49  ? 526 LEU D CD2   1 
ATOM   4856 N  N     . SER D 4 527 ? -32.482 -10.841 69.536 1.00 36.01  ? 527 SER D N     1 
ATOM   4857 C  CA    . SER D 4 527 ? -31.452 -10.064 70.225 1.00 36.06  ? 527 SER D CA    1 
ATOM   4858 C  C     . SER D 4 527 ? -30.462 -9.531  69.219 1.00 34.65  ? 527 SER D C     1 
ATOM   4859 O  O     . SER D 4 527 ? -29.644 -8.671  69.529 1.00 33.77  ? 527 SER D O     1 
ATOM   4860 C  CB    . SER D 4 527 ? -30.704 -10.947 71.210 1.00 37.82  ? 527 SER D CB    1 
ATOM   4861 O  OG    . SER D 4 527 ? -30.824 -10.415 72.509 1.00 45.63  ? 527 SER D OG    1 
ATOM   4862 N  N     . TYR D 4 528 ? -30.536 -10.056 68.003 1.00 33.42  ? 528 TYR D N     1 
ATOM   4863 C  CA    . TYR D 4 528 ? -29.627 -9.636  66.957 1.00 31.92  ? 528 TYR D CA    1 
ATOM   4864 C  C     . TYR D 4 528 ? -29.536 -8.124  66.834 1.00 32.41  ? 528 TYR D C     1 
ATOM   4865 O  O     . TYR D 4 528 ? -30.543 -7.401  66.735 1.00 31.25  ? 528 TYR D O     1 
ATOM   4866 C  CB    . TYR D 4 528 ? -30.057 -10.222 65.634 1.00 31.32  ? 528 TYR D CB    1 
ATOM   4867 C  CG    . TYR D 4 528 ? -29.112 -9.947  64.500 1.00 32.31  ? 528 TYR D CG    1 
ATOM   4868 C  CD1   . TYR D 4 528 ? -27.826 -10.511 64.476 1.00 32.15  ? 528 TYR D CD1   1 
ATOM   4869 C  CD2   . TYR D 4 528 ? -29.524 -9.178  63.410 1.00 33.32  ? 528 TYR D CD2   1 
ATOM   4870 C  CE1   . TYR D 4 528 ? -26.989 -10.328 63.394 1.00 30.51  ? 528 TYR D CE1   1 
ATOM   4871 C  CE2   . TYR D 4 528 ? -28.702 -8.981  62.331 1.00 34.58  ? 528 TYR D CE2   1 
ATOM   4872 C  CZ    . TYR D 4 528 ? -27.441 -9.565  62.323 1.00 36.00  ? 528 TYR D CZ    1 
ATOM   4873 O  OH    . TYR D 4 528 ? -26.675 -9.419  61.199 1.00 41.06  ? 528 TYR D OH    1 
ATOM   4874 N  N     . ASN D 4 529 ? -28.303 -7.648  66.851 1.00 32.49  ? 529 ASN D N     1 
ATOM   4875 C  CA    . ASN D 4 529 ? -28.050 -6.244  66.718 1.00 31.75  ? 529 ASN D CA    1 
ATOM   4876 C  C     . ASN D 4 529 ? -28.137 -5.990  65.226 1.00 31.37  ? 529 ASN D C     1 
ATOM   4877 O  O     . ASN D 4 529 ? -27.394 -6.580  64.466 1.00 33.17  ? 529 ASN D O     1 
ATOM   4878 C  CB    . ASN D 4 529 ? -26.667 -5.922  67.255 1.00 31.63  ? 529 ASN D CB    1 
ATOM   4879 C  CG    . ASN D 4 529 ? -26.447 -4.450  67.378 1.00 35.50  ? 529 ASN D CG    1 
ATOM   4880 O  OD1   . ASN D 4 529 ? -26.334 -3.752  66.374 1.00 40.48  ? 529 ASN D OD1   1 
ATOM   4881 N  ND2   . ASN D 4 529 ? -26.418 -3.954  68.602 1.00 35.24  ? 529 ASN D ND2   1 
ATOM   4882 N  N     . CYS D 4 530 ? -29.072 -5.145  64.806 1.00 31.79  ? 530 CYS D N     1 
ATOM   4883 C  CA    . CYS D 4 530 ? -29.257 -4.859  63.387 1.00 32.79  ? 530 CYS D CA    1 
ATOM   4884 C  C     . CYS D 4 530 ? -29.213 -3.360  63.112 1.00 33.89  ? 530 CYS D C     1 
ATOM   4885 O  O     . CYS D 4 530 ? -29.738 -2.567  63.887 1.00 36.93  ? 530 CYS D O     1 
ATOM   4886 C  CB    . CYS D 4 530 ? -30.589 -5.433  62.920 1.00 33.14  ? 530 CYS D CB    1 
ATOM   4887 S  SG    . CYS D 4 530 ? -30.766 -5.416  61.140 1.00 36.84  ? 530 CYS D SG    1 
ATOM   4888 N  N     . SER D 4 531 ? -28.590 -2.963  62.011 1.00 32.34  ? 531 SER D N     1 
ATOM   4889 C  CA    . SER D 4 531 ? -28.487 -1.540  61.705 1.00 31.18  ? 531 SER D CA    1 
ATOM   4890 C  C     . SER D 4 531 ? -28.884 -1.255  60.277 1.00 31.52  ? 531 SER D C     1 
ATOM   4891 O  O     . SER D 4 531 ? -28.565 -0.205  59.731 1.00 30.94  ? 531 SER D O     1 
ATOM   4892 C  CB    . SER D 4 531 ? -27.051 -1.044  61.947 1.00 32.82  ? 531 SER D CB    1 
ATOM   4893 O  OG    . SER D 4 531 ? -26.087 -1.726  61.155 1.00 28.18  ? 531 SER D OG    1 
ATOM   4894 N  N     . LEU D 4 532 ? -29.598 -2.196  59.678 1.00 30.85  ? 532 LEU D N     1 
ATOM   4895 C  CA    . LEU D 4 532 ? -30.016 -2.054  58.304 1.00 32.66  ? 532 LEU D CA    1 
ATOM   4896 C  C     . LEU D 4 532 ? -31.007 -0.898  58.153 1.00 34.58  ? 532 LEU D C     1 
ATOM   4897 O  O     . LEU D 4 532 ? -32.040 -0.841  58.835 1.00 36.34  ? 532 LEU D O     1 
ATOM   4898 C  CB    . LEU D 4 532 ? -30.639 -3.362  57.828 1.00 30.94  ? 532 LEU D CB    1 
ATOM   4899 C  CG    . LEU D 4 532 ? -30.902 -3.372  56.327 1.00 32.26  ? 532 LEU D CG    1 
ATOM   4900 C  CD1   . LEU D 4 532 ? -29.603 -3.659  55.582 1.00 25.38  ? 532 LEU D CD1   1 
ATOM   4901 C  CD2   . LEU D 4 532 ? -31.967 -4.426  56.009 1.00 30.07  ? 532 LEU D CD2   1 
ATOM   4902 N  N     . PRO D 4 533 ? -30.704 0.058   57.268 1.00 33.77  ? 533 PRO D N     1 
ATOM   4903 C  CA    . PRO D 4 533 ? -31.662 1.153   57.137 1.00 30.86  ? 533 PRO D CA    1 
ATOM   4904 C  C     . PRO D 4 533 ? -32.924 0.638   56.496 1.00 29.56  ? 533 PRO D C     1 
ATOM   4905 O  O     . PRO D 4 533 ? -32.911 0.226   55.341 1.00 26.18  ? 533 PRO D O     1 
ATOM   4906 C  CB    . PRO D 4 533 ? -30.911 2.167   56.281 1.00 31.42  ? 533 PRO D CB    1 
ATOM   4907 C  CG    . PRO D 4 533 ? -30.025 1.329   55.452 1.00 33.34  ? 533 PRO D CG    1 
ATOM   4908 C  CD    . PRO D 4 533 ? -29.537 0.254   56.394 1.00 34.19  ? 533 PRO D CD    1 
ATOM   4909 N  N     . LEU D 4 534 ? -34.003 0.628   57.276 1.00 30.85  ? 534 LEU D N     1 
ATOM   4910 C  CA    . LEU D 4 534 ? -35.314 0.168   56.824 1.00 32.74  ? 534 LEU D CA    1 
ATOM   4911 C  C     . LEU D 4 534 ? -36.103 1.354   56.311 1.00 34.08  ? 534 LEU D C     1 
ATOM   4912 O  O     . LEU D 4 534 ? -36.546 2.180   57.082 1.00 36.32  ? 534 LEU D O     1 
ATOM   4913 C  CB    . LEU D 4 534 ? -36.079 -0.447  57.980 1.00 35.25  ? 534 LEU D CB    1 
ATOM   4914 C  CG    . LEU D 4 534 ? -35.533 -1.698  58.653 1.00 36.56  ? 534 LEU D CG    1 
ATOM   4915 C  CD1   . LEU D 4 534 ? -36.610 -2.260  59.546 1.00 34.96  ? 534 LEU D CD1   1 
ATOM   4916 C  CD2   . LEU D 4 534 ? -35.118 -2.719  57.600 1.00 37.08  ? 534 LEU D CD2   1 
ATOM   4917 N  N     . ALA D 4 535 ? -36.318 1.408   55.008 1.00 36.43  ? 535 ALA D N     1 
ATOM   4918 C  CA    . ALA D 4 535 ? -37.009 2.519   54.362 1.00 37.04  ? 535 ALA D CA    1 
ATOM   4919 C  C     . ALA D 4 535 ? -38.551 2.570   54.284 1.00 37.90  ? 535 ALA D C     1 
ATOM   4920 O  O     . ALA D 4 535 ? -39.193 1.619   53.851 1.00 39.17  ? 535 ALA D O     1 
ATOM   4921 C  CB    . ALA D 4 535 ? -36.448 2.647   52.966 1.00 33.30  ? 535 ALA D CB    1 
ATOM   4922 N  N     . PHE D 4 536 ? -39.119 3.706   54.686 1.00 40.24  ? 536 PHE D N     1 
ATOM   4923 C  CA    . PHE D 4 536 ? -40.567 3.984   54.597 1.00 42.65  ? 536 PHE D CA    1 
ATOM   4924 C  C     . PHE D 4 536 ? -40.697 5.100   53.543 1.00 44.52  ? 536 PHE D C     1 
ATOM   4925 O  O     . PHE D 4 536 ? -40.184 6.196   53.741 1.00 45.46  ? 536 PHE D O     1 
ATOM   4926 C  CB    . PHE D 4 536 ? -41.105 4.522   55.913 1.00 41.99  ? 536 PHE D CB    1 
ATOM   4927 C  CG    . PHE D 4 536 ? -41.127 3.511   57.006 1.00 47.30  ? 536 PHE D CG    1 
ATOM   4928 C  CD1   . PHE D 4 536 ? -41.820 2.315   56.845 1.00 48.59  ? 536 PHE D CD1   1 
ATOM   4929 C  CD2   . PHE D 4 536 ? -40.464 3.748   58.208 1.00 47.22  ? 536 PHE D CD2   1 
ATOM   4930 C  CE1   . PHE D 4 536 ? -41.850 1.377   57.864 1.00 47.63  ? 536 PHE D CE1   1 
ATOM   4931 C  CE2   . PHE D 4 536 ? -40.491 2.816   59.226 1.00 46.15  ? 536 PHE D CE2   1 
ATOM   4932 C  CZ    . PHE D 4 536 ? -41.185 1.630   59.055 1.00 47.16  ? 536 PHE D CZ    1 
ATOM   4933 N  N     . ASP D 4 537 ? -41.354 4.845   52.422 1.00 45.24  ? 537 ASP D N     1 
ATOM   4934 C  CA    . ASP D 4 537 ? -41.449 5.896   51.428 1.00 48.10  ? 537 ASP D CA    1 
ATOM   4935 C  C     . ASP D 4 537 ? -42.876 6.372   51.215 1.00 48.81  ? 537 ASP D C     1 
ATOM   4936 O  O     . ASP D 4 537 ? -43.800 5.574   51.179 1.00 51.56  ? 537 ASP D O     1 
ATOM   4937 C  CB    . ASP D 4 537 ? -40.852 5.422   50.095 1.00 51.46  ? 537 ASP D CB    1 
ATOM   4938 C  CG    . ASP D 4 537 ? -40.792 6.539   49.039 1.00 57.55  ? 537 ASP D CG    1 
ATOM   4939 O  OD1   . ASP D 4 537 ? -40.225 7.627   49.327 1.00 57.79  ? 537 ASP D OD1   1 
ATOM   4940 O  OD2   . ASP D 4 537 ? -41.308 6.330   47.914 1.00 60.12  ? 537 ASP D OD2   1 
ATOM   4941 N  N     . GLY D 4 538 ? -43.063 7.679   51.092 1.00 47.49  ? 538 GLY D N     1 
ATOM   4942 C  CA    . GLY D 4 538 ? -44.392 8.183   50.844 1.00 46.67  ? 538 GLY D CA    1 
ATOM   4943 C  C     . GLY D 4 538 ? -44.829 7.685   49.479 1.00 47.32  ? 538 GLY D C     1 
ATOM   4944 O  O     . GLY D 4 538 ? -43.997 7.442   48.599 1.00 44.66  ? 538 GLY D O     1 
ATOM   4945 N  N     . SER D 4 539 ? -46.134 7.506   49.309 1.00 47.97  ? 539 SER D N     1 
ATOM   4946 C  CA    . SER D 4 539 ? -46.676 7.043   48.041 1.00 48.34  ? 539 SER D CA    1 
ATOM   4947 C  C     . SER D 4 539 ? -47.168 8.255   47.269 1.00 49.27  ? 539 SER D C     1 
ATOM   4948 O  O     . SER D 4 539 ? -48.234 8.797   47.563 1.00 48.90  ? 539 SER D O     1 
ATOM   4949 C  CB    . SER D 4 539 ? -47.827 6.057   48.278 1.00 48.91  ? 539 SER D CB    1 
ATOM   4950 O  OG    . SER D 4 539 ? -48.788 6.577   49.182 1.00 46.90  ? 539 SER D OG    1 
ATOM   4951 N  N     . CYS D 4 540 ? -46.373 8.684   46.293 1.00 49.82  ? 540 CYS D N     1 
ATOM   4952 C  CA    . CYS D 4 540 ? -46.708 9.840   45.473 1.00 51.23  ? 540 CYS D CA    1 
ATOM   4953 C  C     . CYS D 4 540 ? -46.864 11.086  46.335 1.00 50.64  ? 540 CYS D C     1 
ATOM   4954 O  O     . CYS D 4 540 ? -47.921 11.734  46.325 1.00 50.62  ? 540 CYS D O     1 
ATOM   4955 C  CB    . CYS D 4 540 ? -48.001 9.586   44.721 1.00 53.12  ? 540 CYS D CB    1 
ATOM   4956 S  SG    . CYS D 4 540 ? -48.331 10.862  43.509 1.00 65.02  ? 540 CYS D SG    1 
ATOM   4957 N  N     . SER D 4 541 ? -45.800 11.427  47.061 1.00 49.06  ? 541 SER D N     1 
ATOM   4958 C  CA    . SER D 4 541 ? -45.827 12.562  47.975 1.00 48.20  ? 541 SER D CA    1 
ATOM   4959 C  C     . SER D 4 541 ? -46.321 13.876  47.380 1.00 46.63  ? 541 SER D C     1 
ATOM   4960 O  O     . SER D 4 541 ? -46.890 14.702  48.098 1.00 47.17  ? 541 SER D O     1 
ATOM   4961 C  CB    . SER D 4 541 ? -44.443 12.759  48.623 1.00 48.67  ? 541 SER D CB    1 
ATOM   4962 O  OG    . SER D 4 541 ? -43.449 12.874  47.631 1.00 49.10  ? 541 SER D OG    1 
ATOM   4963 N  N     . GLY D 4 542 ? -46.101 14.082  46.086 1.00 44.16  ? 542 GLY D N     1 
ATOM   4964 C  CA    . GLY D 4 542 ? -46.572 15.305  45.470 1.00 41.47  ? 542 GLY D CA    1 
ATOM   4965 C  C     . GLY D 4 542 ? -48.056 15.464  45.752 1.00 40.67  ? 542 GLY D C     1 
ATOM   4966 O  O     . GLY D 4 542 ? -48.475 16.465  46.333 1.00 38.86  ? 542 GLY D O     1 
ATOM   4967 N  N     . ILE D 4 543 ? -48.856 14.476  45.352 1.00 39.39  ? 543 ILE D N     1 
ATOM   4968 C  CA    . ILE D 4 543 ? -50.290 14.541  45.598 1.00 40.33  ? 543 ILE D CA    1 
ATOM   4969 C  C     . ILE D 4 543 ? -50.603 14.516  47.105 1.00 42.50  ? 543 ILE D C     1 
ATOM   4970 O  O     . ILE D 4 543 ? -51.513 15.211  47.561 1.00 44.26  ? 543 ILE D O     1 
ATOM   4971 C  CB    . ILE D 4 543 ? -51.061 13.369  44.948 1.00 38.36  ? 543 ILE D CB    1 
ATOM   4972 C  CG1   . ILE D 4 543 ? -50.809 13.321  43.446 1.00 36.29  ? 543 ILE D CG1   1 
ATOM   4973 C  CG2   . ILE D 4 543 ? -52.538 13.529  45.229 1.00 36.63  ? 543 ILE D CG2   1 
ATOM   4974 C  CD1   . ILE D 4 543 ? -51.107 14.610  42.746 1.00 36.92  ? 543 ILE D CD1   1 
ATOM   4975 N  N     . GLN D 4 544 ? -49.872 13.719  47.882 1.00 41.56  ? 544 GLN D N     1 
ATOM   4976 C  CA    . GLN D 4 544 ? -50.149 13.679  49.310 1.00 40.77  ? 544 GLN D CA    1 
ATOM   4977 C  C     . GLN D 4 544 ? -50.146 15.099  49.836 1.00 38.54  ? 544 GLN D C     1 
ATOM   4978 O  O     . GLN D 4 544 ? -51.132 15.539  50.422 1.00 36.28  ? 544 GLN D O     1 
ATOM   4979 C  CB    . GLN D 4 544 ? -49.111 12.846  50.072 1.00 43.59  ? 544 GLN D CB    1 
ATOM   4980 C  CG    . GLN D 4 544 ? -48.822 11.497  49.443 1.00 48.32  ? 544 GLN D CG    1 
ATOM   4981 C  CD    . GLN D 4 544 ? -48.226 10.507  50.425 1.00 50.31  ? 544 GLN D CD    1 
ATOM   4982 O  OE1   . GLN D 4 544 ? -47.404 10.864  51.268 1.00 54.62  ? 544 GLN D OE1   1 
ATOM   4983 N  NE2   . GLN D 4 544 ? -48.631 9.256   50.314 1.00 49.96  ? 544 GLN D NE2   1 
ATOM   4984 N  N     . HIS D 4 545 ? -49.046 15.820  49.615 1.00 37.83  ? 545 HIS D N     1 
ATOM   4985 C  CA    . HIS D 4 545 ? -48.941 17.201  50.090 1.00 38.63  ? 545 HIS D CA    1 
ATOM   4986 C  C     . HIS D 4 545 ? -50.062 18.083  49.580 1.00 39.27  ? 545 HIS D C     1 
ATOM   4987 O  O     . HIS D 4 545 ? -50.590 18.920  50.310 1.00 37.80  ? 545 HIS D O     1 
ATOM   4988 C  CB    . HIS D 4 545 ? -47.596 17.786  49.706 1.00 38.21  ? 545 HIS D CB    1 
ATOM   4989 C  CG    . HIS D 4 545 ? -46.471 17.219  50.501 1.00 39.54  ? 545 HIS D CG    1 
ATOM   4990 N  ND1   . HIS D 4 545 ? -46.214 17.613  51.794 1.00 38.48  ? 545 HIS D ND1   1 
ATOM   4991 C  CD2   . HIS D 4 545 ? -45.603 16.216  50.230 1.00 38.33  ? 545 HIS D CD2   1 
ATOM   4992 C  CE1   . HIS D 4 545 ? -45.238 16.873  52.289 1.00 40.09  ? 545 HIS D CE1   1 
ATOM   4993 N  NE2   . HIS D 4 545 ? -44.851 16.017  51.361 1.00 39.77  ? 545 HIS D NE2   1 
ATOM   4994 N  N     . PHE D 4 546 ? -50.432 17.895  48.322 1.00 40.78  ? 546 PHE D N     1 
ATOM   4995 C  CA    . PHE D 4 546 ? -51.522 18.664  47.772 1.00 41.92  ? 546 PHE D CA    1 
ATOM   4996 C  C     . PHE D 4 546 ? -52.807 18.351  48.520 1.00 41.70  ? 546 PHE D C     1 
ATOM   4997 O  O     . PHE D 4 546 ? -53.530 19.257  48.939 1.00 42.96  ? 546 PHE D O     1 
ATOM   4998 C  CB    . PHE D 4 546 ? -51.693 18.355  46.293 1.00 42.89  ? 546 PHE D CB    1 
ATOM   4999 C  CG    . PHE D 4 546 ? -50.914 19.277  45.395 1.00 44.99  ? 546 PHE D CG    1 
ATOM   5000 C  CD1   . PHE D 4 546 ? -50.819 20.636  45.696 1.00 44.30  ? 546 PHE D CD1   1 
ATOM   5001 C  CD2   . PHE D 4 546 ? -50.332 18.803  44.223 1.00 42.13  ? 546 PHE D CD2   1 
ATOM   5002 C  CE1   . PHE D 4 546 ? -50.159 21.508  44.839 1.00 44.80  ? 546 PHE D CE1   1 
ATOM   5003 C  CE2   . PHE D 4 546 ? -49.677 19.659  43.370 1.00 43.66  ? 546 PHE D CE2   1 
ATOM   5004 C  CZ    . PHE D 4 546 ? -49.587 21.022  43.672 1.00 44.29  ? 546 PHE D CZ    1 
ATOM   5005 N  N     . SER D 4 547 ? -53.079 17.070  48.704 1.00 40.44  ? 547 SER D N     1 
ATOM   5006 C  CA    . SER D 4 547 ? -54.288 16.648  49.395 1.00 42.05  ? 547 SER D CA    1 
ATOM   5007 C  C     . SER D 4 547 ? -54.324 17.168  50.826 1.00 44.33  ? 547 SER D C     1 
ATOM   5008 O  O     . SER D 4 547 ? -55.340 17.671  51.290 1.00 45.41  ? 547 SER D O     1 
ATOM   5009 C  CB    . SER D 4 547 ? -54.373 15.129  49.401 1.00 39.41  ? 547 SER D CB    1 
ATOM   5010 O  OG    . SER D 4 547 ? -54.103 14.615  48.107 1.00 40.61  ? 547 SER D OG    1 
ATOM   5011 N  N     . ALA D 4 548 ? -53.204 17.053  51.523 1.00 46.68  ? 548 ALA D N     1 
ATOM   5012 C  CA    . ALA D 4 548 ? -53.127 17.502  52.902 1.00 48.02  ? 548 ALA D CA    1 
ATOM   5013 C  C     . ALA D 4 548 ? -53.444 18.971  53.015 1.00 49.25  ? 548 ALA D C     1 
ATOM   5014 O  O     . ALA D 4 548 ? -54.379 19.356  53.699 1.00 50.44  ? 548 ALA D O     1 
ATOM   5015 C  CB    . ALA D 4 548 ? -51.742 17.233  53.463 1.00 49.00  ? 548 ALA D CB    1 
ATOM   5016 N  N     . MET D 4 549 ? -52.664 19.800  52.334 1.00 52.13  ? 549 MET D N     1 
ATOM   5017 C  CA    . MET D 4 549 ? -52.874 21.239  52.409 1.00 53.21  ? 549 MET D CA    1 
ATOM   5018 C  C     . MET D 4 549 ? -54.241 21.699  51.885 1.00 52.53  ? 549 MET D C     1 
ATOM   5019 O  O     . MET D 4 549 ? -54.676 22.816  52.178 1.00 52.52  ? 549 MET D O     1 
ATOM   5020 C  CB    . MET D 4 549 ? -51.754 21.973  51.683 1.00 52.91  ? 549 MET D CB    1 
ATOM   5021 C  CG    . MET D 4 549 ? -51.798 21.816  50.199 1.00 55.51  ? 549 MET D CG    1 
ATOM   5022 S  SD    . MET D 4 549 ? -50.703 23.008  49.468 1.00 58.47  ? 549 MET D SD    1 
ATOM   5023 C  CE    . MET D 4 549 ? -49.090 22.238  49.828 1.00 54.44  ? 549 MET D CE    1 
ATOM   5024 N  N     . LEU D 4 550 ? -54.915 20.847  51.118 1.00 52.36  ? 550 LEU D N     1 
ATOM   5025 C  CA    . LEU D 4 550 ? -56.244 21.192  50.599 1.00 53.32  ? 550 LEU D CA    1 
ATOM   5026 C  C     . LEU D 4 550 ? -57.325 20.409  51.329 1.00 53.05  ? 550 LEU D C     1 
ATOM   5027 O  O     . LEU D 4 550 ? -58.514 20.646  51.124 1.00 51.72  ? 550 LEU D O     1 
ATOM   5028 C  CB    . LEU D 4 550 ? -56.360 20.879  49.111 1.00 52.54  ? 550 LEU D CB    1 
ATOM   5029 C  CG    . LEU D 4 550 ? -55.392 21.598  48.186 1.00 53.60  ? 550 LEU D CG    1 
ATOM   5030 C  CD1   . LEU D 4 550 ? -55.759 21.251  46.752 1.00 54.21  ? 550 LEU D CD1   1 
ATOM   5031 C  CD2   . LEU D 4 550 ? -55.456 23.109  48.425 1.00 53.02  ? 550 LEU D CD2   1 
ATOM   5032 N  N     . ARG D 4 551 ? -56.891 19.474  52.175 1.00 53.01  ? 551 ARG D N     1 
ATOM   5033 C  CA    . ARG D 4 551 ? -57.795 18.631  52.935 1.00 51.81  ? 551 ARG D CA    1 
ATOM   5034 C  C     . ARG D 4 551 ? -58.640 17.843  51.949 1.00 52.16  ? 551 ARG D C     1 
ATOM   5035 O  O     . ARG D 4 551 ? -59.761 17.467  52.246 1.00 51.55  ? 551 ARG D O     1 
ATOM   5036 C  CB    . ARG D 4 551 ? -58.683 19.490  53.817 1.00 53.02  ? 551 ARG D CB    1 
ATOM   5037 C  CG    . ARG D 4 551 ? -57.913 20.370  54.793 1.00 56.35  ? 551 ARG D CG    1 
ATOM   5038 C  CD    . ARG D 4 551 ? -57.326 19.542  55.914 1.00 59.61  ? 551 ARG D CD    1 
ATOM   5039 N  NE    . ARG D 4 551 ? -56.684 20.335  56.962 1.00 64.96  ? 551 ARG D NE    1 
ATOM   5040 C  CZ    . ARG D 4 551 ? -57.238 21.382  57.569 1.00 68.17  ? 551 ARG D CZ    1 
ATOM   5041 N  NH1   . ARG D 4 551 ? -58.460 21.785  57.223 1.00 68.47  ? 551 ARG D NH1   1 
ATOM   5042 N  NH2   . ARG D 4 551 ? -56.582 22.010  58.547 1.00 68.01  ? 551 ARG D NH2   1 
ATOM   5043 N  N     . ASP D 4 552 ? -58.087 17.590  50.771 1.00 53.16  ? 552 ASP D N     1 
ATOM   5044 C  CA    . ASP D 4 552 ? -58.806 16.854  49.752 1.00 55.56  ? 552 ASP D CA    1 
ATOM   5045 C  C     . ASP D 4 552 ? -58.878 15.368  50.050 1.00 57.25  ? 552 ASP D C     1 
ATOM   5046 O  O     . ASP D 4 552 ? -57.878 14.653  49.919 1.00 58.23  ? 552 ASP D O     1 
ATOM   5047 C  CB    . ASP D 4 552 ? -58.151 17.062  48.391 1.00 57.53  ? 552 ASP D CB    1 
ATOM   5048 C  CG    . ASP D 4 552 ? -58.675 16.099  47.339 1.00 61.49  ? 552 ASP D CG    1 
ATOM   5049 O  OD1   . ASP D 4 552 ? -58.255 16.195  46.165 1.00 64.87  ? 552 ASP D OD1   1 
ATOM   5050 O  OD2   . ASP D 4 552 ? -59.511 15.235  47.679 1.00 64.46  ? 552 ASP D OD2   1 
ATOM   5051 N  N     . GLU D 4 553 ? -60.073 14.903  50.413 1.00 57.31  ? 553 GLU D N     1 
ATOM   5052 C  CA    . GLU D 4 553 ? -60.296 13.491  50.717 1.00 56.03  ? 553 GLU D CA    1 
ATOM   5053 C  C     . GLU D 4 553 ? -60.262 12.645  49.460 1.00 52.60  ? 553 GLU D C     1 
ATOM   5054 O  O     . GLU D 4 553 ? -59.833 11.500  49.476 1.00 51.53  ? 553 GLU D O     1 
ATOM   5055 C  CB    . GLU D 4 553 ? -61.647 13.298  51.408 1.00 60.65  ? 553 GLU D CB    1 
ATOM   5056 C  CG    . GLU D 4 553 ? -61.957 11.847  51.760 1.00 67.78  ? 553 GLU D CG    1 
ATOM   5057 C  CD    . GLU D 4 553 ? -63.181 11.690  52.668 1.00 72.08  ? 553 GLU D CD    1 
ATOM   5058 O  OE1   . GLU D 4 553 ? -63.149 12.190  53.819 1.00 72.23  ? 553 GLU D OE1   1 
ATOM   5059 O  OE2   . GLU D 4 553 ? -64.173 11.060  52.228 1.00 74.85  ? 553 GLU D OE2   1 
ATOM   5060 N  N     . VAL D 4 554 ? -60.718 13.200  48.353 1.00 51.39  ? 554 VAL D N     1 
ATOM   5061 C  CA    . VAL D 4 554 ? -60.722 12.418  47.133 1.00 50.81  ? 554 VAL D CA    1 
ATOM   5062 C  C     . VAL D 4 554 ? -59.292 12.050  46.797 1.00 51.06  ? 554 VAL D C     1 
ATOM   5063 O  O     . VAL D 4 554 ? -58.964 10.871  46.680 1.00 52.25  ? 554 VAL D O     1 
ATOM   5064 C  CB    . VAL D 4 554 ? -61.375 13.195  45.974 1.00 50.27  ? 554 VAL D CB    1 
ATOM   5065 C  CG1   . VAL D 4 554 ? -61.478 12.318  44.741 1.00 49.34  ? 554 VAL D CG1   1 
ATOM   5066 C  CG2   . VAL D 4 554 ? -62.750 13.661  46.398 1.00 49.60  ? 554 VAL D CG2   1 
ATOM   5067 N  N     . GLY D 4 555 ? -58.436 13.059  46.669 1.00 51.08  ? 555 GLY D N     1 
ATOM   5068 C  CA    . GLY D 4 555 ? -57.043 12.801  46.359 1.00 48.23  ? 555 GLY D CA    1 
ATOM   5069 C  C     . GLY D 4 555 ? -56.409 12.002  47.477 1.00 46.74  ? 555 GLY D C     1 
ATOM   5070 O  O     . GLY D 4 555 ? -55.773 10.975  47.235 1.00 46.94  ? 555 GLY D O     1 
ATOM   5071 N  N     . GLY D 4 556 ? -56.599 12.470  48.705 1.00 44.46  ? 556 GLY D N     1 
ATOM   5072 C  CA    . GLY D 4 556 ? -56.037 11.783  49.846 1.00 44.88  ? 556 GLY D CA    1 
ATOM   5073 C  C     . GLY D 4 556 ? -56.208 10.279  49.773 1.00 46.79  ? 556 GLY D C     1 
ATOM   5074 O  O     . GLY D 4 556 ? -55.261 9.509   49.965 1.00 46.30  ? 556 GLY D O     1 
ATOM   5075 N  N     . ARG D 4 557 ? -57.424 9.844   49.487 1.00 48.35  ? 557 ARG D N     1 
ATOM   5076 C  CA    . ARG D 4 557 ? -57.674 8.419   49.414 1.00 49.68  ? 557 ARG D CA    1 
ATOM   5077 C  C     . ARG D 4 557 ? -56.717 7.772   48.430 1.00 48.23  ? 557 ARG D C     1 
ATOM   5078 O  O     . ARG D 4 557 ? -56.042 6.815   48.773 1.00 50.52  ? 557 ARG D O     1 
ATOM   5079 C  CB    . ARG D 4 557 ? -59.136 8.143   49.023 1.00 52.56  ? 557 ARG D CB    1 
ATOM   5080 C  CG    . ARG D 4 557 ? -59.492 6.665   48.915 1.00 55.77  ? 557 ARG D CG    1 
ATOM   5081 C  CD    . ARG D 4 557 ? -60.901 6.389   49.421 1.00 61.22  ? 557 ARG D CD    1 
ATOM   5082 N  NE    . ARG D 4 557 ? -61.337 5.024   49.121 1.00 65.94  ? 557 ARG D NE    1 
ATOM   5083 C  CZ    . ARG D 4 557 ? -62.487 4.487   49.532 1.00 67.76  ? 557 ARG D CZ    1 
ATOM   5084 N  NH1   . ARG D 4 557 ? -63.337 5.195   50.273 1.00 67.82  ? 557 ARG D NH1   1 
ATOM   5085 N  NH2   . ARG D 4 557 ? -62.792 3.236   49.199 1.00 67.44  ? 557 ARG D NH2   1 
ATOM   5086 N  N     . ALA D 4 558 ? -56.626 8.308   47.221 1.00 46.23  ? 558 ALA D N     1 
ATOM   5087 C  CA    . ALA D 4 558 ? -55.748 7.722   46.220 1.00 45.18  ? 558 ALA D CA    1 
ATOM   5088 C  C     . ALA D 4 558 ? -54.305 7.554   46.673 1.00 45.21  ? 558 ALA D C     1 
ATOM   5089 O  O     . ALA D 4 558 ? -53.631 6.604   46.273 1.00 46.16  ? 558 ALA D O     1 
ATOM   5090 C  CB    . ALA D 4 558 ? -55.781 8.553   44.958 1.00 46.53  ? 558 ALA D CB    1 
ATOM   5091 N  N     . VAL D 4 559 ? -53.819 8.475   47.497 1.00 43.48  ? 559 VAL D N     1 
ATOM   5092 C  CA    . VAL D 4 559 ? -52.439 8.403   47.940 1.00 41.97  ? 559 VAL D CA    1 
ATOM   5093 C  C     . VAL D 4 559 ? -52.273 7.992   49.391 1.00 42.83  ? 559 VAL D C     1 
ATOM   5094 O  O     . VAL D 4 559 ? -51.383 8.463   50.095 1.00 45.15  ? 559 VAL D O     1 
ATOM   5095 C  CB    . VAL D 4 559 ? -51.735 9.732   47.681 1.00 40.76  ? 559 VAL D CB    1 
ATOM   5096 C  CG1   . VAL D 4 559 ? -51.763 10.019  46.185 1.00 40.06  ? 559 VAL D CG1   1 
ATOM   5097 C  CG2   . VAL D 4 559 ? -52.406 10.850  48.463 1.00 39.74  ? 559 VAL D CG2   1 
ATOM   5098 N  N     . ASN D 4 560 ? -53.165 7.116   49.824 1.00 41.84  ? 560 ASN D N     1 
ATOM   5099 C  CA    . ASN D 4 560 ? -53.168 6.553   51.163 1.00 40.93  ? 560 ASN D CA    1 
ATOM   5100 C  C     . ASN D 4 560 ? -53.127 7.495   52.333 1.00 40.91  ? 560 ASN D C     1 
ATOM   5101 O  O     . ASN D 4 560 ? -52.575 7.161   53.367 1.00 40.14  ? 560 ASN D O     1 
ATOM   5102 C  CB    . ASN D 4 560 ? -52.035 5.562   51.269 1.00 40.31  ? 560 ASN D CB    1 
ATOM   5103 C  CG    . ASN D 4 560 ? -52.044 4.581   50.131 1.00 42.83  ? 560 ASN D CG    1 
ATOM   5104 O  OD1   . ASN D 4 560 ? -52.894 3.692   50.072 1.00 46.51  ? 560 ASN D OD1   1 
ATOM   5105 N  ND2   . ASN D 4 560 ? -51.119 4.750   49.197 1.00 43.60  ? 560 ASN D ND2   1 
ATOM   5106 N  N     . LEU D 4 561 ? -53.719 8.668   52.197 1.00 42.56  ? 561 LEU D N     1 
ATOM   5107 C  CA    . LEU D 4 561 ? -53.716 9.591   53.316 1.00 45.05  ? 561 LEU D CA    1 
ATOM   5108 C  C     . LEU D 4 561 ? -54.815 9.236   54.289 1.00 45.91  ? 561 LEU D C     1 
ATOM   5109 O  O     . LEU D 4 561 ? -55.050 9.971   55.247 1.00 48.05  ? 561 LEU D O     1 
ATOM   5110 C  CB    . LEU D 4 561 ? -53.902 11.021  52.829 1.00 45.16  ? 561 LEU D CB    1 
ATOM   5111 C  CG    . LEU D 4 561 ? -52.633 11.865  52.772 1.00 46.20  ? 561 LEU D CG    1 
ATOM   5112 C  CD1   . LEU D 4 561 ? -51.466 11.043  52.232 1.00 47.27  ? 561 LEU D CD1   1 
ATOM   5113 C  CD2   . LEU D 4 561 ? -52.910 13.083  51.909 1.00 45.73  ? 561 LEU D CD2   1 
ATOM   5114 N  N     . LEU D 4 562 ? -55.482 8.108   54.039 1.00 46.17  ? 562 LEU D N     1 
ATOM   5115 C  CA    . LEU D 4 562 ? -56.581 7.642   54.889 1.00 45.94  ? 562 LEU D CA    1 
ATOM   5116 C  C     . LEU D 4 562 ? -56.445 6.176   55.239 1.00 45.65  ? 562 LEU D C     1 
ATOM   5117 O  O     . LEU D 4 562 ? -55.992 5.379   54.422 1.00 44.95  ? 562 LEU D O     1 
ATOM   5118 C  CB    . LEU D 4 562 ? -57.921 7.810   54.182 1.00 46.02  ? 562 LEU D CB    1 
ATOM   5119 C  CG    . LEU D 4 562 ? -58.467 9.209   53.983 1.00 48.00  ? 562 LEU D CG    1 
ATOM   5120 C  CD1   . LEU D 4 562 ? -59.878 9.084   53.422 1.00 48.18  ? 562 LEU D CD1   1 
ATOM   5121 C  CD2   . LEU D 4 562 ? -58.465 9.963   55.317 1.00 47.00  ? 562 LEU D CD2   1 
ATOM   5122 N  N     . PRO D 4 563 ? -56.855 5.794   56.455 1.00 45.53  ? 563 PRO D N     1 
ATOM   5123 C  CA    . PRO D 4 563 ? -56.745 4.379   56.816 1.00 46.97  ? 563 PRO D CA    1 
ATOM   5124 C  C     . PRO D 4 563 ? -57.516 3.548   55.791 1.00 48.29  ? 563 PRO D C     1 
ATOM   5125 O  O     . PRO D 4 563 ? -58.590 3.939   55.349 1.00 49.61  ? 563 PRO D O     1 
ATOM   5126 C  CB    . PRO D 4 563 ? -57.340 4.326   58.227 1.00 44.09  ? 563 PRO D CB    1 
ATOM   5127 C  CG    . PRO D 4 563 ? -58.270 5.496   58.261 1.00 47.42  ? 563 PRO D CG    1 
ATOM   5128 C  CD    . PRO D 4 563 ? -57.515 6.569   57.516 1.00 46.48  ? 563 PRO D CD    1 
ATOM   5129 N  N     . SER D 4 564 ? -56.947 2.416   55.399 1.00 50.43  ? 564 SER D N     1 
ATOM   5130 C  CA    . SER D 4 564 ? -57.557 1.550   54.403 1.00 52.32  ? 564 SER D CA    1 
ATOM   5131 C  C     . SER D 4 564 ? -57.028 0.123   54.523 1.00 53.91  ? 564 SER D C     1 
ATOM   5132 O  O     . SER D 4 564 ? -55.851 -0.090  54.800 1.00 55.24  ? 564 SER D O     1 
ATOM   5133 C  CB    . SER D 4 564 ? -57.260 2.106   53.010 1.00 52.45  ? 564 SER D CB    1 
ATOM   5134 O  OG    . SER D 4 564 ? -57.315 1.096   52.015 1.00 54.27  ? 564 SER D OG    1 
ATOM   5135 N  N     . GLU D 4 565 ? -57.900 -0.855  54.310 1.00 55.84  ? 565 GLU D N     1 
ATOM   5136 C  CA    . GLU D 4 565 ? -57.504 -2.255  54.410 1.00 57.20  ? 565 GLU D CA    1 
ATOM   5137 C  C     . GLU D 4 565 ? -56.613 -2.579  53.228 1.00 55.75  ? 565 GLU D C     1 
ATOM   5138 O  O     . GLU D 4 565 ? -55.586 -3.237  53.354 1.00 56.33  ? 565 GLU D O     1 
ATOM   5139 C  CB    . GLU D 4 565 ? -58.745 -3.152  54.384 1.00 59.60  ? 565 GLU D CB    1 
ATOM   5140 C  CG    . GLU D 4 565 ? -58.540 -4.583  54.909 1.00 64.62  ? 565 GLU D CG    1 
ATOM   5141 C  CD    . GLU D 4 565 ? -57.584 -5.440  54.065 1.00 66.90  ? 565 GLU D CD    1 
ATOM   5142 O  OE1   . GLU D 4 565 ? -57.795 -5.583  52.836 1.00 66.69  ? 565 GLU D OE1   1 
ATOM   5143 O  OE2   . GLU D 4 565 ? -56.621 -5.983  54.648 1.00 68.91  ? 565 GLU D OE2   1 
ATOM   5144 N  N     . THR D 4 566 ? -57.023 -2.092  52.073 1.00 55.08  ? 566 THR D N     1 
ATOM   5145 C  CA    . THR D 4 566 ? -56.300 -2.326  50.840 1.00 55.75  ? 566 THR D CA    1 
ATOM   5146 C  C     . THR D 4 566 ? -55.315 -1.173  50.620 1.00 55.71  ? 566 THR D C     1 
ATOM   5147 O  O     . THR D 4 566 ? -55.468 -0.100  51.204 1.00 56.39  ? 566 THR D O     1 
ATOM   5148 C  CB    . THR D 4 566 ? -57.323 -2.436  49.668 1.00 55.92  ? 566 THR D CB    1 
ATOM   5149 O  OG1   . THR D 4 566 ? -56.789 -3.268  48.636 1.00 58.19  ? 566 THR D OG1   1 
ATOM   5150 C  CG2   . THR D 4 566 ? -57.652 -1.069  49.095 1.00 53.39  ? 566 THR D CG2   1 
ATOM   5151 N  N     . VAL D 4 567 ? -54.302 -1.382  49.789 1.00 54.50  ? 567 VAL D N     1 
ATOM   5152 C  CA    . VAL D 4 567 ? -53.322 -0.325  49.539 1.00 53.59  ? 567 VAL D CA    1 
ATOM   5153 C  C     . VAL D 4 567 ? -53.590 0.436   48.241 1.00 52.68  ? 567 VAL D C     1 
ATOM   5154 O  O     . VAL D 4 567 ? -53.494 -0.120  47.154 1.00 51.65  ? 567 VAL D O     1 
ATOM   5155 C  CB    . VAL D 4 567 ? -51.870 -0.904  49.511 1.00 54.45  ? 567 VAL D CB    1 
ATOM   5156 C  CG1   . VAL D 4 567 ? -51.861 -2.230  48.766 1.00 54.54  ? 567 VAL D CG1   1 
ATOM   5157 C  CG2   . VAL D 4 567 ? -50.906 0.093   48.849 1.00 52.16  ? 567 VAL D CG2   1 
ATOM   5158 N  N     . GLN D 4 568 ? -53.910 1.719   48.364 1.00 52.19  ? 568 GLN D N     1 
ATOM   5159 C  CA    . GLN D 4 568 ? -54.192 2.545   47.200 1.00 52.63  ? 568 GLN D CA    1 
ATOM   5160 C  C     . GLN D 4 568 ? -52.932 2.905   46.423 1.00 53.39  ? 568 GLN D C     1 
ATOM   5161 O  O     . GLN D 4 568 ? -51.905 3.234   47.005 1.00 54.51  ? 568 GLN D O     1 
ATOM   5162 C  CB    . GLN D 4 568 ? -54.915 3.822   47.632 1.00 52.59  ? 568 GLN D CB    1 
ATOM   5163 C  CG    . GLN D 4 568 ? -56.118 3.559   48.517 1.00 55.44  ? 568 GLN D CG    1 
ATOM   5164 C  CD    . GLN D 4 568 ? -56.981 2.411   47.999 1.00 57.60  ? 568 GLN D CD    1 
ATOM   5165 O  OE1   . GLN D 4 568 ? -57.392 1.540   48.766 1.00 58.28  ? 568 GLN D OE1   1 
ATOM   5166 N  NE2   . GLN D 4 568 ? -57.253 2.405   46.695 1.00 57.84  ? 568 GLN D NE2   1 
ATOM   5167 N  N     . ASP D 4 569 ? -53.018 2.828   45.101 1.00 53.89  ? 569 ASP D N     1 
ATOM   5168 C  CA    . ASP D 4 569 ? -51.907 3.158   44.229 1.00 54.21  ? 569 ASP D CA    1 
ATOM   5169 C  C     . ASP D 4 569 ? -52.460 3.978   43.073 1.00 54.60  ? 569 ASP D C     1 
ATOM   5170 O  O     . ASP D 4 569 ? -52.989 3.434   42.099 1.00 53.85  ? 569 ASP D O     1 
ATOM   5171 C  CB    . ASP D 4 569 ? -51.229 1.894   43.696 1.00 55.73  ? 569 ASP D CB    1 
ATOM   5172 C  CG    . ASP D 4 569 ? -50.072 2.209   42.745 1.00 61.08  ? 569 ASP D CG    1 
ATOM   5173 O  OD1   . ASP D 4 569 ? -49.100 2.886   43.174 1.00 63.46  ? 569 ASP D OD1   1 
ATOM   5174 O  OD2   . ASP D 4 569 ? -50.130 1.787   41.566 1.00 61.86  ? 569 ASP D OD2   1 
ATOM   5175 N  N     . ILE D 4 570 ? -52.334 5.295   43.194 1.00 54.57  ? 570 ILE D N     1 
ATOM   5176 C  CA    . ILE D 4 570 ? -52.839 6.213   42.180 1.00 55.71  ? 570 ILE D CA    1 
ATOM   5177 C  C     . ILE D 4 570 ? -52.382 5.901   40.753 1.00 55.43  ? 570 ILE D C     1 
ATOM   5178 O  O     . ILE D 4 570 ? -53.104 6.181   39.796 1.00 55.63  ? 570 ILE D O     1 
ATOM   5179 C  CB    . ILE D 4 570 ? -52.458 7.674   42.522 1.00 56.66  ? 570 ILE D CB    1 
ATOM   5180 C  CG1   . ILE D 4 570 ? -53.378 8.642   41.778 1.00 56.33  ? 570 ILE D CG1   1 
ATOM   5181 C  CG2   . ILE D 4 570 ? -51.003 7.942   42.147 1.00 56.55  ? 570 ILE D CG2   1 
ATOM   5182 C  CD1   . ILE D 4 570 ? -53.243 10.072  42.241 1.00 55.78  ? 570 ILE D CD1   1 
ATOM   5183 N  N     . TYR D 4 571 ? -51.198 5.323   40.596 1.00 54.32  ? 571 TYR D N     1 
ATOM   5184 C  CA    . TYR D 4 571 ? -50.736 5.017   39.252 1.00 54.76  ? 571 TYR D CA    1 
ATOM   5185 C  C     . TYR D 4 571 ? -51.503 3.824   38.717 1.00 54.63  ? 571 TYR D C     1 
ATOM   5186 O  O     . TYR D 4 571 ? -51.889 3.789   37.557 1.00 54.75  ? 571 TYR D O     1 
ATOM   5187 C  CB    . TYR D 4 571 ? -49.228 4.741   39.247 1.00 54.42  ? 571 TYR D CB    1 
ATOM   5188 C  CG    . TYR D 4 571 ? -48.436 5.824   39.941 1.00 54.60  ? 571 TYR D CG    1 
ATOM   5189 C  CD1   . TYR D 4 571 ? -48.727 7.167   39.729 1.00 54.77  ? 571 TYR D CD1   1 
ATOM   5190 C  CD2   . TYR D 4 571 ? -47.432 5.507   40.854 1.00 54.41  ? 571 TYR D CD2   1 
ATOM   5191 C  CE1   . TYR D 4 571 ? -48.044 8.169   40.419 1.00 56.04  ? 571 TYR D CE1   1 
ATOM   5192 C  CE2   . TYR D 4 571 ? -46.746 6.496   41.542 1.00 53.34  ? 571 TYR D CE2   1 
ATOM   5193 C  CZ    . TYR D 4 571 ? -47.055 7.824   41.325 1.00 54.95  ? 571 TYR D CZ    1 
ATOM   5194 O  OH    . TYR D 4 571 ? -46.381 8.810   42.018 1.00 55.16  ? 571 TYR D OH    1 
ATOM   5195 N  N     . GLY D 4 572 ? -51.729 2.840   39.574 1.00 56.07  ? 572 GLY D N     1 
ATOM   5196 C  CA    . GLY D 4 572 ? -52.466 1.665   39.149 1.00 55.71  ? 572 GLY D CA    1 
ATOM   5197 C  C     . GLY D 4 572 ? -53.880 2.070   38.808 1.00 55.26  ? 572 GLY D C     1 
ATOM   5198 O  O     . GLY D 4 572 ? -54.481 1.564   37.866 1.00 54.60  ? 572 GLY D O     1 
ATOM   5199 N  N     . ILE D 4 573 ? -54.417 2.994   39.591 1.00 55.24  ? 573 ILE D N     1 
ATOM   5200 C  CA    . ILE D 4 573 ? -55.760 3.477   39.354 1.00 56.31  ? 573 ILE D CA    1 
ATOM   5201 C  C     . ILE D 4 573 ? -55.818 4.021   37.935 1.00 56.90  ? 573 ILE D C     1 
ATOM   5202 O  O     . ILE D 4 573 ? -56.555 3.506   37.094 1.00 57.54  ? 573 ILE D O     1 
ATOM   5203 C  CB    . ILE D 4 573 ? -56.119 4.571   40.365 1.00 57.07  ? 573 ILE D CB    1 
ATOM   5204 C  CG1   . ILE D 4 573 ? -56.312 3.927   41.741 1.00 57.01  ? 573 ILE D CG1   1 
ATOM   5205 C  CG2   . ILE D 4 573 ? -57.352 5.332   39.908 1.00 55.99  ? 573 ILE D CG2   1 
ATOM   5206 C  CD1   . ILE D 4 573 ? -56.408 4.907   42.877 1.00 58.97  ? 573 ILE D CD1   1 
ATOM   5207 N  N     . VAL D 4 574 ? -55.021 5.051   37.669 1.00 56.63  ? 574 VAL D N     1 
ATOM   5208 C  CA    . VAL D 4 574 ? -54.963 5.654   36.342 1.00 55.26  ? 574 VAL D CA    1 
ATOM   5209 C  C     . VAL D 4 574 ? -54.744 4.583   35.279 1.00 55.53  ? 574 VAL D C     1 
ATOM   5210 O  O     . VAL D 4 574 ? -55.256 4.697   34.166 1.00 56.74  ? 574 VAL D O     1 
ATOM   5211 C  CB    . VAL D 4 574 ? -53.828 6.700   36.258 1.00 53.29  ? 574 VAL D CB    1 
ATOM   5212 C  CG1   . VAL D 4 574 ? -53.617 7.147   34.820 1.00 52.56  ? 574 VAL D CG1   1 
ATOM   5213 C  CG2   . VAL D 4 574 ? -54.175 7.891   37.123 1.00 52.02  ? 574 VAL D CG2   1 
ATOM   5214 N  N     . ALA D 4 575 ? -53.997 3.540   35.627 1.00 55.01  ? 575 ALA D N     1 
ATOM   5215 C  CA    . ALA D 4 575 ? -53.725 2.461   34.692 1.00 56.13  ? 575 ALA D CA    1 
ATOM   5216 C  C     . ALA D 4 575 ? -54.998 1.692   34.337 1.00 57.16  ? 575 ALA D C     1 
ATOM   5217 O  O     . ALA D 4 575 ? -55.192 1.317   33.182 1.00 58.05  ? 575 ALA D O     1 
ATOM   5218 C  CB    . ALA D 4 575 ? -52.693 1.516   35.272 1.00 56.82  ? 575 ALA D CB    1 
ATOM   5219 N  N     . LYS D 4 576 ? -55.863 1.453   35.322 1.00 57.45  ? 576 LYS D N     1 
ATOM   5220 C  CA    . LYS D 4 576 ? -57.112 0.738   35.067 1.00 57.85  ? 576 LYS D CA    1 
ATOM   5221 C  C     . LYS D 4 576 ? -57.989 1.549   34.129 1.00 56.71  ? 576 LYS D C     1 
ATOM   5222 O  O     . LYS D 4 576 ? -58.466 1.036   33.118 1.00 54.69  ? 576 LYS D O     1 
ATOM   5223 C  CB    . LYS D 4 576 ? -57.872 0.472   36.369 1.00 60.22  ? 576 LYS D CB    1 
ATOM   5224 C  CG    . LYS D 4 576 ? -57.189 -0.514  37.304 1.00 64.06  ? 576 LYS D CG    1 
ATOM   5225 C  CD    . LYS D 4 576 ? -56.947 -1.863  36.624 1.00 66.19  ? 576 LYS D CD    1 
ATOM   5226 C  CE    . LYS D 4 576 ? -56.146 -2.802  37.530 1.00 66.14  ? 576 LYS D CE    1 
ATOM   5227 N  NZ    . LYS D 4 576 ? -56.850 -3.082  38.813 1.00 64.94  ? 576 LYS D NZ    1 
ATOM   5228 N  N     . LYS D 4 577 ? -58.194 2.817   34.472 1.00 56.84  ? 577 LYS D N     1 
ATOM   5229 C  CA    . LYS D 4 577 ? -59.002 3.709   33.652 1.00 58.34  ? 577 LYS D CA    1 
ATOM   5230 C  C     . LYS D 4 577 ? -58.505 3.672   32.213 1.00 59.36  ? 577 LYS D C     1 
ATOM   5231 O  O     . LYS D 4 577 ? -59.299 3.581   31.271 1.00 59.16  ? 577 LYS D O     1 
ATOM   5232 C  CB    . LYS D 4 577 ? -58.924 5.144   34.171 1.00 59.09  ? 577 LYS D CB    1 
ATOM   5233 C  CG    . LYS D 4 577 ? -59.590 5.382   35.515 1.00 61.18  ? 577 LYS D CG    1 
ATOM   5234 C  CD    . LYS D 4 577 ? -59.649 6.880   35.811 1.00 62.70  ? 577 LYS D CD    1 
ATOM   5235 C  CE    . LYS D 4 577 ? -60.286 7.171   37.162 1.00 64.92  ? 577 LYS D CE    1 
ATOM   5236 N  NZ    . LYS D 4 577 ? -59.488 6.639   38.306 1.00 65.37  ? 577 LYS D NZ    1 
ATOM   5237 N  N     . VAL D 4 578 ? -57.185 3.751   32.051 1.00 59.86  ? 578 VAL D N     1 
ATOM   5238 C  CA    . VAL D 4 578 ? -56.573 3.709   30.731 1.00 59.04  ? 578 VAL D CA    1 
ATOM   5239 C  C     . VAL D 4 578 ? -56.939 2.402   30.054 1.00 60.61  ? 578 VAL D C     1 
ATOM   5240 O  O     . VAL D 4 578 ? -57.211 2.378   28.860 1.00 61.44  ? 578 VAL D O     1 
ATOM   5241 C  CB    . VAL D 4 578 ? -55.039 3.822   30.811 1.00 57.27  ? 578 VAL D CB    1 
ATOM   5242 C  CG1   . VAL D 4 578 ? -54.400 3.433   29.483 1.00 55.49  ? 578 VAL D CG1   1 
ATOM   5243 C  CG2   . VAL D 4 578 ? -54.658 5.238   31.150 1.00 56.74  ? 578 VAL D CG2   1 
ATOM   5244 N  N     . ASN D 4 579 ? -56.958 1.316   30.817 1.00 61.65  ? 579 ASN D N     1 
ATOM   5245 C  CA    . ASN D 4 579 ? -57.300 0.025   30.245 1.00 64.10  ? 579 ASN D CA    1 
ATOM   5246 C  C     . ASN D 4 579 ? -58.764 -0.057  29.819 1.00 65.16  ? 579 ASN D C     1 
ATOM   5247 O  O     . ASN D 4 579 ? -59.063 -0.621  28.766 1.00 65.10  ? 579 ASN D O     1 
ATOM   5248 C  CB    . ASN D 4 579 ? -56.936 -1.093  31.220 1.00 64.54  ? 579 ASN D CB    1 
ATOM   5249 C  CG    . ASN D 4 579 ? -55.456 -1.463  31.151 1.00 65.81  ? 579 ASN D CG    1 
ATOM   5250 O  OD1   . ASN D 4 579 ? -54.854 -1.841  32.151 1.00 67.38  ? 579 ASN D OD1   1 
ATOM   5251 N  ND2   . ASN D 4 579 ? -54.871 -1.366  29.960 1.00 66.61  ? 579 ASN D ND2   1 
ATOM   5252 N  N     . GLU D 4 580 ? -59.672 0.505   30.618 1.00 66.22  ? 580 GLU D N     1 
ATOM   5253 C  CA    . GLU D 4 580 ? -61.090 0.502   30.254 1.00 66.15  ? 580 GLU D CA    1 
ATOM   5254 C  C     . GLU D 4 580 ? -61.140 1.151   28.866 1.00 64.99  ? 580 GLU D C     1 
ATOM   5255 O  O     . GLU D 4 580 ? -61.786 0.639   27.948 1.00 64.88  ? 580 GLU D O     1 
ATOM   5256 C  CB    . GLU D 4 580 ? -61.928 1.350   31.224 1.00 68.63  ? 580 GLU D CB    1 
ATOM   5257 C  CG    . GLU D 4 580 ? -61.777 1.026   32.701 1.00 73.98  ? 580 GLU D CG    1 
ATOM   5258 C  CD    . GLU D 4 580 ? -62.531 2.016   33.600 1.00 78.27  ? 580 GLU D CD    1 
ATOM   5259 O  OE1   . GLU D 4 580 ? -62.432 3.244   33.356 1.00 80.08  ? 580 GLU D OE1   1 
ATOM   5260 O  OE2   . GLU D 4 580 ? -63.214 1.574   34.557 1.00 79.32  ? 580 GLU D OE2   1 
ATOM   5261 N  N     . ILE D 4 581 ? -60.445 2.279   28.727 1.00 61.83  ? 581 ILE D N     1 
ATOM   5262 C  CA    . ILE D 4 581 ? -60.399 2.997   27.465 1.00 61.14  ? 581 ILE D CA    1 
ATOM   5263 C  C     . ILE D 4 581 ? -59.891 2.082   26.360 1.00 62.47  ? 581 ILE D C     1 
ATOM   5264 O  O     . ILE D 4 581 ? -60.607 1.796   25.404 1.00 63.18  ? 581 ILE D O     1 
ATOM   5265 C  CB    . ILE D 4 581 ? -59.461 4.224   27.533 1.00 61.05  ? 581 ILE D CB    1 
ATOM   5266 C  CG1   . ILE D 4 581 ? -60.003 5.259   28.514 1.00 59.60  ? 581 ILE D CG1   1 
ATOM   5267 C  CG2   . ILE D 4 581 ? -59.307 4.845   26.144 1.00 58.96  ? 581 ILE D CG2   1 
ATOM   5268 C  CD1   . ILE D 4 581 ? -59.182 6.538   28.542 1.00 59.53  ? 581 ILE D CD1   1 
ATOM   5269 N  N     . LEU D 4 582 ? -58.644 1.640   26.489 1.00 63.51  ? 582 LEU D N     1 
ATOM   5270 C  CA    . LEU D 4 582 ? -58.037 0.760   25.503 1.00 63.79  ? 582 LEU D CA    1 
ATOM   5271 C  C     . LEU D 4 582 ? -58.973 -0.386  25.166 1.00 64.45  ? 582 LEU D C     1 
ATOM   5272 O  O     . LEU D 4 582 ? -59.174 -0.695  23.995 1.00 63.19  ? 582 LEU D O     1 
ATOM   5273 C  CB    . LEU D 4 582 ? -56.714 0.203   26.026 1.00 64.60  ? 582 LEU D CB    1 
ATOM   5274 C  CG    . LEU D 4 582 ? -55.544 1.181   26.107 1.00 65.25  ? 582 LEU D CG    1 
ATOM   5275 C  CD1   . LEU D 4 582 ? -54.336 0.482   26.698 1.00 65.75  ? 582 LEU D CD1   1 
ATOM   5276 C  CD2   . LEU D 4 582 ? -55.229 1.707   24.724 1.00 65.55  ? 582 LEU D CD2   1 
ATOM   5277 N  N     . GLN D 4 583 ? -59.540 -1.011  26.196 1.00 65.41  ? 583 GLN D N     1 
ATOM   5278 C  CA    . GLN D 4 583 ? -60.466 -2.122  26.000 1.00 67.44  ? 583 GLN D CA    1 
ATOM   5279 C  C     . GLN D 4 583 ? -61.632 -1.664  25.132 1.00 68.52  ? 583 GLN D C     1 
ATOM   5280 O  O     . GLN D 4 583 ? -62.019 -2.348  24.185 1.00 68.66  ? 583 GLN D O     1 
ATOM   5281 C  CB    . GLN D 4 583 ? -61.003 -2.622  27.346 1.00 68.39  ? 583 GLN D CB    1 
ATOM   5282 C  CG    . GLN D 4 583 ? -60.014 -3.416  28.194 1.00 70.63  ? 583 GLN D CG    1 
ATOM   5283 C  CD    . GLN D 4 583 ? -59.806 -4.841  27.698 1.00 72.92  ? 583 GLN D CD    1 
ATOM   5284 O  OE1   . GLN D 4 583 ? -59.345 -5.067  26.573 1.00 74.46  ? 583 GLN D OE1   1 
ATOM   5285 N  NE2   . GLN D 4 583 ? -60.147 -5.812  28.541 1.00 72.97  ? 583 GLN D NE2   1 
ATOM   5286 N  N     . ALA D 4 584 ? -62.184 -0.500  25.463 1.00 69.61  ? 584 ALA D N     1 
ATOM   5287 C  CA    . ALA D 4 584 ? -63.308 0.064   24.721 1.00 70.47  ? 584 ALA D CA    1 
ATOM   5288 C  C     . ALA D 4 584 ? -62.927 0.407   23.286 1.00 70.69  ? 584 ALA D C     1 
ATOM   5289 O  O     . ALA D 4 584 ? -63.651 0.077   22.354 1.00 70.35  ? 584 ALA D O     1 
ATOM   5290 C  CB    . ALA D 4 584 ? -63.831 1.304   25.430 1.00 69.46  ? 584 ALA D CB    1 
ATOM   5291 N  N     . ASP D 4 585 ? -61.794 1.078   23.113 1.00 72.17  ? 585 ASP D N     1 
ATOM   5292 C  CA    . ASP D 4 585 ? -61.322 1.459   21.783 1.00 74.40  ? 585 ASP D CA    1 
ATOM   5293 C  C     . ASP D 4 585 ? -60.926 0.231   20.964 1.00 75.63  ? 585 ASP D C     1 
ATOM   5294 O  O     . ASP D 4 585 ? -60.877 0.278   19.730 1.00 74.73  ? 585 ASP D O     1 
ATOM   5295 C  CB    . ASP D 4 585 ? -60.118 2.400   21.897 1.00 74.16  ? 585 ASP D CB    1 
ATOM   5296 C  CG    . ASP D 4 585 ? -60.519 3.853   22.065 1.00 75.88  ? 585 ASP D CG    1 
ATOM   5297 O  OD1   . ASP D 4 585 ? -59.623 4.683   22.336 1.00 74.53  ? 585 ASP D OD1   1 
ATOM   5298 O  OD2   . ASP D 4 585 ? -61.722 4.170   21.915 1.00 77.67  ? 585 ASP D OD2   1 
ATOM   5299 N  N     . ALA D 4 586 ? -60.642 -0.864  21.661 1.00 77.01  ? 586 ALA D N     1 
ATOM   5300 C  CA    . ALA D 4 586 ? -60.238 -2.097  21.005 1.00 78.87  ? 586 ALA D CA    1 
ATOM   5301 C  C     . ALA D 4 586 ? -61.306 -2.583  20.038 1.00 80.70  ? 586 ALA D C     1 
ATOM   5302 O  O     . ALA D 4 586 ? -61.067 -2.659  18.831 1.00 81.99  ? 586 ALA D O     1 
ATOM   5303 C  CB    . ALA D 4 586 ? -59.948 -3.175  22.041 1.00 77.83  ? 586 ALA D CB    1 
ATOM   5304 N  N     . ILE D 4 587 ? -62.488 -2.903  20.560 1.00 81.43  ? 587 ILE D N     1 
ATOM   5305 C  CA    . ILE D 4 587 ? -63.549 -3.403  19.704 1.00 82.36  ? 587 ILE D CA    1 
ATOM   5306 C  C     . ILE D 4 587 ? -64.200 -2.339  18.832 1.00 83.11  ? 587 ILE D C     1 
ATOM   5307 O  O     . ILE D 4 587 ? -64.534 -2.613  17.682 1.00 83.86  ? 587 ILE D O     1 
ATOM   5308 C  CB    . ILE D 4 587 ? -64.643 -4.157  20.512 1.00 82.71  ? 587 ILE D CB    1 
ATOM   5309 C  CG1   . ILE D 4 587 ? -65.505 -3.181  21.316 1.00 82.55  ? 587 ILE D CG1   1 
ATOM   5310 C  CG2   . ILE D 4 587 ? -63.983 -5.173  21.432 1.00 82.33  ? 587 ILE D CG2   1 
ATOM   5311 C  CD1   . ILE D 4 587 ? -66.632 -3.860  22.095 1.00 81.21  ? 587 ILE D CD1   1 
ATOM   5312 N  N     . ASN D 4 588 ? -64.370 -1.125  19.343 1.00 83.64  ? 588 ASN D N     1 
ATOM   5313 C  CA    . ASN D 4 588 ? -64.995 -0.096  18.520 1.00 85.68  ? 588 ASN D CA    1 
ATOM   5314 C  C     . ASN D 4 588 ? -64.456 1.313   18.695 1.00 86.92  ? 588 ASN D C     1 
ATOM   5315 O  O     . ASN D 4 588 ? -65.032 2.119   19.419 1.00 87.75  ? 588 ASN D O     1 
ATOM   5316 C  CB    . ASN D 4 588 ? -66.518 -0.114  18.730 1.00 85.62  ? 588 ASN D CB    1 
ATOM   5317 C  CG    . ASN D 4 588 ? -66.912 -0.124  20.192 1.00 85.24  ? 588 ASN D CG    1 
ATOM   5318 O  OD1   . ASN D 4 588 ? -68.027 -0.513  20.541 1.00 83.63  ? 588 ASN D OD1   1 
ATOM   5319 N  ND2   . ASN D 4 588 ? -66.004 0.314   21.054 1.00 86.40  ? 588 ASN D ND2   1 
ATOM   5320 N  N     . GLY D 4 589 ? -63.359 1.612   18.004 1.00 88.50  ? 589 GLY D N     1 
ATOM   5321 C  CA    . GLY D 4 589 ? -62.765 2.931   18.108 1.00 90.41  ? 589 GLY D CA    1 
ATOM   5322 C  C     . GLY D 4 589 ? -61.988 3.362   16.881 1.00 92.03  ? 589 GLY D C     1 
ATOM   5323 O  O     . GLY D 4 589 ? -60.762 3.334   16.878 1.00 93.56  ? 589 GLY D O     1 
ATOM   5324 N  N     . THR D 4 590 ? -62.707 3.764   15.838 1.00 93.27  ? 590 THR D N     1 
ATOM   5325 C  CA    . THR D 4 590 ? -62.112 4.227   14.583 1.00 94.20  ? 590 THR D CA    1 
ATOM   5326 C  C     . THR D 4 590 ? -61.056 3.303   13.976 1.00 95.74  ? 590 THR D C     1 
ATOM   5327 O  O     . THR D 4 590 ? -60.559 2.386   14.627 1.00 95.43  ? 590 THR D O     1 
ATOM   5328 C  CB    . THR D 4 590 ? -61.490 5.632   14.744 1.00 93.17  ? 590 THR D CB    1 
ATOM   5329 O  OG1   . THR D 4 590 ? -60.278 5.541   15.501 1.00 91.50  ? 590 THR D OG1   1 
ATOM   5330 C  CG2   . THR D 4 590 ? -62.466 6.564   15.456 1.00 92.30  ? 590 THR D CG2   1 
ATOM   5331 N  N     . ASP D 4 591 ? -60.728 3.553   12.712 1.00 97.65  ? 591 ASP D N     1 
ATOM   5332 C  CA    . ASP D 4 591 ? -59.735 2.759   12.005 1.00 99.72  ? 591 ASP D CA    1 
ATOM   5333 C  C     . ASP D 4 591 ? -58.697 3.634   11.317 1.00 100.86 ? 591 ASP D C     1 
ATOM   5334 O  O     . ASP D 4 591 ? -58.779 4.863   11.353 1.00 100.02 ? 591 ASP D O     1 
ATOM   5335 C  CB    . ASP D 4 591 ? -60.411 1.832   10.987 1.00 101.28 ? 591 ASP D CB    1 
ATOM   5336 C  CG    . ASP D 4 591 ? -61.472 2.536   10.160 1.00 103.19 ? 591 ASP D CG    1 
ATOM   5337 O  OD1   . ASP D 4 591 ? -61.149 3.549   9.500  1.00 104.01 ? 591 ASP D OD1   1 
ATOM   5338 O  OD2   . ASP D 4 591 ? -62.633 2.067   10.169 1.00 103.85 ? 591 ASP D OD2   1 
ATOM   5339 N  N     . ASN D 4 592 ? -57.725 2.987   10.685 1.00 102.72 ? 592 ASN D N     1 
ATOM   5340 C  CA    . ASN D 4 592 ? -56.631 3.679   10.015 1.00 104.60 ? 592 ASN D CA    1 
ATOM   5341 C  C     . ASN D 4 592 ? -57.038 4.405   8.733  1.00 106.01 ? 592 ASN D C     1 
ATOM   5342 O  O     . ASN D 4 592 ? -57.782 3.869   7.915  1.00 105.92 ? 592 ASN D O     1 
ATOM   5343 C  CB    . ASN D 4 592 ? -55.514 2.682   9.695  1.00 104.52 ? 592 ASN D CB    1 
ATOM   5344 C  CG    . ASN D 4 592 ? -55.184 1.768   10.868 1.00 104.69 ? 592 ASN D CG    1 
ATOM   5345 O  OD1   . ASN D 4 592 ? -54.212 1.011   10.822 1.00 104.67 ? 592 ASN D OD1   1 
ATOM   5346 N  ND2   . ASN D 4 592 ? -55.993 1.827   11.919 1.00 104.41 ? 592 ASN D ND2   1 
ATOM   5347 N  N     . GLU D 4 593 ? -56.539 5.628   8.569  1.00 107.47 ? 593 GLU D N     1 
ATOM   5348 C  CA    . GLU D 4 593 ? -56.818 6.436   7.383  1.00 109.01 ? 593 GLU D CA    1 
ATOM   5349 C  C     . GLU D 4 593 ? -55.499 6.676   6.654  1.00 109.94 ? 593 GLU D C     1 
ATOM   5350 O  O     . GLU D 4 593 ? -54.540 7.160   7.253  1.00 110.28 ? 593 GLU D O     1 
ATOM   5351 C  CB    . GLU D 4 593 ? -57.426 7.789   7.773  1.00 109.38 ? 593 GLU D CB    1 
ATOM   5352 C  CG    . GLU D 4 593 ? -58.770 7.716   8.489  1.00 110.75 ? 593 GLU D CG    1 
ATOM   5353 C  CD    . GLU D 4 593 ? -59.863 7.076   7.648  1.00 111.51 ? 593 GLU D CD    1 
ATOM   5354 O  OE1   . GLU D 4 593 ? -59.769 5.860   7.368  1.00 111.68 ? 593 GLU D OE1   1 
ATOM   5355 O  OE2   . GLU D 4 593 ? -60.816 7.792   7.264  1.00 111.63 ? 593 GLU D OE2   1 
ATOM   5356 N  N     . VAL D 4 594 ? -55.450 6.337   5.368  1.00 110.70 ? 594 VAL D N     1 
ATOM   5357 C  CA    . VAL D 4 594 ? -54.235 6.518   4.574  1.00 110.83 ? 594 VAL D CA    1 
ATOM   5358 C  C     . VAL D 4 594 ? -53.120 5.611   5.103  1.00 110.74 ? 594 VAL D C     1 
ATOM   5359 O  O     . VAL D 4 594 ? -52.834 4.558   4.527  1.00 110.90 ? 594 VAL D O     1 
ATOM   5360 C  CB    . VAL D 4 594 ? -53.751 7.987   4.628  1.00 111.10 ? 594 VAL D CB    1 
ATOM   5361 C  CG1   . VAL D 4 594 ? -52.585 8.191   3.673  1.00 110.79 ? 594 VAL D CG1   1 
ATOM   5362 C  CG2   . VAL D 4 594 ? -54.905 8.927   4.300  1.00 111.12 ? 594 VAL D CG2   1 
ATOM   5363 N  N     . VAL D 4 609 ? -52.499 6.035   6.202  1.00 110.10 ? 609 VAL D N     1 
ATOM   5364 C  CA    . VAL D 4 609 ? -51.419 5.287   6.846  1.00 109.12 ? 609 VAL D CA    1 
ATOM   5365 C  C     . VAL D 4 609 ? -51.494 5.482   8.356  1.00 107.86 ? 609 VAL D C     1 
ATOM   5366 O  O     . VAL D 4 609 ? -51.268 4.548   9.123  1.00 107.46 ? 609 VAL D O     1 
ATOM   5367 C  CB    . VAL D 4 609 ? -50.020 5.768   6.376  1.00 109.36 ? 609 VAL D CB    1 
ATOM   5368 C  CG1   . VAL D 4 609 ? -48.933 5.066   7.178  1.00 109.50 ? 609 VAL D CG1   1 
ATOM   5369 C  CG2   . VAL D 4 609 ? -49.837 5.488   4.894  1.00 109.72 ? 609 VAL D CG2   1 
ATOM   5370 N  N     . LYS D 4 610 ? -51.813 6.710   8.761  1.00 106.42 ? 610 LYS D N     1 
ATOM   5371 C  CA    . LYS D 4 610 ? -51.919 7.094   10.168 1.00 104.76 ? 610 LYS D CA    1 
ATOM   5372 C  C     . LYS D 4 610 ? -52.818 6.170   10.983 1.00 103.60 ? 610 LYS D C     1 
ATOM   5373 O  O     . LYS D 4 610 ? -54.045 6.228   10.887 1.00 103.21 ? 610 LYS D O     1 
ATOM   5374 C  CB    . LYS D 4 610 ? -52.428 8.537   10.272 1.00 104.69 ? 610 LYS D CB    1 
ATOM   5375 C  CG    . LYS D 4 610 ? -52.417 9.112   11.679 1.00 104.86 ? 610 LYS D CG    1 
ATOM   5376 C  CD    . LYS D 4 610 ? -52.583 10.623  11.658 1.00 104.38 ? 610 LYS D CD    1 
ATOM   5377 C  CE    . LYS D 4 610 ? -53.912 11.028  11.048 1.00 104.69 ? 610 LYS D CE    1 
ATOM   5378 N  NZ    . LYS D 4 610 ? -54.007 12.504  10.867 1.00 105.00 ? 610 LYS D NZ    1 
ATOM   5379 N  N     . LEU D 4 611 ? -52.190 5.323   11.793 1.00 102.43 ? 611 LEU D N     1 
ATOM   5380 C  CA    . LEU D 4 611 ? -52.908 4.373   12.633 1.00 100.88 ? 611 LEU D CA    1 
ATOM   5381 C  C     . LEU D 4 611 ? -53.976 5.056   13.479 1.00 99.67  ? 611 LEU D C     1 
ATOM   5382 O  O     . LEU D 4 611 ? -53.679 5.953   14.270 1.00 99.67  ? 611 LEU D O     1 
ATOM   5383 C  CB    . LEU D 4 611 ? -51.929 3.634   13.553 1.00 101.05 ? 611 LEU D CB    1 
ATOM   5384 C  CG    . LEU D 4 611 ? -50.907 2.679   12.928 1.00 101.03 ? 611 LEU D CG    1 
ATOM   5385 C  CD1   . LEU D 4 611 ? -49.983 2.146   14.011 1.00 100.60 ? 611 LEU D CD1   1 
ATOM   5386 C  CD2   . LEU D 4 611 ? -51.626 1.530   12.235 1.00 101.32 ? 611 LEU D CD2   1 
ATOM   5387 N  N     . GLY D 4 612 ? -55.222 4.634   13.300 1.00 98.11  ? 612 GLY D N     1 
ATOM   5388 C  CA    . GLY D 4 612 ? -56.301 5.208   14.077 1.00 96.13  ? 612 GLY D CA    1 
ATOM   5389 C  C     . GLY D 4 612 ? -56.337 4.486   15.405 1.00 95.15  ? 612 GLY D C     1 
ATOM   5390 O  O     . GLY D 4 612 ? -55.404 3.752   15.734 1.00 95.28  ? 612 GLY D O     1 
ATOM   5391 N  N     . THR D 4 613 ? -57.400 4.686   16.174 1.00 93.83  ? 613 THR D N     1 
ATOM   5392 C  CA    . THR D 4 613 ? -57.521 4.018   17.461 1.00 92.31  ? 613 THR D CA    1 
ATOM   5393 C  C     . THR D 4 613 ? -57.833 2.557   17.170 1.00 91.93  ? 613 THR D C     1 
ATOM   5394 O  O     . THR D 4 613 ? -57.676 2.117   16.035 1.00 93.79  ? 613 THR D O     1 
ATOM   5395 C  CB    . THR D 4 613 ? -58.644 4.636   18.297 1.00 91.91  ? 613 THR D CB    1 
ATOM   5396 O  OG1   . THR D 4 613 ? -58.491 6.059   18.326 1.00 91.46  ? 613 THR D OG1   1 
ATOM   5397 C  CG2   . THR D 4 613 ? -58.583 4.121   19.710 1.00 92.23  ? 613 THR D CG2   1 
ATOM   5398 N  N     . LYS D 4 614 ? -58.277 1.805   18.173 1.00 90.64  ? 614 LYS D N     1 
ATOM   5399 C  CA    . LYS D 4 614 ? -58.591 0.387   17.981 1.00 89.04  ? 614 LYS D CA    1 
ATOM   5400 C  C     . LYS D 4 614 ? -57.303 -0.366  17.681 1.00 87.16  ? 614 LYS D C     1 
ATOM   5401 O  O     . LYS D 4 614 ? -56.851 -1.183  18.479 1.00 86.76  ? 614 LYS D O     1 
ATOM   5402 C  CB    . LYS D 4 614 ? -59.573 0.193   16.817 1.00 89.21  ? 614 LYS D CB    1 
ATOM   5403 C  CG    . LYS D 4 614 ? -60.004 -1.251  16.604 1.00 89.52  ? 614 LYS D CG    1 
ATOM   5404 C  CD    . LYS D 4 614 ? -60.696 -1.458  15.261 1.00 91.78  ? 614 LYS D CD    1 
ATOM   5405 C  CE    . LYS D 4 614 ? -62.004 -0.676  15.139 1.00 93.29  ? 614 LYS D CE    1 
ATOM   5406 N  NZ    . LYS D 4 614 ? -62.607 -0.795  13.772 1.00 92.57  ? 614 LYS D NZ    1 
ATOM   5407 N  N     . ALA D 4 615 ? -56.725 -0.088  16.519 1.00 85.58  ? 615 ALA D N     1 
ATOM   5408 C  CA    . ALA D 4 615 ? -55.477 -0.715  16.105 1.00 84.42  ? 615 ALA D CA    1 
ATOM   5409 C  C     . ALA D 4 615 ? -54.358 -0.164  16.981 1.00 83.02  ? 615 ALA D C     1 
ATOM   5410 O  O     . ALA D 4 615 ? -53.377 -0.851  17.272 1.00 82.44  ? 615 ALA D O     1 
ATOM   5411 C  CB    . ALA D 4 615 ? -55.198 -0.405  14.644 1.00 84.66  ? 615 ALA D CB    1 
ATOM   5412 N  N     . LEU D 4 616 ? -54.522 1.086   17.402 1.00 81.42  ? 616 LEU D N     1 
ATOM   5413 C  CA    . LEU D 4 616 ? -53.544 1.746   18.254 1.00 79.09  ? 616 LEU D CA    1 
ATOM   5414 C  C     . LEU D 4 616 ? -53.673 1.176   19.662 1.00 78.25  ? 616 LEU D C     1 
ATOM   5415 O  O     . LEU D 4 616 ? -52.676 0.909   20.328 1.00 77.92  ? 616 LEU D O     1 
ATOM   5416 C  CB    . LEU D 4 616 ? -53.797 3.256   18.256 1.00 77.49  ? 616 LEU D CB    1 
ATOM   5417 C  CG    . LEU D 4 616 ? -52.566 4.164   18.217 1.00 77.13  ? 616 LEU D CG    1 
ATOM   5418 C  CD1   . LEU D 4 616 ? -51.579 3.686   17.165 1.00 76.07  ? 616 LEU D CD1   1 
ATOM   5419 C  CD2   . LEU D 4 616 ? -53.004 5.581   17.917 1.00 76.41  ? 616 LEU D CD2   1 
ATOM   5420 N  N     . ALA D 4 617 ? -54.911 0.973   20.102 1.00 77.42  ? 617 ALA D N     1 
ATOM   5421 C  CA    . ALA D 4 617 ? -55.176 0.422   21.425 1.00 76.11  ? 617 ALA D CA    1 
ATOM   5422 C  C     . ALA D 4 617 ? -54.731 -1.036  21.497 1.00 75.69  ? 617 ALA D C     1 
ATOM   5423 O  O     . ALA D 4 617 ? -54.139 -1.469  22.486 1.00 76.34  ? 617 ALA D O     1 
ATOM   5424 C  CB    . ALA D 4 617 ? -56.657 0.530   21.742 1.00 76.02  ? 617 ALA D CB    1 
ATOM   5425 N  N     . GLY D 4 618 ? -55.029 -1.793  20.447 1.00 74.62  ? 618 GLY D N     1 
ATOM   5426 C  CA    . GLY D 4 618 ? -54.643 -3.189  20.414 1.00 72.81  ? 618 GLY D CA    1 
ATOM   5427 C  C     . GLY D 4 618 ? -53.161 -3.303  20.685 1.00 71.84  ? 618 GLY D C     1 
ATOM   5428 O  O     . GLY D 4 618 ? -52.731 -4.136  21.482 1.00 70.98  ? 618 GLY D O     1 
ATOM   5429 N  N     . GLN D 4 619 ? -52.383 -2.453  20.019 1.00 71.33  ? 619 GLN D N     1 
ATOM   5430 C  CA    . GLN D 4 619 ? -50.931 -2.424  20.184 1.00 70.72  ? 619 GLN D CA    1 
ATOM   5431 C  C     . GLN D 4 619 ? -50.547 -2.305  21.656 1.00 70.73  ? 619 GLN D C     1 
ATOM   5432 O  O     . GLN D 4 619 ? -49.756 -3.101  22.163 1.00 70.94  ? 619 GLN D O     1 
ATOM   5433 C  CB    . GLN D 4 619 ? -50.335 -1.257  19.398 1.00 69.89  ? 619 GLN D CB    1 
ATOM   5434 C  CG    . GLN D 4 619 ? -50.107 -1.554  17.932 1.00 70.39  ? 619 GLN D CG    1 
ATOM   5435 C  CD    . GLN D 4 619 ? -49.745 -0.316  17.141 1.00 71.63  ? 619 GLN D CD    1 
ATOM   5436 O  OE1   . GLN D 4 619 ? -49.214 0.649   17.689 1.00 74.28  ? 619 GLN D OE1   1 
ATOM   5437 N  NE2   . GLN D 4 619 ? -50.019 -0.339  15.843 1.00 71.72  ? 619 GLN D NE2   1 
ATOM   5438 N  N     . TRP D 4 620 ? -51.107 -1.309  22.338 1.00 70.54  ? 620 TRP D N     1 
ATOM   5439 C  CA    . TRP D 4 620 ? -50.834 -1.109  23.757 1.00 69.22  ? 620 TRP D CA    1 
ATOM   5440 C  C     . TRP D 4 620 ? -51.355 -2.287  24.554 1.00 69.20  ? 620 TRP D C     1 
ATOM   5441 O  O     . TRP D 4 620 ? -50.760 -2.677  25.551 1.00 69.30  ? 620 TRP D O     1 
ATOM   5442 C  CB    . TRP D 4 620 ? -51.488 0.177   24.261 1.00 68.03  ? 620 TRP D CB    1 
ATOM   5443 C  CG    . TRP D 4 620 ? -50.714 1.385   23.901 1.00 66.40  ? 620 TRP D CG    1 
ATOM   5444 C  CD1   . TRP D 4 620 ? -50.990 2.276   22.908 1.00 64.58  ? 620 TRP D CD1   1 
ATOM   5445 C  CD2   . TRP D 4 620 ? -49.490 1.813   24.500 1.00 66.41  ? 620 TRP D CD2   1 
ATOM   5446 N  NE1   . TRP D 4 620 ? -50.008 3.235   22.850 1.00 64.47  ? 620 TRP D NE1   1 
ATOM   5447 C  CE2   . TRP D 4 620 ? -49.075 2.973   23.818 1.00 65.20  ? 620 TRP D CE2   1 
ATOM   5448 C  CE3   . TRP D 4 620 ? -48.701 1.325   25.551 1.00 65.52  ? 620 TRP D CE3   1 
ATOM   5449 C  CZ2   . TRP D 4 620 ? -47.906 3.654   24.151 1.00 65.71  ? 620 TRP D CZ2   1 
ATOM   5450 C  CZ3   . TRP D 4 620 ? -47.541 2.002   25.881 1.00 64.75  ? 620 TRP D CZ3   1 
ATOM   5451 C  CH2   . TRP D 4 620 ? -47.154 3.153   25.185 1.00 65.61  ? 620 TRP D CH2   1 
ATOM   5452 N  N     . LEU D 4 621 ? -52.475 -2.847  24.116 1.00 69.29  ? 621 LEU D N     1 
ATOM   5453 C  CA    . LEU D 4 621 ? -53.050 -3.996  24.795 1.00 69.68  ? 621 LEU D CA    1 
ATOM   5454 C  C     . LEU D 4 621 ? -52.088 -5.155  24.618 1.00 69.80  ? 621 LEU D C     1 
ATOM   5455 O  O     . LEU D 4 621 ? -51.882 -5.958  25.535 1.00 69.22  ? 621 LEU D O     1 
ATOM   5456 C  CB    . LEU D 4 621 ? -54.410 -4.333  24.196 1.00 70.10  ? 621 LEU D CB    1 
ATOM   5457 C  CG    . LEU D 4 621 ? -55.500 -3.347  24.613 1.00 70.66  ? 621 LEU D CG    1 
ATOM   5458 C  CD1   . LEU D 4 621 ? -56.721 -3.524  23.735 1.00 71.32  ? 621 LEU D CD1   1 
ATOM   5459 C  CD2   . LEU D 4 621 ? -55.834 -3.563  26.086 1.00 70.05  ? 621 LEU D CD2   1 
ATOM   5460 N  N     . ALA D 4 622 ? -51.498 -5.226  23.428 1.00 69.70  ? 622 ALA D N     1 
ATOM   5461 C  CA    . ALA D 4 622 ? -50.523 -6.260  23.113 1.00 69.10  ? 622 ALA D CA    1 
ATOM   5462 C  C     . ALA D 4 622 ? -49.358 -6.052  24.069 1.00 68.58  ? 622 ALA D C     1 
ATOM   5463 O  O     . ALA D 4 622 ? -48.797 -7.007  24.598 1.00 68.53  ? 622 ALA D O     1 
ATOM   5464 C  CB    . ALA D 4 622 ? -50.052 -6.120  21.673 1.00 68.51  ? 622 ALA D CB    1 
ATOM   5465 N  N     . TYR D 4 623 ? -49.008 -4.789  24.289 1.00 68.04  ? 623 TYR D N     1 
ATOM   5466 C  CA    . TYR D 4 623 ? -47.925 -4.452  25.198 1.00 68.54  ? 623 TYR D CA    1 
ATOM   5467 C  C     . TYR D 4 623 ? -48.300 -4.972  26.587 1.00 67.89  ? 623 TYR D C     1 
ATOM   5468 O  O     . TYR D 4 623 ? -48.400 -6.180  26.797 1.00 68.64  ? 623 TYR D O     1 
ATOM   5469 C  CB    . TYR D 4 623 ? -47.720 -2.936  25.238 1.00 69.25  ? 623 TYR D CB    1 
ATOM   5470 C  CG    . TYR D 4 623 ? -46.455 -2.510  25.950 1.00 70.74  ? 623 TYR D CG    1 
ATOM   5471 C  CD1   . TYR D 4 623 ? -45.216 -2.569  25.311 1.00 71.10  ? 623 TYR D CD1   1 
ATOM   5472 C  CD2   . TYR D 4 623 ? -46.492 -2.064  27.270 1.00 71.01  ? 623 TYR D CD2   1 
ATOM   5473 C  CE1   . TYR D 4 623 ? -44.050 -2.194  25.971 1.00 70.32  ? 623 TYR D CE1   1 
ATOM   5474 C  CE2   . TYR D 4 623 ? -45.330 -1.690  27.936 1.00 70.71  ? 623 TYR D CE2   1 
ATOM   5475 C  CZ    . TYR D 4 623 ? -44.120 -1.757  27.282 1.00 70.04  ? 623 TYR D CZ    1 
ATOM   5476 O  OH    . TYR D 4 623 ? -42.979 -1.384  27.944 1.00 72.18  ? 623 TYR D OH    1 
ATOM   5477 N  N     . GLY D 4 624 ? -48.520 -4.067  27.532 1.00 66.44  ? 624 GLY D N     1 
ATOM   5478 C  CA    . GLY D 4 624 ? -48.884 -4.495  28.865 1.00 66.01  ? 624 GLY D CA    1 
ATOM   5479 C  C     . GLY D 4 624 ? -49.109 -3.332  29.804 1.00 66.40  ? 624 GLY D C     1 
ATOM   5480 O  O     . GLY D 4 624 ? -48.737 -3.401  30.975 1.00 68.23  ? 624 GLY D O     1 
ATOM   5481 N  N     . VAL D 4 625 ? -49.720 -2.269  29.288 1.00 64.98  ? 625 VAL D N     1 
ATOM   5482 C  CA    . VAL D 4 625 ? -50.013 -1.062  30.057 1.00 63.32  ? 625 VAL D CA    1 
ATOM   5483 C  C     . VAL D 4 625 ? -50.237 -1.327  31.538 1.00 62.75  ? 625 VAL D C     1 
ATOM   5484 O  O     . VAL D 4 625 ? -51.261 -1.881  31.927 1.00 63.33  ? 625 VAL D O     1 
ATOM   5485 C  CB    . VAL D 4 625 ? -51.255 -0.348  29.486 1.00 62.30  ? 625 VAL D CB    1 
ATOM   5486 C  CG1   . VAL D 4 625 ? -51.580 0.896   30.300 1.00 60.25  ? 625 VAL D CG1   1 
ATOM   5487 C  CG2   . VAL D 4 625 ? -50.997 0.019   28.039 1.00 62.39  ? 625 VAL D CG2   1 
ATOM   5488 N  N     . THR D 4 626 ? -49.269 -0.927  32.356 1.00 62.80  ? 626 THR D N     1 
ATOM   5489 C  CA    . THR D 4 626 ? -49.340 -1.108  33.805 1.00 64.08  ? 626 THR D CA    1 
ATOM   5490 C  C     . THR D 4 626 ? -49.087 0.208   34.525 1.00 64.05  ? 626 THR D C     1 
ATOM   5491 O  O     . THR D 4 626 ? -48.876 1.240   33.893 1.00 66.25  ? 626 THR D O     1 
ATOM   5492 C  CB    . THR D 4 626 ? -48.302 -2.114  34.282 1.00 64.69  ? 626 THR D CB    1 
ATOM   5493 O  OG1   . THR D 4 626 ? -47.046 -1.822  33.651 1.00 66.29  ? 626 THR D OG1   1 
ATOM   5494 C  CG2   . THR D 4 626 ? -48.733 -3.529  33.932 1.00 65.16  ? 626 THR D CG2   1 
ATOM   5495 N  N     . ARG D 4 627 ? -49.098 0.177   35.849 1.00 63.23  ? 627 ARG D N     1 
ATOM   5496 C  CA    . ARG D 4 627 ? -48.878 1.392   36.617 1.00 62.31  ? 627 ARG D CA    1 
ATOM   5497 C  C     . ARG D 4 627 ? -47.635 2.130   36.150 1.00 62.01  ? 627 ARG D C     1 
ATOM   5498 O  O     . ARG D 4 627 ? -47.592 3.352   36.147 1.00 62.03  ? 627 ARG D O     1 
ATOM   5499 C  CB    . ARG D 4 627 ? -48.756 1.057   38.104 1.00 62.46  ? 627 ARG D CB    1 
ATOM   5500 C  CG    . ARG D 4 627 ? -47.682 0.042   38.438 1.00 61.50  ? 627 ARG D CG    1 
ATOM   5501 C  CD    . ARG D 4 627 ? -47.758 -0.350  39.904 1.00 63.74  ? 627 ARG D CD    1 
ATOM   5502 N  NE    . ARG D 4 627 ? -47.668 0.799   40.807 1.00 65.46  ? 627 ARG D NE    1 
ATOM   5503 C  CZ    . ARG D 4 627 ? -46.561 1.509   41.028 1.00 65.98  ? 627 ARG D CZ    1 
ATOM   5504 N  NH1   . ARG D 4 627 ? -45.423 1.197   40.410 1.00 65.90  ? 627 ARG D NH1   1 
ATOM   5505 N  NH2   . ARG D 4 627 ? -46.595 2.532   41.871 1.00 64.10  ? 627 ARG D NH2   1 
ATOM   5506 N  N     . SER D 4 628 ? -46.632 1.374   35.734 1.00 62.12  ? 628 SER D N     1 
ATOM   5507 C  CA    . SER D 4 628 ? -45.374 1.945   35.285 1.00 63.56  ? 628 SER D CA    1 
ATOM   5508 C  C     . SER D 4 628 ? -45.476 2.914   34.115 1.00 63.97  ? 628 SER D C     1 
ATOM   5509 O  O     . SER D 4 628 ? -44.787 3.934   34.083 1.00 63.67  ? 628 SER D O     1 
ATOM   5510 C  CB    . SER D 4 628 ? -44.411 0.814   34.941 1.00 64.00  ? 628 SER D CB    1 
ATOM   5511 O  OG    . SER D 4 628 ? -45.138 -0.328  34.533 1.00 65.28  ? 628 SER D OG    1 
ATOM   5512 N  N     . VAL D 4 629 ? -46.334 2.596   33.155 1.00 64.21  ? 629 VAL D N     1 
ATOM   5513 C  CA    . VAL D 4 629 ? -46.509 3.435   31.978 1.00 64.43  ? 629 VAL D CA    1 
ATOM   5514 C  C     . VAL D 4 629 ? -47.114 4.790   32.322 1.00 64.87  ? 629 VAL D C     1 
ATOM   5515 O  O     . VAL D 4 629 ? -46.789 5.803   31.704 1.00 65.46  ? 629 VAL D O     1 
ATOM   5516 C  CB    . VAL D 4 629 ? -47.441 2.756   30.960 1.00 64.71  ? 629 VAL D CB    1 
ATOM   5517 C  CG1   . VAL D 4 629 ? -47.431 3.526   29.645 1.00 64.38  ? 629 VAL D CG1   1 
ATOM   5518 C  CG2   . VAL D 4 629 ? -47.027 1.308   30.760 1.00 65.11  ? 629 VAL D CG2   1 
ATOM   5519 N  N     . THR D 4 630 ? -47.988 4.798   33.320 1.00 65.22  ? 630 THR D N     1 
ATOM   5520 C  CA    . THR D 4 630 ? -48.686 6.008   33.732 1.00 67.46  ? 630 THR D CA    1 
ATOM   5521 C  C     . THR D 4 630 ? -48.007 6.838   34.822 1.00 68.15  ? 630 THR D C     1 
ATOM   5522 O  O     . THR D 4 630 ? -48.322 8.019   34.996 1.00 66.60  ? 630 THR D O     1 
ATOM   5523 C  CB    . THR D 4 630 ? -50.106 5.657   34.222 1.00 67.66  ? 630 THR D CB    1 
ATOM   5524 O  OG1   . THR D 4 630 ? -50.017 4.807   35.371 1.00 66.65  ? 630 THR D OG1   1 
ATOM   5525 C  CG2   . THR D 4 630 ? -50.878 4.924   33.137 1.00 67.64  ? 630 THR D CG2   1 
ATOM   5526 N  N     . LYS D 4 631 ? -47.079 6.217   35.544 1.00 69.51  ? 631 LYS D N     1 
ATOM   5527 C  CA    . LYS D 4 631 ? -46.376 6.868   36.647 1.00 71.57  ? 631 LYS D CA    1 
ATOM   5528 C  C     . LYS D 4 631 ? -46.038 8.348   36.454 1.00 70.37  ? 631 LYS D C     1 
ATOM   5529 O  O     . LYS D 4 631 ? -46.747 9.225   36.955 1.00 69.36  ? 631 LYS D O     1 
ATOM   5530 C  CB    . LYS D 4 631 ? -45.100 6.086   36.986 1.00 75.77  ? 631 LYS D CB    1 
ATOM   5531 C  CG    . LYS D 4 631 ? -44.391 6.539   38.266 1.00 81.54  ? 631 LYS D CG    1 
ATOM   5532 C  CD    . LYS D 4 631 ? -43.573 5.402   38.889 1.00 84.21  ? 631 LYS D CD    1 
ATOM   5533 C  CE    . LYS D 4 631 ? -42.938 5.827   40.212 1.00 87.24  ? 631 LYS D CE    1 
ATOM   5534 N  NZ    . LYS D 4 631 ? -43.956 6.251   41.225 1.00 88.07  ? 631 LYS D NZ    1 
ATOM   5535 N  N     . ARG D 4 632 ? -44.933 8.601   35.742 1.00 69.01  ? 632 ARG D N     1 
ATOM   5536 C  CA    . ARG D 4 632 ? -44.464 9.954   35.479 1.00 68.40  ? 632 ARG D CA    1 
ATOM   5537 C  C     . ARG D 4 632 ? -45.588 10.956  35.336 1.00 66.73  ? 632 ARG D C     1 
ATOM   5538 O  O     . ARG D 4 632 ? -45.671 11.934  36.071 1.00 67.17  ? 632 ARG D O     1 
ATOM   5539 C  CB    . ARG D 4 632 ? -43.639 9.986   34.194 1.00 71.62  ? 632 ARG D CB    1 
ATOM   5540 C  CG    . ARG D 4 632 ? -42.255 9.386   34.299 1.00 75.69  ? 632 ARG D CG    1 
ATOM   5541 C  CD    . ARG D 4 632 ? -41.340 10.297  35.080 1.00 78.02  ? 632 ARG D CD    1 
ATOM   5542 N  NE    . ARG D 4 632 ? -41.308 11.650  34.526 1.00 80.79  ? 632 ARG D NE    1 
ATOM   5543 C  CZ    . ARG D 4 632 ? -40.924 11.954  33.289 1.00 81.73  ? 632 ARG D CZ    1 
ATOM   5544 N  NH1   . ARG D 4 632 ? -40.539 10.999  32.451 1.00 81.89  ? 632 ARG D NH1   1 
ATOM   5545 N  NH2   . ARG D 4 632 ? -40.904 13.221  32.895 1.00 81.11  ? 632 ARG D NH2   1 
ATOM   5546 N  N     . SER D 4 633 ? -46.457 10.691  34.375 1.00 64.58  ? 633 SER D N     1 
ATOM   5547 C  CA    . SER D 4 633 ? -47.562 11.573  34.065 1.00 62.52  ? 633 SER D CA    1 
ATOM   5548 C  C     . SER D 4 633 ? -48.548 11.840  35.200 1.00 61.31  ? 633 SER D C     1 
ATOM   5549 O  O     . SER D 4 633 ? -49.022 12.960  35.358 1.00 61.63  ? 633 SER D O     1 
ATOM   5550 C  CB    . SER D 4 633 ? -48.280 11.018  32.840 1.00 62.92  ? 633 SER D CB    1 
ATOM   5551 O  OG    . SER D 4 633 ? -47.325 10.535  31.908 1.00 60.53  ? 633 SER D OG    1 
ATOM   5552 N  N     . VAL D 4 634 ? -48.866 10.830  35.996 1.00 60.61  ? 634 VAL D N     1 
ATOM   5553 C  CA    . VAL D 4 634 ? -49.808 11.045  37.090 1.00 60.52  ? 634 VAL D CA    1 
ATOM   5554 C  C     . VAL D 4 634 ? -49.140 11.932  38.125 1.00 60.71  ? 634 VAL D C     1 
ATOM   5555 O  O     . VAL D 4 634 ? -49.759 12.814  38.713 1.00 61.12  ? 634 VAL D O     1 
ATOM   5556 C  CB    . VAL D 4 634 ? -50.234 9.701   37.757 1.00 59.79  ? 634 VAL D CB    1 
ATOM   5557 C  CG1   . VAL D 4 634 ? -51.203 9.964   38.910 1.00 56.98  ? 634 VAL D CG1   1 
ATOM   5558 C  CG2   . VAL D 4 634 ? -50.886 8.792   36.720 1.00 57.68  ? 634 VAL D CG2   1 
ATOM   5559 N  N     . MET D 4 635 ? -47.855 11.692  38.321 1.00 62.14  ? 635 MET D N     1 
ATOM   5560 C  CA    . MET D 4 635 ? -47.061 12.433  39.279 1.00 63.39  ? 635 MET D CA    1 
ATOM   5561 C  C     . MET D 4 635 ? -46.776 13.881  38.881 1.00 63.45  ? 635 MET D C     1 
ATOM   5562 O  O     . MET D 4 635 ? -46.770 14.768  39.736 1.00 64.84  ? 635 MET D O     1 
ATOM   5563 C  CB    . MET D 4 635 ? -45.748 11.682  39.516 1.00 65.85  ? 635 MET D CB    1 
ATOM   5564 C  CG    . MET D 4 635 ? -44.569 12.569  39.903 1.00 70.25  ? 635 MET D CG    1 
ATOM   5565 S  SD    . MET D 4 635 ? -43.169 11.596  40.506 1.00 74.62  ? 635 MET D SD    1 
ATOM   5566 C  CE    . MET D 4 635 ? -42.841 10.491  39.074 1.00 73.22  ? 635 MET D CE    1 
ATOM   5567 N  N     . THR D 4 636 ? -46.557 14.128  37.591 1.00 61.92  ? 636 THR D N     1 
ATOM   5568 C  CA    . THR D 4 636 ? -46.231 15.472  37.123 1.00 60.10  ? 636 THR D CA    1 
ATOM   5569 C  C     . THR D 4 636 ? -47.409 16.363  36.753 1.00 58.66  ? 636 THR D C     1 
ATOM   5570 O  O     . THR D 4 636 ? -47.280 17.580  36.749 1.00 58.68  ? 636 THR D O     1 
ATOM   5571 C  CB    . THR D 4 636 ? -45.240 15.417  35.923 1.00 61.05  ? 636 THR D CB    1 
ATOM   5572 O  OG1   . THR D 4 636 ? -45.845 14.724  34.825 1.00 63.17  ? 636 THR D OG1   1 
ATOM   5573 C  CG2   . THR D 4 636 ? -43.961 14.693  36.318 1.00 59.07  ? 636 THR D CG2   1 
ATOM   5574 N  N     . LEU D 4 637 ? -48.550 15.765  36.432 1.00 58.55  ? 637 LEU D N     1 
ATOM   5575 C  CA    . LEU D 4 637 ? -49.749 16.530  36.074 1.00 57.96  ? 637 LEU D CA    1 
ATOM   5576 C  C     . LEU D 4 637 ? -49.941 17.788  36.940 1.00 58.35  ? 637 LEU D C     1 
ATOM   5577 O  O     . LEU D 4 637 ? -49.926 18.920  36.438 1.00 58.21  ? 637 LEU D O     1 
ATOM   5578 C  CB    . LEU D 4 637 ? -50.989 15.654  36.222 1.00 56.36  ? 637 LEU D CB    1 
ATOM   5579 C  CG    . LEU D 4 637 ? -52.278 16.469  36.318 1.00 57.17  ? 637 LEU D CG    1 
ATOM   5580 C  CD1   . LEU D 4 637 ? -52.729 16.845  34.918 1.00 58.93  ? 637 LEU D CD1   1 
ATOM   5581 C  CD2   . LEU D 4 637 ? -53.353 15.672  37.025 1.00 58.62  ? 637 LEU D CD2   1 
ATOM   5582 N  N     . ALA D 4 638 ? -50.137 17.566  38.240 1.00 57.75  ? 638 ALA D N     1 
ATOM   5583 C  CA    . ALA D 4 638 ? -50.347 18.640  39.201 1.00 56.29  ? 638 ALA D CA    1 
ATOM   5584 C  C     . ALA D 4 638 ? -49.122 19.526  39.344 1.00 55.86  ? 638 ALA D C     1 
ATOM   5585 O  O     . ALA D 4 638 ? -49.126 20.470  40.131 1.00 55.20  ? 638 ALA D O     1 
ATOM   5586 C  CB    . ALA D 4 638 ? -50.739 18.067  40.553 1.00 55.84  ? 638 ALA D CB    1 
ATOM   5587 N  N     . TYR D 4 639 ? -48.069 19.215  38.596 1.00 55.65  ? 639 TYR D N     1 
ATOM   5588 C  CA    . TYR D 4 639 ? -46.862 20.041  38.623 1.00 55.57  ? 639 TYR D CA    1 
ATOM   5589 C  C     . TYR D 4 639 ? -46.850 20.929  37.389 1.00 55.93  ? 639 TYR D C     1 
ATOM   5590 O  O     . TYR D 4 639 ? -46.051 21.859  37.287 1.00 57.76  ? 639 TYR D O     1 
ATOM   5591 C  CB    . TYR D 4 639 ? -45.588 19.194  38.653 1.00 51.96  ? 639 TYR D CB    1 
ATOM   5592 C  CG    . TYR D 4 639 ? -45.311 18.567  39.987 1.00 49.10  ? 639 TYR D CG    1 
ATOM   5593 C  CD1   . TYR D 4 639 ? -45.882 19.078  41.150 1.00 48.07  ? 639 TYR D CD1   1 
ATOM   5594 C  CD2   . TYR D 4 639 ? -44.445 17.486  40.096 1.00 48.80  ? 639 TYR D CD2   1 
ATOM   5595 C  CE1   . TYR D 4 639 ? -45.593 18.525  42.391 1.00 48.89  ? 639 TYR D CE1   1 
ATOM   5596 C  CE2   . TYR D 4 639 ? -44.145 16.927  41.328 1.00 48.73  ? 639 TYR D CE2   1 
ATOM   5597 C  CZ    . TYR D 4 639 ? -44.721 17.449  42.471 1.00 48.66  ? 639 TYR D CZ    1 
ATOM   5598 O  OH    . TYR D 4 639 ? -44.420 16.889  43.688 1.00 50.00  ? 639 TYR D OH    1 
ATOM   5599 N  N     . GLY D 4 640 ? -47.735 20.636  36.447 1.00 55.66  ? 640 GLY D N     1 
ATOM   5600 C  CA    . GLY D 4 640 ? -47.805 21.450  35.255 1.00 57.89  ? 640 GLY D CA    1 
ATOM   5601 C  C     . GLY D 4 640 ? -47.581 20.673  33.983 1.00 59.66  ? 640 GLY D C     1 
ATOM   5602 O  O     . GLY D 4 640 ? -47.633 21.238  32.893 1.00 58.91  ? 640 GLY D O     1 
ATOM   5603 N  N     . SER D 4 641 ? -47.321 19.379  34.108 1.00 62.11  ? 641 SER D N     1 
ATOM   5604 C  CA    . SER D 4 641 ? -47.097 18.563  32.928 1.00 64.56  ? 641 SER D CA    1 
ATOM   5605 C  C     . SER D 4 641 ? -48.417 18.431  32.169 1.00 66.35  ? 641 SER D C     1 
ATOM   5606 O  O     . SER D 4 641 ? -49.426 18.000  32.720 1.00 67.39  ? 641 SER D O     1 
ATOM   5607 C  CB    . SER D 4 641 ? -46.575 17.187  33.332 1.00 64.65  ? 641 SER D CB    1 
ATOM   5608 O  OG    . SER D 4 641 ? -45.739 16.642  32.324 1.00 66.29  ? 641 SER D OG    1 
ATOM   5609 N  N     . LYS D 4 642 ? -48.412 18.831  30.905 1.00 68.19  ? 642 LYS D N     1 
ATOM   5610 C  CA    . LYS D 4 642 ? -49.610 18.756  30.084 1.00 69.59  ? 642 LYS D CA    1 
ATOM   5611 C  C     . LYS D 4 642 ? -49.567 17.515  29.195 1.00 70.90  ? 642 LYS D C     1 
ATOM   5612 O  O     . LYS D 4 642 ? -48.573 16.784  29.172 1.00 70.53  ? 642 LYS D O     1 
ATOM   5613 C  CB    . LYS D 4 642 ? -49.728 20.010  29.213 1.00 69.63  ? 642 LYS D CB    1 
ATOM   5614 C  CG    . LYS D 4 642 ? -49.896 21.304  29.986 1.00 69.19  ? 642 LYS D CG    1 
ATOM   5615 C  CD    . LYS D 4 642 ? -51.244 21.358  30.679 1.00 70.47  ? 642 LYS D CD    1 
ATOM   5616 C  CE    . LYS D 4 642 ? -51.498 22.718  31.315 1.00 71.41  ? 642 LYS D CE    1 
ATOM   5617 N  NZ    . LYS D 4 642 ? -50.642 22.976  32.510 1.00 72.59  ? 642 LYS D NZ    1 
ATOM   5618 N  N     . GLU D 4 643 ? -50.651 17.288  28.460 1.00 72.18  ? 643 GLU D N     1 
ATOM   5619 C  CA    . GLU D 4 643 ? -50.747 16.140  27.567 1.00 72.39  ? 643 GLU D CA    1 
ATOM   5620 C  C     . GLU D 4 643 ? -49.523 16.025  26.662 1.00 71.24  ? 643 GLU D C     1 
ATOM   5621 O  O     . GLU D 4 643 ? -49.019 14.928  26.448 1.00 70.70  ? 643 GLU D O     1 
ATOM   5622 C  CB    . GLU D 4 643 ? -52.014 16.244  26.714 1.00 74.70  ? 643 GLU D CB    1 
ATOM   5623 C  CG    . GLU D 4 643 ? -52.428 14.946  26.042 1.00 77.42  ? 643 GLU D CG    1 
ATOM   5624 C  CD    . GLU D 4 643 ? -53.704 15.095  25.218 1.00 80.24  ? 643 GLU D CD    1 
ATOM   5625 O  OE1   . GLU D 4 643 ? -54.684 15.682  25.738 1.00 81.78  ? 643 GLU D OE1   1 
ATOM   5626 O  OE2   . GLU D 4 643 ? -53.727 14.617  24.058 1.00 78.97  ? 643 GLU D OE2   1 
ATOM   5627 N  N     . PHE D 4 644 ? -49.033 17.144  26.133 1.00 70.37  ? 644 PHE D N     1 
ATOM   5628 C  CA    . PHE D 4 644 ? -47.868 17.064  25.264 1.00 70.65  ? 644 PHE D CA    1 
ATOM   5629 C  C     . PHE D 4 644 ? -46.649 16.616  26.054 1.00 70.58  ? 644 PHE D C     1 
ATOM   5630 O  O     . PHE D 4 644 ? -45.708 16.043  25.503 1.00 70.12  ? 644 PHE D O     1 
ATOM   5631 C  CB    . PHE D 4 644 ? -47.574 18.398  24.574 1.00 72.02  ? 644 PHE D CB    1 
ATOM   5632 C  CG    . PHE D 4 644 ? -46.561 18.283  23.460 1.00 74.53  ? 644 PHE D CG    1 
ATOM   5633 C  CD1   . PHE D 4 644 ? -46.803 17.442  22.368 1.00 75.53  ? 644 PHE D CD1   1 
ATOM   5634 C  CD2   . PHE D 4 644 ? -45.352 18.971  23.519 1.00 74.25  ? 644 PHE D CD2   1 
ATOM   5635 C  CE1   . PHE D 4 644 ? -45.855 17.286  21.358 1.00 75.04  ? 644 PHE D CE1   1 
ATOM   5636 C  CE2   . PHE D 4 644 ? -44.399 18.823  22.514 1.00 74.24  ? 644 PHE D CE2   1 
ATOM   5637 C  CZ    . PHE D 4 644 ? -44.651 17.977  21.432 1.00 74.76  ? 644 PHE D CZ    1 
ATOM   5638 N  N     . GLY D 4 645 ? -46.666 16.881  27.353 1.00 70.90  ? 645 GLY D N     1 
ATOM   5639 C  CA    . GLY D 4 645 ? -45.558 16.461  28.181 1.00 70.00  ? 645 GLY D CA    1 
ATOM   5640 C  C     . GLY D 4 645 ? -45.585 14.950  28.189 1.00 70.22  ? 645 GLY D C     1 
ATOM   5641 O  O     . GLY D 4 645 ? -44.597 14.301  27.839 1.00 70.80  ? 645 GLY D O     1 
ATOM   5642 N  N     . PHE D 4 646 ? -46.739 14.400  28.564 1.00 68.79  ? 646 PHE D N     1 
ATOM   5643 C  CA    . PHE D 4 646 ? -46.948 12.960  28.638 1.00 68.51  ? 646 PHE D CA    1 
ATOM   5644 C  C     . PHE D 4 646 ? -46.424 12.218  27.421 1.00 69.70  ? 646 PHE D C     1 
ATOM   5645 O  O     . PHE D 4 646 ? -45.781 11.177  27.549 1.00 69.83  ? 646 PHE D O     1 
ATOM   5646 C  CB    . PHE D 4 646 ? -48.430 12.657  28.804 1.00 66.68  ? 646 PHE D CB    1 
ATOM   5647 C  CG    . PHE D 4 646 ? -49.023 13.213  30.061 1.00 67.05  ? 646 PHE D CG    1 
ATOM   5648 C  CD1   . PHE D 4 646 ? -50.377 13.057  30.329 1.00 67.73  ? 646 PHE D CD1   1 
ATOM   5649 C  CD2   . PHE D 4 646 ? -48.239 13.911  30.972 1.00 67.56  ? 646 PHE D CD2   1 
ATOM   5650 C  CE1   . PHE D 4 646 ? -50.942 13.592  31.484 1.00 67.33  ? 646 PHE D CE1   1 
ATOM   5651 C  CE2   . PHE D 4 646 ? -48.792 14.450  32.128 1.00 66.54  ? 646 PHE D CE2   1 
ATOM   5652 C  CZ    . PHE D 4 646 ? -50.146 14.290  32.383 1.00 67.73  ? 646 PHE D CZ    1 
ATOM   5653 N  N     . ARG D 4 647 ? -46.707 12.751  26.240 1.00 71.34  ? 647 ARG D N     1 
ATOM   5654 C  CA    . ARG D 4 647 ? -46.255 12.132  25.005 1.00 72.45  ? 647 ARG D CA    1 
ATOM   5655 C  C     . ARG D 4 647 ? -44.760 11.851  25.062 1.00 71.42  ? 647 ARG D C     1 
ATOM   5656 O  O     . ARG D 4 647 ? -44.329 10.726  24.823 1.00 70.87  ? 647 ARG D O     1 
ATOM   5657 C  CB    . ARG D 4 647 ? -46.557 13.040  23.812 1.00 75.36  ? 647 ARG D CB    1 
ATOM   5658 C  CG    . ARG D 4 647 ? -46.050 12.485  22.497 1.00 79.90  ? 647 ARG D CG    1 
ATOM   5659 C  CD    . ARG D 4 647 ? -45.752 13.594  21.518 1.00 84.42  ? 647 ARG D CD    1 
ATOM   5660 N  NE    . ARG D 4 647 ? -44.863 13.145  20.450 1.00 88.67  ? 647 ARG D NE    1 
ATOM   5661 C  CZ    . ARG D 4 647 ? -44.167 13.968  19.669 1.00 91.37  ? 647 ARG D CZ    1 
ATOM   5662 N  NH1   . ARG D 4 647 ? -44.259 15.284  19.841 1.00 92.05  ? 647 ARG D NH1   1 
ATOM   5663 N  NH2   . ARG D 4 647 ? -43.373 13.481  18.722 1.00 91.53  ? 647 ARG D NH2   1 
ATOM   5664 N  N     . GLN D 4 648 ? -43.976 12.880  25.381 1.00 71.33  ? 648 GLN D N     1 
ATOM   5665 C  CA    . GLN D 4 648 ? -42.521 12.756  25.470 1.00 71.28  ? 648 GLN D CA    1 
ATOM   5666 C  C     . GLN D 4 648 ? -42.182 11.728  26.535 1.00 70.21  ? 648 GLN D C     1 
ATOM   5667 O  O     . GLN D 4 648 ? -41.311 10.880  26.344 1.00 69.48  ? 648 GLN D O     1 
ATOM   5668 C  CB    . GLN D 4 648 ? -41.882 14.105  25.845 1.00 72.58  ? 648 GLN D CB    1 
ATOM   5669 C  CG    . GLN D 4 648 ? -40.440 14.296  25.344 1.00 75.96  ? 648 GLN D CG    1 
ATOM   5670 C  CD    . GLN D 4 648 ? -39.445 13.273  25.898 1.00 78.04  ? 648 GLN D CD    1 
ATOM   5671 O  OE1   . GLN D 4 648 ? -39.063 13.327  27.073 1.00 78.27  ? 648 GLN D OE1   1 
ATOM   5672 N  NE2   . GLN D 4 648 ? -39.024 12.333  25.048 1.00 78.07  ? 648 GLN D NE2   1 
ATOM   5673 N  N     . GLN D 4 649 ? -42.886 11.819  27.658 1.00 69.63  ? 649 GLN D N     1 
ATOM   5674 C  CA    . GLN D 4 649 ? -42.692 10.916  28.781 1.00 69.16  ? 649 GLN D CA    1 
ATOM   5675 C  C     . GLN D 4 649 ? -42.932 9.461   28.395 1.00 69.76  ? 649 GLN D C     1 
ATOM   5676 O  O     . GLN D 4 649 ? -42.033 8.628   28.492 1.00 69.08  ? 649 GLN D O     1 
ATOM   5677 C  CB    . GLN D 4 649 ? -43.634 11.304  29.914 1.00 69.19  ? 649 GLN D CB    1 
ATOM   5678 C  CG    . GLN D 4 649 ? -43.504 12.750  30.350 1.00 70.00  ? 649 GLN D CG    1 
ATOM   5679 C  CD    . GLN D 4 649 ? -44.398 13.077  31.526 1.00 70.78  ? 649 GLN D CD    1 
ATOM   5680 O  OE1   . GLN D 4 649 ? -44.337 14.172  32.079 1.00 72.52  ? 649 GLN D OE1   1 
ATOM   5681 N  NE2   . GLN D 4 649 ? -45.239 12.127  31.912 1.00 71.10  ? 649 GLN D NE2   1 
ATOM   5682 N  N     . VAL D 4 650 ? -44.147 9.149   27.959 1.00 70.34  ? 650 VAL D N     1 
ATOM   5683 C  CA    . VAL D 4 650 ? -44.447 7.777   27.581 1.00 71.78  ? 650 VAL D CA    1 
ATOM   5684 C  C     . VAL D 4 650 ? -43.432 7.331   26.534 1.00 73.10  ? 650 VAL D C     1 
ATOM   5685 O  O     . VAL D 4 650 ? -42.838 6.258   26.641 1.00 72.06  ? 650 VAL D O     1 
ATOM   5686 C  CB    . VAL D 4 650 ? -45.889 7.633   27.018 1.00 69.72  ? 650 VAL D CB    1 
ATOM   5687 C  CG1   . VAL D 4 650 ? -46.056 8.455   25.759 1.00 70.58  ? 650 VAL D CG1   1 
ATOM   5688 C  CG2   . VAL D 4 650 ? -46.178 6.185   26.723 1.00 69.07  ? 650 VAL D CG2   1 
ATOM   5689 N  N     . LEU D 4 651 ? -43.222 8.183   25.539 1.00 75.15  ? 651 LEU D N     1 
ATOM   5690 C  CA    . LEU D 4 651 ? -42.295 7.896   24.460 1.00 78.41  ? 651 LEU D CA    1 
ATOM   5691 C  C     . LEU D 4 651 ? -40.935 7.476   24.991 1.00 81.19  ? 651 LEU D C     1 
ATOM   5692 O  O     . LEU D 4 651 ? -40.473 6.364   24.748 1.00 82.16  ? 651 LEU D O     1 
ATOM   5693 C  CB    . LEU D 4 651 ? -42.130 9.133   23.573 1.00 78.59  ? 651 LEU D CB    1 
ATOM   5694 C  CG    . LEU D 4 651 ? -41.177 9.031   22.377 1.00 78.19  ? 651 LEU D CG    1 
ATOM   5695 C  CD1   . LEU D 4 651 ? -41.659 7.952   21.428 1.00 78.61  ? 651 LEU D CD1   1 
ATOM   5696 C  CD2   . LEU D 4 651 ? -41.105 10.367  21.662 1.00 76.85  ? 651 LEU D CD2   1 
ATOM   5697 N  N     . GLU D 4 652 ? -40.301 8.371   25.732 1.00 83.45  ? 652 GLU D N     1 
ATOM   5698 C  CA    . GLU D 4 652 ? -38.982 8.097   26.261 1.00 85.18  ? 652 GLU D CA    1 
ATOM   5699 C  C     . GLU D 4 652 ? -38.936 7.144   27.453 1.00 84.91  ? 652 GLU D C     1 
ATOM   5700 O  O     . GLU D 4 652 ? -38.037 6.321   27.541 1.00 85.97  ? 652 GLU D O     1 
ATOM   5701 C  CB    . GLU D 4 652 ? -38.293 9.420   26.608 1.00 87.80  ? 652 GLU D CB    1 
ATOM   5702 C  CG    . GLU D 4 652 ? -36.788 9.292   26.745 1.00 91.78  ? 652 GLU D CG    1 
ATOM   5703 C  CD    . GLU D 4 652 ? -36.177 8.471   25.616 1.00 93.35  ? 652 GLU D CD    1 
ATOM   5704 O  OE1   . GLU D 4 652 ? -36.311 8.878   24.438 1.00 94.11  ? 652 GLU D OE1   1 
ATOM   5705 O  OE2   . GLU D 4 652 ? -35.571 7.415   25.912 1.00 92.73  ? 652 GLU D OE2   1 
ATOM   5706 N  N     . ASP D 4 653 ? -39.899 7.237   28.362 1.00 84.89  ? 653 ASP D N     1 
ATOM   5707 C  CA    . ASP D 4 653 ? -39.904 6.374   29.542 1.00 85.21  ? 653 ASP D CA    1 
ATOM   5708 C  C     . ASP D 4 653 ? -40.273 4.907   29.331 1.00 85.95  ? 653 ASP D C     1 
ATOM   5709 O  O     . ASP D 4 653 ? -39.737 4.038   30.020 1.00 85.27  ? 653 ASP D O     1 
ATOM   5710 C  CB    . ASP D 4 653 ? -40.822 6.956   30.620 1.00 85.69  ? 653 ASP D CB    1 
ATOM   5711 C  CG    . ASP D 4 653 ? -40.217 8.159   31.318 1.00 87.00  ? 653 ASP D CG    1 
ATOM   5712 O  OD1   . ASP D 4 653 ? -39.869 9.139   30.625 1.00 88.90  ? 653 ASP D OD1   1 
ATOM   5713 O  OD2   . ASP D 4 653 ? -40.091 8.127   32.562 1.00 86.51  ? 653 ASP D OD2   1 
ATOM   5714 N  N     . THR D 4 654 ? -41.180 4.620   28.396 1.00 87.01  ? 654 THR D N     1 
ATOM   5715 C  CA    . THR D 4 654 ? -41.603 3.235   28.172 1.00 87.72  ? 654 THR D CA    1 
ATOM   5716 C  C     . THR D 4 654 ? -41.510 2.716   26.738 1.00 88.28  ? 654 THR D C     1 
ATOM   5717 O  O     . THR D 4 654 ? -41.223 1.534   26.528 1.00 88.41  ? 654 THR D O     1 
ATOM   5718 C  CB    . THR D 4 654 ? -43.055 3.004   28.655 1.00 87.80  ? 654 THR D CB    1 
ATOM   5719 O  OG1   . THR D 4 654 ? -43.954 3.747   27.828 1.00 88.80  ? 654 THR D OG1   1 
ATOM   5720 C  CG2   . THR D 4 654 ? -43.223 3.450   30.106 1.00 88.14  ? 654 THR D CG2   1 
ATOM   5721 N  N     . ILE D 4 655 ? -41.764 3.577   25.756 1.00 88.72  ? 655 ILE D N     1 
ATOM   5722 C  CA    . ILE D 4 655 ? -41.699 3.158   24.356 1.00 89.64  ? 655 ILE D CA    1 
ATOM   5723 C  C     . ILE D 4 655 ? -40.268 3.104   23.824 1.00 91.61  ? 655 ILE D C     1 
ATOM   5724 O  O     . ILE D 4 655 ? -39.798 2.054   23.391 1.00 91.89  ? 655 ILE D O     1 
ATOM   5725 C  CB    . ILE D 4 655 ? -42.534 4.087   23.448 1.00 88.16  ? 655 ILE D CB    1 
ATOM   5726 C  CG1   . ILE D 4 655 ? -44.025 3.815   23.663 1.00 87.13  ? 655 ILE D CG1   1 
ATOM   5727 C  CG2   . ILE D 4 655 ? -42.155 3.867   21.991 1.00 87.33  ? 655 ILE D CG2   1 
ATOM   5728 C  CD1   . ILE D 4 655 ? -44.940 4.643   22.787 1.00 85.47  ? 655 ILE D CD1   1 
ATOM   5729 N  N     . GLN D 4 656 ? -39.582 4.241   23.853 1.00 93.69  ? 656 GLN D N     1 
ATOM   5730 C  CA    . GLN D 4 656 ? -38.206 4.329   23.380 1.00 95.18  ? 656 GLN D CA    1 
ATOM   5731 C  C     . GLN D 4 656 ? -37.335 3.183   23.899 1.00 95.53  ? 656 GLN D C     1 
ATOM   5732 O  O     . GLN D 4 656 ? -36.636 2.537   23.123 1.00 94.85  ? 656 GLN D O     1 
ATOM   5733 C  CB    . GLN D 4 656 ? -37.595 5.672   23.797 1.00 96.90  ? 656 GLN D CB    1 
ATOM   5734 C  CG    . GLN D 4 656 ? -36.136 5.841   23.424 1.00 98.06  ? 656 GLN D CG    1 
ATOM   5735 C  CD    . GLN D 4 656 ? -35.900 5.645   21.945 1.00 99.65  ? 656 GLN D CD    1 
ATOM   5736 O  OE1   . GLN D 4 656 ? -36.072 4.544   21.416 1.00 100.00 ? 656 GLN D OE1   1 
ATOM   5737 N  NE2   . GLN D 4 656 ? -35.510 6.716   21.264 1.00 100.64 ? 656 GLN D NE2   1 
ATOM   5738 N  N     . PRO D 4 657 ? -37.366 2.919   25.220 1.00 95.93  ? 657 PRO D N     1 
ATOM   5739 C  CA    . PRO D 4 657 ? -36.571 1.845   25.819 1.00 96.93  ? 657 PRO D CA    1 
ATOM   5740 C  C     . PRO D 4 657 ? -37.084 0.460   25.455 1.00 98.24  ? 657 PRO D C     1 
ATOM   5741 O  O     . PRO D 4 657 ? -36.303 -0.433  25.132 1.00 98.64  ? 657 PRO D O     1 
ATOM   5742 C  CB    . PRO D 4 657 ? -36.686 2.129   27.308 1.00 96.08  ? 657 PRO D CB    1 
ATOM   5743 C  CG    . PRO D 4 657 ? -38.054 2.660   27.423 1.00 95.82  ? 657 PRO D CG    1 
ATOM   5744 C  CD    . PRO D 4 657 ? -38.130 3.625   26.262 1.00 95.96  ? 657 PRO D CD    1 
ATOM   5745 N  N     . ALA D 4 658 ? -38.396 0.274   25.519 1.00 99.90  ? 658 ALA D N     1 
ATOM   5746 C  CA    . ALA D 4 658 ? -38.974 -1.014  25.167 1.00 101.88 ? 658 ALA D CA    1 
ATOM   5747 C  C     . ALA D 4 658 ? -38.464 -1.391  23.774 1.00 102.92 ? 658 ALA D C     1 
ATOM   5748 O  O     . ALA D 4 658 ? -38.056 -2.527  23.532 1.00 102.77 ? 658 ALA D O     1 
ATOM   5749 C  CB    . ALA D 4 658 ? -40.497 -0.927  25.171 1.00 101.75 ? 658 ALA D CB    1 
ATOM   5750 N  N     . ILE D 4 659 ? -38.479 -0.418  22.867 1.00 104.14 ? 659 ILE D N     1 
ATOM   5751 C  CA    . ILE D 4 659 ? -38.019 -0.629  21.501 1.00 105.38 ? 659 ILE D CA    1 
ATOM   5752 C  C     . ILE D 4 659 ? -36.578 -1.130  21.481 1.00 106.79 ? 659 ILE D C     1 
ATOM   5753 O  O     . ILE D 4 659 ? -36.280 -2.147  20.851 1.00 107.67 ? 659 ILE D O     1 
ATOM   5754 C  CB    . ILE D 4 659 ? -38.086 0.678   20.677 1.00 105.06 ? 659 ILE D CB    1 
ATOM   5755 C  CG1   . ILE D 4 659 ? -39.540 1.116   20.502 1.00 105.08 ? 659 ILE D CG1   1 
ATOM   5756 C  CG2   . ILE D 4 659 ? -37.432 0.476   19.318 1.00 104.70 ? 659 ILE D CG2   1 
ATOM   5757 C  CD1   . ILE D 4 659 ? -39.691 2.430   19.752 1.00 105.50 ? 659 ILE D CD1   1 
ATOM   5758 N  N     . ASP D 4 660 ? -35.695 -0.409  22.173 1.00 107.60 ? 660 ASP D N     1 
ATOM   5759 C  CA    . ASP D 4 660 ? -34.273 -0.746  22.240 1.00 108.07 ? 660 ASP D CA    1 
ATOM   5760 C  C     . ASP D 4 660 ? -33.972 -2.203  22.595 1.00 108.79 ? 660 ASP D C     1 
ATOM   5761 O  O     . ASP D 4 660 ? -33.117 -2.829  21.966 1.00 109.31 ? 660 ASP D O     1 
ATOM   5762 C  CB    . ASP D 4 660 ? -33.556 0.186   23.226 1.00 108.20 ? 660 ASP D CB    1 
ATOM   5763 C  CG    . ASP D 4 660 ? -33.371 1.596   22.676 1.00 108.61 ? 660 ASP D CG    1 
ATOM   5764 O  OD1   . ASP D 4 660 ? -32.810 2.452   23.397 1.00 108.37 ? 660 ASP D OD1   1 
ATOM   5765 O  OD2   . ASP D 4 660 ? -33.782 1.848   21.522 1.00 108.37 ? 660 ASP D OD2   1 
ATOM   5766 N  N     . SER D 4 661 ? -34.659 -2.743  23.598 1.00 109.03 ? 661 SER D N     1 
ATOM   5767 C  CA    . SER D 4 661 ? -34.436 -4.130  23.991 1.00 109.52 ? 661 SER D CA    1 
ATOM   5768 C  C     . SER D 4 661 ? -35.187 -5.073  23.056 1.00 109.84 ? 661 SER D C     1 
ATOM   5769 O  O     . SER D 4 661 ? -35.034 -6.291  23.132 1.00 110.33 ? 661 SER D O     1 
ATOM   5770 C  CB    . SER D 4 661 ? -34.883 -4.360  25.436 1.00 109.61 ? 661 SER D CB    1 
ATOM   5771 O  OG    . SER D 4 661 ? -36.253 -4.056  25.601 1.00 110.66 ? 661 SER D OG    1 
ATOM   5772 N  N     . GLY D 4 662 ? -36.003 -4.497  22.177 1.00 110.22 ? 662 GLY D N     1 
ATOM   5773 C  CA    . GLY D 4 662 ? -36.752 -5.291  21.219 1.00 110.66 ? 662 GLY D CA    1 
ATOM   5774 C  C     . GLY D 4 662 ? -38.056 -5.883  21.718 1.00 110.91 ? 662 GLY D C     1 
ATOM   5775 O  O     . GLY D 4 662 ? -38.633 -6.748  21.062 1.00 111.17 ? 662 GLY D O     1 
ATOM   5776 N  N     . LYS D 4 663 ? -38.530 -5.421  22.870 1.00 111.29 ? 663 LYS D N     1 
ATOM   5777 C  CA    . LYS D 4 663 ? -39.777 -5.927  23.440 1.00 111.67 ? 663 LYS D CA    1 
ATOM   5778 C  C     . LYS D 4 663 ? -40.976 -5.060  23.051 1.00 111.37 ? 663 LYS D C     1 
ATOM   5779 O  O     . LYS D 4 663 ? -42.034 -5.115  23.682 1.00 110.21 ? 663 LYS D O     1 
ATOM   5780 C  CB    . LYS D 4 663 ? -39.661 -6.011  24.969 1.00 112.17 ? 663 LYS D CB    1 
ATOM   5781 C  CG    . LYS D 4 663 ? -38.868 -7.215  25.483 1.00 112.59 ? 663 LYS D CG    1 
ATOM   5782 C  CD    . LYS D 4 663 ? -37.449 -7.266  24.927 1.00 113.11 ? 663 LYS D CD    1 
ATOM   5783 C  CE    . LYS D 4 663 ? -36.732 -8.538  25.363 1.00 113.33 ? 663 LYS D CE    1 
ATOM   5784 N  NZ    . LYS D 4 663 ? -35.376 -8.667  24.760 1.00 113.55 ? 663 LYS D NZ    1 
ATOM   5785 N  N     . GLY D 4 664 ? -40.796 -4.265  22.000 1.00 111.45 ? 664 GLY D N     1 
ATOM   5786 C  CA    . GLY D 4 664 ? -41.859 -3.397  21.531 1.00 111.47 ? 664 GLY D CA    1 
ATOM   5787 C  C     . GLY D 4 664 ? -42.047 -3.470  20.027 1.00 111.41 ? 664 GLY D C     1 
ATOM   5788 O  O     . GLY D 4 664 ? -42.557 -2.532  19.415 1.00 110.94 ? 664 GLY D O     1 
ATOM   5789 N  N     . LEU D 4 665 ? -41.633 -4.589  19.434 1.00 112.02 ? 665 LEU D N     1 
ATOM   5790 C  CA    . LEU D 4 665 ? -41.754 -4.804  17.989 1.00 112.20 ? 665 LEU D CA    1 
ATOM   5791 C  C     . LEU D 4 665 ? -43.219 -4.895  17.588 1.00 111.95 ? 665 LEU D C     1 
ATOM   5792 O  O     . LEU D 4 665 ? -43.631 -5.800  16.856 1.00 111.84 ? 665 LEU D O     1 
ATOM   5793 C  CB    . LEU D 4 665 ? -41.016 -6.085  17.578 1.00 111.74 ? 665 LEU D CB    1 
ATOM   5794 C  CG    . LEU D 4 665 ? -39.488 -6.011  17.648 1.00 111.45 ? 665 LEU D CG    1 
ATOM   5795 C  CD1   . LEU D 4 665 ? -38.887 -7.395  17.483 1.00 111.54 ? 665 LEU D CD1   1 
ATOM   5796 C  CD2   . LEU D 4 665 ? -38.980 -5.060  16.571 1.00 111.35 ? 665 LEU D CD2   1 
ATOM   5797 N  N     . MET D 4 666 ? -43.995 -3.935  18.076 1.00 111.31 ? 666 MET D N     1 
ATOM   5798 C  CA    . MET D 4 666 ? -45.418 -3.866  17.810 1.00 110.64 ? 666 MET D CA    1 
ATOM   5799 C  C     . MET D 4 666 ? -45.928 -2.461  18.089 1.00 110.50 ? 666 MET D C     1 
ATOM   5800 O  O     . MET D 4 666 ? -47.001 -2.283  18.661 1.00 110.51 ? 666 MET D O     1 
ATOM   5801 C  CB    . MET D 4 666 ? -46.155 -4.888  18.680 1.00 109.65 ? 666 MET D CB    1 
ATOM   5802 C  CG    . MET D 4 666 ? -45.502 -5.129  20.034 1.00 107.40 ? 666 MET D CG    1 
ATOM   5803 S  SD    . MET D 4 666 ? -45.622 -3.746  21.169 1.00 104.50 ? 666 MET D SD    1 
ATOM   5804 C  CE    . MET D 4 666 ? -46.090 -4.585  22.641 1.00 103.73 ? 666 MET D CE    1 
ATOM   5805 N  N     . PHE D 4 667 ? -45.143 -1.466  17.686 1.00 110.47 ? 667 PHE D N     1 
ATOM   5806 C  CA    . PHE D 4 667 ? -45.515 -0.071  17.876 1.00 110.39 ? 667 PHE D CA    1 
ATOM   5807 C  C     . PHE D 4 667 ? -45.524 0.708   16.564 1.00 110.30 ? 667 PHE D C     1 
ATOM   5808 O  O     . PHE D 4 667 ? -46.130 1.780   16.485 1.00 110.63 ? 667 PHE D O     1 
ATOM   5809 C  CB    . PHE D 4 667 ? -44.572 0.609   18.879 1.00 110.29 ? 667 PHE D CB    1 
ATOM   5810 C  CG    . PHE D 4 667 ? -44.993 0.449   20.323 1.00 110.86 ? 667 PHE D CG    1 
ATOM   5811 C  CD1   . PHE D 4 667 ? -46.285 0.783   20.729 1.00 110.68 ? 667 PHE D CD1   1 
ATOM   5812 C  CD2   . PHE D 4 667 ? -44.094 -0.012  21.281 1.00 110.88 ? 667 PHE D CD2   1 
ATOM   5813 C  CE1   . PHE D 4 667 ? -46.676 0.661   22.067 1.00 110.04 ? 667 PHE D CE1   1 
ATOM   5814 C  CE2   . PHE D 4 667 ? -44.476 -0.137  22.622 1.00 110.66 ? 667 PHE D CE2   1 
ATOM   5815 C  CZ    . PHE D 4 667 ? -45.771 0.202   23.012 1.00 110.26 ? 667 PHE D CZ    1 
ATOM   5816 N  N     . THR D 4 668 ? -44.862 0.161   15.542 1.00 109.70 ? 668 THR D N     1 
ATOM   5817 C  CA    . THR D 4 668 ? -44.781 0.784   14.214 1.00 109.47 ? 668 THR D CA    1 
ATOM   5818 C  C     . THR D 4 668 ? -44.875 2.305   14.296 1.00 109.46 ? 668 THR D C     1 
ATOM   5819 O  O     . THR D 4 668 ? -45.921 2.896   14.016 1.00 109.26 ? 668 THR D O     1 
ATOM   5820 C  CB    . THR D 4 668 ? -45.894 0.261   13.287 1.00 109.32 ? 668 THR D CB    1 
ATOM   5821 O  OG1   . THR D 4 668 ? -47.174 0.553   13.859 1.00 108.78 ? 668 THR D OG1   1 
ATOM   5822 C  CG2   . THR D 4 668 ? -45.760 -1.242  13.097 1.00 109.24 ? 668 THR D CG2   1 
ATOM   5823 N  N     . GLN D 4 669 ? -43.756 2.917   14.671 1.00 109.28 ? 669 GLN D N     1 
ATOM   5824 C  CA    . GLN D 4 669 ? -43.629 4.359   14.864 1.00 108.78 ? 669 GLN D CA    1 
ATOM   5825 C  C     . GLN D 4 669 ? -44.060 4.663   16.293 1.00 108.06 ? 669 GLN D C     1 
ATOM   5826 O  O     . GLN D 4 669 ? -45.249 4.646   16.617 1.00 107.51 ? 669 GLN D O     1 
ATOM   5827 C  CB    . GLN D 4 669 ? -44.491 5.166   13.882 1.00 109.34 ? 669 GLN D CB    1 
ATOM   5828 C  CG    . GLN D 4 669 ? -44.346 6.680   14.079 1.00 109.16 ? 669 GLN D CG    1 
ATOM   5829 C  CD    . GLN D 4 669 ? -45.033 7.502   13.005 1.00 108.88 ? 669 GLN D CD    1 
ATOM   5830 O  OE1   . GLN D 4 669 ? -44.932 8.730   12.991 1.00 108.25 ? 669 GLN D OE1   1 
ATOM   5831 N  NE2   . GLN D 4 669 ? -45.736 6.832   12.099 1.00 108.86 ? 669 GLN D NE2   1 
ATOM   5832 N  N     . PRO D 4 670 ? -43.085 4.938   17.171 1.00 107.41 ? 670 PRO D N     1 
ATOM   5833 C  CA    . PRO D 4 670 ? -43.345 5.246   18.580 1.00 106.19 ? 670 PRO D CA    1 
ATOM   5834 C  C     . PRO D 4 670 ? -44.393 6.339   18.724 1.00 104.05 ? 670 PRO D C     1 
ATOM   5835 O  O     . PRO D 4 670 ? -45.272 6.259   19.579 1.00 103.73 ? 670 PRO D O     1 
ATOM   5836 C  CB    . PRO D 4 670 ? -41.973 5.669   19.097 1.00 107.39 ? 670 PRO D CB    1 
ATOM   5837 C  CG    . PRO D 4 670 ? -41.324 6.268   17.875 1.00 108.26 ? 670 PRO D CG    1 
ATOM   5838 C  CD    . PRO D 4 670 ? -41.691 5.259   16.817 1.00 107.85 ? 670 PRO D CD    1 
ATOM   5839 N  N     . ASN D 4 671 ? -44.294 7.359   17.880 1.00 101.92 ? 671 ASN D N     1 
ATOM   5840 C  CA    . ASN D 4 671 ? -45.259 8.443   17.908 1.00 100.52 ? 671 ASN D CA    1 
ATOM   5841 C  C     . ASN D 4 671 ? -46.613 7.789   17.683 1.00 99.64  ? 671 ASN D C     1 
ATOM   5842 O  O     . ASN D 4 671 ? -46.678 6.593   17.391 1.00 100.21 ? 671 ASN D O     1 
ATOM   5843 C  CB    . ASN D 4 671 ? -44.962 9.450   16.798 1.00 101.22 ? 671 ASN D CB    1 
ATOM   5844 C  CG    . ASN D 4 671 ? -43.617 10.125  16.971 1.00 101.41 ? 671 ASN D CG    1 
ATOM   5845 O  OD1   . ASN D 4 671 ? -42.578 9.469   16.987 1.00 101.59 ? 671 ASN D OD1   1 
ATOM   5846 N  ND2   . ASN D 4 671 ? -43.630 11.444  17.101 1.00 101.75 ? 671 ASN D ND2   1 
ATOM   5847 N  N     . GLN D 4 672 ? -47.686 8.567   17.803 1.00 97.42  ? 672 GLN D N     1 
ATOM   5848 C  CA    . GLN D 4 672 ? -49.044 8.046   17.648 1.00 94.33  ? 672 GLN D CA    1 
ATOM   5849 C  C     . GLN D 4 672 ? -49.246 7.100   18.815 1.00 91.99  ? 672 GLN D C     1 
ATOM   5850 O  O     . GLN D 4 672 ? -50.087 7.336   19.672 1.00 92.80  ? 672 GLN D O     1 
ATOM   5851 C  CB    . GLN D 4 672 ? -49.212 7.284   16.330 1.00 94.80  ? 672 GLN D CB    1 
ATOM   5852 C  CG    . GLN D 4 672 ? -48.922 8.104   15.084 1.00 95.45  ? 672 GLN D CG    1 
ATOM   5853 C  CD    . GLN D 4 672 ? -49.250 7.352   13.810 1.00 95.59  ? 672 GLN D CD    1 
ATOM   5854 O  OE1   . GLN D 4 672 ? -50.419 7.131   13.492 1.00 95.73  ? 672 GLN D OE1   1 
ATOM   5855 N  NE2   . GLN D 4 672 ? -48.217 6.942   13.080 1.00 94.69  ? 672 GLN D NE2   1 
ATOM   5856 N  N     . ALA D 4 673 ? -48.461 6.029   18.846 1.00 88.47  ? 673 ALA D N     1 
ATOM   5857 C  CA    . ALA D 4 673 ? -48.534 5.076   19.935 1.00 85.54  ? 673 ALA D CA    1 
ATOM   5858 C  C     . ALA D 4 673 ? -48.365 5.877   21.218 1.00 83.58  ? 673 ALA D C     1 
ATOM   5859 O  O     . ALA D 4 673 ? -49.036 5.624   22.216 1.00 83.67  ? 673 ALA D O     1 
ATOM   5860 C  CB    . ALA D 4 673 ? -47.422 4.060   19.809 1.00 85.60  ? 673 ALA D CB    1 
ATOM   5861 N  N     . ALA D 4 674 ? -47.470 6.859   21.170 1.00 80.73  ? 674 ALA D N     1 
ATOM   5862 C  CA    . ALA D 4 674 ? -47.195 7.713   22.320 1.00 78.44  ? 674 ALA D CA    1 
ATOM   5863 C  C     . ALA D 4 674 ? -48.261 8.791   22.514 1.00 76.43  ? 674 ALA D C     1 
ATOM   5864 O  O     . ALA D 4 674 ? -48.817 8.934   23.608 1.00 77.17  ? 674 ALA D O     1 
ATOM   5865 C  CB    . ALA D 4 674 ? -45.817 8.363   22.172 1.00 78.42  ? 674 ALA D CB    1 
ATOM   5866 N  N     . GLY D 4 675 ? -48.535 9.550   21.458 1.00 72.81  ? 675 GLY D N     1 
ATOM   5867 C  CA    . GLY D 4 675 ? -49.532 10.600  21.548 1.00 69.72  ? 675 GLY D CA    1 
ATOM   5868 C  C     . GLY D 4 675 ? -50.869 10.040  21.982 1.00 67.49  ? 675 GLY D C     1 
ATOM   5869 O  O     . GLY D 4 675 ? -51.629 10.680  22.713 1.00 67.03  ? 675 GLY D O     1 
ATOM   5870 N  N     . TYR D 4 676 ? -51.148 8.828   21.522 1.00 65.50  ? 676 TYR D N     1 
ATOM   5871 C  CA    . TYR D 4 676 ? -52.385 8.138   21.845 1.00 63.73  ? 676 TYR D CA    1 
ATOM   5872 C  C     . TYR D 4 676 ? -52.379 7.838   23.329 1.00 63.22  ? 676 TYR D C     1 
ATOM   5873 O  O     . TYR D 4 676 ? -53.323 8.165   24.053 1.00 62.38  ? 676 TYR D O     1 
ATOM   5874 C  CB    . TYR D 4 676 ? -52.472 6.829   21.052 1.00 62.96  ? 676 TYR D CB    1 
ATOM   5875 C  CG    . TYR D 4 676 ? -53.660 5.969   21.405 1.00 62.52  ? 676 TYR D CG    1 
ATOM   5876 C  CD1   . TYR D 4 676 ? -54.963 6.448   21.251 1.00 61.47  ? 676 TYR D CD1   1 
ATOM   5877 C  CD2   . TYR D 4 676 ? -53.485 4.688   21.916 1.00 61.55  ? 676 TYR D CD2   1 
ATOM   5878 C  CE1   . TYR D 4 676 ? -56.052 5.679   21.599 1.00 59.77  ? 676 TYR D CE1   1 
ATOM   5879 C  CE2   . TYR D 4 676 ? -54.577 3.910   22.267 1.00 61.83  ? 676 TYR D CE2   1 
ATOM   5880 C  CZ    . TYR D 4 676 ? -55.857 4.414   22.107 1.00 60.59  ? 676 TYR D CZ    1 
ATOM   5881 O  OH    . TYR D 4 676 ? -56.944 3.654   22.472 1.00 61.55  ? 676 TYR D OH    1 
ATOM   5882 N  N     . MET D 4 677 ? -51.301 7.206   23.778 1.00 62.79  ? 677 MET D N     1 
ATOM   5883 C  CA    . MET D 4 677 ? -51.172 6.860   25.182 1.00 62.62  ? 677 MET D CA    1 
ATOM   5884 C  C     . MET D 4 677 ? -51.240 8.122   26.033 1.00 61.79  ? 677 MET D C     1 
ATOM   5885 O  O     . MET D 4 677 ? -51.891 8.144   27.079 1.00 60.93  ? 677 MET D O     1 
ATOM   5886 C  CB    . MET D 4 677 ? -49.852 6.134   25.435 1.00 61.44  ? 677 MET D CB    1 
ATOM   5887 C  CG    . MET D 4 677 ? -49.716 5.656   26.864 1.00 61.24  ? 677 MET D CG    1 
ATOM   5888 S  SD    . MET D 4 677 ? -51.264 4.940   27.472 1.00 61.10  ? 677 MET D SD    1 
ATOM   5889 C  CE    . MET D 4 677 ? -51.248 3.301   26.686 1.00 56.14  ? 677 MET D CE    1 
ATOM   5890 N  N     . ALA D 4 678 ? -50.564 9.166   25.566 1.00 60.51  ? 678 ALA D N     1 
ATOM   5891 C  CA    . ALA D 4 678 ? -50.539 10.446  26.257 1.00 60.47  ? 678 ALA D CA    1 
ATOM   5892 C  C     . ALA D 4 678 ? -51.943 11.002  26.489 1.00 60.85  ? 678 ALA D C     1 
ATOM   5893 O  O     . ALA D 4 678 ? -52.205 11.632  27.519 1.00 59.59  ? 678 ALA D O     1 
ATOM   5894 C  CB    . ALA D 4 678 ? -49.712 11.442  25.462 1.00 59.90  ? 678 ALA D CB    1 
ATOM   5895 N  N     . LYS D 4 679 ? -52.844 10.765  25.535 1.00 61.61  ? 679 LYS D N     1 
ATOM   5896 C  CA    . LYS D 4 679 ? -54.209 11.260  25.654 1.00 62.70  ? 679 LYS D CA    1 
ATOM   5897 C  C     . LYS D 4 679 ? -55.065 10.457  26.613 1.00 62.51  ? 679 LYS D C     1 
ATOM   5898 O  O     . LYS D 4 679 ? -55.879 11.026  27.336 1.00 63.30  ? 679 LYS D O     1 
ATOM   5899 C  CB    . LYS D 4 679 ? -54.904 11.313  24.292 1.00 65.06  ? 679 LYS D CB    1 
ATOM   5900 C  CG    . LYS D 4 679 ? -56.354 11.783  24.391 1.00 67.35  ? 679 LYS D CG    1 
ATOM   5901 C  CD    . LYS D 4 679 ? -56.892 12.307  23.069 1.00 69.28  ? 679 LYS D CD    1 
ATOM   5902 C  CE    . LYS D 4 679 ? -58.255 12.980  23.259 1.00 71.34  ? 679 LYS D CE    1 
ATOM   5903 N  NZ    . LYS D 4 679 ? -58.727 13.696  22.026 1.00 73.42  ? 679 LYS D NZ    1 
ATOM   5904 N  N     . LEU D 4 680 ? -54.900 9.141   26.623 1.00 62.46  ? 680 LEU D N     1 
ATOM   5905 C  CA    . LEU D 4 680 ? -55.692 8.329   27.530 1.00 62.98  ? 680 LEU D CA    1 
ATOM   5906 C  C     . LEU D 4 680 ? -55.301 8.677   28.953 1.00 63.81  ? 680 LEU D C     1 
ATOM   5907 O  O     . LEU D 4 680 ? -56.153 8.816   29.824 1.00 63.83  ? 680 LEU D O     1 
ATOM   5908 C  CB    . LEU D 4 680 ? -55.453 6.846   27.280 1.00 61.95  ? 680 LEU D CB    1 
ATOM   5909 C  CG    . LEU D 4 680 ? -55.631 6.380   25.840 1.00 63.28  ? 680 LEU D CG    1 
ATOM   5910 C  CD1   . LEU D 4 680 ? -55.674 4.855   25.813 1.00 63.07  ? 680 LEU D CD1   1 
ATOM   5911 C  CD2   . LEU D 4 680 ? -56.917 6.954   25.268 1.00 63.57  ? 680 LEU D CD2   1 
ATOM   5912 N  N     . ILE D 4 681 ? -53.998 8.823   29.173 1.00 65.97  ? 681 ILE D N     1 
ATOM   5913 C  CA    . ILE D 4 681 ? -53.463 9.151   30.486 1.00 67.34  ? 681 ILE D CA    1 
ATOM   5914 C  C     . ILE D 4 681 ? -53.953 10.517  30.947 1.00 69.55  ? 681 ILE D C     1 
ATOM   5915 O  O     . ILE D 4 681 ? -54.259 10.708  32.127 1.00 69.92  ? 681 ILE D O     1 
ATOM   5916 C  CB    . ILE D 4 681 ? -51.918 9.139   30.469 1.00 66.48  ? 681 ILE D CB    1 
ATOM   5917 C  CG1   . ILE D 4 681 ? -51.421 7.719   30.219 1.00 65.25  ? 681 ILE D CG1   1 
ATOM   5918 C  CG2   . ILE D 4 681 ? -51.366 9.670   31.789 1.00 65.84  ? 681 ILE D CG2   1 
ATOM   5919 C  CD1   . ILE D 4 681 ? -49.917 7.596   30.217 1.00 66.64  ? 681 ILE D CD1   1 
ATOM   5920 N  N     . TRP D 4 682 ? -54.030 11.467  30.020 1.00 70.94  ? 682 TRP D N     1 
ATOM   5921 C  CA    . TRP D 4 682 ? -54.495 12.798  30.364 1.00 73.11  ? 682 TRP D CA    1 
ATOM   5922 C  C     . TRP D 4 682 ? -55.954 12.764  30.778 1.00 74.80  ? 682 TRP D C     1 
ATOM   5923 O  O     . TRP D 4 682 ? -56.313 13.223  31.859 1.00 75.94  ? 682 TRP D O     1 
ATOM   5924 C  CB    . TRP D 4 682 ? -54.321 13.749  29.184 1.00 74.91  ? 682 TRP D CB    1 
ATOM   5925 C  CG    . TRP D 4 682 ? -54.925 15.099  29.424 1.00 76.22  ? 682 TRP D CG    1 
ATOM   5926 C  CD1   . TRP D 4 682 ? -56.215 15.474  29.192 1.00 76.20  ? 682 TRP D CD1   1 
ATOM   5927 C  CD2   . TRP D 4 682 ? -54.274 16.236  29.999 1.00 76.78  ? 682 TRP D CD2   1 
ATOM   5928 N  NE1   . TRP D 4 682 ? -56.410 16.773  29.588 1.00 76.44  ? 682 TRP D NE1   1 
ATOM   5929 C  CE2   . TRP D 4 682 ? -55.234 17.266  30.087 1.00 76.72  ? 682 TRP D CE2   1 
ATOM   5930 C  CE3   . TRP D 4 682 ? -52.972 16.484  30.450 1.00 76.92  ? 682 TRP D CE3   1 
ATOM   5931 C  CZ2   . TRP D 4 682 ? -54.935 18.525  30.608 1.00 76.79  ? 682 TRP D CZ2   1 
ATOM   5932 C  CZ3   . TRP D 4 682 ? -52.673 17.734  30.968 1.00 77.31  ? 682 TRP D CZ3   1 
ATOM   5933 C  CH2   . TRP D 4 682 ? -53.652 18.740  31.042 1.00 77.78  ? 682 TRP D CH2   1 
ATOM   5934 N  N     . GLU D 4 683 ? -56.801 12.215  29.918 1.00 75.82  ? 683 GLU D N     1 
ATOM   5935 C  CA    . GLU D 4 683 ? -58.222 12.142  30.224 1.00 77.87  ? 683 GLU D CA    1 
ATOM   5936 C  C     . GLU D 4 683 ? -58.498 11.293  31.465 1.00 77.22  ? 683 GLU D C     1 
ATOM   5937 O  O     . GLU D 4 683 ? -59.485 11.512  32.168 1.00 78.03  ? 683 GLU D O     1 
ATOM   5938 C  CB    . GLU D 4 683 ? -58.988 11.582  29.021 1.00 80.24  ? 683 GLU D CB    1 
ATOM   5939 C  CG    . GLU D 4 683 ? -58.808 12.404  27.751 1.00 83.63  ? 683 GLU D CG    1 
ATOM   5940 C  CD    . GLU D 4 683 ? -59.451 11.757  26.539 1.00 86.70  ? 683 GLU D CD    1 
ATOM   5941 O  OE1   . GLU D 4 683 ? -59.169 10.565  26.278 1.00 87.81  ? 683 GLU D OE1   1 
ATOM   5942 O  OE2   . GLU D 4 683 ? -60.235 12.441  25.842 1.00 88.70  ? 683 GLU D OE2   1 
ATOM   5943 N  N     . SER D 4 684 ? -57.624 10.329  31.737 1.00 76.01  ? 684 SER D N     1 
ATOM   5944 C  CA    . SER D 4 684 ? -57.789 9.453   32.893 1.00 74.55  ? 684 SER D CA    1 
ATOM   5945 C  C     . SER D 4 684 ? -57.239 10.095  34.160 1.00 73.88  ? 684 SER D C     1 
ATOM   5946 O  O     . SER D 4 684 ? -57.868 10.053  35.218 1.00 73.66  ? 684 SER D O     1 
ATOM   5947 C  CB    . SER D 4 684 ? -57.073 8.119   32.657 1.00 74.33  ? 684 SER D CB    1 
ATOM   5948 O  OG    . SER D 4 684 ? -57.632 7.417   31.562 1.00 73.70  ? 684 SER D OG    1 
ATOM   5949 N  N     . VAL D 4 685 ? -56.057 10.687  34.046 1.00 73.05  ? 685 VAL D N     1 
ATOM   5950 C  CA    . VAL D 4 685 ? -55.416 11.323  35.186 1.00 71.46  ? 685 VAL D CA    1 
ATOM   5951 C  C     . VAL D 4 685 ? -56.200 12.563  35.612 1.00 71.09  ? 685 VAL D C     1 
ATOM   5952 O  O     . VAL D 4 685 ? -56.237 12.906  36.792 1.00 70.42  ? 685 VAL D O     1 
ATOM   5953 C  CB    . VAL D 4 685 ? -53.930 11.696  34.856 1.00 70.32  ? 685 VAL D CB    1 
ATOM   5954 C  CG1   . VAL D 4 685 ? -53.864 12.957  34.003 1.00 69.10  ? 685 VAL D CG1   1 
ATOM   5955 C  CG2   . VAL D 4 685 ? -53.137 11.855  36.134 1.00 69.00  ? 685 VAL D CG2   1 
ATOM   5956 N  N     . SER D 4 686 ? -56.844 13.215  34.647 1.00 70.80  ? 686 SER D N     1 
ATOM   5957 C  CA    . SER D 4 686 ? -57.623 14.421  34.920 1.00 70.94  ? 686 SER D CA    1 
ATOM   5958 C  C     . SER D 4 686 ? -58.837 14.130  35.801 1.00 71.41  ? 686 SER D C     1 
ATOM   5959 O  O     . SER D 4 686 ? -59.119 14.854  36.758 1.00 71.27  ? 686 SER D O     1 
ATOM   5960 C  CB    . SER D 4 686 ? -58.073 15.069  33.606 1.00 70.78  ? 686 SER D CB    1 
ATOM   5961 O  OG    . SER D 4 686 ? -56.966 15.580  32.872 1.00 69.91  ? 686 SER D OG    1 
ATOM   5962 N  N     . VAL D 4 687 ? -59.546 13.056  35.483 1.00 71.80  ? 687 VAL D N     1 
ATOM   5963 C  CA    . VAL D 4 687 ? -60.727 12.676  36.243 1.00 71.96  ? 687 VAL D CA    1 
ATOM   5964 C  C     . VAL D 4 687 ? -60.356 12.143  37.626 1.00 71.40  ? 687 VAL D C     1 
ATOM   5965 O  O     . VAL D 4 687 ? -61.201 11.573  38.316 1.00 71.93  ? 687 VAL D O     1 
ATOM   5966 C  CB    . VAL D 4 687 ? -61.527 11.583  35.498 1.00 71.86  ? 687 VAL D CB    1 
ATOM   5967 C  CG1   . VAL D 4 687 ? -61.834 12.039  34.084 1.00 71.86  ? 687 VAL D CG1   1 
ATOM   5968 C  CG2   . VAL D 4 687 ? -60.739 10.285  35.478 1.00 71.99  ? 687 VAL D CG2   1 
ATOM   5969 N  N     . THR D 4 688 ? -59.100 12.337  38.029 1.00 70.24  ? 688 THR D N     1 
ATOM   5970 C  CA    . THR D 4 688 ? -58.623 11.834  39.320 1.00 69.12  ? 688 THR D CA    1 
ATOM   5971 C  C     . THR D 4 688 ? -57.944 12.886  40.195 1.00 67.43  ? 688 THR D C     1 
ATOM   5972 O  O     . THR D 4 688 ? -58.233 13.014  41.387 1.00 67.31  ? 688 THR D O     1 
ATOM   5973 C  CB    . THR D 4 688 ? -57.620 10.683  39.115 1.00 69.88  ? 688 THR D CB    1 
ATOM   5974 O  OG1   . THR D 4 688 ? -58.202 9.684   38.265 1.00 70.31  ? 688 THR D OG1   1 
ATOM   5975 C  CG2   . THR D 4 688 ? -57.239 10.063  40.458 1.00 70.54  ? 688 THR D CG2   1 
ATOM   5976 N  N     . VAL D 4 689 ? -57.025 13.627  39.595 1.00 64.98  ? 689 VAL D N     1 
ATOM   5977 C  CA    . VAL D 4 689 ? -56.295 14.661  40.308 1.00 62.76  ? 689 VAL D CA    1 
ATOM   5978 C  C     . VAL D 4 689 ? -56.944 16.004  39.991 1.00 60.54  ? 689 VAL D C     1 
ATOM   5979 O  O     . VAL D 4 689 ? -56.761 16.542  38.902 1.00 61.82  ? 689 VAL D O     1 
ATOM   5980 C  CB    . VAL D 4 689 ? -54.818 14.680  39.853 1.00 62.88  ? 689 VAL D CB    1 
ATOM   5981 C  CG1   . VAL D 4 689 ? -54.036 15.689  40.670 1.00 62.64  ? 689 VAL D CG1   1 
ATOM   5982 C  CG2   . VAL D 4 689 ? -54.220 13.285  39.968 1.00 60.33  ? 689 VAL D CG2   1 
ATOM   5983 N  N     . VAL D 4 690 ? -57.700 16.554  40.929 1.00 57.11  ? 690 VAL D N     1 
ATOM   5984 C  CA    . VAL D 4 690 ? -58.355 17.815  40.648 1.00 54.43  ? 690 VAL D CA    1 
ATOM   5985 C  C     . VAL D 4 690 ? -58.023 18.915  41.633 1.00 52.39  ? 690 VAL D C     1 
ATOM   5986 O  O     . VAL D 4 690 ? -57.528 19.961  41.240 1.00 54.21  ? 690 VAL D O     1 
ATOM   5987 C  CB    . VAL D 4 690 ? -59.905 17.639  40.556 1.00 55.47  ? 690 VAL D CB    1 
ATOM   5988 C  CG1   . VAL D 4 690 ? -60.239 16.420  39.684 1.00 54.02  ? 690 VAL D CG1   1 
ATOM   5989 C  CG2   . VAL D 4 690 ? -60.517 17.494  41.946 1.00 56.89  ? 690 VAL D CG2   1 
ATOM   5990 N  N     . ALA D 4 691 ? -58.290 18.699  42.909 1.00 50.00  ? 691 ALA D N     1 
ATOM   5991 C  CA    . ALA D 4 691 ? -57.993 19.724  43.888 1.00 49.19  ? 691 ALA D CA    1 
ATOM   5992 C  C     . ALA D 4 691 ? -56.571 20.178  43.622 1.00 49.25  ? 691 ALA D C     1 
ATOM   5993 O  O     . ALA D 4 691 ? -56.271 21.381  43.571 1.00 49.36  ? 691 ALA D O     1 
ATOM   5994 C  CB    . ALA D 4 691 ? -58.111 19.157  45.292 1.00 48.94  ? 691 ALA D CB    1 
ATOM   5995 N  N     . ALA D 4 692 ? -55.698 19.193  43.437 1.00 47.95  ? 692 ALA D N     1 
ATOM   5996 C  CA    . ALA D 4 692 ? -54.303 19.453  43.173 1.00 46.45  ? 692 ALA D CA    1 
ATOM   5997 C  C     . ALA D 4 692 ? -54.171 20.442  42.015 1.00 46.36  ? 692 ALA D C     1 
ATOM   5998 O  O     . ALA D 4 692 ? -53.609 21.526  42.188 1.00 46.99  ? 692 ALA D O     1 
ATOM   5999 C  CB    . ALA D 4 692 ? -53.604 18.159  42.852 1.00 48.54  ? 692 ALA D CB    1 
ATOM   6000 N  N     . VAL D 4 693 ? -54.698 20.081  40.844 1.00 44.06  ? 693 VAL D N     1 
ATOM   6001 C  CA    . VAL D 4 693 ? -54.622 20.971  39.689 1.00 43.93  ? 693 VAL D CA    1 
ATOM   6002 C  C     . VAL D 4 693 ? -55.180 22.353  40.031 1.00 45.53  ? 693 VAL D C     1 
ATOM   6003 O  O     . VAL D 4 693 ? -54.673 23.377  39.566 1.00 43.67  ? 693 VAL D O     1 
ATOM   6004 C  CB    . VAL D 4 693 ? -55.382 20.395  38.462 1.00 42.69  ? 693 VAL D CB    1 
ATOM   6005 C  CG1   . VAL D 4 693 ? -55.341 21.394  37.311 1.00 39.63  ? 693 VAL D CG1   1 
ATOM   6006 C  CG2   . VAL D 4 693 ? -54.744 19.073  38.013 1.00 41.23  ? 693 VAL D CG2   1 
ATOM   6007 N  N     . GLU D 4 694 ? -56.219 22.395  40.854 1.00 47.45  ? 694 GLU D N     1 
ATOM   6008 C  CA    . GLU D 4 694 ? -56.769 23.682  41.224 1.00 50.09  ? 694 GLU D CA    1 
ATOM   6009 C  C     . GLU D 4 694 ? -55.703 24.421  41.997 1.00 49.27  ? 694 GLU D C     1 
ATOM   6010 O  O     . GLU D 4 694 ? -55.441 25.595  41.728 1.00 50.03  ? 694 GLU D O     1 
ATOM   6011 C  CB    . GLU D 4 694 ? -58.020 23.530  42.082 1.00 53.55  ? 694 GLU D CB    1 
ATOM   6012 C  CG    . GLU D 4 694 ? -59.164 22.844  41.358 1.00 62.75  ? 694 GLU D CG    1 
ATOM   6013 C  CD    . GLU D 4 694 ? -60.511 23.228  41.932 1.00 68.26  ? 694 GLU D CD    1 
ATOM   6014 O  OE1   . GLU D 4 694 ? -61.549 22.764  41.394 1.00 70.73  ? 694 GLU D OE1   1 
ATOM   6015 O  OE2   . GLU D 4 694 ? -60.524 24.003  42.920 1.00 71.26  ? 694 GLU D OE2   1 
ATOM   6016 N  N     . ALA D 4 695 ? -55.079 23.720  42.942 1.00 47.41  ? 695 ALA D N     1 
ATOM   6017 C  CA    . ALA D 4 695 ? -54.026 24.303  43.777 1.00 44.43  ? 695 ALA D CA    1 
ATOM   6018 C  C     . ALA D 4 695 ? -52.816 24.711  42.946 1.00 42.43  ? 695 ALA D C     1 
ATOM   6019 O  O     . ALA D 4 695 ? -52.165 25.705  43.232 1.00 41.57  ? 695 ALA D O     1 
ATOM   6020 C  CB    . ALA D 4 695 ? -53.613 23.315  44.849 1.00 44.59  ? 695 ALA D CB    1 
ATOM   6021 N  N     . MET D 4 696 ? -52.503 23.927  41.926 1.00 40.49  ? 696 MET D N     1 
ATOM   6022 C  CA    . MET D 4 696 ? -51.399 24.270  41.066 1.00 42.28  ? 696 MET D CA    1 
ATOM   6023 C  C     . MET D 4 696 ? -51.706 25.610  40.399 1.00 42.87  ? 696 MET D C     1 
ATOM   6024 O  O     . MET D 4 696 ? -50.964 26.581  40.554 1.00 43.25  ? 696 MET D O     1 
ATOM   6025 C  CB    . MET D 4 696 ? -51.214 23.203  39.996 1.00 45.53  ? 696 MET D CB    1 
ATOM   6026 C  CG    . MET D 4 696 ? -50.525 23.730  38.739 1.00 48.58  ? 696 MET D CG    1 
ATOM   6027 S  SD    . MET D 4 696 ? -50.316 22.428  37.520 1.00 55.33  ? 696 MET D SD    1 
ATOM   6028 C  CE    . MET D 4 696 ? -52.047 22.025  37.152 1.00 49.91  ? 696 MET D CE    1 
ATOM   6029 N  N     . ASN D 4 697 ? -52.814 25.650  39.662 1.00 43.35  ? 697 ASN D N     1 
ATOM   6030 C  CA    . ASN D 4 697 ? -53.246 26.852  38.956 1.00 42.29  ? 697 ASN D CA    1 
ATOM   6031 C  C     . ASN D 4 697 ? -53.312 28.079  39.862 1.00 41.53  ? 697 ASN D C     1 
ATOM   6032 O  O     . ASN D 4 697 ? -53.041 29.200  39.427 1.00 42.49  ? 697 ASN D O     1 
ATOM   6033 C  CB    . ASN D 4 697 ? -54.590 26.590  38.282 1.00 42.56  ? 697 ASN D CB    1 
ATOM   6034 C  CG    . ASN D 4 697 ? -54.456 25.698  37.047 1.00 46.28  ? 697 ASN D CG    1 
ATOM   6035 O  OD1   . ASN D 4 697 ? -55.121 24.666  36.922 1.00 46.17  ? 697 ASN D OD1   1 
ATOM   6036 N  ND2   . ASN D 4 697 ? -53.588 26.100  36.126 1.00 49.51  ? 697 ASN D ND2   1 
ATOM   6037 N  N     . TRP D 4 698 ? -53.655 27.873  41.128 1.00 39.32  ? 698 TRP D N     1 
ATOM   6038 C  CA    . TRP D 4 698 ? -53.714 28.985  42.057 1.00 37.90  ? 698 TRP D CA    1 
ATOM   6039 C  C     . TRP D 4 698 ? -52.300 29.505  42.246 1.00 37.69  ? 698 TRP D C     1 
ATOM   6040 O  O     . TRP D 4 698 ? -52.079 30.709  42.264 1.00 38.51  ? 698 TRP D O     1 
ATOM   6041 C  CB    . TRP D 4 698 ? -54.278 28.549  43.403 1.00 37.39  ? 698 TRP D CB    1 
ATOM   6042 C  CG    . TRP D 4 698 ? -54.410 29.688  44.365 1.00 38.37  ? 698 TRP D CG    1 
ATOM   6043 C  CD1   . TRP D 4 698 ? -55.474 30.527  44.497 1.00 39.20  ? 698 TRP D CD1   1 
ATOM   6044 C  CD2   . TRP D 4 698 ? -53.414 30.157  45.279 1.00 40.46  ? 698 TRP D CD2   1 
ATOM   6045 N  NE1   . TRP D 4 698 ? -55.207 31.491  45.434 1.00 40.08  ? 698 TRP D NE1   1 
ATOM   6046 C  CE2   . TRP D 4 698 ? -53.946 31.291  45.930 1.00 40.53  ? 698 TRP D CE2   1 
ATOM   6047 C  CE3   . TRP D 4 698 ? -52.118 29.734  45.608 1.00 41.34  ? 698 TRP D CE3   1 
ATOM   6048 C  CZ2   . TRP D 4 698 ? -53.227 32.014  46.892 1.00 40.96  ? 698 TRP D CZ2   1 
ATOM   6049 C  CZ3   . TRP D 4 698 ? -51.403 30.455  46.566 1.00 41.86  ? 698 TRP D CZ3   1 
ATOM   6050 C  CH2   . TRP D 4 698 ? -51.960 31.582  47.194 1.00 41.19  ? 698 TRP D CH2   1 
ATOM   6051 N  N     . LEU D 4 699 ? -51.345 28.591  42.398 1.00 37.30  ? 699 LEU D N     1 
ATOM   6052 C  CA    . LEU D 4 699 ? -49.941 28.968  42.561 1.00 36.84  ? 699 LEU D CA    1 
ATOM   6053 C  C     . LEU D 4 699 ? -49.430 29.671  41.301 1.00 38.26  ? 699 LEU D C     1 
ATOM   6054 O  O     . LEU D 4 699 ? -48.755 30.702  41.374 1.00 37.22  ? 699 LEU D O     1 
ATOM   6055 C  CB    . LEU D 4 699 ? -49.093 27.727  42.842 1.00 32.36  ? 699 LEU D CB    1 
ATOM   6056 C  CG    . LEU D 4 699 ? -49.327 27.151  44.234 1.00 28.89  ? 699 LEU D CG    1 
ATOM   6057 C  CD1   . LEU D 4 699 ? -48.794 25.728  44.351 1.00 25.48  ? 699 LEU D CD1   1 
ATOM   6058 C  CD2   . LEU D 4 699 ? -48.677 28.087  45.246 1.00 27.45  ? 699 LEU D CD2   1 
ATOM   6059 N  N     . LYS D 4 700 ? -49.764 29.103  40.145 1.00 39.12  ? 700 LYS D N     1 
ATOM   6060 C  CA    . LYS D 4 700 ? -49.353 29.667  38.876 1.00 40.70  ? 700 LYS D CA    1 
ATOM   6061 C  C     . LYS D 4 700 ? -49.871 31.091  38.702 1.00 44.43  ? 700 LYS D C     1 
ATOM   6062 O  O     . LYS D 4 700 ? -49.181 31.950  38.149 1.00 45.94  ? 700 LYS D O     1 
ATOM   6063 C  CB    . LYS D 4 700 ? -49.862 28.808  37.734 1.00 38.55  ? 700 LYS D CB    1 
ATOM   6064 C  CG    . LYS D 4 700 ? -49.152 27.503  37.586 1.00 37.89  ? 700 LYS D CG    1 
ATOM   6065 C  CD    . LYS D 4 700 ? -49.334 26.960  36.187 1.00 36.36  ? 700 LYS D CD    1 
ATOM   6066 C  CE    . LYS D 4 700 ? -48.411 25.802  35.941 1.00 37.35  ? 700 LYS D CE    1 
ATOM   6067 N  NZ    . LYS D 4 700 ? -48.377 25.371  34.517 1.00 43.08  ? 700 LYS D NZ    1 
ATOM   6068 N  N     . SER D 4 701 ? -51.093 31.337  39.161 1.00 46.33  ? 701 SER D N     1 
ATOM   6069 C  CA    . SER D 4 701 ? -51.678 32.661  39.045 1.00 46.69  ? 701 SER D CA    1 
ATOM   6070 C  C     . SER D 4 701 ? -50.867 33.637  39.872 1.00 46.80  ? 701 SER D C     1 
ATOM   6071 O  O     . SER D 4 701 ? -50.631 34.768  39.469 1.00 48.51  ? 701 SER D O     1 
ATOM   6072 C  CB    . SER D 4 701 ? -53.127 32.643  39.529 1.00 47.77  ? 701 SER D CB    1 
ATOM   6073 O  OG    . SER D 4 701 ? -53.925 31.800  38.708 1.00 49.10  ? 701 SER D OG    1 
ATOM   6074 N  N     . ALA D 4 702 ? -50.435 33.184  41.035 1.00 47.59  ? 702 ALA D N     1 
ATOM   6075 C  CA    . ALA D 4 702 ? -49.650 34.009  41.933 1.00 48.29  ? 702 ALA D CA    1 
ATOM   6076 C  C     . ALA D 4 702 ? -48.330 34.366  41.285 1.00 49.28  ? 702 ALA D C     1 
ATOM   6077 O  O     . ALA D 4 702 ? -47.913 35.528  41.272 1.00 49.39  ? 702 ALA D O     1 
ATOM   6078 C  CB    . ALA D 4 702 ? -49.401 33.262  43.219 1.00 48.47  ? 702 ALA D CB    1 
ATOM   6079 N  N     . ALA D 4 703 ? -47.670 33.350  40.750 1.00 49.38  ? 703 ALA D N     1 
ATOM   6080 C  CA    . ALA D 4 703 ? -46.389 33.554  40.107 1.00 49.43  ? 703 ALA D CA    1 
ATOM   6081 C  C     . ALA D 4 703 ? -46.593 34.508  38.934 1.00 49.70  ? 703 ALA D C     1 
ATOM   6082 O  O     . ALA D 4 703 ? -45.856 35.474  38.769 1.00 50.04  ? 703 ALA D O     1 
ATOM   6083 C  CB    . ALA D 4 703 ? -45.829 32.211  39.634 1.00 46.90  ? 703 ALA D CB    1 
ATOM   6084 N  N     . LYS D 4 704 ? -47.624 34.237  38.143 1.00 51.00  ? 704 LYS D N     1 
ATOM   6085 C  CA    . LYS D 4 704 ? -47.954 35.034  36.972 1.00 51.20  ? 704 LYS D CA    1 
ATOM   6086 C  C     . LYS D 4 704 ? -48.143 36.513  37.296 1.00 51.49  ? 704 LYS D C     1 
ATOM   6087 O  O     . LYS D 4 704 ? -47.562 37.381  36.642 1.00 53.14  ? 704 LYS D O     1 
ATOM   6088 C  CB    . LYS D 4 704 ? -49.219 34.474  36.326 1.00 52.67  ? 704 LYS D CB    1 
ATOM   6089 C  CG    . LYS D 4 704 ? -49.540 35.020  34.957 1.00 54.44  ? 704 LYS D CG    1 
ATOM   6090 C  CD    . LYS D 4 704 ? -50.710 34.250  34.365 1.00 57.35  ? 704 LYS D CD    1 
ATOM   6091 C  CE    . LYS D 4 704 ? -51.096 34.780  32.988 1.00 60.45  ? 704 LYS D CE    1 
ATOM   6092 N  NZ    . LYS D 4 704 ? -52.213 33.992  32.373 1.00 60.93  ? 704 LYS D NZ    1 
ATOM   6093 N  N     . LEU D 4 705 ? -48.941 36.810  38.310 1.00 49.89  ? 705 LEU D N     1 
ATOM   6094 C  CA    . LEU D 4 705 ? -49.181 38.194  38.661 1.00 48.80  ? 705 LEU D CA    1 
ATOM   6095 C  C     . LEU D 4 705 ? -47.991 38.869  39.304 1.00 48.95  ? 705 LEU D C     1 
ATOM   6096 O  O     . LEU D 4 705 ? -47.923 40.092  39.333 1.00 50.91  ? 705 LEU D O     1 
ATOM   6097 C  CB    . LEU D 4 705 ? -50.386 38.309  39.590 1.00 49.60  ? 705 LEU D CB    1 
ATOM   6098 C  CG    . LEU D 4 705 ? -51.706 37.787  39.028 1.00 49.56  ? 705 LEU D CG    1 
ATOM   6099 C  CD1   . LEU D 4 705 ? -52.830 38.116  39.981 1.00 49.78  ? 705 LEU D CD1   1 
ATOM   6100 C  CD2   . LEU D 4 705 ? -51.968 38.416  37.682 1.00 50.77  ? 705 LEU D CD2   1 
ATOM   6101 N  N     . LEU D 4 706 ? -47.053 38.093  39.832 1.00 49.20  ? 706 LEU D N     1 
ATOM   6102 C  CA    . LEU D 4 706 ? -45.880 38.685  40.480 1.00 48.36  ? 706 LEU D CA    1 
ATOM   6103 C  C     . LEU D 4 706 ? -44.777 38.899  39.484 1.00 47.65  ? 706 LEU D C     1 
ATOM   6104 O  O     . LEU D 4 706 ? -43.973 39.812  39.623 1.00 47.83  ? 706 LEU D O     1 
ATOM   6105 C  CB    . LEU D 4 706 ? -45.366 37.798  41.615 1.00 48.56  ? 706 LEU D CB    1 
ATOM   6106 C  CG    . LEU D 4 706 ? -46.114 37.912  42.946 1.00 49.33  ? 706 LEU D CG    1 
ATOM   6107 C  CD1   . LEU D 4 706 ? -45.582 36.889  43.944 1.00 49.17  ? 706 LEU D CD1   1 
ATOM   6108 C  CD2   . LEU D 4 706 ? -45.950 39.326  43.487 1.00 48.20  ? 706 LEU D CD2   1 
ATOM   6109 N  N     . ALA D 4 707 ? -44.749 38.042  38.476 1.00 48.20  ? 707 ALA D N     1 
ATOM   6110 C  CA    . ALA D 4 707 ? -43.744 38.114  37.439 1.00 49.52  ? 707 ALA D CA    1 
ATOM   6111 C  C     . ALA D 4 707 ? -44.124 39.223  36.469 1.00 50.82  ? 707 ALA D C     1 
ATOM   6112 O  O     . ALA D 4 707 ? -43.275 39.895  35.897 1.00 49.94  ? 707 ALA D O     1 
ATOM   6113 C  CB    . ALA D 4 707 ? -43.670 36.786  36.717 1.00 47.09  ? 707 ALA D CB    1 
ATOM   6114 N  N     . ALA D 4 708 ? -45.419 39.401  36.276 1.00 53.56  ? 708 ALA D N     1 
ATOM   6115 C  CA    . ALA D 4 708 ? -45.901 40.429  35.374 1.00 54.77  ? 708 ALA D CA    1 
ATOM   6116 C  C     . ALA D 4 708 ? -45.226 41.753  35.687 1.00 55.39  ? 708 ALA D C     1 
ATOM   6117 O  O     . ALA D 4 708 ? -44.677 41.951  36.774 1.00 54.78  ? 708 ALA D O     1 
ATOM   6118 C  CB    . ALA D 4 708 ? -47.415 40.572  35.508 1.00 52.10  ? 708 ALA D CB    1 
ATOM   6119 N  N     . GLU D 4 709 ? -45.253 42.646  34.709 1.00 57.89  ? 709 GLU D N     1 
ATOM   6120 C  CA    . GLU D 4 709 ? -44.699 43.982  34.859 1.00 60.50  ? 709 GLU D CA    1 
ATOM   6121 C  C     . GLU D 4 709 ? -45.906 44.872  34.610 1.00 60.74  ? 709 GLU D C     1 
ATOM   6122 O  O     . GLU D 4 709 ? -46.513 44.814  33.545 1.00 59.87  ? 709 GLU D O     1 
ATOM   6123 C  CB    . GLU D 4 709 ? -43.623 44.219  33.808 1.00 63.40  ? 709 GLU D CB    1 
ATOM   6124 C  CG    . GLU D 4 709 ? -42.837 45.499  33.983 1.00 66.45  ? 709 GLU D CG    1 
ATOM   6125 C  CD    . GLU D 4 709 ? -41.675 45.581  33.010 1.00 69.12  ? 709 GLU D CD    1 
ATOM   6126 O  OE1   . GLU D 4 709 ? -41.917 45.514  31.785 1.00 70.05  ? 709 GLU D OE1   1 
ATOM   6127 O  OE2   . GLU D 4 709 ? -40.520 45.705  33.467 1.00 71.92  ? 709 GLU D OE2   1 
ATOM   6128 N  N     . VAL D 4 710 ? -46.278 45.678  35.591 1.00 62.07  ? 710 VAL D N     1 
ATOM   6129 C  CA    . VAL D 4 710 ? -47.450 46.518  35.423 1.00 64.50  ? 710 VAL D CA    1 
ATOM   6130 C  C     . VAL D 4 710 ? -47.146 47.943  34.987 1.00 65.66  ? 710 VAL D C     1 
ATOM   6131 O  O     . VAL D 4 710 ? -46.445 48.688  35.668 1.00 64.74  ? 710 VAL D O     1 
ATOM   6132 C  CB    . VAL D 4 710 ? -48.290 46.530  36.711 1.00 65.08  ? 710 VAL D CB    1 
ATOM   6133 C  CG1   . VAL D 4 710 ? -49.454 47.492  36.571 1.00 65.48  ? 710 VAL D CG1   1 
ATOM   6134 C  CG2   . VAL D 4 710 ? -48.804 45.130  36.989 1.00 65.33  ? 710 VAL D CG2   1 
ATOM   6135 N  N     . LYS D 4 711 ? -47.686 48.312  33.832 1.00 68.34  ? 711 LYS D N     1 
ATOM   6136 C  CA    . LYS D 4 711 ? -47.484 49.645  33.290 1.00 71.37  ? 711 LYS D CA    1 
ATOM   6137 C  C     . LYS D 4 711 ? -48.808 50.404  33.294 1.00 73.24  ? 711 LYS D C     1 
ATOM   6138 O  O     . LYS D 4 711 ? -49.863 49.829  33.017 1.00 73.20  ? 711 LYS D O     1 
ATOM   6139 C  CB    . LYS D 4 711 ? -46.937 49.558  31.859 1.00 70.99  ? 711 LYS D CB    1 
ATOM   6140 C  CG    . LYS D 4 711 ? -45.743 48.624  31.708 1.00 72.20  ? 711 LYS D CG    1 
ATOM   6141 C  CD    . LYS D 4 711 ? -45.174 48.640  30.294 1.00 74.01  ? 711 LYS D CD    1 
ATOM   6142 C  CE    . LYS D 4 711 ? -44.282 49.856  30.055 1.00 76.54  ? 711 LYS D CE    1 
ATOM   6143 N  NZ    . LYS D 4 711 ? -43.780 49.946  28.653 1.00 77.47  ? 711 LYS D NZ    1 
ATOM   6144 N  N     . ASP D 4 712 ? -48.746 51.690  33.628 1.00 75.06  ? 712 ASP D N     1 
ATOM   6145 C  CA    . ASP D 4 712 ? -49.932 52.538  33.643 1.00 75.87  ? 712 ASP D CA    1 
ATOM   6146 C  C     . ASP D 4 712 ? -50.561 52.411  32.260 1.00 76.14  ? 712 ASP D C     1 
ATOM   6147 O  O     . ASP D 4 712 ? -49.890 52.596  31.244 1.00 76.30  ? 712 ASP D O     1 
ATOM   6148 C  CB    . ASP D 4 712 ? -49.522 53.988  33.921 1.00 77.83  ? 712 ASP D CB    1 
ATOM   6149 C  CG    . ASP D 4 712 ? -50.711 54.934  34.019 1.00 80.17  ? 712 ASP D CG    1 
ATOM   6150 O  OD1   . ASP D 4 712 ? -51.464 55.049  33.025 1.00 81.07  ? 712 ASP D OD1   1 
ATOM   6151 O  OD2   . ASP D 4 712 ? -50.887 55.569  35.088 1.00 80.75  ? 712 ASP D OD2   1 
ATOM   6152 N  N     . LYS D 4 713 ? -51.845 52.083  32.220 1.00 76.76  ? 713 LYS D N     1 
ATOM   6153 C  CA    . LYS D 4 713 ? -52.546 51.903  30.952 1.00 76.96  ? 713 LYS D CA    1 
ATOM   6154 C  C     . LYS D 4 713 ? -52.370 53.082  30.002 1.00 76.14  ? 713 LYS D C     1 
ATOM   6155 O  O     . LYS D 4 713 ? -52.373 52.914  28.785 1.00 76.22  ? 713 LYS D O     1 
ATOM   6156 C  CB    . LYS D 4 713 ? -54.042 51.660  31.206 1.00 78.72  ? 713 LYS D CB    1 
ATOM   6157 C  CG    . LYS D 4 713 ? -54.355 50.400  32.018 1.00 80.46  ? 713 LYS D CG    1 
ATOM   6158 C  CD    . LYS D 4 713 ? -53.885 50.532  33.465 1.00 83.01  ? 713 LYS D CD    1 
ATOM   6159 C  CE    . LYS D 4 713 ? -54.192 49.288  34.297 1.00 84.48  ? 713 LYS D CE    1 
ATOM   6160 N  NZ    . LYS D 4 713 ? -55.658 49.014  34.407 1.00 83.76  ? 713 LYS D NZ    1 
ATOM   6161 N  N     . LYS D 4 714 ? -52.194 54.273  30.562 1.00 75.63  ? 714 LYS D N     1 
ATOM   6162 C  CA    . LYS D 4 714 ? -52.050 55.473  29.750 1.00 75.18  ? 714 LYS D CA    1 
ATOM   6163 C  C     . LYS D 4 714 ? -50.638 56.064  29.656 1.00 73.85  ? 714 LYS D C     1 
ATOM   6164 O  O     . LYS D 4 714 ? -50.160 56.350  28.560 1.00 74.59  ? 714 LYS D O     1 
ATOM   6165 C  CB    . LYS D 4 714 ? -53.025 56.546  30.255 1.00 76.84  ? 714 LYS D CB    1 
ATOM   6166 C  CG    . LYS D 4 714 ? -54.494 56.105  30.247 1.00 79.09  ? 714 LYS D CG    1 
ATOM   6167 C  CD    . LYS D 4 714 ? -54.998 55.828  28.825 1.00 80.76  ? 714 LYS D CD    1 
ATOM   6168 C  CE    . LYS D 4 714 ? -56.397 55.195  28.808 1.00 81.29  ? 714 LYS D CE    1 
ATOM   6169 N  NZ    . LYS D 4 714 ? -56.401 53.748  29.187 1.00 81.51  ? 714 LYS D NZ    1 
ATOM   6170 N  N     . THR D 4 715 ? -49.961 56.248  30.782 1.00 71.06  ? 715 THR D N     1 
ATOM   6171 C  CA    . THR D 4 715 ? -48.632 56.838  30.725 1.00 69.22  ? 715 THR D CA    1 
ATOM   6172 C  C     . THR D 4 715 ? -47.504 55.896  30.299 1.00 67.91  ? 715 THR D C     1 
ATOM   6173 O  O     . THR D 4 715 ? -46.411 56.352  29.952 1.00 65.95  ? 715 THR D O     1 
ATOM   6174 C  CB    . THR D 4 715 ? -48.264 57.503  32.072 1.00 69.55  ? 715 THR D CB    1 
ATOM   6175 O  OG1   . THR D 4 715 ? -48.173 56.515  33.105 1.00 70.84  ? 715 THR D OG1   1 
ATOM   6176 C  CG2   . THR D 4 715 ? -49.322 58.525  32.450 1.00 68.46  ? 715 THR D CG2   1 
ATOM   6177 N  N     . GLY D 4 716 ? -47.775 54.590  30.307 1.00 66.48  ? 716 GLY D N     1 
ATOM   6178 C  CA    . GLY D 4 716 ? -46.762 53.614  29.929 1.00 63.33  ? 716 GLY D CA    1 
ATOM   6179 C  C     . GLY D 4 716 ? -45.684 53.419  30.990 1.00 61.76  ? 716 GLY D C     1 
ATOM   6180 O  O     . GLY D 4 716 ? -44.681 52.741  30.763 1.00 61.88  ? 716 GLY D O     1 
ATOM   6181 N  N     . GLU D 4 717 ? -45.887 54.022  32.154 1.00 59.83  ? 717 GLU D N     1 
ATOM   6182 C  CA    . GLU D 4 717 ? -44.940 53.920  33.249 1.00 59.96  ? 717 GLU D CA    1 
ATOM   6183 C  C     . GLU D 4 717 ? -45.027 52.571  33.956 1.00 60.72  ? 717 GLU D C     1 
ATOM   6184 O  O     . GLU D 4 717 ? -46.110 51.985  34.076 1.00 60.58  ? 717 GLU D O     1 
ATOM   6185 C  CB    . GLU D 4 717 ? -45.198 55.043  34.261 1.00 60.39  ? 717 GLU D CB    1 
ATOM   6186 C  CG    . GLU D 4 717 ? -44.496 54.880  35.604 1.00 59.21  ? 717 GLU D CG    1 
ATOM   6187 C  CD    . GLU D 4 717 ? -44.630 56.112  36.499 1.00 62.20  ? 717 GLU D CD    1 
ATOM   6188 O  OE1   . GLU D 4 717 ? -45.752 56.673  36.601 1.00 62.39  ? 717 GLU D OE1   1 
ATOM   6189 O  OE2   . GLU D 4 717 ? -43.610 56.514  37.114 1.00 61.60  ? 717 GLU D OE2   1 
ATOM   6190 N  N     . ILE D 4 718 ? -43.878 52.073  34.409 1.00 59.84  ? 718 ILE D N     1 
ATOM   6191 C  CA    . ILE D 4 718 ? -43.846 50.811  35.137 1.00 58.86  ? 718 ILE D CA    1 
ATOM   6192 C  C     . ILE D 4 718 ? -44.390 51.185  36.507 1.00 58.87  ? 718 ILE D C     1 
ATOM   6193 O  O     . ILE D 4 718 ? -43.888 52.106  37.140 1.00 59.67  ? 718 ILE D O     1 
ATOM   6194 C  CB    . ILE D 4 718 ? -42.407 50.272  35.319 1.00 57.18  ? 718 ILE D CB    1 
ATOM   6195 C  CG1   . ILE D 4 718 ? -41.747 50.008  33.964 1.00 56.02  ? 718 ILE D CG1   1 
ATOM   6196 C  CG2   . ILE D 4 718 ? -42.435 49.000  36.138 1.00 57.08  ? 718 ILE D CG2   1 
ATOM   6197 C  CD1   . ILE D 4 718 ? -42.388 48.927  33.156 1.00 54.85  ? 718 ILE D CD1   1 
ATOM   6198 N  N     . LEU D 4 719 ? -45.427 50.496  36.957 1.00 58.12  ? 719 LEU D N     1 
ATOM   6199 C  CA    . LEU D 4 719 ? -46.004 50.797  38.259 1.00 58.18  ? 719 LEU D CA    1 
ATOM   6200 C  C     . LEU D 4 719 ? -45.469 49.819  39.303 1.00 58.86  ? 719 LEU D C     1 
ATOM   6201 O  O     . LEU D 4 719 ? -45.145 50.208  40.437 1.00 59.36  ? 719 LEU D O     1 
ATOM   6202 C  CB    . LEU D 4 719 ? -47.528 50.712  38.176 1.00 57.73  ? 719 LEU D CB    1 
ATOM   6203 C  CG    . LEU D 4 719 ? -48.145 51.790  37.281 1.00 57.70  ? 719 LEU D CG    1 
ATOM   6204 C  CD1   . LEU D 4 719 ? -49.601 51.478  36.994 1.00 56.34  ? 719 LEU D CD1   1 
ATOM   6205 C  CD2   . LEU D 4 719 ? -47.995 53.145  37.959 1.00 57.07  ? 719 LEU D CD2   1 
ATOM   6206 N  N     . ARG D 4 720 ? -45.368 48.554  38.895 1.00 56.68  ? 720 ARG D N     1 
ATOM   6207 C  CA    . ARG D 4 720 ? -44.877 47.476  39.737 1.00 53.50  ? 720 ARG D CA    1 
ATOM   6208 C  C     . ARG D 4 720 ? -43.911 46.659  38.878 1.00 53.28  ? 720 ARG D C     1 
ATOM   6209 O  O     . ARG D 4 720 ? -44.300 46.103  37.852 1.00 52.87  ? 720 ARG D O     1 
ATOM   6210 C  CB    . ARG D 4 720 ? -46.058 46.605  40.191 1.00 54.08  ? 720 ARG D CB    1 
ATOM   6211 C  CG    . ARG D 4 720 ? -45.852 45.838  41.504 1.00 51.63  ? 720 ARG D CG    1 
ATOM   6212 C  CD    . ARG D 4 720 ? -44.780 44.761  41.399 1.00 48.89  ? 720 ARG D CD    1 
ATOM   6213 N  NE    . ARG D 4 720 ? -45.119 43.722  40.431 1.00 47.64  ? 720 ARG D NE    1 
ATOM   6214 C  CZ    . ARG D 4 720 ? -46.234 42.998  40.468 1.00 47.87  ? 720 ARG D CZ    1 
ATOM   6215 N  NH1   . ARG D 4 720 ? -47.135 43.194  41.425 1.00 47.09  ? 720 ARG D NH1   1 
ATOM   6216 N  NH2   . ARG D 4 720 ? -46.448 42.068  39.549 1.00 45.91  ? 720 ARG D NH2   1 
ATOM   6217 N  N     . LYS D 4 721 ? -42.651 46.604  39.292 1.00 53.65  ? 721 LYS D N     1 
ATOM   6218 C  CA    . LYS D 4 721 ? -41.626 45.857  38.566 1.00 54.94  ? 721 LYS D CA    1 
ATOM   6219 C  C     . LYS D 4 721 ? -41.791 44.357  38.794 1.00 53.71  ? 721 LYS D C     1 
ATOM   6220 O  O     . LYS D 4 721 ? -42.241 43.938  39.856 1.00 53.03  ? 721 LYS D O     1 
ATOM   6221 C  CB    . LYS D 4 721 ? -40.234 46.281  39.044 1.00 58.62  ? 721 LYS D CB    1 
ATOM   6222 C  CG    . LYS D 4 721 ? -40.031 47.784  39.069 1.00 63.43  ? 721 LYS D CG    1 
ATOM   6223 C  CD    . LYS D 4 721 ? -38.599 48.178  39.418 1.00 64.71  ? 721 LYS D CD    1 
ATOM   6224 C  CE    . LYS D 4 721 ? -38.462 49.703  39.439 1.00 65.58  ? 721 LYS D CE    1 
ATOM   6225 N  NZ    . LYS D 4 721 ? -38.982 50.303  38.173 1.00 64.51  ? 721 LYS D NZ    1 
ATOM   6226 N  N     . ARG D 4 722 ? -41.427 43.553  37.801 1.00 53.00  ? 722 ARG D N     1 
ATOM   6227 C  CA    . ARG D 4 722 ? -41.530 42.111  37.935 1.00 54.36  ? 722 ARG D CA    1 
ATOM   6228 C  C     . ARG D 4 722 ? -41.026 41.748  39.327 1.00 56.74  ? 722 ARG D C     1 
ATOM   6229 O  O     . ARG D 4 722 ? -40.106 42.387  39.838 1.00 58.31  ? 722 ARG D O     1 
ATOM   6230 C  CB    . ARG D 4 722 ? -40.693 41.419  36.864 1.00 52.22  ? 722 ARG D CB    1 
ATOM   6231 C  CG    . ARG D 4 722 ? -41.188 41.677  35.448 1.00 52.45  ? 722 ARG D CG    1 
ATOM   6232 C  CD    . ARG D 4 722 ? -40.391 40.890  34.413 1.00 53.09  ? 722 ARG D CD    1 
ATOM   6233 N  NE    . ARG D 4 722 ? -40.904 41.077  33.055 1.00 54.00  ? 722 ARG D NE    1 
ATOM   6234 C  CZ    . ARG D 4 722 ? -42.057 40.584  32.610 1.00 54.72  ? 722 ARG D CZ    1 
ATOM   6235 N  NH1   . ARG D 4 722 ? -42.834 39.867  33.410 1.00 56.16  ? 722 ARG D NH1   1 
ATOM   6236 N  NH2   . ARG D 4 722 ? -42.433 40.802  31.358 1.00 54.16  ? 722 ARG D NH2   1 
ATOM   6237 N  N     . CYS D 4 723 ? -41.637 40.743  39.952 1.00 57.58  ? 723 CYS D N     1 
ATOM   6238 C  CA    . CYS D 4 723 ? -41.245 40.346  41.299 1.00 58.82  ? 723 CYS D CA    1 
ATOM   6239 C  C     . CYS D 4 723 ? -40.987 38.870  41.428 1.00 58.03  ? 723 CYS D C     1 
ATOM   6240 O  O     . CYS D 4 723 ? -41.495 38.071  40.656 1.00 59.05  ? 723 CYS D O     1 
ATOM   6241 C  CB    . CYS D 4 723 ? -42.322 40.738  42.306 1.00 61.05  ? 723 CYS D CB    1 
ATOM   6242 S  SG    . CYS D 4 723 ? -42.500 42.505  42.548 1.00 69.42  ? 723 CYS D SG    1 
ATOM   6243 N  N     . ALA D 4 724 ? -40.200 38.514  42.432 1.00 58.41  ? 724 ALA D N     1 
ATOM   6244 C  CA    . ALA D 4 724 ? -39.858 37.124  42.684 1.00 58.27  ? 724 ALA D CA    1 
ATOM   6245 C  C     . ALA D 4 724 ? -40.824 36.527  43.689 1.00 57.52  ? 724 ALA D C     1 
ATOM   6246 O  O     . ALA D 4 724 ? -41.125 37.156  44.699 1.00 60.24  ? 724 ALA D O     1 
ATOM   6247 C  CB    . ALA D 4 724 ? -38.445 37.036  43.218 1.00 58.25  ? 724 ALA D CB    1 
ATOM   6248 N  N     . VAL D 4 725 ? -41.314 35.321  43.411 1.00 56.14  ? 725 VAL D N     1 
ATOM   6249 C  CA    . VAL D 4 725 ? -42.231 34.630  44.316 1.00 52.44  ? 725 VAL D CA    1 
ATOM   6250 C  C     . VAL D 4 725 ? -41.448 34.238  45.558 1.00 51.46  ? 725 VAL D C     1 
ATOM   6251 O  O     . VAL D 4 725 ? -40.381 33.647  45.462 1.00 52.27  ? 725 VAL D O     1 
ATOM   6252 C  CB    . VAL D 4 725 ? -42.758 33.338  43.714 1.00 51.95  ? 725 VAL D CB    1 
ATOM   6253 C  CG1   . VAL D 4 725 ? -43.805 32.778  44.611 1.00 54.38  ? 725 VAL D CG1   1 
ATOM   6254 C  CG2   . VAL D 4 725 ? -43.313 33.576  42.333 1.00 54.30  ? 725 VAL D CG2   1 
ATOM   6255 N  N     . HIS D 4 726 ? -41.977 34.546  46.727 1.00 50.28  ? 726 HIS D N     1 
ATOM   6256 C  CA    . HIS D 4 726 ? -41.275 34.212  47.952 1.00 47.75  ? 726 HIS D CA    1 
ATOM   6257 C  C     . HIS D 4 726 ? -42.209 33.581  48.990 1.00 45.91  ? 726 HIS D C     1 
ATOM   6258 O  O     . HIS D 4 726 ? -43.381 33.947  49.088 1.00 47.16  ? 726 HIS D O     1 
ATOM   6259 C  CB    . HIS D 4 726 ? -40.632 35.473  48.508 1.00 49.02  ? 726 HIS D CB    1 
ATOM   6260 C  CG    . HIS D 4 726 ? -40.024 35.289  49.856 1.00 52.58  ? 726 HIS D CG    1 
ATOM   6261 N  ND1   . HIS D 4 726 ? -40.374 36.065  50.938 1.00 52.79  ? 726 HIS D ND1   1 
ATOM   6262 C  CD2   . HIS D 4 726 ? -39.119 34.389  50.311 1.00 55.00  ? 726 HIS D CD2   1 
ATOM   6263 C  CE1   . HIS D 4 726 ? -39.714 35.647  52.005 1.00 56.13  ? 726 HIS D CE1   1 
ATOM   6264 N  NE2   . HIS D 4 726 ? -38.945 34.631  51.652 1.00 56.18  ? 726 HIS D NE2   1 
ATOM   6265 N  N     . TRP D 4 727 ? -41.687 32.623  49.749 1.00 42.21  ? 727 TRP D N     1 
ATOM   6266 C  CA    . TRP D 4 727 ? -42.463 31.955  50.777 1.00 39.28  ? 727 TRP D CA    1 
ATOM   6267 C  C     . TRP D 4 727 ? -41.574 31.288  51.811 1.00 38.96  ? 727 TRP D C     1 
ATOM   6268 O  O     . TRP D 4 727 ? -40.391 31.054  51.563 1.00 39.93  ? 727 TRP D O     1 
ATOM   6269 C  CB    . TRP D 4 727 ? -43.395 30.924  50.153 1.00 37.53  ? 727 TRP D CB    1 
ATOM   6270 C  CG    . TRP D 4 727 ? -42.735 29.680  49.601 1.00 38.51  ? 727 TRP D CG    1 
ATOM   6271 C  CD1   . TRP D 4 727 ? -42.581 28.478  50.236 1.00 38.06  ? 727 TRP D CD1   1 
ATOM   6272 C  CD2   . TRP D 4 727 ? -42.239 29.487  48.269 1.00 37.64  ? 727 TRP D CD2   1 
ATOM   6273 N  NE1   . TRP D 4 727 ? -42.036 27.551  49.382 1.00 35.42  ? 727 TRP D NE1   1 
ATOM   6274 C  CE2   . TRP D 4 727 ? -41.816 28.141  48.170 1.00 34.67  ? 727 TRP D CE2   1 
ATOM   6275 C  CE3   . TRP D 4 727 ? -42.114 30.320  47.150 1.00 35.90  ? 727 TRP D CE3   1 
ATOM   6276 C  CZ2   . TRP D 4 727 ? -41.282 27.612  47.004 1.00 35.88  ? 727 TRP D CZ2   1 
ATOM   6277 C  CZ3   . TRP D 4 727 ? -41.578 29.793  45.990 1.00 35.78  ? 727 TRP D CZ3   1 
ATOM   6278 C  CH2   . TRP D 4 727 ? -41.169 28.453  45.924 1.00 36.99  ? 727 TRP D CH2   1 
ATOM   6279 N  N     . VAL D 4 728 ? -42.151 30.989  52.974 1.00 36.49  ? 728 VAL D N     1 
ATOM   6280 C  CA    . VAL D 4 728 ? -41.426 30.344  54.057 1.00 33.90  ? 728 VAL D CA    1 
ATOM   6281 C  C     . VAL D 4 728 ? -42.032 28.973  54.336 1.00 34.84  ? 728 VAL D C     1 
ATOM   6282 O  O     . VAL D 4 728 ? -43.244 28.852  54.458 1.00 36.96  ? 728 VAL D O     1 
ATOM   6283 C  CB    . VAL D 4 728 ? -41.516 31.168  55.322 1.00 31.38  ? 728 VAL D CB    1 
ATOM   6284 C  CG1   . VAL D 4 728 ? -40.604 30.601  56.372 1.00 32.40  ? 728 VAL D CG1   1 
ATOM   6285 C  CG2   . VAL D 4 728 ? -41.160 32.592  55.023 1.00 30.32  ? 728 VAL D CG2   1 
ATOM   6286 N  N     . THR D 4 729 ? -41.209 27.930  54.415 1.00 35.58  ? 729 THR D N     1 
ATOM   6287 C  CA    . THR D 4 729 ? -41.759 26.604  54.694 1.00 35.49  ? 729 THR D CA    1 
ATOM   6288 C  C     . THR D 4 729 ? -42.177 26.543  56.152 1.00 35.19  ? 729 THR D C     1 
ATOM   6289 O  O     . THR D 4 729 ? -41.735 27.349  56.964 1.00 33.88  ? 729 THR D O     1 
ATOM   6290 C  CB    . THR D 4 729 ? -40.761 25.489  54.412 1.00 34.73  ? 729 THR D CB    1 
ATOM   6291 O  OG1   . THR D 4 729 ? -39.582 25.689  55.201 1.00 34.74  ? 729 THR D OG1   1 
ATOM   6292 C  CG2   . THR D 4 729 ? -40.423 25.458  52.936 1.00 33.53  ? 729 THR D CG2   1 
ATOM   6293 N  N     . PRO D 4 730 ? -43.048 25.594  56.500 1.00 36.01  ? 730 PRO D N     1 
ATOM   6294 C  CA    . PRO D 4 730 ? -43.505 25.485  57.886 1.00 37.15  ? 730 PRO D CA    1 
ATOM   6295 C  C     . PRO D 4 730 ? -42.410 25.394  58.953 1.00 39.87  ? 730 PRO D C     1 
ATOM   6296 O  O     . PRO D 4 730 ? -42.613 25.839  60.081 1.00 41.57  ? 730 PRO D O     1 
ATOM   6297 C  CB    . PRO D 4 730 ? -44.418 24.265  57.848 1.00 38.34  ? 730 PRO D CB    1 
ATOM   6298 C  CG    . PRO D 4 730 ? -45.012 24.334  56.444 1.00 37.38  ? 730 PRO D CG    1 
ATOM   6299 C  CD    . PRO D 4 730 ? -43.781 24.668  55.615 1.00 36.93  ? 730 PRO D CD    1 
ATOM   6300 N  N     . ASP D 4 731 ? -41.248 24.841  58.624 1.00 40.94  ? 731 ASP D N     1 
ATOM   6301 C  CA    . ASP D 4 731 ? -40.191 24.769  59.629 1.00 41.84  ? 731 ASP D CA    1 
ATOM   6302 C  C     . ASP D 4 731 ? -39.284 26.002  59.610 1.00 43.30  ? 731 ASP D C     1 
ATOM   6303 O  O     . ASP D 4 731 ? -38.188 26.003  60.196 1.00 45.58  ? 731 ASP D O     1 
ATOM   6304 C  CB    . ASP D 4 731 ? -39.350 23.515  59.442 1.00 43.19  ? 731 ASP D CB    1 
ATOM   6305 C  CG    . ASP D 4 731 ? -38.516 23.568  58.204 1.00 44.72  ? 731 ASP D CG    1 
ATOM   6306 O  OD1   . ASP D 4 731 ? -37.772 22.600  57.954 1.00 46.44  ? 731 ASP D OD1   1 
ATOM   6307 O  OD2   . ASP D 4 731 ? -38.605 24.579  57.478 1.00 46.52  ? 731 ASP D OD2   1 
ATOM   6308 N  N     . GLY D 4 732 ? -39.732 27.044  58.914 1.00 42.88  ? 732 GLY D N     1 
ATOM   6309 C  CA    . GLY D 4 732 ? -38.984 28.286  58.868 1.00 40.67  ? 732 GLY D CA    1 
ATOM   6310 C  C     . GLY D 4 732 ? -37.933 28.458  57.799 1.00 40.26  ? 732 GLY D C     1 
ATOM   6311 O  O     . GLY D 4 732 ? -37.055 29.318  57.929 1.00 41.24  ? 732 GLY D O     1 
ATOM   6312 N  N     . PHE D 4 733 ? -37.993 27.649  56.753 1.00 39.02  ? 733 PHE D N     1 
ATOM   6313 C  CA    . PHE D 4 733 ? -37.023 27.779  55.677 1.00 38.52  ? 733 PHE D CA    1 
ATOM   6314 C  C     . PHE D 4 733 ? -37.624 28.701  54.621 1.00 39.73  ? 733 PHE D C     1 
ATOM   6315 O  O     . PHE D 4 733 ? -38.675 28.400  54.047 1.00 40.53  ? 733 PHE D O     1 
ATOM   6316 C  CB    . PHE D 4 733 ? -36.702 26.420  55.041 1.00 33.59  ? 733 PHE D CB    1 
ATOM   6317 C  CG    . PHE D 4 733 ? -35.658 26.494  53.969 1.00 31.62  ? 733 PHE D CG    1 
ATOM   6318 C  CD1   . PHE D 4 733 ? -34.322 26.690  54.293 1.00 32.37  ? 733 PHE D CD1   1 
ATOM   6319 C  CD2   . PHE D 4 733 ? -36.004 26.401  52.637 1.00 31.89  ? 733 PHE D CD2   1 
ATOM   6320 C  CE1   . PHE D 4 733 ? -33.344 26.793  53.298 1.00 32.61  ? 733 PHE D CE1   1 
ATOM   6321 C  CE2   . PHE D 4 733 ? -35.028 26.506  51.628 1.00 32.55  ? 733 PHE D CE2   1 
ATOM   6322 C  CZ    . PHE D 4 733 ? -33.698 26.703  51.963 1.00 30.22  ? 733 PHE D CZ    1 
ATOM   6323 N  N     . PRO D 4 734 ? -36.971 29.845  54.358 1.00 40.59  ? 734 PRO D N     1 
ATOM   6324 C  CA    . PRO D 4 734 ? -37.458 30.802  53.358 1.00 38.84  ? 734 PRO D CA    1 
ATOM   6325 C  C     . PRO D 4 734 ? -36.934 30.394  51.983 1.00 37.29  ? 734 PRO D C     1 
ATOM   6326 O  O     . PRO D 4 734 ? -35.772 30.020  51.838 1.00 37.78  ? 734 PRO D O     1 
ATOM   6327 C  CB    . PRO D 4 734 ? -36.874 32.116  53.842 1.00 39.90  ? 734 PRO D CB    1 
ATOM   6328 C  CG    . PRO D 4 734 ? -35.516 31.688  54.325 1.00 41.42  ? 734 PRO D CG    1 
ATOM   6329 C  CD    . PRO D 4 734 ? -35.787 30.376  55.060 1.00 40.87  ? 734 PRO D CD    1 
ATOM   6330 N  N     . VAL D 4 735 ? -37.807 30.453  50.991 1.00 35.15  ? 735 VAL D N     1 
ATOM   6331 C  CA    . VAL D 4 735 ? -37.476 30.081  49.628 1.00 35.34  ? 735 VAL D CA    1 
ATOM   6332 C  C     . VAL D 4 735 ? -37.743 31.287  48.720 1.00 38.47  ? 735 VAL D C     1 
ATOM   6333 O  O     . VAL D 4 735 ? -38.819 31.878  48.794 1.00 40.15  ? 735 VAL D O     1 
ATOM   6334 C  CB    . VAL D 4 735 ? -38.380 28.899  49.165 1.00 33.22  ? 735 VAL D CB    1 
ATOM   6335 C  CG1   . VAL D 4 735 ? -38.052 28.493  47.749 1.00 31.30  ? 735 VAL D CG1   1 
ATOM   6336 C  CG2   . VAL D 4 735 ? -38.227 27.731  50.103 1.00 29.17  ? 735 VAL D CG2   1 
ATOM   6337 N  N     . TRP D 4 736 ? -36.768 31.670  47.892 1.00 39.10  ? 736 TRP D N     1 
ATOM   6338 C  CA    . TRP D 4 736 ? -36.941 32.791  46.954 1.00 39.03  ? 736 TRP D CA    1 
ATOM   6339 C  C     . TRP D 4 736 ? -36.871 32.271  45.534 1.00 39.98  ? 736 TRP D C     1 
ATOM   6340 O  O     . TRP D 4 736 ? -35.793 31.912  45.051 1.00 41.19  ? 736 TRP D O     1 
ATOM   6341 C  CB    . TRP D 4 736 ? -35.852 33.854  47.116 1.00 38.28  ? 736 TRP D CB    1 
ATOM   6342 C  CG    . TRP D 4 736 ? -36.079 34.767  48.254 1.00 41.42  ? 736 TRP D CG    1 
ATOM   6343 C  CD1   . TRP D 4 736 ? -36.822 35.921  48.259 1.00 39.60  ? 736 TRP D CD1   1 
ATOM   6344 C  CD2   . TRP D 4 736 ? -35.620 34.578  49.598 1.00 41.98  ? 736 TRP D CD2   1 
ATOM   6345 N  NE1   . TRP D 4 736 ? -36.854 36.455  49.530 1.00 38.90  ? 736 TRP D NE1   1 
ATOM   6346 C  CE2   . TRP D 4 736 ? -36.124 35.654  50.369 1.00 40.35  ? 736 TRP D CE2   1 
ATOM   6347 C  CE3   . TRP D 4 736 ? -34.831 33.603  50.226 1.00 42.01  ? 736 TRP D CE3   1 
ATOM   6348 C  CZ2   . TRP D 4 736 ? -35.864 35.780  51.731 1.00 40.38  ? 736 TRP D CZ2   1 
ATOM   6349 C  CZ3   . TRP D 4 736 ? -34.570 33.730  51.586 1.00 42.93  ? 736 TRP D CZ3   1 
ATOM   6350 C  CH2   . TRP D 4 736 ? -35.086 34.814  52.322 1.00 43.29  ? 736 TRP D CH2   1 
ATOM   6351 N  N     . GLN D 4 737 ? -38.007 32.221  44.856 1.00 39.60  ? 737 GLN D N     1 
ATOM   6352 C  CA    . GLN D 4 737 ? -37.984 31.757  43.492 1.00 41.93  ? 737 GLN D CA    1 
ATOM   6353 C  C     . GLN D 4 737 ? -37.871 32.924  42.525 1.00 44.39  ? 737 GLN D C     1 
ATOM   6354 O  O     . GLN D 4 737 ? -38.820 33.692  42.339 1.00 44.94  ? 737 GLN D O     1 
ATOM   6355 C  CB    . GLN D 4 737 ? -39.231 30.968  43.148 1.00 41.12  ? 737 GLN D CB    1 
ATOM   6356 C  CG    . GLN D 4 737 ? -39.114 30.350  41.783 1.00 41.66  ? 737 GLN D CG    1 
ATOM   6357 C  CD    . GLN D 4 737 ? -40.434 29.866  41.259 1.00 45.68  ? 737 GLN D CD    1 
ATOM   6358 O  OE1   . GLN D 4 737 ? -41.341 30.661  41.012 1.00 46.93  ? 737 GLN D OE1   1 
ATOM   6359 N  NE2   . GLN D 4 737 ? -40.558 28.553  41.081 1.00 46.76  ? 737 GLN D NE2   1 
ATOM   6360 N  N     . GLU D 4 738 ? -36.708 33.074  41.912 1.00 45.84  ? 738 GLU D N     1 
ATOM   6361 C  CA    . GLU D 4 738 ? -36.568 34.139  40.952 1.00 47.81  ? 738 GLU D CA    1 
ATOM   6362 C  C     . GLU D 4 738 ? -35.647 33.733  39.839 1.00 46.14  ? 738 GLU D C     1 
ATOM   6363 O  O     . GLU D 4 738 ? -34.444 33.957  39.873 1.00 45.79  ? 738 GLU D O     1 
ATOM   6364 C  CB    . GLU D 4 738 ? -36.115 35.452  41.612 1.00 52.11  ? 738 GLU D CB    1 
ATOM   6365 C  CG    . GLU D 4 738 ? -34.692 35.521  42.119 1.00 59.43  ? 738 GLU D CG    1 
ATOM   6366 C  CD    . GLU D 4 738 ? -34.420 36.821  42.873 1.00 65.10  ? 738 GLU D CD    1 
ATOM   6367 O  OE1   . GLU D 4 738 ? -34.610 37.920  42.283 1.00 65.49  ? 738 GLU D OE1   1 
ATOM   6368 O  OE2   . GLU D 4 738 ? -34.020 36.738  44.062 1.00 67.93  ? 738 GLU D OE2   1 
ATOM   6369 N  N     . TYR D 4 739 ? -36.251 33.080  38.864 1.00 45.04  ? 739 TYR D N     1 
ATOM   6370 C  CA    . TYR D 4 739 ? -35.566 32.651  37.679 1.00 46.44  ? 739 TYR D CA    1 
ATOM   6371 C  C     . TYR D 4 739 ? -35.285 33.942  36.917 1.00 50.98  ? 739 TYR D C     1 
ATOM   6372 O  O     . TYR D 4 739 ? -36.001 34.936  37.075 1.00 50.99  ? 739 TYR D O     1 
ATOM   6373 C  CB    . TYR D 4 739 ? -36.493 31.749  36.868 1.00 43.88  ? 739 TYR D CB    1 
ATOM   6374 C  CG    . TYR D 4 739 ? -36.718 30.388  37.493 1.00 41.85  ? 739 TYR D CG    1 
ATOM   6375 C  CD1   . TYR D 4 739 ? -35.755 29.380  37.374 1.00 41.20  ? 739 TYR D CD1   1 
ATOM   6376 C  CD2   . TYR D 4 739 ? -37.871 30.114  38.213 1.00 38.34  ? 739 TYR D CD2   1 
ATOM   6377 C  CE1   . TYR D 4 739 ? -35.934 28.152  37.947 1.00 39.54  ? 739 TYR D CE1   1 
ATOM   6378 C  CE2   . TYR D 4 739 ? -38.060 28.883  38.795 1.00 40.71  ? 739 TYR D CE2   1 
ATOM   6379 C  CZ    . TYR D 4 739 ? -37.085 27.898  38.659 1.00 40.46  ? 739 TYR D CZ    1 
ATOM   6380 O  OH    . TYR D 4 739 ? -37.258 26.663  39.240 1.00 39.25  ? 739 TYR D OH    1 
ATOM   6381 N  N     . LYS D 4 740 ? -34.237 33.950  36.105 1.00 55.20  ? 740 LYS D N     1 
ATOM   6382 C  CA    . LYS D 4 740 ? -33.932 35.145  35.346 1.00 58.46  ? 740 LYS D CA    1 
ATOM   6383 C  C     . LYS D 4 740 ? -33.528 34.840  33.920 1.00 61.33  ? 740 LYS D C     1 
ATOM   6384 O  O     . LYS D 4 740 ? -32.708 33.960  33.669 1.00 60.68  ? 740 LYS D O     1 
ATOM   6385 C  CB    . LYS D 4 740 ? -32.861 35.964  36.063 1.00 56.84  ? 740 LYS D CB    1 
ATOM   6386 C  CG    . LYS D 4 740 ? -33.417 36.647  37.297 1.00 58.90  ? 740 LYS D CG    1 
ATOM   6387 C  CD    . LYS D 4 740 ? -32.412 37.543  37.991 1.00 60.18  ? 740 LYS D CD    1 
ATOM   6388 C  CE    . LYS D 4 740 ? -33.045 38.186  39.217 1.00 60.96  ? 740 LYS D CE    1 
ATOM   6389 N  NZ    . LYS D 4 740 ? -32.136 39.172  39.869 1.00 61.92  ? 740 LYS D NZ    1 
ATOM   6390 N  N     . LYS D 4 741 ? -34.155 35.556  32.990 1.00 66.32  ? 741 LYS D N     1 
ATOM   6391 C  CA    . LYS D 4 741 ? -33.875 35.409  31.568 1.00 70.44  ? 741 LYS D CA    1 
ATOM   6392 C  C     . LYS D 4 741 ? -32.421 35.799  31.421 1.00 73.56  ? 741 LYS D C     1 
ATOM   6393 O  O     . LYS D 4 741 ? -31.987 36.814  31.963 1.00 73.68  ? 741 LYS D O     1 
ATOM   6394 C  CB    . LYS D 4 741 ? -34.767 36.347  30.743 1.00 70.53  ? 741 LYS D CB    1 
ATOM   6395 C  CG    . LYS D 4 741 ? -36.063 35.711  30.246 1.00 71.23  ? 741 LYS D CG    1 
ATOM   6396 C  CD    . LYS D 4 741 ? -36.985 36.747  29.615 1.00 73.44  ? 741 LYS D CD    1 
ATOM   6397 C  CE    . LYS D 4 741 ? -38.122 36.105  28.809 1.00 74.62  ? 741 LYS D CE    1 
ATOM   6398 N  NZ    . LYS D 4 741 ? -39.028 35.216  29.600 1.00 75.20  ? 741 LYS D NZ    1 
ATOM   6399 N  N     . PRO D 4 742 ? -31.644 34.992  30.692 1.00 76.69  ? 742 PRO D N     1 
ATOM   6400 C  CA    . PRO D 4 742 ? -30.221 35.256  30.484 1.00 79.12  ? 742 PRO D CA    1 
ATOM   6401 C  C     . PRO D 4 742 ? -29.896 36.713  30.211 1.00 81.75  ? 742 PRO D C     1 
ATOM   6402 O  O     . PRO D 4 742 ? -30.654 37.423  29.546 1.00 81.30  ? 742 PRO D O     1 
ATOM   6403 C  CB    . PRO D 4 742 ? -29.875 34.350  29.311 1.00 79.42  ? 742 PRO D CB    1 
ATOM   6404 C  CG    . PRO D 4 742 ? -30.756 33.163  29.554 1.00 79.79  ? 742 PRO D CG    1 
ATOM   6405 C  CD    . PRO D 4 742 ? -32.082 33.827  29.904 1.00 78.11  ? 742 PRO D CD    1 
ATOM   6406 N  N     . ILE D 4 743 ? -28.762 37.145  30.748 1.00 85.49  ? 743 ILE D N     1 
ATOM   6407 C  CA    . ILE D 4 743 ? -28.277 38.509  30.583 1.00 89.43  ? 743 ILE D CA    1 
ATOM   6408 C  C     . ILE D 4 743 ? -27.760 38.738  29.154 1.00 92.40  ? 743 ILE D C     1 
ATOM   6409 O  O     . ILE D 4 743 ? -28.346 39.504  28.383 1.00 92.00  ? 743 ILE D O     1 
ATOM   6410 C  CB    . ILE D 4 743 ? -27.146 38.814  31.604 1.00 88.89  ? 743 ILE D CB    1 
ATOM   6411 C  CG1   . ILE D 4 743 ? -26.616 37.512  32.234 1.00 88.26  ? 743 ILE D CG1   1 
ATOM   6412 C  CG2   . ILE D 4 743 ? -27.673 39.736  32.695 1.00 89.28  ? 743 ILE D CG2   1 
ATOM   6413 C  CD1   . ILE D 4 743 ? -25.914 36.557  31.276 1.00 85.03  ? 743 ILE D CD1   1 
ATOM   6414 N  N     . GLN D 4 744 ? -26.667 38.065  28.807 1.00 96.14  ? 744 GLN D N     1 
ATOM   6415 C  CA    . GLN D 4 744 ? -26.080 38.188  27.476 1.00 99.64  ? 744 GLN D CA    1 
ATOM   6416 C  C     . GLN D 4 744 ? -26.832 37.297  26.490 1.00 91.75  ? 744 GLN D C     1 
ATOM   6417 O  O     . GLN D 4 744 ? -26.607 36.085  26.445 1.00 91.64  ? 744 GLN D O     1 
ATOM   6418 C  CB    . GLN D 4 744 ? -24.599 37.779  27.492 1.00 90.11  ? 744 GLN D CB    1 
ATOM   6419 C  CG    . GLN D 4 744 ? -23.725 38.512  28.513 1.00 90.67  ? 744 GLN D CG    1 
ATOM   6420 C  CD    . GLN D 4 744 ? -22.235 38.229  28.329 1.00 90.64  ? 744 GLN D CD    1 
ATOM   6421 O  OE1   . GLN D 4 744 ? -21.811 37.072  28.260 1.00 99.84  ? 744 GLN D OE1   1 
ATOM   6422 N  NE2   . GLN D 4 744 ? -21.435 39.291  28.254 1.00 90.03  ? 744 GLN D NE2   1 
ATOM   6423 N  N     . THR D 4 745 ? -27.728 37.895  25.709 1.00 94.82  ? 745 THR D N     1 
ATOM   6424 C  CA    . THR D 4 745 ? -28.493 37.139  24.721 1.00 97.59  ? 745 THR D CA    1 
ATOM   6425 C  C     . THR D 4 745 ? -27.489 36.483  23.773 1.00 99.23  ? 745 THR D C     1 
ATOM   6426 O  O     . THR D 4 745 ? -26.935 37.133  22.887 1.00 99.75  ? 745 THR D O     1 
ATOM   6427 C  CB    . THR D 4 745 ? -29.447 38.060  23.917 1.00 97.71  ? 745 THR D CB    1 
ATOM   6428 O  OG1   . THR D 4 745 ? -30.298 38.778  24.822 1.00 97.44  ? 745 THR D OG1   1 
ATOM   6429 C  CG2   . THR D 4 745 ? -30.313 37.235  22.968 1.00 97.39  ? 745 THR D CG2   1 
ATOM   6430 N  N     . ARG D 4 746 ? -27.253 35.192  23.978 1.00 90.90  ? 746 ARG D N     1 
ATOM   6431 C  CA    . ARG D 4 746 ? -26.300 34.442  23.172 1.00 92.54  ? 746 ARG D CA    1 
ATOM   6432 C  C     . ARG D 4 746 ? -26.760 34.136  21.759 1.00 93.60  ? 746 ARG D C     1 
ATOM   6433 O  O     . ARG D 4 746 ? -27.953 34.015  21.487 1.00 93.46  ? 746 ARG D O     1 
ATOM   6434 C  CB    . ARG D 4 746 ? -25.938 33.133  23.876 1.00 92.99  ? 746 ARG D CB    1 
ATOM   6435 C  CG    . ARG D 4 746 ? -27.138 32.334  24.349 1.00 93.51  ? 746 ARG D CG    1 
ATOM   6436 C  CD    . ARG D 4 746 ? -26.711 31.103  25.129 1.00 93.88  ? 746 ARG D CD    1 
ATOM   6437 N  NE    . ARG D 4 746 ? -27.818 30.538  25.895 1.00 94.36  ? 746 ARG D NE    1 
ATOM   6438 C  CZ    . ARG D 4 746 ? -28.417 31.161  26.905 1.00 94.75  ? 746 ARG D CZ    1 
ATOM   6439 N  NH1   . ARG D 4 746 ? -28.011 32.370  27.272 1.00 94.95  ? 746 ARG D NH1   1 
ATOM   6440 N  NH2   . ARG D 4 746 ? -29.423 30.578  27.546 1.00 94.45  ? 746 ARG D NH2   1 
ATOM   6441 N  N     . LEU D 4 747 ? -25.782 34.016  20.867 1.00 95.55  ? 747 LEU D N     1 
ATOM   6442 C  CA    . LEU D 4 747 ? -26.020 33.700  19.466 1.00 97.19  ? 747 LEU D CA    1 
ATOM   6443 C  C     . LEU D 4 747 ? -25.418 32.325  19.200 1.00 98.19  ? 747 LEU D C     1 
ATOM   6444 O  O     . LEU D 4 747 ? -24.237 32.091  19.460 1.00 97.74  ? 747 LEU D O     1 
ATOM   6445 C  CB    . LEU D 4 747 ? -25.374 34.750  18.557 1.00 97.08  ? 747 LEU D CB    1 
ATOM   6446 C  CG    . LEU D 4 747 ? -23.922 35.154  18.830 1.00 96.95  ? 747 LEU D CG    1 
ATOM   6447 C  CD1   . LEU D 4 747 ? -23.380 35.928  17.634 1.00 97.14  ? 747 LEU D CD1   1 
ATOM   6448 C  CD2   . LEU D 4 747 ? -23.843 35.993  20.101 1.00 96.67  ? 747 LEU D CD2   1 
ATOM   6449 N  N     . ASN D 4 748 ? -26.240 31.418  18.686 1.00 99.71  ? 748 ASN D N     1 
ATOM   6450 C  CA    . ASN D 4 748 ? -25.804 30.055  18.413 1.00 91.37  ? 748 ASN D CA    1 
ATOM   6451 C  C     . ASN D 4 748 ? -25.261 29.882  16.995 1.00 92.08  ? 748 ASN D C     1 
ATOM   6452 O  O     . ASN D 4 748 ? -26.023 29.853  16.030 1.00 92.80  ? 748 ASN D O     1 
ATOM   6453 C  CB    . ASN D 4 748 ? -26.973 29.090  18.642 1.00 91.79  ? 748 ASN D CB    1 
ATOM   6454 C  CG    . ASN D 4 748 ? -26.520 27.655  18.841 1.00 92.40  ? 748 ASN D CG    1 
ATOM   6455 O  OD1   . ASN D 4 748 ? -25.774 27.107  18.029 1.00 93.02  ? 748 ASN D OD1   1 
ATOM   6456 N  ND2   . ASN D 4 748 ? -26.976 27.037  19.925 1.00 92.42  ? 748 ASN D ND2   1 
ATOM   6457 N  N     . LEU D 4 749 ? -23.942 29.770  16.875 1.00 92.61  ? 749 LEU D N     1 
ATOM   6458 C  CA    . LEU D 4 749 ? -23.305 29.581  15.578 1.00 93.08  ? 749 LEU D CA    1 
ATOM   6459 C  C     . LEU D 4 749 ? -22.991 28.101  15.399 1.00 93.70  ? 749 LEU D C     1 
ATOM   6460 O  O     . LEU D 4 749 ? -21.995 27.607  15.924 1.00 93.88  ? 749 LEU D O     1 
ATOM   6461 C  CB    . LEU D 4 749 ? -22.007 30.390  15.490 1.00 93.38  ? 749 LEU D CB    1 
ATOM   6462 C  CG    . LEU D 4 749 ? -22.072 31.920  15.526 1.00 93.89  ? 749 LEU D CG    1 
ATOM   6463 C  CD1   . LEU D 4 749 ? -20.664 32.485  15.383 1.00 93.52  ? 749 LEU D CD1   1 
ATOM   6464 C  CD2   . LEU D 4 749 ? -22.963 32.434  14.404 1.00 94.25  ? 749 LEU D CD2   1 
ATOM   6465 N  N     . MET D 4 750 ? -23.848 27.398  14.666 1.00 94.72  ? 750 MET D N     1 
ATOM   6466 C  CA    . MET D 4 750 ? -23.666 25.972  14.419 1.00 95.70  ? 750 MET D CA    1 
ATOM   6467 C  C     . MET D 4 750 ? -22.199 25.637  14.172 1.00 96.13  ? 750 MET D C     1 
ATOM   6468 O  O     . MET D 4 750 ? -21.449 26.456  13.647 1.00 96.26  ? 750 MET D O     1 
ATOM   6469 C  CB    . MET D 4 750 ? -24.517 25.527  13.223 1.00 96.35  ? 750 MET D CB    1 
ATOM   6470 C  CG    . MET D 4 750 ? -24.279 26.312  11.938 1.00 97.17  ? 750 MET D CG    1 
ATOM   6471 S  SD    . MET D 4 750 ? -24.706 28.063  12.069 1.00 98.08  ? 750 MET D SD    1 
ATOM   6472 C  CE    . MET D 4 750 ? -26.498 27.994  11.865 1.00 98.21  ? 750 MET D CE    1 
ATOM   6473 N  N     . PHE D 4 751 ? -21.804 24.429  14.560 1.00 96.50  ? 751 PHE D N     1 
ATOM   6474 C  CA    . PHE D 4 751 ? -20.430 23.953  14.420 1.00 96.97  ? 751 PHE D CA    1 
ATOM   6475 C  C     . PHE D 4 751 ? -19.570 24.400  15.597 1.00 97.49  ? 751 PHE D C     1 
ATOM   6476 O  O     . PHE D 4 751 ? -19.581 23.761  16.648 1.00 98.09  ? 751 PHE D O     1 
ATOM   6477 C  CB    . PHE D 4 751 ? -19.793 24.435  13.109 1.00 96.77  ? 751 PHE D CB    1 
ATOM   6478 C  CG    . PHE D 4 751 ? -20.437 23.874  11.873 1.00 96.64  ? 751 PHE D CG    1 
ATOM   6479 C  CD1   . PHE D 4 751 ? -21.194 22.707  11.929 1.00 96.70  ? 751 PHE D CD1   1 
ATOM   6480 C  CD2   . PHE D 4 751 ? -20.261 24.496  10.644 1.00 96.91  ? 751 PHE D CD2   1 
ATOM   6481 C  CE1   . PHE D 4 751 ? -21.764 22.169  10.778 1.00 96.81  ? 751 PHE D CE1   1 
ATOM   6482 C  CE2   . PHE D 4 751 ? -20.826 23.966  9.486  1.00 97.09  ? 751 PHE D CE2   1 
ATOM   6483 C  CZ    . PHE D 4 751 ? -21.580 22.801  9.554  1.00 97.02  ? 751 PHE D CZ    1 
ATOM   6484 N  N     . LEU D 4 752 ? -18.833 25.496  15.428 1.00 97.79  ? 752 LEU D N     1 
ATOM   6485 C  CA    . LEU D 4 752 ? -17.961 26.004  16.487 1.00 97.91  ? 752 LEU D CA    1 
ATOM   6486 C  C     . LEU D 4 752 ? -18.616 26.042  17.864 1.00 97.60  ? 752 LEU D C     1 
ATOM   6487 O  O     . LEU D 4 752 ? -17.927 25.994  18.882 1.00 97.28  ? 752 LEU D O     1 
ATOM   6488 C  CB    . LEU D 4 752 ? -17.438 27.399  16.137 1.00 98.45  ? 752 LEU D CB    1 
ATOM   6489 C  CG    . LEU D 4 752 ? -16.440 27.476  14.980 1.00 98.77  ? 752 LEU D CG    1 
ATOM   6490 C  CD1   . LEU D 4 752 ? -17.153 27.228  13.657 1.00 99.48  ? 752 LEU D CD1   1 
ATOM   6491 C  CD2   . LEU D 4 752 ? -15.783 28.840  14.979 1.00 98.79  ? 752 LEU D CD2   1 
ATOM   6492 N  N     . GLY D 4 753 ? -19.941 26.139  17.899 1.00 97.34  ? 753 GLY D N     1 
ATOM   6493 C  CA    . GLY D 4 753 ? -20.626 26.157  19.177 1.00 97.35  ? 753 GLY D CA    1 
ATOM   6494 C  C     . GLY D 4 753 ? -21.446 27.395  19.475 1.00 97.38  ? 753 GLY D C     1 
ATOM   6495 O  O     . GLY D 4 753 ? -21.927 28.073  18.567 1.00 97.35  ? 753 GLY D O     1 
ATOM   6496 N  N     . GLN D 4 754 ? -21.596 27.690  20.763 1.00 97.29  ? 754 GLN D N     1 
ATOM   6497 C  CA    . GLN D 4 754 ? -22.377 28.834  21.213 1.00 97.11  ? 754 GLN D CA    1 
ATOM   6498 C  C     . GLN D 4 754 ? -21.584 29.757  22.138 1.00 96.80  ? 754 GLN D C     1 
ATOM   6499 O  O     . GLN D 4 754 ? -20.690 29.316  22.863 1.00 96.73  ? 754 GLN D O     1 
ATOM   6500 C  CB    . GLN D 4 754 ? -23.629 28.335  21.937 1.00 97.21  ? 754 GLN D CB    1 
ATOM   6501 C  CG    . GLN D 4 754 ? -24.575 29.425  22.400 1.00 98.15  ? 754 GLN D CG    1 
ATOM   6502 C  CD    . GLN D 4 754 ? -25.775 28.866  23.139 1.00 98.70  ? 754 GLN D CD    1 
ATOM   6503 O  OE1   . GLN D 4 754 ? -25.630 28.222  24.176 1.00 98.88  ? 754 GLN D OE1   1 
ATOM   6504 N  NE2   . GLN D 4 754 ? -26.968 29.109  22.606 1.00 98.84  ? 754 GLN D NE2   1 
ATOM   6505 N  N     . PHE D 4 755 ? -21.921 31.044  22.104 1.00 96.22  ? 755 PHE D N     1 
ATOM   6506 C  CA    . PHE D 4 755 ? -21.260 32.034  22.946 1.00 95.44  ? 755 PHE D CA    1 
ATOM   6507 C  C     . PHE D 4 755 ? -22.181 33.225  23.209 1.00 94.33  ? 755 PHE D C     1 
ATOM   6508 O  O     . PHE D 4 755 ? -23.141 33.455  22.471 1.00 93.91  ? 755 PHE D O     1 
ATOM   6509 C  CB    . PHE D 4 755 ? -19.959 32.514  22.296 1.00 96.29  ? 755 PHE D CB    1 
ATOM   6510 C  CG    . PHE D 4 755 ? -20.155 33.205  20.978 1.00 97.75  ? 755 PHE D CG    1 
ATOM   6511 C  CD1   . PHE D 4 755 ? -20.616 32.502  19.868 1.00 98.35  ? 755 PHE D CD1   1 
ATOM   6512 C  CD2   . PHE D 4 755 ? -19.873 34.563  20.845 1.00 98.25  ? 755 PHE D CD2   1 
ATOM   6513 C  CE1   . PHE D 4 755 ? -20.791 33.141  18.641 1.00 98.94  ? 755 PHE D CE1   1 
ATOM   6514 C  CE2   . PHE D 4 755 ? -20.044 35.214  19.624 1.00 98.66  ? 755 PHE D CE2   1 
ATOM   6515 C  CZ    . PHE D 4 755 ? -20.504 34.502  18.519 1.00 99.22  ? 755 PHE D CZ    1 
ATOM   6516 N  N     . ARG D 4 756 ? -21.876 33.975  24.265 1.00 93.08  ? 756 ARG D N     1 
ATOM   6517 C  CA    . ARG D 4 756 ? -22.666 35.136  24.658 1.00 91.65  ? 756 ARG D CA    1 
ATOM   6518 C  C     . ARG D 4 756 ? -21.972 36.429  24.254 1.00 90.12  ? 756 ARG D C     1 
ATOM   6519 O  O     . ARG D 4 756 ? -20.964 36.407  23.553 1.00 99.69  ? 756 ARG D O     1 
ATOM   6520 C  CB    . ARG D 4 756 ? -22.878 35.122  26.172 1.00 92.76  ? 756 ARG D CB    1 
ATOM   6521 C  CG    . ARG D 4 756 ? -23.431 33.809  26.709 1.00 94.38  ? 756 ARG D CG    1 
ATOM   6522 C  CD    . ARG D 4 756 ? -23.531 33.823  28.232 1.00 96.32  ? 756 ARG D CD    1 
ATOM   6523 N  NE    . ARG D 4 756 ? -22.224 33.907  28.887 1.00 97.69  ? 756 ARG D NE    1 
ATOM   6524 C  CZ    . ARG D 4 756 ? -21.304 32.945  28.864 1.00 98.23  ? 756 ARG D CZ    1 
ATOM   6525 N  NH1   . ARG D 4 756 ? -21.537 31.810  28.217 1.00 98.64  ? 756 ARG D NH1   1 
ATOM   6526 N  NH2   . ARG D 4 756 ? -20.146 33.117  29.491 1.00 97.95  ? 756 ARG D NH2   1 
ATOM   6527 N  N     . LEU D 4 757 ? -22.518 37.556  24.699 1.00 98.71  ? 757 LEU D N     1 
ATOM   6528 C  CA    . LEU D 4 757 ? -21.945 38.859  24.385 1.00 97.66  ? 757 LEU D CA    1 
ATOM   6529 C  C     . LEU D 4 757 ? -22.677 39.950  25.165 1.00 96.86  ? 757 LEU D C     1 
ATOM   6530 O  O     . LEU D 4 757 ? -23.900 39.916  25.288 1.00 96.49  ? 757 LEU D O     1 
ATOM   6531 C  CB    . LEU D 4 757 ? -22.065 39.133  22.884 1.00 97.89  ? 757 LEU D CB    1 
ATOM   6532 C  CG    . LEU D 4 757 ? -21.089 40.119  22.224 1.00 98.17  ? 757 LEU D CG    1 
ATOM   6533 C  CD1   . LEU D 4 757 ? -21.544 40.345  20.790 1.00 97.93  ? 757 LEU D CD1   1 
ATOM   6534 C  CD2   . LEU D 4 757 ? -21.031 41.447  22.972 1.00 98.04  ? 757 LEU D CD2   1 
ATOM   6535 N  N     . GLN D 4 758 ? -21.924 40.911  25.695 1.00 96.14  ? 758 GLN D N     1 
ATOM   6536 C  CA    . GLN D 4 758 ? -22.508 42.016  26.453 1.00 95.32  ? 758 GLN D CA    1 
ATOM   6537 C  C     . GLN D 4 758 ? -23.651 42.622  25.642 1.00 94.57  ? 758 GLN D C     1 
ATOM   6538 O  O     . GLN D 4 758 ? -23.488 42.924  24.461 1.00 94.72  ? 758 GLN D O     1 
ATOM   6539 C  CB    . GLN D 4 758 ? -21.449 43.088  26.726 1.00 95.65  ? 758 GLN D CB    1 
ATOM   6540 C  CG    . GLN D 4 758 ? -21.962 44.296  27.503 1.00 95.81  ? 758 GLN D CG    1 
ATOM   6541 C  CD    . GLN D 4 758 ? -22.157 44.008  28.980 1.00 96.27  ? 758 GLN D CD    1 
ATOM   6542 O  OE1   . GLN D 4 758 ? -22.762 43.005  29.355 1.00 96.11  ? 758 GLN D OE1   1 
ATOM   6543 N  NE2   . GLN D 4 758 ? -21.650 44.897  29.827 1.00 96.15  ? 758 GLN D NE2   1 
ATOM   6544 N  N     . PRO D 4 759 ? -24.824 42.812  26.267 1.00 93.78  ? 759 PRO D N     1 
ATOM   6545 C  CA    . PRO D 4 759 ? -25.983 43.383  25.576 1.00 93.10  ? 759 PRO D CA    1 
ATOM   6546 C  C     . PRO D 4 759 ? -25.658 44.645  24.789 1.00 92.66  ? 759 PRO D C     1 
ATOM   6547 O  O     . PRO D 4 759 ? -24.737 45.385  25.131 1.00 92.27  ? 759 PRO D O     1 
ATOM   6548 C  CB    . PRO D 4 759 ? -26.958 43.657  26.715 1.00 92.73  ? 759 PRO D CB    1 
ATOM   6549 C  CG    . PRO D 4 759 ? -26.648 42.569  27.678 1.00 93.06  ? 759 PRO D CG    1 
ATOM   6550 C  CD    . PRO D 4 759 ? -25.140 42.565  27.684 1.00 93.47  ? 759 PRO D CD    1 
ATOM   6551 N  N     . THR D 4 760 ? -26.414 44.876  23.723 1.00 92.58  ? 760 THR D N     1 
ATOM   6552 C  CA    . THR D 4 760 ? -26.225 46.065  22.903 1.00 92.85  ? 760 THR D CA    1 
ATOM   6553 C  C     . THR D 4 760 ? -27.019 47.185  23.572 1.00 92.33  ? 760 THR D C     1 
ATOM   6554 O  O     . THR D 4 760 ? -26.479 48.242  23.900 1.00 91.95  ? 760 THR D O     1 
ATOM   6555 C  CB    . THR D 4 760 ? -26.749 45.847  21.464 1.00 93.30  ? 760 THR D CB    1 
ATOM   6556 O  OG1   . THR D 4 760 ? -28.113 45.402  21.507 1.00 93.24  ? 760 THR D OG1   1 
ATOM   6557 C  CG2   . THR D 4 760 ? -25.901 44.809  20.743 1.00 93.50  ? 760 THR D CG2   1 
ATOM   6558 N  N     . ILE D 4 761 ? -28.307 46.933  23.779 1.00 91.56  ? 761 ILE D N     1 
ATOM   6559 C  CA    . ILE D 4 761 ? -29.178 47.896  24.431 1.00 90.73  ? 761 ILE D CA    1 
ATOM   6560 C  C     . ILE D 4 761 ? -28.731 47.992  25.883 1.00 90.85  ? 761 ILE D C     1 
ATOM   6561 O  O     . ILE D 4 761 ? -28.523 46.972  26.541 1.00 90.92  ? 761 ILE D O     1 
ATOM   6562 C  CB    . ILE D 4 761 ? -30.645 47.429  24.411 1.00 90.08  ? 761 ILE D CB    1 
ATOM   6563 C  CG1   . ILE D 4 761 ? -31.056 47.042  22.991 1.00 90.18  ? 761 ILE D CG1   1 
ATOM   6564 C  CG2   . ILE D 4 761 ? -31.545 48.524  24.951 1.00 99.78  ? 761 ILE D CG2   1 
ATOM   6565 C  CD1   . ILE D 4 761 ? -30.910 48.149  21.984 1.00 91.00  ? 761 ILE D CD1   1 
ATOM   6566 N  N     . ASN D 4 762 ? -28.576 49.212  26.383 1.00 90.91  ? 762 ASN D N     1 
ATOM   6567 C  CA    . ASN D 4 762 ? -28.165 49.403  27.764 1.00 90.99  ? 762 ASN D CA    1 
ATOM   6568 C  C     . ASN D 4 762 ? -29.330 49.138  28.716 1.00 91.67  ? 762 ASN D C     1 
ATOM   6569 O  O     . ASN D 4 762 ? -29.879 50.060  29.321 1.00 92.08  ? 762 ASN D O     1 
ATOM   6570 C  CB    . ASN D 4 762 ? -27.614 50.819  27.960 1.00 99.94  ? 762 ASN D CB    1 
ATOM   6571 C  CG    . ASN D 4 762 ? -26.211 50.982  27.391 1.00 99.60  ? 762 ASN D CG    1 
ATOM   6572 O  OD1   . ASN D 4 762 ? -25.655 52.081  27.383 1.00 98.49  ? 762 ASN D OD1   1 
ATOM   6573 N  ND2   . ASN D 4 762 ? -25.631 49.884  26.920 1.00 99.36  ? 762 ASN D ND2   1 
ATOM   6574 N  N     . THR D 4 763 ? -29.711 47.865  28.819 1.00 92.24  ? 763 THR D N     1 
ATOM   6575 C  CA    . THR D 4 763 ? -30.795 47.422  29.698 1.00 92.06  ? 763 THR D CA    1 
ATOM   6576 C  C     . THR D 4 763 ? -30.131 46.907  30.971 1.00 92.03  ? 763 THR D C     1 
ATOM   6577 O  O     . THR D 4 763 ? -30.036 47.625  31.969 1.00 92.38  ? 763 THR D O     1 
ATOM   6578 C  CB    . THR D 4 763 ? -31.615 46.270  29.057 1.00 91.94  ? 763 THR D CB    1 
ATOM   6579 O  OG1   . THR D 4 763 ? -30.723 45.259  28.570 1.00 91.74  ? 763 THR D OG1   1 
ATOM   6580 C  CG2   . THR D 4 763 ? -32.468 46.787  27.908 1.00 91.71  ? 763 THR D CG2   1 
ATOM   6581 N  N     . ASN D 4 764 ? -29.674 45.657  30.921 1.00 91.36  ? 764 ASN D N     1 
ATOM   6582 C  CA    . ASN D 4 764 ? -28.972 45.029  32.035 1.00 90.42  ? 764 ASN D CA    1 
ATOM   6583 C  C     . ASN D 4 764 ? -29.687 45.199  33.381 1.00 99.20  ? 764 ASN D C     1 
ATOM   6584 O  O     . ASN D 4 764 ? -30.526 44.380  33.752 1.00 99.31  ? 764 ASN D O     1 
ATOM   6585 C  CB    . ASN D 4 764 ? -27.556 45.612  32.100 1.00 91.32  ? 764 ASN D CB    1 
ATOM   6586 C  CG    . ASN D 4 764 ? -26.893 45.690  30.723 1.00 91.53  ? 764 ASN D CG    1 
ATOM   6587 O  OD1   . ASN D 4 764 ? -26.479 44.675  30.161 1.00 92.07  ? 764 ASN D OD1   1 
ATOM   6588 N  ND2   . ASN D 4 764 ? -26.807 46.898  30.170 1.00 91.04  ? 764 ASN D ND2   1 
ATOM   6589 N  N     . LYS D 4 765 ? -29.346 46.262  34.106 1.00 97.71  ? 765 LYS D N     1 
ATOM   6590 C  CA    . LYS D 4 765 ? -29.949 46.560  35.406 1.00 95.79  ? 765 LYS D CA    1 
ATOM   6591 C  C     . LYS D 4 765 ? -29.790 45.408  36.401 1.00 94.09  ? 765 LYS D C     1 
ATOM   6592 O  O     . LYS D 4 765 ? -28.703 45.188  36.939 1.00 93.68  ? 765 LYS D O     1 
ATOM   6593 C  CB    . LYS D 4 765 ? -31.435 46.896  35.233 1.00 95.78  ? 765 LYS D CB    1 
ATOM   6594 C  CG    . LYS D 4 765 ? -32.086 47.475  36.482 1.00 96.06  ? 765 LYS D CG    1 
ATOM   6595 C  CD    . LYS D 4 765 ? -33.577 47.744  36.283 1.00 96.63  ? 765 LYS D CD    1 
ATOM   6596 C  CE    . LYS D 4 765 ? -34.370 46.456  36.091 1.00 96.19  ? 765 LYS D CE    1 
ATOM   6597 N  NZ    . LYS D 4 765 ? -35.832 46.720  36.025 1.00 95.38  ? 765 LYS D NZ    1 
ATOM   6598 N  N     . ASP D 4 766 ? -30.879 44.687  36.653 1.00 92.25  ? 766 ASP D N     1 
ATOM   6599 C  CA    . ASP D 4 766 ? -30.857 43.554  37.577 1.00 90.17  ? 766 ASP D CA    1 
ATOM   6600 C  C     . ASP D 4 766 ? -30.458 42.294  36.812 1.00 97.63  ? 766 ASP D C     1 
ATOM   6601 O  O     . ASP D 4 766 ? -29.467 41.640  37.149 1.00 97.58  ? 766 ASP D O     1 
ATOM   6602 C  CB    . ASP D 4 766 ? -32.234 43.347  38.228 1.00 92.00  ? 766 ASP D CB    1 
ATOM   6603 C  CG    . ASP D 4 766 ? -32.677 44.541  39.070 1.00 93.46  ? 766 ASP D CG    1 
ATOM   6604 O  OD1   . ASP D 4 766 ? -33.601 44.381  39.902 1.00 94.18  ? 766 ASP D OD1   1 
ATOM   6605 O  OD2   . ASP D 4 766 ? -32.110 45.641  38.896 1.00 94.92  ? 766 ASP D OD2   1 
ATOM   6606 N  N     . SER D 4 767 ? -31.241 41.967  35.785 1.00 93.74  ? 767 SER D N     1 
ATOM   6607 C  CA    . SER D 4 767 ? -30.993 40.809  34.930 1.00 89.17  ? 767 SER D CA    1 
ATOM   6608 C  C     . SER D 4 767 ? -32.266 40.420  34.199 1.00 85.90  ? 767 SER D C     1 
ATOM   6609 O  O     . SER D 4 767 ? -32.209 39.802  33.135 1.00 85.94  ? 767 SER D O     1 
ATOM   6610 C  CB    . SER D 4 767 ? -30.495 39.613  35.745 1.00 89.44  ? 767 SER D CB    1 
ATOM   6611 O  OG    . SER D 4 767 ? -30.076 38.561  34.891 1.00 87.76  ? 767 SER D OG    1 
ATOM   6612 N  N     . GLU D 4 768 ? -33.407 40.778  34.785 1.00 81.49  ? 768 GLU D N     1 
ATOM   6613 C  CA    . GLU D 4 768 ? -34.721 40.486  34.211 1.00 77.22  ? 768 GLU D CA    1 
ATOM   6614 C  C     . GLU D 4 768 ? -35.250 39.112  34.638 1.00 74.03  ? 768 GLU D C     1 
ATOM   6615 O  O     . GLU D 4 768 ? -34.645 38.067  34.373 1.00 71.40  ? 768 GLU D O     1 
ATOM   6616 C  CB    . GLU D 4 768 ? -34.658 40.585  32.680 1.00 78.76  ? 768 GLU D CB    1 
ATOM   6617 C  CG    . GLU D 4 768 ? -35.964 40.375  31.933 1.00 80.34  ? 768 GLU D CG    1 
ATOM   6618 C  CD    . GLU D 4 768 ? -35.737 40.255  30.429 1.00 82.53  ? 768 GLU D CD    1 
ATOM   6619 O  OE1   . GLU D 4 768 ? -36.705 40.017  29.674 1.00 84.41  ? 768 GLU D OE1   1 
ATOM   6620 O  OE2   . GLU D 4 768 ? -34.576 40.398  29.997 1.00 83.37  ? 768 GLU D OE2   1 
ATOM   6621 N  N     . ILE D 4 769 ? -36.393 39.136  35.315 1.00 70.28  ? 769 ILE D N     1 
ATOM   6622 C  CA    . ILE D 4 769 ? -37.043 37.929  35.786 1.00 65.24  ? 769 ILE D CA    1 
ATOM   6623 C  C     . ILE D 4 769 ? -37.698 37.194  34.630 1.00 63.73  ? 769 ILE D C     1 
ATOM   6624 O  O     . ILE D 4 769 ? -38.267 37.806  33.732 1.00 64.62  ? 769 ILE D O     1 
ATOM   6625 C  CB    . ILE D 4 769 ? -38.104 38.267  36.843 1.00 62.80  ? 769 ILE D CB    1 
ATOM   6626 C  CG1   . ILE D 4 769 ? -37.403 38.678  38.137 1.00 60.45  ? 769 ILE D CG1   1 
ATOM   6627 C  CG2   . ILE D 4 769 ? -39.042 37.081  37.055 1.00 62.10  ? 769 ILE D CG2   1 
ATOM   6628 C  CD1   . ILE D 4 769 ? -38.336 39.096  39.233 1.00 58.33  ? 769 ILE D CD1   1 
ATOM   6629 N  N     . ASP D 4 770 ? -37.610 35.873  34.665 1.00 62.08  ? 770 ASP D N     1 
ATOM   6630 C  CA    . ASP D 4 770 ? -38.184 35.025  33.637 1.00 59.78  ? 770 ASP D CA    1 
ATOM   6631 C  C     . ASP D 4 770 ? -39.630 34.665  34.014 1.00 58.24  ? 770 ASP D C     1 
ATOM   6632 O  O     . ASP D 4 770 ? -39.887 33.625  34.620 1.00 57.97  ? 770 ASP D O     1 
ATOM   6633 C  CB    . ASP D 4 770 ? -37.335 33.762  33.505 1.00 59.45  ? 770 ASP D CB    1 
ATOM   6634 C  CG    . ASP D 4 770 ? -37.714 32.931  32.301 1.00 62.40  ? 770 ASP D CG    1 
ATOM   6635 O  OD1   . ASP D 4 770 ? -38.929 32.777  32.032 1.00 62.18  ? 770 ASP D OD1   1 
ATOM   6636 O  OD2   . ASP D 4 770 ? -36.793 32.421  31.625 1.00 64.58  ? 770 ASP D OD2   1 
ATOM   6637 N  N     . ALA D 4 771 ? -40.570 35.527  33.652 1.00 56.14  ? 771 ALA D N     1 
ATOM   6638 C  CA    . ALA D 4 771 ? -41.979 35.304  33.964 1.00 54.98  ? 771 ALA D CA    1 
ATOM   6639 C  C     . ALA D 4 771 ? -42.482 33.907  33.602 1.00 54.64  ? 771 ALA D C     1 
ATOM   6640 O  O     . ALA D 4 771 ? -43.384 33.380  34.245 1.00 52.49  ? 771 ALA D O     1 
ATOM   6641 C  CB    . ALA D 4 771 ? -42.823 36.341  33.264 1.00 53.60  ? 771 ALA D CB    1 
ATOM   6642 N  N     . HIS D 4 772 ? -41.903 33.319  32.565 1.00 55.42  ? 772 HIS D N     1 
ATOM   6643 C  CA    . HIS D 4 772 ? -42.313 32.000  32.121 1.00 56.20  ? 772 HIS D CA    1 
ATOM   6644 C  C     . HIS D 4 772 ? -41.862 30.945  33.120 1.00 56.51  ? 772 HIS D C     1 
ATOM   6645 O  O     . HIS D 4 772 ? -42.670 30.176  33.647 1.00 56.04  ? 772 HIS D O     1 
ATOM   6646 C  CB    . HIS D 4 772 ? -41.724 31.708  30.734 1.00 59.15  ? 772 HIS D CB    1 
ATOM   6647 C  CG    . HIS D 4 772 ? -41.988 30.316  30.247 1.00 65.16  ? 772 HIS D CG    1 
ATOM   6648 N  ND1   . HIS D 4 772 ? -41.282 29.220  30.701 1.00 68.59  ? 772 HIS D ND1   1 
ATOM   6649 C  CD2   . HIS D 4 772 ? -42.919 29.832  29.390 1.00 67.15  ? 772 HIS D CD2   1 
ATOM   6650 C  CE1   . HIS D 4 772 ? -41.768 28.122  30.147 1.00 68.27  ? 772 HIS D CE1   1 
ATOM   6651 N  NE2   . HIS D 4 772 ? -42.763 28.465  29.348 1.00 67.92  ? 772 HIS D NE2   1 
ATOM   6652 N  N     . LYS D 4 773 ? -40.559 30.912  33.372 1.00 56.15  ? 773 LYS D N     1 
ATOM   6653 C  CA    . LYS D 4 773 ? -39.991 29.958  34.301 1.00 53.98  ? 773 LYS D CA    1 
ATOM   6654 C  C     . LYS D 4 773 ? -40.651 30.120  35.667 1.00 52.22  ? 773 LYS D C     1 
ATOM   6655 O  O     . LYS D 4 773 ? -41.004 29.132  36.311 1.00 53.59  ? 773 LYS D O     1 
ATOM   6656 C  CB    . LYS D 4 773 ? -38.482 30.175  34.407 1.00 54.55  ? 773 LYS D CB    1 
ATOM   6657 C  CG    . LYS D 4 773 ? -37.675 28.926  34.129 1.00 58.80  ? 773 LYS D CG    1 
ATOM   6658 C  CD    . LYS D 4 773 ? -37.181 28.860  32.688 1.00 60.54  ? 773 LYS D CD    1 
ATOM   6659 C  CE    . LYS D 4 773 ? -35.855 29.609  32.521 1.00 64.09  ? 773 LYS D CE    1 
ATOM   6660 N  NZ    . LYS D 4 773 ? -34.768 29.112  33.438 1.00 62.76  ? 773 LYS D NZ    1 
ATOM   6661 N  N     . GLN D 4 774 ? -40.827 31.366  36.099 1.00 49.32  ? 774 GLN D N     1 
ATOM   6662 C  CA    . GLN D 4 774 ? -41.445 31.661  37.393 1.00 48.12  ? 774 GLN D CA    1 
ATOM   6663 C  C     . GLN D 4 774 ? -42.804 31.016  37.571 1.00 46.50  ? 774 GLN D C     1 
ATOM   6664 O  O     . GLN D 4 774 ? -43.196 30.698  38.686 1.00 46.38  ? 774 GLN D O     1 
ATOM   6665 C  CB    . GLN D 4 774 ? -41.603 33.177  37.597 1.00 47.72  ? 774 GLN D CB    1 
ATOM   6666 C  CG    . GLN D 4 774 ? -40.300 33.919  37.891 1.00 49.46  ? 774 GLN D CG    1 
ATOM   6667 C  CD    . GLN D 4 774 ? -39.782 33.671  39.293 1.00 50.39  ? 774 GLN D CD    1 
ATOM   6668 O  OE1   . GLN D 4 774 ? -40.345 34.161  40.277 1.00 52.29  ? 774 GLN D OE1   1 
ATOM   6669 N  NE2   . GLN D 4 774 ? -38.709 32.903  39.396 1.00 49.46  ? 774 GLN D NE2   1 
ATOM   6670 N  N     . GLU D 4 775 ? -43.519 30.812  36.473 1.00 45.69  ? 775 GLU D N     1 
ATOM   6671 C  CA    . GLU D 4 775 ? -44.853 30.233  36.539 1.00 45.78  ? 775 GLU D CA    1 
ATOM   6672 C  C     . GLU D 4 775 ? -44.888 28.715  36.393 1.00 44.70  ? 775 GLU D C     1 
ATOM   6673 O  O     . GLU D 4 775 ? -45.717 28.043  37.015 1.00 43.64  ? 775 GLU D O     1 
ATOM   6674 C  CB    . GLU D 4 775 ? -45.723 30.865  35.465 1.00 48.18  ? 775 GLU D CB    1 
ATOM   6675 C  CG    . GLU D 4 775 ? -47.193 30.655  35.666 1.00 55.90  ? 775 GLU D CG    1 
ATOM   6676 C  CD    . GLU D 4 775 ? -48.013 31.348  34.603 1.00 61.47  ? 775 GLU D CD    1 
ATOM   6677 O  OE1   . GLU D 4 775 ? -47.849 32.579  34.430 1.00 63.47  ? 775 GLU D OE1   1 
ATOM   6678 O  OE2   . GLU D 4 775 ? -48.823 30.659  33.942 1.00 65.22  ? 775 GLU D OE2   1 
ATOM   6679 N  N     . SER D 4 776 ? -43.979 28.180  35.581 1.00 42.92  ? 776 SER D N     1 
ATOM   6680 C  CA    . SER D 4 776 ? -43.909 26.747  35.335 1.00 41.22  ? 776 SER D CA    1 
ATOM   6681 C  C     . SER D 4 776 ? -43.223 25.992  36.463 1.00 41.65  ? 776 SER D C     1 
ATOM   6682 O  O     . SER D 4 776 ? -43.339 24.763  36.548 1.00 41.67  ? 776 SER D O     1 
ATOM   6683 C  CB    . SER D 4 776 ? -43.150 26.468  34.048 1.00 40.75  ? 776 SER D CB    1 
ATOM   6684 O  OG    . SER D 4 776 ? -41.781 26.747  34.223 1.00 40.32  ? 776 SER D OG    1 
ATOM   6685 N  N     . GLY D 4 777 ? -42.513 26.719  37.324 1.00 39.52  ? 777 GLY D N     1 
ATOM   6686 C  CA    . GLY D 4 777 ? -41.819 26.068  38.419 1.00 38.75  ? 777 GLY D CA    1 
ATOM   6687 C  C     . GLY D 4 777 ? -42.453 26.236  39.783 1.00 37.65  ? 777 GLY D C     1 
ATOM   6688 O  O     . GLY D 4 777 ? -42.323 25.365  40.647 1.00 36.24  ? 777 GLY D O     1 
ATOM   6689 N  N     . ILE D 4 778 ? -43.139 27.353  39.983 1.00 35.85  ? 778 ILE D N     1 
ATOM   6690 C  CA    . ILE D 4 778 ? -43.780 27.605  41.259 1.00 36.49  ? 778 ILE D CA    1 
ATOM   6691 C  C     . ILE D 4 778 ? -44.524 26.401  41.871 1.00 37.59  ? 778 ILE D C     1 
ATOM   6692 O  O     . ILE D 4 778 ? -44.441 26.187  43.077 1.00 41.18  ? 778 ILE D O     1 
ATOM   6693 C  CB    . ILE D 4 778 ? -44.768 28.781  41.170 1.00 35.03  ? 778 ILE D CB    1 
ATOM   6694 C  CG1   . ILE D 4 778 ? -45.257 29.132  42.570 1.00 34.26  ? 778 ILE D CG1   1 
ATOM   6695 C  CG2   . ILE D 4 778 ? -45.940 28.420  40.261 1.00 34.29  ? 778 ILE D CG2   1 
ATOM   6696 C  CD1   . ILE D 4 778 ? -44.145 29.513  43.514 1.00 33.69  ? 778 ILE D CD1   1 
ATOM   6697 N  N     . ALA D 4 779 ? -45.252 25.620  41.080 1.00 35.58  ? 779 ALA D N     1 
ATOM   6698 C  CA    . ALA D 4 779 ? -45.965 24.480  41.660 1.00 36.20  ? 779 ALA D CA    1 
ATOM   6699 C  C     . ALA D 4 779 ? -45.000 23.431  42.225 1.00 35.81  ? 779 ALA D C     1 
ATOM   6700 O  O     . ALA D 4 779 ? -45.008 23.146  43.427 1.00 35.10  ? 779 ALA D O     1 
ATOM   6701 C  CB    . ALA D 4 779 ? -46.888 23.837  40.625 1.00 37.85  ? 779 ALA D CB    1 
ATOM   6702 N  N     . PRO D 4 780 ? -44.160 22.836  41.367 1.00 35.53  ? 780 PRO D N     1 
ATOM   6703 C  CA    . PRO D 4 780 ? -43.243 21.841  41.930 1.00 35.14  ? 780 PRO D CA    1 
ATOM   6704 C  C     . PRO D 4 780 ? -42.284 22.432  42.969 1.00 35.14  ? 780 PRO D C     1 
ATOM   6705 O  O     . PRO D 4 780 ? -42.017 21.811  43.991 1.00 37.76  ? 780 PRO D O     1 
ATOM   6706 C  CB    . PRO D 4 780 ? -42.516 21.286  40.697 1.00 33.37  ? 780 PRO D CB    1 
ATOM   6707 C  CG    . PRO D 4 780 ? -42.535 22.467  39.728 1.00 34.09  ? 780 PRO D CG    1 
ATOM   6708 C  CD    . PRO D 4 780 ? -43.934 23.022  39.917 1.00 35.51  ? 780 PRO D CD    1 
ATOM   6709 N  N     . ASN D 4 781 ? -41.773 23.630  42.736 1.00 34.11  ? 781 ASN D N     1 
ATOM   6710 C  CA    . ASN D 4 781 ? -40.847 24.184  43.701 1.00 37.04  ? 781 ASN D CA    1 
ATOM   6711 C  C     . ASN D 4 781 ? -41.522 24.315  45.046 1.00 37.87  ? 781 ASN D C     1 
ATOM   6712 O  O     . ASN D 4 781 ? -40.931 24.005  46.075 1.00 39.09  ? 781 ASN D O     1 
ATOM   6713 C  CB    . ASN D 4 781 ? -40.317 25.540  43.230 1.00 38.45  ? 781 ASN D CB    1 
ATOM   6714 C  CG    . ASN D 4 781 ? -39.352 25.406  42.067 1.00 41.58  ? 781 ASN D CG    1 
ATOM   6715 O  OD1   . ASN D 4 781 ? -39.215 26.312  41.234 1.00 44.26  ? 781 ASN D OD1   1 
ATOM   6716 N  ND2   . ASN D 4 781 ? -38.674 24.270  42.003 1.00 40.00  ? 781 ASN D ND2   1 
ATOM   6717 N  N     . PHE D 4 782 ? -42.779 24.749  45.036 1.00 38.12  ? 782 PHE D N     1 
ATOM   6718 C  CA    . PHE D 4 782 ? -43.536 24.933  46.278 1.00 35.63  ? 782 PHE D CA    1 
ATOM   6719 C  C     . PHE D 4 782 ? -43.751 23.617  47.017 1.00 34.91  ? 782 PHE D C     1 
ATOM   6720 O  O     . PHE D 4 782 ? -43.442 23.490  48.209 1.00 31.27  ? 782 PHE D O     1 
ATOM   6721 C  CB    . PHE D 4 782 ? -44.898 25.550  45.981 1.00 33.20  ? 782 PHE D CB    1 
ATOM   6722 C  CG    . PHE D 4 782 ? -45.647 25.944  47.203 1.00 32.25  ? 782 PHE D CG    1 
ATOM   6723 C  CD1   . PHE D 4 782 ? -45.187 26.986  48.003 1.00 32.46  ? 782 PHE D CD1   1 
ATOM   6724 C  CD2   . PHE D 4 782 ? -46.790 25.245  47.592 1.00 32.08  ? 782 PHE D CD2   1 
ATOM   6725 C  CE1   . PHE D 4 782 ? -45.851 27.325  49.183 1.00 33.19  ? 782 PHE D CE1   1 
ATOM   6726 C  CE2   . PHE D 4 782 ? -47.462 25.573  48.770 1.00 30.02  ? 782 PHE D CE2   1 
ATOM   6727 C  CZ    . PHE D 4 782 ? -46.996 26.611  49.566 1.00 31.28  ? 782 PHE D CZ    1 
ATOM   6728 N  N     . VAL D 4 783 ? -44.303 22.648  46.295 1.00 33.79  ? 783 VAL D N     1 
ATOM   6729 C  CA    . VAL D 4 783 ? -44.572 21.355  46.875 1.00 33.79  ? 783 VAL D CA    1 
ATOM   6730 C  C     . VAL D 4 783 ? -43.300 20.701  47.370 1.00 32.71  ? 783 VAL D C     1 
ATOM   6731 O  O     . VAL D 4 783 ? -43.270 20.211  48.486 1.00 32.62  ? 783 VAL D O     1 
ATOM   6732 C  CB    . VAL D 4 783 ? -45.272 20.431  45.881 1.00 34.18  ? 783 VAL D CB    1 
ATOM   6733 C  CG1   . VAL D 4 783 ? -45.615 19.136  46.566 1.00 35.25  ? 783 VAL D CG1   1 
ATOM   6734 C  CG2   . VAL D 4 783 ? -46.534 21.089  45.367 1.00 32.82  ? 783 VAL D CG2   1 
ATOM   6735 N  N     . HIS D 4 784 ? -42.251 20.713  46.553 1.00 32.75  ? 784 HIS D N     1 
ATOM   6736 C  CA    . HIS D 4 784 ? -40.966 20.128  46.937 1.00 31.39  ? 784 HIS D CA    1 
ATOM   6737 C  C     . HIS D 4 784 ? -40.401 20.782  48.185 1.00 32.05  ? 784 HIS D C     1 
ATOM   6738 O  O     . HIS D 4 784 ? -39.753 20.126  49.001 1.00 33.82  ? 784 HIS D O     1 
ATOM   6739 C  CB    . HIS D 4 784 ? -39.951 20.273  45.815 1.00 31.84  ? 784 HIS D CB    1 
ATOM   6740 C  CG    . HIS D 4 784 ? -40.192 19.361  44.662 1.00 32.66  ? 784 HIS D CG    1 
ATOM   6741 N  ND1   . HIS D 4 784 ? -39.639 19.575  43.420 1.00 36.76  ? 784 HIS D ND1   1 
ATOM   6742 C  CD2   . HIS D 4 784 ? -40.906 18.216  44.562 1.00 35.49  ? 784 HIS D CD2   1 
ATOM   6743 C  CE1   . HIS D 4 784 ? -40.001 18.602  42.601 1.00 37.42  ? 784 HIS D CE1   1 
ATOM   6744 N  NE2   . HIS D 4 784 ? -40.771 17.763  43.270 1.00 37.19  ? 784 HIS D NE2   1 
ATOM   6745 N  N     . SER D 4 785 ? -40.633 22.076  48.345 1.00 30.91  ? 785 SER D N     1 
ATOM   6746 C  CA    . SER D 4 785 ? -40.125 22.738  49.524 1.00 31.45  ? 785 SER D CA    1 
ATOM   6747 C  C     . SER D 4 785 ? -40.991 22.321  50.692 1.00 33.47  ? 785 SER D C     1 
ATOM   6748 O  O     . SER D 4 785 ? -40.572 22.392  51.840 1.00 35.20  ? 785 SER D O     1 
ATOM   6749 C  CB    . SER D 4 785 ? -40.167 24.257  49.362 1.00 31.19  ? 785 SER D CB    1 
ATOM   6750 O  OG    . SER D 4 785 ? -41.419 24.784  49.740 1.00 32.70  ? 785 SER D OG    1 
ATOM   6751 N  N     . GLN D 4 786 ? -42.211 21.886  50.387 1.00 36.52  ? 786 GLN D N     1 
ATOM   6752 C  CA    . GLN D 4 786 ? -43.158 21.467  51.402 1.00 36.92  ? 786 GLN D CA    1 
ATOM   6753 C  C     . GLN D 4 786 ? -42.807 20.085  51.879 1.00 38.83  ? 786 GLN D C     1 
ATOM   6754 O  O     . GLN D 4 786 ? -42.949 19.775  53.066 1.00 40.87  ? 786 GLN D O     1 
ATOM   6755 C  CB    . GLN D 4 786 ? -44.569 21.474  50.847 1.00 39.08  ? 786 GLN D CB    1 
ATOM   6756 C  CG    . GLN D 4 786 ? -45.167 22.857  50.706 1.00 43.74  ? 786 GLN D CG    1 
ATOM   6757 C  CD    . GLN D 4 786 ? -45.131 23.629  52.006 1.00 45.08  ? 786 GLN D CD    1 
ATOM   6758 O  OE1   . GLN D 4 786 ? -45.412 23.081  53.067 1.00 47.90  ? 786 GLN D OE1   1 
ATOM   6759 N  NE2   . GLN D 4 786 ? -44.803 24.912  51.929 1.00 47.05  ? 786 GLN D NE2   1 
ATOM   6760 N  N     . ASP D 4 787 ? -42.350 19.243  50.962 1.00 38.60  ? 787 ASP D N     1 
ATOM   6761 C  CA    . ASP D 4 787 ? -41.957 17.912  51.363 1.00 39.46  ? 787 ASP D CA    1 
ATOM   6762 C  C     . ASP D 4 787 ? -40.607 18.013  52.090 1.00 39.19  ? 787 ASP D C     1 
ATOM   6763 O  O     . ASP D 4 787 ? -40.392 17.373  53.122 1.00 40.82  ? 787 ASP D O     1 
ATOM   6764 C  CB    . ASP D 4 787 ? -41.890 16.960  50.154 1.00 40.49  ? 787 ASP D CB    1 
ATOM   6765 C  CG    . ASP D 4 787 ? -40.625 17.117  49.320 1.00 47.11  ? 787 ASP D CG    1 
ATOM   6766 O  OD1   . ASP D 4 787 ? -39.509 16.839  49.836 1.00 53.56  ? 787 ASP D OD1   1 
ATOM   6767 O  OD2   . ASP D 4 787 ? -40.746 17.500  48.131 1.00 47.56  ? 787 ASP D OD2   1 
ATOM   6768 N  N     . GLY D 4 788 ? -39.713 18.850  51.585 1.00 35.69  ? 788 GLY D N     1 
ATOM   6769 C  CA    . GLY D 4 788 ? -38.429 18.967  52.230 1.00 34.33  ? 788 GLY D CA    1 
ATOM   6770 C  C     . GLY D 4 788 ? -38.579 19.443  53.657 1.00 34.63  ? 788 GLY D C     1 
ATOM   6771 O  O     . GLY D 4 788 ? -37.797 19.091  54.543 1.00 36.58  ? 788 GLY D O     1 
ATOM   6772 N  N     . SER D 4 789 ? -39.601 20.249  53.893 1.00 34.75  ? 789 SER D N     1 
ATOM   6773 C  CA    . SER D 4 789 ? -39.838 20.793  55.220 1.00 32.01  ? 789 SER D CA    1 
ATOM   6774 C  C     . SER D 4 789 ? -40.381 19.676  56.094 1.00 31.15  ? 789 SER D C     1 
ATOM   6775 O  O     . SER D 4 789 ? -40.044 19.568  57.276 1.00 31.05  ? 789 SER D O     1 
ATOM   6776 C  CB    . SER D 4 789 ? -40.836 21.942  55.124 1.00 32.39  ? 789 SER D CB    1 
ATOM   6777 O  OG    . SER D 4 789 ? -40.853 22.725  56.307 1.00 37.61  ? 789 SER D OG    1 
ATOM   6778 N  N     . HIS D 4 790 ? -41.213 18.833  55.497 1.00 28.20  ? 790 HIS D N     1 
ATOM   6779 C  CA    . HIS D 4 790 ? -41.797 17.723  56.217 1.00 27.38  ? 790 HIS D CA    1 
ATOM   6780 C  C     . HIS D 4 790 ? -40.651 16.765  56.556 1.00 28.73  ? 790 HIS D C     1 
ATOM   6781 O  O     . HIS D 4 790 ? -40.610 16.174  57.642 1.00 27.25  ? 790 HIS D O     1 
ATOM   6782 C  CB    . HIS D 4 790 ? -42.892 17.078  55.344 1.00 26.14  ? 790 HIS D CB    1 
ATOM   6783 C  CG    . HIS D 4 790 ? -43.400 15.768  55.854 1.00 25.88  ? 790 HIS D CG    1 
ATOM   6784 N  ND1   . HIS D 4 790 ? -43.710 15.549  57.182 1.00 26.73  ? 790 HIS D ND1   1 
ATOM   6785 C  CD2   . HIS D 4 790 ? -43.619 14.593  55.214 1.00 25.32  ? 790 HIS D CD2   1 
ATOM   6786 C  CE1   . HIS D 4 790 ? -44.088 14.292  57.341 1.00 25.74  ? 790 HIS D CE1   1 
ATOM   6787 N  NE2   . HIS D 4 790 ? -44.043 13.692  56.161 1.00 29.90  ? 790 HIS D NE2   1 
ATOM   6788 N  N     . LEU D 4 791 ? -39.689 16.641  55.644 1.00 29.82  ? 791 LEU D N     1 
ATOM   6789 C  CA    . LEU D 4 791 ? -38.543 15.773  55.900 1.00 28.68  ? 791 LEU D CA    1 
ATOM   6790 C  C     . LEU D 4 791 ? -37.758 16.284  57.095 1.00 27.32  ? 791 LEU D C     1 
ATOM   6791 O  O     . LEU D 4 791 ? -37.394 15.520  57.995 1.00 26.38  ? 791 LEU D O     1 
ATOM   6792 C  CB    . LEU D 4 791 ? -37.625 15.705  54.690 1.00 28.71  ? 791 LEU D CB    1 
ATOM   6793 C  CG    . LEU D 4 791 ? -36.541 14.641  54.855 1.00 31.24  ? 791 LEU D CG    1 
ATOM   6794 C  CD1   . LEU D 4 791 ? -36.426 13.863  53.572 1.00 30.84  ? 791 LEU D CD1   1 
ATOM   6795 C  CD2   . LEU D 4 791 ? -35.214 15.272  55.270 1.00 29.71  ? 791 LEU D CD2   1 
ATOM   6796 N  N     . ARG D 4 792 ? -37.528 17.588  57.115 1.00 27.62  ? 792 ARG D N     1 
ATOM   6797 C  CA    . ARG D 4 792 ? -36.781 18.198  58.198 1.00 29.45  ? 792 ARG D CA    1 
ATOM   6798 C  C     . ARG D 4 792 ? -37.541 18.113  59.503 1.00 29.33  ? 792 ARG D C     1 
ATOM   6799 O  O     . ARG D 4 792 ? -36.963 17.814  60.545 1.00 30.83  ? 792 ARG D O     1 
ATOM   6800 C  CB    . ARG D 4 792 ? -36.439 19.662  57.863 1.00 31.18  ? 792 ARG D CB    1 
ATOM   6801 C  CG    . ARG D 4 792 ? -35.481 19.827  56.670 1.00 32.96  ? 792 ARG D CG    1 
ATOM   6802 C  CD    . ARG D 4 792 ? -34.870 21.233  56.600 1.00 33.99  ? 792 ARG D CD    1 
ATOM   6803 N  NE    . ARG D 4 792 ? -35.926 22.215  56.441 1.00 31.79  ? 792 ARG D NE    1 
ATOM   6804 C  CZ    . ARG D 4 792 ? -36.548 22.445  55.295 1.00 30.87  ? 792 ARG D CZ    1 
ATOM   6805 N  NH1   . ARG D 4 792 ? -36.189 21.780  54.208 1.00 25.95  ? 792 ARG D NH1   1 
ATOM   6806 N  NH2   . ARG D 4 792 ? -37.580 23.281  55.262 1.00 30.99  ? 792 ARG D NH2   1 
ATOM   6807 N  N     . LYS D 4 793 ? -38.842 18.374  59.450 1.00 29.93  ? 793 LYS D N     1 
ATOM   6808 C  CA    . LYS D 4 793 ? -39.654 18.310  60.656 1.00 29.66  ? 793 LYS D CA    1 
ATOM   6809 C  C     . LYS D 4 793 ? -39.685 16.895  61.216 1.00 30.79  ? 793 LYS D C     1 
ATOM   6810 O  O     . LYS D 4 793 ? -39.672 16.697  62.425 1.00 31.95  ? 793 LYS D O     1 
ATOM   6811 C  CB    . LYS D 4 793 ? -41.071 18.789  60.379 1.00 29.48  ? 793 LYS D CB    1 
ATOM   6812 C  CG    . LYS D 4 793 ? -41.260 20.272  60.609 1.00 33.19  ? 793 LYS D CG    1 
ATOM   6813 C  CD    . LYS D 4 793 ? -42.715 20.672  60.409 1.00 39.42  ? 793 LYS D CD    1 
ATOM   6814 C  CE    . LYS D 4 793 ? -42.940 22.103  60.849 1.00 41.09  ? 793 LYS D CE    1 
ATOM   6815 N  NZ    . LYS D 4 793 ? -42.539 22.226  62.285 1.00 47.72  ? 793 LYS D NZ    1 
ATOM   6816 N  N     . THR D 4 794 ? -39.732 15.905  60.339 1.00 29.10  ? 794 THR D N     1 
ATOM   6817 C  CA    . THR D 4 794 ? -39.740 14.545  60.804 1.00 29.64  ? 794 THR D CA    1 
ATOM   6818 C  C     . THR D 4 794 ? -38.396 14.172  61.428 1.00 31.60  ? 794 THR D C     1 
ATOM   6819 O  O     . THR D 4 794 ? -38.351 13.493  62.451 1.00 31.22  ? 794 THR D O     1 
ATOM   6820 C  CB    . THR D 4 794 ? -40.030 13.631  59.673 1.00 29.63  ? 794 THR D CB    1 
ATOM   6821 O  OG1   . THR D 4 794 ? -41.287 14.007  59.120 1.00 30.63  ? 794 THR D OG1   1 
ATOM   6822 C  CG2   . THR D 4 794 ? -40.059 12.184  60.143 1.00 29.10  ? 794 THR D CG2   1 
ATOM   6823 N  N     . VAL D 4 795 ? -37.299 14.608  60.814 1.00 31.54  ? 795 VAL D N     1 
ATOM   6824 C  CA    . VAL D 4 795 ? -35.990 14.296  61.368 1.00 30.43  ? 795 VAL D CA    1 
ATOM   6825 C  C     . VAL D 4 795 ? -35.902 14.902  62.767 1.00 30.89  ? 795 VAL D C     1 
ATOM   6826 O  O     . VAL D 4 795 ? -35.455 14.242  63.716 1.00 33.88  ? 795 VAL D O     1 
ATOM   6827 C  CB    . VAL D 4 795 ? -34.825 14.858  60.483 1.00 30.24  ? 795 VAL D CB    1 
ATOM   6828 C  CG1   . VAL D 4 795 ? -33.487 14.819  61.254 1.00 28.46  ? 795 VAL D CG1   1 
ATOM   6829 C  CG2   . VAL D 4 795 ? -34.696 14.042  59.214 1.00 25.42  ? 795 VAL D CG2   1 
ATOM   6830 N  N     . VAL D 4 796 ? -36.342 16.145  62.917 1.00 28.30  ? 796 VAL D N     1 
ATOM   6831 C  CA    . VAL D 4 796 ? -36.241 16.773  64.232 1.00 28.14  ? 796 VAL D CA    1 
ATOM   6832 C  C     . VAL D 4 796 ? -37.174 16.164  65.272 1.00 28.90  ? 796 VAL D C     1 
ATOM   6833 O  O     . VAL D 4 796 ? -36.822 16.050  66.441 1.00 29.61  ? 796 VAL D O     1 
ATOM   6834 C  CB    . VAL D 4 796 ? -36.506 18.290  64.169 1.00 24.34  ? 796 VAL D CB    1 
ATOM   6835 C  CG1   . VAL D 4 796 ? -36.513 18.874  65.597 1.00 22.57  ? 796 VAL D CG1   1 
ATOM   6836 C  CG2   . VAL D 4 796 ? -35.416 18.966  63.339 1.00 22.57  ? 796 VAL D CG2   1 
ATOM   6837 N  N     . TRP D 4 797 ? -38.357 15.779  64.818 1.00 28.62  ? 797 TRP D N     1 
ATOM   6838 C  CA    . TRP D 4 797 ? -39.389 15.199  65.647 1.00 29.08  ? 797 TRP D CA    1 
ATOM   6839 C  C     . TRP D 4 797 ? -38.971 13.790  66.095 1.00 30.90  ? 797 TRP D C     1 
ATOM   6840 O  O     . TRP D 4 797 ? -38.991 13.466  67.280 1.00 28.62  ? 797 TRP D O     1 
ATOM   6841 C  CB    . TRP D 4 797 ? -40.671 15.161  64.821 1.00 30.71  ? 797 TRP D CB    1 
ATOM   6842 C  CG    . TRP D 4 797 ? -41.893 14.797  65.551 1.00 36.85  ? 797 TRP D CG    1 
ATOM   6843 C  CD1   . TRP D 4 797 ? -42.214 13.572  66.070 1.00 38.75  ? 797 TRP D CD1   1 
ATOM   6844 C  CD2   . TRP D 4 797 ? -43.021 15.638  65.783 1.00 41.57  ? 797 TRP D CD2   1 
ATOM   6845 N  NE1   . TRP D 4 797 ? -43.481 13.596  66.604 1.00 39.91  ? 797 TRP D NE1   1 
ATOM   6846 C  CE2   . TRP D 4 797 ? -44.003 14.852  66.439 1.00 42.54  ? 797 TRP D CE2   1 
ATOM   6847 C  CE3   . TRP D 4 797 ? -43.309 16.982  65.491 1.00 42.09  ? 797 TRP D CE3   1 
ATOM   6848 C  CZ2   . TRP D 4 797 ? -45.254 15.369  66.810 1.00 43.52  ? 797 TRP D CZ2   1 
ATOM   6849 C  CZ3   . TRP D 4 797 ? -44.552 17.499  65.858 1.00 41.78  ? 797 TRP D CZ3   1 
ATOM   6850 C  CH2   . TRP D 4 797 ? -45.510 16.690  66.510 1.00 44.64  ? 797 TRP D CH2   1 
ATOM   6851 N  N     . ALA D 4 798 ? -38.573 12.956  65.144 1.00 30.40  ? 798 ALA D N     1 
ATOM   6852 C  CA    . ALA D 4 798 ? -38.171 11.616  65.485 1.00 32.01  ? 798 ALA D CA    1 
ATOM   6853 C  C     . ALA D 4 798 ? -37.011 11.648  66.477 1.00 34.14  ? 798 ALA D C     1 
ATOM   6854 O  O     . ALA D 4 798 ? -36.948 10.832  67.393 1.00 34.73  ? 798 ALA D O     1 
ATOM   6855 C  CB    . ALA D 4 798 ? -37.788 10.851  64.228 1.00 30.55  ? 798 ALA D CB    1 
ATOM   6856 N  N     . HIS D 4 799 ? -36.107 12.605  66.309 1.00 34.55  ? 799 HIS D N     1 
ATOM   6857 C  CA    . HIS D 4 799 ? -34.955 12.708  67.187 1.00 34.15  ? 799 HIS D CA    1 
ATOM   6858 C  C     . HIS D 4 799 ? -35.308 13.226  68.564 1.00 36.83  ? 799 HIS D C     1 
ATOM   6859 O  O     . HIS D 4 799 ? -34.908 12.646  69.584 1.00 35.95  ? 799 HIS D O     1 
ATOM   6860 C  CB    . HIS D 4 799 ? -33.939 13.642  66.577 1.00 33.33  ? 799 HIS D CB    1 
ATOM   6861 C  CG    . HIS D 4 799 ? -32.687 13.781  67.377 1.00 33.18  ? 799 HIS D CG    1 
ATOM   6862 N  ND1   . HIS D 4 799 ? -31.700 12.814  67.390 1.00 33.55  ? 799 HIS D ND1   1 
ATOM   6863 C  CD2   . HIS D 4 799 ? -32.242 14.787  68.165 1.00 33.28  ? 799 HIS D CD2   1 
ATOM   6864 C  CE1   . HIS D 4 799 ? -30.701 13.222  68.151 1.00 33.37  ? 799 HIS D CE1   1 
ATOM   6865 N  NE2   . HIS D 4 799 ? -31.003 14.416  68.633 1.00 33.89  ? 799 HIS D NE2   1 
ATOM   6866 N  N     . GLU D 4 800 ? -36.059 14.328  68.589 1.00 38.05  ? 800 GLU D N     1 
ATOM   6867 C  CA    . GLU D 4 800 ? -36.448 14.968  69.836 1.00 37.86  ? 800 GLU D CA    1 
ATOM   6868 C  C     . GLU D 4 800 ? -37.595 14.305  70.600 1.00 36.12  ? 800 GLU D C     1 
ATOM   6869 O  O     . GLU D 4 800 ? -37.670 14.416  71.817 1.00 34.99  ? 800 GLU D O     1 
ATOM   6870 C  CB    . GLU D 4 800 ? -36.755 16.432  69.568 1.00 40.66  ? 800 GLU D CB    1 
ATOM   6871 C  CG    . GLU D 4 800 ? -35.687 17.116  68.726 1.00 49.44  ? 800 GLU D CG    1 
ATOM   6872 C  CD    . GLU D 4 800 ? -35.810 18.634  68.732 1.00 55.30  ? 800 GLU D CD    1 
ATOM   6873 O  OE1   . GLU D 4 800 ? -36.948 19.140  68.562 1.00 56.97  ? 800 GLU D OE1   1 
ATOM   6874 O  OE2   . GLU D 4 800 ? -34.764 19.314  68.897 1.00 56.77  ? 800 GLU D OE2   1 
ATOM   6875 N  N     . LYS D 4 801 ? -38.469 13.601  69.896 1.00 35.53  ? 801 LYS D N     1 
ATOM   6876 C  CA    . LYS D 4 801 ? -39.587 12.921  70.539 1.00 36.34  ? 801 LYS D CA    1 
ATOM   6877 C  C     . LYS D 4 801 ? -39.313 11.450  70.767 1.00 36.73  ? 801 LYS D C     1 
ATOM   6878 O  O     . LYS D 4 801 ? -39.745 10.887  71.758 1.00 40.12  ? 801 LYS D O     1 
ATOM   6879 C  CB    . LYS D 4 801 ? -40.863 13.069  69.708 1.00 36.23  ? 801 LYS D CB    1 
ATOM   6880 C  CG    . LYS D 4 801 ? -41.619 14.345  69.981 1.00 38.14  ? 801 LYS D CG    1 
ATOM   6881 C  CD    . LYS D 4 801 ? -40.682 15.487  70.273 1.00 40.14  ? 801 LYS D CD    1 
ATOM   6882 C  CE    . LYS D 4 801 ? -41.424 16.661  70.904 1.00 44.93  ? 801 LYS D CE    1 
ATOM   6883 N  NZ    . LYS D 4 801 ? -40.537 17.853  71.124 1.00 47.24  ? 801 LYS D NZ    1 
ATOM   6884 N  N     . TYR D 4 802 ? -38.591 10.817  69.862 1.00 35.99  ? 802 TYR D N     1 
ATOM   6885 C  CA    . TYR D 4 802 ? -38.314 9.404   70.033 1.00 35.55  ? 802 TYR D CA    1 
ATOM   6886 C  C     . TYR D 4 802 ? -36.853 9.076   70.233 1.00 34.34  ? 802 TYR D C     1 
ATOM   6887 O  O     . TYR D 4 802 ? -36.511 7.921   70.329 1.00 34.72  ? 802 TYR D O     1 
ATOM   6888 C  CB    . TYR D 4 802 ? -38.839 8.630   68.841 1.00 36.82  ? 802 TYR D CB    1 
ATOM   6889 C  CG    . TYR D 4 802 ? -40.305 8.831   68.668 1.00 39.36  ? 802 TYR D CG    1 
ATOM   6890 C  CD1   . TYR D 4 802 ? -41.219 8.126   69.442 1.00 38.48  ? 802 TYR D CD1   1 
ATOM   6891 C  CD2   . TYR D 4 802 ? -40.785 9.794   67.782 1.00 40.76  ? 802 TYR D CD2   1 
ATOM   6892 C  CE1   . TYR D 4 802 ? -42.583 8.381   69.345 1.00 41.36  ? 802 TYR D CE1   1 
ATOM   6893 C  CE2   . TYR D 4 802 ? -42.145 10.059  67.677 1.00 42.30  ? 802 TYR D CE2   1 
ATOM   6894 C  CZ    . TYR D 4 802 ? -43.039 9.355   68.461 1.00 41.23  ? 802 TYR D CZ    1 
ATOM   6895 O  OH    . TYR D 4 802 ? -44.372 9.656   68.384 1.00 39.27  ? 802 TYR D OH    1 
ATOM   6896 N  N     . GLY D 4 803 ? -35.996 10.089  70.295 1.00 33.67  ? 803 GLY D N     1 
ATOM   6897 C  CA    . GLY D 4 803 ? -34.576 9.847   70.494 1.00 31.59  ? 803 GLY D CA    1 
ATOM   6898 C  C     . GLY D 4 803 ? -33.878 9.075   69.401 1.00 28.70  ? 803 GLY D C     1 
ATOM   6899 O  O     . GLY D 4 803 ? -32.887 8.426   69.653 1.00 30.79  ? 803 GLY D O     1 
ATOM   6900 N  N     . ILE D 4 804 ? -34.401 9.130   68.189 1.00 29.41  ? 804 ILE D N     1 
ATOM   6901 C  CA    . ILE D 4 804 ? -33.800 8.449   67.059 1.00 29.64  ? 804 ILE D CA    1 
ATOM   6902 C  C     . ILE D 4 804 ? -32.564 9.222   66.612 1.00 33.36  ? 804 ILE D C     1 
ATOM   6903 O  O     . ILE D 4 804 ? -32.591 10.446  66.519 1.00 36.06  ? 804 ILE D O     1 
ATOM   6904 C  CB    . ILE D 4 804 ? -34.769 8.392   65.905 1.00 29.52  ? 804 ILE D CB    1 
ATOM   6905 C  CG1   . ILE D 4 804 ? -36.029 7.660   66.353 1.00 28.98  ? 804 ILE D CG1   1 
ATOM   6906 C  CG2   . ILE D 4 804 ? -34.100 7.770   64.698 1.00 28.22  ? 804 ILE D CG2   1 
ATOM   6907 C  CD1   . ILE D 4 804 ? -37.120 7.555   65.278 1.00 28.56  ? 804 ILE D CD1   1 
ATOM   6908 N  N     . GLU D 4 805 ? -31.479 8.512   66.325 1.00 36.61  ? 805 GLU D N     1 
ATOM   6909 C  CA    . GLU D 4 805 ? -30.247 9.165   65.925 1.00 36.68  ? 805 GLU D CA    1 
ATOM   6910 C  C     . GLU D 4 805 ? -29.892 8.886   64.484 1.00 37.78  ? 805 GLU D C     1 
ATOM   6911 O  O     . GLU D 4 805 ? -29.336 9.748   63.803 1.00 41.84  ? 805 GLU D O     1 
ATOM   6912 C  CB    . GLU D 4 805 ? -29.098 8.697   66.790 1.00 35.93  ? 805 GLU D CB    1 
ATOM   6913 C  CG    . GLU D 4 805 ? -29.472 8.348   68.184 1.00 42.03  ? 805 GLU D CG    1 
ATOM   6914 C  CD    . GLU D 4 805 ? -28.267 7.886   68.981 1.00 47.84  ? 805 GLU D CD    1 
ATOM   6915 O  OE1   . GLU D 4 805 ? -27.646 8.739   69.659 1.00 48.08  ? 805 GLU D OE1   1 
ATOM   6916 O  OE2   . GLU D 4 805 ? -27.938 6.669   68.915 1.00 51.17  ? 805 GLU D OE2   1 
ATOM   6917 N  N     . SER D 4 806 ? -30.208 7.687   64.018 1.00 35.67  ? 806 SER D N     1 
ATOM   6918 C  CA    . SER D 4 806 ? -29.891 7.289   62.658 1.00 35.57  ? 806 SER D CA    1 
ATOM   6919 C  C     . SER D 4 806 ? -30.990 7.592   61.663 1.00 34.74  ? 806 SER D C     1 
ATOM   6920 O  O     . SER D 4 806 ? -32.139 7.251   61.885 1.00 35.95  ? 806 SER D O     1 
ATOM   6921 C  CB    . SER D 4 806 ? -29.603 5.798   62.625 1.00 38.22  ? 806 SER D CB    1 
ATOM   6922 O  OG    . SER D 4 806 ? -28.628 5.470   63.610 1.00 47.16  ? 806 SER D OG    1 
ATOM   6923 N  N     . PHE D 4 807 ? -30.637 8.219   60.549 1.00 33.96  ? 807 PHE D N     1 
ATOM   6924 C  CA    . PHE D 4 807 ? -31.627 8.524   59.533 1.00 33.25  ? 807 PHE D CA    1 
ATOM   6925 C  C     . PHE D 4 807 ? -31.116 8.268   58.132 1.00 33.97  ? 807 PHE D C     1 
ATOM   6926 O  O     . PHE D 4 807 ? -30.002 8.615   57.804 1.00 36.65  ? 807 PHE D O     1 
ATOM   6927 C  CB    . PHE D 4 807 ? -32.071 9.997   59.608 1.00 32.09  ? 807 PHE D CB    1 
ATOM   6928 C  CG    . PHE D 4 807 ? -32.715 10.373  60.899 1.00 30.00  ? 807 PHE D CG    1 
ATOM   6929 C  CD1   . PHE D 4 807 ? -31.951 10.842  61.957 1.00 28.12  ? 807 PHE D CD1   1 
ATOM   6930 C  CD2   . PHE D 4 807 ? -34.098 10.232  61.067 1.00 29.44  ? 807 PHE D CD2   1 
ATOM   6931 C  CE1   . PHE D 4 807 ? -32.558 11.168  63.175 1.00 31.38  ? 807 PHE D CE1   1 
ATOM   6932 C  CE2   . PHE D 4 807 ? -34.722 10.555  62.275 1.00 27.55  ? 807 PHE D CE2   1 
ATOM   6933 C  CZ    . PHE D 4 807 ? -33.963 11.023  63.332 1.00 28.66  ? 807 PHE D CZ    1 
ATOM   6934 N  N     . ALA D 4 808 ? -31.931 7.651   57.299 1.00 34.08  ? 808 ALA D N     1 
ATOM   6935 C  CA    . ALA D 4 808 ? -31.556 7.457   55.918 1.00 33.50  ? 808 ALA D CA    1 
ATOM   6936 C  C     . ALA D 4 808 ? -32.658 8.319   55.320 1.00 36.05  ? 808 ALA D C     1 
ATOM   6937 O  O     . ALA D 4 808 ? -33.838 8.003   55.455 1.00 39.46  ? 808 ALA D O     1 
ATOM   6938 C  CB    . ALA D 4 808 ? -31.710 6.017   55.524 1.00 31.75  ? 808 ALA D CB    1 
ATOM   6939 N  N     . LEU D 4 809 ? -32.286 9.438   54.708 1.00 36.56  ? 809 LEU D N     1 
ATOM   6940 C  CA    . LEU D 4 809 ? -33.276 10.340  54.151 1.00 33.08  ? 809 LEU D CA    1 
ATOM   6941 C  C     . LEU D 4 809 ? -33.102 10.462  52.675 1.00 35.29  ? 809 LEU D C     1 
ATOM   6942 O  O     . LEU D 4 809 ? -32.005 10.781  52.202 1.00 35.61  ? 809 LEU D O     1 
ATOM   6943 C  CB    . LEU D 4 809 ? -33.124 11.735  54.736 1.00 29.60  ? 809 LEU D CB    1 
ATOM   6944 C  CG    . LEU D 4 809 ? -32.926 11.806  56.234 1.00 34.59  ? 809 LEU D CG    1 
ATOM   6945 C  CD1   . LEU D 4 809 ? -32.672 13.252  56.664 1.00 35.37  ? 809 LEU D CD1   1 
ATOM   6946 C  CD2   . LEU D 4 809 ? -34.153 11.219  56.914 1.00 35.86  ? 809 LEU D CD2   1 
ATOM   6947 N  N     . ILE D 4 810 ? -34.176 10.226  51.931 1.00 35.73  ? 810 ILE D N     1 
ATOM   6948 C  CA    . ILE D 4 810 ? -34.076 10.387  50.508 1.00 36.12  ? 810 ILE D CA    1 
ATOM   6949 C  C     . ILE D 4 810 ? -35.261 11.177  50.018 1.00 40.12  ? 810 ILE D C     1 
ATOM   6950 O  O     . ILE D 4 810 ? -36.106 10.692  49.263 1.00 44.09  ? 810 ILE D O     1 
ATOM   6951 C  CB    . ILE D 4 810 ? -33.958 9.048   49.787 1.00 35.05  ? 810 ILE D CB    1 
ATOM   6952 C  CG1   . ILE D 4 810 ? -32.942 8.155   50.526 1.00 32.78  ? 810 ILE D CG1   1 
ATOM   6953 C  CG2   . ILE D 4 810 ? -33.443 9.291   48.377 1.00 32.72  ? 810 ILE D CG2   1 
ATOM   6954 C  CD1   . ILE D 4 810 ? -32.644 6.853   49.856 1.00 30.30  ? 810 ILE D CD1   1 
ATOM   6955 N  N     . HIS D 4 811 ? -35.329 12.414  50.487 1.00 41.37  ? 811 HIS D N     1 
ATOM   6956 C  CA    . HIS D 4 811 ? -36.380 13.328  50.065 1.00 43.05  ? 811 HIS D CA    1 
ATOM   6957 C  C     . HIS D 4 811 ? -37.777 13.003  50.541 1.00 43.04  ? 811 HIS D C     1 
ATOM   6958 O  O     . HIS D 4 811 ? -38.369 13.777  51.290 1.00 42.65  ? 811 HIS D O     1 
ATOM   6959 C  CB    . HIS D 4 811 ? -36.384 13.446  48.539 1.00 40.17  ? 811 HIS D CB    1 
ATOM   6960 C  CG    . HIS D 4 811 ? -35.105 13.975  47.986 1.00 40.93  ? 811 HIS D CG    1 
ATOM   6961 N  ND1   . HIS D 4 811 ? -34.633 15.234  48.284 1.00 41.74  ? 811 HIS D ND1   1 
ATOM   6962 C  CD2   . HIS D 4 811 ? -34.175 13.402  47.187 1.00 42.82  ? 811 HIS D CD2   1 
ATOM   6963 C  CE1   . HIS D 4 811 ? -33.466 15.416  47.693 1.00 43.53  ? 811 HIS D CE1   1 
ATOM   6964 N  NE2   . HIS D 4 811 ? -33.164 14.317  47.021 1.00 44.04  ? 811 HIS D NE2   1 
ATOM   6965 N  N     . ASP D 4 812 ? -38.319 11.880  50.089 1.00 43.64  ? 812 ASP D N     1 
ATOM   6966 C  CA    . ASP D 4 812 ? -39.662 11.528  50.492 1.00 46.40  ? 812 ASP D CA    1 
ATOM   6967 C  C     . ASP D 4 812 ? -39.623 10.148  51.109 1.00 46.25  ? 812 ASP D C     1 
ATOM   6968 O  O     . ASP D 4 812 ? -40.654 9.554   51.415 1.00 47.38  ? 812 ASP D O     1 
ATOM   6969 C  CB    . ASP D 4 812 ? -40.589 11.563  49.282 1.00 49.27  ? 812 ASP D CB    1 
ATOM   6970 C  CG    . ASP D 4 812 ? -40.483 10.328  48.450 1.00 53.50  ? 812 ASP D CG    1 
ATOM   6971 O  OD1   . ASP D 4 812 ? -39.344 9.859   48.230 1.00 57.73  ? 812 ASP D OD1   1 
ATOM   6972 O  OD2   . ASP D 4 812 ? -41.539 9.825   48.014 1.00 56.09  ? 812 ASP D OD2   1 
ATOM   6973 N  N     . SER D 4 813 ? -38.405 9.647   51.284 1.00 45.49  ? 813 SER D N     1 
ATOM   6974 C  CA    . SER D 4 813 ? -38.168 8.342   51.885 1.00 42.85  ? 813 SER D CA    1 
ATOM   6975 C  C     . SER D 4 813 ? -37.536 8.611   53.249 1.00 40.48  ? 813 SER D C     1 
ATOM   6976 O  O     . SER D 4 813 ? -36.661 9.453   53.360 1.00 39.91  ? 813 SER D O     1 
ATOM   6977 C  CB    . SER D 4 813 ? -37.221 7.542   50.996 1.00 43.53  ? 813 SER D CB    1 
ATOM   6978 O  OG    . SER D 4 813 ? -37.165 6.195   51.417 1.00 50.97  ? 813 SER D OG    1 
ATOM   6979 N  N     . PHE D 4 814 ? -37.999 7.913   54.283 1.00 40.63  ? 814 PHE D N     1 
ATOM   6980 C  CA    . PHE D 4 814 ? -37.494 8.082   55.653 1.00 38.55  ? 814 PHE D CA    1 
ATOM   6981 C  C     . PHE D 4 814 ? -37.038 6.732   56.177 1.00 38.16  ? 814 PHE D C     1 
ATOM   6982 O  O     . PHE D 4 814 ? -37.832 5.798   56.199 1.00 37.09  ? 814 PHE D O     1 
ATOM   6983 C  CB    . PHE D 4 814 ? -38.600 8.578   56.580 1.00 40.72  ? 814 PHE D CB    1 
ATOM   6984 C  CG    . PHE D 4 814 ? -39.291 9.808   56.101 1.00 39.86  ? 814 PHE D CG    1 
ATOM   6985 C  CD1   . PHE D 4 814 ? -40.204 9.744   55.048 1.00 41.71  ? 814 PHE D CD1   1 
ATOM   6986 C  CD2   . PHE D 4 814 ? -39.006 11.039  56.675 1.00 38.00  ? 814 PHE D CD2   1 
ATOM   6987 C  CE1   . PHE D 4 814 ? -40.821 10.897  54.569 1.00 41.22  ? 814 PHE D CE1   1 
ATOM   6988 C  CE2   . PHE D 4 814 ? -39.612 12.184  56.210 1.00 40.38  ? 814 PHE D CE2   1 
ATOM   6989 C  CZ    . PHE D 4 814 ? -40.524 12.117  55.151 1.00 40.06  ? 814 PHE D CZ    1 
ATOM   6990 N  N     . GLY D 4 815 ? -35.782 6.636   56.619 1.00 37.41  ? 815 GLY D N     1 
ATOM   6991 C  CA    . GLY D 4 815 ? -35.274 5.369   57.116 1.00 33.83  ? 815 GLY D CA    1 
ATOM   6992 C  C     . GLY D 4 815 ? -34.502 5.373   58.418 1.00 33.24  ? 815 GLY D C     1 
ATOM   6993 O  O     . GLY D 4 815 ? -33.877 6.358   58.777 1.00 34.90  ? 815 GLY D O     1 
ATOM   6994 N  N     . THR D 4 816 ? -34.577 4.261   59.141 1.00 31.65  ? 816 THR D N     1 
ATOM   6995 C  CA    . THR D 4 816 ? -33.855 4.079   60.387 1.00 31.35  ? 816 THR D CA    1 
ATOM   6996 C  C     . THR D 4 816 ? -33.533 2.610   60.547 1.00 31.65  ? 816 THR D C     1 
ATOM   6997 O  O     . THR D 4 816 ? -33.782 1.793   59.670 1.00 31.78  ? 816 THR D O     1 
ATOM   6998 C  CB    . THR D 4 816 ? -34.656 4.381   61.635 1.00 33.59  ? 816 THR D CB    1 
ATOM   6999 O  OG1   . THR D 4 816 ? -35.731 5.275   61.332 1.00 40.41  ? 816 THR D OG1   1 
ATOM   7000 C  CG2   . THR D 4 816 ? -33.734 4.954   62.694 1.00 27.94  ? 816 THR D CG2   1 
ATOM   7001 N  N     . ILE D 4 817 ? -32.990 2.284   61.706 1.00 31.14  ? 817 ILE D N     1 
ATOM   7002 C  CA    . ILE D 4 817 ? -32.647 0.926   62.001 1.00 30.07  ? 817 ILE D CA    1 
ATOM   7003 C  C     . ILE D 4 817 ? -33.969 0.288   62.382 1.00 29.37  ? 817 ILE D C     1 
ATOM   7004 O  O     . ILE D 4 817 ? -34.904 0.978   62.790 1.00 26.63  ? 817 ILE D O     1 
ATOM   7005 C  CB    . ILE D 4 817 ? -31.621 0.853   63.157 1.00 30.62  ? 817 ILE D CB    1 
ATOM   7006 C  CG1   . ILE D 4 817 ? -32.198 1.479   64.429 1.00 26.79  ? 817 ILE D CG1   1 
ATOM   7007 C  CG2   . ILE D 4 817 ? -30.359 1.581   62.747 1.00 32.00  ? 817 ILE D CG2   1 
ATOM   7008 C  CD1   . ILE D 4 817 ? -31.331 1.278   65.613 1.00 23.07  ? 817 ILE D CD1   1 
ATOM   7009 N  N     . PRO D 4 818 ? -34.054 -1.043  62.266 1.00 29.96  ? 818 PRO D N     1 
ATOM   7010 C  CA    . PRO D 4 818 ? -35.270 -1.783  62.582 1.00 28.81  ? 818 PRO D CA    1 
ATOM   7011 C  C     . PRO D 4 818 ? -35.854 -1.477  63.942 1.00 28.76  ? 818 PRO D C     1 
ATOM   7012 O  O     . PRO D 4 818 ? -37.071 -1.336  64.084 1.00 32.82  ? 818 PRO D O     1 
ATOM   7013 C  CB    . PRO D 4 818 ? -34.824 -3.233  62.426 1.00 29.32  ? 818 PRO D CB    1 
ATOM   7014 C  CG    . PRO D 4 818 ? -33.739 -3.134  61.369 1.00 25.79  ? 818 PRO D CG    1 
ATOM   7015 C  CD    . PRO D 4 818 ? -32.969 -1.968  61.890 1.00 27.89  ? 818 PRO D CD    1 
ATOM   7016 N  N     . ALA D 4 819 ? -35.000 -1.354  64.944 1.00 26.60  ? 819 ALA D N     1 
ATOM   7017 C  CA    . ALA D 4 819 ? -35.484 -1.081  66.285 1.00 26.25  ? 819 ALA D CA    1 
ATOM   7018 C  C     . ALA D 4 819 ? -36.164 0.265   66.424 1.00 30.06  ? 819 ALA D C     1 
ATOM   7019 O  O     . ALA D 4 819 ? -36.887 0.481   67.398 1.00 33.54  ? 819 ALA D O     1 
ATOM   7020 C  CB    . ALA D 4 819 ? -34.364 -1.168  67.272 1.00 26.14  ? 819 ALA D CB    1 
ATOM   7021 N  N     . ASP D 4 820 ? -35.927 1.190   65.495 1.00 30.65  ? 820 ASP D N     1 
ATOM   7022 C  CA    . ASP D 4 820 ? -36.574 2.485   65.601 1.00 31.21  ? 820 ASP D CA    1 
ATOM   7023 C  C     . ASP D 4 820 ? -37.617 2.655   64.511 1.00 30.51  ? 820 ASP D C     1 
ATOM   7024 O  O     . ASP D 4 820 ? -38.317 3.648   64.468 1.00 30.18  ? 820 ASP D O     1 
ATOM   7025 C  CB    . ASP D 4 820 ? -35.558 3.623   65.513 1.00 36.08  ? 820 ASP D CB    1 
ATOM   7026 C  CG    . ASP D 4 820 ? -34.515 3.584   66.631 1.00 45.68  ? 820 ASP D CG    1 
ATOM   7027 O  OD1   . ASP D 4 820 ? -34.822 3.084   67.749 1.00 49.68  ? 820 ASP D OD1   1 
ATOM   7028 O  OD2   . ASP D 4 820 ? -33.380 4.086   66.398 1.00 50.24  ? 820 ASP D OD2   1 
ATOM   7029 N  N     . ALA D 4 821 ? -37.721 1.678   63.625 1.00 30.74  ? 821 ALA D N     1 
ATOM   7030 C  CA    . ALA D 4 821 ? -38.675 1.757   62.527 1.00 31.15  ? 821 ALA D CA    1 
ATOM   7031 C  C     . ALA D 4 821 ? -40.090 2.145   62.976 1.00 30.92  ? 821 ALA D C     1 
ATOM   7032 O  O     . ALA D 4 821 ? -40.722 3.002   62.391 1.00 33.91  ? 821 ALA D O     1 
ATOM   7033 C  CB    . ALA D 4 821 ? -38.695 0.425   61.759 1.00 27.10  ? 821 ALA D CB    1 
ATOM   7034 N  N     . ALA D 4 822 ? -40.581 1.514   64.023 1.00 32.73  ? 822 ALA D N     1 
ATOM   7035 C  CA    . ALA D 4 822 ? -41.915 1.775   64.520 1.00 31.64  ? 822 ALA D CA    1 
ATOM   7036 C  C     . ALA D 4 822 ? -42.159 3.243   64.827 1.00 32.80  ? 822 ALA D C     1 
ATOM   7037 O  O     . ALA D 4 822 ? -43.231 3.774   64.519 1.00 37.05  ? 822 ALA D O     1 
ATOM   7038 C  CB    . ALA D 4 822 ? -42.174 0.922   65.768 1.00 28.70  ? 822 ALA D CB    1 
ATOM   7039 N  N     . ASN D 4 823 ? -41.177 3.890   65.449 1.00 32.02  ? 823 ASN D N     1 
ATOM   7040 C  CA    . ASN D 4 823 ? -41.290 5.297   65.807 1.00 29.62  ? 823 ASN D CA    1 
ATOM   7041 C  C     . ASN D 4 823 ? -41.117 6.206   64.604 1.00 30.75  ? 823 ASN D C     1 
ATOM   7042 O  O     . ASN D 4 823 ? -41.747 7.250   64.517 1.00 34.43  ? 823 ASN D O     1 
ATOM   7043 C  CB    . ASN D 4 823 ? -40.251 5.684   66.857 1.00 31.40  ? 823 ASN D CB    1 
ATOM   7044 C  CG    . ASN D 4 823 ? -40.526 5.070   68.233 1.00 34.24  ? 823 ASN D CG    1 
ATOM   7045 O  OD1   . ASN D 4 823 ? -41.685 4.914   68.659 1.00 32.65  ? 823 ASN D OD1   1 
ATOM   7046 N  ND2   . ASN D 4 823 ? -39.450 4.744   68.945 1.00 32.07  ? 823 ASN D ND2   1 
ATOM   7047 N  N     . LEU D 4 824 ? -40.244 5.841   63.681 1.00 30.46  ? 824 LEU D N     1 
ATOM   7048 C  CA    . LEU D 4 824 ? -40.062 6.669   62.506 1.00 30.63  ? 824 LEU D CA    1 
ATOM   7049 C  C     . LEU D 4 824 ? -41.397 6.621   61.792 1.00 32.38  ? 824 LEU D C     1 
ATOM   7050 O  O     . LEU D 4 824 ? -41.836 7.603   61.206 1.00 32.83  ? 824 LEU D O     1 
ATOM   7051 C  CB    . LEU D 4 824 ? -38.956 6.113   61.613 1.00 30.05  ? 824 LEU D CB    1 
ATOM   7052 C  CG    . LEU D 4 824 ? -38.581 7.068   60.482 1.00 31.06  ? 824 LEU D CG    1 
ATOM   7053 C  CD1   . LEU D 4 824 ? -38.157 8.389   61.085 1.00 28.52  ? 824 LEU D CD1   1 
ATOM   7054 C  CD2   . LEU D 4 824 ? -37.498 6.459   59.596 1.00 27.78  ? 824 LEU D CD2   1 
ATOM   7055 N  N     . PHE D 4 825 ? -42.053 5.467   61.896 1.00 33.38  ? 825 PHE D N     1 
ATOM   7056 C  CA    . PHE D 4 825 ? -43.356 5.230   61.297 1.00 32.40  ? 825 PHE D CA    1 
ATOM   7057 C  C     . PHE D 4 825 ? -44.408 6.189   61.823 1.00 32.63  ? 825 PHE D C     1 
ATOM   7058 O  O     . PHE D 4 825 ? -45.150 6.765   61.043 1.00 31.48  ? 825 PHE D O     1 
ATOM   7059 C  CB    . PHE D 4 825 ? -43.789 3.802   61.563 1.00 33.15  ? 825 PHE D CB    1 
ATOM   7060 C  CG    . PHE D 4 825 ? -45.013 3.379   60.797 1.00 35.95  ? 825 PHE D CG    1 
ATOM   7061 C  CD1   . PHE D 4 825 ? -46.276 3.425   61.386 1.00 33.63  ? 825 PHE D CD1   1 
ATOM   7062 C  CD2   . PHE D 4 825 ? -44.897 2.880   59.496 1.00 37.31  ? 825 PHE D CD2   1 
ATOM   7063 C  CE1   . PHE D 4 825 ? -47.390 2.980   60.704 1.00 32.14  ? 825 PHE D CE1   1 
ATOM   7064 C  CE2   . PHE D 4 825 ? -46.028 2.427   58.805 1.00 36.61  ? 825 PHE D CE2   1 
ATOM   7065 C  CZ    . PHE D 4 825 ? -47.270 2.478   59.414 1.00 32.39  ? 825 PHE D CZ    1 
ATOM   7066 N  N     . LYS D 4 826 ? -44.486 6.374   63.137 1.00 33.42  ? 826 LYS D N     1 
ATOM   7067 C  CA    . LYS D 4 826 ? -45.488 7.312   63.649 1.00 36.11  ? 826 LYS D CA    1 
ATOM   7068 C  C     . LYS D 4 826 ? -45.078 8.761   63.406 1.00 34.96  ? 826 LYS D C     1 
ATOM   7069 O  O     . LYS D 4 826 ? -45.890 9.577   62.970 1.00 34.61  ? 826 LYS D O     1 
ATOM   7070 C  CB    . LYS D 4 826 ? -45.774 7.079   65.136 1.00 37.08  ? 826 LYS D CB    1 
ATOM   7071 C  CG    . LYS D 4 826 ? -44.564 6.885   65.983 1.00 45.79  ? 826 LYS D CG    1 
ATOM   7072 C  CD    . LYS D 4 826 ? -44.886 6.996   67.493 1.00 51.28  ? 826 LYS D CD    1 
ATOM   7073 C  CE    . LYS D 4 826 ? -45.777 5.879   68.009 1.00 52.89  ? 826 LYS D CE    1 
ATOM   7074 N  NZ    . LYS D 4 826 ? -47.121 5.953   67.386 1.00 56.40  ? 826 LYS D NZ    1 
ATOM   7075 N  N     . ALA D 4 827 ? -43.805 9.051   63.662 1.00 34.32  ? 827 ALA D N     1 
ATOM   7076 C  CA    . ALA D 4 827 ? -43.211 10.374  63.484 1.00 31.37  ? 827 ALA D CA    1 
ATOM   7077 C  C     . ALA D 4 827 ? -43.453 10.987  62.082 1.00 33.10  ? 827 ALA D C     1 
ATOM   7078 O  O     . ALA D 4 827 ? -43.892 12.133  61.958 1.00 32.97  ? 827 ALA D O     1 
ATOM   7079 C  CB    . ALA D 4 827 ? -41.717 10.277  63.759 1.00 26.83  ? 827 ALA D CB    1 
ATOM   7080 N  N     . VAL D 4 828 ? -43.153 10.247  61.019 1.00 30.45  ? 828 VAL D N     1 
ATOM   7081 C  CA    . VAL D 4 828 ? -43.370 10.811  59.720 1.00 29.62  ? 828 VAL D CA    1 
ATOM   7082 C  C     . VAL D 4 828 ? -44.858 11.147  59.592 1.00 34.03  ? 828 VAL D C     1 
ATOM   7083 O  O     . VAL D 4 828 ? -45.231 12.116  58.920 1.00 37.59  ? 828 VAL D O     1 
ATOM   7084 C  CB    . VAL D 4 828 ? -42.960 9.849   58.612 1.00 27.73  ? 828 VAL D CB    1 
ATOM   7085 C  CG1   . VAL D 4 828 ? -43.918 8.673   58.569 1.00 28.12  ? 828 VAL D CG1   1 
ATOM   7086 C  CG2   . VAL D 4 828 ? -42.938 10.574  57.287 1.00 26.25  ? 828 VAL D CG2   1 
ATOM   7087 N  N     . ARG D 4 829 ? -45.721 10.365  60.231 1.00 33.61  ? 829 ARG D N     1 
ATOM   7088 C  CA    . ARG D 4 829 ? -47.144 10.655  60.134 1.00 35.12  ? 829 ARG D CA    1 
ATOM   7089 C  C     . ARG D 4 829 ? -47.531 11.811  61.035 1.00 35.79  ? 829 ARG D C     1 
ATOM   7090 O  O     . ARG D 4 829 ? -48.324 12.655  60.649 1.00 37.91  ? 829 ARG D O     1 
ATOM   7091 C  CB    . ARG D 4 829 ? -47.976 9.423   60.483 1.00 35.03  ? 829 ARG D CB    1 
ATOM   7092 C  CG    . ARG D 4 829 ? -47.879 8.355   59.429 1.00 35.92  ? 829 ARG D CG    1 
ATOM   7093 C  CD    . ARG D 4 829 ? -48.546 7.050   59.812 1.00 35.63  ? 829 ARG D CD    1 
ATOM   7094 N  NE    . ARG D 4 829 ? -48.533 6.171   58.652 1.00 36.39  ? 829 ARG D NE    1 
ATOM   7095 C  CZ    . ARG D 4 829 ? -47.449 5.560   58.193 1.00 36.02  ? 829 ARG D CZ    1 
ATOM   7096 N  NH1   . ARG D 4 829 ? -46.288 5.725   58.812 1.00 37.73  ? 829 ARG D NH1   1 
ATOM   7097 N  NH2   . ARG D 4 829 ? -47.520 4.802   57.104 1.00 33.79  ? 829 ARG D NH2   1 
ATOM   7098 N  N     . GLU D 4 830 ? -46.970 11.857  62.233 1.00 35.18  ? 830 GLU D N     1 
ATOM   7099 C  CA    . GLU D 4 830 ? -47.289 12.929  63.159 1.00 35.28  ? 830 GLU D CA    1 
ATOM   7100 C  C     . GLU D 4 830 ? -46.884 14.294  62.631 1.00 36.20  ? 830 GLU D C     1 
ATOM   7101 O  O     . GLU D 4 830 ? -47.616 15.262  62.785 1.00 40.40  ? 830 GLU D O     1 
ATOM   7102 C  CB    . GLU D 4 830 ? -46.612 12.687  64.508 1.00 35.55  ? 830 GLU D CB    1 
ATOM   7103 C  CG    . GLU D 4 830 ? -46.828 11.290  65.023 1.00 38.83  ? 830 GLU D CG    1 
ATOM   7104 C  CD    . GLU D 4 830 ? -46.385 11.088  66.447 1.00 40.39  ? 830 GLU D CD    1 
ATOM   7105 O  OE1   . GLU D 4 830 ? -45.255 11.484  66.816 1.00 41.34  ? 830 GLU D OE1   1 
ATOM   7106 O  OE2   . GLU D 4 830 ? -47.180 10.502  67.203 1.00 45.25  ? 830 GLU D OE2   1 
ATOM   7107 N  N     . THR D 4 831 ? -45.724 14.393  62.002 1.00 35.15  ? 831 THR D N     1 
ATOM   7108 C  CA    . THR D 4 831 ? -45.302 15.683  61.518 1.00 33.47  ? 831 THR D CA    1 
ATOM   7109 C  C     . THR D 4 831 ? -46.195 16.106  60.371 1.00 33.08  ? 831 THR D C     1 
ATOM   7110 O  O     . THR D 4 831 ? -46.494 17.284  60.218 1.00 32.63  ? 831 THR D O     1 
ATOM   7111 C  CB    . THR D 4 831 ? -43.820 15.666  61.070 1.00 32.06  ? 831 THR D CB    1 
ATOM   7112 O  OG1   . THR D 4 831 ? -43.637 14.718  60.013 1.00 33.39  ? 831 THR D OG1   1 
ATOM   7113 C  CG2   . THR D 4 831 ? -42.948 15.293  62.220 1.00 29.60  ? 831 THR D CG2   1 
ATOM   7114 N  N     . MET D 4 832 ? -46.616 15.133  59.574 1.00 34.18  ? 832 MET D N     1 
ATOM   7115 C  CA    . MET D 4 832 ? -47.478 15.377  58.422 1.00 36.17  ? 832 MET D CA    1 
ATOM   7116 C  C     . MET D 4 832 ? -48.747 16.057  58.917 1.00 39.05  ? 832 MET D C     1 
ATOM   7117 O  O     . MET D 4 832 ? -49.206 17.056  58.358 1.00 40.73  ? 832 MET D O     1 
ATOM   7118 C  CB    . MET D 4 832 ? -47.856 14.059  57.773 1.00 37.45  ? 832 MET D CB    1 
ATOM   7119 C  CG    . MET D 4 832 ? -48.567 14.229  56.475 1.00 39.80  ? 832 MET D CG    1 
ATOM   7120 S  SD    . MET D 4 832 ? -47.395 14.967  55.368 1.00 45.83  ? 832 MET D SD    1 
ATOM   7121 C  CE    . MET D 4 832 ? -47.788 14.153  53.855 1.00 41.70  ? 832 MET D CE    1 
ATOM   7122 N  N     . VAL D 4 833 ? -49.298 15.509  59.992 1.00 38.80  ? 833 VAL D N     1 
ATOM   7123 C  CA    . VAL D 4 833 ? -50.507 16.023  60.586 1.00 38.84  ? 833 VAL D CA    1 
ATOM   7124 C  C     . VAL D 4 833 ? -50.322 17.339  61.333 1.00 40.98  ? 833 VAL D C     1 
ATOM   7125 O  O     . VAL D 4 833 ? -51.104 18.268  61.150 1.00 42.28  ? 833 VAL D O     1 
ATOM   7126 C  CB    . VAL D 4 833 ? -51.115 14.969  61.522 1.00 37.90  ? 833 VAL D CB    1 
ATOM   7127 C  CG1   . VAL D 4 833 ? -52.164 15.593  62.407 1.00 36.64  ? 833 VAL D CG1   1 
ATOM   7128 C  CG2   . VAL D 4 833 ? -51.720 13.848  60.693 1.00 35.95  ? 833 VAL D CG2   1 
ATOM   7129 N  N     . ASP D 4 834 ? -49.297 17.447  62.168 1.00 43.65  ? 834 ASP D N     1 
ATOM   7130 C  CA    . ASP D 4 834 ? -49.131 18.692  62.907 1.00 46.22  ? 834 ASP D CA    1 
ATOM   7131 C  C     . ASP D 4 834 ? -49.015 19.843  61.944 1.00 45.96  ? 834 ASP D C     1 
ATOM   7132 O  O     . ASP D 4 834 ? -49.654 20.873  62.099 1.00 46.95  ? 834 ASP D O     1 
ATOM   7133 C  CB    . ASP D 4 834 ? -47.885 18.669  63.787 1.00 51.29  ? 834 ASP D CB    1 
ATOM   7134 C  CG    . ASP D 4 834 ? -47.785 19.913  64.694 1.00 58.88  ? 834 ASP D CG    1 
ATOM   7135 O  OD1   . ASP D 4 834 ? -46.785 20.046  65.453 1.00 61.15  ? 834 ASP D OD1   1 
ATOM   7136 O  OD2   . ASP D 4 834 ? -48.717 20.762  64.654 1.00 61.67  ? 834 ASP D OD2   1 
ATOM   7137 N  N     . THR D 4 835 ? -48.196 19.637  60.928 1.00 46.33  ? 835 THR D N     1 
ATOM   7138 C  CA    . THR D 4 835 ? -47.922 20.644  59.932 1.00 44.77  ? 835 THR D CA    1 
ATOM   7139 C  C     . THR D 4 835 ? -49.124 21.246  59.262 1.00 44.33  ? 835 THR D C     1 
ATOM   7140 O  O     . THR D 4 835 ? -49.375 22.435  59.402 1.00 43.62  ? 835 THR D O     1 
ATOM   7141 C  CB    . THR D 4 835 ? -46.984 20.083  58.854 1.00 44.19  ? 835 THR D CB    1 
ATOM   7142 O  OG1   . THR D 4 835 ? -45.700 19.849  59.443 1.00 45.93  ? 835 THR D OG1   1 
ATOM   7143 C  CG2   . THR D 4 835 ? -46.852 21.059  57.679 1.00 41.20  ? 835 THR D CG2   1 
ATOM   7144 N  N     . TYR D 4 836 ? -49.856 20.416  58.530 1.00 44.95  ? 836 TYR D N     1 
ATOM   7145 C  CA    . TYR D 4 836 ? -51.014 20.852  57.774 1.00 44.18  ? 836 TYR D CA    1 
ATOM   7146 C  C     . TYR D 4 836 ? -52.251 21.092  58.612 1.00 46.69  ? 836 TYR D C     1 
ATOM   7147 O  O     . TYR D 4 836 ? -53.285 21.520  58.116 1.00 48.85  ? 836 TYR D O     1 
ATOM   7148 C  CB    . TYR D 4 836 ? -51.296 19.836  56.686 1.00 41.73  ? 836 TYR D CB    1 
ATOM   7149 C  CG    . TYR D 4 836 ? -50.225 19.818  55.630 1.00 41.11  ? 836 TYR D CG    1 
ATOM   7150 C  CD1   . TYR D 4 836 ? -50.042 20.907  54.787 1.00 43.22  ? 836 TYR D CD1   1 
ATOM   7151 C  CD2   . TYR D 4 836 ? -49.396 18.718  55.468 1.00 40.68  ? 836 TYR D CD2   1 
ATOM   7152 C  CE1   . TYR D 4 836 ? -49.057 20.902  53.799 1.00 43.36  ? 836 TYR D CE1   1 
ATOM   7153 C  CE2   . TYR D 4 836 ? -48.409 18.699  54.490 1.00 42.30  ? 836 TYR D CE2   1 
ATOM   7154 C  CZ    . TYR D 4 836 ? -48.243 19.797  53.653 1.00 43.32  ? 836 TYR D CZ    1 
ATOM   7155 O  OH    . TYR D 4 836 ? -47.261 19.791  52.674 1.00 44.61  ? 836 TYR D OH    1 
ATOM   7156 N  N     . GLU D 4 837 ? -52.153 20.807  59.894 1.00 49.47  ? 837 GLU D N     1 
ATOM   7157 C  CA    . GLU D 4 837 ? -53.274 21.043  60.766 1.00 51.51  ? 837 GLU D CA    1 
ATOM   7158 C  C     . GLU D 4 837 ? -52.937 22.331  61.484 1.00 50.51  ? 837 GLU D C     1 
ATOM   7159 O  O     . GLU D 4 837 ? -53.795 22.987  62.049 1.00 53.35  ? 837 GLU D O     1 
ATOM   7160 C  CB    . GLU D 4 837 ? -53.423 19.883  61.747 1.00 54.54  ? 837 GLU D CB    1 
ATOM   7161 C  CG    . GLU D 4 837 ? -54.719 19.895  62.529 1.00 61.74  ? 837 GLU D CG    1 
ATOM   7162 C  CD    . GLU D 4 837 ? -55.166 18.496  62.956 1.00 66.42  ? 837 GLU D CD    1 
ATOM   7163 O  OE1   . GLU D 4 837 ? -54.292 17.682  63.359 1.00 66.18  ? 837 GLU D OE1   1 
ATOM   7164 O  OE2   . GLU D 4 837 ? -56.397 18.223  62.896 1.00 67.67  ? 837 GLU D OE2   1 
ATOM   7165 N  N     . SER D 4 838 ? -51.670 22.707  61.416 1.00 49.59  ? 838 SER D N     1 
ATOM   7166 C  CA    . SER D 4 838 ? -51.189 23.900  62.079 1.00 49.15  ? 838 SER D CA    1 
ATOM   7167 C  C     . SER D 4 838 ? -50.867 25.051  61.133 1.00 48.06  ? 838 SER D C     1 
ATOM   7168 O  O     . SER D 4 838 ? -50.745 26.195  61.564 1.00 46.71  ? 838 SER D O     1 
ATOM   7169 C  CB    . SER D 4 838 ? -49.948 23.550  62.890 1.00 50.21  ? 838 SER D CB    1 
ATOM   7170 O  OG    . SER D 4 838 ? -50.136 23.876  64.254 1.00 56.82  ? 838 SER D OG    1 
ATOM   7171 N  N     . CYS D 4 839 ? -50.731 24.749  59.849 1.00 47.14  ? 839 CYS D N     1 
ATOM   7172 C  CA    . CYS D 4 839 ? -50.408 25.769  58.866 1.00 47.25  ? 839 CYS D CA    1 
ATOM   7173 C  C     . CYS D 4 839 ? -51.272 25.681  57.631 1.00 47.63  ? 839 CYS D C     1 
ATOM   7174 O  O     . CYS D 4 839 ? -51.641 24.585  57.187 1.00 47.40  ? 839 CYS D O     1 
ATOM   7175 C  CB    . CYS D 4 839 ? -48.953 25.638  58.408 1.00 47.08  ? 839 CYS D CB    1 
ATOM   7176 S  SG    . CYS D 4 839 ? -47.733 25.818  59.702 1.00 56.03  ? 839 CYS D SG    1 
ATOM   7177 N  N     . ASP D 4 840 ? -51.595 26.846  57.081 1.00 46.57  ? 840 ASP D N     1 
ATOM   7178 C  CA    . ASP D 4 840 ? -52.343 26.907  55.844 1.00 45.63  ? 840 ASP D CA    1 
ATOM   7179 C  C     . ASP D 4 840 ? -51.307 27.510  54.907 1.00 45.55  ? 840 ASP D C     1 
ATOM   7180 O  O     . ASP D 4 840 ? -51.232 28.724  54.707 1.00 44.88  ? 840 ASP D O     1 
ATOM   7181 C  CB    . ASP D 4 840 ? -53.558 27.807  55.977 1.00 46.82  ? 840 ASP D CB    1 
ATOM   7182 C  CG    . ASP D 4 840 ? -54.465 27.724  54.768 1.00 49.62  ? 840 ASP D CG    1 
ATOM   7183 O  OD1   . ASP D 4 840 ? -55.630 28.157  54.890 1.00 52.76  ? 840 ASP D OD1   1 
ATOM   7184 O  OD2   . ASP D 4 840 ? -54.015 27.233  53.698 1.00 49.95  ? 840 ASP D OD2   1 
ATOM   7185 N  N     . VAL D 4 841 ? -50.480 26.632  54.362 1.00 45.16  ? 841 VAL D N     1 
ATOM   7186 C  CA    . VAL D 4 841 ? -49.388 27.033  53.493 1.00 45.08  ? 841 VAL D CA    1 
ATOM   7187 C  C     . VAL D 4 841 ? -49.773 27.907  52.298 1.00 44.98  ? 841 VAL D C     1 
ATOM   7188 O  O     . VAL D 4 841 ? -48.983 28.767  51.884 1.00 45.49  ? 841 VAL D O     1 
ATOM   7189 C  CB    . VAL D 4 841 ? -48.604 25.784  53.013 1.00 42.97  ? 841 VAL D CB    1 
ATOM   7190 C  CG1   . VAL D 4 841 ? -48.199 24.957  54.209 1.00 39.94  ? 841 VAL D CG1   1 
ATOM   7191 C  CG2   . VAL D 4 841 ? -49.455 24.964  52.064 1.00 43.74  ? 841 VAL D CG2   1 
ATOM   7192 N  N     . LEU D 4 842 ? -50.966 27.685  51.743 1.00 43.04  ? 842 LEU D N     1 
ATOM   7193 C  CA    . LEU D 4 842 ? -51.432 28.478  50.612 1.00 42.01  ? 842 LEU D CA    1 
ATOM   7194 C  C     . LEU D 4 842 ? -51.863 29.873  51.094 1.00 43.79  ? 842 LEU D C     1 
ATOM   7195 O  O     . LEU D 4 842 ? -51.516 30.899  50.497 1.00 42.83  ? 842 LEU D O     1 
ATOM   7196 C  CB    . LEU D 4 842 ? -52.580 27.759  49.917 1.00 39.54  ? 842 LEU D CB    1 
ATOM   7197 C  CG    . LEU D 4 842 ? -52.242 26.932  48.662 1.00 42.13  ? 842 LEU D CG    1 
ATOM   7198 C  CD1   . LEU D 4 842 ? -50.899 26.227  48.795 1.00 40.22  ? 842 LEU D CD1   1 
ATOM   7199 C  CD2   . LEU D 4 842 ? -53.367 25.930  48.402 1.00 39.43  ? 842 LEU D CD2   1 
ATOM   7200 N  N     . ALA D 4 843 ? -52.601 29.909  52.196 1.00 44.00  ? 843 ALA D N     1 
ATOM   7201 C  CA    . ALA D 4 843 ? -53.048 31.168  52.755 1.00 43.77  ? 843 ALA D CA    1 
ATOM   7202 C  C     . ALA D 4 843 ? -51.853 31.934  53.300 1.00 45.21  ? 843 ALA D C     1 
ATOM   7203 O  O     . ALA D 4 843 ? -51.858 33.160  53.326 1.00 44.50  ? 843 ALA D O     1 
ATOM   7204 C  CB    . ALA D 4 843 ? -54.046 30.915  53.858 1.00 42.13  ? 843 ALA D CB    1 
ATOM   7205 N  N     . ASP D 4 844 ? -50.831 31.211  53.755 1.00 47.99  ? 844 ASP D N     1 
ATOM   7206 C  CA    . ASP D 4 844 ? -49.641 31.858  54.298 1.00 48.51  ? 844 ASP D CA    1 
ATOM   7207 C  C     . ASP D 4 844 ? -48.888 32.431  53.127 1.00 48.23  ? 844 ASP D C     1 
ATOM   7208 O  O     . ASP D 4 844 ? -48.356 33.539  53.179 1.00 47.51  ? 844 ASP D O     1 
ATOM   7209 C  CB    . ASP D 4 844 ? -48.725 30.860  55.004 1.00 50.77  ? 844 ASP D CB    1 
ATOM   7210 C  CG    . ASP D 4 844 ? -49.350 30.246  56.229 1.00 54.71  ? 844 ASP D CG    1 
ATOM   7211 O  OD1   . ASP D 4 844 ? -49.955 30.993  57.026 1.00 57.12  ? 844 ASP D OD1   1 
ATOM   7212 O  OD2   . ASP D 4 844 ? -49.214 29.010  56.403 1.00 57.20  ? 844 ASP D OD2   1 
ATOM   7213 N  N     . PHE D 4 845 ? -48.836 31.645  52.067 1.00 47.86  ? 845 PHE D N     1 
ATOM   7214 C  CA    . PHE D 4 845 ? -48.143 32.055  50.863 1.00 50.85  ? 845 PHE D CA    1 
ATOM   7215 C  C     . PHE D 4 845 ? -48.762 33.364  50.383 1.00 52.00  ? 845 PHE D C     1 
ATOM   7216 O  O     . PHE D 4 845 ? -48.060 34.342  50.136 1.00 51.40  ? 845 PHE D O     1 
ATOM   7217 C  CB    . PHE D 4 845 ? -48.269 30.942  49.812 1.00 50.54  ? 845 PHE D CB    1 
ATOM   7218 C  CG    . PHE D 4 845 ? -47.643 31.267  48.507 1.00 50.74  ? 845 PHE D CG    1 
ATOM   7219 C  CD1   . PHE D 4 845 ? -46.485 32.023  48.446 1.00 53.14  ? 845 PHE D CD1   1 
ATOM   7220 C  CD2   . PHE D 4 845 ? -48.203 30.797  47.330 1.00 52.18  ? 845 PHE D CD2   1 
ATOM   7221 C  CE1   . PHE D 4 845 ? -45.894 32.305  47.220 1.00 55.46  ? 845 PHE D CE1   1 
ATOM   7222 C  CE2   . PHE D 4 845 ? -47.626 31.069  46.103 1.00 51.61  ? 845 PHE D CE2   1 
ATOM   7223 C  CZ    . PHE D 4 845 ? -46.475 31.820  46.043 1.00 54.13  ? 845 PHE D CZ    1 
ATOM   7224 N  N     . TYR D 4 846 ? -50.087 33.378  50.281 1.00 54.24  ? 846 TYR D N     1 
ATOM   7225 C  CA    . TYR D 4 846 ? -50.812 34.559  49.860 1.00 54.45  ? 846 TYR D CA    1 
ATOM   7226 C  C     . TYR D 4 846 ? -50.470 35.759  50.739 1.00 55.73  ? 846 TYR D C     1 
ATOM   7227 O  O     . TYR D 4 846 ? -50.225 36.847  50.230 1.00 55.08  ? 846 TYR D O     1 
ATOM   7228 C  CB    . TYR D 4 846 ? -52.319 34.296  49.883 1.00 54.78  ? 846 TYR D CB    1 
ATOM   7229 C  CG    . TYR D 4 846 ? -53.106 35.453  49.338 1.00 56.57  ? 846 TYR D CG    1 
ATOM   7230 C  CD1   . TYR D 4 846 ? -53.546 36.473  50.177 1.00 58.69  ? 846 TYR D CD1   1 
ATOM   7231 C  CD2   . TYR D 4 846 ? -53.319 35.585  47.967 1.00 56.78  ? 846 TYR D CD2   1 
ATOM   7232 C  CE1   . TYR D 4 846 ? -54.174 37.604  49.665 1.00 60.37  ? 846 TYR D CE1   1 
ATOM   7233 C  CE2   . TYR D 4 846 ? -53.941 36.705  47.445 1.00 58.86  ? 846 TYR D CE2   1 
ATOM   7234 C  CZ    . TYR D 4 846 ? -54.368 37.713  48.299 1.00 60.52  ? 846 TYR D CZ    1 
ATOM   7235 O  OH    . TYR D 4 846 ? -55.000 38.826  47.791 1.00 63.24  ? 846 TYR D OH    1 
ATOM   7236 N  N     . ASP D 4 847 ? -50.447 35.575  52.054 1.00 57.93  ? 847 ASP D N     1 
ATOM   7237 C  CA    . ASP D 4 847 ? -50.112 36.687  52.934 1.00 61.10  ? 847 ASP D CA    1 
ATOM   7238 C  C     . ASP D 4 847 ? -48.675 37.129  52.662 1.00 63.48  ? 847 ASP D C     1 
ATOM   7239 O  O     . ASP D 4 847 ? -48.233 38.162  53.147 1.00 65.41  ? 847 ASP D O     1 
ATOM   7240 C  CB    . ASP D 4 847 ? -50.256 36.300  54.414 1.00 62.20  ? 847 ASP D CB    1 
ATOM   7241 C  CG    . ASP D 4 847 ? -51.622 35.691  54.745 1.00 65.71  ? 847 ASP D CG    1 
ATOM   7242 O  OD1   . ASP D 4 847 ? -52.625 36.051  54.088 1.00 66.43  ? 847 ASP D OD1   1 
ATOM   7243 O  OD2   . ASP D 4 847 ? -51.694 34.855  55.678 1.00 66.32  ? 847 ASP D OD2   1 
ATOM   7244 N  N     . GLN D 4 848 ? -47.939 36.351  51.879 1.00 65.47  ? 848 GLN D N     1 
ATOM   7245 C  CA    . GLN D 4 848 ? -46.563 36.711  51.575 1.00 67.15  ? 848 GLN D CA    1 
ATOM   7246 C  C     . GLN D 4 848 ? -46.401 37.628  50.361 1.00 68.33  ? 848 GLN D C     1 
ATOM   7247 O  O     . GLN D 4 848 ? -45.468 38.432  50.310 1.00 70.01  ? 848 GLN D O     1 
ATOM   7248 C  CB    . GLN D 4 848 ? -45.725 35.452  51.377 1.00 68.18  ? 848 GLN D CB    1 
ATOM   7249 C  CG    . GLN D 4 848 ? -45.231 34.843  52.664 1.00 69.73  ? 848 GLN D CG    1 
ATOM   7250 C  CD    . GLN D 4 848 ? -44.166 35.687  53.321 1.00 71.23  ? 848 GLN D CD    1 
ATOM   7251 O  OE1   . GLN D 4 848 ? -43.814 35.473  54.484 1.00 72.27  ? 848 GLN D OE1   1 
ATOM   7252 N  NE2   . GLN D 4 848 ? -43.635 36.651  52.576 1.00 72.28  ? 848 GLN D NE2   1 
ATOM   7253 N  N     . PHE D 4 849 ? -47.292 37.523  49.383 1.00 67.88  ? 849 PHE D N     1 
ATOM   7254 C  CA    . PHE D 4 849 ? -47.174 38.371  48.204 1.00 68.94  ? 849 PHE D CA    1 
ATOM   7255 C  C     . PHE D 4 849 ? -48.331 39.332  48.003 1.00 71.06  ? 849 PHE D C     1 
ATOM   7256 O  O     . PHE D 4 849 ? -48.206 40.285  47.248 1.00 70.80  ? 849 PHE D O     1 
ATOM   7257 C  CB    . PHE D 4 849 ? -47.033 37.522  46.944 1.00 67.07  ? 849 PHE D CB    1 
ATOM   7258 C  CG    . PHE D 4 849 ? -48.190 36.619  46.705 1.00 65.14  ? 849 PHE D CG    1 
ATOM   7259 C  CD1   . PHE D 4 849 ? -48.165 35.310  47.151 1.00 66.21  ? 849 PHE D CD1   1 
ATOM   7260 C  CD2   . PHE D 4 849 ? -49.326 37.087  46.068 1.00 65.26  ? 849 PHE D CD2   1 
ATOM   7261 C  CE1   . PHE D 4 849 ? -49.263 34.474  46.967 1.00 66.10  ? 849 PHE D CE1   1 
ATOM   7262 C  CE2   . PHE D 4 849 ? -50.426 36.264  45.880 1.00 65.02  ? 849 PHE D CE2   1 
ATOM   7263 C  CZ    . PHE D 4 849 ? -50.395 34.956  46.330 1.00 65.47  ? 849 PHE D CZ    1 
ATOM   7264 N  N     . ALA D 4 850 ? -49.458 39.079  48.662 1.00 74.77  ? 850 ALA D N     1 
ATOM   7265 C  CA    . ALA D 4 850 ? -50.629 39.940  48.522 1.00 77.60  ? 850 ALA D CA    1 
ATOM   7266 C  C     . ALA D 4 850 ? -50.223 41.404  48.666 1.00 80.65  ? 850 ALA D C     1 
ATOM   7267 O  O     . ALA D 4 850 ? -50.492 42.225  47.791 1.00 80.67  ? 850 ALA D O     1 
ATOM   7268 C  CB    . ALA D 4 850 ? -51.665 39.577  49.559 1.00 76.43  ? 850 ALA D CB    1 
ATOM   7269 N  N     . ASP D 4 851 ? -49.577 41.725  49.780 1.00 84.50  ? 851 ASP D N     1 
ATOM   7270 C  CA    . ASP D 4 851 ? -49.110 43.084  50.024 1.00 87.41  ? 851 ASP D CA    1 
ATOM   7271 C  C     . ASP D 4 851 ? -47.794 43.261  49.277 1.00 89.10  ? 851 ASP D C     1 
ATOM   7272 O  O     . ASP D 4 851 ? -47.794 43.609  48.089 1.00 88.04  ? 851 ASP D O     1 
ATOM   7273 C  CB    . ASP D 4 851 ? -48.899 43.312  51.524 1.00 89.77  ? 851 ASP D CB    1 
ATOM   7274 C  CG    . ASP D 4 851 ? -48.129 42.177  52.186 1.00 92.62  ? 851 ASP D CG    1 
ATOM   7275 O  OD1   . ASP D 4 851 ? -48.635 41.029  52.197 1.00 92.96  ? 851 ASP D OD1   1 
ATOM   7276 O  OD2   . ASP D 4 851 ? -47.014 42.433  52.692 1.00 94.22  ? 851 ASP D OD2   1 
ATOM   7277 N  N     . GLN D 4 852 ? -46.684 42.990  49.967 1.00 90.66  ? 852 GLN D N     1 
ATOM   7278 C  CA    . GLN D 4 852 ? -45.350 43.124  49.380 1.00 92.27  ? 852 GLN D CA    1 
ATOM   7279 C  C     . GLN D 4 852 ? -45.309 42.685  47.923 1.00 91.74  ? 852 GLN D C     1 
ATOM   7280 O  O     . GLN D 4 852 ? -45.218 41.492  47.615 1.00 91.89  ? 852 GLN D O     1 
ATOM   7281 C  CB    . GLN D 4 852 ? -44.307 42.322  50.168 1.00 93.43  ? 852 GLN D CB    1 
ATOM   7282 C  CG    . GLN D 4 852 ? -42.914 42.386  49.528 1.00 95.91  ? 852 GLN D CG    1 
ATOM   7283 C  CD    . GLN D 4 852 ? -41.830 41.702  50.350 1.00 97.51  ? 852 GLN D CD    1 
ATOM   7284 O  OE1   . GLN D 4 852 ? -40.655 41.698  49.966 1.00 96.27  ? 852 GLN D OE1   1 
ATOM   7285 N  NE2   . GLN D 4 852 ? -42.217 41.121  51.485 1.00 99.28  ? 852 GLN D NE2   1 
ATOM   7286 N  N     . LEU D 4 853 ? -45.370 43.671  47.037 1.00 91.05  ? 853 LEU D N     1 
ATOM   7287 C  CA    . LEU D 4 853 ? -45.341 43.437  45.604 1.00 89.76  ? 853 LEU D CA    1 
ATOM   7288 C  C     . LEU D 4 853 ? -46.724 42.980  45.163 1.00 87.51  ? 853 LEU D C     1 
ATOM   7289 O  O     . LEU D 4 853 ? -47.136 41.880  45.490 1.00 87.71  ? 853 LEU D O     1 
ATOM   7290 C  CB    . LEU D 4 853 ? -44.285 42.371  45.272 1.00 91.16  ? 853 LEU D CB    1 
ATOM   7291 C  CG    . LEU D 4 853 ? -42.913 42.518  45.967 1.00 92.64  ? 853 LEU D CG    1 
ATOM   7292 C  CD1   . LEU D 4 853 ? -42.035 41.297  45.662 1.00 91.95  ? 853 LEU D CD1   1 
ATOM   7293 C  CD2   . LEU D 4 853 ? -42.228 43.820  45.526 1.00 91.59  ? 853 LEU D CD2   1 
ATOM   7294 N  N     . HIS D 4 854 ? -47.446 43.845  44.452 1.00 85.61  ? 854 HIS D N     1 
ATOM   7295 C  CA    . HIS D 4 854 ? -48.778 43.517  43.951 1.00 83.55  ? 854 HIS D CA    1 
ATOM   7296 C  C     . HIS D 4 854 ? -49.609 44.710  43.491 1.00 83.55  ? 854 HIS D C     1 
ATOM   7297 O  O     . HIS D 4 854 ? -49.083 45.735  43.065 1.00 84.32  ? 854 HIS D O     1 
ATOM   7298 C  CB    . HIS D 4 854 ? -49.579 42.750  44.994 1.00 82.14  ? 854 HIS D CB    1 
ATOM   7299 C  CG    . HIS D 4 854 ? -50.431 41.666  44.412 1.00 81.30  ? 854 HIS D CG    1 
ATOM   7300 N  ND1   . HIS D 4 854 ? -51.238 40.856  45.183 1.00 82.28  ? 854 HIS D ND1   1 
ATOM   7301 C  CD2   . HIS D 4 854 ? -50.575 41.235  43.138 1.00 80.84  ? 854 HIS D CD2   1 
ATOM   7302 C  CE1   . HIS D 4 854 ? -51.840 39.971  44.410 1.00 80.87  ? 854 HIS D CE1   1 
ATOM   7303 N  NE2   . HIS D 4 854 ? -51.454 40.179  43.164 1.00 81.26  ? 854 HIS D NE2   1 
ATOM   7304 N  N     . GLU D 4 855 ? -50.923 44.548  43.585 1.00 82.84  ? 855 GLU D N     1 
ATOM   7305 C  CA    . GLU D 4 855 ? -51.906 45.552  43.179 1.00 81.35  ? 855 GLU D CA    1 
ATOM   7306 C  C     . GLU D 4 855 ? -51.643 46.234  41.849 1.00 80.66  ? 855 GLU D C     1 
ATOM   7307 O  O     . GLU D 4 855 ? -51.368 45.573  40.851 1.00 80.48  ? 855 GLU D O     1 
ATOM   7308 C  CB    . GLU D 4 855 ? -52.093 46.630  44.251 1.00 81.21  ? 855 GLU D CB    1 
ATOM   7309 C  CG    . GLU D 4 855 ? -53.536 47.148  44.309 1.00 79.59  ? 855 GLU D CG    1 
ATOM   7310 C  CD    . GLU D 4 855 ? -54.045 47.665  42.968 1.00 78.22  ? 855 GLU D CD    1 
ATOM   7311 O  OE1   . GLU D 4 855 ? -53.740 48.834  42.657 1.00 77.99  ? 855 GLU D OE1   1 
ATOM   7312 O  OE2   . GLU D 4 855 ? -54.727 46.910  42.226 1.00 73.50  ? 855 GLU D OE2   1 
ATOM   7313 N  N     . SER D 4 856 ? -51.722 47.565  41.851 1.00 79.98  ? 856 SER D N     1 
ATOM   7314 C  CA    . SER D 4 856 ? -51.560 48.364  40.639 1.00 78.25  ? 856 SER D CA    1 
ATOM   7315 C  C     . SER D 4 856 ? -52.458 47.730  39.576 1.00 77.75  ? 856 SER D C     1 
ATOM   7316 O  O     . SER D 4 856 ? -52.073 47.622  38.414 1.00 77.22  ? 856 SER D O     1 
ATOM   7317 C  CB    . SER D 4 856 ? -50.104 48.365  40.177 1.00 78.03  ? 856 SER D CB    1 
ATOM   7318 O  OG    . SER D 4 856 ? -49.274 49.023  41.117 1.00 77.75  ? 856 SER D OG    1 
ATOM   7319 N  N     . GLN D 4 857 ? -53.650 47.305  40.010 1.00 76.64  ? 857 GLN D N     1 
ATOM   7320 C  CA    . GLN D 4 857 ? -54.649 46.654  39.161 1.00 75.65  ? 857 GLN D CA    1 
ATOM   7321 C  C     . GLN D 4 857 ? -54.678 45.139  39.375 1.00 75.27  ? 857 GLN D C     1 
ATOM   7322 O  O     . GLN D 4 857 ? -55.723 44.508  39.199 1.00 74.53  ? 857 GLN D O     1 
ATOM   7323 C  CB    . GLN D 4 857 ? -54.385 46.968  37.683 1.00 76.23  ? 857 GLN D CB    1 
ATOM   7324 C  CG    . GLN D 4 857 ? -54.607 45.809  36.716 1.00 77.91  ? 857 GLN D CG    1 
ATOM   7325 C  CD    . GLN D 4 857 ? -53.477 45.678  35.691 1.00 78.03  ? 857 GLN D CD    1 
ATOM   7326 O  OE1   . GLN D 4 857 ? -53.224 46.590  34.894 1.00 77.97  ? 857 GLN D OE1   1 
ATOM   7327 N  NE2   . GLN D 4 857 ? -52.795 44.541  35.714 1.00 76.47  ? 857 GLN D NE2   1 
ATOM   7328 N  N     . LEU D 4 858 ? -53.531 44.559  39.742 1.00 73.62  ? 858 LEU D N     1 
ATOM   7329 C  CA    . LEU D 4 858 ? -53.430 43.114  39.970 1.00 71.17  ? 858 LEU D CA    1 
ATOM   7330 C  C     . LEU D 4 858 ? -54.350 42.679  41.101 1.00 72.21  ? 858 LEU D C     1 
ATOM   7331 O  O     . LEU D 4 858 ? -54.043 42.876  42.278 1.00 73.77  ? 858 LEU D O     1 
ATOM   7332 C  CB    . LEU D 4 858 ? -51.995 42.699  40.333 1.00 67.16  ? 858 LEU D CB    1 
ATOM   7333 C  CG    . LEU D 4 858 ? -50.821 42.669  39.350 1.00 62.29  ? 858 LEU D CG    1 
ATOM   7334 C  CD1   . LEU D 4 858 ? -49.550 42.491  40.140 1.00 58.10  ? 858 LEU D CD1   1 
ATOM   7335 C  CD2   . LEU D 4 858 ? -50.973 41.555  38.341 1.00 60.06  ? 858 LEU D CD2   1 
ATOM   7336 N  N     . ASP D 4 859 ? -55.485 42.097  40.743 1.00 72.25  ? 859 ASP D N     1 
ATOM   7337 C  CA    . ASP D 4 859 ? -56.445 41.609  41.726 1.00 72.27  ? 859 ASP D CA    1 
ATOM   7338 C  C     . ASP D 4 859 ? -57.451 40.745  41.005 1.00 73.05  ? 859 ASP D C     1 
ATOM   7339 O  O     . ASP D 4 859 ? -58.656 40.767  41.275 1.00 72.49  ? 859 ASP D O     1 
ATOM   7340 C  CB    . ASP D 4 859 ? -57.121 42.761  42.465 1.00 70.47  ? 859 ASP D CB    1 
ATOM   7341 C  CG    . ASP D 4 859 ? -56.676 42.843  43.907 1.00 69.88  ? 859 ASP D CG    1 
ATOM   7342 O  OD1   . ASP D 4 859 ? -56.562 43.959  44.452 1.00 70.69  ? 859 ASP D OD1   1 
ATOM   7343 O  OD2   . ASP D 4 859 ? -56.442 41.776  44.504 1.00 70.27  ? 859 ASP D OD2   1 
ATOM   7344 N  N     . LYS D 4 860 ? -56.899 40.002  40.052 1.00 72.87  ? 860 LYS D N     1 
ATOM   7345 C  CA    . LYS D 4 860 ? -57.623 39.051  39.242 1.00 73.17  ? 860 LYS D CA    1 
ATOM   7346 C  C     . LYS D 4 860 ? -57.032 37.738  39.728 1.00 71.95  ? 860 LYS D C     1 
ATOM   7347 O  O     . LYS D 4 860 ? -57.009 36.722  39.026 1.00 72.58  ? 860 LYS D O     1 
ATOM   7348 C  CB    . LYS D 4 860 ? -57.324 39.299  37.767 1.00 75.23  ? 860 LYS D CB    1 
ATOM   7349 C  CG    . LYS D 4 860 ? -57.756 40.689  37.329 1.00 79.29  ? 860 LYS D CG    1 
ATOM   7350 C  CD    . LYS D 4 860 ? -59.207 40.939  37.753 1.00 82.44  ? 860 LYS D CD    1 
ATOM   7351 C  CE    . LYS D 4 860 ? -59.644 42.385  37.559 1.00 82.90  ? 860 LYS D CE    1 
ATOM   7352 N  NZ    . LYS D 4 860 ? -61.062 42.567  37.995 1.00 82.40  ? 860 LYS D NZ    1 
ATOM   7353 N  N     . MET D 4 861 ? -56.531 37.806  40.959 1.00 69.04  ? 861 MET D N     1 
ATOM   7354 C  CA    . MET D 4 861 ? -55.930 36.679  41.643 1.00 66.15  ? 861 MET D CA    1 
ATOM   7355 C  C     . MET D 4 861 ? -57.043 35.726  42.043 1.00 63.77  ? 861 MET D C     1 
ATOM   7356 O  O     . MET D 4 861 ? -57.885 36.060  42.871 1.00 63.34  ? 861 MET D O     1 
ATOM   7357 C  CB    . MET D 4 861 ? -55.190 37.171  42.886 1.00 66.62  ? 861 MET D CB    1 
ATOM   7358 C  CG    . MET D 4 861 ? -54.651 36.065  43.769 1.00 67.53  ? 861 MET D CG    1 
ATOM   7359 S  SD    . MET D 4 861 ? -53.611 34.935  42.852 1.00 70.69  ? 861 MET D SD    1 
ATOM   7360 C  CE    . MET D 4 861 ? -52.074 35.821  42.901 1.00 70.35  ? 861 MET D CE    1 
ATOM   7361 N  N     . PRO D 4 862 ? -57.066 34.527  41.451 1.00 61.62  ? 862 PRO D N     1 
ATOM   7362 C  CA    . PRO D 4 862 ? -58.092 33.531  41.760 1.00 60.74  ? 862 PRO D CA    1 
ATOM   7363 C  C     . PRO D 4 862 ? -58.176 33.350  43.264 1.00 60.61  ? 862 PRO D C     1 
ATOM   7364 O  O     . PRO D 4 862 ? -57.209 33.622  43.977 1.00 61.58  ? 862 PRO D O     1 
ATOM   7365 C  CB    . PRO D 4 862 ? -57.577 32.279  41.063 1.00 60.91  ? 862 PRO D CB    1 
ATOM   7366 C  CG    . PRO D 4 862 ? -56.841 32.830  39.890 1.00 62.37  ? 862 PRO D CG    1 
ATOM   7367 C  CD    . PRO D 4 862 ? -56.080 33.986  40.503 1.00 62.22  ? 862 PRO D CD    1 
ATOM   7368 N  N     . ALA D 4 863 ? -59.319 32.885  43.753 1.00 59.38  ? 863 ALA D N     1 
ATOM   7369 C  CA    . ALA D 4 863 ? -59.481 32.684  45.185 1.00 57.75  ? 863 ALA D CA    1 
ATOM   7370 C  C     . ALA D 4 863 ? -58.820 31.397  45.667 1.00 56.73  ? 863 ALA D C     1 
ATOM   7371 O  O     . ALA D 4 863 ? -58.671 30.436  44.909 1.00 54.12  ? 863 ALA D O     1 
ATOM   7372 C  CB    . ALA D 4 863 ? -60.949 32.672  45.542 1.00 57.61  ? 863 ALA D CB    1 
ATOM   7373 N  N     . LEU D 4 864 ? -58.418 31.400  46.936 1.00 57.12  ? 864 LEU D N     1 
ATOM   7374 C  CA    . LEU D 4 864 ? -57.799 30.236  47.553 1.00 57.15  ? 864 LEU D CA    1 
ATOM   7375 C  C     . LEU D 4 864 ? -58.723 29.076  47.289 1.00 57.93  ? 864 LEU D C     1 
ATOM   7376 O  O     . LEU D 4 864 ? -59.931 29.210  47.415 1.00 59.37  ? 864 LEU D O     1 
ATOM   7377 C  CB    . LEU D 4 864 ? -57.667 30.434  49.062 1.00 55.73  ? 864 LEU D CB    1 
ATOM   7378 C  CG    . LEU D 4 864 ? -56.524 31.322  49.548 1.00 56.83  ? 864 LEU D CG    1 
ATOM   7379 C  CD1   . LEU D 4 864 ? -56.627 31.551  51.041 1.00 56.90  ? 864 LEU D CD1   1 
ATOM   7380 C  CD2   . LEU D 4 864 ? -55.207 30.655  49.207 1.00 58.67  ? 864 LEU D CD2   1 
ATOM   7381 N  N     . PRO D 4 865 ? -58.174 27.920  46.915 1.00 59.51  ? 865 PRO D N     1 
ATOM   7382 C  CA    . PRO D 4 865 ? -59.014 26.754  46.643 1.00 61.10  ? 865 PRO D CA    1 
ATOM   7383 C  C     . PRO D 4 865 ? -59.856 26.382  47.863 1.00 62.26  ? 865 PRO D C     1 
ATOM   7384 O  O     . PRO D 4 865 ? -59.457 26.620  49.006 1.00 61.32  ? 865 PRO D O     1 
ATOM   7385 C  CB    . PRO D 4 865 ? -57.997 25.680  46.294 1.00 61.34  ? 865 PRO D CB    1 
ATOM   7386 C  CG    . PRO D 4 865 ? -56.858 26.033  47.184 1.00 62.68  ? 865 PRO D CG    1 
ATOM   7387 C  CD    . PRO D 4 865 ? -56.757 27.533  46.980 1.00 61.12  ? 865 PRO D CD    1 
ATOM   7388 N  N     . ALA D 4 866 ? -61.027 25.806  47.617 1.00 63.51  ? 866 ALA D N     1 
ATOM   7389 C  CA    . ALA D 4 866 ? -61.910 25.412  48.704 1.00 64.53  ? 866 ALA D CA    1 
ATOM   7390 C  C     . ALA D 4 866 ? -61.322 24.213  49.449 1.00 65.17  ? 866 ALA D C     1 
ATOM   7391 O  O     . ALA D 4 866 ? -60.782 23.293  48.831 1.00 66.39  ? 866 ALA D O     1 
ATOM   7392 C  CB    . ALA D 4 866 ? -63.276 25.065  48.150 1.00 64.94  ? 866 ALA D CB    1 
ATOM   7393 N  N     . LYS D 4 867 ? -61.418 24.225  50.774 1.00 64.34  ? 867 LYS D N     1 
ATOM   7394 C  CA    . LYS D 4 867 ? -60.896 23.126  51.566 1.00 63.46  ? 867 LYS D CA    1 
ATOM   7395 C  C     . LYS D 4 867 ? -61.799 21.908  51.408 1.00 62.49  ? 867 LYS D C     1 
ATOM   7396 O  O     . LYS D 4 867 ? -62.917 22.019  50.900 1.00 63.22  ? 867 LYS D O     1 
ATOM   7397 C  CB    . LYS D 4 867 ? -60.788 23.541  53.033 1.00 64.66  ? 867 LYS D CB    1 
ATOM   7398 C  CG    . LYS D 4 867 ? -59.827 24.708  53.255 1.00 67.54  ? 867 LYS D CG    1 
ATOM   7399 C  CD    . LYS D 4 867 ? -58.390 24.348  52.831 1.00 69.92  ? 867 LYS D CD    1 
ATOM   7400 C  CE    . LYS D 4 867 ? -57.446 25.551  52.879 1.00 70.03  ? 867 LYS D CE    1 
ATOM   7401 N  NZ    . LYS D 4 867 ? -57.625 26.482  51.719 1.00 70.20  ? 867 LYS D NZ    1 
ATOM   7402 N  N     . GLY D 4 868 ? -61.301 20.746  51.820 1.00 60.83  ? 868 GLY D N     1 
ATOM   7403 C  CA    . GLY D 4 868 ? -62.065 19.520  51.699 1.00 58.54  ? 868 GLY D CA    1 
ATOM   7404 C  C     . GLY D 4 868 ? -62.449 18.943  53.044 1.00 58.23  ? 868 GLY D C     1 
ATOM   7405 O  O     . GLY D 4 868 ? -62.372 19.621  54.067 1.00 57.41  ? 868 GLY D O     1 
ATOM   7406 N  N     . ASN D 4 869 ? -62.857 17.680  53.051 1.00 58.14  ? 869 ASN D N     1 
ATOM   7407 C  CA    . ASN D 4 869 ? -63.270 17.047  54.294 1.00 58.49  ? 869 ASN D CA    1 
ATOM   7408 C  C     . ASN D 4 869 ? -62.308 15.984  54.791 1.00 57.79  ? 869 ASN D C     1 
ATOM   7409 O  O     . ASN D 4 869 ? -62.624 15.241  55.715 1.00 59.48  ? 869 ASN D O     1 
ATOM   7410 C  CB    . ASN D 4 869 ? -64.680 16.459  54.139 1.00 60.28  ? 869 ASN D CB    1 
ATOM   7411 C  CG    . ASN D 4 869 ? -65.757 17.544  54.061 1.00 62.74  ? 869 ASN D CG    1 
ATOM   7412 O  OD1   . ASN D 4 869 ? -66.034 18.241  55.051 1.00 62.12  ? 869 ASN D OD1   1 
ATOM   7413 N  ND2   . ASN D 4 869 ? -66.356 17.703  52.875 1.00 60.80  ? 869 ASN D ND2   1 
ATOM   7414 N  N     . LEU D 4 870 ? -61.134 15.914  54.180 1.00 56.03  ? 870 LEU D N     1 
ATOM   7415 C  CA    . LEU D 4 870 ? -60.131 14.953  54.595 1.00 54.28  ? 870 LEU D CA    1 
ATOM   7416 C  C     . LEU D 4 870 ? -59.728 15.288  56.025 1.00 55.02  ? 870 LEU D C     1 
ATOM   7417 O  O     . LEU D 4 870 ? -59.226 16.381  56.288 1.00 55.18  ? 870 LEU D O     1 
ATOM   7418 C  CB    . LEU D 4 870 ? -58.905 15.046  53.693 1.00 52.69  ? 870 LEU D CB    1 
ATOM   7419 C  CG    . LEU D 4 870 ? -57.599 14.493  54.269 1.00 50.78  ? 870 LEU D CG    1 
ATOM   7420 C  CD1   . LEU D 4 870 ? -57.732 12.996  54.459 1.00 51.31  ? 870 LEU D CD1   1 
ATOM   7421 C  CD2   . LEU D 4 870 ? -56.447 14.802  53.339 1.00 48.02  ? 870 LEU D CD2   1 
ATOM   7422 N  N     . ASN D 4 871 ? -59.966 14.354  56.944 1.00 53.65  ? 871 ASN D N     1 
ATOM   7423 C  CA    . ASN D 4 871 ? -59.609 14.537  58.348 1.00 52.14  ? 871 ASN D CA    1 
ATOM   7424 C  C     . ASN D 4 871 ? -58.113 14.232  58.466 1.00 51.82  ? 871 ASN D C     1 
ATOM   7425 O  O     . ASN D 4 871 ? -57.716 13.069  58.530 1.00 50.76  ? 871 ASN D O     1 
ATOM   7426 C  CB    . ASN D 4 871 ? -60.407 13.564  59.207 1.00 51.74  ? 871 ASN D CB    1 
ATOM   7427 C  CG    . ASN D 4 871 ? -60.059 13.655  60.671 1.00 53.79  ? 871 ASN D CG    1 
ATOM   7428 O  OD1   . ASN D 4 871 ? -60.212 12.688  61.411 1.00 57.27  ? 871 ASN D OD1   1 
ATOM   7429 N  ND2   . ASN D 4 871 ? -59.604 14.818  61.107 1.00 54.77  ? 871 ASN D ND2   1 
ATOM   7430 N  N     . LEU D 4 872 ? -57.284 15.270  58.499 1.00 50.59  ? 872 LEU D N     1 
ATOM   7431 C  CA    . LEU D 4 872 ? -55.841 15.059  58.568 1.00 50.05  ? 872 LEU D CA    1 
ATOM   7432 C  C     . LEU D 4 872 ? -55.374 14.103  59.661 1.00 51.43  ? 872 LEU D C     1 
ATOM   7433 O  O     . LEU D 4 872 ? -54.397 13.377  59.478 1.00 52.12  ? 872 LEU D O     1 
ATOM   7434 C  CB    . LEU D 4 872 ? -55.111 16.389  58.721 1.00 46.24  ? 872 LEU D CB    1 
ATOM   7435 C  CG    . LEU D 4 872 ? -55.181 17.342  57.531 1.00 43.90  ? 872 LEU D CG    1 
ATOM   7436 C  CD1   . LEU D 4 872 ? -54.505 18.649  57.899 1.00 43.42  ? 872 LEU D CD1   1 
ATOM   7437 C  CD2   . LEU D 4 872 ? -54.536 16.710  56.321 1.00 41.46  ? 872 LEU D CD2   1 
ATOM   7438 N  N     . ARG D 4 873 ? -56.068 14.078  60.788 1.00 52.14  ? 873 ARG D N     1 
ATOM   7439 C  CA    . ARG D 4 873 ? -55.641 13.206  61.868 1.00 53.93  ? 873 ARG D CA    1 
ATOM   7440 C  C     . ARG D 4 873 ? -55.770 11.707  61.521 1.00 53.64  ? 873 ARG D C     1 
ATOM   7441 O  O     . ARG D 4 873 ? -55.257 10.843  62.231 1.00 53.85  ? 873 ARG D O     1 
ATOM   7442 C  CB    . ARG D 4 873 ? -56.410 13.561  63.144 1.00 55.17  ? 873 ARG D CB    1 
ATOM   7443 C  CG    . ARG D 4 873 ? -55.838 12.922  64.382 1.00 62.49  ? 873 ARG D CG    1 
ATOM   7444 C  CD    . ARG D 4 873 ? -56.390 13.514  65.669 1.00 66.53  ? 873 ARG D CD    1 
ATOM   7445 N  NE    . ARG D 4 873 ? -55.625 14.669  66.136 1.00 69.39  ? 873 ARG D NE    1 
ATOM   7446 C  CZ    . ARG D 4 873 ? -55.614 15.857  65.542 1.00 71.01  ? 873 ARG D CZ    1 
ATOM   7447 N  NH1   . ARG D 4 873 ? -56.325 16.064  64.443 1.00 72.03  ? 873 ARG D NH1   1 
ATOM   7448 N  NH2   . ARG D 4 873 ? -54.908 16.849  66.062 1.00 72.78  ? 873 ARG D NH2   1 
ATOM   7449 N  N     . ASP D 4 874 ? -56.441 11.400  60.419 1.00 53.45  ? 874 ASP D N     1 
ATOM   7450 C  CA    . ASP D 4 874 ? -56.596 10.015  59.986 1.00 52.75  ? 874 ASP D CA    1 
ATOM   7451 C  C     . ASP D 4 874 ? -55.276 9.455   59.511 1.00 50.30  ? 874 ASP D C     1 
ATOM   7452 O  O     . ASP D 4 874 ? -55.044 8.251   59.573 1.00 50.15  ? 874 ASP D O     1 
ATOM   7453 C  CB    . ASP D 4 874 ? -57.602 9.920   58.847 1.00 58.15  ? 874 ASP D CB    1 
ATOM   7454 C  CG    . ASP D 4 874 ? -59.015 9.745   59.339 1.00 62.75  ? 874 ASP D CG    1 
ATOM   7455 O  OD1   . ASP D 4 874 ? -59.508 10.621  60.088 1.00 65.48  ? 874 ASP D OD1   1 
ATOM   7456 O  OD2   . ASP D 4 874 ? -59.631 8.720   58.976 1.00 66.59  ? 874 ASP D OD2   1 
ATOM   7457 N  N     . ILE D 4 875 ? -54.425 10.339  59.002 1.00 48.43  ? 875 ILE D N     1 
ATOM   7458 C  CA    . ILE D 4 875 ? -53.096 9.967   58.518 1.00 45.76  ? 875 ILE D CA    1 
ATOM   7459 C  C     . ILE D 4 875 ? -52.341 9.163   59.594 1.00 43.65  ? 875 ILE D C     1 
ATOM   7460 O  O     . ILE D 4 875 ? -51.556 8.271   59.287 1.00 43.25  ? 875 ILE D O     1 
ATOM   7461 C  CB    . ILE D 4 875 ? -52.291 11.248  58.142 1.00 46.21  ? 875 ILE D CB    1 
ATOM   7462 C  CG1   . ILE D 4 875 ? -53.043 12.005  57.035 1.00 47.66  ? 875 ILE D CG1   1 
ATOM   7463 C  CG2   . ILE D 4 875 ? -50.876 10.884  57.700 1.00 44.55  ? 875 ILE D CG2   1 
ATOM   7464 C  CD1   . ILE D 4 875 ? -52.437 13.346  56.642 1.00 45.94  ? 875 ILE D CD1   1 
ATOM   7465 N  N     . LEU D 4 876 ? -52.592 9.479   60.858 1.00 40.94  ? 876 LEU D N     1 
ATOM   7466 C  CA    . LEU D 4 876 ? -51.948 8.771   61.948 1.00 40.44  ? 876 LEU D CA    1 
ATOM   7467 C  C     . LEU D 4 876 ? -52.308 7.294   61.922 1.00 41.66  ? 876 LEU D C     1 
ATOM   7468 O  O     . LEU D 4 876 ? -51.513 6.454   62.326 1.00 41.64  ? 876 LEU D O     1 
ATOM   7469 C  CB    . LEU D 4 876 ? -52.372 9.365   63.291 1.00 36.03  ? 876 LEU D CB    1 
ATOM   7470 C  CG    . LEU D 4 876 ? -51.597 10.525  63.913 1.00 37.76  ? 876 LEU D CG    1 
ATOM   7471 C  CD1   . LEU D 4 876 ? -50.976 11.416  62.847 1.00 37.97  ? 876 LEU D CD1   1 
ATOM   7472 C  CD2   . LEU D 4 876 ? -52.536 11.311  64.812 1.00 35.57  ? 876 LEU D CD2   1 
ATOM   7473 N  N     . GLU D 4 877 ? -53.507 6.978   61.440 1.00 45.14  ? 877 GLU D N     1 
ATOM   7474 C  CA    . GLU D 4 877 ? -53.975 5.591   61.410 1.00 48.08  ? 877 GLU D CA    1 
ATOM   7475 C  C     . GLU D 4 877 ? -53.885 4.982   60.025 1.00 46.63  ? 877 GLU D C     1 
ATOM   7476 O  O     . GLU D 4 877 ? -54.475 3.946   59.758 1.00 47.03  ? 877 GLU D O     1 
ATOM   7477 C  CB    . GLU D 4 877 ? -55.428 5.503   61.904 1.00 52.38  ? 877 GLU D CB    1 
ATOM   7478 C  CG    . GLU D 4 877 ? -55.782 6.446   63.068 1.00 60.11  ? 877 GLU D CG    1 
ATOM   7479 C  CD    . GLU D 4 877 ? -55.194 6.012   64.414 1.00 64.02  ? 877 GLU D CD    1 
ATOM   7480 O  OE1   . GLU D 4 877 ? -53.955 5.844   64.506 1.00 66.56  ? 877 GLU D OE1   1 
ATOM   7481 O  OE2   . GLU D 4 877 ? -55.975 5.846   65.385 1.00 66.10  ? 877 GLU D OE2   1 
ATOM   7482 N  N     . SER D 4 878 ? -53.150 5.625   59.135 1.00 46.24  ? 878 SER D N     1 
ATOM   7483 C  CA    . SER D 4 878 ? -53.006 5.095   57.795 1.00 44.81  ? 878 SER D CA    1 
ATOM   7484 C  C     . SER D 4 878 ? -51.762 4.240   57.685 1.00 44.87  ? 878 SER D C     1 
ATOM   7485 O  O     . SER D 4 878 ? -50.651 4.724   57.827 1.00 44.92  ? 878 SER D O     1 
ATOM   7486 C  CB    . SER D 4 878 ? -52.923 6.214   56.776 1.00 43.97  ? 878 SER D CB    1 
ATOM   7487 O  OG    . SER D 4 878 ? -52.723 5.645   55.499 1.00 45.31  ? 878 SER D OG    1 
ATOM   7488 N  N     . ASP D 4 879 ? -51.968 2.964   57.409 1.00 45.50  ? 879 ASP D N     1 
ATOM   7489 C  CA    . ASP D 4 879 ? -50.887 2.012   57.278 1.00 45.29  ? 879 ASP D CA    1 
ATOM   7490 C  C     . ASP D 4 879 ? -49.967 2.268   56.124 1.00 44.19  ? 879 ASP D C     1 
ATOM   7491 O  O     . ASP D 4 879 ? -48.760 2.102   56.236 1.00 46.26  ? 879 ASP D O     1 
ATOM   7492 C  CB    . ASP D 4 879 ? -51.442 0.606   57.079 1.00 48.75  ? 879 ASP D CB    1 
ATOM   7493 C  CG    . ASP D 4 879 ? -51.611 -0.139  58.370 1.00 53.64  ? 879 ASP D CG    1 
ATOM   7494 O  OD1   . ASP D 4 879 ? -51.771 -1.382  58.299 1.00 56.23  ? 879 ASP D OD1   1 
ATOM   7495 O  OD2   . ASP D 4 879 ? -51.584 0.512   59.447 1.00 54.99  ? 879 ASP D OD2   1 
ATOM   7496 N  N     . PHE D 4 880 ? -50.552 2.661   55.005 1.00 43.50  ? 880 PHE D N     1 
ATOM   7497 C  CA    . PHE D 4 880 ? -49.815 2.843   53.770 1.00 42.01  ? 880 PHE D CA    1 
ATOM   7498 C  C     . PHE D 4 880 ? -49.328 4.208   53.340 1.00 42.17  ? 880 PHE D C     1 
ATOM   7499 O  O     . PHE D 4 880 ? -48.751 4.333   52.261 1.00 43.70  ? 880 PHE D O     1 
ATOM   7500 C  CB    . PHE D 4 880 ? -50.647 2.227   52.665 1.00 38.56  ? 880 PHE D CB    1 
ATOM   7501 C  CG    . PHE D 4 880 ? -51.197 0.896   53.034 1.00 38.74  ? 880 PHE D CG    1 
ATOM   7502 C  CD1   . PHE D 4 880 ? -50.344 -0.162  53.317 1.00 38.97  ? 880 PHE D CD1   1 
ATOM   7503 C  CD2   . PHE D 4 880 ? -52.574 0.691   53.117 1.00 40.61  ? 880 PHE D CD2   1 
ATOM   7504 C  CE1   . PHE D 4 880 ? -50.846 -1.413  53.676 1.00 39.68  ? 880 PHE D CE1   1 
ATOM   7505 C  CE2   . PHE D 4 880 ? -53.090 -0.560  53.475 1.00 39.57  ? 880 PHE D CE2   1 
ATOM   7506 C  CZ    . PHE D 4 880 ? -52.220 -1.612  53.752 1.00 38.54  ? 880 PHE D CZ    1 
ATOM   7507 N  N     . ALA D 4 881 ? -49.538 5.224   54.166 1.00 40.76  ? 881 ALA D N     1 
ATOM   7508 C  CA    . ALA D 4 881 ? -49.103 6.561   53.816 1.00 40.76  ? 881 ALA D CA    1 
ATOM   7509 C  C     . ALA D 4 881 ? -47.589 6.666   53.838 1.00 43.16  ? 881 ALA D C     1 
ATOM   7510 O  O     . ALA D 4 881 ? -46.991 7.217   52.920 1.00 44.02  ? 881 ALA D O     1 
ATOM   7511 C  CB    . ALA D 4 881 ? -49.687 7.553   54.780 1.00 40.26  ? 881 ALA D CB    1 
ATOM   7512 N  N     . PHE D 4 882 ? -46.982 6.109   54.884 1.00 46.53  ? 882 PHE D N     1 
ATOM   7513 C  CA    . PHE D 4 882 ? -45.538 6.156   55.097 1.00 47.74  ? 882 PHE D CA    1 
ATOM   7514 C  C     . PHE D 4 882 ? -45.177 7.618   55.328 1.00 48.93  ? 882 PHE D C     1 
ATOM   7515 O  O     . PHE D 4 882 ? -45.276 8.106   56.443 1.00 51.36  ? 882 PHE D O     1 
ATOM   7516 C  CB    . PHE D 4 882 ? -44.791 5.601   53.897 1.00 47.59  ? 882 PHE D CB    1 
ATOM   7517 C  CG    . PHE D 4 882 ? -44.690 4.114   53.887 1.00 46.68  ? 882 PHE D CG    1 
ATOM   7518 C  CD1   . PHE D 4 882 ? -44.004 3.458   52.863 1.00 48.57  ? 882 PHE D CD1   1 
ATOM   7519 C  CD2   . PHE D 4 882 ? -45.291 3.367   54.868 1.00 47.56  ? 882 PHE D CD2   1 
ATOM   7520 C  CE1   . PHE D 4 882 ? -43.921 2.071   52.809 1.00 49.25  ? 882 PHE D CE1   1 
ATOM   7521 C  CE2   . PHE D 4 882 ? -45.220 1.970   54.830 1.00 52.34  ? 882 PHE D CE2   1 
ATOM   7522 C  CZ    . PHE D 4 882 ? -44.532 1.321   53.793 1.00 51.90  ? 882 PHE D CZ    1 
ATOM   7523 N  N     . ALA D 4 883 ? -44.766 8.325   54.287 1.00 50.13  ? 883 ALA D N     1 
ATOM   7524 C  CA    . ALA D 4 883 ? -44.455 9.741   54.435 1.00 50.68  ? 883 ALA D CA    1 
ATOM   7525 C  C     . ALA D 4 883 ? -45.751 10.446  54.813 1.00 51.45  ? 883 ALA D C     1 
ATOM   7526 O  O     . ALA D 4 883 ? -46.695 9.733   55.214 1.00 51.19  ? 883 ALA D O     1 
ATOM   7527 C  CB    . ALA D 4 883 ? -43.928 10.305  53.139 1.00 51.99  ? 883 ALA D CB    1 
ATOM   7528 O  OXT   . ALA D 4 883 ? -45.810 11.691  54.711 1.00 51.77  ? 883 ALA D OXT   1 
HETATM 7529 MG MG    . MG  E 5 .   ? -37.716 8.962   43.124 1.00 39.72  ? 902 MG  R MG    1 
HETATM 7530 MG MG    . MG  F 5 .   ? -41.741 8.284   46.446 1.00 61.98  ? 903 MG  D MG    1 
HETATM 7531 P  P1    . POP G 6 .   ? -43.543 3.632   44.168 1.00 145.39 ? 901 POP D P1    1 
HETATM 7532 O  O1    . POP G 6 .   ? -44.235 2.831   45.257 1.00 145.40 ? 901 POP D O1    1 
HETATM 7533 O  O2    . POP G 6 .   ? -43.627 2.981   42.842 1.00 144.68 ? 901 POP D O2    1 
HETATM 7534 O  O3    . POP G 6 .   ? -42.083 3.894   44.599 1.00 145.29 ? 901 POP D O3    1 
HETATM 7535 O  O     . POP G 6 .   ? -44.320 5.068   44.071 1.00 145.33 ? 901 POP D O     1 
HETATM 7536 P  P2    . POP G 6 .   ? -44.910 6.056   45.147 1.00 145.57 ? 901 POP D P2    1 
HETATM 7537 O  O4    . POP G 6 .   ? -44.148 5.855   46.373 1.00 145.23 ? 901 POP D O4    1 
HETATM 7538 O  O5    . POP G 6 .   ? -44.773 7.428   44.579 1.00 144.40 ? 901 POP D O5    1 
HETATM 7539 O  O6    . POP G 6 .   ? -46.353 5.627   45.308 1.00 145.55 ? 901 POP D O6    1 
HETATM 7540 O  O     . HOH H 7 .   ? -43.617 9.862   45.273 1.00 54.51  ? 904 HOH D O     1 
# 
_database_PDB_caveat.id     1 
_database_PDB_caveat.text   'chirality error at MET362D, CA center' 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DG  1   130 130 DG  G   T . n 
A 1 2   DC  2   129 129 DC  C   T . n 
A 1 3   DC  3   128 128 DC  C   T . n 
A 1 4   DG  4   127 127 DG  G   T . n 
A 1 5   DT  5   126 126 DT  T   T . n 
A 1 6   DG  6   125 125 DG  G   T . n 
A 1 7   DC  7   124 124 DC  C   T . n 
A 1 8   DG  8   123 123 DG  G   T . n 
A 1 9   DC  9   122 122 DC  C   T . n 
A 1 10  DA  10  121 121 DA  A   T . n 
A 1 11  DT  11  120 120 DT  T   T . n 
A 1 12  DT  12  119 119 DT  T   T . n 
A 1 13  DC  13  118 118 DC  C   T . n 
A 1 14  DG  14  117 117 DG  G   T . n 
A 1 15  DC  15  116 116 DC  C   T . n 
A 1 16  DC  16  115 115 DC  C   T . n 
A 1 17  DG  17  114 114 DG  G   T . n 
A 1 18  DT  18  113 113 DT  T   T . n 
A 1 19  DG  19  112 112 DG  G   T . n 
A 1 20  DT  20  111 111 DT  T   T . n 
A 1 21  DT  21  110 110 DT  T   T . n 
B 2 1   DT  1   14  14  DT  T   N . n 
B 2 2   DT  2   15  15  DT  T   N . n 
B 2 3   DT  3   16  16  DT  T   N . n 
B 2 4   DA  4   17  17  DA  A   N . n 
B 2 5   DC  5   18  18  DC  C   N . n 
B 2 6   DG  6   19  19  DG  G   N . n 
B 2 7   DT  7   20  20  DT  T   N . n 
B 2 8   DT  8   21  21  DT  T   N . n 
B 2 9   DG  9   22  22  DG  G   N . n 
B 2 10  DC  10  23  23  DC  C   N . n 
B 2 11  DG  11  24  24  DG  G   N . n 
B 2 12  DC  12  25  25  DC  C   N . n 
B 2 13  DA  13  26  26  DA  A   N . n 
B 2 14  DC  14  27  27  DC  C   N . n 
B 2 15  DG  15  28  28  DG  G   N . n 
B 2 16  DG  16  29  29  DG  G   N . n 
B 2 17  DC  17  30  30  DC  C   N . n 
C 3 1   A   1   10  10  A   A   R . n 
C 3 2   C   2   9   9   C   C   R . n 
C 3 3   A   3   8   8   A   A   R . n 
C 3 4   C   4   7   7   C   C   R . n 
C 3 5   G   5   6   6   G   G   R . n 
C 3 6   G   6   5   5   G   G   R . n 
C 3 7   C   7   4   4   C   C   R . n 
C 3 8   G   8   3   3   G   G   R . n 
C 3 9   A   9   2   2   A   A   R . n 
C 3 10  3DA 10  1   1   3DA 3DA R . n 
D 4 1   MET 1   1   ?   ?   ?   D . n 
D 4 2   ASN 2   2   ?   ?   ?   D . n 
D 4 3   THR 3   3   ?   ?   ?   D . n 
D 4 4   ILE 4   4   ?   ?   ?   D . n 
D 4 5   ASN 5   5   ?   ?   ?   D . n 
D 4 6   ILE 6   6   ?   ?   ?   D . n 
D 4 7   ALA 7   7   ?   ?   ?   D . n 
D 4 8   LYS 8   8   ?   ?   ?   D . n 
D 4 9   ASN 9   9   ?   ?   ?   D . n 
D 4 10  ASP 10  10  ?   ?   ?   D . n 
D 4 11  PHE 11  11  ?   ?   ?   D . n 
D 4 12  SER 12  12  12  SER SER D . n 
D 4 13  ASP 13  13  13  ASP ASP D . n 
D 4 14  ILE 14  14  14  ILE ILE D . n 
D 4 15  GLU 15  15  15  GLU GLU D . n 
D 4 16  LEU 16  16  16  LEU LEU D . n 
D 4 17  ALA 17  17  17  ALA ALA D . n 
D 4 18  ALA 18  18  18  ALA ALA D . n 
D 4 19  ILE 19  19  19  ILE ILE D . n 
D 4 20  PRO 20  20  20  PRO PRO D . n 
D 4 21  PHE 21  21  21  PHE PHE D . n 
D 4 22  ASN 22  22  22  ASN ASN D . n 
D 4 23  THR 23  23  23  THR THR D . n 
D 4 24  LEU 24  24  24  LEU LEU D . n 
D 4 25  ALA 25  25  25  ALA ALA D . n 
D 4 26  ASP 26  26  26  ASP ASP D . n 
D 4 27  HIS 27  27  27  HIS HIS D . n 
D 4 28  TYR 28  28  28  TYR TYR D . n 
D 4 29  GLY 29  29  29  GLY GLY D . n 
D 4 30  GLU 30  30  30  GLU GLU D . n 
D 4 31  ARG 31  31  31  ARG ARG D . n 
D 4 32  LEU 32  32  32  LEU LEU D . n 
D 4 33  ALA 33  33  33  ALA ALA D . n 
D 4 34  ARG 34  34  34  ARG ARG D . n 
D 4 35  GLU 35  35  35  GLU GLU D . n 
D 4 36  GLN 36  36  36  GLN GLN D . n 
D 4 37  LEU 37  37  37  LEU LEU D . n 
D 4 38  ALA 38  38  38  ALA ALA D . n 
D 4 39  LEU 39  39  39  LEU LEU D . n 
D 4 40  GLU 40  40  40  GLU GLU D . n 
D 4 41  HIS 41  41  41  HIS HIS D . n 
D 4 42  GLU 42  42  42  GLU GLU D . n 
D 4 43  SER 43  43  43  SER SER D . n 
D 4 44  TYR 44  44  44  TYR TYR D . n 
D 4 45  GLU 45  45  45  GLU GLU D . n 
D 4 46  MET 46  46  46  MET MET D . n 
D 4 47  GLY 47  47  47  GLY GLY D . n 
D 4 48  GLU 48  48  48  GLU GLU D . n 
D 4 49  ALA 49  49  49  ALA ALA D . n 
D 4 50  ARG 50  50  50  ARG ARG D . n 
D 4 51  PHE 51  51  51  PHE PHE D . n 
D 4 52  ARG 52  52  52  ARG ARG D . n 
D 4 53  LYS 53  53  53  LYS LYS D . n 
D 4 54  MET 54  54  54  MET MET D . n 
D 4 55  PHE 55  55  55  PHE PHE D . n 
D 4 56  GLU 56  56  56  GLU GLU D . n 
D 4 57  ARG 57  57  57  ARG ARG D . n 
D 4 58  GLN 58  58  58  GLN GLN D . n 
D 4 59  LEU 59  59  59  LEU LEU D . n 
D 4 60  LYS 60  60  60  LYS LYS D . n 
D 4 61  ALA 61  61  61  ALA ALA D . n 
D 4 62  GLY 62  62  62  GLY GLY D . n 
D 4 63  GLU 63  63  63  GLU GLU D . n 
D 4 64  VAL 64  64  64  VAL VAL D . n 
D 4 65  ALA 65  65  65  ALA ALA D . n 
D 4 66  ASP 66  66  66  ASP ASP D . n 
D 4 67  ASN 67  67  67  ASN ASN D . n 
D 4 68  ALA 68  68  68  ALA ALA D . n 
D 4 69  ALA 69  69  69  ALA ALA D . n 
D 4 70  ALA 70  70  70  ALA ALA D . n 
D 4 71  LYS 71  71  71  LYS LYS D . n 
D 4 72  PRO 72  72  72  PRO PRO D . n 
D 4 73  LEU 73  73  73  LEU LEU D . n 
D 4 74  ILE 74  74  74  ILE ILE D . n 
D 4 75  THR 75  75  75  THR THR D . n 
D 4 76  THR 76  76  76  THR THR D . n 
D 4 77  LEU 77  77  77  LEU LEU D . n 
D 4 78  LEU 78  78  78  LEU LEU D . n 
D 4 79  PRO 79  79  79  PRO PRO D . n 
D 4 80  LYS 80  80  80  LYS LYS D . n 
D 4 81  MET 81  81  81  MET MET D . n 
D 4 82  ILE 82  82  82  ILE ILE D . n 
D 4 83  ALA 83  83  83  ALA ALA D . n 
D 4 84  ARG 84  84  84  ARG ARG D . n 
D 4 85  ILE 85  85  85  ILE ILE D . n 
D 4 86  ASN 86  86  86  ASN ASN D . n 
D 4 87  ASP 87  87  87  ASP ASP D . n 
D 4 88  TRP 88  88  88  TRP TRP D . n 
D 4 89  PHE 89  89  89  PHE PHE D . n 
D 4 90  GLU 90  90  90  GLU GLU D . n 
D 4 91  GLU 91  91  91  GLU GLU D . n 
D 4 92  VAL 92  92  92  VAL VAL D . n 
D 4 93  LYS 93  93  93  LYS LYS D . n 
D 4 94  ALA 94  94  94  ALA ALA D . n 
D 4 95  LYS 95  95  95  LYS LYS D . n 
D 4 96  ARG 96  96  96  ARG ARG D . n 
D 4 97  GLY 97  97  97  GLY GLY D . n 
D 4 98  LYS 98  98  98  LYS LYS D . n 
D 4 99  ARG 99  99  99  ARG ARG D . n 
D 4 100 PRO 100 100 100 PRO PRO D . n 
D 4 101 THR 101 101 101 THR THR D . n 
D 4 102 ALA 102 102 102 ALA ALA D . n 
D 4 103 PHE 103 103 103 PHE PHE D . n 
D 4 104 GLN 104 104 104 GLN GLN D . n 
D 4 105 PHE 105 105 105 PHE PHE D . n 
D 4 106 LEU 106 106 106 LEU LEU D . n 
D 4 107 GLN 107 107 107 GLN GLN D . n 
D 4 108 GLU 108 108 108 GLU GLU D . n 
D 4 109 ILE 109 109 109 ILE ILE D . n 
D 4 110 LYS 110 110 110 LYS LYS D . n 
D 4 111 PRO 111 111 111 PRO PRO D . n 
D 4 112 GLU 112 112 112 GLU GLU D . n 
D 4 113 ALA 113 113 113 ALA ALA D . n 
D 4 114 VAL 114 114 114 VAL VAL D . n 
D 4 115 ALA 115 115 115 ALA ALA D . n 
D 4 116 TYR 116 116 116 TYR TYR D . n 
D 4 117 ILE 117 117 117 ILE ILE D . n 
D 4 118 THR 118 118 118 THR THR D . n 
D 4 119 ILE 119 119 119 ILE ILE D . n 
D 4 120 LYS 120 120 120 LYS LYS D . n 
D 4 121 THR 121 121 121 THR THR D . n 
D 4 122 THR 122 122 122 THR THR D . n 
D 4 123 LEU 123 123 123 LEU LEU D . n 
D 4 124 ALA 124 124 124 ALA ALA D . n 
D 4 125 CYS 125 125 125 CYS CYS D . n 
D 4 126 LEU 126 126 126 LEU LEU D . n 
D 4 127 THR 127 127 127 THR THR D . n 
D 4 128 SER 128 128 128 SER SER D . n 
D 4 129 ALA 129 129 129 ALA ALA D . n 
D 4 130 ASP 130 130 130 ASP ASP D . n 
D 4 131 ASN 131 131 131 ASN ASN D . n 
D 4 132 THR 132 132 132 THR THR D . n 
D 4 133 THR 133 133 133 THR THR D . n 
D 4 134 VAL 134 134 134 VAL VAL D . n 
D 4 135 GLN 135 135 135 GLN GLN D . n 
D 4 136 ALA 136 136 136 ALA ALA D . n 
D 4 137 VAL 137 137 137 VAL VAL D . n 
D 4 138 ALA 138 138 138 ALA ALA D . n 
D 4 139 SER 139 139 139 SER SER D . n 
D 4 140 ALA 140 140 140 ALA ALA D . n 
D 4 141 ILE 141 141 141 ILE ILE D . n 
D 4 142 GLY 142 142 142 GLY GLY D . n 
D 4 143 ARG 143 143 143 ARG ARG D . n 
D 4 144 ALA 144 144 144 ALA ALA D . n 
D 4 145 ILE 145 145 145 ILE ILE D . n 
D 4 146 GLU 146 146 146 GLU GLU D . n 
D 4 147 ASP 147 147 147 ASP ASP D . n 
D 4 148 GLU 148 148 148 GLU GLU D . n 
D 4 149 ALA 149 149 149 ALA ALA D . n 
D 4 150 ARG 150 150 150 ARG ARG D . n 
D 4 151 PHE 151 151 151 PHE PHE D . n 
D 4 152 GLY 152 152 152 GLY GLY D . n 
D 4 153 ARG 153 153 153 ARG ARG D . n 
D 4 154 ILE 154 154 154 ILE ILE D . n 
D 4 155 ARG 155 155 155 ARG ARG D . n 
D 4 156 ASP 156 156 156 ASP ASP D . n 
D 4 157 LEU 157 157 157 LEU LEU D . n 
D 4 158 GLU 158 158 158 GLU GLU D . n 
D 4 159 ALA 159 159 159 ALA ALA D . n 
D 4 160 LYS 160 160 160 LYS LYS D . n 
D 4 161 HIS 161 161 161 HIS HIS D . n 
D 4 162 PHE 162 162 162 PHE PHE D . n 
D 4 163 LYS 163 163 163 LYS LYS D . n 
D 4 164 LYS 164 164 164 LYS LYS D . n 
D 4 165 ASN 165 165 165 ASN ASN D . n 
D 4 166 VAL 166 166 166 VAL VAL D . n 
D 4 167 GLU 167 167 167 GLU GLU D . n 
D 4 168 GLU 168 168 168 GLU GLU D . n 
D 4 169 GLN 169 169 169 GLN GLN D . n 
D 4 170 LEU 170 170 170 LEU LEU D . n 
D 4 171 ASN 171 171 171 ASN ASN D . n 
D 4 172 LYS 172 172 172 LYS LYS D . n 
D 4 173 ARG 173 173 173 ARG ARG D . n 
D 4 174 VAL 174 174 174 VAL VAL D . n 
D 4 175 GLY 175 175 175 GLY GLY D . n 
D 4 176 HIS 176 176 176 HIS HIS D . n 
D 4 177 VAL 177 177 177 VAL VAL D . n 
D 4 178 TYR 178 178 178 TYR TYR D . n 
D 4 179 LYS 179 179 179 LYS LYS D . n 
D 4 180 LYS 180 180 180 LYS LYS D . n 
D 4 181 ALA 181 181 181 ALA ALA D . n 
D 4 182 PHE 182 182 182 PHE PHE D . n 
D 4 183 MET 183 183 183 MET MET D . n 
D 4 184 GLN 184 184 184 GLN GLN D . n 
D 4 185 VAL 185 185 185 VAL VAL D . n 
D 4 186 VAL 186 186 186 VAL VAL D . n 
D 4 187 GLU 187 187 187 GLU GLU D . n 
D 4 188 ALA 188 188 188 ALA ALA D . n 
D 4 189 ASP 189 189 189 ASP ASP D . n 
D 4 190 MET 190 190 190 MET MET D . n 
D 4 191 LEU 191 191 191 LEU LEU D . n 
D 4 192 SER 192 192 192 SER SER D . n 
D 4 193 LYS 193 193 193 LYS LYS D . n 
D 4 194 GLY 194 194 194 GLY GLY D . n 
D 4 195 LEU 195 195 ?   ?   ?   D . n 
D 4 196 LEU 196 196 ?   ?   ?   D . n 
D 4 197 GLY 197 197 ?   ?   ?   D . n 
D 4 198 GLY 198 198 ?   ?   ?   D . n 
D 4 199 GLU 199 199 ?   ?   ?   D . n 
D 4 200 ALA 200 200 200 ALA ALA D . n 
D 4 201 TRP 201 201 201 TRP TRP D . n 
D 4 202 SER 202 202 202 SER SER D . n 
D 4 203 SER 203 203 203 SER SER D . n 
D 4 204 TRP 204 204 204 TRP TRP D . n 
D 4 205 HIS 205 205 205 HIS HIS D . n 
D 4 206 LYS 206 206 206 LYS LYS D . n 
D 4 207 GLU 207 207 207 GLU GLU D . n 
D 4 208 ASP 208 208 208 ASP ASP D . n 
D 4 209 SER 209 209 209 SER SER D . n 
D 4 210 ILE 210 210 210 ILE ILE D . n 
D 4 211 HIS 211 211 211 HIS HIS D . n 
D 4 212 VAL 212 212 212 VAL VAL D . n 
D 4 213 GLY 213 213 213 GLY GLY D . n 
D 4 214 VAL 214 214 214 VAL VAL D . n 
D 4 215 ARG 215 215 215 ARG ARG D . n 
D 4 216 CYS 216 216 216 CYS CYS D . n 
D 4 217 ILE 217 217 217 ILE ILE D . n 
D 4 218 GLU 218 218 218 GLU GLU D . n 
D 4 219 MET 219 219 219 MET MET D . n 
D 4 220 LEU 220 220 220 LEU LEU D . n 
D 4 221 ILE 221 221 221 ILE ILE D . n 
D 4 222 GLU 222 222 222 GLU GLU D . n 
D 4 223 SER 223 223 223 SER SER D . n 
D 4 224 THR 224 224 224 THR THR D . n 
D 4 225 GLY 225 225 225 GLY GLY D . n 
D 4 226 MET 226 226 226 MET MET D . n 
D 4 227 VAL 227 227 227 VAL VAL D . n 
D 4 228 SER 228 228 228 SER SER D . n 
D 4 229 LEU 229 229 229 LEU LEU D . n 
D 4 230 HIS 230 230 230 HIS HIS D . n 
D 4 231 ARG 231 231 ?   ?   ?   D . n 
D 4 232 GLN 232 232 ?   ?   ?   D . n 
D 4 233 ASN 233 233 ?   ?   ?   D . n 
D 4 234 ALA 234 234 ?   ?   ?   D . n 
D 4 235 GLY 235 235 ?   ?   ?   D . n 
D 4 236 VAL 236 236 ?   ?   ?   D . n 
D 4 237 VAL 237 237 ?   ?   ?   D . n 
D 4 238 GLY 238 238 ?   ?   ?   D . n 
D 4 239 GLN 239 239 ?   ?   ?   D . n 
D 4 240 ASP 240 240 ?   ?   ?   D . n 
D 4 241 SER 241 241 241 SER SER D . n 
D 4 242 GLU 242 242 242 GLU GLU D . n 
D 4 243 THR 243 243 243 THR THR D . n 
D 4 244 ILE 244 244 244 ILE ILE D . n 
D 4 245 GLU 245 245 245 GLU GLU D . n 
D 4 246 LEU 246 246 246 LEU LEU D . n 
D 4 247 ALA 247 247 247 ALA ALA D . n 
D 4 248 PRO 248 248 248 PRO PRO D . n 
D 4 249 GLU 249 249 249 GLU GLU D . n 
D 4 250 TYR 250 250 250 TYR TYR D . n 
D 4 251 ALA 251 251 251 ALA ALA D . n 
D 4 252 GLU 252 252 252 GLU GLU D . n 
D 4 253 ALA 253 253 253 ALA ALA D . n 
D 4 254 ILE 254 254 254 ILE ILE D . n 
D 4 255 ALA 255 255 255 ALA ALA D . n 
D 4 256 THR 256 256 256 THR THR D . n 
D 4 257 ARG 257 257 257 ARG ARG D . n 
D 4 258 ALA 258 258 258 ALA ALA D . n 
D 4 259 GLY 259 259 259 GLY GLY D . n 
D 4 260 ALA 260 260 260 ALA ALA D . n 
D 4 261 LEU 261 261 261 LEU LEU D . n 
D 4 262 ALA 262 262 262 ALA ALA D . n 
D 4 263 GLY 263 263 263 GLY GLY D . n 
D 4 264 ILE 264 264 264 ILE ILE D . n 
D 4 265 SER 265 265 265 SER SER D . n 
D 4 266 PRO 266 266 266 PRO PRO D . n 
D 4 267 MET 267 267 267 MET MET D . n 
D 4 268 PHE 268 268 268 PHE PHE D . n 
D 4 269 GLN 269 269 269 GLN GLN D . n 
D 4 270 PRO 270 270 270 PRO PRO D . n 
D 4 271 CYS 271 271 271 CYS CYS D . n 
D 4 272 VAL 272 272 272 VAL VAL D . n 
D 4 273 VAL 273 273 273 VAL VAL D . n 
D 4 274 PRO 274 274 274 PRO PRO D . n 
D 4 275 PRO 275 275 275 PRO PRO D . n 
D 4 276 LYS 276 276 276 LYS LYS D . n 
D 4 277 PRO 277 277 277 PRO PRO D . n 
D 4 278 TRP 278 278 278 TRP TRP D . n 
D 4 279 THR 279 279 279 THR THR D . n 
D 4 280 GLY 280 280 280 GLY GLY D . n 
D 4 281 ILE 281 281 281 ILE ILE D . n 
D 4 282 THR 282 282 282 THR THR D . n 
D 4 283 GLY 283 283 283 GLY GLY D . n 
D 4 284 GLY 284 284 284 GLY GLY D . n 
D 4 285 GLY 285 285 285 GLY GLY D . n 
D 4 286 TYR 286 286 286 TYR TYR D . n 
D 4 287 TRP 287 287 287 TRP TRP D . n 
D 4 288 ALA 288 288 288 ALA ALA D . n 
D 4 289 ASN 289 289 289 ASN ASN D . n 
D 4 290 GLY 290 290 290 GLY GLY D . n 
D 4 291 ARG 291 291 291 ARG ARG D . n 
D 4 292 ARG 292 292 292 ARG ARG D . n 
D 4 293 PRO 293 293 293 PRO PRO D . n 
D 4 294 LEU 294 294 294 LEU LEU D . n 
D 4 295 ALA 295 295 295 ALA ALA D . n 
D 4 296 LEU 296 296 296 LEU LEU D . n 
D 4 297 VAL 297 297 297 VAL VAL D . n 
D 4 298 ARG 298 298 298 ARG ARG D . n 
D 4 299 THR 299 299 299 THR THR D . n 
D 4 300 HIS 300 300 300 HIS HIS D . n 
D 4 301 SER 301 301 301 SER SER D . n 
D 4 302 LYS 302 302 302 LYS LYS D . n 
D 4 303 LYS 303 303 303 LYS LYS D . n 
D 4 304 ALA 304 304 304 ALA ALA D . n 
D 4 305 LEU 305 305 305 LEU LEU D . n 
D 4 306 MET 306 306 306 MET MET D . n 
D 4 307 ARG 307 307 307 ARG ARG D . n 
D 4 308 TYR 308 308 308 TYR TYR D . n 
D 4 309 GLU 309 309 309 GLU GLU D . n 
D 4 310 ASP 310 310 310 ASP ASP D . n 
D 4 311 VAL 311 311 311 VAL VAL D . n 
D 4 312 TYR 312 312 312 TYR TYR D . n 
D 4 313 MET 313 313 313 MET MET D . n 
D 4 314 PRO 314 314 314 PRO PRO D . n 
D 4 315 GLU 315 315 315 GLU GLU D . n 
D 4 316 VAL 316 316 316 VAL VAL D . n 
D 4 317 TYR 317 317 317 TYR TYR D . n 
D 4 318 LYS 318 318 318 LYS LYS D . n 
D 4 319 ALA 319 319 319 ALA ALA D . n 
D 4 320 ILE 320 320 320 ILE ILE D . n 
D 4 321 ASN 321 321 321 ASN ASN D . n 
D 4 322 ILE 322 322 322 ILE ILE D . n 
D 4 323 ALA 323 323 323 ALA ALA D . n 
D 4 324 GLN 324 324 324 GLN GLN D . n 
D 4 325 ASN 325 325 325 ASN ASN D . n 
D 4 326 THR 326 326 326 THR THR D . n 
D 4 327 ALA 327 327 327 ALA ALA D . n 
D 4 328 TRP 328 328 328 TRP TRP D . n 
D 4 329 LYS 329 329 329 LYS LYS D . n 
D 4 330 ILE 330 330 330 ILE ILE D . n 
D 4 331 ASN 331 331 331 ASN ASN D . n 
D 4 332 LYS 332 332 332 LYS LYS D . n 
D 4 333 LYS 333 333 333 LYS LYS D . n 
D 4 334 VAL 334 334 334 VAL VAL D . n 
D 4 335 LEU 335 335 335 LEU LEU D . n 
D 4 336 ALA 336 336 336 ALA ALA D . n 
D 4 337 VAL 337 337 337 VAL VAL D . n 
D 4 338 ALA 338 338 338 ALA ALA D . n 
D 4 339 ASN 339 339 339 ASN ASN D . n 
D 4 340 VAL 340 340 340 VAL VAL D . n 
D 4 341 ILE 341 341 341 ILE ILE D . n 
D 4 342 THR 342 342 342 THR THR D . n 
D 4 343 LYS 343 343 343 LYS LYS D . n 
D 4 344 TRP 344 344 344 TRP TRP D . n 
D 4 345 LYS 345 345 345 LYS LYS D . n 
D 4 346 HIS 346 346 346 HIS HIS D . n 
D 4 347 CYS 347 347 347 CYS CYS D . n 
D 4 348 PRO 348 348 348 PRO PRO D . n 
D 4 349 VAL 349 349 349 VAL VAL D . n 
D 4 350 GLU 350 350 350 GLU GLU D . n 
D 4 351 ASP 351 351 351 ASP ASP D . n 
D 4 352 ILE 352 352 352 ILE ILE D . n 
D 4 353 PRO 353 353 353 PRO PRO D . n 
D 4 354 ALA 354 354 354 ALA ALA D . n 
D 4 355 ILE 355 355 355 ILE ILE D . n 
D 4 356 GLU 356 356 356 GLU GLU D . n 
D 4 357 ARG 357 357 357 ARG ARG D . n 
D 4 358 GLU 358 358 358 GLU GLU D . n 
D 4 359 GLU 359 359 359 GLU GLU D . n 
D 4 360 LEU 360 360 360 LEU LEU D . n 
D 4 361 PRO 361 361 361 PRO PRO D . n 
D 4 362 MET 362 362 ?   ?   ?   D . n 
D 4 363 LYS 363 363 ?   ?   ?   D . n 
D 4 364 PRO 364 364 ?   ?   ?   D . n 
D 4 365 GLU 365 365 ?   ?   ?   D . n 
D 4 366 ASP 366 366 ?   ?   ?   D . n 
D 4 367 ILE 367 367 ?   ?   ?   D . n 
D 4 368 ASP 368 368 ?   ?   ?   D . n 
D 4 369 MET 369 369 ?   ?   ?   D . n 
D 4 370 ASN 370 370 ?   ?   ?   D . n 
D 4 371 PRO 371 371 ?   ?   ?   D . n 
D 4 372 GLU 372 372 ?   ?   ?   D . n 
D 4 373 ALA 373 373 ?   ?   ?   D . n 
D 4 374 LEU 374 374 ?   ?   ?   D . n 
D 4 375 THR 375 375 ?   ?   ?   D . n 
D 4 376 ALA 376 376 ?   ?   ?   D . n 
D 4 377 TRP 377 377 377 TRP TRP D . n 
D 4 378 LYS 378 378 378 LYS LYS D . n 
D 4 379 ARG 379 379 379 ARG ARG D . n 
D 4 380 ALA 380 380 380 ALA ALA D . n 
D 4 381 ALA 381 381 381 ALA ALA D . n 
D 4 382 ALA 382 382 382 ALA ALA D . n 
D 4 383 ALA 383 383 383 ALA ALA D . n 
D 4 384 VAL 384 384 384 VAL VAL D . n 
D 4 385 TYR 385 385 385 TYR TYR D . n 
D 4 386 ARG 386 386 386 ARG ARG D . n 
D 4 387 LYS 387 387 387 LYS LYS D . n 
D 4 388 ASP 388 388 388 ASP ASP D . n 
D 4 389 LYS 389 389 389 LYS LYS D . n 
D 4 390 ALA 390 390 390 ALA ALA D . n 
D 4 391 ARG 391 391 391 ARG ARG D . n 
D 4 392 LYS 392 392 392 LYS LYS D . n 
D 4 393 SER 393 393 393 SER SER D . n 
D 4 394 ARG 394 394 394 ARG ARG D . n 
D 4 395 ARG 395 395 395 ARG ARG D . n 
D 4 396 ILE 396 396 396 ILE ILE D . n 
D 4 397 SER 397 397 397 SER SER D . n 
D 4 398 LEU 398 398 398 LEU LEU D . n 
D 4 399 GLU 399 399 399 GLU GLU D . n 
D 4 400 PHE 400 400 400 PHE PHE D . n 
D 4 401 MET 401 401 401 MET MET D . n 
D 4 402 LEU 402 402 402 LEU LEU D . n 
D 4 403 GLU 403 403 403 GLU GLU D . n 
D 4 404 GLN 404 404 404 GLN GLN D . n 
D 4 405 ALA 405 405 405 ALA ALA D . n 
D 4 406 ASN 406 406 406 ASN ASN D . n 
D 4 407 LYS 407 407 407 LYS LYS D . n 
D 4 408 PHE 408 408 408 PHE PHE D . n 
D 4 409 ALA 409 409 409 ALA ALA D . n 
D 4 410 ASN 410 410 410 ASN ASN D . n 
D 4 411 HIS 411 411 411 HIS HIS D . n 
D 4 412 LYS 412 412 412 LYS LYS D . n 
D 4 413 ALA 413 413 413 ALA ALA D . n 
D 4 414 ILE 414 414 414 ILE ILE D . n 
D 4 415 TRP 415 415 415 TRP TRP D . n 
D 4 416 PHE 416 416 416 PHE PHE D . n 
D 4 417 PRO 417 417 417 PRO PRO D . n 
D 4 418 TYR 418 418 418 TYR TYR D . n 
D 4 419 ASN 419 419 419 ASN ASN D . n 
D 4 420 MET 420 420 420 MET MET D . n 
D 4 421 ASP 421 421 421 ASP ASP D . n 
D 4 422 TRP 422 422 422 TRP TRP D . n 
D 4 423 ARG 423 423 423 ARG ARG D . n 
D 4 424 GLY 424 424 424 GLY GLY D . n 
D 4 425 ARG 425 425 425 ARG ARG D . n 
D 4 426 VAL 426 426 426 VAL VAL D . n 
D 4 427 TYR 427 427 427 TYR TYR D . n 
D 4 428 ALA 428 428 428 ALA ALA D . n 
D 4 429 VAL 429 429 429 VAL VAL D . n 
D 4 430 SER 430 430 430 SER SER D . n 
D 4 431 MET 431 431 431 MET MET D . n 
D 4 432 PHE 432 432 432 PHE PHE D . n 
D 4 433 ASN 433 433 433 ASN ASN D . n 
D 4 434 PRO 434 434 434 PRO PRO D . n 
D 4 435 GLN 435 435 435 GLN GLN D . n 
D 4 436 GLY 436 436 436 GLY GLY D . n 
D 4 437 ASN 437 437 437 ASN ASN D . n 
D 4 438 ASP 438 438 438 ASP ASP D . n 
D 4 439 MET 439 439 439 MET MET D . n 
D 4 440 THR 440 440 440 THR THR D . n 
D 4 441 LYS 441 441 441 LYS LYS D . n 
D 4 442 GLY 442 442 442 GLY GLY D . n 
D 4 443 LEU 443 443 443 LEU LEU D . n 
D 4 444 LEU 444 444 444 LEU LEU D . n 
D 4 445 THR 445 445 445 THR THR D . n 
D 4 446 LEU 446 446 446 LEU LEU D . n 
D 4 447 ALA 447 447 447 ALA ALA D . n 
D 4 448 LYS 448 448 448 LYS LYS D . n 
D 4 449 GLY 449 449 449 GLY GLY D . n 
D 4 450 LYS 450 450 450 LYS LYS D . n 
D 4 451 PRO 451 451 451 PRO PRO D . n 
D 4 452 ILE 452 452 452 ILE ILE D . n 
D 4 453 GLY 453 453 453 GLY GLY D . n 
D 4 454 LYS 454 454 454 LYS LYS D . n 
D 4 455 GLU 455 455 455 GLU GLU D . n 
D 4 456 GLY 456 456 456 GLY GLY D . n 
D 4 457 TYR 457 457 457 TYR TYR D . n 
D 4 458 TYR 458 458 458 TYR TYR D . n 
D 4 459 TRP 459 459 459 TRP TRP D . n 
D 4 460 LEU 460 460 460 LEU LEU D . n 
D 4 461 LYS 461 461 461 LYS LYS D . n 
D 4 462 ILE 462 462 462 ILE ILE D . n 
D 4 463 HIS 463 463 463 HIS HIS D . n 
D 4 464 GLY 464 464 464 GLY GLY D . n 
D 4 465 ALA 465 465 465 ALA ALA D . n 
D 4 466 ASN 466 466 466 ASN ASN D . n 
D 4 467 CYS 467 467 467 CYS CYS D . n 
D 4 468 ALA 468 468 468 ALA ALA D . n 
D 4 469 GLY 469 469 469 GLY GLY D . n 
D 4 470 VAL 470 470 470 VAL VAL D . n 
D 4 471 ASP 471 471 471 ASP ASP D . n 
D 4 472 LYS 472 472 472 LYS LYS D . n 
D 4 473 VAL 473 473 473 VAL VAL D . n 
D 4 474 PRO 474 474 474 PRO PRO D . n 
D 4 475 PHE 475 475 475 PHE PHE D . n 
D 4 476 PRO 476 476 476 PRO PRO D . n 
D 4 477 GLU 477 477 477 GLU GLU D . n 
D 4 478 ARG 478 478 478 ARG ARG D . n 
D 4 479 ILE 479 479 479 ILE ILE D . n 
D 4 480 LYS 480 480 480 LYS LYS D . n 
D 4 481 PHE 481 481 481 PHE PHE D . n 
D 4 482 ILE 482 482 482 ILE ILE D . n 
D 4 483 GLU 483 483 483 GLU GLU D . n 
D 4 484 GLU 484 484 484 GLU GLU D . n 
D 4 485 ASN 485 485 485 ASN ASN D . n 
D 4 486 HIS 486 486 486 HIS HIS D . n 
D 4 487 GLU 487 487 487 GLU GLU D . n 
D 4 488 ASN 488 488 488 ASN ASN D . n 
D 4 489 ILE 489 489 489 ILE ILE D . n 
D 4 490 MET 490 490 490 MET MET D . n 
D 4 491 ALA 491 491 491 ALA ALA D . n 
D 4 492 CYS 492 492 492 CYS CYS D . n 
D 4 493 ALA 493 493 493 ALA ALA D . n 
D 4 494 LYS 494 494 494 LYS LYS D . n 
D 4 495 SER 495 495 495 SER SER D . n 
D 4 496 PRO 496 496 496 PRO PRO D . n 
D 4 497 LEU 497 497 497 LEU LEU D . n 
D 4 498 GLU 498 498 498 GLU GLU D . n 
D 4 499 ASN 499 499 499 ASN ASN D . n 
D 4 500 THR 500 500 500 THR THR D . n 
D 4 501 TRP 501 501 501 TRP TRP D . n 
D 4 502 TRP 502 502 502 TRP TRP D . n 
D 4 503 ALA 503 503 503 ALA ALA D . n 
D 4 504 GLU 504 504 504 GLU GLU D . n 
D 4 505 GLN 505 505 505 GLN GLN D . n 
D 4 506 ASP 506 506 506 ASP ASP D . n 
D 4 507 SER 507 507 507 SER SER D . n 
D 4 508 PRO 508 508 508 PRO PRO D . n 
D 4 509 PHE 509 509 509 PHE PHE D . n 
D 4 510 CYS 510 510 510 CYS CYS D . n 
D 4 511 PHE 511 511 511 PHE PHE D . n 
D 4 512 LEU 512 512 512 LEU LEU D . n 
D 4 513 ALA 513 513 513 ALA ALA D . n 
D 4 514 PHE 514 514 514 PHE PHE D . n 
D 4 515 CYS 515 515 515 CYS CYS D . n 
D 4 516 PHE 516 516 516 PHE PHE D . n 
D 4 517 GLU 517 517 517 GLU GLU D . n 
D 4 518 TYR 518 518 518 TYR TYR D . n 
D 4 519 ALA 519 519 519 ALA ALA D . n 
D 4 520 GLY 520 520 520 GLY GLY D . n 
D 4 521 VAL 521 521 521 VAL VAL D . n 
D 4 522 GLN 522 522 522 GLN GLN D . n 
D 4 523 HIS 523 523 523 HIS HIS D . n 
D 4 524 HIS 524 524 524 HIS HIS D . n 
D 4 525 GLY 525 525 525 GLY GLY D . n 
D 4 526 LEU 526 526 526 LEU LEU D . n 
D 4 527 SER 527 527 527 SER SER D . n 
D 4 528 TYR 528 528 528 TYR TYR D . n 
D 4 529 ASN 529 529 529 ASN ASN D . n 
D 4 530 CYS 530 530 530 CYS CYS D . n 
D 4 531 SER 531 531 531 SER SER D . n 
D 4 532 LEU 532 532 532 LEU LEU D . n 
D 4 533 PRO 533 533 533 PRO PRO D . n 
D 4 534 LEU 534 534 534 LEU LEU D . n 
D 4 535 ALA 535 535 535 ALA ALA D . n 
D 4 536 PHE 536 536 536 PHE PHE D . n 
D 4 537 ASP 537 537 537 ASP ASP D . n 
D 4 538 GLY 538 538 538 GLY GLY D . n 
D 4 539 SER 539 539 539 SER SER D . n 
D 4 540 CYS 540 540 540 CYS CYS D . n 
D 4 541 SER 541 541 541 SER SER D . n 
D 4 542 GLY 542 542 542 GLY GLY D . n 
D 4 543 ILE 543 543 543 ILE ILE D . n 
D 4 544 GLN 544 544 544 GLN GLN D . n 
D 4 545 HIS 545 545 545 HIS HIS D . n 
D 4 546 PHE 546 546 546 PHE PHE D . n 
D 4 547 SER 547 547 547 SER SER D . n 
D 4 548 ALA 548 548 548 ALA ALA D . n 
D 4 549 MET 549 549 549 MET MET D . n 
D 4 550 LEU 550 550 550 LEU LEU D . n 
D 4 551 ARG 551 551 551 ARG ARG D . n 
D 4 552 ASP 552 552 552 ASP ASP D . n 
D 4 553 GLU 553 553 553 GLU GLU D . n 
D 4 554 VAL 554 554 554 VAL VAL D . n 
D 4 555 GLY 555 555 555 GLY GLY D . n 
D 4 556 GLY 556 556 556 GLY GLY D . n 
D 4 557 ARG 557 557 557 ARG ARG D . n 
D 4 558 ALA 558 558 558 ALA ALA D . n 
D 4 559 VAL 559 559 559 VAL VAL D . n 
D 4 560 ASN 560 560 560 ASN ASN D . n 
D 4 561 LEU 561 561 561 LEU LEU D . n 
D 4 562 LEU 562 562 562 LEU LEU D . n 
D 4 563 PRO 563 563 563 PRO PRO D . n 
D 4 564 SER 564 564 564 SER SER D . n 
D 4 565 GLU 565 565 565 GLU GLU D . n 
D 4 566 THR 566 566 566 THR THR D . n 
D 4 567 VAL 567 567 567 VAL VAL D . n 
D 4 568 GLN 568 568 568 GLN GLN D . n 
D 4 569 ASP 569 569 569 ASP ASP D . n 
D 4 570 ILE 570 570 570 ILE ILE D . n 
D 4 571 TYR 571 571 571 TYR TYR D . n 
D 4 572 GLY 572 572 572 GLY GLY D . n 
D 4 573 ILE 573 573 573 ILE ILE D . n 
D 4 574 VAL 574 574 574 VAL VAL D . n 
D 4 575 ALA 575 575 575 ALA ALA D . n 
D 4 576 LYS 576 576 576 LYS LYS D . n 
D 4 577 LYS 577 577 577 LYS LYS D . n 
D 4 578 VAL 578 578 578 VAL VAL D . n 
D 4 579 ASN 579 579 579 ASN ASN D . n 
D 4 580 GLU 580 580 580 GLU GLU D . n 
D 4 581 ILE 581 581 581 ILE ILE D . n 
D 4 582 LEU 582 582 582 LEU LEU D . n 
D 4 583 GLN 583 583 583 GLN GLN D . n 
D 4 584 ALA 584 584 584 ALA ALA D . n 
D 4 585 ASP 585 585 585 ASP ASP D . n 
D 4 586 ALA 586 586 586 ALA ALA D . n 
D 4 587 ILE 587 587 587 ILE ILE D . n 
D 4 588 ASN 588 588 588 ASN ASN D . n 
D 4 589 GLY 589 589 589 GLY GLY D . n 
D 4 590 THR 590 590 590 THR THR D . n 
D 4 591 ASP 591 591 591 ASP ASP D . n 
D 4 592 ASN 592 592 592 ASN ASN D . n 
D 4 593 GLU 593 593 593 GLU GLU D . n 
D 4 594 VAL 594 594 594 VAL VAL D . n 
D 4 595 VAL 595 595 ?   ?   ?   D . n 
D 4 596 THR 596 596 ?   ?   ?   D . n 
D 4 597 VAL 597 597 ?   ?   ?   D . n 
D 4 598 THR 598 598 ?   ?   ?   D . n 
D 4 599 ASP 599 599 ?   ?   ?   D . n 
D 4 600 GLU 600 600 ?   ?   ?   D . n 
D 4 601 ASN 601 601 ?   ?   ?   D . n 
D 4 602 THR 602 602 ?   ?   ?   D . n 
D 4 603 GLY 603 603 ?   ?   ?   D . n 
D 4 604 GLU 604 604 ?   ?   ?   D . n 
D 4 605 ILE 605 605 ?   ?   ?   D . n 
D 4 606 SER 606 606 ?   ?   ?   D . n 
D 4 607 GLU 607 607 ?   ?   ?   D . n 
D 4 608 LYS 608 608 ?   ?   ?   D . n 
D 4 609 VAL 609 609 609 VAL VAL D . n 
D 4 610 LYS 610 610 610 LYS LYS D . n 
D 4 611 LEU 611 611 611 LEU LEU D . n 
D 4 612 GLY 612 612 612 GLY GLY D . n 
D 4 613 THR 613 613 613 THR THR D . n 
D 4 614 LYS 614 614 614 LYS LYS D . n 
D 4 615 ALA 615 615 615 ALA ALA D . n 
D 4 616 LEU 616 616 616 LEU LEU D . n 
D 4 617 ALA 617 617 617 ALA ALA D . n 
D 4 618 GLY 618 618 618 GLY GLY D . n 
D 4 619 GLN 619 619 619 GLN GLN D . n 
D 4 620 TRP 620 620 620 TRP TRP D . n 
D 4 621 LEU 621 621 621 LEU LEU D . n 
D 4 622 ALA 622 622 622 ALA ALA D . n 
D 4 623 TYR 623 623 623 TYR TYR D . n 
D 4 624 GLY 624 624 624 GLY GLY D . n 
D 4 625 VAL 625 625 625 VAL VAL D . n 
D 4 626 THR 626 626 626 THR THR D . n 
D 4 627 ARG 627 627 627 ARG ARG D . n 
D 4 628 SER 628 628 628 SER SER D . n 
D 4 629 VAL 629 629 629 VAL VAL D . n 
D 4 630 THR 630 630 630 THR THR D . n 
D 4 631 LYS 631 631 631 LYS LYS D . n 
D 4 632 ARG 632 632 632 ARG ARG D . n 
D 4 633 SER 633 633 633 SER SER D . n 
D 4 634 VAL 634 634 634 VAL VAL D . n 
D 4 635 MET 635 635 635 MET MET D . n 
D 4 636 THR 636 636 636 THR THR D . n 
D 4 637 LEU 637 637 637 LEU LEU D . n 
D 4 638 ALA 638 638 638 ALA ALA D . n 
D 4 639 TYR 639 639 639 TYR TYR D . n 
D 4 640 GLY 640 640 640 GLY GLY D . n 
D 4 641 SER 641 641 641 SER SER D . n 
D 4 642 LYS 642 642 642 LYS LYS D . n 
D 4 643 GLU 643 643 643 GLU GLU D . n 
D 4 644 PHE 644 644 644 PHE PHE D . n 
D 4 645 GLY 645 645 645 GLY GLY D . n 
D 4 646 PHE 646 646 646 PHE PHE D . n 
D 4 647 ARG 647 647 647 ARG ARG D . n 
D 4 648 GLN 648 648 648 GLN GLN D . n 
D 4 649 GLN 649 649 649 GLN GLN D . n 
D 4 650 VAL 650 650 650 VAL VAL D . n 
D 4 651 LEU 651 651 651 LEU LEU D . n 
D 4 652 GLU 652 652 652 GLU GLU D . n 
D 4 653 ASP 653 653 653 ASP ASP D . n 
D 4 654 THR 654 654 654 THR THR D . n 
D 4 655 ILE 655 655 655 ILE ILE D . n 
D 4 656 GLN 656 656 656 GLN GLN D . n 
D 4 657 PRO 657 657 657 PRO PRO D . n 
D 4 658 ALA 658 658 658 ALA ALA D . n 
D 4 659 ILE 659 659 659 ILE ILE D . n 
D 4 660 ASP 660 660 660 ASP ASP D . n 
D 4 661 SER 661 661 661 SER SER D . n 
D 4 662 GLY 662 662 662 GLY GLY D . n 
D 4 663 LYS 663 663 663 LYS LYS D . n 
D 4 664 GLY 664 664 664 GLY GLY D . n 
D 4 665 LEU 665 665 665 LEU LEU D . n 
D 4 666 MET 666 666 666 MET MET D . n 
D 4 667 PHE 667 667 667 PHE PHE D . n 
D 4 668 THR 668 668 668 THR THR D . n 
D 4 669 GLN 669 669 669 GLN GLN D . n 
D 4 670 PRO 670 670 670 PRO PRO D . n 
D 4 671 ASN 671 671 671 ASN ASN D . n 
D 4 672 GLN 672 672 672 GLN GLN D . n 
D 4 673 ALA 673 673 673 ALA ALA D . n 
D 4 674 ALA 674 674 674 ALA ALA D . n 
D 4 675 GLY 675 675 675 GLY GLY D . n 
D 4 676 TYR 676 676 676 TYR TYR D . n 
D 4 677 MET 677 677 677 MET MET D . n 
D 4 678 ALA 678 678 678 ALA ALA D . n 
D 4 679 LYS 679 679 679 LYS LYS D . n 
D 4 680 LEU 680 680 680 LEU LEU D . n 
D 4 681 ILE 681 681 681 ILE ILE D . n 
D 4 682 TRP 682 682 682 TRP TRP D . n 
D 4 683 GLU 683 683 683 GLU GLU D . n 
D 4 684 SER 684 684 684 SER SER D . n 
D 4 685 VAL 685 685 685 VAL VAL D . n 
D 4 686 SER 686 686 686 SER SER D . n 
D 4 687 VAL 687 687 687 VAL VAL D . n 
D 4 688 THR 688 688 688 THR THR D . n 
D 4 689 VAL 689 689 689 VAL VAL D . n 
D 4 690 VAL 690 690 690 VAL VAL D . n 
D 4 691 ALA 691 691 691 ALA ALA D . n 
D 4 692 ALA 692 692 692 ALA ALA D . n 
D 4 693 VAL 693 693 693 VAL VAL D . n 
D 4 694 GLU 694 694 694 GLU GLU D . n 
D 4 695 ALA 695 695 695 ALA ALA D . n 
D 4 696 MET 696 696 696 MET MET D . n 
D 4 697 ASN 697 697 697 ASN ASN D . n 
D 4 698 TRP 698 698 698 TRP TRP D . n 
D 4 699 LEU 699 699 699 LEU LEU D . n 
D 4 700 LYS 700 700 700 LYS LYS D . n 
D 4 701 SER 701 701 701 SER SER D . n 
D 4 702 ALA 702 702 702 ALA ALA D . n 
D 4 703 ALA 703 703 703 ALA ALA D . n 
D 4 704 LYS 704 704 704 LYS LYS D . n 
D 4 705 LEU 705 705 705 LEU LEU D . n 
D 4 706 LEU 706 706 706 LEU LEU D . n 
D 4 707 ALA 707 707 707 ALA ALA D . n 
D 4 708 ALA 708 708 708 ALA ALA D . n 
D 4 709 GLU 709 709 709 GLU GLU D . n 
D 4 710 VAL 710 710 710 VAL VAL D . n 
D 4 711 LYS 711 711 711 LYS LYS D . n 
D 4 712 ASP 712 712 712 ASP ASP D . n 
D 4 713 LYS 713 713 713 LYS LYS D . n 
D 4 714 LYS 714 714 714 LYS LYS D . n 
D 4 715 THR 715 715 715 THR THR D . n 
D 4 716 GLY 716 716 716 GLY GLY D . n 
D 4 717 GLU 717 717 717 GLU GLU D . n 
D 4 718 ILE 718 718 718 ILE ILE D . n 
D 4 719 LEU 719 719 719 LEU LEU D . n 
D 4 720 ARG 720 720 720 ARG ARG D . n 
D 4 721 LYS 721 721 721 LYS LYS D . n 
D 4 722 ARG 722 722 722 ARG ARG D . n 
D 4 723 CYS 723 723 723 CYS CYS D . n 
D 4 724 ALA 724 724 724 ALA ALA D . n 
D 4 725 VAL 725 725 725 VAL VAL D . n 
D 4 726 HIS 726 726 726 HIS HIS D . n 
D 4 727 TRP 727 727 727 TRP TRP D . n 
D 4 728 VAL 728 728 728 VAL VAL D . n 
D 4 729 THR 729 729 729 THR THR D . n 
D 4 730 PRO 730 730 730 PRO PRO D . n 
D 4 731 ASP 731 731 731 ASP ASP D . n 
D 4 732 GLY 732 732 732 GLY GLY D . n 
D 4 733 PHE 733 733 733 PHE PHE D . n 
D 4 734 PRO 734 734 734 PRO PRO D . n 
D 4 735 VAL 735 735 735 VAL VAL D . n 
D 4 736 TRP 736 736 736 TRP TRP D . n 
D 4 737 GLN 737 737 737 GLN GLN D . n 
D 4 738 GLU 738 738 738 GLU GLU D . n 
D 4 739 TYR 739 739 739 TYR TYR D . n 
D 4 740 LYS 740 740 740 LYS LYS D . n 
D 4 741 LYS 741 741 741 LYS LYS D . n 
D 4 742 PRO 742 742 742 PRO PRO D . n 
D 4 743 ILE 743 743 743 ILE ILE D . n 
D 4 744 GLN 744 744 744 GLN GLN D . n 
D 4 745 THR 745 745 745 THR THR D . n 
D 4 746 ARG 746 746 746 ARG ARG D . n 
D 4 747 LEU 747 747 747 LEU LEU D . n 
D 4 748 ASN 748 748 748 ASN ASN D . n 
D 4 749 LEU 749 749 749 LEU LEU D . n 
D 4 750 MET 750 750 750 MET MET D . n 
D 4 751 PHE 751 751 751 PHE PHE D . n 
D 4 752 LEU 752 752 752 LEU LEU D . n 
D 4 753 GLY 753 753 753 GLY GLY D . n 
D 4 754 GLN 754 754 754 GLN GLN D . n 
D 4 755 PHE 755 755 755 PHE PHE D . n 
D 4 756 ARG 756 756 756 ARG ARG D . n 
D 4 757 LEU 757 757 757 LEU LEU D . n 
D 4 758 GLN 758 758 758 GLN GLN D . n 
D 4 759 PRO 759 759 759 PRO PRO D . n 
D 4 760 THR 760 760 760 THR THR D . n 
D 4 761 ILE 761 761 761 ILE ILE D . n 
D 4 762 ASN 762 762 762 ASN ASN D . n 
D 4 763 THR 763 763 763 THR THR D . n 
D 4 764 ASN 764 764 764 ASN ASN D . n 
D 4 765 LYS 765 765 765 LYS LYS D . n 
D 4 766 ASP 766 766 766 ASP ASP D . n 
D 4 767 SER 767 767 767 SER SER D . n 
D 4 768 GLU 768 768 768 GLU GLU D . n 
D 4 769 ILE 769 769 769 ILE ILE D . n 
D 4 770 ASP 770 770 770 ASP ASP D . n 
D 4 771 ALA 771 771 771 ALA ALA D . n 
D 4 772 HIS 772 772 772 HIS HIS D . n 
D 4 773 LYS 773 773 773 LYS LYS D . n 
D 4 774 GLN 774 774 774 GLN GLN D . n 
D 4 775 GLU 775 775 775 GLU GLU D . n 
D 4 776 SER 776 776 776 SER SER D . n 
D 4 777 GLY 777 777 777 GLY GLY D . n 
D 4 778 ILE 778 778 778 ILE ILE D . n 
D 4 779 ALA 779 779 779 ALA ALA D . n 
D 4 780 PRO 780 780 780 PRO PRO D . n 
D 4 781 ASN 781 781 781 ASN ASN D . n 
D 4 782 PHE 782 782 782 PHE PHE D . n 
D 4 783 VAL 783 783 783 VAL VAL D . n 
D 4 784 HIS 784 784 784 HIS HIS D . n 
D 4 785 SER 785 785 785 SER SER D . n 
D 4 786 GLN 786 786 786 GLN GLN D . n 
D 4 787 ASP 787 787 787 ASP ASP D . n 
D 4 788 GLY 788 788 788 GLY GLY D . n 
D 4 789 SER 789 789 789 SER SER D . n 
D 4 790 HIS 790 790 790 HIS HIS D . n 
D 4 791 LEU 791 791 791 LEU LEU D . n 
D 4 792 ARG 792 792 792 ARG ARG D . n 
D 4 793 LYS 793 793 793 LYS LYS D . n 
D 4 794 THR 794 794 794 THR THR D . n 
D 4 795 VAL 795 795 795 VAL VAL D . n 
D 4 796 VAL 796 796 796 VAL VAL D . n 
D 4 797 TRP 797 797 797 TRP TRP D . n 
D 4 798 ALA 798 798 798 ALA ALA D . n 
D 4 799 HIS 799 799 799 HIS HIS D . n 
D 4 800 GLU 800 800 800 GLU GLU D . n 
D 4 801 LYS 801 801 801 LYS LYS D . n 
D 4 802 TYR 802 802 802 TYR TYR D . n 
D 4 803 GLY 803 803 803 GLY GLY D . n 
D 4 804 ILE 804 804 804 ILE ILE D . n 
D 4 805 GLU 805 805 805 GLU GLU D . n 
D 4 806 SER 806 806 806 SER SER D . n 
D 4 807 PHE 807 807 807 PHE PHE D . n 
D 4 808 ALA 808 808 808 ALA ALA D . n 
D 4 809 LEU 809 809 809 LEU LEU D . n 
D 4 810 ILE 810 810 810 ILE ILE D . n 
D 4 811 HIS 811 811 811 HIS HIS D . n 
D 4 812 ASP 812 812 812 ASP ASP D . n 
D 4 813 SER 813 813 813 SER SER D . n 
D 4 814 PHE 814 814 814 PHE PHE D . n 
D 4 815 GLY 815 815 815 GLY GLY D . n 
D 4 816 THR 816 816 816 THR THR D . n 
D 4 817 ILE 817 817 817 ILE ILE D . n 
D 4 818 PRO 818 818 818 PRO PRO D . n 
D 4 819 ALA 819 819 819 ALA ALA D . n 
D 4 820 ASP 820 820 820 ASP ASP D . n 
D 4 821 ALA 821 821 821 ALA ALA D . n 
D 4 822 ALA 822 822 822 ALA ALA D . n 
D 4 823 ASN 823 823 823 ASN ASN D . n 
D 4 824 LEU 824 824 824 LEU LEU D . n 
D 4 825 PHE 825 825 825 PHE PHE D . n 
D 4 826 LYS 826 826 826 LYS LYS D . n 
D 4 827 ALA 827 827 827 ALA ALA D . n 
D 4 828 VAL 828 828 828 VAL VAL D . n 
D 4 829 ARG 829 829 829 ARG ARG D . n 
D 4 830 GLU 830 830 830 GLU GLU D . n 
D 4 831 THR 831 831 831 THR THR D . n 
D 4 832 MET 832 832 832 MET MET D . n 
D 4 833 VAL 833 833 833 VAL VAL D . n 
D 4 834 ASP 834 834 834 ASP ASP D . n 
D 4 835 THR 835 835 835 THR THR D . n 
D 4 836 TYR 836 836 836 TYR TYR D . n 
D 4 837 GLU 837 837 837 GLU GLU D . n 
D 4 838 SER 838 838 838 SER SER D . n 
D 4 839 CYS 839 839 839 CYS CYS D . n 
D 4 840 ASP 840 840 840 ASP ASP D . n 
D 4 841 VAL 841 841 841 VAL VAL D . n 
D 4 842 LEU 842 842 842 LEU LEU D . n 
D 4 843 ALA 843 843 843 ALA ALA D . n 
D 4 844 ASP 844 844 844 ASP ASP D . n 
D 4 845 PHE 845 845 845 PHE PHE D . n 
D 4 846 TYR 846 846 846 TYR TYR D . n 
D 4 847 ASP 847 847 847 ASP ASP D . n 
D 4 848 GLN 848 848 848 GLN GLN D . n 
D 4 849 PHE 849 849 849 PHE PHE D . n 
D 4 850 ALA 850 850 850 ALA ALA D . n 
D 4 851 ASP 851 851 851 ASP ASP D . n 
D 4 852 GLN 852 852 852 GLN GLN D . n 
D 4 853 LEU 853 853 853 LEU LEU D . n 
D 4 854 HIS 854 854 854 HIS HIS D . n 
D 4 855 GLU 855 855 855 GLU GLU D . n 
D 4 856 SER 856 856 856 SER SER D . n 
D 4 857 GLN 857 857 857 GLN GLN D . n 
D 4 858 LEU 858 858 858 LEU LEU D . n 
D 4 859 ASP 859 859 859 ASP ASP D . n 
D 4 860 LYS 860 860 860 LYS LYS D . n 
D 4 861 MET 861 861 861 MET MET D . n 
D 4 862 PRO 862 862 862 PRO PRO D . n 
D 4 863 ALA 863 863 863 ALA ALA D . n 
D 4 864 LEU 864 864 864 LEU LEU D . n 
D 4 865 PRO 865 865 865 PRO PRO D . n 
D 4 866 ALA 866 866 866 ALA ALA D . n 
D 4 867 LYS 867 867 867 LYS LYS D . n 
D 4 868 GLY 868 868 868 GLY GLY D . n 
D 4 869 ASN 869 869 869 ASN ASN D . n 
D 4 870 LEU 870 870 870 LEU LEU D . n 
D 4 871 ASN 871 871 871 ASN ASN D . n 
D 4 872 LEU 872 872 872 LEU LEU D . n 
D 4 873 ARG 873 873 873 ARG ARG D . n 
D 4 874 ASP 874 874 874 ASP ASP D . n 
D 4 875 ILE 875 875 875 ILE ILE D . n 
D 4 876 LEU 876 876 876 LEU LEU D . n 
D 4 877 GLU 877 877 877 GLU GLU D . n 
D 4 878 SER 878 878 878 SER SER D . n 
D 4 879 ASP 879 879 879 ASP ASP D . n 
D 4 880 PHE 880 880 880 PHE PHE D . n 
D 4 881 ALA 881 881 881 ALA ALA D . n 
D 4 882 PHE 882 882 882 PHE PHE D . n 
D 4 883 ALA 883 883 883 ALA ALA D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 5 MG  1 902 902 MG  MG  R . 
F 5 MG  1 903 903 MG  MG  D . 
G 6 POP 1 901 901 POP POP D . 
H 7 HOH 1 904 904 HOH HOH D . 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    C 
_pdbx_struct_mod_residue.label_comp_id    3DA 
_pdbx_struct_mod_residue.label_seq_id     10 
_pdbx_struct_mod_residue.auth_asym_id     R 
_pdbx_struct_mod_residue.auth_comp_id     3DA 
_pdbx_struct_mod_residue.auth_seq_id      1 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   DA 
_pdbx_struct_mod_residue.details          "3'-DEOXYADENOSINE-5'-MONOPHOSPHATE" 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 OD2   ? D ASP 537 ? D ASP 537 ? 1_555 MG ? F MG . ? D MG 903 ? 1_555 O1P   ? C 3DA 10  ? R 3DA 1   ? 1_555 98.5  ? 
2 OD2   ? D ASP 537 ? D ASP 537 ? 1_555 MG ? F MG . ? D MG 903 ? 1_555 O     ? H HOH .   ? D HOH 904 ? 1_555 146.4 ? 
3 O1P   ? C 3DA 10  ? R 3DA 1   ? 1_555 MG ? F MG . ? D MG 903 ? 1_555 O     ? H HOH .   ? D HOH 904 ? 1_555 114.9 ? 
4 OD2   ? D ASP 537 ? D ASP 537 ? 1_555 MG ? F MG . ? D MG 903 ? 1_555 OD2   ? D ASP 812 ? D ASP 812 ? 1_555 96.5  ? 
5 O1P   ? C 3DA 10  ? R 3DA 1   ? 1_555 MG ? F MG . ? D MG 903 ? 1_555 OD2   ? D ASP 812 ? D ASP 812 ? 1_555 88.9  ? 
6 O     ? H HOH .   ? D HOH 904 ? 1_555 MG ? F MG . ? D MG 903 ? 1_555 OD2   ? D ASP 812 ? D ASP 812 ? 1_555 88.0  ? 
7 O2P   ? C 3DA 10  ? R 3DA 1   ? 1_555 MG ? E MG . ? R MG 902 ? 1_555 "O3'" ? C A   9   ? R A   2   ? 1_555 69.2  ? 
8 O2P   ? C 3DA 10  ? R 3DA 1   ? 1_555 MG ? E MG . ? R MG 902 ? 1_555 O1P   ? C 3DA 10  ? R 3DA 1   ? 1_555 60.1  ? 
9 "O3'" ? C A   9   ? R A   2   ? 1_555 MG ? E MG . ? R MG 902 ? 1_555 O1P   ? C 3DA 10  ? R 3DA 1   ? 1_555 55.4  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-03-23 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement       1.1 ? 1 
DENZO     'data reduction' .   ? 2 
SCALEPACK 'data scaling'   .   ? 3 
AMoRE     phasing          .   ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 CA  D LYS 378 ? ? N  D ARG 379 ? ? 1.59 
2 1 N   D LYS 378 ? ? N  D ARG 379 ? ? 1.61 
3 1 O   D TRP 377 ? ? N  D ARG 379 ? ? 1.61 
4 1 O   D LYS 378 ? ? O  D ARG 379 ? ? 1.75 
5 1 OD1 D ASP 147 ? ? NZ D LYS 180 ? ? 1.77 
6 1 C   D TRP 377 ? ? N  D ARG 379 ? ? 1.80 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" T DT  120 ? ? "C1'" T DT  120 ? ? N1 T DT  120 ? ? 111.29 108.30 2.99   0.30 N 
2 1 "O4'" T DT  119 ? ? "C1'" T DT  119 ? ? N1 T DT  119 ? ? 111.17 108.30 2.87   0.30 N 
3 1 "O4'" T DC  118 ? ? "C1'" T DC  118 ? ? N1 T DC  118 ? ? 110.64 108.30 2.34   0.30 N 
4 1 C     D ILE 19  ? ? N     D PRO 20  ? ? CA D PRO 20  ? ? 128.45 119.30 9.15   1.50 Y 
5 1 O     D TRP 377 ? ? C     D TRP 377 ? ? N  D LYS 378 ? ? 109.48 122.70 -13.22 1.60 Y 
6 1 C     D TRP 377 ? ? N     D LYS 378 ? ? CA D LYS 378 ? ? 139.69 121.70 17.99  2.50 Y 
7 1 CA    D LYS 378 ? ? C     D LYS 378 ? ? N  D ARG 379 ? ? 67.43  117.20 -49.77 2.20 Y 
8 1 O     D LYS 378 ? ? C     D LYS 378 ? ? N  D ARG 379 ? ? 142.15 122.70 19.45  1.60 Y 
9 1 C     D LYS 378 ? ? N     D ARG 379 ? ? CA D ARG 379 ? ? 83.57  121.70 -38.13 2.50 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1 LEU D 16  ? ? -60.34  0.12    
2   1 ALA D 18  ? ? -118.07 -132.75 
3   1 GLN D 36  ? ? -52.74  -70.24  
4   1 ALA D 61  ? ? -154.26 37.87   
5   1 GLU D 63  ? ? -166.89 33.94   
6   1 ALA D 65  ? ? -40.00  -32.12  
7   1 ALA D 83  ? ? -65.72  21.13   
8   1 ARG D 84  ? ? -157.71 -53.34  
9   1 GLU D 90  ? ? -66.42  19.97   
10  1 ARG D 96  ? ? -96.95  52.46   
11  1 PRO D 100 ? ? -48.10  28.01   
12  1 THR D 101 ? ? 61.63   -49.06  
13  1 PHE D 103 ? ? -35.11  -71.19  
14  1 PHE D 105 ? ? -89.64  46.31   
15  1 LEU D 106 ? ? -168.15 -14.01  
16  1 THR D 118 ? ? -72.21  -74.20  
17  1 ALA D 124 ? ? -66.49  11.98   
18  1 CYS D 125 ? ? -135.86 -39.23  
19  1 THR D 133 ? ? -115.84 -165.62 
20  1 ASP D 147 ? ? 64.06   -65.40  
21  1 ARG D 150 ? ? -74.44  -90.95  
22  1 PHE D 151 ? ? -56.91  -5.22   
23  1 LEU D 157 ? ? 46.58   27.73   
24  1 GLU D 158 ? ? -169.56 -12.21  
25  1 LYS D 160 ? ? 64.91   -6.09   
26  1 LYS D 164 ? ? -54.00  4.78    
27  1 ASN D 165 ? ? 48.53   18.66   
28  1 GLU D 168 ? ? 46.67   97.53   
29  1 LEU D 170 ? ? 35.81   -120.95 
30  1 VAL D 174 ? ? -47.27  165.89  
31  1 ALA D 181 ? ? -72.07  -73.12  
32  1 PHE D 182 ? ? -71.17  40.44   
33  1 MET D 183 ? ? -166.87 15.86   
34  1 ASP D 189 ? ? -38.44  127.51  
35  1 LEU D 191 ? ? 49.03   -150.65 
36  1 LYS D 193 ? ? 63.74   -114.40 
37  1 ALA D 200 ? ? 66.39   141.79  
38  1 SER D 203 ? ? -39.00  143.00  
39  1 TRP D 204 ? ? -65.20  24.61   
40  1 HIS D 205 ? ? 57.73   -126.74 
41  1 LYS D 206 ? ? -159.90 22.07   
42  1 SER D 223 ? ? -100.53 -60.20  
43  1 THR D 224 ? ? -77.70  -121.62 
44  1 MET D 226 ? ? -41.12  -90.63  
45  1 LEU D 229 ? ? -133.77 -123.82 
46  1 ALA D 247 ? ? -48.79  163.05  
47  1 ALA D 260 ? ? -87.26  36.41   
48  1 LEU D 261 ? ? -152.67 -24.84  
49  1 PRO D 293 ? ? -68.64  -175.90 
50  1 GLU D 309 ? ? -35.86  -30.79  
51  1 MET D 313 ? ? -149.07 58.27   
52  1 GLU D 350 ? ? -20.50  -86.46  
53  1 ASP D 351 ? ? -109.12 78.67   
54  1 ARG D 357 ? ? -79.76  -142.13 
55  1 GLU D 359 ? ? 39.01   93.09   
56  1 LEU D 360 ? ? 51.05   134.01  
57  1 LYS D 378 ? ? 7.09    -4.20   
58  1 ARG D 379 ? ? -55.77  -105.34 
59  1 ALA D 381 ? ? -108.47 44.20   
60  1 ASN D 410 ? ? 76.46   -31.28  
61  1 THR D 500 ? ? -93.67  33.72   
62  1 SER D 507 ? ? -111.57 72.67   
63  1 LEU D 526 ? ? -53.09  -6.48   
64  1 THR D 590 ? ? 50.45   165.66  
65  1 VAL D 594 ? ? 65.15   -78.31  
66  1 VAL D 609 ? ? -145.74 -39.27  
67  1 LYS D 610 ? ? -51.66  104.88  
68  1 THR D 613 ? ? -73.17  -165.50 
69  1 LYS D 614 ? ? 66.71   -67.70  
70  1 TYR D 623 ? ? -60.80  -113.69 
71  1 VAL D 625 ? ? -29.54  107.78  
72  1 LYS D 631 ? ? -37.05  -82.10  
73  1 ALA D 638 ? ? -65.12  0.31    
74  1 LEU D 665 ? ? -66.28  48.11   
75  1 MET D 666 ? ? -161.03 41.13   
76  1 THR D 668 ? ? 28.75   78.36   
77  1 GLN D 669 ? ? 86.42   104.88  
78  1 ASN D 671 ? ? -57.89  173.27  
79  1 GLN D 672 ? ? 66.32   -63.87  
80  1 VAL D 690 ? ? -123.46 -58.05  
81  1 ALA D 708 ? ? -49.57  159.88  
82  1 THR D 745 ? ? -58.65  101.78  
83  1 MET D 750 ? ? -39.84  148.93  
84  1 PHE D 751 ? ? 84.76   -96.93  
85  1 LEU D 757 ? ? -173.12 138.50  
86  1 PRO D 759 ? ? -48.23  151.23  
87  1 THR D 763 ? ? -97.79  -82.37  
88  1 ASN D 764 ? ? 48.43   -91.21  
89  1 LYS D 765 ? ? 56.73   -105.79 
90  1 SER D 767 ? ? 160.00  -24.94  
91  1 GLU D 768 ? ? 87.88   119.17  
92  1 HIS D 811 ? ? 69.23   -65.06  
93  1 ASP D 851 ? ? -81.43  -92.01  
94  1 GLN D 852 ? ? -37.94  99.08   
95  1 LEU D 853 ? ? 78.60   108.48  
96  1 HIS D 854 ? ? 164.36  -152.31 
97  1 GLU D 855 ? ? 44.29   -131.30 
98  1 GLN D 857 ? ? 102.62  -29.60  
99  1 ASP D 859 ? ? -167.58 38.27   
100 1 PHE D 882 ? ? 65.37   -95.10  
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   TRP 
_pdbx_validate_peptide_omega.auth_asym_id_1   D 
_pdbx_validate_peptide_omega.auth_seq_id_1    377 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   LYS 
_pdbx_validate_peptide_omega.auth_asym_id_2   D 
_pdbx_validate_peptide_omega.auth_seq_id_2    378 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            144.86 
# 
_pdbx_validate_main_chain_plane.id                       1 
_pdbx_validate_main_chain_plane.PDB_model_num            1 
_pdbx_validate_main_chain_plane.auth_comp_id             LYS 
_pdbx_validate_main_chain_plane.auth_asym_id             D 
_pdbx_validate_main_chain_plane.auth_seq_id              378 
_pdbx_validate_main_chain_plane.PDB_ins_code             ? 
_pdbx_validate_main_chain_plane.label_alt_id             ? 
_pdbx_validate_main_chain_plane.improper_torsion_angle   -18.02 
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 DT T 120 ? ? 0.093 'SIDE CHAIN' 
2 1 DT T 119 ? ? 0.100 'SIDE CHAIN' 
3 1 DC T 118 ? ? 0.109 'SIDE CHAIN' 
4 1 DG T 117 ? ? 0.079 'SIDE CHAIN' 
5 1 DC T 116 ? ? 0.070 'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 D MET 1   ? D MET 1   
2  1 Y 1 D ASN 2   ? D ASN 2   
3  1 Y 1 D THR 3   ? D THR 3   
4  1 Y 1 D ILE 4   ? D ILE 4   
5  1 Y 1 D ASN 5   ? D ASN 5   
6  1 Y 1 D ILE 6   ? D ILE 6   
7  1 Y 1 D ALA 7   ? D ALA 7   
8  1 Y 1 D LYS 8   ? D LYS 8   
9  1 Y 1 D ASN 9   ? D ASN 9   
10 1 Y 1 D ASP 10  ? D ASP 10  
11 1 Y 1 D PHE 11  ? D PHE 11  
12 1 Y 1 D LEU 195 ? D LEU 195 
13 1 Y 1 D LEU 196 ? D LEU 196 
14 1 Y 1 D GLY 197 ? D GLY 197 
15 1 Y 1 D GLY 198 ? D GLY 198 
16 1 Y 1 D GLU 199 ? D GLU 199 
17 1 Y 1 D ARG 231 ? D ARG 231 
18 1 Y 1 D GLN 232 ? D GLN 232 
19 1 Y 1 D ASN 233 ? D ASN 233 
20 1 Y 1 D ALA 234 ? D ALA 234 
21 1 Y 1 D GLY 235 ? D GLY 235 
22 1 Y 1 D VAL 236 ? D VAL 236 
23 1 Y 1 D VAL 237 ? D VAL 237 
24 1 Y 1 D GLY 238 ? D GLY 238 
25 1 Y 1 D GLN 239 ? D GLN 239 
26 1 Y 1 D ASP 240 ? D ASP 240 
27 1 Y 1 D MET 362 ? D MET 362 
28 1 Y 1 D LYS 363 ? D LYS 363 
29 1 Y 1 D PRO 364 ? D PRO 364 
30 1 Y 1 D GLU 365 ? D GLU 365 
31 1 Y 1 D ASP 366 ? D ASP 366 
32 1 Y 1 D ILE 367 ? D ILE 367 
33 1 Y 1 D ASP 368 ? D ASP 368 
34 1 Y 1 D MET 369 ? D MET 369 
35 1 Y 1 D ASN 370 ? D ASN 370 
36 1 Y 1 D PRO 371 ? D PRO 371 
37 1 Y 1 D GLU 372 ? D GLU 372 
38 1 Y 1 D ALA 373 ? D ALA 373 
39 1 Y 1 D LEU 374 ? D LEU 374 
40 1 Y 1 D THR 375 ? D THR 375 
41 1 Y 1 D ALA 376 ? D ALA 376 
42 1 Y 1 D VAL 595 ? D VAL 595 
43 1 Y 1 D THR 596 ? D THR 596 
44 1 Y 1 D VAL 597 ? D VAL 597 
45 1 Y 1 D THR 598 ? D THR 598 
46 1 Y 1 D ASP 599 ? D ASP 599 
47 1 Y 1 D GLU 600 ? D GLU 600 
48 1 Y 1 D ASN 601 ? D ASN 601 
49 1 Y 1 D THR 602 ? D THR 602 
50 1 Y 1 D GLY 603 ? D GLY 603 
51 1 Y 1 D GLU 604 ? D GLU 604 
52 1 Y 1 D ILE 605 ? D ILE 605 
53 1 Y 1 D SER 606 ? D SER 606 
54 1 Y 1 D GLU 607 ? D GLU 607 
55 1 Y 1 D LYS 608 ? D LYS 608 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1S77 'double helix'        
1S77 'a-form double helix' 
1S77 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DG 1  1_555 B DC  17 1_555 0.028  -0.071 0.553  19.594  -18.545 -1.829  1  T_DG130:DC30_N T 130 ? N 30 ? 19 1 
1 A DC 2  1_555 B DG  16 1_555 -0.002 -0.098 1.026  -17.322 -10.576 -6.200  2  T_DC129:DG29_N T 129 ? N 29 ? 19 1 
1 A DC 3  1_555 B DG  15 1_555 0.077  -0.044 -0.436 -5.470  6.219   -1.535  3  T_DC128:DG28_N T 128 ? N 28 ? 19 1 
1 A DG 4  1_555 B DC  14 1_555 -0.041 -0.032 -0.184 0.059   13.435  -1.251  4  T_DG127:DC27_N T 127 ? N 27 ? 19 1 
1 A DT 5  1_555 B DA  13 1_555 -0.028 -0.023 -0.208 17.993  -14.503 -3.594  5  T_DT126:DA26_N T 126 ? N 26 ? 20 1 
1 A DG 6  1_555 B DC  12 1_555 -0.174 -0.076 -0.484 -6.651  -6.587  -1.043  6  T_DG125:DC25_N T 125 ? N 25 ? 19 1 
1 A DC 7  1_555 B DG  11 1_555 0.006  -0.021 -0.126 -6.755  -1.111  -3.870  7  T_DC124:DG24_N T 124 ? N 24 ? 19 1 
1 A DG 8  1_555 B DC  10 1_555 -0.025 -0.017 0.520  13.833  3.367   -3.246  8  T_DG123:DC23_N T 123 ? N 23 ? 19 1 
1 A DC 9  1_555 B DG  9  1_555 -0.016 -0.051 0.112  8.332   11.099  0.202   9  T_DC122:DG22_N T 122 ? N 22 ? 19 1 
1 A DT 11 1_555 C 3DA 10 1_555 0.032  -0.445 -0.414 -6.065  6.256   -1.820  10 T_DT120:3DA1_R T 120 ? R 1  ? 20 1 
1 A DT 12 1_555 C A   9  1_555 -0.040 -0.228 -0.445 11.885  5.897   -1.706  11 T_DT119:A2_R   T 119 ? R 2  ? 20 1 
1 A DC 13 1_555 C G   8  1_555 0.525  -0.129 -0.854 3.648   -5.134  13.474  12 T_DC118:G3_R   T 118 ? R 3  ? 19 1 
1 A DG 14 1_555 C C   7  1_555 -0.305 0.027  -2.040 -57.518 -20.225 13.549  13 T_DG117:C4_R   T 117 ? R 4  ? 19 1 
1 A DC 15 1_555 C G   6  1_555 0.205  -0.567 -1.426 -8.618  -11.780 13.644  14 T_DC116:G5_R   T 116 ? R 5  ? 19 1 
1 A DC 16 1_555 C G   5  1_555 0.317  -0.477 1.360  -1.674  13.502  8.010   15 T_DC115:G6_R   T 115 ? R 6  ? 19 1 
1 A DG 17 1_555 C C   4  1_555 -0.020 -0.147 0.810  18.776  -16.770 -4.399  16 T_DG114:C7_R   T 114 ? R 7  ? 19 1 
1 A DT 18 1_555 C A   3  1_555 -0.118 -0.030 0.456  5.177   -30.828 -13.328 17 T_DT113:A8_R   T 113 ? R 8  ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DG 1  1_555 B DC  17 1_555 A DC 2  1_555 B DG 16 1_555 -0.482 -0.548 4.334 -5.464  7.785   41.506 -1.796 -0.066 4.197 10.814  
7.591   42.535 1  TT_DG130DC129:DG29DC30_NN T 130 ? N 30 ? T 129 ? N 29 ? 
1 A DC 2  1_555 B DG  16 1_555 A DC 3  1_555 B DG 15 1_555 0.598  1.887  3.046 10.055  -12.619 42.895 3.397  0.001  2.498 -16.571 
-13.204 45.695 2  TT_DC129DC128:DG28DG29_NN T 129 ? N 29 ? T 128 ? N 28 ? 
1 A DC 3  1_555 B DG  15 1_555 A DG 4  1_555 B DC 14 1_555 -1.393 0.056  3.201 -7.187  13.565  31.448 -2.027 1.198  3.193 23.365  
12.379  34.909 3  TT_DC128DG127:DC27DG28_NN T 128 ? N 28 ? T 127 ? N 27 ? 
1 A DG 4  1_555 B DC  14 1_555 A DT 5  1_555 B DA 13 1_555 -0.588 0.131  3.210 3.847   1.596   35.839 -0.009 1.479  3.135 2.584   
-6.225  36.072 4  TT_DG127DT126:DA26DC27_NN T 127 ? N 27 ? T 126 ? N 26 ? 
1 A DT 5  1_555 B DA  13 1_555 A DG 6  1_555 B DC 12 1_555 0.041  -1.107 3.905 -1.168  17.185  31.792 -4.514 -0.251 2.941 28.874  
1.963   36.052 5  TT_DT126DG125:DC25DA26_NN T 126 ? N 26 ? T 125 ? N 25 ? 
1 A DG 6  1_555 B DC  12 1_555 A DC 7  1_555 B DG 11 1_555 -0.103 0.002  3.253 -2.093  -2.376  38.794 0.290  -0.098 3.248 -3.570  
3.144   38.918 6  TT_DG125DC124:DG24DC25_NN T 125 ? N 25 ? T 124 ? N 24 ? 
1 A DC 7  1_555 B DG  11 1_555 A DG 8  1_555 B DC 10 1_555 0.589  -0.004 3.172 -5.404  -3.659  35.852 0.479  -1.661 3.040 -5.883  
8.690   36.421 7  TT_DC124DG123:DC23DG24_NN T 124 ? N 24 ? T 123 ? N 23 ? 
1 A DG 8  1_555 B DC  10 1_555 A DC 9  1_555 B DG 9  1_555 1.306  0.336  3.699 2.242   1.056   39.055 0.357  -1.643 3.773 1.578   
-3.349  39.131 8  TT_DG123DC122:DG22DC23_NN T 123 ? N 23 ? T 122 ? N 22 ? 
1 A DT 11 1_555 C 3DA 10 1_555 A DT 12 1_555 C A  9  1_555 0.317  -1.487 3.009 -3.030  6.225   28.833 -4.049 -1.174 2.592 12.279  
5.976   29.635 9  TT_DT120DT119:A23DA1_RR   T 120 ? R 1  ? T 119 ? R 2  ? 
1 A DT 12 1_555 C A   9  1_555 A DC 13 1_555 C G  8  1_555 -0.291 -1.608 3.431 3.196   11.776  22.475 -6.751 1.504  2.257 27.740  
-7.530  25.536 10 TT_DT119DC118:G3A2_RR     T 119 ? R 2  ? T 118 ? R 3  ? 
1 A DC 13 1_555 C G   8  1_555 A DG 14 1_555 C C  7  1_555 -0.428 -1.311 4.796 9.337   28.288  25.625 -6.394 2.104  2.145 47.651  
-15.728 39.104 11 TT_DC118DG117:C4G3_RR     T 118 ? R 3  ? T 117 ? R 4  ? 
1 A DG 14 1_555 C C   7  1_555 A DC 15 1_555 C G  6  1_555 -0.385 0.315  2.155 -5.016  4.382   21.899 -0.268 -0.247 2.207 11.206  
12.828  22.878 12 TT_DG117DC116:G5C4_RR     T 117 ? R 4  ? T 116 ? R 5  ? 
1 A DC 15 1_555 C G   6  1_555 A DC 16 1_555 C G  5  1_555 -1.058 -1.336 3.442 -30.720 9.554   30.885 -2.803 -1.912 2.865 14.042  
45.148  44.312 13 TT_DC116DC115:G6G5_RR     T 116 ? R 5  ? T 115 ? R 6  ? 
1 A DC 16 1_555 C G   5  1_555 A DG 17 1_555 C C  4  1_555 -0.961 -0.687 2.681 5.687   -0.505  36.541 -1.029 2.128  2.518 -0.799  
-9.003  36.969 14 TT_DC115DG114:C7G6_RR     T 115 ? R 6  ? T 114 ? R 7  ? 
1 A DG 17 1_555 C C   4  1_555 A DT 18 1_555 C A  3  1_555 -0.335 -1.191 3.588 -0.518  5.167   37.911 -2.514 0.441  3.406 7.907   
0.792   38.252 15 TT_DG114DT113:A8C7_RR     T 114 ? R 7  ? T 113 ? R 8  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
5 'MAGNESIUM ION'    MG  
6 'PYROPHOSPHATE 2-' POP 
7 water              HOH 
#