data_1SA4
# 
_entry.id   1SA4 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1SA4         
RCSB  RCSB021557   
WWPDB D_1000021557 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1D8D 
;Co-Crystal Structure Of Rat Protein Farnesyltransferase Complexed With A K-Ras4B Peptide Substrate and Fpp Analog At 2.0A Resolution
;
unspecified 
PDB 1FT1 'Crystal Structure Of Protein Farnesyltransferase At 2.25 Angstroms Resolution' unspecified 
PDB 1JCQ 
;Crystal Structure Of Human Protein Farnesyltransferase Complexed With Farnesyl Diphosphate and The Peptidomimetic Inhibitor L-739,750
;
unspecified 
PDB 1JCR 
;Crystal Structure Of Rat Protein Farnesyltransferase Complexed With The Non-Substrate Tetrapeptide Inhibitor Cvfm and Farnesyl Diphosphate
;
unspecified 
PDB 1O5M 'Structure Of Fpt Bound To The Inhibitor Sch66336' unspecified 
PDB 1LD8 'Co-Crystal Structure Of Human Farnesyltransferase With Farnesyldiphosphate and Inhibitor Compound 49' unspecified 
PDB 1SA5 'Rat protein farnesyltransferase complexed with FPP and BMS-214662' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1SA4 
_pdbx_database_status.recvd_initial_deposition_date   2004-02-06 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Reid, T.S.'  1 
'Beese, L.S.' 2 
# 
_citation.id                        primary 
_citation.title                     
;Crystal Structures of the Anticancer Clinical Candidates R115777 (Tipifarnib) and BMS-214662 Complexed with Protein Farnesyltransferase Suggest a Mechanism of FTI Selectivity.
;
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            43 
_citation.page_first                6877 
_citation.page_last                 6884 
_citation.year                      2004 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15170324 
_citation.pdbx_database_id_DOI      10.1021/bi049723b 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Reid, T.S.'  1 ? 
primary 'Beese, L.S.' 2 ? 
# 
_cell.entry_id           1SA4 
_cell.length_a           178.442 
_cell.length_b           178.442 
_cell.length_c           64.458 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1SA4 
_symmetry.space_group_name_H-M             'P 61' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                169 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit'                                   
44864.840 1   '2.5.1.58, 2.5.1.59' ? ? ? 
2 polymer     man 'Protein farnesyltransferase beta subunit'                                                                     
48822.406 1   2.5.1.58             ? ? ? 
3 branched    man 'beta-D-fructofuranose-(2-1)-alpha-D-glucopyranose'                                                            
342.297   1   ?                    ? ? ? 
4 non-polymer syn 'ZINC ION'                                                                                                     
65.409    1   ?                    ? ? ? 
5 non-polymer syn 'FARNESYL DIPHOSPHATE'                                                                                         
382.326   1   ?                    ? ? ? 
6 non-polymer syn '6-[(S)-AMINO(4-CHLOROPHENYL)(1-METHYL-1H-IMIDAZOL-5-YL)METHYL]-4-(3-CHLOROPHENYL)-1-METHYLQUINOLIN-2(1H)-ONE' 
489.396   1   ?                    ? ? ? 
7 water       nat water                                                                                                          
18.015    672 ?                    ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 
;CAAX farnesyltransferase alpha subunit, Ras proteins prenyltransferase alpha, FTase-alpha, Type I protein geranyl-geranyltransferase alpha subunit, GGTase-I-alpha
;
2 'CAAX farnesyltransferase beta subunit, RAS proteins prenyltransferase beta, FTase-beta' 
3 sucrose 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MAATEGVGEAAQGGEPGQPAQPPPQPHPPPPQQQHKEEMAAEAGEAVASPMDDGFVSLDSPSYVLYRDRAEWADIDPVPQ
NDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIE
EQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQR
YFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYE
DMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSTENDSPTNVQQEEF
;
;MAATEGVGEAAQGGEPGQPAQPPPQPHPPPPQQQHKEEMAAEAGEAVASPMDDGFVSLDSPSYVLYRDRAEWADIDPVPQ
NDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIE
EQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQR
YFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYE
DMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSTENDSPTNVQQEEF
;
A ? 
2 'polypeptide(L)' no no 
;MASPSSFTYYCPPSSSPVWSEPLYSLRPEHARERLQDDSVETVTSIEQAKVEEKIQEVFSSYKFNHLVPRLVLQREKHFH
YLKRGLRQLTDAYECLDASRPWLCYWILHSLELLDEPIPQIVATDVCQFLELCQSPEGGFGGGPGQYPHLAPTYAAVNAL
CIIGTEEAYDIINREKLLQYLYSLKQPDGSFLMHVGGEVDVRSAYCAASVASLTNIITPDLFEGTAEWIARCQNWEGGIG
GVPGMEAHGGYTFCGLAALVILKRERSLNLKSLLQWVTSRQMRFEGGFQGRCNKLVDGCYSFWQAGLLPLLHRALHAQGD
PALSMSHWMFHQQALQEYILMCCQCPAGGLLDKPGKSRDFYHTCYCLSGLSIAQHFGSGAMLHDVVLGVPENALQPTHPV
YNIGPDKVIQATTYFLQKPVPGFEELKDETSAEPATD
;
;MASPSSFTYYCPPSSSPVWSEPLYSLRPEHARERLQDDSVETVTSIEQAKVEEKIQEVFSSYKFNHLVPRLVLQREKHFH
YLKRGLRQLTDAYECLDASRPWLCYWILHSLELLDEPIPQIVATDVCQFLELCQSPEGGFGGGPGQYPHLAPTYAAVNAL
CIIGTEEAYDIINREKLLQYLYSLKQPDGSFLMHVGGEVDVRSAYCAASVASLTNIITPDLFEGTAEWIARCQNWEGGIG
GVPGMEAHGGYTFCGLAALVILKRERSLNLKSLLQWVTSRQMRFEGGFQGRCNKLVDGCYSFWQAGLLPLLHRALHAQGD
PALSMSHWMFHQQALQEYILMCCQCPAGGLLDKPGKSRDFYHTCYCLSGLSIAQHFGSGAMLHDVVLGVPENALQPTHPV
YNIGPDKVIQATTYFLQKPVPGFEELKDETSAEPATD
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   ALA n 
1 4   THR n 
1 5   GLU n 
1 6   GLY n 
1 7   VAL n 
1 8   GLY n 
1 9   GLU n 
1 10  ALA n 
1 11  ALA n 
1 12  GLN n 
1 13  GLY n 
1 14  GLY n 
1 15  GLU n 
1 16  PRO n 
1 17  GLY n 
1 18  GLN n 
1 19  PRO n 
1 20  ALA n 
1 21  GLN n 
1 22  PRO n 
1 23  PRO n 
1 24  PRO n 
1 25  GLN n 
1 26  PRO n 
1 27  HIS n 
1 28  PRO n 
1 29  PRO n 
1 30  PRO n 
1 31  PRO n 
1 32  GLN n 
1 33  GLN n 
1 34  GLN n 
1 35  HIS n 
1 36  LYS n 
1 37  GLU n 
1 38  GLU n 
1 39  MET n 
1 40  ALA n 
1 41  ALA n 
1 42  GLU n 
1 43  ALA n 
1 44  GLY n 
1 45  GLU n 
1 46  ALA n 
1 47  VAL n 
1 48  ALA n 
1 49  SER n 
1 50  PRO n 
1 51  MET n 
1 52  ASP n 
1 53  ASP n 
1 54  GLY n 
1 55  PHE n 
1 56  VAL n 
1 57  SER n 
1 58  LEU n 
1 59  ASP n 
1 60  SER n 
1 61  PRO n 
1 62  SER n 
1 63  TYR n 
1 64  VAL n 
1 65  LEU n 
1 66  TYR n 
1 67  ARG n 
1 68  ASP n 
1 69  ARG n 
1 70  ALA n 
1 71  GLU n 
1 72  TRP n 
1 73  ALA n 
1 74  ASP n 
1 75  ILE n 
1 76  ASP n 
1 77  PRO n 
1 78  VAL n 
1 79  PRO n 
1 80  GLN n 
1 81  ASN n 
1 82  ASP n 
1 83  GLY n 
1 84  PRO n 
1 85  ASN n 
1 86  PRO n 
1 87  VAL n 
1 88  VAL n 
1 89  GLN n 
1 90  ILE n 
1 91  ILE n 
1 92  TYR n 
1 93  SER n 
1 94  ASP n 
1 95  LYS n 
1 96  PHE n 
1 97  ARG n 
1 98  ASP n 
1 99  VAL n 
1 100 TYR n 
1 101 ASP n 
1 102 TYR n 
1 103 PHE n 
1 104 ARG n 
1 105 ALA n 
1 106 VAL n 
1 107 LEU n 
1 108 GLN n 
1 109 ARG n 
1 110 ASP n 
1 111 GLU n 
1 112 ARG n 
1 113 SER n 
1 114 GLU n 
1 115 ARG n 
1 116 ALA n 
1 117 PHE n 
1 118 LYS n 
1 119 LEU n 
1 120 THR n 
1 121 ARG n 
1 122 ASP n 
1 123 ALA n 
1 124 ILE n 
1 125 GLU n 
1 126 LEU n 
1 127 ASN n 
1 128 ALA n 
1 129 ALA n 
1 130 ASN n 
1 131 TYR n 
1 132 THR n 
1 133 VAL n 
1 134 TRP n 
1 135 HIS n 
1 136 PHE n 
1 137 ARG n 
1 138 ARG n 
1 139 VAL n 
1 140 LEU n 
1 141 LEU n 
1 142 LYS n 
1 143 SER n 
1 144 LEU n 
1 145 GLN n 
1 146 LYS n 
1 147 ASP n 
1 148 LEU n 
1 149 HIS n 
1 150 GLU n 
1 151 GLU n 
1 152 MET n 
1 153 ASN n 
1 154 TYR n 
1 155 ILE n 
1 156 THR n 
1 157 ALA n 
1 158 ILE n 
1 159 ILE n 
1 160 GLU n 
1 161 GLU n 
1 162 GLN n 
1 163 PRO n 
1 164 LYS n 
1 165 ASN n 
1 166 TYR n 
1 167 GLN n 
1 168 VAL n 
1 169 TRP n 
1 170 HIS n 
1 171 HIS n 
1 172 ARG n 
1 173 ARG n 
1 174 VAL n 
1 175 LEU n 
1 176 VAL n 
1 177 GLU n 
1 178 TRP n 
1 179 LEU n 
1 180 ARG n 
1 181 ASP n 
1 182 PRO n 
1 183 SER n 
1 184 GLN n 
1 185 GLU n 
1 186 LEU n 
1 187 GLU n 
1 188 PHE n 
1 189 ILE n 
1 190 ALA n 
1 191 ASP n 
1 192 ILE n 
1 193 LEU n 
1 194 ASN n 
1 195 GLN n 
1 196 ASP n 
1 197 ALA n 
1 198 LYS n 
1 199 ASN n 
1 200 TYR n 
1 201 HIS n 
1 202 ALA n 
1 203 TRP n 
1 204 GLN n 
1 205 HIS n 
1 206 ARG n 
1 207 GLN n 
1 208 TRP n 
1 209 VAL n 
1 210 ILE n 
1 211 GLN n 
1 212 GLU n 
1 213 PHE n 
1 214 LYS n 
1 215 LEU n 
1 216 TRP n 
1 217 ASP n 
1 218 ASN n 
1 219 GLU n 
1 220 LEU n 
1 221 GLN n 
1 222 TYR n 
1 223 VAL n 
1 224 ASP n 
1 225 GLN n 
1 226 LEU n 
1 227 LEU n 
1 228 LYS n 
1 229 GLU n 
1 230 ASP n 
1 231 VAL n 
1 232 ARG n 
1 233 ASN n 
1 234 ASN n 
1 235 SER n 
1 236 VAL n 
1 237 TRP n 
1 238 ASN n 
1 239 GLN n 
1 240 ARG n 
1 241 TYR n 
1 242 PHE n 
1 243 VAL n 
1 244 ILE n 
1 245 SER n 
1 246 ASN n 
1 247 THR n 
1 248 THR n 
1 249 GLY n 
1 250 TYR n 
1 251 ASN n 
1 252 ASP n 
1 253 ARG n 
1 254 ALA n 
1 255 VAL n 
1 256 LEU n 
1 257 GLU n 
1 258 ARG n 
1 259 GLU n 
1 260 VAL n 
1 261 GLN n 
1 262 TYR n 
1 263 THR n 
1 264 LEU n 
1 265 GLU n 
1 266 MET n 
1 267 ILE n 
1 268 LYS n 
1 269 LEU n 
1 270 VAL n 
1 271 PRO n 
1 272 HIS n 
1 273 ASN n 
1 274 GLU n 
1 275 SER n 
1 276 ALA n 
1 277 TRP n 
1 278 ASN n 
1 279 TYR n 
1 280 LEU n 
1 281 LYS n 
1 282 GLY n 
1 283 ILE n 
1 284 LEU n 
1 285 GLN n 
1 286 ASP n 
1 287 ARG n 
1 288 GLY n 
1 289 LEU n 
1 290 SER n 
1 291 LYS n 
1 292 TYR n 
1 293 PRO n 
1 294 ASN n 
1 295 LEU n 
1 296 LEU n 
1 297 ASN n 
1 298 GLN n 
1 299 LEU n 
1 300 LEU n 
1 301 ASP n 
1 302 LEU n 
1 303 GLN n 
1 304 PRO n 
1 305 SER n 
1 306 HIS n 
1 307 SER n 
1 308 SER n 
1 309 PRO n 
1 310 TYR n 
1 311 LEU n 
1 312 ILE n 
1 313 ALA n 
1 314 PHE n 
1 315 LEU n 
1 316 VAL n 
1 317 ASP n 
1 318 ILE n 
1 319 TYR n 
1 320 GLU n 
1 321 ASP n 
1 322 MET n 
1 323 LEU n 
1 324 GLU n 
1 325 ASN n 
1 326 GLN n 
1 327 CYS n 
1 328 ASP n 
1 329 ASN n 
1 330 LYS n 
1 331 GLU n 
1 332 ASP n 
1 333 ILE n 
1 334 LEU n 
1 335 ASN n 
1 336 LYS n 
1 337 ALA n 
1 338 LEU n 
1 339 GLU n 
1 340 LEU n 
1 341 CYS n 
1 342 GLU n 
1 343 ILE n 
1 344 LEU n 
1 345 ALA n 
1 346 LYS n 
1 347 GLU n 
1 348 LYS n 
1 349 ASP n 
1 350 THR n 
1 351 ILE n 
1 352 ARG n 
1 353 LYS n 
1 354 GLU n 
1 355 TYR n 
1 356 TRP n 
1 357 ARG n 
1 358 TYR n 
1 359 ILE n 
1 360 GLY n 
1 361 ARG n 
1 362 SER n 
1 363 LEU n 
1 364 GLN n 
1 365 SER n 
1 366 LYS n 
1 367 HIS n 
1 368 SER n 
1 369 THR n 
1 370 GLU n 
1 371 ASN n 
1 372 ASP n 
1 373 SER n 
1 374 PRO n 
1 375 THR n 
1 376 ASN n 
1 377 VAL n 
1 378 GLN n 
1 379 GLN n 
1 380 GLU n 
1 381 GLU n 
1 382 PHE n 
2 1   MET n 
2 2   ALA n 
2 3   SER n 
2 4   PRO n 
2 5   SER n 
2 6   SER n 
2 7   PHE n 
2 8   THR n 
2 9   TYR n 
2 10  TYR n 
2 11  CYS n 
2 12  PRO n 
2 13  PRO n 
2 14  SER n 
2 15  SER n 
2 16  SER n 
2 17  PRO n 
2 18  VAL n 
2 19  TRP n 
2 20  SER n 
2 21  GLU n 
2 22  PRO n 
2 23  LEU n 
2 24  TYR n 
2 25  SER n 
2 26  LEU n 
2 27  ARG n 
2 28  PRO n 
2 29  GLU n 
2 30  HIS n 
2 31  ALA n 
2 32  ARG n 
2 33  GLU n 
2 34  ARG n 
2 35  LEU n 
2 36  GLN n 
2 37  ASP n 
2 38  ASP n 
2 39  SER n 
2 40  VAL n 
2 41  GLU n 
2 42  THR n 
2 43  VAL n 
2 44  THR n 
2 45  SER n 
2 46  ILE n 
2 47  GLU n 
2 48  GLN n 
2 49  ALA n 
2 50  LYS n 
2 51  VAL n 
2 52  GLU n 
2 53  GLU n 
2 54  LYS n 
2 55  ILE n 
2 56  GLN n 
2 57  GLU n 
2 58  VAL n 
2 59  PHE n 
2 60  SER n 
2 61  SER n 
2 62  TYR n 
2 63  LYS n 
2 64  PHE n 
2 65  ASN n 
2 66  HIS n 
2 67  LEU n 
2 68  VAL n 
2 69  PRO n 
2 70  ARG n 
2 71  LEU n 
2 72  VAL n 
2 73  LEU n 
2 74  GLN n 
2 75  ARG n 
2 76  GLU n 
2 77  LYS n 
2 78  HIS n 
2 79  PHE n 
2 80  HIS n 
2 81  TYR n 
2 82  LEU n 
2 83  LYS n 
2 84  ARG n 
2 85  GLY n 
2 86  LEU n 
2 87  ARG n 
2 88  GLN n 
2 89  LEU n 
2 90  THR n 
2 91  ASP n 
2 92  ALA n 
2 93  TYR n 
2 94  GLU n 
2 95  CYS n 
2 96  LEU n 
2 97  ASP n 
2 98  ALA n 
2 99  SER n 
2 100 ARG n 
2 101 PRO n 
2 102 TRP n 
2 103 LEU n 
2 104 CYS n 
2 105 TYR n 
2 106 TRP n 
2 107 ILE n 
2 108 LEU n 
2 109 HIS n 
2 110 SER n 
2 111 LEU n 
2 112 GLU n 
2 113 LEU n 
2 114 LEU n 
2 115 ASP n 
2 116 GLU n 
2 117 PRO n 
2 118 ILE n 
2 119 PRO n 
2 120 GLN n 
2 121 ILE n 
2 122 VAL n 
2 123 ALA n 
2 124 THR n 
2 125 ASP n 
2 126 VAL n 
2 127 CYS n 
2 128 GLN n 
2 129 PHE n 
2 130 LEU n 
2 131 GLU n 
2 132 LEU n 
2 133 CYS n 
2 134 GLN n 
2 135 SER n 
2 136 PRO n 
2 137 GLU n 
2 138 GLY n 
2 139 GLY n 
2 140 PHE n 
2 141 GLY n 
2 142 GLY n 
2 143 GLY n 
2 144 PRO n 
2 145 GLY n 
2 146 GLN n 
2 147 TYR n 
2 148 PRO n 
2 149 HIS n 
2 150 LEU n 
2 151 ALA n 
2 152 PRO n 
2 153 THR n 
2 154 TYR n 
2 155 ALA n 
2 156 ALA n 
2 157 VAL n 
2 158 ASN n 
2 159 ALA n 
2 160 LEU n 
2 161 CYS n 
2 162 ILE n 
2 163 ILE n 
2 164 GLY n 
2 165 THR n 
2 166 GLU n 
2 167 GLU n 
2 168 ALA n 
2 169 TYR n 
2 170 ASP n 
2 171 ILE n 
2 172 ILE n 
2 173 ASN n 
2 174 ARG n 
2 175 GLU n 
2 176 LYS n 
2 177 LEU n 
2 178 LEU n 
2 179 GLN n 
2 180 TYR n 
2 181 LEU n 
2 182 TYR n 
2 183 SER n 
2 184 LEU n 
2 185 LYS n 
2 186 GLN n 
2 187 PRO n 
2 188 ASP n 
2 189 GLY n 
2 190 SER n 
2 191 PHE n 
2 192 LEU n 
2 193 MET n 
2 194 HIS n 
2 195 VAL n 
2 196 GLY n 
2 197 GLY n 
2 198 GLU n 
2 199 VAL n 
2 200 ASP n 
2 201 VAL n 
2 202 ARG n 
2 203 SER n 
2 204 ALA n 
2 205 TYR n 
2 206 CYS n 
2 207 ALA n 
2 208 ALA n 
2 209 SER n 
2 210 VAL n 
2 211 ALA n 
2 212 SER n 
2 213 LEU n 
2 214 THR n 
2 215 ASN n 
2 216 ILE n 
2 217 ILE n 
2 218 THR n 
2 219 PRO n 
2 220 ASP n 
2 221 LEU n 
2 222 PHE n 
2 223 GLU n 
2 224 GLY n 
2 225 THR n 
2 226 ALA n 
2 227 GLU n 
2 228 TRP n 
2 229 ILE n 
2 230 ALA n 
2 231 ARG n 
2 232 CYS n 
2 233 GLN n 
2 234 ASN n 
2 235 TRP n 
2 236 GLU n 
2 237 GLY n 
2 238 GLY n 
2 239 ILE n 
2 240 GLY n 
2 241 GLY n 
2 242 VAL n 
2 243 PRO n 
2 244 GLY n 
2 245 MET n 
2 246 GLU n 
2 247 ALA n 
2 248 HIS n 
2 249 GLY n 
2 250 GLY n 
2 251 TYR n 
2 252 THR n 
2 253 PHE n 
2 254 CYS n 
2 255 GLY n 
2 256 LEU n 
2 257 ALA n 
2 258 ALA n 
2 259 LEU n 
2 260 VAL n 
2 261 ILE n 
2 262 LEU n 
2 263 LYS n 
2 264 ARG n 
2 265 GLU n 
2 266 ARG n 
2 267 SER n 
2 268 LEU n 
2 269 ASN n 
2 270 LEU n 
2 271 LYS n 
2 272 SER n 
2 273 LEU n 
2 274 LEU n 
2 275 GLN n 
2 276 TRP n 
2 277 VAL n 
2 278 THR n 
2 279 SER n 
2 280 ARG n 
2 281 GLN n 
2 282 MET n 
2 283 ARG n 
2 284 PHE n 
2 285 GLU n 
2 286 GLY n 
2 287 GLY n 
2 288 PHE n 
2 289 GLN n 
2 290 GLY n 
2 291 ARG n 
2 292 CYS n 
2 293 ASN n 
2 294 LYS n 
2 295 LEU n 
2 296 VAL n 
2 297 ASP n 
2 298 GLY n 
2 299 CYS n 
2 300 TYR n 
2 301 SER n 
2 302 PHE n 
2 303 TRP n 
2 304 GLN n 
2 305 ALA n 
2 306 GLY n 
2 307 LEU n 
2 308 LEU n 
2 309 PRO n 
2 310 LEU n 
2 311 LEU n 
2 312 HIS n 
2 313 ARG n 
2 314 ALA n 
2 315 LEU n 
2 316 HIS n 
2 317 ALA n 
2 318 GLN n 
2 319 GLY n 
2 320 ASP n 
2 321 PRO n 
2 322 ALA n 
2 323 LEU n 
2 324 SER n 
2 325 MET n 
2 326 SER n 
2 327 HIS n 
2 328 TRP n 
2 329 MET n 
2 330 PHE n 
2 331 HIS n 
2 332 GLN n 
2 333 GLN n 
2 334 ALA n 
2 335 LEU n 
2 336 GLN n 
2 337 GLU n 
2 338 TYR n 
2 339 ILE n 
2 340 LEU n 
2 341 MET n 
2 342 CYS n 
2 343 CYS n 
2 344 GLN n 
2 345 CYS n 
2 346 PRO n 
2 347 ALA n 
2 348 GLY n 
2 349 GLY n 
2 350 LEU n 
2 351 LEU n 
2 352 ASP n 
2 353 LYS n 
2 354 PRO n 
2 355 GLY n 
2 356 LYS n 
2 357 SER n 
2 358 ARG n 
2 359 ASP n 
2 360 PHE n 
2 361 TYR n 
2 362 HIS n 
2 363 THR n 
2 364 CYS n 
2 365 TYR n 
2 366 CYS n 
2 367 LEU n 
2 368 SER n 
2 369 GLY n 
2 370 LEU n 
2 371 SER n 
2 372 ILE n 
2 373 ALA n 
2 374 GLN n 
2 375 HIS n 
2 376 PHE n 
2 377 GLY n 
2 378 SER n 
2 379 GLY n 
2 380 ALA n 
2 381 MET n 
2 382 LEU n 
2 383 HIS n 
2 384 ASP n 
2 385 VAL n 
2 386 VAL n 
2 387 LEU n 
2 388 GLY n 
2 389 VAL n 
2 390 PRO n 
2 391 GLU n 
2 392 ASN n 
2 393 ALA n 
2 394 LEU n 
2 395 GLN n 
2 396 PRO n 
2 397 THR n 
2 398 HIS n 
2 399 PRO n 
2 400 VAL n 
2 401 TYR n 
2 402 ASN n 
2 403 ILE n 
2 404 GLY n 
2 405 PRO n 
2 406 ASP n 
2 407 LYS n 
2 408 VAL n 
2 409 ILE n 
2 410 GLN n 
2 411 ALA n 
2 412 THR n 
2 413 THR n 
2 414 TYR n 
2 415 PHE n 
2 416 LEU n 
2 417 GLN n 
2 418 LYS n 
2 419 PRO n 
2 420 VAL n 
2 421 PRO n 
2 422 GLY n 
2 423 PHE n 
2 424 GLU n 
2 425 GLU n 
2 426 LEU n 
2 427 LYS n 
2 428 ASP n 
2 429 GLU n 
2 430 THR n 
2 431 SER n 
2 432 ALA n 
2 433 GLU n 
2 434 PRO n 
2 435 ALA n 
2 436 THR n 
2 437 ASP n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo FNTA ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? human Homo FNTB ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP PFTA_HUMAN P49354 1 
;MAATEGVGEAAQGGEPGQPAQPPPQPHPPPPQQQHKEEMAAEAGEAVASPMDDGFVSLDSPSYVLYRDRAEWADIDPVPQ
NDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIE
EQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQR
YFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYE
DMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSTENDSPTNVQQ
;
1 ? 
2 UNP PFTB_HUMAN P49356 2 
;MASPSSFTYYCPPSSSPVWSEPLYSLRPEHARERLQDDSVETVTSIEQAKVEEKIQEVFSSYKFNHLVPRLVLQREKHFH
YLKRGLRQLTDAYECLDASRPWLCYWILHSLELLDEPIPQIVATDVCQFLELCQSPEGGFGGGPGQYPHLAPTYAAVNAL
CIIGTEEAYDIINREKLLQYLYSLKQPDGSFLMHVGGEVDVRSAYCAASVASLTNIITPDLFEGTAEWIARCQNWEGGIG
GVPGMEAHGGYTFCGLAALVILKRERSLNLKSLLQWVTSRQMRFEGGFQGRCNKLVDGCYSFWQAGLLPLLHRALHAQGD
PALSMSHWMFHQQALQEYILMCCQCPAGGLLDKPGKSRDFYHTCYCLSGLSIAQHFGSGAMLHDVVLGVPENALQPTHPV
YNIGPDKVIQATTYFLQKPVPGFEELKDETSAEPATD
;
1 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1SA4 A 1 ? 379 ? P49354 1 ? 379 ? 1 379 
2 2 1SA4 B 1 ? 437 ? P49356 1 ? 437 ? 1 437 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1SA4 GLU A 380 ? UNP P49354 ? ? insertion 380 1 
1 1SA4 GLU A 381 ? UNP P49354 ? ? insertion 381 2 
1 1SA4 PHE A 382 ? UNP P49354 ? ? insertion 382 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE ?                     'C3 H7 N O2'       89.093  
ARG 'L-peptide linking'           y ARGININE ?                     'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking'           y ASPARAGINE ?                     'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID' ?                     'C4 H7 N O4'       133.103 
CYS 'L-peptide linking'           y CYSTEINE ?                     'C3 H7 N O2 S'     121.158 
FPP non-polymer                   . 'FARNESYL DIPHOSPHATE' ?                     'C15 H28 O7 P2'    382.326 
FRU 'D-saccharide, beta linking'  . beta-D-fructofuranose ?                     'C6 H12 O6'        180.156 
GLC 'D-saccharide, alpha linking' . alpha-D-glucopyranose ?                     'C6 H12 O6'        180.156 
GLN 'L-peptide linking'           y GLUTAMINE ?                     'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID' ?                     'C5 H9 N O4'       147.129 
GLY 'peptide linking'             y GLYCINE ?                     'C2 H5 N O2'       75.067  
HIS 'L-peptide linking'           y HISTIDINE ?                     'C6 H10 N3 O2 1'   156.162 
HOH non-polymer                   . WATER ?                     'H2 O'             18.015  
ILE 'L-peptide linking'           y ISOLEUCINE ?                     'C6 H13 N O2'      131.173 
JAN non-polymer                   . 
'6-[(S)-AMINO(4-CHLOROPHENYL)(1-METHYL-1H-IMIDAZOL-5-YL)METHYL]-4-(3-CHLOROPHENYL)-1-METHYLQUINOLIN-2(1H)-ONE' 
'R115777; TIPIFARNIB' 'C27 H22 Cl2 N4 O' 489.396 
LEU 'L-peptide linking'           y LEUCINE ?                     'C6 H13 N O2'      131.173 
LYS 'L-peptide linking'           y LYSINE ?                     'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking'           y METHIONINE ?                     'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking'           y PHENYLALANINE ?                     'C9 H11 N O2'      165.189 
PRO 'L-peptide linking'           y PROLINE ?                     'C5 H9 N O2'       115.130 
SER 'L-peptide linking'           y SERINE ?                     'C3 H7 N O3'       105.093 
THR 'L-peptide linking'           y THREONINE ?                     'C4 H9 N O3'       119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN ?                     'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking'           y TYROSINE ?                     'C9 H11 N O3'      181.189 
VAL 'L-peptide linking'           y VALINE ?                     'C5 H11 N O2'      117.146 
ZN  non-polymer                   . 'ZINC ION' ?                     'Zn 2'             65.409  
# 
_exptl.entry_id          1SA4 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.16 
_exptl_crystal.density_percent_sol   61.08 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            290 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.70 
_exptl_crystal_grow.pdbx_details    
'14% PEG 8000, 400 mM ammonium acetate pH 5.7, 20 mM DTT, VAPOR DIFFUSION, HANGING DROP, temperature 290K, pH 5.70' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2002-10-24 
_diffrn_detector.details                'BENT CONICAL SI-MIRROR (RH COATING)' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'BENT GE(III) MONOCHROMATOR' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.90000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 14-BM-C' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   14-BM-C 
_diffrn_source.pdbx_wavelength             0.90000 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1SA4 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             40.000 
_reflns.d_resolution_high            2.100 
_reflns.number_obs                   66907 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         96.6 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.087 
_reflns.pdbx_netI_over_sigmaI        10.6000 
_reflns.B_iso_Wilson_estimate        10.6 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.10 
_reflns_shell.d_res_low              2.18 
_reflns_shell.percent_possible_all   92.0 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.27 
_reflns_shell.meanI_over_sigI_obs    3.000 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1SA4 
_refine.ls_number_reflns_obs                     66309 
_refine.ls_number_reflns_all                     68612 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               4229389.55 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.88 
_refine.ls_d_res_high                            2.10 
_refine.ls_percent_reflns_obs                    96.7 
_refine.ls_R_factor_obs                          0.166 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.166 
_refine.ls_R_factor_R_free                       0.195 
_refine.ls_R_factor_R_free_error                 0.003 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.2 
_refine.ls_number_reflns_R_free                  3445 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               23.7 
_refine.aniso_B[1][1]                            1.19 
_refine.aniso_B[2][2]                            1.19 
_refine.aniso_B[3][3]                            -2.38 
_refine.aniso_B[1][2]                            1.42 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.403744 
_refine.solvent_model_param_bsol                 60.4844 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1JCQ 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'ENGH & HUBER' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1SA4 
_refine_analyze.Luzzati_coordinate_error_obs    0.19 
_refine_analyze.Luzzati_sigma_a_obs             0.22 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.23 
_refine_analyze.Luzzati_sigma_a_free            0.22 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5909 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         82 
_refine_hist.number_atoms_solvent             672 
_refine_hist.number_atoms_total               6663 
_refine_hist.d_res_high                       2.10 
_refine_hist.d_res_low                        29.88 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.006 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.2   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      19.8  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.80  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.23  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            1.89  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             2.14  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            3.20  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.10 
_refine_ls_shell.d_res_low                        2.23 
_refine_ls_shell.number_reflns_R_work             10043 
_refine_ls_shell.R_factor_R_work                  0.23 
_refine_ls_shell.percent_reflns_obs               92.9 
_refine_ls_shell.R_factor_R_free                  0.24 
_refine_ls_shell.R_factor_R_free_error            0.011 
_refine_ls_shell.percent_reflns_R_free            4.8 
_refine_ls_shell.number_reflns_R_free             511 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP   'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM   WATER_REP.TOP 'X-RAY DIFFRACTION' 
3 ION.PARAM         JANSSEN.TOP   'X-RAY DIFFRACTION' 
4 FPP.PAR           ION.TOP       'X-RAY DIFFRACTION' 
5 JANSSEN.PAR       SUCROSE.TOP   'X-RAY DIFFRACTION' 
6 SUCROSE.PAR       ?             'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1SA4 
_struct.title                     'human protein farnesyltransferase complexed with FPP and R115777' 
_struct.pdbx_descriptor           
;Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit (E.C.2.5.1.58, 2.5.1.59), Protein farnesyltransferase beta subunit (E.C.2.5.1.58)
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1SA4 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
;FTASE, FARNESYLTRANSFERASE, FARNESYL TRANSFERASE, CAAX, RAS, CANCER, TUMOR REGRESSION, R115777, TIPIFARNIB, ZARNESTRA, FTI, CLINICAL CANDIDATE, INHIBITOR, PROTEIN PRENYLATION, LIPID MODIFICATION, TRANSFERASE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 7 ? 
H N N 7 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LEU A 65  ? ALA A 73  ? LEU A 65  ALA A 73  5 ? 9  
HELX_P HELX_P2  2  SER A 93  ? ARG A 109 ? SER A 93  ARG A 109 1 ? 17 
HELX_P HELX_P3  3  SER A 113 ? ASN A 127 ? SER A 113 ASN A 127 1 ? 15 
HELX_P HELX_P4  4  ASN A 130 ? LEU A 144 ? ASN A 130 LEU A 144 1 ? 15 
HELX_P HELX_P5  5  ASP A 147 ? GLN A 162 ? ASP A 147 GLN A 162 1 ? 16 
HELX_P HELX_P6  6  ASN A 165 ? ARG A 180 ? ASN A 165 ARG A 180 1 ? 16 
HELX_P HELX_P7  7  GLN A 184 ? ASP A 196 ? GLN A 184 ASP A 196 1 ? 13 
HELX_P HELX_P8  8  ASN A 199 ? LYS A 214 ? ASN A 199 LYS A 214 1 ? 16 
HELX_P HELX_P9  9  ASN A 218 ? ASP A 230 ? ASN A 218 ASP A 230 1 ? 13 
HELX_P HELX_P10 10 ASN A 233 ? THR A 247 ? ASN A 233 THR A 247 1 ? 15 
HELX_P HELX_P11 11 ASP A 252 ? VAL A 270 ? ASP A 252 VAL A 270 1 ? 19 
HELX_P HELX_P12 12 ASN A 273 ? GLN A 285 ? ASN A 273 GLN A 285 1 ? 13 
HELX_P HELX_P13 13 GLY A 288 ? LYS A 291 ? GLY A 288 LYS A 291 5 ? 4  
HELX_P HELX_P14 14 TYR A 292 ? GLN A 303 ? TYR A 292 GLN A 303 1 ? 12 
HELX_P HELX_P15 15 SER A 308 ? ASN A 325 ? SER A 308 ASN A 325 1 ? 18 
HELX_P HELX_P16 16 ASN A 329 ? GLU A 347 ? ASN A 329 GLU A 347 1 ? 19 
HELX_P HELX_P17 17 ASP A 349 ? ILE A 351 ? ASP A 349 ILE A 351 5 ? 3  
HELX_P HELX_P18 18 ARG A 352 ? SER A 368 ? ARG A 352 SER A 368 1 ? 17 
HELX_P HELX_P19 19 LEU B 23  ? ARG B 34  ? LEU B 23  ARG B 34  5 ? 12 
HELX_P HELX_P20 20 THR B 42  ? SER B 61  ? THR B 42  SER B 61  1 ? 20 
HELX_P HELX_P21 21 GLN B 74  ? LEU B 86  ? GLN B 74  LEU B 86  1 ? 13 
HELX_P HELX_P22 22 THR B 90  ? ASP B 97  ? THR B 90  ASP B 97  5 ? 8  
HELX_P HELX_P23 23 SER B 99  ? LEU B 114 ? SER B 99  LEU B 114 1 ? 16 
HELX_P HELX_P24 24 PRO B 119 ? GLN B 134 ? PRO B 119 GLN B 134 1 ? 16 
HELX_P HELX_P25 25 HIS B 149 ? GLY B 164 ? HIS B 149 GLY B 164 1 ? 16 
HELX_P HELX_P26 26 THR B 165 ? ILE B 172 ? THR B 165 ILE B 172 1 ? 8  
HELX_P HELX_P27 27 ASN B 173 ? LYS B 185 ? ASN B 173 LYS B 185 1 ? 13 
HELX_P HELX_P28 28 ASP B 200 ? THR B 214 ? ASP B 200 THR B 214 1 ? 15 
HELX_P HELX_P29 29 GLY B 224 ? GLN B 233 ? GLY B 224 GLN B 233 1 ? 10 
HELX_P HELX_P30 30 HIS B 248 ? LYS B 263 ? HIS B 248 LYS B 263 1 ? 16 
HELX_P HELX_P31 31 ARG B 264 ? LEU B 268 ? ARG B 264 LEU B 268 5 ? 5  
HELX_P HELX_P32 32 ASN B 269 ? ARG B 280 ? ASN B 269 ARG B 280 1 ? 12 
HELX_P HELX_P33 33 CYS B 299 ? GLN B 304 ? CYS B 299 GLN B 304 1 ? 6  
HELX_P HELX_P34 34 GLY B 306 ? GLN B 318 ? GLY B 306 GLN B 318 1 ? 13 
HELX_P HELX_P35 35 HIS B 331 ? CYS B 343 ? HIS B 331 CYS B 343 1 ? 13 
HELX_P HELX_P36 36 ASP B 359 ? GLN B 374 ? ASP B 359 GLN B 374 1 ? 16 
HELX_P HELX_P37 37 VAL B 389 ? ALA B 393 ? VAL B 389 ALA B 393 5 ? 5  
HELX_P HELX_P38 38 GLY B 404 ? LEU B 416 ? GLY B 404 LEU B 416 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1 covale both ? C GLC .   C1  ? ? ? 1_555 C FRU . O2 ? ? C GLC 1   C FRU 2   1_555 ? ? ? ? ? ? ? 1.462 sing ? 
metalc1 metalc ?    ? B ASP 297 OD1 ? ? ? 1_555 D ZN  . ZN ? ? B ASP 297 B ZN  439 1_555 ? ? ? ? ? ? ? 2.498 ?    ? 
metalc2 metalc ?    ? B ASP 297 OD2 ? ? ? 1_555 D ZN  . ZN ? ? B ASP 297 B ZN  439 1_555 ? ? ? ? ? ? ? 2.040 ?    ? 
metalc3 metalc ?    ? B CYS 299 SG  ? ? ? 1_555 D ZN  . ZN ? ? B CYS 299 B ZN  439 1_555 ? ? ? ? ? ? ? 2.321 ?    ? 
metalc4 metalc ?    ? B HIS 362 NE2 ? ? ? 1_555 D ZN  . ZN ? ? B HIS 362 B ZN  439 1_555 ? ? ? ? ? ? ? 2.095 ?    ? 
metalc5 metalc ?    ? D ZN  .   ZN  ? ? ? 1_555 F JAN . N2 ? ? B ZN  439 B JAN 441 1_555 ? ? ? ? ? ? ? 2.098 ?    ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLN A 89  ? ILE A 90  ? GLN A 89  ILE A 90  
A 2 GLN B 88  ? LEU B 89  ? GLN B 88  LEU B 89  
B 1 HIS B 375 ? SER B 378 ? HIS B 375 SER B 378 
B 2 MET B 381 ? ASP B 384 ? MET B 381 ASP B 384 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLN A 89  ? N GLN A 89  O LEU B 89  ? O LEU B 89  
B 1 2 N SER B 378 ? N SER B 378 O MET B 381 ? O MET B 381 
# 
_database_PDB_matrix.entry_id          1SA4 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1SA4 
_atom_sites.fract_transf_matrix[1][1]   0.005604 
_atom_sites.fract_transf_matrix[1][2]   0.003236 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006471 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.015514 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . PHE A 1 55  ? 27.300  159.251 -17.281 1.00 59.14 ? 55  PHE A N   1 
ATOM   2    C  CA  . PHE A 1 55  ? 27.512  160.711 -17.064 1.00 58.68 ? 55  PHE A CA  1 
ATOM   3    C  C   . PHE A 1 55  ? 27.288  161.116 -15.609 1.00 56.83 ? 55  PHE A C   1 
ATOM   4    O  O   . PHE A 1 55  ? 28.229  161.493 -14.907 1.00 57.25 ? 55  PHE A O   1 
ATOM   5    C  CB  . PHE A 1 55  ? 26.581  161.521 -17.973 1.00 60.79 ? 55  PHE A CB  1 
ATOM   6    C  CG  . PHE A 1 55  ? 27.072  161.655 -19.391 1.00 63.22 ? 55  PHE A CG  1 
ATOM   7    C  CD1 . PHE A 1 55  ? 26.362  162.420 -20.313 1.00 64.39 ? 55  PHE A CD1 1 
ATOM   8    C  CD2 . PHE A 1 55  ? 28.254  161.037 -19.802 1.00 64.64 ? 55  PHE A CD2 1 
ATOM   9    C  CE1 . PHE A 1 55  ? 26.821  162.572 -21.623 1.00 65.85 ? 55  PHE A CE1 1 
ATOM   10   C  CE2 . PHE A 1 55  ? 28.722  161.182 -21.109 1.00 65.90 ? 55  PHE A CE2 1 
ATOM   11   C  CZ  . PHE A 1 55  ? 28.004  161.953 -22.021 1.00 66.23 ? 55  PHE A CZ  1 
ATOM   12   N  N   . VAL A 1 56  ? 26.038  161.037 -15.163 1.00 53.24 ? 56  VAL A N   1 
ATOM   13   C  CA  . VAL A 1 56  ? 25.698  161.398 -13.794 1.00 48.76 ? 56  VAL A CA  1 
ATOM   14   C  C   . VAL A 1 56  ? 24.999  160.242 -13.068 1.00 46.28 ? 56  VAL A C   1 
ATOM   15   O  O   . VAL A 1 56  ? 24.096  159.603 -13.610 1.00 44.67 ? 56  VAL A O   1 
ATOM   16   C  CB  . VAL A 1 56  ? 24.810  162.670 -13.770 1.00 48.25 ? 56  VAL A CB  1 
ATOM   17   C  CG1 . VAL A 1 56  ? 23.527  162.432 -14.546 1.00 48.30 ? 56  VAL A CG1 1 
ATOM   18   C  CG2 . VAL A 1 56  ? 24.512  163.073 -12.339 1.00 47.33 ? 56  VAL A CG2 1 
ATOM   19   N  N   . SER A 1 57  ? 25.438  159.987 -11.839 1.00 44.06 ? 57  SER A N   1 
ATOM   20   C  CA  . SER A 1 57  ? 24.908  158.914 -10.996 1.00 42.73 ? 57  SER A CA  1 
ATOM   21   C  C   . SER A 1 57  ? 23.651  159.292 -10.208 1.00 40.39 ? 57  SER A C   1 
ATOM   22   O  O   . SER A 1 57  ? 23.369  160.471 -9.990  1.00 39.44 ? 57  SER A O   1 
ATOM   23   C  CB  . SER A 1 57  ? 26.001  158.452 -10.026 1.00 43.71 ? 57  SER A CB  1 
ATOM   24   O  OG  . SER A 1 57  ? 25.453  157.830 -8.877  1.00 48.52 ? 57  SER A OG  1 
ATOM   25   N  N   . LEU A 1 58  ? 22.910  158.275 -9.774  1.00 38.21 ? 58  LEU A N   1 
ATOM   26   C  CA  . LEU A 1 58  ? 21.680  158.466 -9.008  1.00 37.59 ? 58  LEU A CA  1 
ATOM   27   C  C   . LEU A 1 58  ? 21.874  159.265 -7.727  1.00 36.43 ? 58  LEU A C   1 
ATOM   28   O  O   . LEU A 1 58  ? 20.929  159.874 -7.228  1.00 36.07 ? 58  LEU A O   1 
ATOM   29   C  CB  . LEU A 1 58  ? 21.062  157.111 -8.649  1.00 38.70 ? 58  LEU A CB  1 
ATOM   30   C  CG  . LEU A 1 58  ? 20.169  156.437 -9.691  1.00 40.76 ? 58  LEU A CG  1 
ATOM   31   C  CD1 . LEU A 1 58  ? 20.021  154.963 -9.359  1.00 42.74 ? 58  LEU A CD1 1 
ATOM   32   C  CD2 . LEU A 1 58  ? 18.815  157.120 -9.722  1.00 40.14 ? 58  LEU A CD2 1 
ATOM   33   N  N   . ASP A 1 59  ? 23.087  159.252 -7.185  1.00 35.85 ? 59  ASP A N   1 
ATOM   34   C  CA  . ASP A 1 59  ? 23.363  159.984 -5.954  1.00 36.63 ? 59  ASP A CA  1 
ATOM   35   C  C   . ASP A 1 59  ? 24.155  161.262 -6.190  1.00 34.19 ? 59  ASP A C   1 
ATOM   36   O  O   . ASP A 1 59  ? 24.449  161.993 -5.247  1.00 35.40 ? 59  ASP A O   1 
ATOM   37   C  CB  . ASP A 1 59  ? 24.131  159.104 -4.967  1.00 40.39 ? 59  ASP A CB  1 
ATOM   38   C  CG  . ASP A 1 59  ? 23.464  157.767 -4.743  1.00 45.59 ? 59  ASP A CG  1 
ATOM   39   O  OD1 . ASP A 1 59  ? 23.551  156.908 -5.648  1.00 49.74 ? 59  ASP A OD1 1 
ATOM   40   O  OD2 . ASP A 1 59  ? 22.849  157.578 -3.670  1.00 46.25 ? 59  ASP A OD2 1 
ATOM   41   N  N   . SER A 1 60  ? 24.508  161.530 -7.440  1.00 31.65 ? 60  SER A N   1 
ATOM   42   C  CA  . SER A 1 60  ? 25.271  162.731 -7.761  1.00 30.59 ? 60  SER A CA  1 
ATOM   43   C  C   . SER A 1 60  ? 24.471  163.987 -7.429  1.00 27.66 ? 60  SER A C   1 
ATOM   44   O  O   . SER A 1 60  ? 23.257  164.027 -7.615  1.00 26.02 ? 60  SER A O   1 
ATOM   45   C  CB  . SER A 1 60  ? 25.639  162.742 -9.241  1.00 30.95 ? 60  SER A CB  1 
ATOM   46   O  OG  . SER A 1 60  ? 26.426  161.614 -9.570  1.00 37.44 ? 60  SER A OG  1 
ATOM   47   N  N   . PRO A 1 61  ? 25.145  165.037 -6.938  1.00 27.86 ? 61  PRO A N   1 
ATOM   48   C  CA  . PRO A 1 61  ? 24.412  166.262 -6.608  1.00 27.09 ? 61  PRO A CA  1 
ATOM   49   C  C   . PRO A 1 61  ? 23.691  166.883 -7.806  1.00 26.00 ? 61  PRO A C   1 
ATOM   50   O  O   . PRO A 1 61  ? 22.650  167.516 -7.643  1.00 26.08 ? 61  PRO A O   1 
ATOM   51   C  CB  . PRO A 1 61  ? 25.499  167.171 -6.026  1.00 28.06 ? 61  PRO A CB  1 
ATOM   52   C  CG  . PRO A 1 61  ? 26.742  166.710 -6.721  1.00 26.72 ? 61  PRO A CG  1 
ATOM   53   C  CD  . PRO A 1 61  ? 26.589  165.204 -6.694  1.00 27.60 ? 61  PRO A CD  1 
ATOM   54   N  N   . SER A 1 62  ? 24.225  166.684 -9.008  1.00 25.18 ? 62  SER A N   1 
ATOM   55   C  CA  . SER A 1 62  ? 23.608  167.256 -10.201 1.00 24.24 ? 62  SER A CA  1 
ATOM   56   C  C   . SER A 1 62  ? 22.682  166.305 -10.956 1.00 24.50 ? 62  SER A C   1 
ATOM   57   O  O   . SER A 1 62  ? 22.329  166.570 -12.106 1.00 24.32 ? 62  SER A O   1 
ATOM   58   C  CB  . SER A 1 62  ? 24.682  167.776 -11.163 1.00 23.83 ? 62  SER A CB  1 
ATOM   59   O  OG  . SER A 1 62  ? 25.338  166.717 -11.838 1.00 25.93 ? 62  SER A OG  1 
ATOM   60   N  N   . TYR A 1 63  ? 22.290  165.202 -10.324 1.00 23.88 ? 63  TYR A N   1 
ATOM   61   C  CA  . TYR A 1 63  ? 21.389  164.247 -10.968 1.00 24.43 ? 63  TYR A CA  1 
ATOM   62   C  C   . TYR A 1 63  ? 20.038  164.907 -11.221 1.00 23.41 ? 63  TYR A C   1 
ATOM   63   O  O   . TYR A 1 63  ? 19.510  165.606 -10.356 1.00 24.24 ? 63  TYR A O   1 
ATOM   64   C  CB  . TYR A 1 63  ? 21.173  163.020 -10.077 1.00 25.21 ? 63  TYR A CB  1 
ATOM   65   C  CG  . TYR A 1 63  ? 20.209  161.997 -10.655 1.00 25.21 ? 63  TYR A CG  1 
ATOM   66   C  CD1 . TYR A 1 63  ? 20.623  161.086 -11.626 1.00 25.07 ? 63  TYR A CD1 1 
ATOM   67   C  CD2 . TYR A 1 63  ? 18.883  161.939 -10.224 1.00 24.92 ? 63  TYR A CD2 1 
ATOM   68   C  CE1 . TYR A 1 63  ? 19.741  160.138 -12.150 1.00 24.73 ? 63  TYR A CE1 1 
ATOM   69   C  CE2 . TYR A 1 63  ? 17.993  160.999 -10.740 1.00 24.32 ? 63  TYR A CE2 1 
ATOM   70   C  CZ  . TYR A 1 63  ? 18.426  160.100 -11.701 1.00 26.41 ? 63  TYR A CZ  1 
ATOM   71   O  OH  . TYR A 1 63  ? 17.549  159.160 -12.206 1.00 24.43 ? 63  TYR A OH  1 
ATOM   72   N  N   . VAL A 1 64  ? 19.480  164.676 -12.404 1.00 22.14 ? 64  VAL A N   1 
ATOM   73   C  CA  . VAL A 1 64  ? 18.180  165.226 -12.762 1.00 22.77 ? 64  VAL A CA  1 
ATOM   74   C  C   . VAL A 1 64  ? 17.220  164.086 -13.110 1.00 24.82 ? 64  VAL A C   1 
ATOM   75   O  O   . VAL A 1 64  ? 17.610  163.132 -13.783 1.00 24.19 ? 64  VAL A O   1 
ATOM   76   C  CB  . VAL A 1 64  ? 18.290  166.169 -13.989 1.00 23.28 ? 64  VAL A CB  1 
ATOM   77   C  CG1 . VAL A 1 64  ? 16.898  166.575 -14.464 1.00 20.65 ? 64  VAL A CG1 1 
ATOM   78   C  CG2 . VAL A 1 64  ? 19.110  167.403 -13.629 1.00 22.26 ? 64  VAL A CG2 1 
ATOM   79   N  N   . LEU A 1 65  ? 15.973  164.184 -12.652 1.00 24.96 ? 65  LEU A N   1 
ATOM   80   C  CA  . LEU A 1 65  ? 14.977  163.159 -12.953 1.00 26.15 ? 65  LEU A CA  1 
ATOM   81   C  C   . LEU A 1 65  ? 14.753  163.127 -14.461 1.00 26.10 ? 65  LEU A C   1 
ATOM   82   O  O   . LEU A 1 65  ? 14.802  164.165 -15.127 1.00 25.45 ? 65  LEU A O   1 
ATOM   83   C  CB  . LEU A 1 65  ? 13.640  163.466 -12.268 1.00 26.67 ? 65  LEU A CB  1 
ATOM   84   C  CG  . LEU A 1 65  ? 13.587  163.564 -10.744 1.00 29.81 ? 65  LEU A CG  1 
ATOM   85   C  CD1 . LEU A 1 65  ? 12.149  163.815 -10.319 1.00 31.14 ? 65  LEU A CD1 1 
ATOM   86   C  CD2 . LEU A 1 65  ? 14.109  162.287 -10.112 1.00 29.55 ? 65  LEU A CD2 1 
ATOM   87   N  N   . TYR A 1 66  ? 14.497  161.939 -14.996 1.00 23.63 ? 66  TYR A N   1 
ATOM   88   C  CA  . TYR A 1 66  ? 14.272  161.798 -16.424 1.00 23.09 ? 66  TYR A CA  1 
ATOM   89   C  C   . TYR A 1 66  ? 13.095  162.619 -16.935 1.00 23.66 ? 66  TYR A C   1 
ATOM   90   O  O   . TYR A 1 66  ? 13.125  163.112 -18.064 1.00 22.75 ? 66  TYR A O   1 
ATOM   91   C  CB  . TYR A 1 66  ? 14.095  160.318 -16.786 1.00 21.25 ? 66  TYR A CB  1 
ATOM   92   C  CG  . TYR A 1 66  ? 15.415  159.581 -16.809 1.00 21.44 ? 66  TYR A CG  1 
ATOM   93   C  CD1 . TYR A 1 66  ? 16.001  159.119 -15.629 1.00 20.73 ? 66  TYR A CD1 1 
ATOM   94   C  CD2 . TYR A 1 66  ? 16.114  159.408 -18.004 1.00 20.00 ? 66  TYR A CD2 1 
ATOM   95   C  CE1 . TYR A 1 66  ? 17.252  158.507 -15.639 1.00 19.12 ? 66  TYR A CE1 1 
ATOM   96   C  CE2 . TYR A 1 66  ? 17.367  158.797 -18.025 1.00 21.36 ? 66  TYR A CE2 1 
ATOM   97   C  CZ  . TYR A 1 66  ? 17.929  158.351 -16.840 1.00 20.77 ? 66  TYR A CZ  1 
ATOM   98   O  OH  . TYR A 1 66  ? 19.167  157.751 -16.859 1.00 21.35 ? 66  TYR A OH  1 
ATOM   99   N  N   . ARG A 1 67  ? 12.063  162.777 -16.114 1.00 23.29 ? 67  ARG A N   1 
ATOM   100  C  CA  . ARG A 1 67  ? 10.913  163.560 -16.541 1.00 26.56 ? 67  ARG A CA  1 
ATOM   101  C  C   . ARG A 1 67  ? 11.278  165.037 -16.703 1.00 27.76 ? 67  ARG A C   1 
ATOM   102  O  O   . ARG A 1 67  ? 10.492  165.813 -17.247 1.00 29.51 ? 67  ARG A O   1 
ATOM   103  C  CB  . ARG A 1 67  ? 9.752   163.416 -15.550 1.00 25.61 ? 67  ARG A CB  1 
ATOM   104  C  CG  . ARG A 1 67  ? 10.017  163.918 -14.137 1.00 26.22 ? 67  ARG A CG  1 
ATOM   105  C  CD  . ARG A 1 67  ? 8.684   164.191 -13.430 1.00 28.28 ? 67  ARG A CD  1 
ATOM   106  N  NE  . ARG A 1 67  ? 8.842   164.667 -12.056 1.00 30.51 ? 67  ARG A NE  1 
ATOM   107  C  CZ  . ARG A 1 67  ? 8.983   163.876 -10.998 1.00 32.03 ? 67  ARG A CZ  1 
ATOM   108  N  NH1 . ARG A 1 67  ? 8.985   162.558 -11.147 1.00 32.61 ? 67  ARG A NH1 1 
ATOM   109  N  NH2 . ARG A 1 67  ? 9.119   164.404 -9.788  1.00 31.74 ? 67  ARG A NH2 1 
ATOM   110  N  N   . ASP A 1 68  ? 12.472  165.414 -16.242 1.00 27.43 ? 68  ASP A N   1 
ATOM   111  C  CA  . ASP A 1 68  ? 12.943  166.798 -16.334 1.00 28.80 ? 68  ASP A CA  1 
ATOM   112  C  C   . ASP A 1 68  ? 14.067  166.993 -17.343 1.00 29.54 ? 68  ASP A C   1 
ATOM   113  O  O   . ASP A 1 68  ? 14.561  168.106 -17.512 1.00 31.72 ? 68  ASP A O   1 
ATOM   114  C  CB  . ASP A 1 68  ? 13.436  167.304 -14.972 1.00 27.68 ? 68  ASP A CB  1 
ATOM   115  C  CG  . ASP A 1 68  ? 12.320  167.454 -13.966 1.00 28.12 ? 68  ASP A CG  1 
ATOM   116  O  OD1 . ASP A 1 68  ? 11.202  167.812 -14.379 1.00 29.41 ? 68  ASP A OD1 1 
ATOM   117  O  OD2 . ASP A 1 68  ? 12.561  167.231 -12.761 1.00 29.77 ? 68  ASP A OD2 1 
ATOM   118  N  N   . ARG A 1 69  ? 14.480  165.918 -18.005 1.00 28.97 ? 69  ARG A N   1 
ATOM   119  C  CA  . ARG A 1 69  ? 15.556  166.000 -18.985 1.00 29.24 ? 69  ARG A CA  1 
ATOM   120  C  C   . ARG A 1 69  ? 15.017  166.337 -20.370 1.00 29.95 ? 69  ARG A C   1 
ATOM   121  O  O   . ARG A 1 69  ? 14.134  165.653 -20.892 1.00 28.33 ? 69  ARG A O   1 
ATOM   122  C  CB  . ARG A 1 69  ? 16.330  164.678 -19.027 1.00 27.81 ? 69  ARG A CB  1 
ATOM   123  C  CG  . ARG A 1 69  ? 16.898  164.278 -17.675 1.00 26.88 ? 69  ARG A CG  1 
ATOM   124  C  CD  . ARG A 1 69  ? 17.812  163.067 -17.773 1.00 26.67 ? 69  ARG A CD  1 
ATOM   125  N  NE  . ARG A 1 69  ? 18.269  162.634 -16.454 1.00 26.16 ? 69  ARG A NE  1 
ATOM   126  C  CZ  . ARG A 1 69  ? 19.303  161.824 -16.250 1.00 26.60 ? 69  ARG A CZ  1 
ATOM   127  N  NH1 . ARG A 1 69  ? 19.997  161.355 -17.278 1.00 26.59 ? 69  ARG A NH1 1 
ATOM   128  N  NH2 . ARG A 1 69  ? 19.648  161.488 -15.015 1.00 27.77 ? 69  ARG A NH2 1 
ATOM   129  N  N   . ALA A 1 70  ? 15.559  167.393 -20.966 1.00 30.36 ? 70  ALA A N   1 
ATOM   130  C  CA  . ALA A 1 70  ? 15.115  167.830 -22.285 1.00 30.73 ? 70  ALA A CA  1 
ATOM   131  C  C   . ALA A 1 70  ? 15.366  166.780 -23.360 1.00 30.60 ? 70  ALA A C   1 
ATOM   132  O  O   . ALA A 1 70  ? 14.577  166.650 -24.298 1.00 31.13 ? 70  ALA A O   1 
ATOM   133  C  CB  . ALA A 1 70  ? 15.803  169.143 -22.661 1.00 30.66 ? 70  ALA A CB  1 
ATOM   134  N  N   . GLU A 1 71  ? 16.455  166.029 -23.227 1.00 29.74 ? 71  GLU A N   1 
ATOM   135  C  CA  . GLU A 1 71  ? 16.778  165.001 -24.211 1.00 29.61 ? 71  GLU A CA  1 
ATOM   136  C  C   . GLU A 1 71  ? 15.823  163.814 -24.128 1.00 29.49 ? 71  GLU A C   1 
ATOM   137  O  O   . GLU A 1 71  ? 15.891  162.900 -24.952 1.00 30.89 ? 71  GLU A O   1 
ATOM   138  C  CB  . GLU A 1 71  ? 18.223  164.508 -24.042 1.00 31.89 ? 71  GLU A CB  1 
ATOM   139  C  CG  . GLU A 1 71  ? 18.495  163.787 -22.731 1.00 33.32 ? 71  GLU A CG  1 
ATOM   140  C  CD  . GLU A 1 71  ? 18.982  164.713 -21.637 1.00 35.07 ? 71  GLU A CD  1 
ATOM   141  O  OE1 . GLU A 1 71  ? 18.521  165.873 -21.586 1.00 35.06 ? 71  GLU A OE1 1 
ATOM   142  O  OE2 . GLU A 1 71  ? 19.819  164.275 -20.817 1.00 36.30 ? 71  GLU A OE2 1 
ATOM   143  N  N   . TRP A 1 72  ? 14.939  163.826 -23.134 1.00 27.88 ? 72  TRP A N   1 
ATOM   144  C  CA  . TRP A 1 72  ? 13.962  162.752 -22.961 1.00 27.63 ? 72  TRP A CA  1 
ATOM   145  C  C   . TRP A 1 72  ? 12.531  163.257 -23.119 1.00 29.05 ? 72  TRP A C   1 
ATOM   146  O  O   . TRP A 1 72  ? 11.579  162.497 -22.947 1.00 29.18 ? 72  TRP A O   1 
ATOM   147  C  CB  . TRP A 1 72  ? 14.098  162.104 -21.574 1.00 26.37 ? 72  TRP A CB  1 
ATOM   148  C  CG  . TRP A 1 72  ? 15.241  161.140 -21.452 1.00 26.22 ? 72  TRP A CG  1 
ATOM   149  C  CD1 . TRP A 1 72  ? 16.513  161.417 -21.039 1.00 25.16 ? 72  TRP A CD1 1 
ATOM   150  C  CD2 . TRP A 1 72  ? 15.220  159.745 -21.779 1.00 26.37 ? 72  TRP A CD2 1 
ATOM   151  N  NE1 . TRP A 1 72  ? 17.286  160.280 -21.087 1.00 26.88 ? 72  TRP A NE1 1 
ATOM   152  C  CE2 . TRP A 1 72  ? 16.517  159.239 -21.539 1.00 26.88 ? 72  TRP A CE2 1 
ATOM   153  C  CE3 . TRP A 1 72  ? 14.229  158.873 -22.254 1.00 26.73 ? 72  TRP A CE3 1 
ATOM   154  C  CZ2 . TRP A 1 72  ? 16.852  157.896 -21.756 1.00 27.54 ? 72  TRP A CZ2 1 
ATOM   155  C  CZ3 . TRP A 1 72  ? 14.562  157.535 -22.472 1.00 27.36 ? 72  TRP A CZ3 1 
ATOM   156  C  CH2 . TRP A 1 72  ? 15.866  157.063 -22.221 1.00 28.17 ? 72  TRP A CH2 1 
ATOM   157  N  N   . ALA A 1 73  ? 12.382  164.536 -23.452 1.00 30.05 ? 73  ALA A N   1 
ATOM   158  C  CA  . ALA A 1 73  ? 11.063  165.150 -23.603 1.00 30.38 ? 73  ALA A CA  1 
ATOM   159  C  C   . ALA A 1 73  ? 10.174  164.539 -24.685 1.00 30.94 ? 73  ALA A C   1 
ATOM   160  O  O   . ALA A 1 73  ? 8.950   164.543 -24.563 1.00 31.39 ? 73  ALA A O   1 
ATOM   161  C  CB  . ALA A 1 73  ? 11.223  166.654 -23.855 1.00 29.86 ? 73  ALA A CB  1 
ATOM   162  N  N   . ASP A 1 74  ? 10.791  164.013 -25.736 1.00 31.66 ? 74  ASP A N   1 
ATOM   163  C  CA  . ASP A 1 74  ? 10.056  163.427 -26.854 1.00 33.49 ? 74  ASP A CA  1 
ATOM   164  C  C   . ASP A 1 74  ? 9.381   162.086 -26.576 1.00 35.36 ? 74  ASP A C   1 
ATOM   165  O  O   . ASP A 1 74  ? 8.550   161.639 -27.364 1.00 36.20 ? 74  ASP A O   1 
ATOM   166  C  CB  . ASP A 1 74  ? 10.995  163.248 -28.039 1.00 34.86 ? 74  ASP A CB  1 
ATOM   167  C  CG  . ASP A 1 74  ? 12.097  162.256 -27.745 1.00 35.70 ? 74  ASP A CG  1 
ATOM   168  O  OD1 . ASP A 1 74  ? 12.171  161.222 -28.442 1.00 38.65 ? 74  ASP A OD1 1 
ATOM   169  O  OD2 . ASP A 1 74  ? 12.882  162.507 -26.806 1.00 35.49 ? 74  ASP A OD2 1 
ATOM   170  N  N   . ILE A 1 75  ? 9.739   161.430 -25.479 1.00 35.45 ? 75  ILE A N   1 
ATOM   171  C  CA  . ILE A 1 75  ? 9.133   160.139 -25.177 1.00 34.89 ? 75  ILE A CA  1 
ATOM   172  C  C   . ILE A 1 75  ? 8.307   160.181 -23.894 1.00 33.68 ? 75  ILE A C   1 
ATOM   173  O  O   . ILE A 1 75  ? 8.749   160.715 -22.877 1.00 33.42 ? 75  ILE A O   1 
ATOM   174  C  CB  . ILE A 1 75  ? 10.218  159.034 -25.078 1.00 36.78 ? 75  ILE A CB  1 
ATOM   175  C  CG1 . ILE A 1 75  ? 9.557   157.660 -24.941 1.00 39.06 ? 75  ILE A CG1 1 
ATOM   176  C  CG2 . ILE A 1 75  ? 11.140  159.309 -23.907 1.00 36.22 ? 75  ILE A CG2 1 
ATOM   177  C  CD1 . ILE A 1 75  ? 10.540  156.502 -24.983 1.00 39.36 ? 75  ILE A CD1 1 
ATOM   178  N  N   . ASP A 1 76  ? 7.099   159.629 -23.956 1.00 31.60 ? 76  ASP A N   1 
ATOM   179  C  CA  . ASP A 1 76  ? 6.206   159.601 -22.805 1.00 32.22 ? 76  ASP A CA  1 
ATOM   180  C  C   . ASP A 1 76  ? 6.498   158.424 -21.885 1.00 32.49 ? 76  ASP A C   1 
ATOM   181  O  O   . ASP A 1 76  ? 6.635   157.287 -22.335 1.00 31.47 ? 76  ASP A O   1 
ATOM   182  C  CB  . ASP A 1 76  ? 4.747   159.518 -23.255 1.00 35.60 ? 76  ASP A CB  1 
ATOM   183  C  CG  . ASP A 1 76  ? 4.284   160.769 -23.972 1.00 38.71 ? 76  ASP A CG  1 
ATOM   184  O  OD1 . ASP A 1 76  ? 4.358   161.862 -23.371 1.00 40.40 ? 76  ASP A OD1 1 
ATOM   185  O  OD2 . ASP A 1 76  ? 3.842   160.658 -25.134 1.00 40.71 ? 76  ASP A OD2 1 
ATOM   186  N  N   . PRO A 1 77  ? 6.592   158.686 -20.574 1.00 32.12 ? 77  PRO A N   1 
ATOM   187  C  CA  . PRO A 1 77  ? 6.866   157.615 -19.617 1.00 31.61 ? 77  PRO A CA  1 
ATOM   188  C  C   . PRO A 1 77  ? 5.684   156.647 -19.555 1.00 31.92 ? 77  PRO A C   1 
ATOM   189  O  O   . PRO A 1 77  ? 4.544   157.029 -19.821 1.00 31.62 ? 77  PRO A O   1 
ATOM   190  C  CB  . PRO A 1 77  ? 7.071   158.374 -18.311 1.00 31.56 ? 77  PRO A CB  1 
ATOM   191  C  CG  . PRO A 1 77  ? 6.129   159.542 -18.463 1.00 31.23 ? 77  PRO A CG  1 
ATOM   192  C  CD  . PRO A 1 77  ? 6.393   159.975 -19.886 1.00 30.62 ? 77  PRO A CD  1 
ATOM   193  N  N   . VAL A 1 78  ? 5.963   155.393 -19.222 1.00 30.90 ? 78  VAL A N   1 
ATOM   194  C  CA  . VAL A 1 78  ? 4.920   154.384 -19.119 1.00 30.13 ? 78  VAL A CA  1 
ATOM   195  C  C   . VAL A 1 78  ? 4.812   153.916 -17.674 1.00 29.99 ? 78  VAL A C   1 
ATOM   196  O  O   . VAL A 1 78  ? 5.676   153.194 -17.173 1.00 29.66 ? 78  VAL A O   1 
ATOM   197  C  CB  . VAL A 1 78  ? 5.223   153.177 -20.030 1.00 30.97 ? 78  VAL A CB  1 
ATOM   198  C  CG1 . VAL A 1 78  ? 4.218   152.060 -19.777 1.00 30.12 ? 78  VAL A CG1 1 
ATOM   199  C  CG2 . VAL A 1 78  ? 5.169   153.613 -21.489 1.00 29.35 ? 78  VAL A CG2 1 
ATOM   200  N  N   . PRO A 1 79  ? 3.750   154.337 -16.977 1.00 29.96 ? 79  PRO A N   1 
ATOM   201  C  CA  . PRO A 1 79  ? 3.561   153.939 -15.580 1.00 30.22 ? 79  PRO A CA  1 
ATOM   202  C  C   . PRO A 1 79  ? 3.292   152.445 -15.424 1.00 30.12 ? 79  PRO A C   1 
ATOM   203  O  O   . PRO A 1 79  ? 2.826   151.781 -16.352 1.00 28.33 ? 79  PRO A O   1 
ATOM   204  C  CB  . PRO A 1 79  ? 2.380   154.796 -15.137 1.00 29.82 ? 79  PRO A CB  1 
ATOM   205  C  CG  . PRO A 1 79  ? 1.581   154.924 -16.392 1.00 31.87 ? 79  PRO A CG  1 
ATOM   206  C  CD  . PRO A 1 79  ? 2.641   155.193 -17.435 1.00 30.49 ? 79  PRO A CD  1 
ATOM   207  N  N   . GLN A 1 80  ? 3.603   151.919 -14.248 1.00 29.46 ? 80  GLN A N   1 
ATOM   208  C  CA  . GLN A 1 80  ? 3.380   150.510 -13.975 1.00 31.23 ? 80  GLN A CA  1 
ATOM   209  C  C   . GLN A 1 80  ? 1.917   150.298 -13.596 1.00 32.19 ? 80  GLN A C   1 
ATOM   210  O  O   . GLN A 1 80  ? 1.397   150.963 -12.703 1.00 34.14 ? 80  GLN A O   1 
ATOM   211  C  CB  . GLN A 1 80  ? 4.296   150.055 -12.839 1.00 30.46 ? 80  GLN A CB  1 
ATOM   212  C  CG  . GLN A 1 80  ? 3.985   148.679 -12.285 1.00 29.92 ? 80  GLN A CG  1 
ATOM   213  C  CD  . GLN A 1 80  ? 5.047   148.207 -11.317 1.00 28.62 ? 80  GLN A CD  1 
ATOM   214  O  OE1 . GLN A 1 80  ? 6.084   147.683 -11.724 1.00 28.14 ? 80  GLN A OE1 1 
ATOM   215  N  NE2 . GLN A 1 80  ? 4.802   148.405 -10.026 1.00 28.41 ? 80  GLN A NE2 1 
ATOM   216  N  N   . ASN A 1 81  ? 1.249   149.381 -14.284 1.00 33.57 ? 81  ASN A N   1 
ATOM   217  C  CA  . ASN A 1 81  ? -0.150  149.103 -13.986 1.00 34.94 ? 81  ASN A CA  1 
ATOM   218  C  C   . ASN A 1 81  ? -0.282  147.945 -13.000 1.00 33.41 ? 81  ASN A C   1 
ATOM   219  O  O   . ASN A 1 81  ? -0.113  146.783 -13.368 1.00 31.89 ? 81  ASN A O   1 
ATOM   220  C  CB  . ASN A 1 81  ? -0.913  148.781 -15.276 1.00 37.97 ? 81  ASN A CB  1 
ATOM   221  C  CG  . ASN A 1 81  ? -2.348  148.346 -15.017 1.00 40.85 ? 81  ASN A CG  1 
ATOM   222  O  OD1 . ASN A 1 81  ? -3.069  148.966 -14.230 1.00 41.17 ? 81  ASN A OD1 1 
ATOM   223  N  ND2 . ASN A 1 81  ? -2.771  147.281 -15.689 1.00 42.12 ? 81  ASN A ND2 1 
ATOM   224  N  N   . ASP A 1 82  ? -0.580  148.273 -11.745 1.00 32.77 ? 82  ASP A N   1 
ATOM   225  C  CA  . ASP A 1 82  ? -0.747  147.260 -10.711 1.00 33.22 ? 82  ASP A CA  1 
ATOM   226  C  C   . ASP A 1 82  ? -2.208  146.896 -10.488 1.00 33.73 ? 82  ASP A C   1 
ATOM   227  O  O   . ASP A 1 82  ? -2.536  146.171 -9.547  1.00 35.01 ? 82  ASP A O   1 
ATOM   228  C  CB  . ASP A 1 82  ? -0.143  147.727 -9.382  1.00 32.53 ? 82  ASP A CB  1 
ATOM   229  C  CG  . ASP A 1 82  ? 1.361   147.551 -9.331  1.00 33.56 ? 82  ASP A CG  1 
ATOM   230  O  OD1 . ASP A 1 82  ? 1.876   146.631 -9.998  1.00 30.78 ? 82  ASP A OD1 1 
ATOM   231  O  OD2 . ASP A 1 82  ? 2.029   148.318 -8.609  1.00 36.66 ? 82  ASP A OD2 1 
ATOM   232  N  N   . GLY A 1 83  ? -3.084  147.394 -11.354 1.00 34.26 ? 83  GLY A N   1 
ATOM   233  C  CA  . GLY A 1 83  ? -4.496  147.095 -11.212 1.00 34.34 ? 83  GLY A CA  1 
ATOM   234  C  C   . GLY A 1 83  ? -5.185  148.032 -10.236 1.00 35.46 ? 83  GLY A C   1 
ATOM   235  O  O   . GLY A 1 83  ? -4.518  148.771 -9.512  1.00 34.52 ? 83  GLY A O   1 
ATOM   236  N  N   . PRO A 1 84  ? -6.527  148.019 -10.187 1.00 36.48 ? 84  PRO A N   1 
ATOM   237  C  CA  . PRO A 1 84  ? -7.304  148.880 -9.290  1.00 37.46 ? 84  PRO A CA  1 
ATOM   238  C  C   . PRO A 1 84  ? -7.097  148.626 -7.797  1.00 38.53 ? 84  PRO A C   1 
ATOM   239  O  O   . PRO A 1 84  ? -7.056  149.571 -7.009  1.00 39.18 ? 84  PRO A O   1 
ATOM   240  C  CB  . PRO A 1 84  ? -8.742  148.628 -9.736  1.00 37.29 ? 84  PRO A CB  1 
ATOM   241  C  CG  . PRO A 1 84  ? -8.702  147.202 -10.191 1.00 38.64 ? 84  PRO A CG  1 
ATOM   242  C  CD  . PRO A 1 84  ? -7.418  147.159 -10.986 1.00 37.08 ? 84  PRO A CD  1 
ATOM   243  N  N   . ASN A 1 85  ? -6.965  147.361 -7.407  1.00 38.55 ? 85  ASN A N   1 
ATOM   244  C  CA  . ASN A 1 85  ? -6.767  147.017 -5.999  1.00 38.95 ? 85  ASN A CA  1 
ATOM   245  C  C   . ASN A 1 85  ? -5.474  146.225 -5.838  1.00 38.69 ? 85  ASN A C   1 
ATOM   246  O  O   . ASN A 1 85  ? -5.492  145.014 -5.619  1.00 38.00 ? 85  ASN A O   1 
ATOM   247  C  CB  . ASN A 1 85  ? -7.951  146.197 -5.490  1.00 40.75 ? 85  ASN A CB  1 
ATOM   248  C  CG  . ASN A 1 85  ? -9.281  146.762 -5.944  1.00 43.54 ? 85  ASN A CG  1 
ATOM   249  O  OD1 . ASN A 1 85  ? -9.859  146.304 -6.931  1.00 45.06 ? 85  ASN A OD1 1 
ATOM   250  N  ND2 . ASN A 1 85  ? -9.765  147.775 -5.238  1.00 44.60 ? 85  ASN A ND2 1 
ATOM   251  N  N   . PRO A 1 86  ? -4.330  146.914 -5.932  1.00 37.99 ? 86  PRO A N   1 
ATOM   252  C  CA  . PRO A 1 86  ? -2.993  146.328 -5.815  1.00 36.62 ? 86  PRO A CA  1 
ATOM   253  C  C   . PRO A 1 86  ? -2.662  145.546 -4.545  1.00 34.43 ? 86  PRO A C   1 
ATOM   254  O  O   . PRO A 1 86  ? -3.223  145.785 -3.473  1.00 34.37 ? 86  PRO A O   1 
ATOM   255  C  CB  . PRO A 1 86  ? -2.071  147.535 -6.010  1.00 37.91 ? 86  PRO A CB  1 
ATOM   256  C  CG  . PRO A 1 86  ? -2.882  148.666 -5.468  1.00 39.37 ? 86  PRO A CG  1 
ATOM   257  C  CD  . PRO A 1 86  ? -4.245  148.382 -6.046  1.00 38.01 ? 86  PRO A CD  1 
ATOM   258  N  N   . VAL A 1 87  ? -1.745  144.596 -4.698  1.00 30.80 ? 87  VAL A N   1 
ATOM   259  C  CA  . VAL A 1 87  ? -1.273  143.766 -3.600  1.00 27.45 ? 87  VAL A CA  1 
ATOM   260  C  C   . VAL A 1 87  ? 0.249   143.856 -3.637  1.00 25.47 ? 87  VAL A C   1 
ATOM   261  O  O   . VAL A 1 87  ? 0.815   144.211 -4.674  1.00 23.50 ? 87  VAL A O   1 
ATOM   262  C  CB  . VAL A 1 87  ? -1.742  142.303 -3.758  1.00 28.93 ? 87  VAL A CB  1 
ATOM   263  C  CG1 . VAL A 1 87  ? -3.265  142.242 -3.648  1.00 29.18 ? 87  VAL A CG1 1 
ATOM   264  C  CG2 . VAL A 1 87  ? -1.288  141.742 -5.095  1.00 26.45 ? 87  VAL A CG2 1 
ATOM   265  N  N   . VAL A 1 88  ? 0.898   143.541 -2.514  1.00 22.72 ? 88  VAL A N   1 
ATOM   266  C  CA  . VAL A 1 88  ? 2.353   143.631 -2.388  1.00 22.13 ? 88  VAL A CA  1 
ATOM   267  C  C   . VAL A 1 88  ? 2.866   144.855 -3.147  1.00 23.31 ? 88  VAL A C   1 
ATOM   268  O  O   . VAL A 1 88  ? 3.883   144.810 -3.842  1.00 21.20 ? 88  VAL A O   1 
ATOM   269  C  CB  . VAL A 1 88  ? 3.072   142.330 -2.884  1.00 22.12 ? 88  VAL A CB  1 
ATOM   270  C  CG1 . VAL A 1 88  ? 2.668   141.153 -1.994  1.00 20.42 ? 88  VAL A CG1 1 
ATOM   271  C  CG2 . VAL A 1 88  ? 2.734   142.039 -4.343  1.00 21.27 ? 88  VAL A CG2 1 
ATOM   272  N  N   . GLN A 1 89  ? 2.140   145.957 -2.988  1.00 24.87 ? 89  GLN A N   1 
ATOM   273  C  CA  . GLN A 1 89  ? 2.468   147.213 -3.646  1.00 26.38 ? 89  GLN A CA  1 
ATOM   274  C  C   . GLN A 1 89  ? 3.589   147.947 -2.930  1.00 27.47 ? 89  GLN A C   1 
ATOM   275  O  O   . GLN A 1 89  ? 3.475   148.292 -1.748  1.00 27.90 ? 89  GLN A O   1 
ATOM   276  C  CB  . GLN A 1 89  ? 1.225   148.101 -3.707  1.00 29.15 ? 89  GLN A CB  1 
ATOM   277  C  CG  . GLN A 1 89  ? 1.455   149.451 -4.357  1.00 32.55 ? 89  GLN A CG  1 
ATOM   278  C  CD  . GLN A 1 89  ? 0.209   150.316 -4.339  1.00 35.44 ? 89  GLN A CD  1 
ATOM   279  O  OE1 . GLN A 1 89  ? -0.387  150.543 -3.286  1.00 36.98 ? 89  GLN A OE1 1 
ATOM   280  N  NE2 . GLN A 1 89  ? -0.190  150.805 -5.506  1.00 38.66 ? 89  GLN A NE2 1 
ATOM   281  N  N   . ILE A 1 90  ? 4.675   148.180 -3.657  1.00 27.03 ? 90  ILE A N   1 
ATOM   282  C  CA  . ILE A 1 90  ? 5.838   148.873 -3.115  1.00 27.40 ? 90  ILE A CA  1 
ATOM   283  C  C   . ILE A 1 90  ? 5.670   150.379 -3.326  1.00 26.91 ? 90  ILE A C   1 
ATOM   284  O  O   . ILE A 1 90  ? 5.463   150.834 -4.447  1.00 26.51 ? 90  ILE A O   1 
ATOM   285  C  CB  . ILE A 1 90  ? 7.130   148.399 -3.824  1.00 27.63 ? 90  ILE A CB  1 
ATOM   286  C  CG1 . ILE A 1 90  ? 7.272   146.881 -3.679  1.00 25.32 ? 90  ILE A CG1 1 
ATOM   287  C  CG2 . ILE A 1 90  ? 8.351   149.116 -3.244  1.00 27.10 ? 90  ILE A CG2 1 
ATOM   288  C  CD1 . ILE A 1 90  ? 8.355   146.283 -4.555  1.00 24.59 ? 90  ILE A CD1 1 
ATOM   289  N  N   . ILE A 1 91  ? 5.740   151.150 -2.247  1.00 28.86 ? 91  ILE A N   1 
ATOM   290  C  CA  . ILE A 1 91  ? 5.608   152.599 -2.361  1.00 30.70 ? 91  ILE A CA  1 
ATOM   291  C  C   . ILE A 1 91  ? 6.976   153.138 -2.764  1.00 29.60 ? 91  ILE A C   1 
ATOM   292  O  O   . ILE A 1 91  ? 7.770   153.541 -1.917  1.00 31.37 ? 91  ILE A O   1 
ATOM   293  C  CB  . ILE A 1 91  ? 5.175   153.230 -1.021  1.00 33.43 ? 91  ILE A CB  1 
ATOM   294  C  CG1 . ILE A 1 91  ? 3.921   152.523 -0.496  1.00 33.04 ? 91  ILE A CG1 1 
ATOM   295  C  CG2 . ILE A 1 91  ? 4.894   154.717 -1.213  1.00 32.68 ? 91  ILE A CG2 1 
ATOM   296  C  CD1 . ILE A 1 91  ? 2.756   152.520 -1.472  1.00 35.20 ? 91  ILE A CD1 1 
ATOM   297  N  N   . TYR A 1 92  ? 7.239   153.134 -4.067  1.00 28.28 ? 92  TYR A N   1 
ATOM   298  C  CA  . TYR A 1 92  ? 8.520   153.576 -4.613  1.00 27.75 ? 92  TYR A CA  1 
ATOM   299  C  C   . TYR A 1 92  ? 8.883   155.035 -4.350  1.00 27.97 ? 92  TYR A C   1 
ATOM   300  O  O   . TYR A 1 92  ? 8.012   155.898 -4.234  1.00 26.20 ? 92  TYR A O   1 
ATOM   301  C  CB  . TYR A 1 92  ? 8.554   153.361 -6.128  1.00 29.19 ? 92  TYR A CB  1 
ATOM   302  C  CG  . TYR A 1 92  ? 8.064   152.012 -6.608  1.00 28.44 ? 92  TYR A CG  1 
ATOM   303  C  CD1 . TYR A 1 92  ? 6.791   151.870 -7.163  1.00 29.37 ? 92  TYR A CD1 1 
ATOM   304  C  CD2 . TYR A 1 92  ? 8.886   150.886 -6.548  1.00 28.41 ? 92  TYR A CD2 1 
ATOM   305  C  CE1 . TYR A 1 92  ? 6.352   150.638 -7.654  1.00 28.68 ? 92  TYR A CE1 1 
ATOM   306  C  CE2 . TYR A 1 92  ? 8.457   149.652 -7.037  1.00 26.87 ? 92  TYR A CE2 1 
ATOM   307  C  CZ  . TYR A 1 92  ? 7.191   149.536 -7.589  1.00 27.90 ? 92  TYR A CZ  1 
ATOM   308  O  OH  . TYR A 1 92  ? 6.766   148.322 -8.083  1.00 26.87 ? 92  TYR A OH  1 
ATOM   309  N  N   . SER A 1 93  ? 10.183  155.303 -4.272  1.00 27.33 ? 93  SER A N   1 
ATOM   310  C  CA  . SER A 1 93  ? 10.656  156.665 -4.087  1.00 26.45 ? 93  SER A CA  1 
ATOM   311  C  C   . SER A 1 93  ? 10.383  157.336 -5.428  1.00 26.39 ? 93  SER A C   1 
ATOM   312  O  O   . SER A 1 93  ? 10.128  156.651 -6.423  1.00 24.60 ? 93  SER A O   1 
ATOM   313  C  CB  . SER A 1 93  ? 12.153  156.679 -3.799  1.00 25.96 ? 93  SER A CB  1 
ATOM   314  O  OG  . SER A 1 93  ? 12.886  156.227 -4.925  1.00 28.26 ? 93  SER A OG  1 
ATOM   315  N  N   . ASP A 1 94  ? 10.429  158.664 -5.462  1.00 25.78 ? 94  ASP A N   1 
ATOM   316  C  CA  . ASP A 1 94  ? 10.180  159.400 -6.696  1.00 26.16 ? 94  ASP A CA  1 
ATOM   317  C  C   . ASP A 1 94  ? 11.236  159.060 -7.754  1.00 25.16 ? 94  ASP A C   1 
ATOM   318  O  O   . ASP A 1 94  ? 10.914  158.886 -8.929  1.00 24.98 ? 94  ASP A O   1 
ATOM   319  C  CB  . ASP A 1 94  ? 10.167  160.911 -6.407  1.00 28.77 ? 94  ASP A CB  1 
ATOM   320  C  CG  . ASP A 1 94  ? 9.703   161.742 -7.601  1.00 33.58 ? 94  ASP A CG  1 
ATOM   321  O  OD1 . ASP A 1 94  ? 8.873   161.245 -8.394  1.00 33.42 ? 94  ASP A OD1 1 
ATOM   322  O  OD2 . ASP A 1 94  ? 10.153  162.904 -7.738  1.00 34.88 ? 94  ASP A OD2 1 
ATOM   323  N  N   . LYS A 1 95  ? 12.492  158.951 -7.331  1.00 24.14 ? 95  LYS A N   1 
ATOM   324  C  CA  . LYS A 1 95  ? 13.585  158.631 -8.246  1.00 25.79 ? 95  LYS A CA  1 
ATOM   325  C  C   . LYS A 1 95  ? 13.474  157.222 -8.830  1.00 24.87 ? 95  LYS A C   1 
ATOM   326  O  O   . LYS A 1 95  ? 13.745  157.010 -10.012 1.00 23.30 ? 95  LYS A O   1 
ATOM   327  C  CB  . LYS A 1 95  ? 14.932  158.791 -7.531  1.00 28.08 ? 95  LYS A CB  1 
ATOM   328  C  CG  . LYS A 1 95  ? 15.341  160.247 -7.326  1.00 33.88 ? 95  LYS A CG  1 
ATOM   329  C  CD  . LYS A 1 95  ? 16.369  160.417 -6.213  1.00 34.24 ? 95  LYS A CD  1 
ATOM   330  C  CE  . LYS A 1 95  ? 17.697  159.781 -6.547  1.00 34.22 ? 95  LYS A CE  1 
ATOM   331  N  NZ  . LYS A 1 95  ? 18.657  160.022 -5.439  1.00 32.43 ? 95  LYS A NZ  1 
ATOM   332  N  N   . PHE A 1 96  ? 13.077  156.262 -8.002  1.00 24.07 ? 96  PHE A N   1 
ATOM   333  C  CA  . PHE A 1 96  ? 12.938  154.884 -8.462  1.00 23.83 ? 96  PHE A CA  1 
ATOM   334  C  C   . PHE A 1 96  ? 11.866  154.808 -9.540  1.00 24.65 ? 96  PHE A C   1 
ATOM   335  O  O   . PHE A 1 96  ? 12.106  154.297 -10.634 1.00 24.30 ? 96  PHE A O   1 
ATOM   336  C  CB  . PHE A 1 96  ? 12.554  153.965 -7.299  1.00 24.51 ? 96  PHE A CB  1 
ATOM   337  C  CG  . PHE A 1 96  ? 12.608  152.496 -7.640  1.00 25.30 ? 96  PHE A CG  1 
ATOM   338  C  CD1 . PHE A 1 96  ? 13.713  151.730 -7.292  1.00 23.70 ? 96  PHE A CD1 1 
ATOM   339  C  CD2 . PHE A 1 96  ? 11.546  151.880 -8.300  1.00 26.68 ? 96  PHE A CD2 1 
ATOM   340  C  CE1 . PHE A 1 96  ? 13.765  150.369 -7.590  1.00 24.39 ? 96  PHE A CE1 1 
ATOM   341  C  CE2 . PHE A 1 96  ? 11.588  150.516 -8.606  1.00 26.83 ? 96  PHE A CE2 1 
ATOM   342  C  CZ  . PHE A 1 96  ? 12.702  149.761 -8.248  1.00 23.97 ? 96  PHE A CZ  1 
ATOM   343  N  N   . ARG A 1 97  ? 10.683  155.329 -9.230  1.00 24.31 ? 97  ARG A N   1 
ATOM   344  C  CA  . ARG A 1 97  ? 9.571   155.305 -10.167 1.00 25.12 ? 97  ARG A CA  1 
ATOM   345  C  C   . ARG A 1 97  ? 9.906   156.047 -11.455 1.00 24.71 ? 97  ARG A C   1 
ATOM   346  O  O   . ARG A 1 97  ? 9.584   155.583 -12.552 1.00 25.01 ? 97  ARG A O   1 
ATOM   347  C  CB  . ARG A 1 97  ? 8.326   155.922 -9.523  1.00 28.17 ? 97  ARG A CB  1 
ATOM   348  C  CG  . ARG A 1 97  ? 7.095   155.881 -10.415 1.00 32.36 ? 97  ARG A CG  1 
ATOM   349  C  CD  . ARG A 1 97  ? 5.891   156.546 -9.761  1.00 36.90 ? 97  ARG A CD  1 
ATOM   350  N  NE  . ARG A 1 97  ? 5.550   155.936 -8.478  1.00 40.94 ? 97  ARG A NE  1 
ATOM   351  C  CZ  . ARG A 1 97  ? 5.722   156.529 -7.299  1.00 43.91 ? 97  ARG A CZ  1 
ATOM   352  N  NH1 . ARG A 1 97  ? 6.231   157.754 -7.240  1.00 43.97 ? 97  ARG A NH1 1 
ATOM   353  N  NH2 . ARG A 1 97  ? 5.382   155.898 -6.180  1.00 43.70 ? 97  ARG A NH2 1 
ATOM   354  N  N   . ASP A 1 98  ? 10.548  157.201 -11.318 1.00 23.25 ? 98  ASP A N   1 
ATOM   355  C  CA  . ASP A 1 98  ? 10.928  158.003 -12.475 1.00 22.80 ? 98  ASP A CA  1 
ATOM   356  C  C   . ASP A 1 98  ? 11.761  157.191 -13.467 1.00 22.29 ? 98  ASP A C   1 
ATOM   357  O  O   . ASP A 1 98  ? 11.454  157.147 -14.659 1.00 23.45 ? 98  ASP A O   1 
ATOM   358  C  CB  . ASP A 1 98  ? 11.716  159.234 -12.022 1.00 23.53 ? 98  ASP A CB  1 
ATOM   359  C  CG  . ASP A 1 98  ? 12.311  160.004 -13.185 1.00 23.35 ? 98  ASP A CG  1 
ATOM   360  O  OD1 . ASP A 1 98  ? 11.546  160.598 -13.968 1.00 24.21 ? 98  ASP A OD1 1 
ATOM   361  O  OD2 . ASP A 1 98  ? 13.549  160.003 -13.317 1.00 24.76 ? 98  ASP A OD2 1 
ATOM   362  N  N   . VAL A 1 99  ? 12.814  156.546 -12.978 1.00 21.91 ? 99  VAL A N   1 
ATOM   363  C  CA  . VAL A 1 99  ? 13.668  155.746 -13.850 1.00 21.20 ? 99  VAL A CA  1 
ATOM   364  C  C   . VAL A 1 99  ? 12.918  154.578 -14.496 1.00 20.98 ? 99  VAL A C   1 
ATOM   365  O  O   . VAL A 1 99  ? 13.061  154.327 -15.695 1.00 19.47 ? 99  VAL A O   1 
ATOM   366  C  CB  . VAL A 1 99  ? 14.892  155.190 -13.082 1.00 22.55 ? 99  VAL A CB  1 
ATOM   367  C  CG1 . VAL A 1 99  ? 15.587  154.100 -13.907 1.00 21.35 ? 99  VAL A CG1 1 
ATOM   368  C  CG2 . VAL A 1 99  ? 15.878  156.322 -12.791 1.00 22.62 ? 99  VAL A CG2 1 
ATOM   369  N  N   . TYR A 1 100 ? 12.112  153.869 -13.715 1.00 20.34 ? 100 TYR A N   1 
ATOM   370  C  CA  . TYR A 1 100 ? 11.393  152.731 -14.271 1.00 21.91 ? 100 TYR A CA  1 
ATOM   371  C  C   . TYR A 1 100 ? 10.231  153.094 -15.192 1.00 22.55 ? 100 TYR A C   1 
ATOM   372  O  O   . TYR A 1 100 ? 9.873   152.313 -16.081 1.00 21.19 ? 100 TYR A O   1 
ATOM   373  C  CB  . TYR A 1 100 ? 10.962  151.772 -13.151 1.00 19.72 ? 100 TYR A CB  1 
ATOM   374  C  CG  . TYR A 1 100 ? 12.086  150.827 -12.792 1.00 21.20 ? 100 TYR A CG  1 
ATOM   375  C  CD1 . TYR A 1 100 ? 13.042  151.173 -11.835 1.00 18.82 ? 100 TYR A CD1 1 
ATOM   376  C  CD2 . TYR A 1 100 ? 12.270  149.637 -13.507 1.00 20.45 ? 100 TYR A CD2 1 
ATOM   377  C  CE1 . TYR A 1 100 ? 14.156  150.363 -11.605 1.00 20.38 ? 100 TYR A CE1 1 
ATOM   378  C  CE2 . TYR A 1 100 ? 13.384  148.823 -13.286 1.00 20.39 ? 100 TYR A CE2 1 
ATOM   379  C  CZ  . TYR A 1 100 ? 14.323  149.192 -12.339 1.00 19.39 ? 100 TYR A CZ  1 
ATOM   380  O  OH  . TYR A 1 100 ? 15.449  148.416 -12.156 1.00 20.50 ? 100 TYR A OH  1 
ATOM   381  N  N   . ASP A 1 101 ? 9.655   154.278 -15.006 1.00 23.56 ? 101 ASP A N   1 
ATOM   382  C  CA  . ASP A 1 101 ? 8.575   154.713 -15.887 1.00 22.88 ? 101 ASP A CA  1 
ATOM   383  C  C   . ASP A 1 101 ? 9.163   154.926 -17.281 1.00 22.77 ? 101 ASP A C   1 
ATOM   384  O  O   . ASP A 1 101 ? 8.509   154.659 -18.294 1.00 22.43 ? 101 ASP A O   1 
ATOM   385  C  CB  . ASP A 1 101 ? 7.951   156.018 -15.387 1.00 25.40 ? 101 ASP A CB  1 
ATOM   386  C  CG  . ASP A 1 101 ? 6.874   155.790 -14.343 1.00 27.38 ? 101 ASP A CG  1 
ATOM   387  O  OD1 . ASP A 1 101 ? 6.330   156.793 -13.838 1.00 27.12 ? 101 ASP A OD1 1 
ATOM   388  O  OD2 . ASP A 1 101 ? 6.567   154.617 -14.034 1.00 26.47 ? 101 ASP A OD2 1 
ATOM   389  N  N   . TYR A 1 102 ? 10.401  155.409 -17.334 1.00 22.35 ? 102 TYR A N   1 
ATOM   390  C  CA  . TYR A 1 102 ? 11.048  155.626 -18.620 1.00 23.00 ? 102 TYR A CA  1 
ATOM   391  C  C   . TYR A 1 102 ? 11.644  154.335 -19.166 1.00 23.99 ? 102 TYR A C   1 
ATOM   392  O  O   . TYR A 1 102 ? 11.689  154.132 -20.383 1.00 23.24 ? 102 TYR A O   1 
ATOM   393  C  CB  . TYR A 1 102 ? 12.103  156.734 -18.523 1.00 23.48 ? 102 TYR A CB  1 
ATOM   394  C  CG  . TYR A 1 102 ? 11.473  158.111 -18.595 1.00 24.44 ? 102 TYR A CG  1 
ATOM   395  C  CD1 . TYR A 1 102 ? 10.953  158.726 -17.457 1.00 23.66 ? 102 TYR A CD1 1 
ATOM   396  C  CD2 . TYR A 1 102 ? 11.311  158.755 -19.823 1.00 25.16 ? 102 TYR A CD2 1 
ATOM   397  C  CE1 . TYR A 1 102 ? 10.278  159.949 -17.539 1.00 23.49 ? 102 TYR A CE1 1 
ATOM   398  C  CE2 . TYR A 1 102 ? 10.638  159.974 -19.917 1.00 24.50 ? 102 TYR A CE2 1 
ATOM   399  C  CZ  . TYR A 1 102 ? 10.124  160.563 -18.774 1.00 24.68 ? 102 TYR A CZ  1 
ATOM   400  O  OH  . TYR A 1 102 ? 9.441   161.755 -18.871 1.00 25.73 ? 102 TYR A OH  1 
ATOM   401  N  N   . PHE A 1 103 ? 12.088  153.450 -18.276 1.00 22.00 ? 103 PHE A N   1 
ATOM   402  C  CA  . PHE A 1 103 ? 12.624  152.181 -18.738 1.00 23.50 ? 103 PHE A CA  1 
ATOM   403  C  C   . PHE A 1 103 ? 11.487  151.448 -19.443 1.00 22.45 ? 103 PHE A C   1 
ATOM   404  O  O   . PHE A 1 103 ? 11.663  150.918 -20.539 1.00 23.67 ? 103 PHE A O   1 
ATOM   405  C  CB  . PHE A 1 103 ? 13.134  151.319 -17.580 1.00 24.27 ? 103 PHE A CB  1 
ATOM   406  C  CG  . PHE A 1 103 ? 13.528  149.930 -18.005 1.00 25.17 ? 103 PHE A CG  1 
ATOM   407  C  CD1 . PHE A 1 103 ? 14.643  149.728 -18.813 1.00 25.52 ? 103 PHE A CD1 1 
ATOM   408  C  CD2 . PHE A 1 103 ? 12.750  148.831 -17.650 1.00 24.16 ? 103 PHE A CD2 1 
ATOM   409  C  CE1 . PHE A 1 103 ? 14.977  148.448 -19.269 1.00 27.80 ? 103 PHE A CE1 1 
ATOM   410  C  CE2 . PHE A 1 103 ? 13.074  147.547 -18.099 1.00 24.96 ? 103 PHE A CE2 1 
ATOM   411  C  CZ  . PHE A 1 103 ? 14.187  147.355 -18.910 1.00 24.84 ? 103 PHE A CZ  1 
ATOM   412  N  N   . ARG A 1 104 ? 10.317  151.428 -18.811 1.00 22.80 ? 104 ARG A N   1 
ATOM   413  C  CA  . ARG A 1 104 ? 9.154   150.766 -19.396 1.00 24.47 ? 104 ARG A CA  1 
ATOM   414  C  C   . ARG A 1 104 ? 8.820   151.366 -20.760 1.00 25.59 ? 104 ARG A C   1 
ATOM   415  O  O   . ARG A 1 104 ? 8.344   150.666 -21.653 1.00 25.71 ? 104 ARG A O   1 
ATOM   416  C  CB  . ARG A 1 104 ? 7.937   150.885 -18.471 1.00 24.13 ? 104 ARG A CB  1 
ATOM   417  C  CG  . ARG A 1 104 ? 7.936   149.917 -17.286 1.00 23.81 ? 104 ARG A CG  1 
ATOM   418  C  CD  . ARG A 1 104 ? 6.657   150.048 -16.460 1.00 23.69 ? 104 ARG A CD  1 
ATOM   419  N  NE  . ARG A 1 104 ? 6.735   151.132 -15.483 1.00 23.88 ? 104 ARG A NE  1 
ATOM   420  C  CZ  . ARG A 1 104 ? 7.361   151.037 -14.314 1.00 24.81 ? 104 ARG A CZ  1 
ATOM   421  N  NH1 . ARG A 1 104 ? 7.961   149.901 -13.970 1.00 25.16 ? 104 ARG A NH1 1 
ATOM   422  N  NH2 . ARG A 1 104 ? 7.394   152.076 -13.490 1.00 22.66 ? 104 ARG A NH2 1 
ATOM   423  N  N   . ALA A 1 105 ? 9.074   152.660 -20.921 1.00 25.35 ? 105 ALA A N   1 
ATOM   424  C  CA  . ALA A 1 105 ? 8.794   153.329 -22.188 1.00 26.25 ? 105 ALA A CA  1 
ATOM   425  C  C   . ALA A 1 105 ? 9.733   152.862 -23.295 1.00 25.80 ? 105 ALA A C   1 
ATOM   426  O  O   . ALA A 1 105 ? 9.284   152.524 -24.389 1.00 26.02 ? 105 ALA A O   1 
ATOM   427  C  CB  . ALA A 1 105 ? 8.893   154.845 -22.022 1.00 25.37 ? 105 ALA A CB  1 
ATOM   428  N  N   . VAL A 1 106 ? 11.035  152.840 -23.017 1.00 26.76 ? 106 VAL A N   1 
ATOM   429  C  CA  . VAL A 1 106 ? 11.995  152.409 -24.028 1.00 28.75 ? 106 VAL A CA  1 
ATOM   430  C  C   . VAL A 1 106 ? 11.838  150.926 -24.342 1.00 29.56 ? 106 VAL A C   1 
ATOM   431  O  O   . VAL A 1 106 ? 11.997  150.510 -25.489 1.00 29.61 ? 106 VAL A O   1 
ATOM   432  C  CB  . VAL A 1 106 ? 13.464  152.685 -23.597 1.00 29.48 ? 106 VAL A CB  1 
ATOM   433  C  CG1 . VAL A 1 106 ? 13.666  154.175 -23.386 1.00 29.77 ? 106 VAL A CG1 1 
ATOM   434  C  CG2 . VAL A 1 106 ? 13.803  151.916 -22.331 1.00 30.94 ? 106 VAL A CG2 1 
ATOM   435  N  N   . LEU A 1 107 ? 11.517  150.134 -23.324 1.00 30.38 ? 107 LEU A N   1 
ATOM   436  C  CA  . LEU A 1 107 ? 11.333  148.701 -23.508 1.00 31.99 ? 107 LEU A CA  1 
ATOM   437  C  C   . LEU A 1 107 ? 10.121  148.452 -24.395 1.00 33.04 ? 107 LEU A C   1 
ATOM   438  O  O   . LEU A 1 107 ? 10.163  147.621 -25.300 1.00 32.72 ? 107 LEU A O   1 
ATOM   439  C  CB  . LEU A 1 107 ? 11.127  148.004 -22.158 1.00 31.64 ? 107 LEU A CB  1 
ATOM   440  C  CG  . LEU A 1 107 ? 11.107  146.472 -22.196 1.00 33.14 ? 107 LEU A CG  1 
ATOM   441  C  CD1 . LEU A 1 107 ? 12.481  145.965 -22.618 1.00 33.72 ? 107 LEU A CD1 1 
ATOM   442  C  CD2 . LEU A 1 107 ? 10.735  145.913 -20.827 1.00 32.66 ? 107 LEU A CD2 1 
ATOM   443  N  N   . GLN A 1 108 ? 9.044   149.183 -24.130 1.00 34.20 ? 108 GLN A N   1 
ATOM   444  C  CA  . GLN A 1 108 ? 7.811   149.044 -24.896 1.00 36.88 ? 108 GLN A CA  1 
ATOM   445  C  C   . GLN A 1 108 ? 8.004   149.451 -26.355 1.00 37.94 ? 108 GLN A C   1 
ATOM   446  O  O   . GLN A 1 108 ? 7.407   148.864 -27.256 1.00 38.72 ? 108 GLN A O   1 
ATOM   447  C  CB  . GLN A 1 108 ? 6.709   149.891 -24.250 1.00 38.64 ? 108 GLN A CB  1 
ATOM   448  C  CG  . GLN A 1 108 ? 5.376   149.872 -24.978 1.00 42.45 ? 108 GLN A CG  1 
ATOM   449  C  CD  . GLN A 1 108 ? 4.266   150.539 -24.176 1.00 45.46 ? 108 GLN A CD  1 
ATOM   450  O  OE1 . GLN A 1 108 ? 3.862   150.044 -23.120 1.00 46.66 ? 108 GLN A OE1 1 
ATOM   451  N  NE2 . GLN A 1 108 ? 3.774   151.670 -24.672 1.00 46.61 ? 108 GLN A NE2 1 
ATOM   452  N  N   . ARG A 1 109 ? 8.845   150.454 -26.582 1.00 39.10 ? 109 ARG A N   1 
ATOM   453  C  CA  . ARG A 1 109 ? 9.118   150.940 -27.932 1.00 40.67 ? 109 ARG A CA  1 
ATOM   454  C  C   . ARG A 1 109 ? 10.353  150.256 -28.515 1.00 38.87 ? 109 ARG A C   1 
ATOM   455  O  O   . ARG A 1 109 ? 10.745  150.530 -29.648 1.00 38.91 ? 109 ARG A O   1 
ATOM   456  C  CB  . ARG A 1 109 ? 9.326   152.457 -27.899 1.00 43.54 ? 109 ARG A CB  1 
ATOM   457  C  CG  . ARG A 1 109 ? 8.138   153.203 -27.305 1.00 50.55 ? 109 ARG A CG  1 
ATOM   458  C  CD  . ARG A 1 109 ? 8.469   154.625 -26.854 1.00 54.52 ? 109 ARG A CD  1 
ATOM   459  N  NE  . ARG A 1 109 ? 8.589   155.582 -27.952 1.00 58.28 ? 109 ARG A NE  1 
ATOM   460  C  CZ  . ARG A 1 109 ? 9.643   155.680 -28.757 1.00 61.36 ? 109 ARG A CZ  1 
ATOM   461  N  NH1 . ARG A 1 109 ? 10.687  154.876 -28.597 1.00 62.39 ? 109 ARG A NH1 1 
ATOM   462  N  NH2 . ARG A 1 109 ? 9.657   156.595 -29.719 1.00 62.20 ? 109 ARG A NH2 1 
ATOM   463  N  N   . ASP A 1 110 ? 10.952  149.360 -27.732 1.00 36.91 ? 110 ASP A N   1 
ATOM   464  C  CA  . ASP A 1 110 ? 12.151  148.634 -28.140 1.00 35.35 ? 110 ASP A CA  1 
ATOM   465  C  C   . ASP A 1 110 ? 13.160  149.583 -28.785 1.00 35.54 ? 110 ASP A C   1 
ATOM   466  O  O   . ASP A 1 110 ? 13.691  149.314 -29.864 1.00 35.37 ? 110 ASP A O   1 
ATOM   467  C  CB  . ASP A 1 110 ? 11.784  147.500 -29.104 1.00 36.53 ? 110 ASP A CB  1 
ATOM   468  C  CG  . ASP A 1 110 ? 12.963  146.588 -29.419 1.00 37.13 ? 110 ASP A CG  1 
ATOM   469  O  OD1 . ASP A 1 110 ? 13.774  146.312 -28.510 1.00 35.59 ? 110 ASP A OD1 1 
ATOM   470  O  OD2 . ASP A 1 110 ? 13.074  146.133 -30.575 1.00 39.89 ? 110 ASP A OD2 1 
ATOM   471  N  N   . GLU A 1 111 ? 13.419  150.697 -28.106 1.00 34.42 ? 111 GLU A N   1 
ATOM   472  C  CA  . GLU A 1 111 ? 14.355  151.704 -28.588 1.00 33.85 ? 111 GLU A CA  1 
ATOM   473  C  C   . GLU A 1 111 ? 15.804  151.306 -28.320 1.00 33.96 ? 111 GLU A C   1 
ATOM   474  O  O   . GLU A 1 111 ? 16.241  151.275 -27.171 1.00 33.56 ? 111 GLU A O   1 
ATOM   475  C  CB  . GLU A 1 111 ? 14.067  153.046 -27.909 1.00 32.50 ? 111 GLU A CB  1 
ATOM   476  C  CG  . GLU A 1 111 ? 14.908  154.205 -28.426 1.00 32.09 ? 111 GLU A CG  1 
ATOM   477  C  CD  . GLU A 1 111 ? 14.673  155.483 -27.641 1.00 32.61 ? 111 GLU A CD  1 
ATOM   478  O  OE1 . GLU A 1 111 ? 15.526  155.834 -26.799 1.00 31.67 ? 111 GLU A OE1 1 
ATOM   479  O  OE2 . GLU A 1 111 ? 13.626  156.131 -27.857 1.00 33.40 ? 111 GLU A OE2 1 
ATOM   480  N  N   . ARG A 1 112 ? 16.543  151.001 -29.382 1.00 34.50 ? 112 ARG A N   1 
ATOM   481  C  CA  . ARG A 1 112 ? 17.947  150.624 -29.253 1.00 35.28 ? 112 ARG A CA  1 
ATOM   482  C  C   . ARG A 1 112 ? 18.765  151.904 -29.399 1.00 34.47 ? 112 ARG A C   1 
ATOM   483  O  O   . ARG A 1 112 ? 19.279  152.197 -30.476 1.00 36.65 ? 112 ARG A O   1 
ATOM   484  C  CB  . ARG A 1 112 ? 18.352  149.644 -30.361 1.00 36.41 ? 112 ARG A CB  1 
ATOM   485  C  CG  . ARG A 1 112 ? 17.363  148.514 -30.631 1.00 38.52 ? 112 ARG A CG  1 
ATOM   486  C  CD  . ARG A 1 112 ? 17.235  147.558 -29.462 1.00 39.65 ? 112 ARG A CD  1 
ATOM   487  N  NE  . ARG A 1 112 ? 16.326  146.454 -29.766 1.00 40.02 ? 112 ARG A NE  1 
ATOM   488  C  CZ  . ARG A 1 112 ? 16.622  145.430 -30.560 1.00 40.44 ? 112 ARG A CZ  1 
ATOM   489  N  NH1 . ARG A 1 112 ? 17.812  145.351 -31.136 1.00 40.58 ? 112 ARG A NH1 1 
ATOM   490  N  NH2 . ARG A 1 112 ? 15.720  144.483 -30.784 1.00 41.59 ? 112 ARG A NH2 1 
ATOM   491  N  N   . SER A 1 113 ? 18.889  152.663 -28.317 1.00 32.89 ? 113 SER A N   1 
ATOM   492  C  CA  . SER A 1 113 ? 19.625  153.918 -28.364 1.00 30.52 ? 113 SER A CA  1 
ATOM   493  C  C   . SER A 1 113 ? 20.659  154.062 -27.261 1.00 30.15 ? 113 SER A C   1 
ATOM   494  O  O   . SER A 1 113 ? 20.688  153.292 -26.300 1.00 29.63 ? 113 SER A O   1 
ATOM   495  C  CB  . SER A 1 113 ? 18.650  155.087 -28.262 1.00 30.78 ? 113 SER A CB  1 
ATOM   496  O  OG  . SER A 1 113 ? 17.999  155.070 -27.000 1.00 30.82 ? 113 SER A OG  1 
ATOM   497  N  N   . GLU A 1 114 ? 21.501  155.076 -27.406 1.00 28.22 ? 114 GLU A N   1 
ATOM   498  C  CA  . GLU A 1 114 ? 22.532  155.361 -26.427 1.00 28.62 ? 114 GLU A CA  1 
ATOM   499  C  C   . GLU A 1 114 ? 21.881  155.878 -25.146 1.00 27.60 ? 114 GLU A C   1 
ATOM   500  O  O   . GLU A 1 114 ? 22.335  155.564 -24.046 1.00 27.72 ? 114 GLU A O   1 
ATOM   501  C  CB  . GLU A 1 114 ? 23.505  156.399 -26.991 1.00 30.61 ? 114 GLU A CB  1 
ATOM   502  C  CG  . GLU A 1 114 ? 24.603  156.848 -26.036 1.00 34.45 ? 114 GLU A CG  1 
ATOM   503  C  CD  . GLU A 1 114 ? 25.485  155.707 -25.558 1.00 35.90 ? 114 GLU A CD  1 
ATOM   504  O  OE1 . GLU A 1 114 ? 25.738  154.770 -26.345 1.00 36.60 ? 114 GLU A OE1 1 
ATOM   505  O  OE2 . GLU A 1 114 ? 25.939  155.758 -24.396 1.00 35.87 ? 114 GLU A OE2 1 
ATOM   506  N  N   . ARG A 1 115 ? 20.810  156.660 -25.281 1.00 25.74 ? 115 ARG A N   1 
ATOM   507  C  CA  . ARG A 1 115 ? 20.145  157.189 -24.096 1.00 25.94 ? 115 ARG A CA  1 
ATOM   508  C  C   . ARG A 1 115 ? 19.484  156.054 -23.319 1.00 25.02 ? 115 ARG A C   1 
ATOM   509  O  O   . ARG A 1 115 ? 19.486  156.051 -22.088 1.00 24.76 ? 115 ARG A O   1 
ATOM   510  C  CB  . ARG A 1 115 ? 19.113  158.271 -24.465 1.00 25.00 ? 115 ARG A CB  1 
ATOM   511  C  CG  . ARG A 1 115 ? 17.866  157.798 -25.198 1.00 27.96 ? 115 ARG A CG  1 
ATOM   512  C  CD  . ARG A 1 115 ? 16.860  158.950 -25.331 1.00 28.80 ? 115 ARG A CD  1 
ATOM   513  N  NE  . ARG A 1 115 ? 15.652  158.571 -26.063 1.00 29.80 ? 115 ARG A NE  1 
ATOM   514  C  CZ  . ARG A 1 115 ? 14.656  159.407 -26.350 1.00 30.55 ? 115 ARG A CZ  1 
ATOM   515  N  NH1 . ARG A 1 115 ? 14.714  160.675 -25.965 1.00 30.47 ? 115 ARG A NH1 1 
ATOM   516  N  NH2 . ARG A 1 115 ? 13.604  158.980 -27.035 1.00 28.37 ? 115 ARG A NH2 1 
ATOM   517  N  N   . ALA A 1 116 ? 18.926  155.084 -24.036 1.00 24.74 ? 116 ALA A N   1 
ATOM   518  C  CA  . ALA A 1 116 ? 18.295  153.942 -23.381 1.00 25.93 ? 116 ALA A CA  1 
ATOM   519  C  C   . ALA A 1 116 ? 19.380  153.144 -22.654 1.00 25.84 ? 116 ALA A C   1 
ATOM   520  O  O   . ALA A 1 116 ? 19.175  152.671 -21.533 1.00 25.32 ? 116 ALA A O   1 
ATOM   521  C  CB  . ALA A 1 116 ? 17.593  153.060 -24.413 1.00 22.86 ? 116 ALA A CB  1 
ATOM   522  N  N   . PHE A 1 117 ? 20.535  153.006 -23.300 1.00 26.28 ? 117 PHE A N   1 
ATOM   523  C  CA  . PHE A 1 117 ? 21.661  152.275 -22.726 1.00 26.12 ? 117 PHE A CA  1 
ATOM   524  C  C   . PHE A 1 117 ? 22.099  152.899 -21.403 1.00 27.68 ? 117 PHE A C   1 
ATOM   525  O  O   . PHE A 1 117 ? 22.300  152.192 -20.413 1.00 26.37 ? 117 PHE A O   1 
ATOM   526  C  CB  . PHE A 1 117 ? 22.841  152.267 -23.704 1.00 25.19 ? 117 PHE A CB  1 
ATOM   527  C  CG  . PHE A 1 117 ? 24.043  151.509 -23.204 1.00 24.95 ? 117 PHE A CG  1 
ATOM   528  C  CD1 . PHE A 1 117 ? 23.997  150.127 -23.049 1.00 25.48 ? 117 PHE A CD1 1 
ATOM   529  C  CD2 . PHE A 1 117 ? 25.221  152.177 -22.890 1.00 25.31 ? 117 PHE A CD2 1 
ATOM   530  C  CE1 . PHE A 1 117 ? 25.111  149.420 -22.590 1.00 26.66 ? 117 PHE A CE1 1 
ATOM   531  C  CE2 . PHE A 1 117 ? 26.340  151.481 -22.430 1.00 25.35 ? 117 PHE A CE2 1 
ATOM   532  C  CZ  . PHE A 1 117 ? 26.284  150.099 -22.280 1.00 24.72 ? 117 PHE A CZ  1 
ATOM   533  N  N   . LYS A 1 118 ? 22.251  154.222 -21.385 1.00 26.63 ? 118 LYS A N   1 
ATOM   534  C  CA  . LYS A 1 118 ? 22.667  154.907 -20.164 1.00 27.57 ? 118 LYS A CA  1 
ATOM   535  C  C   . LYS A 1 118 ? 21.602  154.763 -19.088 1.00 25.16 ? 118 LYS A C   1 
ATOM   536  O  O   . LYS A 1 118 ? 21.914  154.688 -17.899 1.00 24.96 ? 118 LYS A O   1 
ATOM   537  C  CB  . LYS A 1 118 ? 22.927  156.392 -20.434 1.00 29.87 ? 118 LYS A CB  1 
ATOM   538  C  CG  . LYS A 1 118 ? 24.120  156.664 -21.339 1.00 35.05 ? 118 LYS A CG  1 
ATOM   539  C  CD  . LYS A 1 118 ? 24.336  158.165 -21.518 1.00 39.63 ? 118 LYS A CD  1 
ATOM   540  C  CE  . LYS A 1 118 ? 25.480  158.459 -22.477 1.00 41.53 ? 118 LYS A CE  1 
ATOM   541  N  NZ  . LYS A 1 118 ? 26.770  157.889 -21.988 1.00 46.21 ? 118 LYS A NZ  1 
ATOM   542  N  N   . LEU A 1 119 ? 20.344  154.721 -19.512 1.00 23.33 ? 119 LEU A N   1 
ATOM   543  C  CA  . LEU A 1 119 ? 19.228  154.583 -18.585 1.00 23.89 ? 119 LEU A CA  1 
ATOM   544  C  C   . LEU A 1 119 ? 19.281  153.252 -17.834 1.00 23.60 ? 119 LEU A C   1 
ATOM   545  O  O   . LEU A 1 119 ? 19.020  153.207 -16.626 1.00 22.42 ? 119 LEU A O   1 
ATOM   546  C  CB  . LEU A 1 119 ? 17.902  154.703 -19.339 1.00 23.05 ? 119 LEU A CB  1 
ATOM   547  C  CG  . LEU A 1 119 ? 16.609  154.339 -18.598 1.00 26.18 ? 119 LEU A CG  1 
ATOM   548  C  CD1 . LEU A 1 119 ? 16.354  155.306 -17.451 1.00 26.30 ? 119 LEU A CD1 1 
ATOM   549  C  CD2 . LEU A 1 119 ? 15.450  154.381 -19.585 1.00 28.46 ? 119 LEU A CD2 1 
ATOM   550  N  N   . THR A 1 120 ? 19.615  152.170 -18.537 1.00 23.01 ? 120 THR A N   1 
ATOM   551  C  CA  . THR A 1 120 ? 19.686  150.864 -17.884 1.00 23.45 ? 120 THR A CA  1 
ATOM   552  C  C   . THR A 1 120 ? 20.680  150.885 -16.726 1.00 23.88 ? 120 THR A C   1 
ATOM   553  O  O   . THR A 1 120 ? 20.492  150.185 -15.731 1.00 24.49 ? 120 THR A O   1 
ATOM   554  C  CB  . THR A 1 120 ? 20.073  149.726 -18.874 1.00 23.14 ? 120 THR A CB  1 
ATOM   555  O  OG1 . THR A 1 120 ? 21.405  149.927 -19.366 1.00 22.69 ? 120 THR A OG1 1 
ATOM   556  C  CG2 . THR A 1 120 ? 19.095  149.685 -20.037 1.00 20.52 ? 120 THR A CG2 1 
ATOM   557  N  N   . ARG A 1 121 ? 21.732  151.692 -16.842 1.00 23.50 ? 121 ARG A N   1 
ATOM   558  C  CA  . ARG A 1 121 ? 22.716  151.785 -15.765 1.00 24.93 ? 121 ARG A CA  1 
ATOM   559  C  C   . ARG A 1 121 ? 22.062  152.308 -14.483 1.00 24.76 ? 121 ARG A C   1 
ATOM   560  O  O   . ARG A 1 121 ? 22.373  151.846 -13.383 1.00 21.94 ? 121 ARG A O   1 
ATOM   561  C  CB  . ARG A 1 121 ? 23.870  152.710 -16.158 1.00 28.86 ? 121 ARG A CB  1 
ATOM   562  C  CG  . ARG A 1 121 ? 24.839  152.985 -15.016 1.00 33.31 ? 121 ARG A CG  1 
ATOM   563  C  CD  . ARG A 1 121 ? 25.796  154.115 -15.358 1.00 37.74 ? 121 ARG A CD  1 
ATOM   564  N  NE  . ARG A 1 121 ? 26.935  153.656 -16.140 1.00 42.17 ? 121 ARG A NE  1 
ATOM   565  C  CZ  . ARG A 1 121 ? 28.118  153.344 -15.619 1.00 44.69 ? 121 ARG A CZ  1 
ATOM   566  N  NH1 . ARG A 1 121 ? 28.317  153.448 -14.310 1.00 43.49 ? 121 ARG A NH1 1 
ATOM   567  N  NH2 . ARG A 1 121 ? 29.102  152.925 -16.405 1.00 43.61 ? 121 ARG A NH2 1 
ATOM   568  N  N   . ASP A 1 122 ? 21.163  153.280 -14.619 1.00 24.24 ? 122 ASP A N   1 
ATOM   569  C  CA  . ASP A 1 122 ? 20.483  153.826 -13.450 1.00 23.72 ? 122 ASP A CA  1 
ATOM   570  C  C   . ASP A 1 122 ? 19.458  152.827 -12.923 1.00 21.65 ? 122 ASP A C   1 
ATOM   571  O  O   . ASP A 1 122 ? 19.278  152.692 -11.714 1.00 23.07 ? 122 ASP A O   1 
ATOM   572  C  CB  . ASP A 1 122 ? 19.782  155.152 -13.785 1.00 23.71 ? 122 ASP A CB  1 
ATOM   573  C  CG  . ASP A 1 122 ? 20.760  156.296 -13.998 1.00 26.38 ? 122 ASP A CG  1 
ATOM   574  O  OD1 . ASP A 1 122 ? 21.815  156.317 -13.329 1.00 24.95 ? 122 ASP A OD1 1 
ATOM   575  O  OD2 . ASP A 1 122 ? 20.465  157.184 -14.826 1.00 27.48 ? 122 ASP A OD2 1 
ATOM   576  N  N   . ALA A 1 123 ? 18.782  152.135 -13.833 1.00 21.42 ? 123 ALA A N   1 
ATOM   577  C  CA  . ALA A 1 123 ? 17.787  151.147 -13.439 1.00 21.14 ? 123 ALA A CA  1 
ATOM   578  C  C   . ALA A 1 123 ? 18.472  150.042 -12.639 1.00 22.93 ? 123 ALA A C   1 
ATOM   579  O  O   . ALA A 1 123 ? 17.932  149.552 -11.646 1.00 22.67 ? 123 ALA A O   1 
ATOM   580  C  CB  . ALA A 1 123 ? 17.110  150.565 -14.669 1.00 21.53 ? 123 ALA A CB  1 
ATOM   581  N  N   . ILE A 1 124 ? 19.668  149.662 -13.078 1.00 22.89 ? 124 ILE A N   1 
ATOM   582  C  CA  . ILE A 1 124 ? 20.435  148.625 -12.406 1.00 23.47 ? 124 ILE A CA  1 
ATOM   583  C  C   . ILE A 1 124 ? 20.874  149.073 -11.013 1.00 24.99 ? 124 ILE A C   1 
ATOM   584  O  O   . ILE A 1 124 ? 20.799  148.301 -10.056 1.00 24.34 ? 124 ILE A O   1 
ATOM   585  C  CB  . ILE A 1 124 ? 21.663  148.226 -13.256 1.00 23.57 ? 124 ILE A CB  1 
ATOM   586  C  CG1 . ILE A 1 124 ? 21.186  147.444 -14.487 1.00 23.70 ? 124 ILE A CG1 1 
ATOM   587  C  CG2 . ILE A 1 124 ? 22.639  147.399 -12.434 1.00 21.78 ? 124 ILE A CG2 1 
ATOM   588  C  CD1 . ILE A 1 124 ? 22.278  147.103 -15.480 1.00 24.74 ? 124 ILE A CD1 1 
ATOM   589  N  N   . GLU A 1 125 ? 21.321  150.319 -10.889 1.00 25.94 ? 125 GLU A N   1 
ATOM   590  C  CA  . GLU A 1 125 ? 21.744  150.820 -9.587  1.00 27.22 ? 125 GLU A CA  1 
ATOM   591  C  C   . GLU A 1 125 ? 20.567  150.801 -8.610  1.00 26.07 ? 125 GLU A C   1 
ATOM   592  O  O   . GLU A 1 125 ? 20.747  150.541 -7.423  1.00 27.12 ? 125 GLU A O   1 
ATOM   593  C  CB  . GLU A 1 125 ? 22.312  152.243 -9.709  1.00 30.07 ? 125 GLU A CB  1 
ATOM   594  C  CG  . GLU A 1 125 ? 22.615  152.895 -8.365  1.00 36.10 ? 125 GLU A CG  1 
ATOM   595  C  CD  . GLU A 1 125 ? 23.408  154.189 -8.485  1.00 41.80 ? 125 GLU A CD  1 
ATOM   596  O  OE1 . GLU A 1 125 ? 23.141  154.982 -9.414  1.00 45.65 ? 125 GLU A OE1 1 
ATOM   597  O  OE2 . GLU A 1 125 ? 24.293  154.425 -7.635  1.00 43.85 ? 125 GLU A OE2 1 
ATOM   598  N  N   . LEU A 1 126 ? 19.366  151.069 -9.117  1.00 24.20 ? 126 LEU A N   1 
ATOM   599  C  CA  . LEU A 1 126 ? 18.156  151.079 -8.295  1.00 24.11 ? 126 LEU A CA  1 
ATOM   600  C  C   . LEU A 1 126 ? 17.727  149.673 -7.868  1.00 24.22 ? 126 LEU A C   1 
ATOM   601  O  O   . LEU A 1 126 ? 17.169  149.489 -6.788  1.00 22.82 ? 126 LEU A O   1 
ATOM   602  C  CB  . LEU A 1 126 ? 17.013  151.764 -9.050  1.00 23.96 ? 126 LEU A CB  1 
ATOM   603  C  CG  . LEU A 1 126 ? 17.155  153.281 -9.208  1.00 24.64 ? 126 LEU A CG  1 
ATOM   604  C  CD1 . LEU A 1 126 ? 16.061  153.822 -10.119 1.00 24.57 ? 126 LEU A CD1 1 
ATOM   605  C  CD2 . LEU A 1 126 ? 17.081  153.935 -7.830  1.00 24.38 ? 126 LEU A CD2 1 
ATOM   606  N  N   . ASN A 1 127 ? 17.969  148.690 -8.727  1.00 22.56 ? 127 ASN A N   1 
ATOM   607  C  CA  . ASN A 1 127 ? 17.642  147.300 -8.418  1.00 22.36 ? 127 ASN A CA  1 
ATOM   608  C  C   . ASN A 1 127 ? 18.435  146.392 -9.343  1.00 21.45 ? 127 ASN A C   1 
ATOM   609  O  O   . ASN A 1 127 ? 18.003  146.089 -10.453 1.00 19.65 ? 127 ASN A O   1 
ATOM   610  C  CB  . ASN A 1 127 ? 16.142  147.034 -8.578  1.00 21.34 ? 127 ASN A CB  1 
ATOM   611  C  CG  . ASN A 1 127 ? 15.784  145.575 -8.339  1.00 23.32 ? 127 ASN A CG  1 
ATOM   612  O  OD1 . ASN A 1 127 ? 16.572  144.817 -7.769  1.00 22.65 ? 127 ASN A OD1 1 
ATOM   613  N  ND2 . ASN A 1 127 ? 14.590  145.178 -8.766  1.00 21.74 ? 127 ASN A ND2 1 
ATOM   614  N  N   . ALA A 1 128 ? 19.603  145.966 -8.877  1.00 20.96 ? 128 ALA A N   1 
ATOM   615  C  CA  . ALA A 1 128 ? 20.474  145.112 -9.668  1.00 22.97 ? 128 ALA A CA  1 
ATOM   616  C  C   . ALA A 1 128 ? 19.902  143.716 -9.906  1.00 22.64 ? 128 ALA A C   1 
ATOM   617  O  O   . ALA A 1 128 ? 20.447  142.951 -10.697 1.00 23.81 ? 128 ALA A O   1 
ATOM   618  C  CB  . ALA A 1 128 ? 21.844  145.018 -9.007  1.00 23.66 ? 128 ALA A CB  1 
ATOM   619  N  N   . ALA A 1 129 ? 18.805  143.384 -9.233  1.00 22.85 ? 129 ALA A N   1 
ATOM   620  C  CA  . ALA A 1 129 ? 18.193  142.068 -9.411  1.00 23.57 ? 129 ALA A CA  1 
ATOM   621  C  C   . ALA A 1 129 ? 17.125  142.064 -10.503 1.00 22.78 ? 129 ALA A C   1 
ATOM   622  O  O   . ALA A 1 129 ? 16.468  141.048 -10.723 1.00 22.89 ? 129 ALA A O   1 
ATOM   623  C  CB  . ALA A 1 129 ? 17.589  141.578 -8.093  1.00 21.75 ? 129 ALA A CB  1 
ATOM   624  N  N   . ASN A 1 130 ? 16.937  143.193 -11.182 1.00 21.66 ? 130 ASN A N   1 
ATOM   625  C  CA  . ASN A 1 130 ? 15.933  143.247 -12.244 1.00 21.42 ? 130 ASN A CA  1 
ATOM   626  C  C   . ASN A 1 130 ? 16.548  142.674 -13.515 1.00 21.57 ? 130 ASN A C   1 
ATOM   627  O  O   . ASN A 1 130 ? 17.217  143.383 -14.270 1.00 19.35 ? 130 ASN A O   1 
ATOM   628  C  CB  . ASN A 1 130 ? 15.460  144.682 -12.496 1.00 20.07 ? 130 ASN A CB  1 
ATOM   629  C  CG  . ASN A 1 130 ? 14.262  144.735 -13.425 1.00 20.98 ? 130 ASN A CG  1 
ATOM   630  O  OD1 . ASN A 1 130 ? 14.279  144.145 -14.505 1.00 21.41 ? 130 ASN A OD1 1 
ATOM   631  N  ND2 . ASN A 1 130 ? 13.212  145.436 -13.007 1.00 18.18 ? 130 ASN A ND2 1 
ATOM   632  N  N   . TYR A 1 131 ? 16.307  141.382 -13.733 1.00 19.94 ? 131 TYR A N   1 
ATOM   633  C  CA  . TYR A 1 131 ? 16.837  140.646 -14.878 1.00 19.73 ? 131 TYR A CA  1 
ATOM   634  C  C   . TYR A 1 131 ? 16.329  141.162 -16.222 1.00 19.12 ? 131 TYR A C   1 
ATOM   635  O  O   . TYR A 1 131 ? 16.987  140.990 -17.250 1.00 20.05 ? 131 TYR A O   1 
ATOM   636  C  CB  . TYR A 1 131 ? 16.503  139.158 -14.715 1.00 17.72 ? 131 TYR A CB  1 
ATOM   637  C  CG  . TYR A 1 131 ? 15.022  138.892 -14.593 1.00 17.10 ? 131 TYR A CG  1 
ATOM   638  C  CD1 . TYR A 1 131 ? 14.237  138.705 -15.728 1.00 15.58 ? 131 TYR A CD1 1 
ATOM   639  C  CD2 . TYR A 1 131 ? 14.394  138.884 -13.345 1.00 17.34 ? 131 TYR A CD2 1 
ATOM   640  C  CE1 . TYR A 1 131 ? 12.864  138.523 -15.628 1.00 16.39 ? 131 TYR A CE1 1 
ATOM   641  C  CE2 . TYR A 1 131 ? 13.013  138.703 -13.232 1.00 16.99 ? 131 TYR A CE2 1 
ATOM   642  C  CZ  . TYR A 1 131 ? 12.258  138.527 -14.379 1.00 16.67 ? 131 TYR A CZ  1 
ATOM   643  O  OH  . TYR A 1 131 ? 10.892  138.388 -14.291 1.00 16.33 ? 131 TYR A OH  1 
ATOM   644  N  N   . THR A 1 132 ? 15.158  141.787 -16.222 1.00 18.80 ? 132 THR A N   1 
ATOM   645  C  CA  . THR A 1 132 ? 14.611  142.329 -17.461 1.00 18.51 ? 132 THR A CA  1 
ATOM   646  C  C   . THR A 1 132 ? 15.497  143.483 -17.937 1.00 19.93 ? 132 THR A C   1 
ATOM   647  O  O   . THR A 1 132 ? 15.798  143.599 -19.129 1.00 20.49 ? 132 THR A O   1 
ATOM   648  C  CB  . THR A 1 132 ? 13.170  142.822 -17.262 1.00 19.09 ? 132 THR A CB  1 
ATOM   649  O  OG1 . THR A 1 132 ? 12.325  141.699 -16.978 1.00 18.73 ? 132 THR A OG1 1 
ATOM   650  C  CG2 . THR A 1 132 ? 12.661  143.533 -18.512 1.00 19.56 ? 132 THR A CG2 1 
ATOM   651  N  N   . VAL A 1 133 ? 15.925  144.330 -17.007 1.00 17.70 ? 133 VAL A N   1 
ATOM   652  C  CA  . VAL A 1 133 ? 16.793  145.443 -17.368 1.00 19.86 ? 133 VAL A CA  1 
ATOM   653  C  C   . VAL A 1 133 ? 18.113  144.887 -17.904 1.00 20.76 ? 133 VAL A C   1 
ATOM   654  O  O   . VAL A 1 133 ? 18.597  145.308 -18.957 1.00 20.20 ? 133 VAL A O   1 
ATOM   655  C  CB  . VAL A 1 133 ? 17.081  146.355 -16.149 1.00 18.09 ? 133 VAL A CB  1 
ATOM   656  C  CG1 . VAL A 1 133 ? 18.090  147.441 -16.530 1.00 19.55 ? 133 VAL A CG1 1 
ATOM   657  C  CG2 . VAL A 1 133 ? 15.787  146.997 -15.668 1.00 17.56 ? 133 VAL A CG2 1 
ATOM   658  N  N   . TRP A 1 134 ? 18.692  143.934 -17.179 1.00 21.03 ? 134 TRP A N   1 
ATOM   659  C  CA  . TRP A 1 134 ? 19.951  143.330 -17.599 1.00 22.45 ? 134 TRP A CA  1 
ATOM   660  C  C   . TRP A 1 134 ? 19.871  142.752 -19.007 1.00 23.22 ? 134 TRP A C   1 
ATOM   661  O  O   . TRP A 1 134 ? 20.790  142.927 -19.808 1.00 23.63 ? 134 TRP A O   1 
ATOM   662  C  CB  . TRP A 1 134 ? 20.377  142.234 -16.618 1.00 21.16 ? 134 TRP A CB  1 
ATOM   663  C  CG  . TRP A 1 134 ? 21.019  142.771 -15.375 1.00 20.46 ? 134 TRP A CG  1 
ATOM   664  C  CD1 . TRP A 1 134 ? 20.489  142.793 -14.115 1.00 20.62 ? 134 TRP A CD1 1 
ATOM   665  C  CD2 . TRP A 1 134 ? 22.319  143.359 -15.275 1.00 20.29 ? 134 TRP A CD2 1 
ATOM   666  N  NE1 . TRP A 1 134 ? 21.385  143.355 -13.234 1.00 20.47 ? 134 TRP A NE1 1 
ATOM   667  C  CE2 . TRP A 1 134 ? 22.516  143.712 -13.921 1.00 19.76 ? 134 TRP A CE2 1 
ATOM   668  C  CE3 . TRP A 1 134 ? 23.341  143.624 -16.200 1.00 21.56 ? 134 TRP A CE3 1 
ATOM   669  C  CZ2 . TRP A 1 134 ? 23.694  144.314 -13.466 1.00 19.98 ? 134 TRP A CZ2 1 
ATOM   670  C  CZ3 . TRP A 1 134 ? 24.513  144.225 -15.746 1.00 20.51 ? 134 TRP A CZ3 1 
ATOM   671  C  CH2 . TRP A 1 134 ? 24.677  144.562 -14.390 1.00 20.16 ? 134 TRP A CH2 1 
ATOM   672  N  N   . HIS A 1 135 ? 18.774  142.060 -19.305 1.00 23.39 ? 135 HIS A N   1 
ATOM   673  C  CA  . HIS A 1 135 ? 18.592  141.466 -20.623 1.00 24.62 ? 135 HIS A CA  1 
ATOM   674  C  C   . HIS A 1 135 ? 18.585  142.555 -21.689 1.00 25.17 ? 135 HIS A C   1 
ATOM   675  O  O   . HIS A 1 135 ? 19.256  142.444 -22.716 1.00 24.65 ? 135 HIS A O   1 
ATOM   676  C  CB  . HIS A 1 135 ? 17.272  140.698 -20.695 1.00 27.70 ? 135 HIS A CB  1 
ATOM   677  C  CG  . HIS A 1 135 ? 16.967  140.160 -22.059 1.00 31.51 ? 135 HIS A CG  1 
ATOM   678  N  ND1 . HIS A 1 135 ? 17.588  139.042 -22.574 1.00 34.44 ? 135 HIS A ND1 1 
ATOM   679  C  CD2 . HIS A 1 135 ? 16.153  140.620 -23.037 1.00 31.37 ? 135 HIS A CD2 1 
ATOM   680  C  CE1 . HIS A 1 135 ? 17.170  138.838 -23.811 1.00 33.44 ? 135 HIS A CE1 1 
ATOM   681  N  NE2 . HIS A 1 135 ? 16.298  139.782 -24.115 1.00 35.06 ? 135 HIS A NE2 1 
ATOM   682  N  N   . PHE A 1 136 ? 17.809  143.605 -21.444 1.00 23.30 ? 136 PHE A N   1 
ATOM   683  C  CA  . PHE A 1 136 ? 17.721  144.705 -22.390 1.00 24.44 ? 136 PHE A CA  1 
ATOM   684  C  C   . PHE A 1 136 ? 19.088  145.350 -22.591 1.00 22.64 ? 136 PHE A C   1 
ATOM   685  O  O   . PHE A 1 136 ? 19.455  145.694 -23.714 1.00 23.87 ? 136 PHE A O   1 
ATOM   686  C  CB  . PHE A 1 136 ? 16.717  145.755 -21.902 1.00 24.46 ? 136 PHE A CB  1 
ATOM   687  C  CG  . PHE A 1 136 ? 16.329  146.755 -22.957 1.00 26.75 ? 136 PHE A CG  1 
ATOM   688  C  CD1 . PHE A 1 136 ? 15.706  146.338 -24.132 1.00 27.90 ? 136 PHE A CD1 1 
ATOM   689  C  CD2 . PHE A 1 136 ? 16.591  148.108 -22.783 1.00 26.60 ? 136 PHE A CD2 1 
ATOM   690  C  CE1 . PHE A 1 136 ? 15.348  147.259 -25.121 1.00 29.36 ? 136 PHE A CE1 1 
ATOM   691  C  CE2 . PHE A 1 136 ? 16.238  149.038 -23.763 1.00 27.73 ? 136 PHE A CE2 1 
ATOM   692  C  CZ  . PHE A 1 136 ? 15.616  148.613 -24.933 1.00 27.25 ? 136 PHE A CZ  1 
ATOM   693  N  N   . ARG A 1 137 ? 19.848  145.506 -21.509 1.00 21.61 ? 137 ARG A N   1 
ATOM   694  C  CA  . ARG A 1 137 ? 21.168  146.115 -21.615 1.00 23.36 ? 137 ARG A CA  1 
ATOM   695  C  C   . ARG A 1 137 ? 22.044  145.303 -22.568 1.00 24.15 ? 137 ARG A C   1 
ATOM   696  O  O   . ARG A 1 137 ? 22.766  145.871 -23.383 1.00 25.02 ? 137 ARG A O   1 
ATOM   697  C  CB  . ARG A 1 137 ? 21.840  146.215 -20.238 1.00 21.65 ? 137 ARG A CB  1 
ATOM   698  C  CG  . ARG A 1 137 ? 23.140  147.035 -20.241 1.00 22.86 ? 137 ARG A CG  1 
ATOM   699  C  CD  . ARG A 1 137 ? 23.795  147.062 -18.863 1.00 23.03 ? 137 ARG A CD  1 
ATOM   700  N  NE  . ARG A 1 137 ? 25.083  147.757 -18.850 1.00 22.76 ? 137 ARG A NE  1 
ATOM   701  C  CZ  . ARG A 1 137 ? 25.233  149.079 -18.888 1.00 25.42 ? 137 ARG A CZ  1 
ATOM   702  N  NH1 . ARG A 1 137 ? 24.171  149.878 -18.942 1.00 24.02 ? 137 ARG A NH1 1 
ATOM   703  N  NH2 . ARG A 1 137 ? 26.452  149.605 -18.863 1.00 24.43 ? 137 ARG A NH2 1 
ATOM   704  N  N   . ARG A 1 138 ? 21.973  143.976 -22.469 1.00 23.81 ? 138 ARG A N   1 
ATOM   705  C  CA  . ARG A 1 138 ? 22.756  143.108 -23.347 1.00 24.46 ? 138 ARG A CA  1 
ATOM   706  C  C   . ARG A 1 138 ? 22.286  143.249 -24.797 1.00 25.31 ? 138 ARG A C   1 
ATOM   707  O  O   . ARG A 1 138 ? 23.092  143.198 -25.725 1.00 26.24 ? 138 ARG A O   1 
ATOM   708  C  CB  . ARG A 1 138 ? 22.660  141.643 -22.891 1.00 23.10 ? 138 ARG A CB  1 
ATOM   709  C  CG  . ARG A 1 138 ? 23.493  141.332 -21.645 1.00 23.79 ? 138 ARG A CG  1 
ATOM   710  C  CD  . ARG A 1 138 ? 23.633  139.827 -21.392 1.00 22.41 ? 138 ARG A CD  1 
ATOM   711  N  NE  . ARG A 1 138 ? 22.433  139.218 -20.816 1.00 22.59 ? 138 ARG A NE  1 
ATOM   712  C  CZ  . ARG A 1 138 ? 22.072  139.326 -19.538 1.00 21.71 ? 138 ARG A CZ  1 
ATOM   713  N  NH1 . ARG A 1 138 ? 22.815  140.022 -18.683 1.00 19.48 ? 138 ARG A NH1 1 
ATOM   714  N  NH2 . ARG A 1 138 ? 20.965  138.734 -19.113 1.00 19.53 ? 138 ARG A NH2 1 
ATOM   715  N  N   . VAL A 1 139 ? 20.982  143.430 -24.991 1.00 25.11 ? 139 VAL A N   1 
ATOM   716  C  CA  . VAL A 1 139 ? 20.440  143.616 -26.334 1.00 26.29 ? 139 VAL A CA  1 
ATOM   717  C  C   . VAL A 1 139 ? 21.035  144.906 -26.914 1.00 26.54 ? 139 VAL A C   1 
ATOM   718  O  O   . VAL A 1 139 ? 21.385  144.965 -28.096 1.00 26.09 ? 139 VAL A O   1 
ATOM   719  C  CB  . VAL A 1 139 ? 18.895  143.745 -26.310 1.00 27.20 ? 139 VAL A CB  1 
ATOM   720  C  CG1 . VAL A 1 139 ? 18.385  144.178 -27.679 1.00 26.77 ? 139 VAL A CG1 1 
ATOM   721  C  CG2 . VAL A 1 139 ? 18.265  142.413 -25.905 1.00 26.37 ? 139 VAL A CG2 1 
ATOM   722  N  N   . LEU A 1 140 ? 21.155  145.928 -26.069 1.00 26.76 ? 140 LEU A N   1 
ATOM   723  C  CA  . LEU A 1 140 ? 21.710  147.218 -26.478 1.00 26.36 ? 140 LEU A CA  1 
ATOM   724  C  C   . LEU A 1 140 ? 23.214  147.134 -26.731 1.00 27.08 ? 140 LEU A C   1 
ATOM   725  O  O   . LEU A 1 140 ? 23.722  147.737 -27.678 1.00 25.42 ? 140 LEU A O   1 
ATOM   726  C  CB  . LEU A 1 140 ? 21.426  148.284 -25.412 1.00 25.87 ? 140 LEU A CB  1 
ATOM   727  C  CG  . LEU A 1 140 ? 19.956  148.654 -25.187 1.00 28.01 ? 140 LEU A CG  1 
ATOM   728  C  CD1 . LEU A 1 140 ? 19.834  149.624 -24.017 1.00 27.85 ? 140 LEU A CD1 1 
ATOM   729  C  CD2 . LEU A 1 140 ? 19.383  149.272 -26.454 1.00 28.40 ? 140 LEU A CD2 1 
ATOM   730  N  N   . LEU A 1 141 ? 23.928  146.398 -25.882 1.00 27.55 ? 141 LEU A N   1 
ATOM   731  C  CA  . LEU A 1 141 ? 25.371  146.241 -26.051 1.00 29.08 ? 141 LEU A CA  1 
ATOM   732  C  C   . LEU A 1 141 ? 25.681  145.755 -27.464 1.00 30.46 ? 141 LEU A C   1 
ATOM   733  O  O   . LEU A 1 141 ? 26.639  146.205 -28.097 1.00 29.57 ? 141 LEU A O   1 
ATOM   734  C  CB  . LEU A 1 141 ? 25.928  145.230 -25.043 1.00 27.83 ? 141 LEU A CB  1 
ATOM   735  C  CG  . LEU A 1 141 ? 26.161  145.687 -23.603 1.00 28.22 ? 141 LEU A CG  1 
ATOM   736  C  CD1 . LEU A 1 141 ? 26.500  144.480 -22.737 1.00 27.85 ? 141 LEU A CD1 1 
ATOM   737  C  CD2 . LEU A 1 141 ? 27.291  146.708 -23.564 1.00 24.58 ? 141 LEU A CD2 1 
ATOM   738  N  N   . LYS A 1 142 ? 24.860  144.831 -27.953 1.00 32.16 ? 142 LYS A N   1 
ATOM   739  C  CA  . LYS A 1 142 ? 25.049  144.283 -29.286 1.00 34.12 ? 142 LYS A CA  1 
ATOM   740  C  C   . LYS A 1 142 ? 24.561  145.244 -30.372 1.00 33.42 ? 142 LYS A C   1 
ATOM   741  O  O   . LYS A 1 142 ? 25.289  145.530 -31.321 1.00 33.02 ? 142 LYS A O   1 
ATOM   742  C  CB  . LYS A 1 142 ? 24.330  142.935 -29.406 1.00 36.96 ? 142 LYS A CB  1 
ATOM   743  C  CG  . LYS A 1 142 ? 24.656  142.195 -30.689 1.00 42.07 ? 142 LYS A CG  1 
ATOM   744  C  CD  . LYS A 1 142 ? 24.102  140.778 -30.698 1.00 45.27 ? 142 LYS A CD  1 
ATOM   745  C  CE  . LYS A 1 142 ? 24.515  140.049 -31.975 1.00 47.37 ? 142 LYS A CE  1 
ATOM   746  N  NZ  . LYS A 1 142 ? 24.035  138.637 -32.012 1.00 50.38 ? 142 LYS A NZ  1 
ATOM   747  N  N   . SER A 1 143 ? 23.338  145.746 -30.227 1.00 32.83 ? 143 SER A N   1 
ATOM   748  C  CA  . SER A 1 143 ? 22.767  146.673 -31.204 1.00 33.12 ? 143 SER A CA  1 
ATOM   749  C  C   . SER A 1 143 ? 23.613  147.927 -31.412 1.00 33.55 ? 143 SER A C   1 
ATOM   750  O  O   . SER A 1 143 ? 23.754  148.408 -32.535 1.00 33.53 ? 143 SER A O   1 
ATOM   751  C  CB  . SER A 1 143 ? 21.360  147.099 -30.778 1.00 33.57 ? 143 SER A CB  1 
ATOM   752  O  OG  . SER A 1 143 ? 20.458  146.011 -30.822 1.00 38.06 ? 143 SER A OG  1 
ATOM   753  N  N   . LEU A 1 144 ? 24.170  148.458 -30.329 1.00 32.99 ? 144 LEU A N   1 
ATOM   754  C  CA  . LEU A 1 144 ? 24.981  149.666 -30.406 1.00 32.37 ? 144 LEU A CA  1 
ATOM   755  C  C   . LEU A 1 144 ? 26.458  149.360 -30.582 1.00 33.10 ? 144 LEU A C   1 
ATOM   756  O  O   . LEU A 1 144 ? 27.277  150.275 -30.681 1.00 31.92 ? 144 LEU A O   1 
ATOM   757  C  CB  . LEU A 1 144 ? 24.786  150.510 -29.145 1.00 31.34 ? 144 LEU A CB  1 
ATOM   758  C  CG  . LEU A 1 144 ? 23.350  150.955 -28.848 1.00 30.99 ? 144 LEU A CG  1 
ATOM   759  C  CD1 . LEU A 1 144 ? 23.278  151.575 -27.461 1.00 31.24 ? 144 LEU A CD1 1 
ATOM   760  C  CD2 . LEU A 1 144 ? 22.892  151.941 -29.905 1.00 29.12 ? 144 LEU A CD2 1 
ATOM   761  N  N   . GLN A 1 145 ? 26.798  148.076 -30.621 1.00 34.05 ? 145 GLN A N   1 
ATOM   762  C  CA  . GLN A 1 145 ? 28.189  147.663 -30.778 1.00 35.53 ? 145 GLN A CA  1 
ATOM   763  C  C   . GLN A 1 145 ? 29.076  148.361 -29.753 1.00 35.17 ? 145 GLN A C   1 
ATOM   764  O  O   . GLN A 1 145 ? 30.114  148.927 -30.097 1.00 35.64 ? 145 GLN A O   1 
ATOM   765  C  CB  . GLN A 1 145 ? 28.683  147.982 -32.193 1.00 37.71 ? 145 GLN A CB  1 
ATOM   766  C  CG  . GLN A 1 145 ? 27.986  147.185 -33.285 1.00 42.72 ? 145 GLN A CG  1 
ATOM   767  C  CD  . GLN A 1 145 ? 28.589  147.423 -34.659 1.00 48.10 ? 145 GLN A CD  1 
ATOM   768  O  OE1 . GLN A 1 145 ? 29.784  147.203 -34.872 1.00 50.34 ? 145 GLN A OE1 1 
ATOM   769  N  NE2 . GLN A 1 145 ? 27.763  147.873 -35.601 1.00 47.79 ? 145 GLN A NE2 1 
ATOM   770  N  N   . LYS A 1 146 ? 28.660  148.316 -28.492 1.00 33.96 ? 146 LYS A N   1 
ATOM   771  C  CA  . LYS A 1 146 ? 29.408  148.944 -27.412 1.00 33.93 ? 146 LYS A CA  1 
ATOM   772  C  C   . LYS A 1 146 ? 30.724  148.219 -27.157 1.00 34.45 ? 146 LYS A C   1 
ATOM   773  O  O   . LYS A 1 146 ? 30.844  147.021 -27.407 1.00 34.66 ? 146 LYS A O   1 
ATOM   774  C  CB  . LYS A 1 146 ? 28.576  148.947 -26.127 1.00 32.85 ? 146 LYS A CB  1 
ATOM   775  C  CG  . LYS A 1 146 ? 27.221  149.629 -26.252 1.00 33.97 ? 146 LYS A CG  1 
ATOM   776  C  CD  . LYS A 1 146 ? 27.353  151.106 -26.604 1.00 35.04 ? 146 LYS A CD  1 
ATOM   777  C  CE  . LYS A 1 146 ? 28.106  151.871 -25.530 1.00 35.89 ? 146 LYS A CE  1 
ATOM   778  N  NZ  . LYS A 1 146 ? 28.170  153.328 -25.832 1.00 36.02 ? 146 LYS A NZ  1 
ATOM   779  N  N   . ASP A 1 147 ? 31.712  148.954 -26.656 1.00 33.89 ? 147 ASP A N   1 
ATOM   780  C  CA  . ASP A 1 147 ? 33.013  148.373 -26.358 1.00 34.96 ? 147 ASP A CA  1 
ATOM   781  C  C   . ASP A 1 147 ? 32.852  147.429 -25.166 1.00 33.67 ? 147 ASP A C   1 
ATOM   782  O  O   . ASP A 1 147 ? 32.585  147.872 -24.049 1.00 33.29 ? 147 ASP A O   1 
ATOM   783  C  CB  . ASP A 1 147 ? 34.014  149.476 -26.019 1.00 36.73 ? 147 ASP A CB  1 
ATOM   784  C  CG  . ASP A 1 147 ? 35.434  148.963 -25.931 1.00 40.44 ? 147 ASP A CG  1 
ATOM   785  O  OD1 . ASP A 1 147 ? 35.706  148.095 -25.075 1.00 39.57 ? 147 ASP A OD1 1 
ATOM   786  O  OD2 . ASP A 1 147 ? 36.280  149.427 -26.725 1.00 44.67 ? 147 ASP A OD2 1 
ATOM   787  N  N   . LEU A 1 148 ? 33.020  146.132 -25.408 1.00 32.45 ? 148 LEU A N   1 
ATOM   788  C  CA  . LEU A 1 148 ? 32.864  145.136 -24.355 1.00 30.52 ? 148 LEU A CA  1 
ATOM   789  C  C   . LEU A 1 148 ? 33.909  145.199 -23.246 1.00 30.96 ? 148 LEU A C   1 
ATOM   790  O  O   . LEU A 1 148 ? 33.636  144.798 -22.117 1.00 30.87 ? 148 LEU A O   1 
ATOM   791  C  CB  . LEU A 1 148 ? 32.817  143.735 -24.972 1.00 28.72 ? 148 LEU A CB  1 
ATOM   792  C  CG  . LEU A 1 148 ? 31.655  143.561 -25.957 1.00 26.85 ? 148 LEU A CG  1 
ATOM   793  C  CD1 . LEU A 1 148 ? 31.620  142.143 -26.487 1.00 28.10 ? 148 LEU A CD1 1 
ATOM   794  C  CD2 . LEU A 1 148 ? 30.343  143.900 -25.263 1.00 27.66 ? 148 LEU A CD2 1 
ATOM   795  N  N   . HIS A 1 149 ? 35.103  145.696 -23.549 1.00 30.56 ? 149 HIS A N   1 
ATOM   796  C  CA  . HIS A 1 149 ? 36.129  145.808 -22.518 1.00 31.30 ? 149 HIS A CA  1 
ATOM   797  C  C   . HIS A 1 149 ? 35.708  146.911 -21.561 1.00 31.46 ? 149 HIS A C   1 
ATOM   798  O  O   . HIS A 1 149 ? 36.012  146.873 -20.370 1.00 31.82 ? 149 HIS A O   1 
ATOM   799  C  CB  . HIS A 1 149 ? 37.492  146.127 -23.140 1.00 33.92 ? 149 HIS A CB  1 
ATOM   800  C  CG  . HIS A 1 149 ? 38.088  144.979 -23.891 1.00 37.48 ? 149 HIS A CG  1 
ATOM   801  N  ND1 . HIS A 1 149 ? 38.406  143.781 -23.285 1.00 37.53 ? 149 HIS A ND1 1 
ATOM   802  C  CD2 . HIS A 1 149 ? 38.386  144.827 -25.203 1.00 39.15 ? 149 HIS A CD2 1 
ATOM   803  C  CE1 . HIS A 1 149 ? 38.871  142.941 -24.192 1.00 38.75 ? 149 HIS A CE1 1 
ATOM   804  N  NE2 . HIS A 1 149 ? 38.869  143.551 -25.364 1.00 40.32 ? 149 HIS A NE2 1 
ATOM   805  N  N   . GLU A 1 150 ? 34.992  147.894 -22.090 1.00 32.17 ? 150 GLU A N   1 
ATOM   806  C  CA  . GLU A 1 150 ? 34.507  148.994 -21.273 1.00 32.98 ? 150 GLU A CA  1 
ATOM   807  C  C   . GLU A 1 150 ? 33.415  148.422 -20.362 1.00 30.24 ? 150 GLU A C   1 
ATOM   808  O  O   . GLU A 1 150 ? 33.358  148.726 -19.171 1.00 27.29 ? 150 GLU A O   1 
ATOM   809  C  CB  . GLU A 1 150 ? 33.926  150.094 -22.166 1.00 36.91 ? 150 GLU A CB  1 
ATOM   810  C  CG  . GLU A 1 150 ? 33.965  151.480 -21.554 1.00 45.11 ? 150 GLU A CG  1 
ATOM   811  C  CD  . GLU A 1 150 ? 35.377  152.048 -21.495 1.00 50.38 ? 150 GLU A CD  1 
ATOM   812  O  OE1 . GLU A 1 150 ? 35.551  153.177 -20.983 1.00 53.23 ? 150 GLU A OE1 1 
ATOM   813  O  OE2 . GLU A 1 150 ? 36.315  151.366 -21.965 1.00 52.93 ? 150 GLU A OE2 1 
ATOM   814  N  N   . GLU A 1 151 ? 32.552  147.585 -20.932 1.00 29.33 ? 151 GLU A N   1 
ATOM   815  C  CA  . GLU A 1 151 ? 31.473  146.970 -20.165 1.00 28.97 ? 151 GLU A CA  1 
ATOM   816  C  C   . GLU A 1 151 ? 32.062  146.057 -19.090 1.00 28.32 ? 151 GLU A C   1 
ATOM   817  O  O   . GLU A 1 151 ? 31.494  145.912 -18.010 1.00 27.83 ? 151 GLU A O   1 
ATOM   818  C  CB  . GLU A 1 151 ? 30.544  146.170 -21.088 1.00 28.86 ? 151 GLU A CB  1 
ATOM   819  C  CG  . GLU A 1 151 ? 29.333  145.544 -20.382 1.00 27.92 ? 151 GLU A CG  1 
ATOM   820  C  CD  . GLU A 1 151 ? 28.311  146.570 -19.900 1.00 28.03 ? 151 GLU A CD  1 
ATOM   821  O  OE1 . GLU A 1 151 ? 28.580  147.784 -20.002 1.00 25.89 ? 151 GLU A OE1 1 
ATOM   822  O  OE2 . GLU A 1 151 ? 27.233  146.159 -19.413 1.00 25.96 ? 151 GLU A OE2 1 
ATOM   823  N  N   . MET A 1 152 ? 33.205  145.446 -19.386 1.00 28.60 ? 152 MET A N   1 
ATOM   824  C  CA  . MET A 1 152 ? 33.857  144.568 -18.420 1.00 29.18 ? 152 MET A CA  1 
ATOM   825  C  C   . MET A 1 152 ? 34.286  145.360 -17.189 1.00 29.02 ? 152 MET A C   1 
ATOM   826  O  O   . MET A 1 152 ? 34.168  144.874 -16.062 1.00 27.59 ? 152 MET A O   1 
ATOM   827  C  CB  . MET A 1 152 ? 35.079  143.881 -19.046 1.00 29.96 ? 152 MET A CB  1 
ATOM   828  C  CG  . MET A 1 152 ? 34.774  142.566 -19.763 1.00 33.20 ? 152 MET A CG  1 
ATOM   829  S  SD  . MET A 1 152 ? 34.300  141.214 -18.632 1.00 35.39 ? 152 MET A SD  1 
ATOM   830  C  CE  . MET A 1 152 ? 35.904  140.685 -18.054 1.00 34.99 ? 152 MET A CE  1 
ATOM   831  N  N   . ASN A 1 153 ? 34.781  146.579 -17.406 1.00 28.41 ? 153 ASN A N   1 
ATOM   832  C  CA  . ASN A 1 153 ? 35.215  147.423 -16.295 1.00 28.03 ? 153 ASN A CA  1 
ATOM   833  C  C   . ASN A 1 153 ? 34.006  147.794 -15.451 1.00 25.86 ? 153 ASN A C   1 
ATOM   834  O  O   . ASN A 1 153 ? 34.095  147.917 -14.229 1.00 25.90 ? 153 ASN A O   1 
ATOM   835  C  CB  . ASN A 1 153 ? 35.885  148.708 -16.801 1.00 30.05 ? 153 ASN A CB  1 
ATOM   836  C  CG  . ASN A 1 153 ? 37.135  148.440 -17.615 1.00 33.76 ? 153 ASN A CG  1 
ATOM   837  O  OD1 . ASN A 1 153 ? 37.865  147.482 -17.362 1.00 35.11 ? 153 ASN A OD1 1 
ATOM   838  N  ND2 . ASN A 1 153 ? 37.401  149.305 -18.589 1.00 34.58 ? 153 ASN A ND2 1 
ATOM   839  N  N   . TYR A 1 154 ? 32.875  147.983 -16.119 1.00 24.75 ? 154 TYR A N   1 
ATOM   840  C  CA  . TYR A 1 154 ? 31.634  148.330 -15.444 1.00 24.09 ? 154 TYR A CA  1 
ATOM   841  C  C   . TYR A 1 154 ? 31.152  147.172 -14.562 1.00 24.27 ? 154 TYR A C   1 
ATOM   842  O  O   . TYR A 1 154 ? 30.880  147.356 -13.373 1.00 21.57 ? 154 TYR A O   1 
ATOM   843  C  CB  . TYR A 1 154 ? 30.559  148.673 -16.481 1.00 23.41 ? 154 TYR A CB  1 
ATOM   844  C  CG  . TYR A 1 154 ? 29.156  148.748 -15.914 1.00 25.35 ? 154 TYR A CG  1 
ATOM   845  C  CD1 . TYR A 1 154 ? 28.800  149.747 -15.009 1.00 24.89 ? 154 TYR A CD1 1 
ATOM   846  C  CD2 . TYR A 1 154 ? 28.187  147.810 -16.274 1.00 25.65 ? 154 TYR A CD2 1 
ATOM   847  C  CE1 . TYR A 1 154 ? 27.513  149.814 -14.475 1.00 25.87 ? 154 TYR A CE1 1 
ATOM   848  C  CE2 . TYR A 1 154 ? 26.895  147.866 -15.746 1.00 25.98 ? 154 TYR A CE2 1 
ATOM   849  C  CZ  . TYR A 1 154 ? 26.567  148.871 -14.847 1.00 26.96 ? 154 TYR A CZ  1 
ATOM   850  O  OH  . TYR A 1 154 ? 25.297  148.936 -14.319 1.00 25.34 ? 154 TYR A OH  1 
ATOM   851  N  N   . ILE A 1 155 ? 31.064  145.976 -15.144 1.00 23.46 ? 155 ILE A N   1 
ATOM   852  C  CA  . ILE A 1 155 ? 30.586  144.817 -14.398 1.00 23.58 ? 155 ILE A CA  1 
ATOM   853  C  C   . ILE A 1 155 ? 31.502  144.485 -13.225 1.00 25.14 ? 155 ILE A C   1 
ATOM   854  O  O   . ILE A 1 155 ? 31.046  143.989 -12.189 1.00 23.09 ? 155 ILE A O   1 
ATOM   855  C  CB  . ILE A 1 155 ? 30.425  143.579 -15.322 1.00 24.58 ? 155 ILE A CB  1 
ATOM   856  C  CG1 . ILE A 1 155 ? 29.508  142.548 -14.654 1.00 24.24 ? 155 ILE A CG1 1 
ATOM   857  C  CG2 . ILE A 1 155 ? 31.788  142.951 -15.621 1.00 23.73 ? 155 ILE A CG2 1 
ATOM   858  C  CD1 . ILE A 1 155 ? 28.125  143.081 -14.301 1.00 24.61 ? 155 ILE A CD1 1 
ATOM   859  N  N   . THR A 1 156 ? 32.790  144.779 -13.382 1.00 25.44 ? 156 THR A N   1 
ATOM   860  C  CA  . THR A 1 156 ? 33.771  144.530 -12.331 1.00 25.48 ? 156 THR A CA  1 
ATOM   861  C  C   . THR A 1 156 ? 33.425  145.364 -11.097 1.00 26.01 ? 156 THR A C   1 
ATOM   862  O  O   . THR A 1 156 ? 33.437  144.862 -9.969  1.00 24.63 ? 156 THR A O   1 
ATOM   863  C  CB  . THR A 1 156 ? 35.203  144.891 -12.807 1.00 26.69 ? 156 THR A CB  1 
ATOM   864  O  OG1 . THR A 1 156 ? 35.609  143.979 -13.837 1.00 25.99 ? 156 THR A OG1 1 
ATOM   865  C  CG2 . THR A 1 156 ? 36.196  144.816 -11.652 1.00 25.31 ? 156 THR A CG2 1 
ATOM   866  N  N   . ALA A 1 157 ? 33.114  146.638 -11.316 1.00 25.61 ? 157 ALA A N   1 
ATOM   867  C  CA  . ALA A 1 157 ? 32.758  147.534 -10.223 1.00 25.54 ? 157 ALA A CA  1 
ATOM   868  C  C   . ALA A 1 157 ? 31.426  147.114 -9.596  1.00 25.55 ? 157 ALA A C   1 
ATOM   869  O  O   . ALA A 1 157 ? 31.269  147.132 -8.376  1.00 26.03 ? 157 ALA A O   1 
ATOM   870  C  CB  . ALA A 1 157 ? 32.669  148.965 -10.731 1.00 23.60 ? 157 ALA A CB  1 
ATOM   871  N  N   . ILE A 1 158 ? 30.470  146.734 -10.435 1.00 25.52 ? 158 ILE A N   1 
ATOM   872  C  CA  . ILE A 1 158 ? 29.160  146.315 -9.951  1.00 26.63 ? 158 ILE A CA  1 
ATOM   873  C  C   . ILE A 1 158 ? 29.232  145.076 -9.057  1.00 25.49 ? 158 ILE A C   1 
ATOM   874  O  O   . ILE A 1 158 ? 28.636  145.047 -7.979  1.00 24.49 ? 158 ILE A O   1 
ATOM   875  C  CB  . ILE A 1 158 ? 28.202  146.030 -11.127 1.00 28.56 ? 158 ILE A CB  1 
ATOM   876  C  CG1 . ILE A 1 158 ? 27.943  147.322 -11.906 1.00 31.00 ? 158 ILE A CG1 1 
ATOM   877  C  CG2 . ILE A 1 158 ? 26.892  145.440 -10.610 1.00 30.16 ? 158 ILE A CG2 1 
ATOM   878  C  CD1 . ILE A 1 158 ? 27.363  148.450 -11.064 1.00 31.61 ? 158 ILE A CD1 1 
ATOM   879  N  N   . ILE A 1 159 ? 29.954  144.052 -9.504  1.00 24.05 ? 159 ILE A N   1 
ATOM   880  C  CA  . ILE A 1 159 ? 30.086  142.828 -8.719  1.00 23.20 ? 159 ILE A CA  1 
ATOM   881  C  C   . ILE A 1 159 ? 30.802  143.113 -7.393  1.00 24.98 ? 159 ILE A C   1 
ATOM   882  O  O   . ILE A 1 159 ? 30.452  142.540 -6.359  1.00 24.18 ? 159 ILE A O   1 
ATOM   883  C  CB  . ILE A 1 159 ? 30.850  141.734 -9.510  1.00 21.38 ? 159 ILE A CB  1 
ATOM   884  C  CG1 . ILE A 1 159 ? 30.045  141.339 -10.750 1.00 19.09 ? 159 ILE A CG1 1 
ATOM   885  C  CG2 . ILE A 1 159 ? 31.083  140.509 -8.627  1.00 20.81 ? 159 ILE A CG2 1 
ATOM   886  C  CD1 . ILE A 1 159 ? 30.751  140.351 -11.665 1.00 17.51 ? 159 ILE A CD1 1 
ATOM   887  N  N   . GLU A 1 160 ? 31.797  143.999 -7.417  1.00 25.05 ? 160 GLU A N   1 
ATOM   888  C  CA  . GLU A 1 160 ? 32.515  144.348 -6.191  1.00 28.78 ? 160 GLU A CA  1 
ATOM   889  C  C   . GLU A 1 160 ? 31.525  144.905 -5.163  1.00 29.58 ? 160 GLU A C   1 
ATOM   890  O  O   . GLU A 1 160 ? 31.640  144.640 -3.967  1.00 29.36 ? 160 GLU A O   1 
ATOM   891  C  CB  . GLU A 1 160 ? 33.592  145.402 -6.473  1.00 28.43 ? 160 GLU A CB  1 
ATOM   892  C  CG  . GLU A 1 160 ? 34.850  144.888 -7.162  1.00 29.54 ? 160 GLU A CG  1 
ATOM   893  C  CD  . GLU A 1 160 ? 35.763  144.096 -6.234  1.00 32.22 ? 160 GLU A CD  1 
ATOM   894  O  OE1 . GLU A 1 160 ? 35.578  144.158 -4.997  1.00 32.24 ? 160 GLU A OE1 1 
ATOM   895  O  OE2 . GLU A 1 160 ? 36.681  143.420 -6.747  1.00 33.08 ? 160 GLU A OE2 1 
ATOM   896  N  N   . GLU A 1 161 ? 30.551  145.671 -5.645  1.00 30.53 ? 161 GLU A N   1 
ATOM   897  C  CA  . GLU A 1 161 ? 29.538  146.276 -4.785  1.00 32.52 ? 161 GLU A CA  1 
ATOM   898  C  C   . GLU A 1 161 ? 28.453  145.294 -4.349  1.00 31.93 ? 161 GLU A C   1 
ATOM   899  O  O   . GLU A 1 161 ? 28.002  145.332 -3.206  1.00 30.60 ? 161 GLU A O   1 
ATOM   900  C  CB  . GLU A 1 161 ? 28.874  147.451 -5.504  1.00 36.33 ? 161 GLU A CB  1 
ATOM   901  C  CG  . GLU A 1 161 ? 29.817  148.581 -5.862  1.00 43.10 ? 161 GLU A CG  1 
ATOM   902  C  CD  . GLU A 1 161 ? 29.158  149.622 -6.748  1.00 46.87 ? 161 GLU A CD  1 
ATOM   903  O  OE1 . GLU A 1 161 ? 29.810  150.645 -7.050  1.00 49.24 ? 161 GLU A OE1 1 
ATOM   904  O  OE2 . GLU A 1 161 ? 27.990  149.413 -7.146  1.00 48.82 ? 161 GLU A OE2 1 
ATOM   905  N  N   . GLN A 1 162 ? 28.028  144.430 -5.267  1.00 29.92 ? 162 GLN A N   1 
ATOM   906  C  CA  . GLN A 1 162 ? 26.987  143.445 -4.979  1.00 30.86 ? 162 GLN A CA  1 
ATOM   907  C  C   . GLN A 1 162 ? 27.402  142.057 -5.471  1.00 28.73 ? 162 GLN A C   1 
ATOM   908  O  O   . GLN A 1 162 ? 26.886  141.568 -6.474  1.00 29.03 ? 162 GLN A O   1 
ATOM   909  C  CB  . GLN A 1 162 ? 25.678  143.859 -5.657  1.00 32.66 ? 162 GLN A CB  1 
ATOM   910  C  CG  . GLN A 1 162 ? 25.196  145.247 -5.264  1.00 36.76 ? 162 GLN A CG  1 
ATOM   911  C  CD  . GLN A 1 162 ? 23.787  145.534 -5.738  1.00 38.80 ? 162 GLN A CD  1 
ATOM   912  O  OE1 . GLN A 1 162 ? 22.840  144.846 -5.356  1.00 40.38 ? 162 GLN A OE1 1 
ATOM   913  N  NE2 . GLN A 1 162 ? 23.639  146.555 -6.573  1.00 38.95 ? 162 GLN A NE2 1 
ATOM   914  N  N   . PRO A 1 163 ? 28.338  141.406 -4.762  1.00 27.42 ? 163 PRO A N   1 
ATOM   915  C  CA  . PRO A 1 163 ? 28.842  140.073 -5.111  1.00 26.85 ? 163 PRO A CA  1 
ATOM   916  C  C   . PRO A 1 163 ? 27.883  138.893 -4.914  1.00 27.26 ? 163 PRO A C   1 
ATOM   917  O  O   . PRO A 1 163 ? 28.133  137.806 -5.434  1.00 27.90 ? 163 PRO A O   1 
ATOM   918  C  CB  . PRO A 1 163 ? 30.099  139.951 -4.255  1.00 26.86 ? 163 PRO A CB  1 
ATOM   919  C  CG  . PRO A 1 163 ? 29.728  140.720 -3.022  1.00 26.95 ? 163 PRO A CG  1 
ATOM   920  C  CD  . PRO A 1 163 ? 29.057  141.949 -3.592  1.00 28.70 ? 163 PRO A CD  1 
ATOM   921  N  N   . LYS A 1 164 ? 26.800  139.097 -4.169  1.00 26.92 ? 164 LYS A N   1 
ATOM   922  C  CA  . LYS A 1 164 ? 25.825  138.031 -3.940  1.00 28.50 ? 164 LYS A CA  1 
ATOM   923  C  C   . LYS A 1 164 ? 24.556  138.297 -4.745  1.00 28.54 ? 164 LYS A C   1 
ATOM   924  O  O   . LYS A 1 164 ? 23.473  138.475 -4.192  1.00 32.25 ? 164 LYS A O   1 
ATOM   925  C  CB  . LYS A 1 164 ? 25.485  137.921 -2.449  1.00 29.14 ? 164 LYS A CB  1 
ATOM   926  C  CG  . LYS A 1 164 ? 26.607  137.335 -1.596  1.00 32.05 ? 164 LYS A CG  1 
ATOM   927  C  CD  . LYS A 1 164 ? 26.101  136.900 -0.222  1.00 33.07 ? 164 LYS A CD  1 
ATOM   928  C  CE  . LYS A 1 164 ? 27.180  136.141 0.546   1.00 37.47 ? 164 LYS A CE  1 
ATOM   929  N  NZ  . LYS A 1 164 ? 26.711  135.705 1.895   1.00 37.26 ? 164 LYS A NZ  1 
ATOM   930  N  N   . ASN A 1 165 ? 24.704  138.307 -6.061  1.00 27.82 ? 165 ASN A N   1 
ATOM   931  C  CA  . ASN A 1 165 ? 23.599  138.585 -6.968  1.00 25.51 ? 165 ASN A CA  1 
ATOM   932  C  C   . ASN A 1 165 ? 23.800  137.713 -8.204  1.00 24.15 ? 165 ASN A C   1 
ATOM   933  O  O   . ASN A 1 165 ? 24.901  137.656 -8.746  1.00 23.26 ? 165 ASN A O   1 
ATOM   934  C  CB  . ASN A 1 165 ? 23.637  140.080 -7.317  1.00 24.80 ? 165 ASN A CB  1 
ATOM   935  C  CG  . ASN A 1 165 ? 22.718  140.450 -8.456  1.00 24.49 ? 165 ASN A CG  1 
ATOM   936  O  OD1 . ASN A 1 165 ? 22.878  139.974 -9.578  1.00 26.73 ? 165 ASN A OD1 1 
ATOM   937  N  ND2 . ASN A 1 165 ? 21.753  141.318 -8.178  1.00 23.54 ? 165 ASN A ND2 1 
ATOM   938  N  N   . TYR A 1 166 ? 22.746  137.025 -8.640  1.00 22.73 ? 166 TYR A N   1 
ATOM   939  C  CA  . TYR A 1 166 ? 22.841  136.146 -9.803  1.00 22.39 ? 166 TYR A CA  1 
ATOM   940  C  C   . TYR A 1 166 ? 23.061  136.870 -11.125 1.00 22.18 ? 166 TYR A C   1 
ATOM   941  O  O   . TYR A 1 166 ? 23.880  136.447 -11.932 1.00 22.34 ? 166 TYR A O   1 
ATOM   942  C  CB  . TYR A 1 166 ? 21.584  135.284 -9.952  1.00 21.39 ? 166 TYR A CB  1 
ATOM   943  C  CG  . TYR A 1 166 ? 21.471  134.112 -9.001  1.00 22.19 ? 166 TYR A CG  1 
ATOM   944  C  CD1 . TYR A 1 166 ? 20.751  134.224 -7.815  1.00 21.16 ? 166 TYR A CD1 1 
ATOM   945  C  CD2 . TYR A 1 166 ? 22.054  132.878 -9.307  1.00 21.35 ? 166 TYR A CD2 1 
ATOM   946  C  CE1 . TYR A 1 166 ? 20.606  133.138 -6.956  1.00 23.19 ? 166 TYR A CE1 1 
ATOM   947  C  CE2 . TYR A 1 166 ? 21.917  131.785 -8.454  1.00 21.83 ? 166 TYR A CE2 1 
ATOM   948  C  CZ  . TYR A 1 166 ? 21.188  131.922 -7.281  1.00 22.55 ? 166 TYR A CZ  1 
ATOM   949  O  OH  . TYR A 1 166 ? 21.019  130.844 -6.439  1.00 23.78 ? 166 TYR A OH  1 
ATOM   950  N  N   . GLN A 1 167 ? 22.320  137.951 -11.346 1.00 23.33 ? 167 GLN A N   1 
ATOM   951  C  CA  . GLN A 1 167 ? 22.412  138.701 -12.593 1.00 22.27 ? 167 GLN A CA  1 
ATOM   952  C  C   . GLN A 1 167 ? 23.779  139.294 -12.924 1.00 21.64 ? 167 GLN A C   1 
ATOM   953  O  O   . GLN A 1 167 ? 24.208  139.241 -14.077 1.00 23.06 ? 167 GLN A O   1 
ATOM   954  C  CB  . GLN A 1 167 ? 21.360  139.817 -12.619 1.00 24.01 ? 167 GLN A CB  1 
ATOM   955  C  CG  . GLN A 1 167 ? 19.908  139.339 -12.675 1.00 25.87 ? 167 GLN A CG  1 
ATOM   956  C  CD  . GLN A 1 167 ? 19.441  138.695 -11.381 1.00 29.89 ? 167 GLN A CD  1 
ATOM   957  O  OE1 . GLN A 1 167 ? 19.762  139.163 -10.283 1.00 32.53 ? 167 GLN A OE1 1 
ATOM   958  N  NE2 . GLN A 1 167 ? 18.662  137.627 -11.501 1.00 31.03 ? 167 GLN A NE2 1 
ATOM   959  N  N   . VAL A 1 168 ? 24.466  139.857 -11.936 1.00 20.68 ? 168 VAL A N   1 
ATOM   960  C  CA  . VAL A 1 168 ? 25.770  140.460 -12.206 1.00 20.78 ? 168 VAL A CA  1 
ATOM   961  C  C   . VAL A 1 168 ? 26.808  139.429 -12.633 1.00 21.17 ? 168 VAL A C   1 
ATOM   962  O  O   . VAL A 1 168 ? 27.626  139.698 -13.517 1.00 20.00 ? 168 VAL A O   1 
ATOM   963  C  CB  . VAL A 1 168 ? 26.294  141.280 -10.988 1.00 20.21 ? 168 VAL A CB  1 
ATOM   964  C  CG1 . VAL A 1 168 ? 25.281  142.345 -10.629 1.00 19.01 ? 168 VAL A CG1 1 
ATOM   965  C  CG2 . VAL A 1 168 ? 26.561  140.376 -9.785  1.00 20.69 ? 168 VAL A CG2 1 
ATOM   966  N  N   . TRP A 1 169 ? 26.775  138.246 -12.027 1.00 19.38 ? 169 TRP A N   1 
ATOM   967  C  CA  . TRP A 1 169 ? 27.733  137.217 -12.410 1.00 19.67 ? 169 TRP A CA  1 
ATOM   968  C  C   . TRP A 1 169 ? 27.399  136.654 -13.790 1.00 19.63 ? 169 TRP A C   1 
ATOM   969  O  O   . TRP A 1 169 ? 28.299  136.374 -14.584 1.00 19.01 ? 169 TRP A O   1 
ATOM   970  C  CB  . TRP A 1 169 ? 27.781  136.093 -11.369 1.00 18.50 ? 169 TRP A CB  1 
ATOM   971  C  CG  . TRP A 1 169 ? 28.526  136.485 -10.121 1.00 18.04 ? 169 TRP A CG  1 
ATOM   972  C  CD1 . TRP A 1 169 ? 27.988  136.943 -8.949  1.00 18.75 ? 169 TRP A CD1 1 
ATOM   973  C  CD2 . TRP A 1 169 ? 29.948  136.496 -9.940  1.00 17.68 ? 169 TRP A CD2 1 
ATOM   974  N  NE1 . TRP A 1 169 ? 28.988  137.238 -8.052  1.00 19.83 ? 169 TRP A NE1 1 
ATOM   975  C  CE2 . TRP A 1 169 ? 30.200  136.974 -8.633  1.00 17.68 ? 169 TRP A CE2 1 
ATOM   976  C  CE3 . TRP A 1 169 ? 31.036  136.150 -10.757 1.00 16.67 ? 169 TRP A CE3 1 
ATOM   977  C  CZ2 . TRP A 1 169 ? 31.498  137.115 -8.120  1.00 16.68 ? 169 TRP A CZ2 1 
ATOM   978  C  CZ3 . TRP A 1 169 ? 32.328  136.291 -10.249 1.00 16.11 ? 169 TRP A CZ3 1 
ATOM   979  C  CH2 . TRP A 1 169 ? 32.546  136.770 -8.940  1.00 17.47 ? 169 TRP A CH2 1 
ATOM   980  N  N   . HIS A 1 170 ? 26.110  136.497 -14.087 1.00 18.61 ? 170 HIS A N   1 
ATOM   981  C  CA  . HIS A 1 170 ? 25.722  135.980 -15.392 1.00 19.17 ? 170 HIS A CA  1 
ATOM   982  C  C   . HIS A 1 170 ? 26.121  136.965 -16.492 1.00 19.37 ? 170 HIS A C   1 
ATOM   983  O  O   . HIS A 1 170 ? 26.570  136.564 -17.566 1.00 19.94 ? 170 HIS A O   1 
ATOM   984  C  CB  . HIS A 1 170 ? 24.215  135.727 -15.466 1.00 17.62 ? 170 HIS A CB  1 
ATOM   985  C  CG  . HIS A 1 170 ? 23.770  135.219 -16.801 1.00 19.53 ? 170 HIS A CG  1 
ATOM   986  N  ND1 . HIS A 1 170 ? 24.240  134.040 -17.342 1.00 19.93 ? 170 HIS A ND1 1 
ATOM   987  C  CD2 . HIS A 1 170 ? 22.936  135.750 -17.726 1.00 19.32 ? 170 HIS A CD2 1 
ATOM   988  C  CE1 . HIS A 1 170 ? 23.718  133.871 -18.544 1.00 20.50 ? 170 HIS A CE1 1 
ATOM   989  N  NE2 . HIS A 1 170 ? 22.924  134.896 -18.802 1.00 21.00 ? 170 HIS A NE2 1 
ATOM   990  N  N   . HIS A 1 171 ? 25.948  138.254 -16.222 1.00 19.63 ? 171 HIS A N   1 
ATOM   991  C  CA  . HIS A 1 171 ? 26.307  139.283 -17.191 1.00 20.91 ? 171 HIS A CA  1 
ATOM   992  C  C   . HIS A 1 171 ? 27.801  139.186 -17.498 1.00 20.96 ? 171 HIS A C   1 
ATOM   993  O  O   . HIS A 1 171 ? 28.209  139.248 -18.658 1.00 22.54 ? 171 HIS A O   1 
ATOM   994  C  CB  . HIS A 1 171 ? 25.986  140.677 -16.638 1.00 19.57 ? 171 HIS A CB  1 
ATOM   995  C  CG  . HIS A 1 171 ? 26.090  141.773 -17.657 1.00 21.85 ? 171 HIS A CG  1 
ATOM   996  N  ND1 . HIS A 1 171 ? 25.225  141.882 -18.727 1.00 21.87 ? 171 HIS A ND1 1 
ATOM   997  C  CD2 . HIS A 1 171 ? 26.953  142.812 -17.767 1.00 21.48 ? 171 HIS A CD2 1 
ATOM   998  C  CE1 . HIS A 1 171 ? 25.551  142.939 -19.450 1.00 22.23 ? 171 HIS A CE1 1 
ATOM   999  N  NE2 . HIS A 1 171 ? 26.597  143.521 -18.890 1.00 21.11 ? 171 HIS A NE2 1 
ATOM   1000 N  N   . ARG A 1 172 ? 28.616  139.036 -16.458 1.00 21.05 ? 172 ARG A N   1 
ATOM   1001 C  CA  . ARG A 1 172 ? 30.059  138.933 -16.650 1.00 21.02 ? 172 ARG A CA  1 
ATOM   1002 C  C   . ARG A 1 172 ? 30.410  137.694 -17.467 1.00 22.56 ? 172 ARG A C   1 
ATOM   1003 O  O   . ARG A 1 172 ? 31.292  137.738 -18.324 1.00 22.39 ? 172 ARG A O   1 
ATOM   1004 C  CB  . ARG A 1 172 ? 30.800  138.879 -15.313 1.00 21.46 ? 172 ARG A CB  1 
ATOM   1005 C  CG  . ARG A 1 172 ? 32.316  138.937 -15.492 1.00 21.48 ? 172 ARG A CG  1 
ATOM   1006 C  CD  . ARG A 1 172 ? 33.087  138.774 -14.198 1.00 22.33 ? 172 ARG A CD  1 
ATOM   1007 N  NE  . ARG A 1 172 ? 34.519  138.955 -14.430 1.00 23.76 ? 172 ARG A NE  1 
ATOM   1008 C  CZ  . ARG A 1 172 ? 35.183  140.089 -14.219 1.00 24.41 ? 172 ARG A CZ  1 
ATOM   1009 N  NH1 . ARG A 1 172 ? 34.557  141.161 -13.752 1.00 23.12 ? 172 ARG A NH1 1 
ATOM   1010 N  NH2 . ARG A 1 172 ? 36.474  140.158 -14.503 1.00 24.42 ? 172 ARG A NH2 1 
ATOM   1011 N  N   . ARG A 1 173 ? 29.726  136.585 -17.206 1.00 22.78 ? 173 ARG A N   1 
ATOM   1012 C  CA  . ARG A 1 173 ? 30.001  135.371 -17.958 1.00 22.99 ? 173 ARG A CA  1 
ATOM   1013 C  C   . ARG A 1 173 ? 29.679  135.579 -19.434 1.00 22.54 ? 173 ARG A C   1 
ATOM   1014 O  O   . ARG A 1 173 ? 30.435  135.150 -20.304 1.00 22.65 ? 173 ARG A O   1 
ATOM   1015 C  CB  . ARG A 1 173 ? 29.191  134.197 -17.413 1.00 23.76 ? 173 ARG A CB  1 
ATOM   1016 C  CG  . ARG A 1 173 ? 29.154  133.003 -18.359 1.00 23.76 ? 173 ARG A CG  1 
ATOM   1017 C  CD  . ARG A 1 173 ? 28.567  131.782 -17.684 1.00 25.36 ? 173 ARG A CD  1 
ATOM   1018 N  NE  . ARG A 1 173 ? 28.345  130.689 -18.625 1.00 24.45 ? 173 ARG A NE  1 
ATOM   1019 C  CZ  . ARG A 1 173 ? 28.171  129.422 -18.263 1.00 24.70 ? 173 ARG A CZ  1 
ATOM   1020 N  NH1 . ARG A 1 173 ? 28.202  129.087 -16.978 1.00 24.28 ? 173 ARG A NH1 1 
ATOM   1021 N  NH2 . ARG A 1 173 ? 27.958  128.493 -19.183 1.00 24.31 ? 173 ARG A NH2 1 
ATOM   1022 N  N   . VAL A 1 174 ? 28.559  136.235 -19.720 1.00 21.39 ? 174 VAL A N   1 
ATOM   1023 C  CA  . VAL A 1 174 ? 28.182  136.489 -21.107 1.00 23.05 ? 174 VAL A CA  1 
ATOM   1024 C  C   . VAL A 1 174 ? 29.256  137.331 -21.804 1.00 23.00 ? 174 VAL A C   1 
ATOM   1025 O  O   . VAL A 1 174 ? 29.617  137.055 -22.948 1.00 24.59 ? 174 VAL A O   1 
ATOM   1026 C  CB  . VAL A 1 174 ? 26.812  137.215 -21.209 1.00 23.60 ? 174 VAL A CB  1 
ATOM   1027 C  CG1 . VAL A 1 174 ? 26.565  137.669 -22.642 1.00 25.16 ? 174 VAL A CG1 1 
ATOM   1028 C  CG2 . VAL A 1 174 ? 25.690  136.282 -20.768 1.00 21.52 ? 174 VAL A CG2 1 
ATOM   1029 N  N   . LEU A 1 175 ? 29.769  138.347 -21.112 1.00 21.77 ? 175 LEU A N   1 
ATOM   1030 C  CA  . LEU A 1 175 ? 30.804  139.211 -21.677 1.00 22.42 ? 175 LEU A CA  1 
ATOM   1031 C  C   . LEU A 1 175 ? 32.063  138.414 -22.004 1.00 24.56 ? 175 LEU A C   1 
ATOM   1032 O  O   . LEU A 1 175 ? 32.644  138.572 -23.080 1.00 24.92 ? 175 LEU A O   1 
ATOM   1033 C  CB  . LEU A 1 175 ? 31.157  140.344 -20.703 1.00 21.11 ? 175 LEU A CB  1 
ATOM   1034 C  CG  . LEU A 1 175 ? 30.035  141.334 -20.353 1.00 22.98 ? 175 LEU A CG  1 
ATOM   1035 C  CD1 . LEU A 1 175 ? 30.544  142.349 -19.345 1.00 21.06 ? 175 LEU A CD1 1 
ATOM   1036 C  CD2 . LEU A 1 175 ? 29.547  142.040 -21.612 1.00 22.80 ? 175 LEU A CD2 1 
ATOM   1037 N  N   . VAL A 1 176 ? 32.489  137.563 -21.073 1.00 24.08 ? 176 VAL A N   1 
ATOM   1038 C  CA  . VAL A 1 176 ? 33.682  136.752 -21.287 1.00 25.55 ? 176 VAL A CA  1 
ATOM   1039 C  C   . VAL A 1 176 ? 33.451  135.791 -22.453 1.00 26.57 ? 176 VAL A C   1 
ATOM   1040 O  O   . VAL A 1 176 ? 34.362  135.515 -23.233 1.00 26.06 ? 176 VAL A O   1 
ATOM   1041 C  CB  . VAL A 1 176 ? 34.061  135.968 -20.007 1.00 26.17 ? 176 VAL A CB  1 
ATOM   1042 C  CG1 . VAL A 1 176 ? 35.227  135.029 -20.285 1.00 25.20 ? 176 VAL A CG1 1 
ATOM   1043 C  CG2 . VAL A 1 176 ? 34.433  136.951 -18.902 1.00 23.95 ? 176 VAL A CG2 1 
ATOM   1044 N  N   . GLU A 1 177 ? 32.224  135.294 -22.576 1.00 27.41 ? 177 GLU A N   1 
ATOM   1045 C  CA  . GLU A 1 177 ? 31.875  134.395 -23.672 1.00 28.51 ? 177 GLU A CA  1 
ATOM   1046 C  C   . GLU A 1 177 ? 31.922  135.144 -25.009 1.00 29.29 ? 177 GLU A C   1 
ATOM   1047 O  O   . GLU A 1 177 ? 32.415  134.617 -26.007 1.00 28.33 ? 177 GLU A O   1 
ATOM   1048 C  CB  . GLU A 1 177 ? 30.472  133.816 -23.464 1.00 29.54 ? 177 GLU A CB  1 
ATOM   1049 C  CG  . GLU A 1 177 ? 30.422  132.634 -22.510 1.00 33.21 ? 177 GLU A CG  1 
ATOM   1050 C  CD  . GLU A 1 177 ? 29.005  132.227 -22.146 1.00 34.86 ? 177 GLU A CD  1 
ATOM   1051 O  OE1 . GLU A 1 177 ? 28.827  131.115 -21.602 1.00 37.26 ? 177 GLU A OE1 1 
ATOM   1052 O  OE2 . GLU A 1 177 ? 28.069  133.019 -22.390 1.00 36.95 ? 177 GLU A OE2 1 
ATOM   1053 N  N   . TRP A 1 178 ? 31.405  136.370 -25.026 1.00 28.40 ? 178 TRP A N   1 
ATOM   1054 C  CA  . TRP A 1 178 ? 31.398  137.175 -26.245 1.00 29.59 ? 178 TRP A CA  1 
ATOM   1055 C  C   . TRP A 1 178 ? 32.808  137.550 -26.677 1.00 30.09 ? 178 TRP A C   1 
ATOM   1056 O  O   . TRP A 1 178 ? 33.114  137.561 -27.865 1.00 31.49 ? 178 TRP A O   1 
ATOM   1057 C  CB  . TRP A 1 178 ? 30.594  138.464 -26.047 1.00 28.86 ? 178 TRP A CB  1 
ATOM   1058 C  CG  . TRP A 1 178 ? 29.109  138.293 -26.112 1.00 30.67 ? 178 TRP A CG  1 
ATOM   1059 C  CD1 . TRP A 1 178 ? 28.422  137.184 -26.519 1.00 29.09 ? 178 TRP A CD1 1 
ATOM   1060 C  CD2 . TRP A 1 178 ? 28.123  139.286 -25.801 1.00 30.55 ? 178 TRP A CD2 1 
ATOM   1061 N  NE1 . TRP A 1 178 ? 27.067  137.426 -26.483 1.00 30.60 ? 178 TRP A NE1 1 
ATOM   1062 C  CE2 . TRP A 1 178 ? 26.856  138.708 -26.046 1.00 30.24 ? 178 TRP A CE2 1 
ATOM   1063 C  CE3 . TRP A 1 178 ? 28.186  140.608 -25.340 1.00 30.22 ? 178 TRP A CE3 1 
ATOM   1064 C  CZ2 . TRP A 1 178 ? 25.661  139.408 -25.847 1.00 31.65 ? 178 TRP A CZ2 1 
ATOM   1065 C  CZ3 . TRP A 1 178 ? 26.996  141.307 -25.141 1.00 30.93 ? 178 TRP A CZ3 1 
ATOM   1066 C  CH2 . TRP A 1 178 ? 25.751  140.703 -25.396 1.00 31.25 ? 178 TRP A CH2 1 
ATOM   1067 N  N   . LEU A 1 179 ? 33.654  137.873 -25.706 1.00 29.54 ? 179 LEU A N   1 
ATOM   1068 C  CA  . LEU A 1 179 ? 35.031  138.258 -25.976 1.00 30.49 ? 179 LEU A CA  1 
ATOM   1069 C  C   . LEU A 1 179 ? 35.967  137.068 -26.134 1.00 32.86 ? 179 LEU A C   1 
ATOM   1070 O  O   . LEU A 1 179 ? 37.003  137.175 -26.793 1.00 33.43 ? 179 LEU A O   1 
ATOM   1071 C  CB  . LEU A 1 179 ? 35.567  139.136 -24.844 1.00 30.23 ? 179 LEU A CB  1 
ATOM   1072 C  CG  . LEU A 1 179 ? 35.036  140.561 -24.686 1.00 29.70 ? 179 LEU A CG  1 
ATOM   1073 C  CD1 . LEU A 1 179 ? 35.493  141.123 -23.349 1.00 28.19 ? 179 LEU A CD1 1 
ATOM   1074 C  CD2 . LEU A 1 179 ? 35.537  141.426 -25.832 1.00 28.12 ? 179 LEU A CD2 1 
ATOM   1075 N  N   . ARG A 1 180 ? 35.605  135.937 -25.533 1.00 33.54 ? 180 ARG A N   1 
ATOM   1076 C  CA  . ARG A 1 180 ? 36.463  134.757 -25.579 1.00 34.89 ? 180 ARG A CA  1 
ATOM   1077 C  C   . ARG A 1 180 ? 37.776  135.165 -24.910 1.00 34.40 ? 180 ARG A C   1 
ATOM   1078 O  O   . ARG A 1 180 ? 38.850  134.687 -25.275 1.00 35.40 ? 180 ARG A O   1 
ATOM   1079 C  CB  . ARG A 1 180 ? 36.730  134.337 -27.028 1.00 36.96 ? 180 ARG A CB  1 
ATOM   1080 C  CG  . ARG A 1 180 ? 35.574  133.636 -27.729 1.00 39.17 ? 180 ARG A CG  1 
ATOM   1081 C  CD  . ARG A 1 180 ? 35.663  132.129 -27.548 1.00 43.88 ? 180 ARG A CD  1 
ATOM   1082 N  NE  . ARG A 1 180 ? 35.024  131.659 -26.323 1.00 47.29 ? 180 ARG A NE  1 
ATOM   1083 C  CZ  . ARG A 1 180 ? 35.183  130.438 -25.818 1.00 48.32 ? 180 ARG A CZ  1 
ATOM   1084 N  NH1 . ARG A 1 180 ? 35.970  129.561 -26.425 1.00 49.04 ? 180 ARG A NH1 1 
ATOM   1085 N  NH2 . ARG A 1 180 ? 34.539  130.086 -24.714 1.00 48.92 ? 180 ARG A NH2 1 
ATOM   1086 N  N   . ASP A 1 181 ? 37.674  136.062 -23.931 1.00 33.18 ? 181 ASP A N   1 
ATOM   1087 C  CA  . ASP A 1 181 ? 38.837  136.565 -23.206 1.00 33.28 ? 181 ASP A CA  1 
ATOM   1088 C  C   . ASP A 1 181 ? 38.706  136.397 -21.688 1.00 32.97 ? 181 ASP A C   1 
ATOM   1089 O  O   . ASP A 1 181 ? 38.010  137.164 -21.018 1.00 32.19 ? 181 ASP A O   1 
ATOM   1090 C  CB  . ASP A 1 181 ? 39.058  138.038 -23.558 1.00 33.29 ? 181 ASP A CB  1 
ATOM   1091 C  CG  . ASP A 1 181 ? 40.128  138.689 -22.709 1.00 35.88 ? 181 ASP A CG  1 
ATOM   1092 O  OD1 . ASP A 1 181 ? 41.066  137.985 -22.277 1.00 35.68 ? 181 ASP A OD1 1 
ATOM   1093 O  OD2 . ASP A 1 181 ? 40.035  139.914 -22.487 1.00 37.98 ? 181 ASP A OD2 1 
ATOM   1094 N  N   . PRO A 1 182 ? 39.390  135.387 -21.127 1.00 32.38 ? 182 PRO A N   1 
ATOM   1095 C  CA  . PRO A 1 182 ? 39.362  135.096 -19.692 1.00 31.39 ? 182 PRO A CA  1 
ATOM   1096 C  C   . PRO A 1 182 ? 40.578  135.635 -18.951 1.00 30.14 ? 182 PRO A C   1 
ATOM   1097 O  O   . PRO A 1 182 ? 40.776  135.323 -17.782 1.00 29.14 ? 182 PRO A O   1 
ATOM   1098 C  CB  . PRO A 1 182 ? 39.343  133.582 -19.676 1.00 32.22 ? 182 PRO A CB  1 
ATOM   1099 C  CG  . PRO A 1 182 ? 40.368  133.280 -20.747 1.00 33.24 ? 182 PRO A CG  1 
ATOM   1100 C  CD  . PRO A 1 182 ? 40.011  134.269 -21.865 1.00 32.70 ? 182 PRO A CD  1 
ATOM   1101 N  N   . SER A 1 183 ? 41.384  136.443 -19.631 1.00 29.53 ? 183 SER A N   1 
ATOM   1102 C  CA  . SER A 1 183 ? 42.613  136.977 -19.046 1.00 30.42 ? 183 SER A CA  1 
ATOM   1103 C  C   . SER A 1 183 ? 42.491  137.692 -17.697 1.00 29.31 ? 183 SER A C   1 
ATOM   1104 O  O   . SER A 1 183 ? 43.445  137.719 -16.926 1.00 28.87 ? 183 SER A O   1 
ATOM   1105 C  CB  . SER A 1 183 ? 43.306  137.905 -20.053 1.00 30.37 ? 183 SER A CB  1 
ATOM   1106 O  OG  . SER A 1 183 ? 42.543  139.075 -20.284 1.00 33.22 ? 183 SER A OG  1 
ATOM   1107 N  N   . GLN A 1 184 ? 41.327  138.265 -17.409 1.00 29.56 ? 184 GLN A N   1 
ATOM   1108 C  CA  . GLN A 1 184 ? 41.128  138.985 -16.151 1.00 29.47 ? 184 GLN A CA  1 
ATOM   1109 C  C   . GLN A 1 184 ? 40.392  138.189 -15.075 1.00 28.17 ? 184 GLN A C   1 
ATOM   1110 O  O   . GLN A 1 184 ? 40.420  138.551 -13.900 1.00 27.34 ? 184 GLN A O   1 
ATOM   1111 C  CB  . GLN A 1 184 ? 40.341  140.275 -16.403 1.00 30.47 ? 184 GLN A CB  1 
ATOM   1112 C  CG  . GLN A 1 184 ? 41.090  141.361 -17.151 1.00 33.20 ? 184 GLN A CG  1 
ATOM   1113 C  CD  . GLN A 1 184 ? 40.208  142.565 -17.436 1.00 36.34 ? 184 GLN A CD  1 
ATOM   1114 O  OE1 . GLN A 1 184 ? 39.513  143.064 -16.549 1.00 37.53 ? 184 GLN A OE1 1 
ATOM   1115 N  NE2 . GLN A 1 184 ? 40.235  143.040 -18.675 1.00 38.58 ? 184 GLN A NE2 1 
ATOM   1116 N  N   . GLU A 1 185 ? 39.744  137.104 -15.479 1.00 28.29 ? 185 GLU A N   1 
ATOM   1117 C  CA  . GLU A 1 185 ? 38.943  136.298 -14.565 1.00 27.29 ? 185 GLU A CA  1 
ATOM   1118 C  C   . GLU A 1 185 ? 39.538  135.785 -13.255 1.00 27.27 ? 185 GLU A C   1 
ATOM   1119 O  O   . GLU A 1 185 ? 39.041  136.131 -12.183 1.00 25.71 ? 185 GLU A O   1 
ATOM   1120 C  CB  . GLU A 1 185 ? 38.323  135.139 -15.339 1.00 28.10 ? 185 GLU A CB  1 
ATOM   1121 C  CG  . GLU A 1 185 ? 37.481  135.618 -16.502 1.00 26.68 ? 185 GLU A CG  1 
ATOM   1122 C  CD  . GLU A 1 185 ? 36.586  136.782 -16.112 1.00 29.66 ? 185 GLU A CD  1 
ATOM   1123 O  OE1 . GLU A 1 185 ? 35.618  136.568 -15.349 1.00 28.11 ? 185 GLU A OE1 1 
ATOM   1124 O  OE2 . GLU A 1 185 ? 36.864  137.916 -16.560 1.00 28.59 ? 185 GLU A OE2 1 
ATOM   1125 N  N   . LEU A 1 186 ? 40.582  134.965 -13.324 1.00 26.71 ? 186 LEU A N   1 
ATOM   1126 C  CA  . LEU A 1 186 ? 41.169  134.413 -12.106 1.00 27.96 ? 186 LEU A CA  1 
ATOM   1127 C  C   . LEU A 1 186 ? 41.616  135.469 -11.098 1.00 29.50 ? 186 LEU A C   1 
ATOM   1128 O  O   . LEU A 1 186 ? 41.463  135.283 -9.890  1.00 29.74 ? 186 LEU A O   1 
ATOM   1129 C  CB  . LEU A 1 186 ? 42.338  133.482 -12.451 1.00 28.12 ? 186 LEU A CB  1 
ATOM   1130 C  CG  . LEU A 1 186 ? 41.966  132.225 -13.249 1.00 26.82 ? 186 LEU A CG  1 
ATOM   1131 C  CD1 . LEU A 1 186 ? 43.198  131.355 -13.442 1.00 29.03 ? 186 LEU A CD1 1 
ATOM   1132 C  CD2 . LEU A 1 186 ? 40.880  131.444 -12.514 1.00 28.18 ? 186 LEU A CD2 1 
ATOM   1133 N  N   . GLU A 1 187 ? 42.161  136.578 -11.583 1.00 28.89 ? 187 GLU A N   1 
ATOM   1134 C  CA  . GLU A 1 187 ? 42.609  137.632 -10.681 1.00 28.85 ? 187 GLU A CA  1 
ATOM   1135 C  C   . GLU A 1 187 ? 41.413  138.362 -10.062 1.00 26.99 ? 187 GLU A C   1 
ATOM   1136 O  O   . GLU A 1 187 ? 41.397  138.639 -8.864  1.00 25.02 ? 187 GLU A O   1 
ATOM   1137 C  CB  . GLU A 1 187 ? 43.498  138.629 -11.424 1.00 31.88 ? 187 GLU A CB  1 
ATOM   1138 C  CG  . GLU A 1 187 ? 44.050  139.733 -10.535 1.00 38.78 ? 187 GLU A CG  1 
ATOM   1139 C  CD  . GLU A 1 187 ? 44.924  140.717 -11.294 1.00 43.54 ? 187 GLU A CD  1 
ATOM   1140 O  OE1 . GLU A 1 187 ? 45.928  140.281 -11.899 1.00 45.14 ? 187 GLU A OE1 1 
ATOM   1141 O  OE2 . GLU A 1 187 ? 44.607  141.926 -11.285 1.00 46.96 ? 187 GLU A OE2 1 
ATOM   1142 N  N   . PHE A 1 188 ? 40.416  138.677 -10.881 1.00 26.16 ? 188 PHE A N   1 
ATOM   1143 C  CA  . PHE A 1 188 ? 39.230  139.362 -10.380 1.00 25.58 ? 188 PHE A CA  1 
ATOM   1144 C  C   . PHE A 1 188 ? 38.513  138.501 -9.338  1.00 24.96 ? 188 PHE A C   1 
ATOM   1145 O  O   . PHE A 1 188 ? 38.146  138.983 -8.266  1.00 23.49 ? 188 PHE A O   1 
ATOM   1146 C  CB  . PHE A 1 188 ? 38.262  139.675 -11.524 1.00 26.07 ? 188 PHE A CB  1 
ATOM   1147 C  CG  . PHE A 1 188 ? 36.885  140.052 -11.055 1.00 26.22 ? 188 PHE A CG  1 
ATOM   1148 C  CD1 . PHE A 1 188 ? 36.659  141.276 -10.435 1.00 26.16 ? 188 PHE A CD1 1 
ATOM   1149 C  CD2 . PHE A 1 188 ? 35.822  139.159 -11.189 1.00 24.91 ? 188 PHE A CD2 1 
ATOM   1150 C  CE1 . PHE A 1 188 ? 35.395  141.608 -9.950  1.00 27.65 ? 188 PHE A CE1 1 
ATOM   1151 C  CE2 . PHE A 1 188 ? 34.552  139.480 -10.708 1.00 25.43 ? 188 PHE A CE2 1 
ATOM   1152 C  CZ  . PHE A 1 188 ? 34.339  140.708 -10.087 1.00 25.70 ? 188 PHE A CZ  1 
ATOM   1153 N  N   . ILE A 1 189 ? 38.309  137.227 -9.655  1.00 24.35 ? 189 ILE A N   1 
ATOM   1154 C  CA  . ILE A 1 189 ? 37.633  136.332 -8.725  1.00 23.03 ? 189 ILE A CA  1 
ATOM   1155 C  C   . ILE A 1 189 ? 38.412  136.243 -7.416  1.00 24.52 ? 189 ILE A C   1 
ATOM   1156 O  O   . ILE A 1 189 ? 37.830  136.285 -6.328  1.00 23.89 ? 189 ILE A O   1 
ATOM   1157 C  CB  . ILE A 1 189 ? 37.487  134.915 -9.313  1.00 22.56 ? 189 ILE A CB  1 
ATOM   1158 C  CG1 . ILE A 1 189 ? 36.690  134.977 -10.618 1.00 19.60 ? 189 ILE A CG1 1 
ATOM   1159 C  CG2 . ILE A 1 189 ? 36.792  134.000 -8.299  1.00 22.11 ? 189 ILE A CG2 1 
ATOM   1160 C  CD1 . ILE A 1 189 ? 36.740  133.694 -11.427 1.00 21.88 ? 189 ILE A CD1 1 
ATOM   1161 N  N   . ALA A 1 190 ? 39.731  136.124 -7.527  1.00 24.13 ? 190 ALA A N   1 
ATOM   1162 C  CA  . ALA A 1 190 ? 40.582  136.033 -6.349  1.00 25.01 ? 190 ALA A CA  1 
ATOM   1163 C  C   . ALA A 1 190 ? 40.359  137.228 -5.429  1.00 24.25 ? 190 ALA A C   1 
ATOM   1164 O  O   . ALA A 1 190 ? 40.425  137.099 -4.206  1.00 24.84 ? 190 ALA A O   1 
ATOM   1165 C  CB  . ALA A 1 190 ? 42.057  135.954 -6.766  1.00 24.00 ? 190 ALA A CB  1 
ATOM   1166 N  N   . ASP A 1 191 ? 40.096  138.392 -6.018  1.00 25.05 ? 191 ASP A N   1 
ATOM   1167 C  CA  . ASP A 1 191 ? 39.868  139.596 -5.228  1.00 24.39 ? 191 ASP A CA  1 
ATOM   1168 C  C   . ASP A 1 191 ? 38.532  139.511 -4.500  1.00 23.98 ? 191 ASP A C   1 
ATOM   1169 O  O   . ASP A 1 191 ? 38.417  139.909 -3.341  1.00 22.93 ? 191 ASP A O   1 
ATOM   1170 C  CB  . ASP A 1 191 ? 39.883  140.841 -6.112  1.00 27.72 ? 191 ASP A CB  1 
ATOM   1171 C  CG  . ASP A 1 191 ? 39.743  142.118 -5.304  1.00 31.49 ? 191 ASP A CG  1 
ATOM   1172 O  OD1 . ASP A 1 191 ? 40.645  142.404 -4.488  1.00 33.85 ? 191 ASP A OD1 1 
ATOM   1173 O  OD2 . ASP A 1 191 ? 38.730  142.827 -5.467  1.00 32.75 ? 191 ASP A OD2 1 
ATOM   1174 N  N   . ILE A 1 192 ? 37.516  138.997 -5.187  1.00 23.55 ? 192 ILE A N   1 
ATOM   1175 C  CA  . ILE A 1 192 ? 36.202  138.842 -4.574  1.00 22.91 ? 192 ILE A CA  1 
ATOM   1176 C  C   . ILE A 1 192 ? 36.314  137.841 -3.424  1.00 23.05 ? 192 ILE A C   1 
ATOM   1177 O  O   . ILE A 1 192 ? 35.800  138.077 -2.329  1.00 22.90 ? 192 ILE A O   1 
ATOM   1178 C  CB  . ILE A 1 192 ? 35.163  138.325 -5.603  1.00 23.04 ? 192 ILE A CB  1 
ATOM   1179 C  CG1 . ILE A 1 192 ? 34.931  139.387 -6.682  1.00 22.18 ? 192 ILE A CG1 1 
ATOM   1180 C  CG2 . ILE A 1 192 ? 33.853  137.966 -4.902  1.00 23.63 ? 192 ILE A CG2 1 
ATOM   1181 C  CD1 . ILE A 1 192 ? 34.418  140.718 -6.138  1.00 22.04 ? 192 ILE A CD1 1 
ATOM   1182 N  N   . LEU A 1 193 ? 36.997  136.726 -3.677  1.00 23.12 ? 193 LEU A N   1 
ATOM   1183 C  CA  . LEU A 1 193 ? 37.168  135.689 -2.668  1.00 23.78 ? 193 LEU A CA  1 
ATOM   1184 C  C   . LEU A 1 193 ? 38.018  136.166 -1.500  1.00 26.73 ? 193 LEU A C   1 
ATOM   1185 O  O   . LEU A 1 193 ? 37.921  135.634 -0.392  1.00 26.16 ? 193 LEU A O   1 
ATOM   1186 C  CB  . LEU A 1 193 ? 37.793  134.440 -3.292  1.00 22.89 ? 193 LEU A CB  1 
ATOM   1187 C  CG  . LEU A 1 193 ? 36.881  133.696 -4.272  1.00 22.91 ? 193 LEU A CG  1 
ATOM   1188 C  CD1 . LEU A 1 193 ? 37.647  132.553 -4.937  1.00 21.68 ? 193 LEU A CD1 1 
ATOM   1189 C  CD2 . LEU A 1 193 ? 35.652  133.174 -3.526  1.00 20.33 ? 193 LEU A CD2 1 
ATOM   1190 N  N   . ASN A 1 194 ? 38.850  137.171 -1.747  1.00 27.90 ? 194 ASN A N   1 
ATOM   1191 C  CA  . ASN A 1 194 ? 39.691  137.714 -0.694  1.00 27.41 ? 194 ASN A CA  1 
ATOM   1192 C  C   . ASN A 1 194 ? 38.796  138.440 0.313   1.00 27.04 ? 194 ASN A C   1 
ATOM   1193 O  O   . ASN A 1 194 ? 39.158  138.598 1.480   1.00 26.91 ? 194 ASN A O   1 
ATOM   1194 C  CB  . ASN A 1 194 ? 40.716  138.684 -1.283  1.00 30.06 ? 194 ASN A CB  1 
ATOM   1195 C  CG  . ASN A 1 194 ? 41.757  139.105 -0.274  1.00 34.43 ? 194 ASN A CG  1 
ATOM   1196 O  OD1 . ASN A 1 194 ? 42.505  138.273 0.247   1.00 35.51 ? 194 ASN A OD1 1 
ATOM   1197 N  ND2 . ASN A 1 194 ? 41.812  140.401 0.015   1.00 36.16 ? 194 ASN A ND2 1 
ATOM   1198 N  N   . GLN A 1 195 ? 37.624  138.874 -0.143  1.00 24.84 ? 195 GLN A N   1 
ATOM   1199 C  CA  . GLN A 1 195 ? 36.675  139.578 0.716   1.00 25.65 ? 195 GLN A CA  1 
ATOM   1200 C  C   . GLN A 1 195 ? 35.687  138.605 1.369   1.00 26.00 ? 195 GLN A C   1 
ATOM   1201 O  O   . GLN A 1 195 ? 35.246  138.816 2.500   1.00 25.86 ? 195 GLN A O   1 
ATOM   1202 C  CB  . GLN A 1 195 ? 35.927  140.636 -0.099  1.00 26.40 ? 195 GLN A CB  1 
ATOM   1203 C  CG  . GLN A 1 195 ? 36.849  141.709 -0.666  1.00 28.91 ? 195 GLN A CG  1 
ATOM   1204 C  CD  . GLN A 1 195 ? 36.157  142.625 -1.657  1.00 30.90 ? 195 GLN A CD  1 
ATOM   1205 O  OE1 . GLN A 1 195 ? 35.199  143.318 -1.316  1.00 31.54 ? 195 GLN A OE1 1 
ATOM   1206 N  NE2 . GLN A 1 195 ? 36.642  142.632 -2.895  1.00 30.59 ? 195 GLN A NE2 1 
ATOM   1207 N  N   . ASP A 1 196 ? 35.347  137.543 0.643   1.00 24.38 ? 196 ASP A N   1 
ATOM   1208 C  CA  . ASP A 1 196 ? 34.436  136.501 1.125   1.00 23.36 ? 196 ASP A CA  1 
ATOM   1209 C  C   . ASP A 1 196 ? 34.921  135.212 0.470   1.00 21.58 ? 196 ASP A C   1 
ATOM   1210 O  O   . ASP A 1 196 ? 34.584  134.922 -0.679  1.00 20.26 ? 196 ASP A O   1 
ATOM   1211 C  CB  . ASP A 1 196 ? 32.994  136.810 0.704   1.00 24.11 ? 196 ASP A CB  1 
ATOM   1212 C  CG  . ASP A 1 196 ? 31.999  135.753 1.177   1.00 28.20 ? 196 ASP A CG  1 
ATOM   1213 O  OD1 . ASP A 1 196 ? 30.790  135.938 0.933   1.00 31.72 ? 196 ASP A OD1 1 
ATOM   1214 O  OD2 . ASP A 1 196 ? 32.415  134.740 1.785   1.00 28.14 ? 196 ASP A OD2 1 
ATOM   1215 N  N   . ALA A 1 197 ? 35.720  134.446 1.204   1.00 19.74 ? 197 ALA A N   1 
ATOM   1216 C  CA  . ALA A 1 197 ? 36.300  133.214 0.680   1.00 20.67 ? 197 ALA A CA  1 
ATOM   1217 C  C   . ALA A 1 197 ? 35.321  132.091 0.336   1.00 20.38 ? 197 ALA A C   1 
ATOM   1218 O  O   . ALA A 1 197 ? 35.730  131.056 -0.189  1.00 20.07 ? 197 ALA A O   1 
ATOM   1219 C  CB  . ALA A 1 197 ? 37.365  132.697 1.654   1.00 19.18 ? 197 ALA A CB  1 
ATOM   1220 N  N   . LYS A 1 198 ? 34.036  132.287 0.611   1.00 20.12 ? 198 LYS A N   1 
ATOM   1221 C  CA  . LYS A 1 198 ? 33.055  131.243 0.326   1.00 20.11 ? 198 LYS A CA  1 
ATOM   1222 C  C   . LYS A 1 198 ? 31.937  131.677 -0.627  1.00 20.19 ? 198 LYS A C   1 
ATOM   1223 O  O   . LYS A 1 198 ? 30.970  130.938 -0.836  1.00 19.21 ? 198 LYS A O   1 
ATOM   1224 C  CB  . LYS A 1 198 ? 32.458  130.729 1.646   1.00 20.20 ? 198 LYS A CB  1 
ATOM   1225 C  CG  . LYS A 1 198 ? 33.515  130.253 2.649   1.00 18.76 ? 198 LYS A CG  1 
ATOM   1226 C  CD  . LYS A 1 198 ? 32.890  129.710 3.933   1.00 20.42 ? 198 LYS A CD  1 
ATOM   1227 C  CE  . LYS A 1 198 ? 33.959  129.268 4.923   1.00 18.97 ? 198 LYS A CE  1 
ATOM   1228 N  NZ  . LYS A 1 198 ? 33.392  128.574 6.119   1.00 19.09 ? 198 LYS A NZ  1 
ATOM   1229 N  N   . ASN A 1 199 ? 32.068  132.864 -1.212  1.00 20.42 ? 199 ASN A N   1 
ATOM   1230 C  CA  . ASN A 1 199 ? 31.050  133.357 -2.139  1.00 19.60 ? 199 ASN A CA  1 
ATOM   1231 C  C   . ASN A 1 199 ? 30.752  132.280 -3.189  1.00 20.80 ? 199 ASN A C   1 
ATOM   1232 O  O   . ASN A 1 199 ? 31.602  131.950 -4.021  1.00 20.61 ? 199 ASN A O   1 
ATOM   1233 C  CB  . ASN A 1 199 ? 31.528  134.648 -2.808  1.00 20.77 ? 199 ASN A CB  1 
ATOM   1234 C  CG  . ASN A 1 199 ? 30.478  135.252 -3.715  1.00 20.55 ? 199 ASN A CG  1 
ATOM   1235 O  OD1 . ASN A 1 199 ? 30.124  134.673 -4.735  1.00 20.52 ? 199 ASN A OD1 1 
ATOM   1236 N  ND2 . ASN A 1 199 ? 29.967  136.420 -3.340  1.00 23.86 ? 199 ASN A ND2 1 
ATOM   1237 N  N   . TYR A 1 200 ? 29.537  131.736 -3.134  1.00 18.97 ? 200 TYR A N   1 
ATOM   1238 C  CA  . TYR A 1 200 ? 29.111  130.666 -4.032  1.00 17.88 ? 200 TYR A CA  1 
ATOM   1239 C  C   . TYR A 1 200 ? 29.196  131.031 -5.515  1.00 17.72 ? 200 TYR A C   1 
ATOM   1240 O  O   . TYR A 1 200 ? 29.699  130.247 -6.321  1.00 17.58 ? 200 TYR A O   1 
ATOM   1241 C  CB  . TYR A 1 200 ? 27.677  130.239 -3.691  1.00 16.69 ? 200 TYR A CB  1 
ATOM   1242 C  CG  . TYR A 1 200 ? 27.354  128.823 -4.111  1.00 18.35 ? 200 TYR A CG  1 
ATOM   1243 C  CD1 . TYR A 1 200 ? 27.534  127.753 -3.227  1.00 18.78 ? 200 TYR A CD1 1 
ATOM   1244 C  CD2 . TYR A 1 200 ? 26.900  128.543 -5.400  1.00 16.10 ? 200 TYR A CD2 1 
ATOM   1245 C  CE1 . TYR A 1 200 ? 27.265  126.436 -3.621  1.00 19.73 ? 200 TYR A CE1 1 
ATOM   1246 C  CE2 . TYR A 1 200 ? 26.635  127.237 -5.803  1.00 17.35 ? 200 TYR A CE2 1 
ATOM   1247 C  CZ  . TYR A 1 200 ? 26.818  126.189 -4.909  1.00 18.81 ? 200 TYR A CZ  1 
ATOM   1248 O  OH  . TYR A 1 200 ? 26.547  124.898 -5.306  1.00 17.68 ? 200 TYR A OH  1 
ATOM   1249 N  N   . HIS A 1 201 ? 28.696  132.212 -5.872  1.00 18.71 ? 201 HIS A N   1 
ATOM   1250 C  CA  . HIS A 1 201 ? 28.723  132.674 -7.260  1.00 18.67 ? 201 HIS A CA  1 
ATOM   1251 C  C   . HIS A 1 201 ? 30.148  132.811 -7.769  1.00 18.95 ? 201 HIS A C   1 
ATOM   1252 O  O   . HIS A 1 201 ? 30.433  132.498 -8.925  1.00 18.54 ? 201 HIS A O   1 
ATOM   1253 C  CB  . HIS A 1 201 ? 28.038  134.035 -7.388  1.00 20.17 ? 201 HIS A CB  1 
ATOM   1254 C  CG  . HIS A 1 201 ? 26.629  134.054 -6.892  1.00 21.09 ? 201 HIS A CG  1 
ATOM   1255 N  ND1 . HIS A 1 201 ? 25.589  133.466 -7.578  1.00 21.79 ? 201 HIS A ND1 1 
ATOM   1256 C  CD2 . HIS A 1 201 ? 26.088  134.587 -5.770  1.00 21.17 ? 201 HIS A CD2 1 
ATOM   1257 C  CE1 . HIS A 1 201 ? 24.467  133.639 -6.901  1.00 23.89 ? 201 HIS A CE1 1 
ATOM   1258 N  NE2 . HIS A 1 201 ? 24.744  134.315 -5.801  1.00 23.31 ? 201 HIS A NE2 1 
ATOM   1259 N  N   . ALA A 1 202 ? 31.036  133.305 -6.909  1.00 19.03 ? 202 ALA A N   1 
ATOM   1260 C  CA  . ALA A 1 202 ? 32.434  133.489 -7.284  1.00 20.45 ? 202 ALA A CA  1 
ATOM   1261 C  C   . ALA A 1 202 ? 33.080  132.150 -7.623  1.00 20.45 ? 202 ALA A C   1 
ATOM   1262 O  O   . ALA A 1 202 ? 33.736  132.013 -8.655  1.00 21.43 ? 202 ALA A O   1 
ATOM   1263 C  CB  . ALA A 1 202 ? 33.195  134.173 -6.154  1.00 18.24 ? 202 ALA A CB  1 
ATOM   1264 N  N   . TRP A 1 203 ? 32.893  131.159 -6.758  1.00 19.31 ? 203 TRP A N   1 
ATOM   1265 C  CA  . TRP A 1 203 ? 33.465  129.842 -7.005  1.00 19.87 ? 203 TRP A CA  1 
ATOM   1266 C  C   . TRP A 1 203 ? 32.868  129.193 -8.249  1.00 19.49 ? 203 TRP A C   1 
ATOM   1267 O  O   . TRP A 1 203 ? 33.580  128.537 -9.013  1.00 21.19 ? 203 TRP A O   1 
ATOM   1268 C  CB  . TRP A 1 203 ? 33.257  128.929 -5.791  1.00 18.70 ? 203 TRP A CB  1 
ATOM   1269 C  CG  . TRP A 1 203 ? 34.223  129.200 -4.676  1.00 21.43 ? 203 TRP A CG  1 
ATOM   1270 C  CD1 . TRP A 1 203 ? 33.940  129.729 -3.446  1.00 19.65 ? 203 TRP A CD1 1 
ATOM   1271 C  CD2 . TRP A 1 203 ? 35.636  128.964 -4.696  1.00 21.53 ? 203 TRP A CD2 1 
ATOM   1272 N  NE1 . TRP A 1 203 ? 35.089  129.837 -2.701  1.00 22.24 ? 203 TRP A NE1 1 
ATOM   1273 C  CE2 . TRP A 1 203 ? 36.146  129.374 -3.443  1.00 22.30 ? 203 TRP A CE2 1 
ATOM   1274 C  CE3 . TRP A 1 203 ? 36.522  128.444 -5.652  1.00 20.13 ? 203 TRP A CE3 1 
ATOM   1275 C  CZ2 . TRP A 1 203 ? 37.505  129.282 -3.120  1.00 20.60 ? 203 TRP A CZ2 1 
ATOM   1276 C  CZ3 . TRP A 1 203 ? 37.874  128.354 -5.331  1.00 21.03 ? 203 TRP A CZ3 1 
ATOM   1277 C  CH2 . TRP A 1 203 ? 38.351  128.772 -4.074  1.00 20.46 ? 203 TRP A CH2 1 
ATOM   1278 N  N   . GLN A 1 204 ? 31.565  129.374 -8.458  1.00 19.44 ? 204 GLN A N   1 
ATOM   1279 C  CA  . GLN A 1 204 ? 30.906  128.783 -9.620  1.00 17.77 ? 204 GLN A CA  1 
ATOM   1280 C  C   . GLN A 1 204 ? 31.447  129.400 -10.908 1.00 18.67 ? 204 GLN A C   1 
ATOM   1281 O  O   . GLN A 1 204 ? 31.698  128.698 -11.892 1.00 19.62 ? 204 GLN A O   1 
ATOM   1282 C  CB  . GLN A 1 204 ? 29.391  128.989 -9.543  1.00 19.20 ? 204 GLN A CB  1 
ATOM   1283 C  CG  . GLN A 1 204 ? 28.613  128.223 -10.620 1.00 20.59 ? 204 GLN A CG  1 
ATOM   1284 C  CD  . GLN A 1 204 ? 27.109  128.289 -10.417 1.00 23.39 ? 204 GLN A CD  1 
ATOM   1285 O  OE1 . GLN A 1 204 ? 26.614  128.081 -9.309  1.00 25.66 ? 204 GLN A OE1 1 
ATOM   1286 N  NE2 . GLN A 1 204 ? 26.374  128.566 -11.487 1.00 20.70 ? 204 GLN A NE2 1 
ATOM   1287 N  N   . HIS A 1 205 ? 31.627  130.716 -10.898 1.00 17.69 ? 205 HIS A N   1 
ATOM   1288 C  CA  . HIS A 1 205 ? 32.150  131.415 -12.062 1.00 19.17 ? 205 HIS A CA  1 
ATOM   1289 C  C   . HIS A 1 205 ? 33.594  130.966 -12.311 1.00 20.54 ? 205 HIS A C   1 
ATOM   1290 O  O   . HIS A 1 205 ? 34.019  130.812 -13.457 1.00 19.29 ? 205 HIS A O   1 
ATOM   1291 C  CB  . HIS A 1 205 ? 32.110  132.927 -11.832 1.00 20.98 ? 205 HIS A CB  1 
ATOM   1292 C  CG  . HIS A 1 205 ? 32.496  133.731 -13.035 1.00 22.04 ? 205 HIS A CG  1 
ATOM   1293 N  ND1 . HIS A 1 205 ? 31.688  133.842 -14.146 1.00 24.74 ? 205 HIS A ND1 1 
ATOM   1294 C  CD2 . HIS A 1 205 ? 33.612  134.448 -13.308 1.00 21.77 ? 205 HIS A CD2 1 
ATOM   1295 C  CE1 . HIS A 1 205 ? 32.290  134.593 -15.052 1.00 24.42 ? 205 HIS A CE1 1 
ATOM   1296 N  NE2 . HIS A 1 205 ? 33.459  134.973 -14.567 1.00 21.91 ? 205 HIS A NE2 1 
ATOM   1297 N  N   . ARG A 1 206 ? 34.336  130.745 -11.228 1.00 20.60 ? 206 ARG A N   1 
ATOM   1298 C  CA  . ARG A 1 206 ? 35.727  130.316 -11.325 1.00 21.39 ? 206 ARG A CA  1 
ATOM   1299 C  C   . ARG A 1 206 ? 35.837  128.937 -11.981 1.00 22.64 ? 206 ARG A C   1 
ATOM   1300 O  O   . ARG A 1 206 ? 36.688  128.727 -12.857 1.00 21.05 ? 206 ARG A O   1 
ATOM   1301 C  CB  . ARG A 1 206 ? 36.370  130.295 -9.931  1.00 22.66 ? 206 ARG A CB  1 
ATOM   1302 C  CG  . ARG A 1 206 ? 37.901  130.332 -9.947  1.00 22.33 ? 206 ARG A CG  1 
ATOM   1303 C  CD  . ARG A 1 206 ? 38.504  130.346 -8.539  1.00 22.50 ? 206 ARG A CD  1 
ATOM   1304 N  NE  . ARG A 1 206 ? 39.966  130.284 -8.584  1.00 21.60 ? 206 ARG A NE  1 
ATOM   1305 C  CZ  . ARG A 1 206 ? 40.769  131.336 -8.726  1.00 23.05 ? 206 ARG A CZ  1 
ATOM   1306 N  NH1 . ARG A 1 206 ? 40.269  132.561 -8.824  1.00 22.34 ? 206 ARG A NH1 1 
ATOM   1307 N  NH2 . ARG A 1 206 ? 42.081  131.159 -8.800  1.00 23.82 ? 206 ARG A NH2 1 
ATOM   1308 N  N   . GLN A 1 207 ? 34.981  128.000 -11.573 1.00 21.05 ? 207 GLN A N   1 
ATOM   1309 C  CA  . GLN A 1 207 ? 35.011  126.660 -12.153 1.00 22.27 ? 207 GLN A CA  1 
ATOM   1310 C  C   . GLN A 1 207 ? 34.673  126.717 -13.638 1.00 23.16 ? 207 GLN A C   1 
ATOM   1311 O  O   . GLN A 1 207 ? 35.271  126.001 -14.451 1.00 22.91 ? 207 GLN A O   1 
ATOM   1312 C  CB  . GLN A 1 207 ? 34.020  125.719 -11.450 1.00 21.83 ? 207 GLN A CB  1 
ATOM   1313 C  CG  . GLN A 1 207 ? 34.299  125.486 -9.973  1.00 20.26 ? 207 GLN A CG  1 
ATOM   1314 C  CD  . GLN A 1 207 ? 33.571  124.271 -9.424  1.00 21.39 ? 207 GLN A CD  1 
ATOM   1315 O  OE1 . GLN A 1 207 ? 32.527  123.865 -9.944  1.00 21.24 ? 207 GLN A OE1 1 
ATOM   1316 N  NE2 . GLN A 1 207 ? 34.112  123.692 -8.359  1.00 18.62 ? 207 GLN A NE2 1 
ATOM   1317 N  N   . TRP A 1 208 ? 33.710  127.563 -13.993 1.00 22.48 ? 208 TRP A N   1 
ATOM   1318 C  CA  . TRP A 1 208 ? 33.314  127.694 -15.388 1.00 22.37 ? 208 TRP A CA  1 
ATOM   1319 C  C   . TRP A 1 208 ? 34.481  128.169 -16.251 1.00 23.28 ? 208 TRP A C   1 
ATOM   1320 O  O   . TRP A 1 208 ? 34.796  127.557 -17.270 1.00 24.74 ? 208 TRP A O   1 
ATOM   1321 C  CB  . TRP A 1 208 ? 32.150  128.677 -15.545 1.00 20.61 ? 208 TRP A CB  1 
ATOM   1322 C  CG  . TRP A 1 208 ? 31.877  128.965 -16.993 1.00 20.79 ? 208 TRP A CG  1 
ATOM   1323 C  CD1 . TRP A 1 208 ? 31.399  128.085 -17.927 1.00 21.76 ? 208 TRP A CD1 1 
ATOM   1324 C  CD2 . TRP A 1 208 ? 32.185  130.171 -17.701 1.00 20.87 ? 208 TRP A CD2 1 
ATOM   1325 N  NE1 . TRP A 1 208 ? 31.400  128.667 -19.172 1.00 21.97 ? 208 TRP A NE1 1 
ATOM   1326 C  CE2 . TRP A 1 208 ? 31.876  129.948 -19.062 1.00 22.43 ? 208 TRP A CE2 1 
ATOM   1327 C  CE3 . TRP A 1 208 ? 32.695  131.419 -17.319 1.00 22.51 ? 208 TRP A CE3 1 
ATOM   1328 C  CZ2 . TRP A 1 208 ? 32.061  130.927 -20.044 1.00 23.31 ? 208 TRP A CZ2 1 
ATOM   1329 C  CZ3 . TRP A 1 208 ? 32.881  132.395 -18.297 1.00 23.49 ? 208 TRP A CZ3 1 
ATOM   1330 C  CH2 . TRP A 1 208 ? 32.563  132.141 -19.643 1.00 23.85 ? 208 TRP A CH2 1 
ATOM   1331 N  N   . VAL A 1 209 ? 35.108  129.267 -15.842 1.00 23.65 ? 209 VAL A N   1 
ATOM   1332 C  CA  . VAL A 1 209 ? 36.238  129.836 -16.575 1.00 24.34 ? 209 VAL A CA  1 
ATOM   1333 C  C   . VAL A 1 209 ? 37.377  128.833 -16.736 1.00 24.11 ? 209 VAL A C   1 
ATOM   1334 O  O   . VAL A 1 209 ? 37.913  128.647 -17.830 1.00 23.18 ? 209 VAL A O   1 
ATOM   1335 C  CB  . VAL A 1 209 ? 36.799  131.082 -15.857 1.00 25.85 ? 209 VAL A CB  1 
ATOM   1336 C  CG1 . VAL A 1 209 ? 38.007  131.622 -16.615 1.00 29.24 ? 209 VAL A CG1 1 
ATOM   1337 C  CG2 . VAL A 1 209 ? 35.727  132.151 -15.756 1.00 28.27 ? 209 VAL A CG2 1 
ATOM   1338 N  N   . ILE A 1 210 ? 37.748  128.196 -15.634 1.00 23.42 ? 210 ILE A N   1 
ATOM   1339 C  CA  . ILE A 1 210 ? 38.826  127.223 -15.648 1.00 24.89 ? 210 ILE A CA  1 
ATOM   1340 C  C   . ILE A 1 210 ? 38.539  126.086 -16.615 1.00 26.07 ? 210 ILE A C   1 
ATOM   1341 O  O   . ILE A 1 210 ? 39.393  125.715 -17.419 1.00 25.61 ? 210 ILE A O   1 
ATOM   1342 C  CB  . ILE A 1 210 ? 39.062  126.656 -14.233 1.00 23.55 ? 210 ILE A CB  1 
ATOM   1343 C  CG1 . ILE A 1 210 ? 39.695  127.740 -13.358 1.00 22.38 ? 210 ILE A CG1 1 
ATOM   1344 C  CG2 . ILE A 1 210 ? 39.941  125.405 -14.297 1.00 25.08 ? 210 ILE A CG2 1 
ATOM   1345 C  CD1 . ILE A 1 210 ? 39.851  127.356 -11.897 1.00 23.68 ? 210 ILE A CD1 1 
ATOM   1346 N  N   . GLN A 1 211 ? 37.329  125.544 -16.548 1.00 27.28 ? 211 GLN A N   1 
ATOM   1347 C  CA  . GLN A 1 211 ? 36.955  124.440 -17.418 1.00 29.46 ? 211 GLN A CA  1 
ATOM   1348 C  C   . GLN A 1 211 ? 36.737  124.864 -18.868 1.00 29.74 ? 211 GLN A C   1 
ATOM   1349 O  O   . GLN A 1 211 ? 37.153  124.167 -19.790 1.00 29.10 ? 211 GLN A O   1 
ATOM   1350 C  CB  . GLN A 1 211 ? 35.700  123.751 -16.877 1.00 32.31 ? 211 GLN A CB  1 
ATOM   1351 C  CG  . GLN A 1 211 ? 35.322  122.488 -17.633 1.00 38.64 ? 211 GLN A CG  1 
ATOM   1352 C  CD  . GLN A 1 211 ? 34.535  121.513 -16.778 1.00 42.87 ? 211 GLN A CD  1 
ATOM   1353 O  OE1 . GLN A 1 211 ? 33.448  121.831 -16.289 1.00 44.62 ? 211 GLN A OE1 1 
ATOM   1354 N  NE2 . GLN A 1 211 ? 35.085  120.317 -16.588 1.00 43.48 ? 211 GLN A NE2 1 
ATOM   1355 N  N   . GLU A 1 212 ? 36.098  126.010 -19.071 1.00 29.29 ? 212 GLU A N   1 
ATOM   1356 C  CA  . GLU A 1 212 ? 35.831  126.493 -20.419 1.00 29.79 ? 212 GLU A CA  1 
ATOM   1357 C  C   . GLU A 1 212 ? 37.090  126.917 -21.169 1.00 29.92 ? 212 GLU A C   1 
ATOM   1358 O  O   . GLU A 1 212 ? 37.202  126.697 -22.375 1.00 30.06 ? 212 GLU A O   1 
ATOM   1359 C  CB  . GLU A 1 212 ? 34.851  127.669 -20.376 1.00 29.99 ? 212 GLU A CB  1 
ATOM   1360 C  CG  . GLU A 1 212 ? 34.565  128.278 -21.740 1.00 33.00 ? 212 GLU A CG  1 
ATOM   1361 C  CD  . GLU A 1 212 ? 33.840  127.326 -22.673 1.00 34.86 ? 212 GLU A CD  1 
ATOM   1362 O  OE1 . GLU A 1 212 ? 33.775  127.622 -23.883 1.00 37.46 ? 212 GLU A OE1 1 
ATOM   1363 O  OE2 . GLU A 1 212 ? 33.328  126.288 -22.202 1.00 36.55 ? 212 GLU A OE2 1 
ATOM   1364 N  N   . PHE A 1 213 ? 38.039  127.521 -20.465 1.00 29.44 ? 213 PHE A N   1 
ATOM   1365 C  CA  . PHE A 1 213 ? 39.261  127.977 -21.114 1.00 30.14 ? 213 PHE A CA  1 
ATOM   1366 C  C   . PHE A 1 213 ? 40.502  127.175 -20.748 1.00 30.95 ? 213 PHE A C   1 
ATOM   1367 O  O   . PHE A 1 213 ? 41.624  127.575 -21.067 1.00 30.84 ? 213 PHE A O   1 
ATOM   1368 C  CB  . PHE A 1 213 ? 39.483  129.462 -20.819 1.00 28.50 ? 213 PHE A CB  1 
ATOM   1369 C  CG  . PHE A 1 213 ? 38.374  130.345 -21.321 1.00 30.18 ? 213 PHE A CG  1 
ATOM   1370 C  CD1 . PHE A 1 213 ? 37.261  130.611 -20.527 1.00 29.33 ? 213 PHE A CD1 1 
ATOM   1371 C  CD2 . PHE A 1 213 ? 38.424  130.880 -22.608 1.00 30.93 ? 213 PHE A CD2 1 
ATOM   1372 C  CE1 . PHE A 1 213 ? 36.209  131.400 -21.007 1.00 29.83 ? 213 PHE A CE1 1 
ATOM   1373 C  CE2 . PHE A 1 213 ? 37.379  131.670 -23.102 1.00 31.62 ? 213 PHE A CE2 1 
ATOM   1374 C  CZ  . PHE A 1 213 ? 36.268  131.930 -22.297 1.00 31.56 ? 213 PHE A CZ  1 
ATOM   1375 N  N   . LYS A 1 214 ? 40.292  126.043 -20.080 1.00 30.96 ? 214 LYS A N   1 
ATOM   1376 C  CA  . LYS A 1 214 ? 41.378  125.153 -19.676 1.00 32.75 ? 214 LYS A CA  1 
ATOM   1377 C  C   . LYS A 1 214 ? 42.500  125.855 -18.919 1.00 31.91 ? 214 LYS A C   1 
ATOM   1378 O  O   . LYS A 1 214 ? 43.658  125.795 -19.326 1.00 32.25 ? 214 LYS A O   1 
ATOM   1379 C  CB  . LYS A 1 214 ? 41.963  124.453 -20.909 1.00 34.62 ? 214 LYS A CB  1 
ATOM   1380 C  CG  . LYS A 1 214 ? 40.912  123.844 -21.826 1.00 38.31 ? 214 LYS A CG  1 
ATOM   1381 C  CD  . LYS A 1 214 ? 41.542  123.187 -23.044 1.00 43.33 ? 214 LYS A CD  1 
ATOM   1382 C  CE  . LYS A 1 214 ? 40.488  122.836 -24.085 1.00 46.45 ? 214 LYS A CE  1 
ATOM   1383 N  NZ  . LYS A 1 214 ? 39.407  121.979 -23.520 1.00 48.35 ? 214 LYS A NZ  1 
ATOM   1384 N  N   . LEU A 1 215 ? 42.159  126.511 -17.815 1.00 31.03 ? 215 LEU A N   1 
ATOM   1385 C  CA  . LEU A 1 215 ? 43.150  127.213 -17.004 1.00 29.90 ? 215 LEU A CA  1 
ATOM   1386 C  C   . LEU A 1 215 ? 43.399  126.448 -15.702 1.00 30.13 ? 215 LEU A C   1 
ATOM   1387 O  O   . LEU A 1 215 ? 43.249  126.995 -14.609 1.00 29.20 ? 215 LEU A O   1 
ATOM   1388 C  CB  . LEU A 1 215 ? 42.655  128.629 -16.695 1.00 29.51 ? 215 LEU A CB  1 
ATOM   1389 C  CG  . LEU A 1 215 ? 42.313  129.501 -17.908 1.00 30.69 ? 215 LEU A CG  1 
ATOM   1390 C  CD1 . LEU A 1 215 ? 41.745  130.834 -17.443 1.00 29.88 ? 215 LEU A CD1 1 
ATOM   1391 C  CD2 . LEU A 1 215 ? 43.565  129.720 -18.752 1.00 31.00 ? 215 LEU A CD2 1 
ATOM   1392 N  N   . TRP A 1 216 ? 43.802  125.185 -15.830 1.00 30.13 ? 216 TRP A N   1 
ATOM   1393 C  CA  . TRP A 1 216 ? 44.044  124.317 -14.675 1.00 30.49 ? 216 TRP A CA  1 
ATOM   1394 C  C   . TRP A 1 216 ? 45.404  124.456 -14.002 1.00 31.16 ? 216 TRP A C   1 
ATOM   1395 O  O   . TRP A 1 216 ? 45.547  124.209 -12.802 1.00 32.18 ? 216 TRP A O   1 
ATOM   1396 C  CB  . TRP A 1 216 ? 43.880  122.853 -15.085 1.00 29.29 ? 216 TRP A CB  1 
ATOM   1397 C  CG  . TRP A 1 216 ? 42.594  122.547 -15.763 1.00 27.81 ? 216 TRP A CG  1 
ATOM   1398 C  CD1 . TRP A 1 216 ? 42.368  122.489 -17.108 1.00 26.23 ? 216 TRP A CD1 1 
ATOM   1399 C  CD2 . TRP A 1 216 ? 41.345  122.264 -15.131 1.00 26.14 ? 216 TRP A CD2 1 
ATOM   1400 N  NE1 . TRP A 1 216 ? 41.052  122.186 -17.354 1.00 25.78 ? 216 TRP A NE1 1 
ATOM   1401 C  CE2 . TRP A 1 216 ? 40.399  122.043 -16.157 1.00 27.42 ? 216 TRP A CE2 1 
ATOM   1402 C  CE3 . TRP A 1 216 ? 40.930  122.176 -13.794 1.00 26.09 ? 216 TRP A CE3 1 
ATOM   1403 C  CZ2 . TRP A 1 216 ? 39.057  121.739 -15.890 1.00 26.24 ? 216 TRP A CZ2 1 
ATOM   1404 C  CZ3 . TRP A 1 216 ? 39.593  121.872 -13.526 1.00 25.33 ? 216 TRP A CZ3 1 
ATOM   1405 C  CH2 . TRP A 1 216 ? 38.675  121.658 -14.572 1.00 26.44 ? 216 TRP A CH2 1 
ATOM   1406 N  N   . ASP A 1 217 ? 46.399  124.841 -14.790 1.00 32.70 ? 217 ASP A N   1 
ATOM   1407 C  CA  . ASP A 1 217 ? 47.779  124.974 -14.336 1.00 32.23 ? 217 ASP A CA  1 
ATOM   1408 C  C   . ASP A 1 217 ? 48.107  125.435 -12.920 1.00 30.82 ? 217 ASP A C   1 
ATOM   1409 O  O   . ASP A 1 217 ? 48.936  124.817 -12.250 1.00 31.97 ? 217 ASP A O   1 
ATOM   1410 C  CB  . ASP A 1 217 ? 48.547  125.848 -15.328 1.00 36.22 ? 217 ASP A CB  1 
ATOM   1411 C  CG  . ASP A 1 217 ? 48.696  125.189 -16.686 1.00 39.59 ? 217 ASP A CG  1 
ATOM   1412 O  OD1 . ASP A 1 217 ? 49.251  125.832 -17.598 1.00 45.50 ? 217 ASP A OD1 1 
ATOM   1413 O  OD2 . ASP A 1 217 ? 48.263  124.027 -16.842 1.00 40.78 ? 217 ASP A OD2 1 
ATOM   1414 N  N   . ASN A 1 218 ? 47.480  126.504 -12.449 1.00 28.30 ? 218 ASN A N   1 
ATOM   1415 C  CA  . ASN A 1 218 ? 47.814  127.008 -11.121 1.00 28.36 ? 218 ASN A CA  1 
ATOM   1416 C  C   . ASN A 1 218 ? 46.738  126.910 -10.051 1.00 26.90 ? 218 ASN A C   1 
ATOM   1417 O  O   . ASN A 1 218 ? 46.937  127.395 -8.938  1.00 25.97 ? 218 ASN A O   1 
ATOM   1418 C  CB  . ASN A 1 218 ? 48.253  128.471 -11.231 1.00 30.42 ? 218 ASN A CB  1 
ATOM   1419 C  CG  . ASN A 1 218 ? 49.399  128.662 -12.202 1.00 33.03 ? 218 ASN A CG  1 
ATOM   1420 O  OD1 . ASN A 1 218 ? 50.482  128.111 -12.013 1.00 34.33 ? 218 ASN A OD1 1 
ATOM   1421 N  ND2 . ASN A 1 218 ? 49.165  129.444 -13.251 1.00 33.26 ? 218 ASN A ND2 1 
ATOM   1422 N  N   . GLU A 1 219 ? 45.614  126.274 -10.359 1.00 26.72 ? 219 GLU A N   1 
ATOM   1423 C  CA  . GLU A 1 219 ? 44.533  126.205 -9.384  1.00 26.38 ? 219 GLU A CA  1 
ATOM   1424 C  C   . GLU A 1 219 ? 44.814  125.391 -8.120  1.00 27.12 ? 219 GLU A C   1 
ATOM   1425 O  O   . GLU A 1 219 ? 44.352  125.757 -7.039  1.00 27.23 ? 219 GLU A O   1 
ATOM   1426 C  CB  . GLU A 1 219 ? 43.246  125.709 -10.054 1.00 25.66 ? 219 GLU A CB  1 
ATOM   1427 C  CG  . GLU A 1 219 ? 41.997  125.912 -9.199  1.00 23.35 ? 219 GLU A CG  1 
ATOM   1428 C  CD  . GLU A 1 219 ? 41.631  127.378 -8.988  1.00 24.38 ? 219 GLU A CD  1 
ATOM   1429 O  OE1 . GLU A 1 219 ? 42.431  128.272 -9.346  1.00 23.18 ? 219 GLU A OE1 1 
ATOM   1430 O  OE2 . GLU A 1 219 ? 40.530  127.637 -8.452  1.00 23.41 ? 219 GLU A OE2 1 
ATOM   1431 N  N   . LEU A 1 220 ? 45.565  124.299 -8.233  1.00 28.50 ? 220 LEU A N   1 
ATOM   1432 C  CA  . LEU A 1 220 ? 45.860  123.494 -7.049  1.00 28.44 ? 220 LEU A CA  1 
ATOM   1433 C  C   . LEU A 1 220 ? 46.713  124.302 -6.070  1.00 28.78 ? 220 LEU A C   1 
ATOM   1434 O  O   . LEU A 1 220 ? 46.586  124.157 -4.852  1.00 28.07 ? 220 LEU A O   1 
ATOM   1435 C  CB  . LEU A 1 220 ? 46.576  122.194 -7.439  1.00 28.79 ? 220 LEU A CB  1 
ATOM   1436 C  CG  . LEU A 1 220 ? 46.794  121.176 -6.310  1.00 30.31 ? 220 LEU A CG  1 
ATOM   1437 C  CD1 . LEU A 1 220 ? 45.467  120.849 -5.627  1.00 29.73 ? 220 LEU A CD1 1 
ATOM   1438 C  CD2 . LEU A 1 220 ? 47.420  119.914 -6.882  1.00 29.62 ? 220 LEU A CD2 1 
ATOM   1439 N  N   . GLN A 1 221 ? 47.579  125.159 -6.602  1.00 29.10 ? 221 GLN A N   1 
ATOM   1440 C  CA  . GLN A 1 221 ? 48.422  126.001 -5.755  1.00 29.09 ? 221 GLN A CA  1 
ATOM   1441 C  C   . GLN A 1 221 ? 47.519  127.014 -5.055  1.00 26.65 ? 221 GLN A C   1 
ATOM   1442 O  O   . GLN A 1 221 ? 47.726  127.344 -3.890  1.00 24.72 ? 221 GLN A O   1 
ATOM   1443 C  CB  . GLN A 1 221 ? 49.453  126.765 -6.592  1.00 32.58 ? 221 GLN A CB  1 
ATOM   1444 C  CG  . GLN A 1 221 ? 50.341  125.903 -7.463  1.00 39.46 ? 221 GLN A CG  1 
ATOM   1445 C  CD  . GLN A 1 221 ? 51.182  126.735 -8.416  1.00 43.65 ? 221 GLN A CD  1 
ATOM   1446 O  OE1 . GLN A 1 221 ? 51.943  127.608 -7.989  1.00 44.50 ? 221 GLN A OE1 1 
ATOM   1447 N  NE2 . GLN A 1 221 ? 51.046  126.471 -9.715  1.00 43.55 ? 221 GLN A NE2 1 
ATOM   1448 N  N   . TYR A 1 222 ? 46.529  127.517 -5.788  1.00 25.31 ? 222 TYR A N   1 
ATOM   1449 C  CA  . TYR A 1 222 ? 45.587  128.491 -5.237  1.00 25.62 ? 222 TYR A CA  1 
ATOM   1450 C  C   . TYR A 1 222 ? 44.792  127.826 -4.114  1.00 25.20 ? 222 TYR A C   1 
ATOM   1451 O  O   . TYR A 1 222 ? 44.583  128.411 -3.049  1.00 24.84 ? 222 TYR A O   1 
ATOM   1452 C  CB  . TYR A 1 222 ? 44.634  128.985 -6.327  1.00 24.29 ? 222 TYR A CB  1 
ATOM   1453 C  CG  . TYR A 1 222 ? 43.678  130.055 -5.851  1.00 25.93 ? 222 TYR A CG  1 
ATOM   1454 C  CD1 . TYR A 1 222 ? 44.154  131.281 -5.383  1.00 26.54 ? 222 TYR A CD1 1 
ATOM   1455 C  CD2 . TYR A 1 222 ? 42.298  129.841 -5.856  1.00 25.12 ? 222 TYR A CD2 1 
ATOM   1456 C  CE1 . TYR A 1 222 ? 43.282  132.268 -4.929  1.00 26.86 ? 222 TYR A CE1 1 
ATOM   1457 C  CE2 . TYR A 1 222 ? 41.415  130.823 -5.405  1.00 24.94 ? 222 TYR A CE2 1 
ATOM   1458 C  CZ  . TYR A 1 222 ? 41.916  132.032 -4.943  1.00 26.16 ? 222 TYR A CZ  1 
ATOM   1459 O  OH  . TYR A 1 222 ? 41.058  133.008 -4.497  1.00 26.16 ? 222 TYR A OH  1 
ATOM   1460 N  N   . VAL A 1 223 ? 44.356  126.594 -4.367  1.00 25.12 ? 223 VAL A N   1 
ATOM   1461 C  CA  . VAL A 1 223 ? 43.608  125.825 -3.382  1.00 24.16 ? 223 VAL A CA  1 
ATOM   1462 C  C   . VAL A 1 223 ? 44.447  125.670 -2.113  1.00 25.11 ? 223 VAL A C   1 
ATOM   1463 O  O   . VAL A 1 223 ? 43.962  125.913 -1.007  1.00 24.17 ? 223 VAL A O   1 
ATOM   1464 C  CB  . VAL A 1 223 ? 43.237  124.421 -3.939  1.00 23.03 ? 223 VAL A CB  1 
ATOM   1465 C  CG1 . VAL A 1 223 ? 42.809  123.494 -2.811  1.00 20.75 ? 223 VAL A CG1 1 
ATOM   1466 C  CG2 . VAL A 1 223 ? 42.104  124.553 -4.959  1.00 21.61 ? 223 VAL A CG2 1 
ATOM   1467 N  N   . ASP A 1 224 ? 45.710  125.280 -2.277  1.00 25.98 ? 224 ASP A N   1 
ATOM   1468 C  CA  . ASP A 1 224 ? 46.594  125.097 -1.129  1.00 27.30 ? 224 ASP A CA  1 
ATOM   1469 C  C   . ASP A 1 224 ? 46.782  126.373 -0.318  1.00 26.11 ? 224 ASP A C   1 
ATOM   1470 O  O   . ASP A 1 224 ? 46.881  126.324 0.905   1.00 25.52 ? 224 ASP A O   1 
ATOM   1471 C  CB  . ASP A 1 224 ? 47.965  124.576 -1.568  1.00 28.95 ? 224 ASP A CB  1 
ATOM   1472 C  CG  . ASP A 1 224 ? 47.914  123.149 -2.062  1.00 30.95 ? 224 ASP A CG  1 
ATOM   1473 O  OD1 . ASP A 1 224 ? 47.052  122.384 -1.577  1.00 33.09 ? 224 ASP A OD1 1 
ATOM   1474 O  OD2 . ASP A 1 224 ? 48.742  122.789 -2.923  1.00 31.58 ? 224 ASP A OD2 1 
ATOM   1475 N  N   . GLN A 1 225 ? 46.839  127.514 -0.992  1.00 25.63 ? 225 GLN A N   1 
ATOM   1476 C  CA  . GLN A 1 225 ? 47.012  128.773 -0.285  1.00 27.43 ? 225 GLN A CA  1 
ATOM   1477 C  C   . GLN A 1 225 ? 45.791  129.087 0.576   1.00 26.72 ? 225 GLN A C   1 
ATOM   1478 O  O   . GLN A 1 225 ? 45.929  129.474 1.736   1.00 27.37 ? 225 GLN A O   1 
ATOM   1479 C  CB  . GLN A 1 225 ? 47.260  129.914 -1.275  1.00 30.77 ? 225 GLN A CB  1 
ATOM   1480 C  CG  . GLN A 1 225 ? 47.473  131.276 -0.620  1.00 36.30 ? 225 GLN A CG  1 
ATOM   1481 C  CD  . GLN A 1 225 ? 48.514  131.243 0.491   1.00 41.23 ? 225 GLN A CD  1 
ATOM   1482 O  OE1 . GLN A 1 225 ? 49.606  130.692 0.323   1.00 45.20 ? 225 GLN A OE1 1 
ATOM   1483 N  NE2 . GLN A 1 225 ? 48.184  131.843 1.632   1.00 41.37 ? 225 GLN A NE2 1 
ATOM   1484 N  N   . LEU A 1 226 ? 44.599  128.911 0.012   1.00 25.82 ? 226 LEU A N   1 
ATOM   1485 C  CA  . LEU A 1 226 ? 43.374  129.192 0.751   1.00 25.60 ? 226 LEU A CA  1 
ATOM   1486 C  C   . LEU A 1 226 ? 43.141  128.215 1.900   1.00 25.24 ? 226 LEU A C   1 
ATOM   1487 O  O   . LEU A 1 226 ? 42.556  128.580 2.916   1.00 25.32 ? 226 LEU A O   1 
ATOM   1488 C  CB  . LEU A 1 226 ? 42.165  129.202 -0.191  1.00 25.48 ? 226 LEU A CB  1 
ATOM   1489 C  CG  . LEU A 1 226 ? 42.140  130.297 -1.271  1.00 27.59 ? 226 LEU A CG  1 
ATOM   1490 C  CD1 . LEU A 1 226 ? 40.713  130.485 -1.765  1.00 26.45 ? 226 LEU A CD1 1 
ATOM   1491 C  CD2 . LEU A 1 226 ? 42.655  131.611 -0.713  1.00 27.25 ? 226 LEU A CD2 1 
ATOM   1492 N  N   . LEU A 1 227 ? 43.588  126.973 1.743   1.00 26.11 ? 227 LEU A N   1 
ATOM   1493 C  CA  . LEU A 1 227 ? 43.428  125.988 2.810   1.00 26.39 ? 227 LEU A CA  1 
ATOM   1494 C  C   . LEU A 1 227 ? 44.350  126.357 3.968   1.00 27.84 ? 227 LEU A C   1 
ATOM   1495 O  O   . LEU A 1 227 ? 44.032  126.107 5.132   1.00 26.92 ? 227 LEU A O   1 
ATOM   1496 C  CB  . LEU A 1 227 ? 43.754  124.578 2.307   1.00 25.87 ? 227 LEU A CB  1 
ATOM   1497 C  CG  . LEU A 1 227 ? 42.669  123.900 1.467   1.00 27.08 ? 227 LEU A CG  1 
ATOM   1498 C  CD1 . LEU A 1 227 ? 43.149  122.534 1.007   1.00 28.61 ? 227 LEU A CD1 1 
ATOM   1499 C  CD2 . LEU A 1 227 ? 41.392  123.762 2.294   1.00 26.87 ? 227 LEU A CD2 1 
ATOM   1500 N  N   . LYS A 1 228 ? 45.494  126.958 3.647   1.00 28.45 ? 228 LYS A N   1 
ATOM   1501 C  CA  . LYS A 1 228 ? 46.433  127.369 4.683   1.00 29.92 ? 228 LYS A CA  1 
ATOM   1502 C  C   . LYS A 1 228 ? 45.803  128.506 5.479   1.00 28.42 ? 228 LYS A C   1 
ATOM   1503 O  O   . LYS A 1 228 ? 45.970  128.593 6.694   1.00 28.32 ? 228 LYS A O   1 
ATOM   1504 C  CB  . LYS A 1 228 ? 47.754  127.835 4.065   1.00 33.07 ? 228 LYS A CB  1 
ATOM   1505 C  CG  . LYS A 1 228 ? 48.783  128.283 5.095   1.00 39.01 ? 228 LYS A CG  1 
ATOM   1506 C  CD  . LYS A 1 228 ? 50.090  128.717 4.439   1.00 43.57 ? 228 LYS A CD  1 
ATOM   1507 C  CE  . LYS A 1 228 ? 51.099  129.206 5.474   1.00 45.87 ? 228 LYS A CE  1 
ATOM   1508 N  NZ  . LYS A 1 228 ? 51.470  128.144 6.457   1.00 47.73 ? 228 LYS A NZ  1 
ATOM   1509 N  N   . GLU A 1 229 ? 45.072  129.373 4.787   1.00 26.21 ? 229 GLU A N   1 
ATOM   1510 C  CA  . GLU A 1 229 ? 44.402  130.495 5.436   1.00 27.90 ? 229 GLU A CA  1 
ATOM   1511 C  C   . GLU A 1 229 ? 43.241  130.009 6.309   1.00 26.18 ? 229 GLU A C   1 
ATOM   1512 O  O   . GLU A 1 229 ? 43.098  130.431 7.456   1.00 26.89 ? 229 GLU A O   1 
ATOM   1513 C  CB  . GLU A 1 229 ? 43.907  131.486 4.379   1.00 29.10 ? 229 GLU A CB  1 
ATOM   1514 C  CG  . GLU A 1 229 ? 45.025  132.326 3.774   1.00 32.69 ? 229 GLU A CG  1 
ATOM   1515 C  CD  . GLU A 1 229 ? 44.590  133.105 2.545   1.00 35.62 ? 229 GLU A CD  1 
ATOM   1516 O  OE1 . GLU A 1 229 ? 43.419  133.535 2.486   1.00 35.83 ? 229 GLU A OE1 1 
ATOM   1517 O  OE2 . GLU A 1 229 ? 45.431  133.298 1.641   1.00 37.64 ? 229 GLU A OE2 1 
ATOM   1518 N  N   . ASP A 1 230 ? 42.415  129.122 5.765   1.00 23.93 ? 230 ASP A N   1 
ATOM   1519 C  CA  . ASP A 1 230 ? 41.297  128.566 6.520   1.00 23.64 ? 230 ASP A CA  1 
ATOM   1520 C  C   . ASP A 1 230 ? 41.053  127.134 6.054   1.00 23.44 ? 230 ASP A C   1 
ATOM   1521 O  O   . ASP A 1 230 ? 40.354  126.898 5.064   1.00 22.52 ? 230 ASP A O   1 
ATOM   1522 C  CB  . ASP A 1 230 ? 40.026  129.401 6.321   1.00 22.70 ? 230 ASP A CB  1 
ATOM   1523 C  CG  . ASP A 1 230 ? 38.901  128.989 7.264   1.00 24.11 ? 230 ASP A CG  1 
ATOM   1524 O  OD1 . ASP A 1 230 ? 39.006  127.909 7.891   1.00 23.09 ? 230 ASP A OD1 1 
ATOM   1525 O  OD2 . ASP A 1 230 ? 37.908  129.741 7.375   1.00 25.89 ? 230 ASP A OD2 1 
ATOM   1526 N  N   . VAL A 1 231 ? 41.639  126.182 6.775   1.00 22.86 ? 231 VAL A N   1 
ATOM   1527 C  CA  . VAL A 1 231 ? 41.507  124.774 6.437   1.00 22.29 ? 231 VAL A CA  1 
ATOM   1528 C  C   . VAL A 1 231 ? 40.069  124.274 6.597   1.00 22.19 ? 231 VAL A C   1 
ATOM   1529 O  O   . VAL A 1 231 ? 39.750  123.155 6.194   1.00 21.71 ? 231 VAL A O   1 
ATOM   1530 C  CB  . VAL A 1 231 ? 42.470  123.909 7.302   1.00 23.21 ? 231 VAL A CB  1 
ATOM   1531 C  CG1 . VAL A 1 231 ? 41.981  123.845 8.741   1.00 21.57 ? 231 VAL A CG1 1 
ATOM   1532 C  CG2 . VAL A 1 231 ? 42.604  122.522 6.702   1.00 24.62 ? 231 VAL A CG2 1 
ATOM   1533 N  N   . ARG A 1 232 ? 39.206  125.107 7.178   1.00 21.44 ? 232 ARG A N   1 
ATOM   1534 C  CA  . ARG A 1 232 ? 37.800  124.744 7.369   1.00 21.92 ? 232 ARG A CA  1 
ATOM   1535 C  C   . ARG A 1 232 ? 36.923  125.236 6.223   1.00 22.14 ? 232 ARG A C   1 
ATOM   1536 O  O   . ARG A 1 232 ? 35.709  125.028 6.234   1.00 21.55 ? 232 ARG A O   1 
ATOM   1537 C  CB  . ARG A 1 232 ? 37.250  125.331 8.678   1.00 21.23 ? 232 ARG A CB  1 
ATOM   1538 C  CG  . ARG A 1 232 ? 37.901  124.808 9.955   1.00 20.51 ? 232 ARG A CG  1 
ATOM   1539 C  CD  . ARG A 1 232 ? 37.122  125.286 11.176  1.00 17.86 ? 232 ARG A CD  1 
ATOM   1540 N  NE  . ARG A 1 232 ? 37.672  124.773 12.429  1.00 19.14 ? 232 ARG A NE  1 
ATOM   1541 C  CZ  . ARG A 1 232 ? 38.728  125.284 13.058  1.00 20.55 ? 232 ARG A CZ  1 
ATOM   1542 N  NH1 . ARG A 1 232 ? 39.365  126.337 12.556  1.00 18.44 ? 232 ARG A NH1 1 
ATOM   1543 N  NH2 . ARG A 1 232 ? 39.145  124.745 14.197  1.00 21.37 ? 232 ARG A NH2 1 
ATOM   1544 N  N   . ASN A 1 233 ? 37.527  125.895 5.239   1.00 22.16 ? 233 ASN A N   1 
ATOM   1545 C  CA  . ASN A 1 233 ? 36.763  126.421 4.113   1.00 21.22 ? 233 ASN A CA  1 
ATOM   1546 C  C   . ASN A 1 233 ? 36.303  125.284 3.201   1.00 20.36 ? 233 ASN A C   1 
ATOM   1547 O  O   . ASN A 1 233 ? 37.054  124.820 2.344   1.00 19.47 ? 233 ASN A O   1 
ATOM   1548 C  CB  . ASN A 1 233 ? 37.610  127.421 3.320   1.00 21.71 ? 233 ASN A CB  1 
ATOM   1549 C  CG  . ASN A 1 233 ? 36.799  128.173 2.285   1.00 23.05 ? 233 ASN A CG  1 
ATOM   1550 O  OD1 . ASN A 1 233 ? 35.790  127.672 1.796   1.00 23.13 ? 233 ASN A OD1 1 
ATOM   1551 N  ND2 . ASN A 1 233 ? 37.243  129.376 1.933   1.00 21.82 ? 233 ASN A ND2 1 
ATOM   1552 N  N   . ASN A 1 234 ? 35.060  124.844 3.384   1.00 19.34 ? 234 ASN A N   1 
ATOM   1553 C  CA  . ASN A 1 234 ? 34.519  123.750 2.585   1.00 17.89 ? 234 ASN A CA  1 
ATOM   1554 C  C   . ASN A 1 234 ? 34.499  124.042 1.085   1.00 18.14 ? 234 ASN A C   1 
ATOM   1555 O  O   . ASN A 1 234 ? 34.593  123.125 0.276   1.00 18.08 ? 234 ASN A O   1 
ATOM   1556 C  CB  . ASN A 1 234 ? 33.106  123.400 3.049   1.00 17.17 ? 234 ASN A CB  1 
ATOM   1557 C  CG  . ASN A 1 234 ? 32.651  122.052 2.536   1.00 19.19 ? 234 ASN A CG  1 
ATOM   1558 O  OD1 . ASN A 1 234 ? 33.212  121.018 2.903   1.00 19.73 ? 234 ASN A OD1 1 
ATOM   1559 N  ND2 . ASN A 1 234 ? 31.637  122.053 1.677   1.00 18.49 ? 234 ASN A ND2 1 
ATOM   1560 N  N   . SER A 1 235 ? 34.368  125.310 0.709   1.00 17.29 ? 235 SER A N   1 
ATOM   1561 C  CA  . SER A 1 235 ? 34.355  125.662 -0.710  1.00 18.72 ? 235 SER A CA  1 
ATOM   1562 C  C   . SER A 1 235 ? 35.704  125.345 -1.359  1.00 19.56 ? 235 SER A C   1 
ATOM   1563 O  O   . SER A 1 235 ? 35.766  124.996 -2.539  1.00 18.84 ? 235 SER A O   1 
ATOM   1564 C  CB  . SER A 1 235 ? 34.048  127.150 -0.900  1.00 16.70 ? 235 SER A CB  1 
ATOM   1565 O  OG  . SER A 1 235 ? 32.747  127.468 -0.450  1.00 19.51 ? 235 SER A OG  1 
ATOM   1566 N  N   . VAL A 1 236 ? 36.782  125.478 -0.591  1.00 20.03 ? 236 VAL A N   1 
ATOM   1567 C  CA  . VAL A 1 236 ? 38.114  125.203 -1.118  1.00 20.76 ? 236 VAL A CA  1 
ATOM   1568 C  C   . VAL A 1 236 ? 38.346  123.698 -1.262  1.00 20.58 ? 236 VAL A C   1 
ATOM   1569 O  O   . VAL A 1 236 ? 38.981  123.257 -2.219  1.00 20.59 ? 236 VAL A O   1 
ATOM   1570 C  CB  . VAL A 1 236 ? 39.204  125.838 -0.229  1.00 21.38 ? 236 VAL A CB  1 
ATOM   1571 C  CG1 . VAL A 1 236 ? 40.589  125.545 -0.801  1.00 20.66 ? 236 VAL A CG1 1 
ATOM   1572 C  CG2 . VAL A 1 236 ? 38.980  127.351 -0.154  1.00 21.09 ? 236 VAL A CG2 1 
ATOM   1573 N  N   . TRP A 1 237 ? 37.831  122.910 -0.322  1.00 19.10 ? 237 TRP A N   1 
ATOM   1574 C  CA  . TRP A 1 237 ? 37.970  121.461 -0.419  1.00 19.76 ? 237 TRP A CA  1 
ATOM   1575 C  C   . TRP A 1 237 ? 37.205  120.973 -1.643  1.00 18.94 ? 237 TRP A C   1 
ATOM   1576 O  O   . TRP A 1 237 ? 37.599  120.002 -2.287  1.00 19.43 ? 237 TRP A O   1 
ATOM   1577 C  CB  . TRP A 1 237 ? 37.417  120.765 0.828   1.00 20.16 ? 237 TRP A CB  1 
ATOM   1578 C  CG  . TRP A 1 237 ? 38.309  120.879 2.025   1.00 22.10 ? 237 TRP A CG  1 
ATOM   1579 C  CD1 . TRP A 1 237 ? 38.223  121.797 3.031   1.00 22.81 ? 237 TRP A CD1 1 
ATOM   1580 C  CD2 . TRP A 1 237 ? 39.437  120.048 2.333   1.00 21.62 ? 237 TRP A CD2 1 
ATOM   1581 N  NE1 . TRP A 1 237 ? 39.227  121.589 3.949   1.00 23.72 ? 237 TRP A NE1 1 
ATOM   1582 C  CE2 . TRP A 1 237 ? 39.987  120.523 3.544   1.00 22.19 ? 237 TRP A CE2 1 
ATOM   1583 C  CE3 . TRP A 1 237 ? 40.036  118.950 1.703   1.00 21.89 ? 237 TRP A CE3 1 
ATOM   1584 C  CZ2 . TRP A 1 237 ? 41.110  119.936 4.139   1.00 23.65 ? 237 TRP A CZ2 1 
ATOM   1585 C  CZ3 . TRP A 1 237 ? 41.153  118.365 2.295   1.00 23.67 ? 237 TRP A CZ3 1 
ATOM   1586 C  CH2 . TRP A 1 237 ? 41.677  118.862 3.501   1.00 22.24 ? 237 TRP A CH2 1 
ATOM   1587 N  N   . ASN A 1 238 ? 36.097  121.642 -1.955  1.00 18.62 ? 238 ASN A N   1 
ATOM   1588 C  CA  . ASN A 1 238 ? 35.304  121.270 -3.120  1.00 19.03 ? 238 ASN A CA  1 
ATOM   1589 C  C   . ASN A 1 238 ? 36.113  121.581 -4.375  1.00 19.22 ? 238 ASN A C   1 
ATOM   1590 O  O   . ASN A 1 238 ? 36.131  120.798 -5.327  1.00 20.43 ? 238 ASN A O   1 
ATOM   1591 C  CB  . ASN A 1 238 ? 33.994  122.059 -3.162  1.00 20.12 ? 238 ASN A CB  1 
ATOM   1592 C  CG  . ASN A 1 238 ? 33.153  121.712 -4.372  1.00 20.13 ? 238 ASN A CG  1 
ATOM   1593 O  OD1 . ASN A 1 238 ? 32.602  120.617 -4.463  1.00 19.71 ? 238 ASN A OD1 1 
ATOM   1594 N  ND2 . ASN A 1 238 ? 33.066  122.637 -5.318  1.00 18.61 ? 238 ASN A ND2 1 
ATOM   1595 N  N   . GLN A 1 239 ? 36.780  122.731 -4.371  1.00 19.86 ? 239 GLN A N   1 
ATOM   1596 C  CA  . GLN A 1 239 ? 37.593  123.139 -5.511  1.00 20.71 ? 239 GLN A CA  1 
ATOM   1597 C  C   . GLN A 1 239 ? 38.745  122.157 -5.691  1.00 21.09 ? 239 GLN A C   1 
ATOM   1598 O  O   . GLN A 1 239 ? 39.186  121.897 -6.812  1.00 20.88 ? 239 GLN A O   1 
ATOM   1599 C  CB  . GLN A 1 239 ? 38.153  124.543 -5.291  1.00 22.27 ? 239 GLN A CB  1 
ATOM   1600 C  CG  . GLN A 1 239 ? 38.791  125.169 -6.531  1.00 23.07 ? 239 GLN A CG  1 
ATOM   1601 C  CD  . GLN A 1 239 ? 37.776  125.572 -7.587  1.00 25.04 ? 239 GLN A CD  1 
ATOM   1602 O  OE1 . GLN A 1 239 ? 38.119  126.220 -8.580  1.00 29.12 ? 239 GLN A OE1 1 
ATOM   1603 N  NE2 . GLN A 1 239 ? 36.524  125.193 -7.380  1.00 23.07 ? 239 GLN A NE2 1 
ATOM   1604 N  N   . ARG A 1 240 ? 39.230  121.613 -4.579  1.00 20.98 ? 240 ARG A N   1 
ATOM   1605 C  CA  . ARG A 1 240 ? 40.325  120.658 -4.630  1.00 20.73 ? 240 ARG A CA  1 
ATOM   1606 C  C   . ARG A 1 240 ? 39.893  119.422 -5.424  1.00 21.54 ? 240 ARG A C   1 
ATOM   1607 O  O   . ARG A 1 240 ? 40.605  118.967 -6.324  1.00 20.29 ? 240 ARG A O   1 
ATOM   1608 C  CB  . ARG A 1 240 ? 40.750  120.251 -3.218  1.00 19.72 ? 240 ARG A CB  1 
ATOM   1609 C  CG  . ARG A 1 240 ? 42.080  119.515 -3.213  1.00 22.16 ? 240 ARG A CG  1 
ATOM   1610 C  CD  . ARG A 1 240 ? 42.540  119.065 -1.835  1.00 23.45 ? 240 ARG A CD  1 
ATOM   1611 N  NE  . ARG A 1 240 ? 43.873  118.484 -1.956  1.00 25.42 ? 240 ARG A NE  1 
ATOM   1612 C  CZ  . ARG A 1 240 ? 44.998  119.193 -1.963  1.00 27.02 ? 240 ARG A CZ  1 
ATOM   1613 N  NH1 . ARG A 1 240 ? 44.956  120.514 -1.831  1.00 25.38 ? 240 ARG A NH1 1 
ATOM   1614 N  NH2 . ARG A 1 240 ? 46.160  118.587 -2.157  1.00 26.51 ? 240 ARG A NH2 1 
ATOM   1615 N  N   . TYR A 1 241 ? 38.720  118.887 -5.095  1.00 20.62 ? 241 TYR A N   1 
ATOM   1616 C  CA  . TYR A 1 241 ? 38.201  117.718 -5.795  1.00 19.36 ? 241 TYR A CA  1 
ATOM   1617 C  C   . TYR A 1 241 ? 37.959  118.068 -7.261  1.00 19.79 ? 241 TYR A C   1 
ATOM   1618 O  O   . TYR A 1 241 ? 38.219  117.268 -8.159  1.00 19.72 ? 241 TYR A O   1 
ATOM   1619 C  CB  . TYR A 1 241 ? 36.879  117.251 -5.174  1.00 20.63 ? 241 TYR A CB  1 
ATOM   1620 C  CG  . TYR A 1 241 ? 36.407  115.932 -5.734  1.00 21.21 ? 241 TYR A CG  1 
ATOM   1621 C  CD1 . TYR A 1 241 ? 36.772  114.729 -5.133  1.00 21.56 ? 241 TYR A CD1 1 
ATOM   1622 C  CD2 . TYR A 1 241 ? 35.665  115.883 -6.915  1.00 21.90 ? 241 TYR A CD2 1 
ATOM   1623 C  CE1 . TYR A 1 241 ? 36.415  113.506 -5.697  1.00 22.40 ? 241 TYR A CE1 1 
ATOM   1624 C  CE2 . TYR A 1 241 ? 35.308  114.669 -7.488  1.00 23.58 ? 241 TYR A CE2 1 
ATOM   1625 C  CZ  . TYR A 1 241 ? 35.689  113.485 -6.872  1.00 23.52 ? 241 TYR A CZ  1 
ATOM   1626 O  OH  . TYR A 1 241 ? 35.357  112.284 -7.449  1.00 26.52 ? 241 TYR A OH  1 
ATOM   1627 N  N   . PHE A 1 242 ? 37.445  119.270 -7.490  1.00 20.43 ? 242 PHE A N   1 
ATOM   1628 C  CA  . PHE A 1 242 ? 37.157  119.747 -8.837  1.00 20.74 ? 242 PHE A CA  1 
ATOM   1629 C  C   . PHE A 1 242 ? 38.422  119.738 -9.698  1.00 21.22 ? 242 PHE A C   1 
ATOM   1630 O  O   . PHE A 1 242 ? 38.426  119.216 -10.814 1.00 22.29 ? 242 PHE A O   1 
ATOM   1631 C  CB  . PHE A 1 242 ? 36.593  121.172 -8.766  1.00 21.68 ? 242 PHE A CB  1 
ATOM   1632 C  CG  . PHE A 1 242 ? 36.417  121.827 -10.109 1.00 21.31 ? 242 PHE A CG  1 
ATOM   1633 C  CD1 . PHE A 1 242 ? 35.408  121.417 -10.973 1.00 21.58 ? 242 PHE A CD1 1 
ATOM   1634 C  CD2 . PHE A 1 242 ? 37.268  122.852 -10.510 1.00 23.30 ? 242 PHE A CD2 1 
ATOM   1635 C  CE1 . PHE A 1 242 ? 35.246  122.020 -12.222 1.00 21.83 ? 242 PHE A CE1 1 
ATOM   1636 C  CE2 . PHE A 1 242 ? 37.115  123.462 -11.758 1.00 22.78 ? 242 PHE A CE2 1 
ATOM   1637 C  CZ  . PHE A 1 242 ? 36.103  123.045 -12.612 1.00 20.74 ? 242 PHE A CZ  1 
ATOM   1638 N  N   . VAL A 1 243 ? 39.495  120.312 -9.168  1.00 21.88 ? 243 VAL A N   1 
ATOM   1639 C  CA  . VAL A 1 243 ? 40.761  120.391 -9.890  1.00 23.68 ? 243 VAL A CA  1 
ATOM   1640 C  C   . VAL A 1 243 ? 41.386  119.023 -10.173 1.00 25.32 ? 243 VAL A C   1 
ATOM   1641 O  O   . VAL A 1 243 ? 41.761  118.727 -11.308 1.00 25.41 ? 243 VAL A O   1 
ATOM   1642 C  CB  . VAL A 1 243 ? 41.788  121.254 -9.113  1.00 24.66 ? 243 VAL A CB  1 
ATOM   1643 C  CG1 . VAL A 1 243 ? 43.142  121.239 -9.825  1.00 24.10 ? 243 VAL A CG1 1 
ATOM   1644 C  CG2 . VAL A 1 243 ? 41.278  122.682 -8.992  1.00 24.75 ? 243 VAL A CG2 1 
ATOM   1645 N  N   . ILE A 1 244 ? 41.491  118.190 -9.142  1.00 26.03 ? 244 ILE A N   1 
ATOM   1646 C  CA  . ILE A 1 244 ? 42.100  116.872 -9.290  1.00 25.51 ? 244 ILE A CA  1 
ATOM   1647 C  C   . ILE A 1 244 ? 41.309  115.925 -10.188 1.00 26.21 ? 244 ILE A C   1 
ATOM   1648 O  O   . ILE A 1 244 ? 41.880  115.296 -11.086 1.00 26.39 ? 244 ILE A O   1 
ATOM   1649 C  CB  . ILE A 1 244 ? 42.326  116.220 -7.906  1.00 26.20 ? 244 ILE A CB  1 
ATOM   1650 C  CG1 . ILE A 1 244 ? 43.324  117.067 -7.109  1.00 24.31 ? 244 ILE A CG1 1 
ATOM   1651 C  CG2 . ILE A 1 244 ? 42.846  114.793 -8.069  1.00 25.22 ? 244 ILE A CG2 1 
ATOM   1652 C  CD1 . ILE A 1 244 ? 43.466  116.671 -5.655  1.00 25.16 ? 244 ILE A CD1 1 
ATOM   1653 N  N   . SER A 1 245 ? 40.001  115.832 -9.970  1.00 25.28 ? 245 SER A N   1 
ATOM   1654 C  CA  . SER A 1 245 ? 39.181  114.942 -10.783 1.00 26.50 ? 245 SER A CA  1 
ATOM   1655 C  C   . SER A 1 245 ? 39.215  115.313 -12.261 1.00 27.38 ? 245 SER A C   1 
ATOM   1656 O  O   . SER A 1 245 ? 39.028  114.452 -13.117 1.00 28.96 ? 245 SER A O   1 
ATOM   1657 C  CB  . SER A 1 245 ? 37.728  114.944 -10.296 1.00 26.54 ? 245 SER A CB  1 
ATOM   1658 O  OG  . SER A 1 245 ? 37.092  116.177 -10.578 1.00 27.81 ? 245 SER A OG  1 
ATOM   1659 N  N   . ASN A 1 246 ? 39.446  116.589 -12.562 1.00 28.06 ? 246 ASN A N   1 
ATOM   1660 C  CA  . ASN A 1 246 ? 39.494  117.042 -13.950 1.00 28.23 ? 246 ASN A CA  1 
ATOM   1661 C  C   . ASN A 1 246 ? 40.889  117.085 -14.570 1.00 28.26 ? 246 ASN A C   1 
ATOM   1662 O  O   . ASN A 1 246 ? 41.025  117.295 -15.774 1.00 29.14 ? 246 ASN A O   1 
ATOM   1663 C  CB  . ASN A 1 246 ? 38.855  118.424 -14.091 1.00 28.57 ? 246 ASN A CB  1 
ATOM   1664 C  CG  . ASN A 1 246 ? 37.345  118.378 -14.018 1.00 29.99 ? 246 ASN A CG  1 
ATOM   1665 O  OD1 . ASN A 1 246 ? 36.754  118.530 -12.948 1.00 29.59 ? 246 ASN A OD1 1 
ATOM   1666 N  ND2 . ASN A 1 246 ? 36.710  118.164 -15.162 1.00 30.23 ? 246 ASN A ND2 1 
ATOM   1667 N  N   . THR A 1 247 ? 41.924  116.902 -13.758 1.00 28.73 ? 247 THR A N   1 
ATOM   1668 C  CA  . THR A 1 247 ? 43.283  116.916 -14.279 1.00 28.68 ? 247 THR A CA  1 
ATOM   1669 C  C   . THR A 1 247 ? 43.887  115.511 -14.271 1.00 30.34 ? 247 THR A C   1 
ATOM   1670 O  O   . THR A 1 247 ? 43.807  114.798 -15.269 1.00 31.06 ? 247 THR A O   1 
ATOM   1671 C  CB  . THR A 1 247 ? 44.184  117.883 -13.483 1.00 28.39 ? 247 THR A CB  1 
ATOM   1672 O  OG1 . THR A 1 247 ? 44.072  117.608 -12.082 1.00 26.85 ? 247 THR A OG1 1 
ATOM   1673 C  CG2 . THR A 1 247 ? 43.780  119.331 -13.754 1.00 28.54 ? 247 THR A CG2 1 
ATOM   1674 N  N   . THR A 1 248 ? 44.472  115.107 -13.148 1.00 31.40 ? 248 THR A N   1 
ATOM   1675 C  CA  . THR A 1 248 ? 45.079  113.782 -13.042 1.00 31.43 ? 248 THR A CA  1 
ATOM   1676 C  C   . THR A 1 248 ? 44.061  112.684 -12.752 1.00 32.33 ? 248 THR A C   1 
ATOM   1677 O  O   . THR A 1 248 ? 44.266  111.530 -13.125 1.00 32.35 ? 248 THR A O   1 
ATOM   1678 C  CB  . THR A 1 248 ? 46.132  113.731 -11.920 1.00 32.25 ? 248 THR A CB  1 
ATOM   1679 O  OG1 . THR A 1 248 ? 45.505  114.035 -10.667 1.00 31.70 ? 248 THR A OG1 1 
ATOM   1680 C  CG2 . THR A 1 248 ? 47.248  114.730 -12.184 1.00 32.04 ? 248 THR A CG2 1 
ATOM   1681 N  N   . GLY A 1 249 ? 42.963  113.043 -12.091 1.00 31.09 ? 249 GLY A N   1 
ATOM   1682 C  CA  . GLY A 1 249 ? 41.966  112.048 -11.739 1.00 28.27 ? 249 GLY A CA  1 
ATOM   1683 C  C   . GLY A 1 249 ? 42.439  111.385 -10.457 1.00 27.80 ? 249 GLY A C   1 
ATOM   1684 O  O   . GLY A 1 249 ? 43.563  111.638 -10.024 1.00 27.46 ? 249 GLY A O   1 
ATOM   1685 N  N   . TYR A 1 250 ? 41.603  110.553 -9.845  1.00 27.41 ? 250 TYR A N   1 
ATOM   1686 C  CA  . TYR A 1 250 ? 41.982  109.871 -8.608  1.00 28.91 ? 250 TYR A CA  1 
ATOM   1687 C  C   . TYR A 1 250 ? 42.349  108.404 -8.823  1.00 30.32 ? 250 TYR A C   1 
ATOM   1688 O  O   . TYR A 1 250 ? 42.694  107.702 -7.871  1.00 28.17 ? 250 TYR A O   1 
ATOM   1689 C  CB  . TYR A 1 250 ? 40.855  109.949 -7.568  1.00 26.87 ? 250 TYR A CB  1 
ATOM   1690 C  CG  . TYR A 1 250 ? 40.654  111.321 -6.959  1.00 25.17 ? 250 TYR A CG  1 
ATOM   1691 C  CD1 . TYR A 1 250 ? 39.774  112.242 -7.527  1.00 24.82 ? 250 TYR A CD1 1 
ATOM   1692 C  CD2 . TYR A 1 250 ? 41.355  111.701 -5.819  1.00 23.59 ? 250 TYR A CD2 1 
ATOM   1693 C  CE1 . TYR A 1 250 ? 39.599  113.511 -6.967  1.00 24.05 ? 250 TYR A CE1 1 
ATOM   1694 C  CE2 . TYR A 1 250 ? 41.192  112.961 -5.257  1.00 23.51 ? 250 TYR A CE2 1 
ATOM   1695 C  CZ  . TYR A 1 250 ? 40.315  113.861 -5.833  1.00 21.00 ? 250 TYR A CZ  1 
ATOM   1696 O  OH  . TYR A 1 250 ? 40.173  115.109 -5.274  1.00 22.12 ? 250 TYR A OH  1 
ATOM   1697 N  N   . ASN A 1 251 ? 42.272  107.941 -10.067 1.00 32.15 ? 251 ASN A N   1 
ATOM   1698 C  CA  . ASN A 1 251 ? 42.603  106.555 -10.373 1.00 34.85 ? 251 ASN A CA  1 
ATOM   1699 C  C   . ASN A 1 251 ? 44.102  106.304 -10.271 1.00 34.95 ? 251 ASN A C   1 
ATOM   1700 O  O   . ASN A 1 251 ? 44.537  105.175 -10.050 1.00 35.84 ? 251 ASN A O   1 
ATOM   1701 C  CB  . ASN A 1 251 ? 42.087  106.178 -11.761 1.00 38.71 ? 251 ASN A CB  1 
ATOM   1702 C  CG  . ASN A 1 251 ? 40.579  106.027 -11.794 1.00 42.43 ? 251 ASN A CG  1 
ATOM   1703 O  OD1 . ASN A 1 251 ? 40.001  105.294 -10.990 1.00 43.68 ? 251 ASN A OD1 1 
ATOM   1704 N  ND2 . ASN A 1 251 ? 39.932  106.717 -12.726 1.00 45.60 ? 251 ASN A ND2 1 
ATOM   1705 N  N   . ASP A 1 252 ? 44.894  107.357 -10.436 1.00 35.64 ? 252 ASP A N   1 
ATOM   1706 C  CA  . ASP A 1 252 ? 46.339  107.236 -10.312 1.00 34.85 ? 252 ASP A CA  1 
ATOM   1707 C  C   . ASP A 1 252 ? 46.590  107.003 -8.822  1.00 33.59 ? 252 ASP A C   1 
ATOM   1708 O  O   . ASP A 1 252 ? 46.390  107.906 -8.010  1.00 32.19 ? 252 ASP A O   1 
ATOM   1709 C  CB  . ASP A 1 252 ? 47.012  108.531 -10.767 1.00 37.89 ? 252 ASP A CB  1 
ATOM   1710 C  CG  . ASP A 1 252 ? 48.523  108.477 -10.644 1.00 41.14 ? 252 ASP A CG  1 
ATOM   1711 O  OD1 . ASP A 1 252 ? 49.026  108.236 -9.527  1.00 42.98 ? 252 ASP A OD1 1 
ATOM   1712 O  OD2 . ASP A 1 252 ? 49.211  108.680 -11.665 1.00 45.29 ? 252 ASP A OD2 1 
ATOM   1713 N  N   . ARG A 1 253 ? 47.024  105.798 -8.464  1.00 31.92 ? 253 ARG A N   1 
ATOM   1714 C  CA  . ARG A 1 253 ? 47.253  105.464 -7.060  1.00 30.30 ? 253 ARG A CA  1 
ATOM   1715 C  C   . ARG A 1 253 ? 48.245  106.365 -6.336  1.00 28.77 ? 253 ARG A C   1 
ATOM   1716 O  O   . ARG A 1 253 ? 48.149  106.539 -5.122  1.00 28.81 ? 253 ARG A O   1 
ATOM   1717 C  CB  . ARG A 1 253 ? 47.655  103.991 -6.928  1.00 29.73 ? 253 ARG A CB  1 
ATOM   1718 C  CG  . ARG A 1 253 ? 46.546  103.057 -7.386  1.00 31.36 ? 253 ARG A CG  1 
ATOM   1719 C  CD  . ARG A 1 253 ? 46.828  101.589 -7.106  1.00 30.88 ? 253 ARG A CD  1 
ATOM   1720 N  NE  . ARG A 1 253 ? 45.801  100.744 -7.711  1.00 31.55 ? 253 ARG A NE  1 
ATOM   1721 C  CZ  . ARG A 1 253 ? 44.536  100.674 -7.299  1.00 31.43 ? 253 ARG A CZ  1 
ATOM   1722 N  NH1 . ARG A 1 253 ? 44.123  101.391 -6.263  1.00 31.60 ? 253 ARG A NH1 1 
ATOM   1723 N  NH2 . ARG A 1 253 ? 43.672  99.904  -7.944  1.00 31.15 ? 253 ARG A NH2 1 
ATOM   1724 N  N   . ALA A 1 254 ? 49.186  106.945 -7.071  1.00 26.99 ? 254 ALA A N   1 
ATOM   1725 C  CA  . ALA A 1 254 ? 50.160  107.852 -6.465  1.00 27.59 ? 254 ALA A CA  1 
ATOM   1726 C  C   . ALA A 1 254 ? 49.451  109.144 -6.041  1.00 26.32 ? 254 ALA A C   1 
ATOM   1727 O  O   . ALA A 1 254 ? 49.731  109.704 -4.983  1.00 26.83 ? 254 ALA A O   1 
ATOM   1728 C  CB  . ALA A 1 254 ? 51.281  108.166 -7.458  1.00 26.10 ? 254 ALA A CB  1 
ATOM   1729 N  N   . VAL A 1 255 ? 48.536  109.616 -6.879  1.00 26.26 ? 255 VAL A N   1 
ATOM   1730 C  CA  . VAL A 1 255 ? 47.782  110.827 -6.578  1.00 26.14 ? 255 VAL A CA  1 
ATOM   1731 C  C   . VAL A 1 255 ? 46.847  110.575 -5.400  1.00 24.71 ? 255 VAL A C   1 
ATOM   1732 O  O   . VAL A 1 255 ? 46.749  111.395 -4.492  1.00 23.36 ? 255 VAL A O   1 
ATOM   1733 C  CB  . VAL A 1 255 ? 46.941  111.285 -7.792  1.00 28.09 ? 255 VAL A CB  1 
ATOM   1734 C  CG1 . VAL A 1 255 ? 46.061  112.469 -7.405  1.00 27.38 ? 255 VAL A CG1 1 
ATOM   1735 C  CG2 . VAL A 1 255 ? 47.862  111.666 -8.943  1.00 27.91 ? 255 VAL A CG2 1 
ATOM   1736 N  N   . LEU A 1 256 ? 46.164  109.435 -5.413  1.00 24.39 ? 256 LEU A N   1 
ATOM   1737 C  CA  . LEU A 1 256 ? 45.244  109.110 -4.328  1.00 24.90 ? 256 LEU A CA  1 
ATOM   1738 C  C   . LEU A 1 256 ? 45.987  109.036 -2.998  1.00 24.97 ? 256 LEU A C   1 
ATOM   1739 O  O   . LEU A 1 256 ? 45.522  109.563 -1.987  1.00 25.36 ? 256 LEU A O   1 
ATOM   1740 C  CB  . LEU A 1 256 ? 44.543  107.780 -4.605  1.00 23.76 ? 256 LEU A CB  1 
ATOM   1741 C  CG  . LEU A 1 256 ? 43.506  107.347 -3.566  1.00 24.56 ? 256 LEU A CG  1 
ATOM   1742 C  CD1 . LEU A 1 256 ? 42.369  108.364 -3.514  1.00 23.10 ? 256 LEU A CD1 1 
ATOM   1743 C  CD2 . LEU A 1 256 ? 42.977  105.967 -3.924  1.00 21.07 ? 256 LEU A CD2 1 
ATOM   1744 N  N   . GLU A 1 257 ? 47.147  108.385 -3.004  1.00 26.19 ? 257 GLU A N   1 
ATOM   1745 C  CA  . GLU A 1 257 ? 47.953  108.257 -1.794  1.00 24.96 ? 257 GLU A CA  1 
ATOM   1746 C  C   . GLU A 1 257 ? 48.327  109.645 -1.287  1.00 24.39 ? 257 GLU A C   1 
ATOM   1747 O  O   . GLU A 1 257 ? 48.210  109.935 -0.097  1.00 23.19 ? 257 GLU A O   1 
ATOM   1748 C  CB  . GLU A 1 257 ? 49.215  107.433 -2.086  1.00 26.15 ? 257 GLU A CB  1 
ATOM   1749 C  CG  . GLU A 1 257 ? 50.188  107.296 -0.916  1.00 27.40 ? 257 GLU A CG  1 
ATOM   1750 C  CD  . GLU A 1 257 ? 49.528  106.816 0.366   1.00 30.98 ? 257 GLU A CD  1 
ATOM   1751 O  OE1 . GLU A 1 257 ? 48.521  106.080 0.291   1.00 33.79 ? 257 GLU A OE1 1 
ATOM   1752 O  OE2 . GLU A 1 257 ? 50.025  107.164 1.458   1.00 33.96 ? 257 GLU A OE2 1 
ATOM   1753 N  N   . ARG A 1 258 ? 48.772  110.502 -2.200  1.00 24.09 ? 258 ARG A N   1 
ATOM   1754 C  CA  . ARG A 1 258 ? 49.150  111.867 -1.853  1.00 24.99 ? 258 ARG A CA  1 
ATOM   1755 C  C   . ARG A 1 258 ? 47.972  112.599 -1.199  1.00 25.40 ? 258 ARG A C   1 
ATOM   1756 O  O   . ARG A 1 258 ? 48.141  113.323 -0.214  1.00 24.58 ? 258 ARG A O   1 
ATOM   1757 C  CB  . ARG A 1 258 ? 49.577  112.626 -3.113  1.00 26.48 ? 258 ARG A CB  1 
ATOM   1758 C  CG  . ARG A 1 258 ? 50.052  114.057 -2.864  1.00 28.17 ? 258 ARG A CG  1 
ATOM   1759 C  CD  . ARG A 1 258 ? 50.001  114.873 -4.150  1.00 30.67 ? 258 ARG A CD  1 
ATOM   1760 N  NE  . ARG A 1 258 ? 48.626  115.182 -4.539  1.00 32.87 ? 258 ARG A NE  1 
ATOM   1761 C  CZ  . ARG A 1 258 ? 48.259  115.564 -5.759  1.00 34.81 ? 258 ARG A CZ  1 
ATOM   1762 N  NH1 . ARG A 1 258 ? 49.166  115.681 -6.719  1.00 35.12 ? 258 ARG A NH1 1 
ATOM   1763 N  NH2 . ARG A 1 258 ? 46.986  115.836 -6.020  1.00 34.03 ? 258 ARG A NH2 1 
ATOM   1764 N  N   . GLU A 1 259 ? 46.779  112.405 -1.751  1.00 24.53 ? 259 GLU A N   1 
ATOM   1765 C  CA  . GLU A 1 259 ? 45.591  113.065 -1.224  1.00 24.20 ? 259 GLU A CA  1 
ATOM   1766 C  C   . GLU A 1 259 ? 45.152  112.523 0.129   1.00 23.39 ? 259 GLU A C   1 
ATOM   1767 O  O   . GLU A 1 259 ? 44.743  113.283 1.006   1.00 22.35 ? 259 GLU A O   1 
ATOM   1768 C  CB  . GLU A 1 259 ? 44.452  112.975 -2.241  1.00 24.12 ? 259 GLU A CB  1 
ATOM   1769 C  CG  . GLU A 1 259 ? 44.667  113.900 -3.428  1.00 24.10 ? 259 GLU A CG  1 
ATOM   1770 C  CD  . GLU A 1 259 ? 44.871  115.337 -2.986  1.00 25.80 ? 259 GLU A CD  1 
ATOM   1771 O  OE1 . GLU A 1 259 ? 43.942  115.904 -2.366  1.00 26.10 ? 259 GLU A OE1 1 
ATOM   1772 O  OE2 . GLU A 1 259 ? 45.958  115.898 -3.248  1.00 25.91 ? 259 GLU A OE2 1 
ATOM   1773 N  N   . VAL A 1 260 ? 45.247  111.212 0.306   1.00 22.61 ? 260 VAL A N   1 
ATOM   1774 C  CA  . VAL A 1 260 ? 44.872  110.612 1.575   1.00 22.09 ? 260 VAL A CA  1 
ATOM   1775 C  C   . VAL A 1 260 ? 45.836  111.064 2.676   1.00 23.41 ? 260 VAL A C   1 
ATOM   1776 O  O   . VAL A 1 260 ? 45.406  111.381 3.787   1.00 23.41 ? 260 VAL A O   1 
ATOM   1777 C  CB  . VAL A 1 260 ? 44.851  109.072 1.467   1.00 20.58 ? 260 VAL A CB  1 
ATOM   1778 C  CG1 . VAL A 1 260 ? 44.638  108.449 2.838   1.00 19.86 ? 260 VAL A CG1 1 
ATOM   1779 C  CG2 . VAL A 1 260 ? 43.733  108.649 0.525   1.00 19.11 ? 260 VAL A CG2 1 
ATOM   1780 N  N   . GLN A 1 261 ? 47.133  111.110 2.369   1.00 24.27 ? 261 GLN A N   1 
ATOM   1781 C  CA  . GLN A 1 261 ? 48.131  111.549 3.349   1.00 25.22 ? 261 GLN A CA  1 
ATOM   1782 C  C   . GLN A 1 261 ? 47.918  113.018 3.704   1.00 25.19 ? 261 GLN A C   1 
ATOM   1783 O  O   . GLN A 1 261 ? 47.990  113.408 4.869   1.00 25.87 ? 261 GLN A O   1 
ATOM   1784 C  CB  . GLN A 1 261 ? 49.553  111.373 2.798   1.00 27.14 ? 261 GLN A CB  1 
ATOM   1785 C  CG  . GLN A 1 261 ? 50.018  109.931 2.705   1.00 32.65 ? 261 GLN A CG  1 
ATOM   1786 C  CD  . GLN A 1 261 ? 50.344  109.329 4.061   1.00 35.72 ? 261 GLN A CD  1 
ATOM   1787 O  OE1 . GLN A 1 261 ? 50.586  108.126 4.177   1.00 40.16 ? 261 GLN A OE1 1 
ATOM   1788 N  NE2 . GLN A 1 261 ? 50.362  110.164 5.093   1.00 36.97 ? 261 GLN A NE2 1 
ATOM   1789 N  N   . TYR A 1 262 ? 47.674  113.834 2.688   1.00 24.84 ? 262 TYR A N   1 
ATOM   1790 C  CA  . TYR A 1 262 ? 47.445  115.258 2.893   1.00 25.91 ? 262 TYR A CA  1 
ATOM   1791 C  C   . TYR A 1 262 ? 46.248  115.454 3.825   1.00 25.54 ? 262 TYR A C   1 
ATOM   1792 O  O   . TYR A 1 262 ? 46.319  116.177 4.821   1.00 25.06 ? 262 TYR A O   1 
ATOM   1793 C  CB  . TYR A 1 262 ? 47.159  115.937 1.553   1.00 26.98 ? 262 TYR A CB  1 
ATOM   1794 C  CG  . TYR A 1 262 ? 46.801  117.401 1.668   1.00 30.55 ? 262 TYR A CG  1 
ATOM   1795 C  CD1 . TYR A 1 262 ? 47.792  118.374 1.785   1.00 33.73 ? 262 TYR A CD1 1 
ATOM   1796 C  CD2 . TYR A 1 262 ? 45.468  117.815 1.680   1.00 31.19 ? 262 TYR A CD2 1 
ATOM   1797 C  CE1 . TYR A 1 262 ? 47.467  119.723 1.911   1.00 36.80 ? 262 TYR A CE1 1 
ATOM   1798 C  CE2 . TYR A 1 262 ? 45.130  119.159 1.808   1.00 33.70 ? 262 TYR A CE2 1 
ATOM   1799 C  CZ  . TYR A 1 262 ? 46.135  120.108 1.922   1.00 36.49 ? 262 TYR A CZ  1 
ATOM   1800 O  OH  . TYR A 1 262 ? 45.813  121.439 2.053   1.00 39.12 ? 262 TYR A OH  1 
ATOM   1801 N  N   . THR A 1 263 ? 45.148  114.793 3.490   1.00 24.21 ? 263 THR A N   1 
ATOM   1802 C  CA  . THR A 1 263 ? 43.928  114.899 4.272   1.00 23.82 ? 263 THR A CA  1 
ATOM   1803 C  C   . THR A 1 263 ? 44.112  114.405 5.701   1.00 24.54 ? 263 THR A C   1 
ATOM   1804 O  O   . THR A 1 263 ? 43.676  115.066 6.646   1.00 23.32 ? 263 THR A O   1 
ATOM   1805 C  CB  . THR A 1 263 ? 42.795  114.125 3.588   1.00 22.65 ? 263 THR A CB  1 
ATOM   1806 O  OG1 . THR A 1 263 ? 42.667  114.592 2.239   1.00 19.31 ? 263 THR A OG1 1 
ATOM   1807 C  CG2 . THR A 1 263 ? 41.475  114.338 4.323   1.00 22.22 ? 263 THR A CG2 1 
ATOM   1808 N  N   . LEU A 1 264 ? 44.752  113.248 5.863   1.00 24.41 ? 264 LEU A N   1 
ATOM   1809 C  CA  . LEU A 1 264 ? 44.986  112.701 7.198   1.00 25.24 ? 264 LEU A CA  1 
ATOM   1810 C  C   . LEU A 1 264 ? 45.805  113.680 8.021   1.00 25.31 ? 264 LEU A C   1 
ATOM   1811 O  O   . LEU A 1 264 ? 45.564  113.857 9.215   1.00 24.87 ? 264 LEU A O   1 
ATOM   1812 C  CB  . LEU A 1 264 ? 45.719  111.358 7.116   1.00 25.39 ? 264 LEU A CB  1 
ATOM   1813 C  CG  . LEU A 1 264 ? 44.863  110.172 6.673   1.00 26.15 ? 264 LEU A CG  1 
ATOM   1814 C  CD1 . LEU A 1 264 ? 45.741  108.935 6.529   1.00 26.25 ? 264 LEU A CD1 1 
ATOM   1815 C  CD2 . LEU A 1 264 ? 43.750  109.931 7.697   1.00 23.14 ? 264 LEU A CD2 1 
ATOM   1816 N  N   . GLU A 1 265 ? 46.775  114.317 7.376   1.00 26.70 ? 265 GLU A N   1 
ATOM   1817 C  CA  . GLU A 1 265 ? 47.615  115.291 8.057   1.00 29.36 ? 265 GLU A CA  1 
ATOM   1818 C  C   . GLU A 1 265 ? 46.774  116.475 8.530   1.00 28.64 ? 265 GLU A C   1 
ATOM   1819 O  O   . GLU A 1 265 ? 46.981  116.985 9.631   1.00 28.77 ? 265 GLU A O   1 
ATOM   1820 C  CB  . GLU A 1 265 ? 48.733  115.781 7.129   1.00 32.38 ? 265 GLU A CB  1 
ATOM   1821 C  CG  . GLU A 1 265 ? 49.551  116.931 7.704   1.00 40.35 ? 265 GLU A CG  1 
ATOM   1822 C  CD  . GLU A 1 265 ? 50.214  116.589 9.035   1.00 46.07 ? 265 GLU A CD  1 
ATOM   1823 O  OE1 . GLU A 1 265 ? 50.763  117.511 9.678   1.00 49.43 ? 265 GLU A OE1 1 
ATOM   1824 O  OE2 . GLU A 1 265 ? 50.195  115.403 9.439   1.00 49.40 ? 265 GLU A OE2 1 
ATOM   1825 N  N   . MET A 1 266 ? 45.827  116.913 7.703   1.00 26.70 ? 266 MET A N   1 
ATOM   1826 C  CA  . MET A 1 266 ? 44.973  118.035 8.084   1.00 26.32 ? 266 MET A CA  1 
ATOM   1827 C  C   . MET A 1 266 ? 44.069  117.622 9.241   1.00 24.41 ? 266 MET A C   1 
ATOM   1828 O  O   . MET A 1 266 ? 43.800  118.412 10.145  1.00 23.58 ? 266 MET A O   1 
ATOM   1829 C  CB  . MET A 1 266 ? 44.121  118.501 6.896   1.00 25.07 ? 266 MET A CB  1 
ATOM   1830 C  CG  . MET A 1 266 ? 44.925  119.096 5.747   1.00 27.39 ? 266 MET A CG  1 
ATOM   1831 S  SD  . MET A 1 266 ? 45.915  120.526 6.245   1.00 28.93 ? 266 MET A SD  1 
ATOM   1832 C  CE  . MET A 1 266 ? 47.536  119.765 6.492   1.00 33.87 ? 266 MET A CE  1 
ATOM   1833 N  N   . ILE A 1 267 ? 43.603  116.379 9.211   1.00 24.25 ? 267 ILE A N   1 
ATOM   1834 C  CA  . ILE A 1 267 ? 42.737  115.879 10.269  1.00 25.45 ? 267 ILE A CA  1 
ATOM   1835 C  C   . ILE A 1 267 ? 43.489  115.865 11.598  1.00 27.84 ? 267 ILE A C   1 
ATOM   1836 O  O   . ILE A 1 267 ? 42.931  116.208 12.645  1.00 26.02 ? 267 ILE A O   1 
ATOM   1837 C  CB  . ILE A 1 267 ? 42.225  114.461 9.939   1.00 24.89 ? 267 ILE A CB  1 
ATOM   1838 C  CG1 . ILE A 1 267 ? 41.225  114.536 8.779   1.00 23.24 ? 267 ILE A CG1 1 
ATOM   1839 C  CG2 . ILE A 1 267 ? 41.588  113.832 11.171  1.00 25.04 ? 267 ILE A CG2 1 
ATOM   1840 C  CD1 . ILE A 1 267 ? 40.710  113.188 8.302   1.00 21.67 ? 267 ILE A CD1 1 
ATOM   1841 N  N   . LYS A 1 268 ? 44.762  115.480 11.555  1.00 28.84 ? 268 LYS A N   1 
ATOM   1842 C  CA  . LYS A 1 268 ? 45.564  115.443 12.768  1.00 31.47 ? 268 LYS A CA  1 
ATOM   1843 C  C   . LYS A 1 268 ? 45.729  116.846 13.344  1.00 29.66 ? 268 LYS A C   1 
ATOM   1844 O  O   . LYS A 1 268 ? 45.727  117.025 14.560  1.00 30.07 ? 268 LYS A O   1 
ATOM   1845 C  CB  . LYS A 1 268 ? 46.940  114.830 12.489  1.00 34.81 ? 268 LYS A CB  1 
ATOM   1846 C  CG  . LYS A 1 268 ? 46.907  113.343 12.154  1.00 40.43 ? 268 LYS A CG  1 
ATOM   1847 C  CD  . LYS A 1 268 ? 48.313  112.756 12.152  1.00 43.83 ? 268 LYS A CD  1 
ATOM   1848 C  CE  . LYS A 1 268 ? 48.311  111.284 11.778  1.00 46.73 ? 268 LYS A CE  1 
ATOM   1849 N  NZ  . LYS A 1 268 ? 47.918  111.068 10.358  1.00 50.15 ? 268 LYS A NZ  1 
ATOM   1850 N  N   . LEU A 1 269 ? 45.871  117.835 12.466  1.00 28.62 ? 269 LEU A N   1 
ATOM   1851 C  CA  . LEU A 1 269 ? 46.029  119.228 12.884  1.00 28.99 ? 269 LEU A CA  1 
ATOM   1852 C  C   . LEU A 1 269 ? 44.745  119.807 13.476  1.00 28.47 ? 269 LEU A C   1 
ATOM   1853 O  O   . LEU A 1 269 ? 44.787  120.557 14.455  1.00 26.33 ? 269 LEU A O   1 
ATOM   1854 C  CB  . LEU A 1 269 ? 46.456  120.094 11.693  1.00 30.38 ? 269 LEU A CB  1 
ATOM   1855 C  CG  . LEU A 1 269 ? 47.945  120.260 11.370  1.00 34.98 ? 269 LEU A CG  1 
ATOM   1856 C  CD1 . LEU A 1 269 ? 48.675  118.933 11.469  1.00 35.72 ? 269 LEU A CD1 1 
ATOM   1857 C  CD2 . LEU A 1 269 ? 48.079  120.856 9.974   1.00 33.73 ? 269 LEU A CD2 1 
ATOM   1858 N  N   . VAL A 1 270 ? 43.608  119.470 12.866  1.00 26.84 ? 270 VAL A N   1 
ATOM   1859 C  CA  . VAL A 1 270 ? 42.305  119.962 13.320  1.00 25.66 ? 270 VAL A CA  1 
ATOM   1860 C  C   . VAL A 1 270 ? 41.323  118.793 13.288  1.00 25.49 ? 270 VAL A C   1 
ATOM   1861 O  O   . VAL A 1 270 ? 40.516  118.668 12.365  1.00 24.15 ? 270 VAL A O   1 
ATOM   1862 C  CB  . VAL A 1 270 ? 41.791  121.089 12.395  1.00 25.58 ? 270 VAL A CB  1 
ATOM   1863 C  CG1 . VAL A 1 270 ? 40.607  121.794 13.033  1.00 25.18 ? 270 VAL A CG1 1 
ATOM   1864 C  CG2 . VAL A 1 270 ? 42.909  122.078 12.111  1.00 25.95 ? 270 VAL A CG2 1 
ATOM   1865 N  N   . PRO A 1 271 ? 41.383  117.920 14.307  1.00 25.60 ? 271 PRO A N   1 
ATOM   1866 C  CA  . PRO A 1 271 ? 40.535  116.733 14.447  1.00 24.53 ? 271 PRO A CA  1 
ATOM   1867 C  C   . PRO A 1 271 ? 39.029  116.939 14.276  1.00 24.78 ? 271 PRO A C   1 
ATOM   1868 O  O   . PRO A 1 271 ? 38.335  116.040 13.791  1.00 23.66 ? 271 PRO A O   1 
ATOM   1869 C  CB  . PRO A 1 271 ? 40.889  116.216 15.842  1.00 24.82 ? 271 PRO A CB  1 
ATOM   1870 C  CG  . PRO A 1 271 ? 42.304  116.646 16.016  1.00 26.64 ? 271 PRO A CG  1 
ATOM   1871 C  CD  . PRO A 1 271 ? 42.279  118.055 15.472  1.00 26.75 ? 271 PRO A CD  1 
ATOM   1872 N  N   . HIS A 1 272 ? 38.524  118.107 14.667  1.00 22.39 ? 272 HIS A N   1 
ATOM   1873 C  CA  . HIS A 1 272 ? 37.092  118.371 14.561  1.00 23.12 ? 272 HIS A CA  1 
ATOM   1874 C  C   . HIS A 1 272 ? 36.644  119.188 13.350  1.00 23.53 ? 272 HIS A C   1 
ATOM   1875 O  O   . HIS A 1 272 ? 35.538  119.731 13.334  1.00 23.62 ? 272 HIS A O   1 
ATOM   1876 C  CB  . HIS A 1 272 ? 36.583  119.017 15.855  1.00 21.55 ? 272 HIS A CB  1 
ATOM   1877 C  CG  . HIS A 1 272 ? 36.708  118.127 17.054  1.00 22.82 ? 272 HIS A CG  1 
ATOM   1878 N  ND1 . HIS A 1 272 ? 37.883  117.995 17.763  1.00 23.74 ? 272 HIS A ND1 1 
ATOM   1879 C  CD2 . HIS A 1 272 ? 35.824  117.279 17.631  1.00 23.09 ? 272 HIS A CD2 1 
ATOM   1880 C  CE1 . HIS A 1 272 ? 37.717  117.104 18.725  1.00 23.30 ? 272 HIS A CE1 1 
ATOM   1881 N  NE2 . HIS A 1 272 ? 36.477  116.653 18.666  1.00 24.71 ? 272 HIS A NE2 1 
ATOM   1882 N  N   . ASN A 1 273 ? 37.500  119.277 12.339  1.00 21.88 ? 273 ASN A N   1 
ATOM   1883 C  CA  . ASN A 1 273 ? 37.148  119.995 11.121  1.00 21.59 ? 273 ASN A CA  1 
ATOM   1884 C  C   . ASN A 1 273 ? 36.438  118.990 10.217  1.00 21.02 ? 273 ASN A C   1 
ATOM   1885 O  O   . ASN A 1 273 ? 37.070  118.099 9.649   1.00 19.91 ? 273 ASN A O   1 
ATOM   1886 C  CB  . ASN A 1 273 ? 38.406  120.535 10.433  1.00 22.40 ? 273 ASN A CB  1 
ATOM   1887 C  CG  . ASN A 1 273 ? 38.125  121.058 9.040   1.00 22.08 ? 273 ASN A CG  1 
ATOM   1888 O  OD1 . ASN A 1 273 ? 37.008  121.486 8.740   1.00 21.21 ? 273 ASN A OD1 1 
ATOM   1889 N  ND2 . ASN A 1 273 ? 39.141  121.041 8.185   1.00 20.44 ? 273 ASN A ND2 1 
ATOM   1890 N  N   . GLU A 1 274 ? 35.123  119.133 10.085  1.00 20.44 ? 274 GLU A N   1 
ATOM   1891 C  CA  . GLU A 1 274 ? 34.344  118.202 9.279   1.00 21.28 ? 274 GLU A CA  1 
ATOM   1892 C  C   . GLU A 1 274 ? 34.709  118.132 7.798   1.00 20.33 ? 274 GLU A C   1 
ATOM   1893 O  O   . GLU A 1 274 ? 34.642  117.060 7.204   1.00 19.89 ? 274 GLU A O   1 
ATOM   1894 C  CB  . GLU A 1 274 ? 32.844  118.501 9.410   1.00 23.54 ? 274 GLU A CB  1 
ATOM   1895 C  CG  . GLU A 1 274 ? 31.975  117.535 8.607   1.00 27.77 ? 274 GLU A CG  1 
ATOM   1896 C  CD  . GLU A 1 274 ? 30.490  117.818 8.724   1.00 29.90 ? 274 GLU A CD  1 
ATOM   1897 O  OE1 . GLU A 1 274 ? 29.705  117.192 7.977   1.00 26.79 ? 274 GLU A OE1 1 
ATOM   1898 O  OE2 . GLU A 1 274 ? 30.106  118.664 9.561   1.00 35.44 ? 274 GLU A OE2 1 
ATOM   1899 N  N   . SER A 1 275 ? 35.094  119.259 7.201   1.00 19.74 ? 275 SER A N   1 
ATOM   1900 C  CA  . SER A 1 275 ? 35.433  119.275 5.778   1.00 19.67 ? 275 SER A CA  1 
ATOM   1901 C  C   . SER A 1 275 ? 36.502  118.256 5.373   1.00 19.58 ? 275 SER A C   1 
ATOM   1902 O  O   . SER A 1 275 ? 36.366  117.582 4.346   1.00 18.38 ? 275 SER A O   1 
ATOM   1903 C  CB  . SER A 1 275 ? 35.881  120.675 5.350   1.00 19.58 ? 275 SER A CB  1 
ATOM   1904 O  OG  . SER A 1 275 ? 34.783  121.568 5.304   1.00 22.23 ? 275 SER A OG  1 
ATOM   1905 N  N   . ALA A 1 276 ? 37.564  118.155 6.169   1.00 18.95 ? 276 ALA A N   1 
ATOM   1906 C  CA  . ALA A 1 276 ? 38.643  117.211 5.877   1.00 19.16 ? 276 ALA A CA  1 
ATOM   1907 C  C   . ALA A 1 276 ? 38.120  115.776 5.934   1.00 18.75 ? 276 ALA A C   1 
ATOM   1908 O  O   . ALA A 1 276 ? 38.445  114.956 5.076   1.00 18.97 ? 276 ALA A O   1 
ATOM   1909 C  CB  . ALA A 1 276 ? 39.788  117.398 6.870   1.00 18.75 ? 276 ALA A CB  1 
ATOM   1910 N  N   . TRP A 1 277 ? 37.311  115.473 6.947   1.00 18.35 ? 277 TRP A N   1 
ATOM   1911 C  CA  . TRP A 1 277 ? 36.739  114.134 7.082   1.00 18.60 ? 277 TRP A CA  1 
ATOM   1912 C  C   . TRP A 1 277 ? 35.846  113.805 5.890   1.00 17.96 ? 277 TRP A C   1 
ATOM   1913 O  O   . TRP A 1 277 ? 35.864  112.683 5.375   1.00 17.66 ? 277 TRP A O   1 
ATOM   1914 C  CB  . TRP A 1 277 ? 35.910  114.023 8.366   1.00 19.85 ? 277 TRP A CB  1 
ATOM   1915 C  CG  . TRP A 1 277 ? 36.730  113.868 9.614   1.00 20.14 ? 277 TRP A CG  1 
ATOM   1916 C  CD1 . TRP A 1 277 ? 37.018  114.831 10.535  1.00 19.62 ? 277 TRP A CD1 1 
ATOM   1917 C  CD2 . TRP A 1 277 ? 37.364  112.667 10.075  1.00 21.05 ? 277 TRP A CD2 1 
ATOM   1918 N  NE1 . TRP A 1 277 ? 37.791  114.306 11.544  1.00 21.45 ? 277 TRP A NE1 1 
ATOM   1919 C  CE2 . TRP A 1 277 ? 38.018  112.979 11.287  1.00 22.42 ? 277 TRP A CE2 1 
ATOM   1920 C  CE3 . TRP A 1 277 ? 37.442  111.358 9.578   1.00 21.29 ? 277 TRP A CE3 1 
ATOM   1921 C  CZ2 . TRP A 1 277 ? 38.743  112.027 12.016  1.00 22.98 ? 277 TRP A CZ2 1 
ATOM   1922 C  CZ3 . TRP A 1 277 ? 38.166  110.408 10.303  1.00 22.58 ? 277 TRP A CZ3 1 
ATOM   1923 C  CH2 . TRP A 1 277 ? 38.806  110.751 11.510  1.00 22.22 ? 277 TRP A CH2 1 
ATOM   1924 N  N   . ASN A 1 278 ? 35.061  114.786 5.453   1.00 19.53 ? 278 ASN A N   1 
ATOM   1925 C  CA  . ASN A 1 278 ? 34.160  114.581 4.325   1.00 19.82 ? 278 ASN A CA  1 
ATOM   1926 C  C   . ASN A 1 278 ? 34.930  114.359 3.030   1.00 18.99 ? 278 ASN A C   1 
ATOM   1927 O  O   . ASN A 1 278 ? 34.515  113.573 2.180   1.00 19.47 ? 278 ASN A O   1 
ATOM   1928 C  CB  . ASN A 1 278 ? 33.210  115.777 4.174   1.00 19.59 ? 278 ASN A CB  1 
ATOM   1929 C  CG  . ASN A 1 278 ? 32.224  115.887 5.328   1.00 20.47 ? 278 ASN A CG  1 
ATOM   1930 O  OD1 . ASN A 1 278 ? 31.987  114.919 6.049   1.00 20.36 ? 278 ASN A OD1 1 
ATOM   1931 N  ND2 . ASN A 1 278 ? 31.633  117.065 5.496   1.00 18.42 ? 278 ASN A ND2 1 
ATOM   1932 N  N   . TYR A 1 279 ? 36.054  115.056 2.885   1.00 18.19 ? 279 TYR A N   1 
ATOM   1933 C  CA  . TYR A 1 279 ? 36.882  114.928 1.692   1.00 18.25 ? 279 TYR A CA  1 
ATOM   1934 C  C   . TYR A 1 279 ? 37.511  113.535 1.673   1.00 18.68 ? 279 TYR A C   1 
ATOM   1935 O  O   . TYR A 1 279 ? 37.579  112.888 0.629   1.00 17.97 ? 279 TYR A O   1 
ATOM   1936 C  CB  . TYR A 1 279 ? 37.979  115.997 1.688   1.00 18.63 ? 279 TYR A CB  1 
ATOM   1937 C  CG  . TYR A 1 279 ? 38.876  115.960 0.468   1.00 20.53 ? 279 TYR A CG  1 
ATOM   1938 C  CD1 . TYR A 1 279 ? 38.406  116.371 -0.780  1.00 19.64 ? 279 TYR A CD1 1 
ATOM   1939 C  CD2 . TYR A 1 279 ? 40.192  115.502 0.558   1.00 19.93 ? 279 TYR A CD2 1 
ATOM   1940 C  CE1 . TYR A 1 279 ? 39.222  116.328 -1.913  1.00 21.65 ? 279 TYR A CE1 1 
ATOM   1941 C  CE2 . TYR A 1 279 ? 41.018  115.453 -0.570  1.00 21.81 ? 279 TYR A CE2 1 
ATOM   1942 C  CZ  . TYR A 1 279 ? 40.523  115.868 -1.803  1.00 22.63 ? 279 TYR A CZ  1 
ATOM   1943 O  OH  . TYR A 1 279 ? 41.318  115.811 -2.927  1.00 22.94 ? 279 TYR A OH  1 
ATOM   1944 N  N   . LEU A 1 280 ? 37.969  113.080 2.835   1.00 18.62 ? 280 LEU A N   1 
ATOM   1945 C  CA  . LEU A 1 280 ? 38.577  111.756 2.950   1.00 19.50 ? 280 LEU A CA  1 
ATOM   1946 C  C   . LEU A 1 280 ? 37.589  110.691 2.488   1.00 20.35 ? 280 LEU A C   1 
ATOM   1947 O  O   . LEU A 1 280 ? 37.931  109.799 1.713   1.00 21.11 ? 280 LEU A O   1 
ATOM   1948 C  CB  . LEU A 1 280 ? 38.981  111.480 4.401   1.00 20.06 ? 280 LEU A CB  1 
ATOM   1949 C  CG  . LEU A 1 280 ? 39.611  110.109 4.671   1.00 20.81 ? 280 LEU A CG  1 
ATOM   1950 C  CD1 . LEU A 1 280 ? 40.898  109.972 3.866   1.00 20.11 ? 280 LEU A CD1 1 
ATOM   1951 C  CD2 . LEU A 1 280 ? 39.886  109.957 6.162   1.00 21.56 ? 280 LEU A CD2 1 
ATOM   1952 N  N   . LYS A 1 281 ? 36.356  110.780 2.968   1.00 20.86 ? 281 LYS A N   1 
ATOM   1953 C  CA  . LYS A 1 281 ? 35.346  109.812 2.568   1.00 22.31 ? 281 LYS A CA  1 
ATOM   1954 C  C   . LYS A 1 281 ? 34.984  110.002 1.098   1.00 19.98 ? 281 LYS A C   1 
ATOM   1955 O  O   . LYS A 1 281 ? 34.757  109.032 0.375   1.00 19.73 ? 281 LYS A O   1 
ATOM   1956 C  CB  . LYS A 1 281 ? 34.090  109.956 3.434   1.00 22.73 ? 281 LYS A CB  1 
ATOM   1957 C  CG  . LYS A 1 281 ? 32.954  109.014 3.033   1.00 27.20 ? 281 LYS A CG  1 
ATOM   1958 C  CD  . LYS A 1 281 ? 31.854  108.978 4.089   1.00 32.32 ? 281 LYS A CD  1 
ATOM   1959 C  CE  . LYS A 1 281 ? 31.246  110.357 4.309   1.00 37.68 ? 281 LYS A CE  1 
ATOM   1960 N  NZ  . LYS A 1 281 ? 30.283  110.358 5.442   1.00 42.83 ? 281 LYS A NZ  1 
ATOM   1961 N  N   . GLY A 1 282 ? 34.937  111.257 0.664   1.00 19.64 ? 282 GLY A N   1 
ATOM   1962 C  CA  . GLY A 1 282 ? 34.589  111.560 -0.714  1.00 19.91 ? 282 GLY A CA  1 
ATOM   1963 C  C   . GLY A 1 282 ? 35.495  110.968 -1.783  1.00 21.29 ? 282 GLY A C   1 
ATOM   1964 O  O   . GLY A 1 282 ? 35.016  110.574 -2.848  1.00 21.70 ? 282 GLY A O   1 
ATOM   1965 N  N   . ILE A 1 283 ? 36.797  110.895 -1.518  1.00 19.28 ? 283 ILE A N   1 
ATOM   1966 C  CA  . ILE A 1 283 ? 37.722  110.353 -2.512  1.00 21.31 ? 283 ILE A CA  1 
ATOM   1967 C  C   . ILE A 1 283 ? 37.898  108.835 -2.449  1.00 21.88 ? 283 ILE A C   1 
ATOM   1968 O  O   . ILE A 1 283 ? 38.564  108.253 -3.306  1.00 21.90 ? 283 ILE A O   1 
ATOM   1969 C  CB  . ILE A 1 283 ? 39.122  111.017 -2.406  1.00 20.77 ? 283 ILE A CB  1 
ATOM   1970 C  CG1 . ILE A 1 283 ? 39.741  110.736 -1.032  1.00 21.56 ? 283 ILE A CG1 1 
ATOM   1971 C  CG2 . ILE A 1 283 ? 38.997  112.519 -2.642  1.00 20.39 ? 283 ILE A CG2 1 
ATOM   1972 C  CD1 . ILE A 1 283 ? 41.132  111.326 -0.847  1.00 21.27 ? 283 ILE A CD1 1 
ATOM   1973 N  N   . LEU A 1 284 ? 37.293  108.193 -1.452  1.00 22.34 ? 284 LEU A N   1 
ATOM   1974 C  CA  . LEU A 1 284 ? 37.415  106.742 -1.306  1.00 23.02 ? 284 LEU A CA  1 
ATOM   1975 C  C   . LEU A 1 284 ? 36.096  105.985 -1.420  1.00 23.98 ? 284 LEU A C   1 
ATOM   1976 O  O   . LEU A 1 284 ? 36.088  104.775 -1.658  1.00 23.72 ? 284 LEU A O   1 
ATOM   1977 C  CB  . LEU A 1 284 ? 38.032  106.404 0.054   1.00 22.20 ? 284 LEU A CB  1 
ATOM   1978 C  CG  . LEU A 1 284 ? 39.374  107.030 0.436   1.00 23.26 ? 284 LEU A CG  1 
ATOM   1979 C  CD1 . LEU A 1 284 ? 39.702  106.653 1.871   1.00 22.29 ? 284 LEU A CD1 1 
ATOM   1980 C  CD2 . LEU A 1 284 ? 40.465  106.563 -0.514  1.00 23.00 ? 284 LEU A CD2 1 
ATOM   1981 N  N   . GLN A 1 285 ? 34.984  106.695 -1.260  1.00 24.53 ? 285 GLN A N   1 
ATOM   1982 C  CA  . GLN A 1 285 ? 33.669  106.063 -1.274  1.00 25.37 ? 285 GLN A CA  1 
ATOM   1983 C  C   . GLN A 1 285 ? 33.246  105.312 -2.532  1.00 26.32 ? 285 GLN A C   1 
ATOM   1984 O  O   . GLN A 1 285 ? 32.595  104.278 -2.436  1.00 26.01 ? 285 GLN A O   1 
ATOM   1985 C  CB  . GLN A 1 285 ? 32.595  107.094 -0.911  1.00 25.65 ? 285 GLN A CB  1 
ATOM   1986 C  CG  . GLN A 1 285 ? 32.263  108.076 -2.021  1.00 25.95 ? 285 GLN A CG  1 
ATOM   1987 C  CD  . GLN A 1 285 ? 31.527  109.303 -1.507  1.00 26.47 ? 285 GLN A CD  1 
ATOM   1988 O  OE1 . GLN A 1 285 ? 30.945  109.285 -0.420  1.00 25.36 ? 285 GLN A OE1 1 
ATOM   1989 N  NE2 . GLN A 1 285 ? 31.545  110.374 -2.293  1.00 25.18 ? 285 GLN A NE2 1 
ATOM   1990 N  N   . ASP A 1 286 ? 33.603  105.810 -3.708  1.00 28.01 ? 286 ASP A N   1 
ATOM   1991 C  CA  . ASP A 1 286 ? 33.189  105.128 -4.928  1.00 31.04 ? 286 ASP A CA  1 
ATOM   1992 C  C   . ASP A 1 286 ? 33.811  103.747 -5.082  1.00 30.72 ? 286 ASP A C   1 
ATOM   1993 O  O   . ASP A 1 286 ? 33.155  102.815 -5.545  1.00 30.04 ? 286 ASP A O   1 
ATOM   1994 C  CB  . ASP A 1 286 ? 33.486  105.992 -6.153  1.00 35.18 ? 286 ASP A CB  1 
ATOM   1995 C  CG  . ASP A 1 286 ? 32.645  107.261 -6.183  1.00 40.08 ? 286 ASP A CG  1 
ATOM   1996 O  OD1 . ASP A 1 286 ? 31.467  107.206 -5.756  1.00 40.40 ? 286 ASP A OD1 1 
ATOM   1997 O  OD2 . ASP A 1 286 ? 33.157  108.304 -6.643  1.00 43.63 ? 286 ASP A OD2 1 
ATOM   1998 N  N   . ARG A 1 287 ? 35.073  103.612 -4.695  1.00 29.99 ? 287 ARG A N   1 
ATOM   1999 C  CA  . ARG A 1 287 ? 35.741  102.319 -4.773  1.00 30.33 ? 287 ARG A CA  1 
ATOM   2000 C  C   . ARG A 1 287 ? 35.254  101.467 -3.602  1.00 28.10 ? 287 ARG A C   1 
ATOM   2001 O  O   . ARG A 1 287 ? 35.189  100.244 -3.693  1.00 28.64 ? 287 ARG A O   1 
ATOM   2002 C  CB  . ARG A 1 287 ? 37.257  102.492 -4.682  1.00 33.40 ? 287 ARG A CB  1 
ATOM   2003 C  CG  . ARG A 1 287 ? 37.901  103.221 -5.855  1.00 40.33 ? 287 ARG A CG  1 
ATOM   2004 C  CD  . ARG A 1 287 ? 37.944  102.355 -7.112  1.00 45.49 ? 287 ARG A CD  1 
ATOM   2005 N  NE  . ARG A 1 287 ? 36.640  102.240 -7.758  1.00 50.33 ? 287 ARG A NE  1 
ATOM   2006 C  CZ  . ARG A 1 287 ? 36.019  103.246 -8.369  1.00 53.65 ? 287 ARG A CZ  1 
ATOM   2007 N  NH1 . ARG A 1 287 ? 36.586  104.446 -8.418  1.00 55.68 ? 287 ARG A NH1 1 
ATOM   2008 N  NH2 . ARG A 1 287 ? 34.831  103.053 -8.929  1.00 53.11 ? 287 ARG A NH2 1 
ATOM   2009 N  N   . GLY A 1 288 ? 34.902  102.128 -2.503  1.00 26.73 ? 288 GLY A N   1 
ATOM   2010 C  CA  . GLY A 1 288 ? 34.436  101.418 -1.324  1.00 26.40 ? 288 GLY A CA  1 
ATOM   2011 C  C   . GLY A 1 288 ? 35.439  101.542 -0.193  1.00 26.17 ? 288 GLY A C   1 
ATOM   2012 O  O   . GLY A 1 288 ? 36.605  101.168 -0.340  1.00 25.03 ? 288 GLY A O   1 
ATOM   2013 N  N   . LEU A 1 289 ? 34.989  102.065 0.941   1.00 25.39 ? 289 LEU A N   1 
ATOM   2014 C  CA  . LEU A 1 289 ? 35.864  102.255 2.090   1.00 25.93 ? 289 LEU A CA  1 
ATOM   2015 C  C   . LEU A 1 289 ? 36.542  100.973 2.576   1.00 26.18 ? 289 LEU A C   1 
ATOM   2016 O  O   . LEU A 1 289 ? 37.640  101.023 3.129   1.00 26.72 ? 289 LEU A O   1 
ATOM   2017 C  CB  . LEU A 1 289 ? 35.084  102.897 3.243   1.00 26.20 ? 289 LEU A CB  1 
ATOM   2018 C  CG  . LEU A 1 289 ? 34.429  104.251 2.947   1.00 27.68 ? 289 LEU A CG  1 
ATOM   2019 C  CD1 . LEU A 1 289 ? 33.740  104.765 4.205   1.00 26.81 ? 289 LEU A CD1 1 
ATOM   2020 C  CD2 . LEU A 1 289 ? 35.479  105.251 2.474   1.00 28.05 ? 289 LEU A CD2 1 
ATOM   2021 N  N   . SER A 1 290 ? 35.899  99.829  2.370   1.00 24.86 ? 290 SER A N   1 
ATOM   2022 C  CA  . SER A 1 290 ? 36.473  98.563  2.814   1.00 26.98 ? 290 SER A CA  1 
ATOM   2023 C  C   . SER A 1 290 ? 37.638  98.105  1.938   1.00 26.51 ? 290 SER A C   1 
ATOM   2024 O  O   . SER A 1 290 ? 38.303  97.124  2.262   1.00 27.66 ? 290 SER A O   1 
ATOM   2025 C  CB  . SER A 1 290 ? 35.403  97.464  2.843   1.00 25.88 ? 290 SER A CB  1 
ATOM   2026 O  OG  . SER A 1 290 ? 35.004  97.098  1.533   1.00 28.15 ? 290 SER A OG  1 
ATOM   2027 N  N   . LYS A 1 291 ? 37.883  98.805  0.833   1.00 26.03 ? 291 LYS A N   1 
ATOM   2028 C  CA  . LYS A 1 291 ? 38.976  98.437  -0.066  1.00 27.42 ? 291 LYS A CA  1 
ATOM   2029 C  C   . LYS A 1 291 ? 40.307  99.013  0.412   1.00 26.60 ? 291 LYS A C   1 
ATOM   2030 O  O   . LYS A 1 291 ? 41.348  98.785  -0.208  1.00 27.43 ? 291 LYS A O   1 
ATOM   2031 C  CB  . LYS A 1 291 ? 38.700  98.935  -1.491  1.00 28.75 ? 291 LYS A CB  1 
ATOM   2032 C  CG  . LYS A 1 291 ? 37.368  98.492  -2.080  1.00 31.38 ? 291 LYS A CG  1 
ATOM   2033 C  CD  . LYS A 1 291 ? 37.233  96.983  -2.113  1.00 34.17 ? 291 LYS A CD  1 
ATOM   2034 C  CE  . LYS A 1 291 ? 35.900  96.569  -2.723  1.00 35.77 ? 291 LYS A CE  1 
ATOM   2035 N  NZ  . LYS A 1 291 ? 35.693  95.096  -2.660  1.00 38.60 ? 291 LYS A NZ  1 
ATOM   2036 N  N   . TYR A 1 292 ? 40.268  99.759  1.512   1.00 24.54 ? 292 TYR A N   1 
ATOM   2037 C  CA  . TYR A 1 292 ? 41.469  100.371 2.068   1.00 25.42 ? 292 TYR A CA  1 
ATOM   2038 C  C   . TYR A 1 292 ? 41.689  99.901  3.504   1.00 26.25 ? 292 TYR A C   1 
ATOM   2039 O  O   . TYR A 1 292 ? 41.517  100.665 4.457   1.00 25.66 ? 292 TYR A O   1 
ATOM   2040 C  CB  . TYR A 1 292 ? 41.352  101.894 2.009   1.00 22.64 ? 292 TYR A CB  1 
ATOM   2041 C  CG  . TYR A 1 292 ? 41.016  102.401 0.622   1.00 23.89 ? 292 TYR A CG  1 
ATOM   2042 C  CD1 . TYR A 1 292 ? 39.690  102.544 0.209   1.00 23.69 ? 292 TYR A CD1 1 
ATOM   2043 C  CD2 . TYR A 1 292 ? 42.026  102.696 -0.295  1.00 22.34 ? 292 TYR A CD2 1 
ATOM   2044 C  CE1 . TYR A 1 292 ? 39.376  102.971 -1.087  1.00 23.76 ? 292 TYR A CE1 1 
ATOM   2045 C  CE2 . TYR A 1 292 ? 41.726  103.117 -1.588  1.00 24.79 ? 292 TYR A CE2 1 
ATOM   2046 C  CZ  . TYR A 1 292 ? 40.399  103.253 -1.978  1.00 25.30 ? 292 TYR A CZ  1 
ATOM   2047 O  OH  . TYR A 1 292 ? 40.110  103.664 -3.259  1.00 26.70 ? 292 TYR A OH  1 
ATOM   2048 N  N   . PRO A 1 293 ? 42.098  98.630  3.666   1.00 26.77 ? 293 PRO A N   1 
ATOM   2049 C  CA  . PRO A 1 293 ? 42.360  97.972  4.951   1.00 26.87 ? 293 PRO A CA  1 
ATOM   2050 C  C   . PRO A 1 293 ? 43.265  98.706  5.937   1.00 27.35 ? 293 PRO A C   1 
ATOM   2051 O  O   . PRO A 1 293 ? 43.025  98.669  7.145   1.00 29.25 ? 293 PRO A O   1 
ATOM   2052 C  CB  . PRO A 1 293 ? 42.926  96.612  4.536   1.00 28.25 ? 293 PRO A CB  1 
ATOM   2053 C  CG  . PRO A 1 293 ? 43.575  96.899  3.214   1.00 27.40 ? 293 PRO A CG  1 
ATOM   2054 C  CD  . PRO A 1 293 ? 42.542  97.777  2.549   1.00 26.05 ? 293 PRO A CD  1 
ATOM   2055 N  N   . ASN A 1 294 ? 44.302  99.371  5.440   1.00 26.93 ? 294 ASN A N   1 
ATOM   2056 C  CA  . ASN A 1 294 ? 45.203  100.085 6.337   1.00 27.16 ? 294 ASN A CA  1 
ATOM   2057 C  C   . ASN A 1 294 ? 44.563  101.309 6.976   1.00 27.81 ? 294 ASN A C   1 
ATOM   2058 O  O   . ASN A 1 294 ? 44.925  101.691 8.091   1.00 27.88 ? 294 ASN A O   1 
ATOM   2059 C  CB  . ASN A 1 294 ? 46.479  100.506 5.605   1.00 26.90 ? 294 ASN A CB  1 
ATOM   2060 C  CG  . ASN A 1 294 ? 47.266  99.321  5.094   1.00 28.77 ? 294 ASN A CG  1 
ATOM   2061 O  OD1 . ASN A 1 294 ? 47.243  98.247  5.694   1.00 28.55 ? 294 ASN A OD1 1 
ATOM   2062 N  ND2 . ASN A 1 294 ? 47.976  99.510  3.986   1.00 26.65 ? 294 ASN A ND2 1 
ATOM   2063 N  N   . LEU A 1 295 ? 43.614  101.925 6.276   1.00 27.36 ? 295 LEU A N   1 
ATOM   2064 C  CA  . LEU A 1 295 ? 42.945  103.113 6.799   1.00 27.96 ? 295 LEU A CA  1 
ATOM   2065 C  C   . LEU A 1 295 ? 42.209  102.794 8.094   1.00 26.35 ? 295 LEU A C   1 
ATOM   2066 O  O   . LEU A 1 295 ? 42.248  103.573 9.047   1.00 27.18 ? 295 LEU A O   1 
ATOM   2067 C  CB  . LEU A 1 295 ? 41.963  103.677 5.766   1.00 28.35 ? 295 LEU A CB  1 
ATOM   2068 C  CG  . LEU A 1 295 ? 41.268  104.989 6.148   1.00 29.37 ? 295 LEU A CG  1 
ATOM   2069 C  CD1 . LEU A 1 295 ? 42.309  106.051 6.467   1.00 30.72 ? 295 LEU A CD1 1 
ATOM   2070 C  CD2 . LEU A 1 295 ? 40.378  105.449 5.010   1.00 28.30 ? 295 LEU A CD2 1 
ATOM   2071 N  N   . LEU A 1 296 ? 41.547  101.644 8.125   1.00 26.62 ? 296 LEU A N   1 
ATOM   2072 C  CA  . LEU A 1 296 ? 40.809  101.217 9.308   1.00 28.58 ? 296 LEU A CA  1 
ATOM   2073 C  C   . LEU A 1 296 ? 41.720  101.124 10.531  1.00 30.52 ? 296 LEU A C   1 
ATOM   2074 O  O   . LEU A 1 296 ? 41.381  101.617 11.607  1.00 28.68 ? 296 LEU A O   1 
ATOM   2075 C  CB  . LEU A 1 296 ? 40.148  99.858  9.060   1.00 26.92 ? 296 LEU A CB  1 
ATOM   2076 C  CG  . LEU A 1 296 ? 39.438  99.258  10.280  1.00 28.47 ? 296 LEU A CG  1 
ATOM   2077 C  CD1 . LEU A 1 296 ? 38.372  100.217 10.790  1.00 25.71 ? 296 LEU A CD1 1 
ATOM   2078 C  CD2 . LEU A 1 296 ? 38.825  97.926  9.906   1.00 28.03 ? 296 LEU A CD2 1 
ATOM   2079 N  N   . ASN A 1 297 ? 42.879  100.492 10.363  1.00 32.67 ? 297 ASN A N   1 
ATOM   2080 C  CA  . ASN A 1 297 ? 43.822  100.350 11.467  1.00 35.55 ? 297 ASN A CA  1 
ATOM   2081 C  C   . ASN A 1 297 ? 44.329  101.703 11.943  1.00 35.49 ? 297 ASN A C   1 
ATOM   2082 O  O   . ASN A 1 297 ? 44.411  101.955 13.144  1.00 35.18 ? 297 ASN A O   1 
ATOM   2083 C  CB  . ASN A 1 297 ? 45.012  99.482  11.053  1.00 39.24 ? 297 ASN A CB  1 
ATOM   2084 C  CG  . ASN A 1 297 ? 44.612  98.057  10.748  1.00 42.79 ? 297 ASN A CG  1 
ATOM   2085 O  OD1 . ASN A 1 297 ? 43.927  97.408  11.542  1.00 46.49 ? 297 ASN A OD1 1 
ATOM   2086 N  ND2 . ASN A 1 297 ? 45.043  97.555  9.598   1.00 46.11 ? 297 ASN A ND2 1 
ATOM   2087 N  N   . GLN A 1 298 ? 44.666  102.575 11.002  1.00 36.42 ? 298 GLN A N   1 
ATOM   2088 C  CA  . GLN A 1 298 ? 45.163  103.895 11.355  1.00 38.63 ? 298 GLN A CA  1 
ATOM   2089 C  C   . GLN A 1 298 ? 44.142  104.724 12.126  1.00 39.04 ? 298 GLN A C   1 
ATOM   2090 O  O   . GLN A 1 298 ? 44.500  105.435 13.064  1.00 39.75 ? 298 GLN A O   1 
ATOM   2091 C  CB  . GLN A 1 298 ? 45.620  104.643 10.100  1.00 40.16 ? 298 GLN A CB  1 
ATOM   2092 C  CG  . GLN A 1 298 ? 46.912  104.086 9.515   1.00 44.45 ? 298 GLN A CG  1 
ATOM   2093 C  CD  . GLN A 1 298 ? 47.481  104.947 8.403   1.00 47.18 ? 298 GLN A CD  1 
ATOM   2094 O  OE1 . GLN A 1 298 ? 47.652  106.158 8.563   1.00 48.94 ? 298 GLN A OE1 1 
ATOM   2095 N  NE2 . GLN A 1 298 ? 47.789  104.323 7.272   1.00 48.91 ? 298 GLN A NE2 1 
ATOM   2096 N  N   . LEU A 1 299 ? 42.873  104.638 11.737  1.00 38.28 ? 299 LEU A N   1 
ATOM   2097 C  CA  . LEU A 1 299 ? 41.826  105.389 12.424  1.00 38.07 ? 299 LEU A CA  1 
ATOM   2098 C  C   . LEU A 1 299 ? 41.555  104.744 13.773  1.00 39.30 ? 299 LEU A C   1 
ATOM   2099 O  O   . LEU A 1 299 ? 41.204  105.416 14.742  1.00 38.92 ? 299 LEU A O   1 
ATOM   2100 C  CB  . LEU A 1 299 ? 40.541  105.409 11.590  1.00 36.07 ? 299 LEU A CB  1 
ATOM   2101 C  CG  . LEU A 1 299 ? 40.639  106.114 10.237  1.00 34.36 ? 299 LEU A CG  1 
ATOM   2102 C  CD1 . LEU A 1 299 ? 39.284  106.099 9.544   1.00 32.74 ? 299 LEU A CD1 1 
ATOM   2103 C  CD2 . LEU A 1 299 ? 41.117  107.544 10.448  1.00 34.61 ? 299 LEU A CD2 1 
ATOM   2104 N  N   . LEU A 1 300 ? 41.724  103.429 13.822  1.00 41.17 ? 300 LEU A N   1 
ATOM   2105 C  CA  . LEU A 1 300 ? 41.514  102.666 15.041  1.00 44.58 ? 300 LEU A CA  1 
ATOM   2106 C  C   . LEU A 1 300 ? 42.569  103.043 16.080  1.00 48.37 ? 300 LEU A C   1 
ATOM   2107 O  O   . LEU A 1 300 ? 42.300  103.029 17.283  1.00 49.35 ? 300 LEU A O   1 
ATOM   2108 C  CB  . LEU A 1 300 ? 41.589  101.171 14.725  1.00 43.61 ? 300 LEU A CB  1 
ATOM   2109 C  CG  . LEU A 1 300 ? 40.359  100.301 14.998  1.00 44.14 ? 300 LEU A CG  1 
ATOM   2110 C  CD1 . LEU A 1 300 ? 39.081  101.063 14.703  1.00 45.19 ? 300 LEU A CD1 1 
ATOM   2111 C  CD2 . LEU A 1 300 ? 40.445  99.047  14.146  1.00 44.13 ? 300 LEU A CD2 1 
ATOM   2112 N  N   . ASP A 1 301 ? 43.766  103.390 15.614  1.00 51.26 ? 301 ASP A N   1 
ATOM   2113 C  CA  . ASP A 1 301 ? 44.847  103.771 16.517  1.00 54.78 ? 301 ASP A CA  1 
ATOM   2114 C  C   . ASP A 1 301 ? 44.669  105.185 17.058  1.00 56.51 ? 301 ASP A C   1 
ATOM   2115 O  O   . ASP A 1 301 ? 45.194  105.519 18.119  1.00 57.99 ? 301 ASP A O   1 
ATOM   2116 C  CB  . ASP A 1 301 ? 46.208  103.668 15.818  1.00 55.77 ? 301 ASP A CB  1 
ATOM   2117 C  CG  . ASP A 1 301 ? 46.571  102.241 15.452  1.00 57.44 ? 301 ASP A CG  1 
ATOM   2118 O  OD1 . ASP A 1 301 ? 46.309  101.334 16.269  1.00 58.65 ? 301 ASP A OD1 1 
ATOM   2119 O  OD2 . ASP A 1 301 ? 47.131  102.028 14.354  1.00 58.64 ? 301 ASP A OD2 1 
ATOM   2120 N  N   . LEU A 1 302 ? 43.931  106.015 16.327  1.00 58.06 ? 302 LEU A N   1 
ATOM   2121 C  CA  . LEU A 1 302 ? 43.693  107.391 16.747  1.00 59.45 ? 302 LEU A CA  1 
ATOM   2122 C  C   . LEU A 1 302 ? 42.432  107.534 17.586  1.00 60.44 ? 302 LEU A C   1 
ATOM   2123 O  O   . LEU A 1 302 ? 42.287  108.491 18.343  1.00 60.69 ? 302 LEU A O   1 
ATOM   2124 C  CB  . LEU A 1 302 ? 43.595  108.308 15.527  1.00 59.45 ? 302 LEU A CB  1 
ATOM   2125 C  CG  . LEU A 1 302 ? 44.921  108.786 14.930  1.00 61.21 ? 302 LEU A CG  1 
ATOM   2126 C  CD1 . LEU A 1 302 ? 45.596  109.744 15.903  1.00 60.97 ? 302 LEU A CD1 1 
ATOM   2127 C  CD2 . LEU A 1 302 ? 45.821  107.594 14.636  1.00 62.07 ? 302 LEU A CD2 1 
ATOM   2128 N  N   . GLN A 1 303 ? 41.524  106.574 17.449  1.00 62.51 ? 303 GLN A N   1 
ATOM   2129 C  CA  . GLN A 1 303 ? 40.263  106.596 18.179  1.00 64.54 ? 303 GLN A CA  1 
ATOM   2130 C  C   . GLN A 1 303 ? 40.402  106.930 19.664  1.00 65.75 ? 303 GLN A C   1 
ATOM   2131 O  O   . GLN A 1 303 ? 39.765  107.860 20.155  1.00 65.65 ? 303 GLN A O   1 
ATOM   2132 C  CB  . GLN A 1 303 ? 39.543  105.256 18.020  1.00 64.97 ? 303 GLN A CB  1 
ATOM   2133 C  CG  . GLN A 1 303 ? 38.232  105.172 18.775  1.00 66.87 ? 303 GLN A CG  1 
ATOM   2134 C  CD  . GLN A 1 303 ? 37.512  103.863 18.540  1.00 68.73 ? 303 GLN A CD  1 
ATOM   2135 O  OE1 . GLN A 1 303 ? 38.084  102.787 18.717  1.00 69.79 ? 303 GLN A OE1 1 
ATOM   2136 N  NE2 . GLN A 1 303 ? 36.246  103.946 18.144  1.00 69.95 ? 303 GLN A NE2 1 
ATOM   2137 N  N   . PRO A 1 304 ? 41.245  106.181 20.396  1.00 67.02 ? 304 PRO A N   1 
ATOM   2138 C  CA  . PRO A 1 304 ? 41.433  106.433 21.829  1.00 67.17 ? 304 PRO A CA  1 
ATOM   2139 C  C   . PRO A 1 304 ? 41.802  107.873 22.181  1.00 66.93 ? 304 PRO A C   1 
ATOM   2140 O  O   . PRO A 1 304 ? 41.393  108.388 23.221  1.00 67.17 ? 304 PRO A O   1 
ATOM   2141 C  CB  . PRO A 1 304 ? 42.531  105.441 22.210  1.00 67.60 ? 304 PRO A CB  1 
ATOM   2142 C  CG  . PRO A 1 304 ? 43.321  105.317 20.941  1.00 67.96 ? 304 PRO A CG  1 
ATOM   2143 C  CD  . PRO A 1 304 ? 42.228  105.196 19.912  1.00 67.42 ? 304 PRO A CD  1 
ATOM   2144 N  N   . SER A 1 305 ? 42.569  108.521 21.310  1.00 66.31 ? 305 SER A N   1 
ATOM   2145 C  CA  . SER A 1 305 ? 42.990  109.896 21.547  1.00 65.59 ? 305 SER A CA  1 
ATOM   2146 C  C   . SER A 1 305 ? 42.210  110.917 20.719  1.00 65.55 ? 305 SER A C   1 
ATOM   2147 O  O   . SER A 1 305 ? 42.358  112.124 20.917  1.00 65.86 ? 305 SER A O   1 
ATOM   2148 C  CB  . SER A 1 305 ? 44.486  110.039 21.261  1.00 65.70 ? 305 SER A CB  1 
ATOM   2149 O  OG  . SER A 1 305 ? 44.794  109.617 19.944  1.00 65.73 ? 305 SER A OG  1 
ATOM   2150 N  N   . HIS A 1 306 ? 41.385  110.439 19.790  1.00 64.66 ? 306 HIS A N   1 
ATOM   2151 C  CA  . HIS A 1 306 ? 40.594  111.333 18.946  1.00 63.56 ? 306 HIS A CA  1 
ATOM   2152 C  C   . HIS A 1 306 ? 39.195  110.783 18.685  1.00 61.30 ? 306 HIS A C   1 
ATOM   2153 O  O   . HIS A 1 306 ? 38.728  110.784 17.547  1.00 61.72 ? 306 HIS A O   1 
ATOM   2154 C  CB  . HIS A 1 306 ? 41.295  111.562 17.600  1.00 65.69 ? 306 HIS A CB  1 
ATOM   2155 C  CG  . HIS A 1 306 ? 42.666  112.153 17.719  1.00 67.75 ? 306 HIS A CG  1 
ATOM   2156 N  ND1 . HIS A 1 306 ? 43.697  111.518 18.378  1.00 68.80 ? 306 HIS A ND1 1 
ATOM   2157 C  CD2 . HIS A 1 306 ? 43.181  113.312 17.245  1.00 68.80 ? 306 HIS A CD2 1 
ATOM   2158 C  CE1 . HIS A 1 306 ? 44.787  112.261 18.306  1.00 69.61 ? 306 HIS A CE1 1 
ATOM   2159 N  NE2 . HIS A 1 306 ? 44.501  113.355 17.624  1.00 69.61 ? 306 HIS A NE2 1 
ATOM   2160 N  N   . SER A 1 307 ? 38.525  110.317 19.733  1.00 58.37 ? 307 SER A N   1 
ATOM   2161 C  CA  . SER A 1 307 ? 37.181  109.767 19.583  1.00 55.59 ? 307 SER A CA  1 
ATOM   2162 C  C   . SER A 1 307 ? 36.134  110.832 19.282  1.00 52.68 ? 307 SER A C   1 
ATOM   2163 O  O   . SER A 1 307 ? 35.162  110.992 20.029  1.00 52.67 ? 307 SER A O   1 
ATOM   2164 C  CB  . SER A 1 307 ? 36.767  108.993 20.839  1.00 57.32 ? 307 SER A CB  1 
ATOM   2165 O  OG  . SER A 1 307 ? 37.363  107.707 20.868  1.00 60.04 ? 307 SER A OG  1 
ATOM   2166 N  N   . SER A 1 308 ? 36.337  111.564 18.191  1.00 47.59 ? 308 SER A N   1 
ATOM   2167 C  CA  . SER A 1 308 ? 35.390  112.590 17.789  1.00 42.26 ? 308 SER A CA  1 
ATOM   2168 C  C   . SER A 1 308 ? 34.261  111.859 17.079  1.00 39.08 ? 308 SER A C   1 
ATOM   2169 O  O   . SER A 1 308 ? 34.444  110.735 16.607  1.00 37.65 ? 308 SER A O   1 
ATOM   2170 C  CB  . SER A 1 308 ? 36.042  113.576 16.822  1.00 42.84 ? 308 SER A CB  1 
ATOM   2171 O  OG  . SER A 1 308 ? 36.306  112.957 15.576  1.00 42.63 ? 308 SER A OG  1 
ATOM   2172 N  N   . PRO A 1 309 ? 33.075  112.477 16.996  1.00 35.96 ? 309 PRO A N   1 
ATOM   2173 C  CA  . PRO A 1 309 ? 31.981  111.785 16.312  1.00 32.99 ? 309 PRO A CA  1 
ATOM   2174 C  C   . PRO A 1 309 ? 32.305  111.517 14.840  1.00 30.32 ? 309 PRO A C   1 
ATOM   2175 O  O   . PRO A 1 309 ? 31.778  110.576 14.245  1.00 28.07 ? 309 PRO A O   1 
ATOM   2176 C  CB  . PRO A 1 309 ? 30.798  112.735 16.499  1.00 33.39 ? 309 PRO A CB  1 
ATOM   2177 C  CG  . PRO A 1 309 ? 31.456  114.089 16.579  1.00 34.97 ? 309 PRO A CG  1 
ATOM   2178 C  CD  . PRO A 1 309 ? 32.655  113.813 17.459  1.00 34.88 ? 309 PRO A CD  1 
ATOM   2179 N  N   . TYR A 1 310 ? 33.183  112.335 14.265  1.00 27.71 ? 310 TYR A N   1 
ATOM   2180 C  CA  . TYR A 1 310 ? 33.563  112.180 12.862  1.00 26.86 ? 310 TYR A CA  1 
ATOM   2181 C  C   . TYR A 1 310 ? 34.365  110.904 12.631  1.00 24.78 ? 310 TYR A C   1 
ATOM   2182 O  O   . TYR A 1 310 ? 34.174  110.215 11.631  1.00 23.46 ? 310 TYR A O   1 
ATOM   2183 C  CB  . TYR A 1 310 ? 34.379  113.387 12.392  1.00 29.61 ? 310 TYR A CB  1 
ATOM   2184 C  CG  . TYR A 1 310 ? 33.750  114.709 12.757  1.00 31.92 ? 310 TYR A CG  1 
ATOM   2185 C  CD1 . TYR A 1 310 ? 34.245  115.465 13.818  1.00 34.22 ? 310 TYR A CD1 1 
ATOM   2186 C  CD2 . TYR A 1 310 ? 32.618  115.170 12.090  1.00 33.11 ? 310 TYR A CD2 1 
ATOM   2187 C  CE1 . TYR A 1 310 ? 33.624  116.645 14.212  1.00 36.46 ? 310 TYR A CE1 1 
ATOM   2188 C  CE2 . TYR A 1 310 ? 31.987  116.351 12.475  1.00 36.50 ? 310 TYR A CE2 1 
ATOM   2189 C  CZ  . TYR A 1 310 ? 32.494  117.081 13.538  1.00 36.83 ? 310 TYR A CZ  1 
ATOM   2190 O  OH  . TYR A 1 310 ? 31.864  118.236 13.936  1.00 37.54 ? 310 TYR A OH  1 
ATOM   2191 N  N   . LEU A 1 311 ? 35.262  110.592 13.559  1.00 23.99 ? 311 LEU A N   1 
ATOM   2192 C  CA  . LEU A 1 311 ? 36.076  109.390 13.438  1.00 23.95 ? 311 LEU A CA  1 
ATOM   2193 C  C   . LEU A 1 311 ? 35.206  108.158 13.692  1.00 22.99 ? 311 LEU A C   1 
ATOM   2194 O  O   . LEU A 1 311 ? 35.309  107.155 12.984  1.00 21.60 ? 311 LEU A O   1 
ATOM   2195 C  CB  . LEU A 1 311 ? 37.239  109.439 14.435  1.00 23.89 ? 311 LEU A CB  1 
ATOM   2196 C  CG  . LEU A 1 311 ? 38.232  108.272 14.414  1.00 24.97 ? 311 LEU A CG  1 
ATOM   2197 C  CD1 . LEU A 1 311 ? 39.541  108.705 15.051  1.00 27.74 ? 311 LEU A CD1 1 
ATOM   2198 C  CD2 . LEU A 1 311 ? 37.648  107.080 15.148  1.00 25.23 ? 311 LEU A CD2 1 
ATOM   2199 N  N   . ILE A 1 312 ? 34.343  108.245 14.699  1.00 22.57 ? 312 ILE A N   1 
ATOM   2200 C  CA  . ILE A 1 312 ? 33.457  107.139 15.045  1.00 22.17 ? 312 ILE A CA  1 
ATOM   2201 C  C   . ILE A 1 312 ? 32.506  106.840 13.887  1.00 21.69 ? 312 ILE A C   1 
ATOM   2202 O  O   . ILE A 1 312 ? 32.256  105.677 13.557  1.00 21.08 ? 312 ILE A O   1 
ATOM   2203 C  CB  . ILE A 1 312 ? 32.626  107.463 16.309  1.00 23.57 ? 312 ILE A CB  1 
ATOM   2204 C  CG1 . ILE A 1 312 ? 33.560  107.717 17.492  1.00 25.46 ? 312 ILE A CG1 1 
ATOM   2205 C  CG2 . ILE A 1 312 ? 31.674  106.306 16.623  1.00 23.08 ? 312 ILE A CG2 1 
ATOM   2206 C  CD1 . ILE A 1 312 ? 34.487  106.554 17.798  1.00 30.15 ? 312 ILE A CD1 1 
ATOM   2207 N  N   . ALA A 1 313 ? 31.980  107.896 13.275  1.00 20.37 ? 313 ALA A N   1 
ATOM   2208 C  CA  . ALA A 1 313 ? 31.066  107.751 12.147  1.00 18.93 ? 313 ALA A CA  1 
ATOM   2209 C  C   . ALA A 1 313 ? 31.795  107.127 10.955  1.00 19.62 ? 313 ALA A C   1 
ATOM   2210 O  O   . ALA A 1 313 ? 31.236  106.292 10.237  1.00 19.20 ? 313 ALA A O   1 
ATOM   2211 C  CB  . ALA A 1 313 ? 30.496  109.118 11.761  1.00 19.90 ? 313 ALA A CB  1 
ATOM   2212 N  N   . PHE A 1 314 ? 33.044  107.532 10.745  1.00 19.45 ? 314 PHE A N   1 
ATOM   2213 C  CA  . PHE A 1 314 ? 33.823  107.000 9.635   1.00 20.34 ? 314 PHE A CA  1 
ATOM   2214 C  C   . PHE A 1 314 ? 34.008  105.492 9.818   1.00 19.87 ? 314 PHE A C   1 
ATOM   2215 O  O   . PHE A 1 314 ? 33.947  104.732 8.853   1.00 21.20 ? 314 PHE A O   1 
ATOM   2216 C  CB  . PHE A 1 314 ? 35.191  107.687 9.558   1.00 20.91 ? 314 PHE A CB  1 
ATOM   2217 C  CG  . PHE A 1 314 ? 35.818  107.631 8.191   1.00 22.42 ? 314 PHE A CG  1 
ATOM   2218 C  CD1 . PHE A 1 314 ? 35.721  108.713 7.325   1.00 21.99 ? 314 PHE A CD1 1 
ATOM   2219 C  CD2 . PHE A 1 314 ? 36.467  106.480 7.755   1.00 24.44 ? 314 PHE A CD2 1 
ATOM   2220 C  CE1 . PHE A 1 314 ? 36.259  108.656 6.040   1.00 24.50 ? 314 PHE A CE1 1 
ATOM   2221 C  CE2 . PHE A 1 314 ? 37.011  106.409 6.468   1.00 26.01 ? 314 PHE A CE2 1 
ATOM   2222 C  CZ  . PHE A 1 314 ? 36.905  107.499 5.608   1.00 23.96 ? 314 PHE A CZ  1 
ATOM   2223 N  N   . LEU A 1 315 ? 34.232  105.065 11.058  1.00 19.59 ? 315 LEU A N   1 
ATOM   2224 C  CA  . LEU A 1 315 ? 34.408  103.646 11.357  1.00 20.71 ? 315 LEU A CA  1 
ATOM   2225 C  C   . LEU A 1 315 ? 33.154  102.858 10.975  1.00 20.05 ? 315 LEU A C   1 
ATOM   2226 O  O   . LEU A 1 315 ? 33.242  101.772 10.407  1.00 20.24 ? 315 LEU A O   1 
ATOM   2227 C  CB  . LEU A 1 315 ? 34.713  103.448 12.848  1.00 20.24 ? 315 LEU A CB  1 
ATOM   2228 C  CG  . LEU A 1 315 ? 36.093  103.907 13.323  1.00 23.58 ? 315 LEU A CG  1 
ATOM   2229 C  CD1 . LEU A 1 315 ? 36.193  103.765 14.842  1.00 24.01 ? 315 LEU A CD1 1 
ATOM   2230 C  CD2 . LEU A 1 315 ? 37.171  103.075 12.632  1.00 21.58 ? 315 LEU A CD2 1 
ATOM   2231 N  N   . VAL A 1 316 ? 31.988  103.409 11.292  1.00 18.44 ? 316 VAL A N   1 
ATOM   2232 C  CA  . VAL A 1 316 ? 30.732  102.750 10.963  1.00 18.64 ? 316 VAL A CA  1 
ATOM   2233 C  C   . VAL A 1 316 ? 30.614  102.644 9.445   1.00 20.02 ? 316 VAL A C   1 
ATOM   2234 O  O   . VAL A 1 316 ? 30.200  101.609 8.916   1.00 19.73 ? 316 VAL A O   1 
ATOM   2235 C  CB  . VAL A 1 316 ? 29.520  103.542 11.521  1.00 19.28 ? 316 VAL A CB  1 
ATOM   2236 C  CG1 . VAL A 1 316 ? 28.214  102.930 11.022  1.00 17.10 ? 316 VAL A CG1 1 
ATOM   2237 C  CG2 . VAL A 1 316 ? 29.559  103.536 13.046  1.00 19.30 ? 316 VAL A CG2 1 
ATOM   2238 N  N   . ASP A 1 317 ? 30.981  103.717 8.746   1.00 20.09 ? 317 ASP A N   1 
ATOM   2239 C  CA  . ASP A 1 317 ? 30.919  103.721 7.290   1.00 20.88 ? 317 ASP A CA  1 
ATOM   2240 C  C   . ASP A 1 317 ? 31.809  102.607 6.730   1.00 21.12 ? 317 ASP A C   1 
ATOM   2241 O  O   . ASP A 1 317 ? 31.433  101.922 5.777   1.00 20.03 ? 317 ASP A O   1 
ATOM   2242 C  CB  . ASP A 1 317 ? 31.372  105.074 6.726   1.00 23.44 ? 317 ASP A CB  1 
ATOM   2243 C  CG  . ASP A 1 317 ? 30.484  106.228 7.174   1.00 29.44 ? 317 ASP A CG  1 
ATOM   2244 O  OD1 . ASP A 1 317 ? 29.265  106.021 7.350   1.00 30.07 ? 317 ASP A OD1 1 
ATOM   2245 O  OD2 . ASP A 1 317 ? 31.006  107.352 7.337   1.00 32.52 ? 317 ASP A OD2 1 
ATOM   2246 N  N   . ILE A 1 318 ? 32.989  102.436 7.320   1.00 19.76 ? 318 ILE A N   1 
ATOM   2247 C  CA  . ILE A 1 318 ? 33.913  101.389 6.886   1.00 20.02 ? 318 ILE A CA  1 
ATOM   2248 C  C   . ILE A 1 318 ? 33.281  100.015 7.129   1.00 20.93 ? 318 ILE A C   1 
ATOM   2249 O  O   . ILE A 1 318 ? 33.268  99.162  6.242   1.00 21.83 ? 318 ILE A O   1 
ATOM   2250 C  CB  . ILE A 1 318 ? 35.265  101.465 7.657   1.00 19.89 ? 318 ILE A CB  1 
ATOM   2251 C  CG1 . ILE A 1 318 ? 36.051  102.706 7.223   1.00 18.59 ? 318 ILE A CG1 1 
ATOM   2252 C  CG2 . ILE A 1 318 ? 36.098  100.207 7.399   1.00 21.02 ? 318 ILE A CG2 1 
ATOM   2253 C  CD1 . ILE A 1 318 ? 37.393  102.887 7.945   1.00 18.04 ? 318 ILE A CD1 1 
ATOM   2254 N  N   . TYR A 1 319 ? 32.756  99.807  8.333   1.00 21.52 ? 319 TYR A N   1 
ATOM   2255 C  CA  . TYR A 1 319 ? 32.126  98.534  8.682   1.00 22.71 ? 319 TYR A CA  1 
ATOM   2256 C  C   . TYR A 1 319 ? 30.945  98.233  7.760   1.00 24.34 ? 319 TYR A C   1 
ATOM   2257 O  O   . TYR A 1 319 ? 30.742  97.089  7.354   1.00 24.56 ? 319 TYR A O   1 
ATOM   2258 C  CB  . TYR A 1 319 ? 31.672  98.564  10.145  1.00 22.07 ? 319 TYR A CB  1 
ATOM   2259 C  CG  . TYR A 1 319 ? 32.818  98.556  11.142  1.00 23.83 ? 319 TYR A CG  1 
ATOM   2260 C  CD1 . TYR A 1 319 ? 32.678  99.147  12.397  1.00 25.20 ? 319 TYR A CD1 1 
ATOM   2261 C  CD2 . TYR A 1 319 ? 34.039  97.947  10.833  1.00 25.16 ? 319 TYR A CD2 1 
ATOM   2262 C  CE1 . TYR A 1 319 ? 33.727  99.140  13.323  1.00 27.23 ? 319 TYR A CE1 1 
ATOM   2263 C  CE2 . TYR A 1 319 ? 35.093  97.932  11.752  1.00 27.72 ? 319 TYR A CE2 1 
ATOM   2264 C  CZ  . TYR A 1 319 ? 34.929  98.532  12.993  1.00 28.30 ? 319 TYR A CZ  1 
ATOM   2265 O  OH  . TYR A 1 319 ? 35.965  98.536  13.900  1.00 30.24 ? 319 TYR A OH  1 
ATOM   2266 N  N   . GLU A 1 320 ? 30.166  99.262  7.435   1.00 24.89 ? 320 GLU A N   1 
ATOM   2267 C  CA  . GLU A 1 320 ? 29.026  99.104  6.535   1.00 26.80 ? 320 GLU A CA  1 
ATOM   2268 C  C   . GLU A 1 320 ? 29.482  98.514  5.206   1.00 25.83 ? 320 GLU A C   1 
ATOM   2269 O  O   . GLU A 1 320 ? 28.874  97.580  4.685   1.00 25.70 ? 320 GLU A O   1 
ATOM   2270 C  CB  . GLU A 1 320 ? 28.377  100.454 6.241   1.00 28.63 ? 320 GLU A CB  1 
ATOM   2271 C  CG  . GLU A 1 320 ? 27.476  101.002 7.318   1.00 35.16 ? 320 GLU A CG  1 
ATOM   2272 C  CD  . GLU A 1 320 ? 27.034  102.420 7.006   1.00 39.10 ? 320 GLU A CD  1 
ATOM   2273 O  OE1 . GLU A 1 320 ? 26.984  102.772 5.806   1.00 40.07 ? 320 GLU A OE1 1 
ATOM   2274 O  OE2 . GLU A 1 320 ? 26.731  103.176 7.953   1.00 41.30 ? 320 GLU A OE2 1 
ATOM   2275 N  N   . ASP A 1 321 ? 30.550  99.082  4.655   1.00 25.47 ? 321 ASP A N   1 
ATOM   2276 C  CA  . ASP A 1 321 ? 31.082  98.627  3.376   1.00 25.18 ? 321 ASP A CA  1 
ATOM   2277 C  C   . ASP A 1 321 ? 31.676  97.226  3.474   1.00 24.04 ? 321 ASP A C   1 
ATOM   2278 O  O   . ASP A 1 321 ? 31.501  96.409  2.568   1.00 24.36 ? 321 ASP A O   1 
ATOM   2279 C  CB  . ASP A 1 321 ? 32.141  99.606  2.861   1.00 25.98 ? 321 ASP A CB  1 
ATOM   2280 C  CG  . ASP A 1 321 ? 32.436  99.410  1.389   1.00 28.60 ? 321 ASP A CG  1 
ATOM   2281 O  OD1 . ASP A 1 321 ? 31.478  99.495  0.592   1.00 29.85 ? 321 ASP A OD1 1 
ATOM   2282 O  OD2 . ASP A 1 321 ? 33.609  99.169  1.026   1.00 26.59 ? 321 ASP A OD2 1 
ATOM   2283 N  N   . MET A 1 322 ? 32.377  96.951  4.571   1.00 23.28 ? 322 MET A N   1 
ATOM   2284 C  CA  . MET A 1 322 ? 32.980  95.638  4.781   1.00 24.58 ? 322 MET A CA  1 
ATOM   2285 C  C   . MET A 1 322 ? 31.909  94.550  4.752   1.00 25.10 ? 322 MET A C   1 
ATOM   2286 O  O   . MET A 1 322 ? 32.074  93.523  4.096   1.00 23.98 ? 322 MET A O   1 
ATOM   2287 C  CB  . MET A 1 322 ? 33.715  95.591  6.126   1.00 26.39 ? 322 MET A CB  1 
ATOM   2288 C  CG  . MET A 1 322 ? 34.929  96.515  6.213   1.00 29.76 ? 322 MET A CG  1 
ATOM   2289 S  SD  . MET A 1 322 ? 35.817  96.370  7.787   1.00 32.84 ? 322 MET A SD  1 
ATOM   2290 C  CE  . MET A 1 322 ? 36.444  94.706  7.664   1.00 30.87 ? 322 MET A CE  1 
ATOM   2291 N  N   . LEU A 1 323 ? 30.814  94.787  5.469   1.00 25.94 ? 323 LEU A N   1 
ATOM   2292 C  CA  . LEU A 1 323 ? 29.707  93.837  5.540   1.00 28.20 ? 323 LEU A CA  1 
ATOM   2293 C  C   . LEU A 1 323 ? 29.049  93.641  4.183   1.00 30.46 ? 323 LEU A C   1 
ATOM   2294 O  O   . LEU A 1 323 ? 28.468  92.594  3.907   1.00 30.72 ? 323 LEU A O   1 
ATOM   2295 C  CB  . LEU A 1 323 ? 28.658  94.330  6.537   1.00 26.63 ? 323 LEU A CB  1 
ATOM   2296 C  CG  . LEU A 1 323 ? 29.083  94.382  8.007   1.00 28.33 ? 323 LEU A CG  1 
ATOM   2297 C  CD1 . LEU A 1 323 ? 28.025  95.102  8.822   1.00 27.44 ? 323 LEU A CD1 1 
ATOM   2298 C  CD2 . LEU A 1 323 ? 29.292  92.969  8.529   1.00 27.26 ? 323 LEU A CD2 1 
ATOM   2299 N  N   . GLU A 1 324 ? 29.143  94.662  3.341   1.00 33.48 ? 324 GLU A N   1 
ATOM   2300 C  CA  . GLU A 1 324 ? 28.549  94.629  2.015   1.00 37.39 ? 324 GLU A CA  1 
ATOM   2301 C  C   . GLU A 1 324 ? 29.432  93.855  1.044   1.00 38.98 ? 324 GLU A C   1 
ATOM   2302 O  O   . GLU A 1 324 ? 28.996  93.488  -0.047  1.00 38.36 ? 324 GLU A O   1 
ATOM   2303 C  CB  . GLU A 1 324 ? 28.361  96.058  1.504   1.00 39.24 ? 324 GLU A CB  1 
ATOM   2304 C  CG  . GLU A 1 324 ? 27.184  96.232  0.574   1.00 44.97 ? 324 GLU A CG  1 
ATOM   2305 C  CD  . GLU A 1 324 ? 25.864  96.094  1.300   1.00 47.17 ? 324 GLU A CD  1 
ATOM   2306 O  OE1 . GLU A 1 324 ? 25.619  96.893  2.230   1.00 49.70 ? 324 GLU A OE1 1 
ATOM   2307 O  OE2 . GLU A 1 324 ? 25.076  95.191  0.948   1.00 48.56 ? 324 GLU A OE2 1 
ATOM   2308 N  N   . ASN A 1 325 ? 30.672  93.605  1.448   1.00 41.52 ? 325 ASN A N   1 
ATOM   2309 C  CA  . ASN A 1 325 ? 31.618  92.895  0.597   1.00 44.71 ? 325 ASN A CA  1 
ATOM   2310 C  C   . ASN A 1 325 ? 32.102  91.560  1.139   1.00 47.07 ? 325 ASN A C   1 
ATOM   2311 O  O   . ASN A 1 325 ? 33.262  91.194  0.956   1.00 48.52 ? 325 ASN A O   1 
ATOM   2312 C  CB  . ASN A 1 325 ? 32.816  93.793  0.306   1.00 44.75 ? 325 ASN A CB  1 
ATOM   2313 C  CG  . ASN A 1 325 ? 32.463  94.936  -0.610  1.00 45.17 ? 325 ASN A CG  1 
ATOM   2314 O  OD1 . ASN A 1 325 ? 32.164  94.730  -1.785  1.00 47.28 ? 325 ASN A OD1 1 
ATOM   2315 N  ND2 . ASN A 1 325 ? 32.481  96.152  -0.077  1.00 46.25 ? 325 ASN A ND2 1 
ATOM   2316 N  N   . GLN A 1 326 ? 31.211  90.837  1.806   1.00 49.02 ? 326 GLN A N   1 
ATOM   2317 C  CA  . GLN A 1 326 ? 31.544  89.526  2.346   1.00 51.75 ? 326 GLN A CA  1 
ATOM   2318 C  C   . GLN A 1 326 ? 32.845  89.518  3.138   1.00 51.87 ? 326 GLN A C   1 
ATOM   2319 O  O   . GLN A 1 326 ? 33.688  88.643  2.948   1.00 52.41 ? 326 GLN A O   1 
ATOM   2320 C  CB  . GLN A 1 326 ? 31.651  88.510  1.206   1.00 53.87 ? 326 GLN A CB  1 
ATOM   2321 C  CG  . GLN A 1 326 ? 30.466  88.508  0.255   1.00 57.21 ? 326 GLN A CG  1 
ATOM   2322 C  CD  . GLN A 1 326 ? 29.140  88.429  0.982   1.00 59.59 ? 326 GLN A CD  1 
ATOM   2323 O  OE1 . GLN A 1 326 ? 28.661  89.421  1.540   1.00 61.14 ? 326 GLN A OE1 1 
ATOM   2324 N  NE2 . GLN A 1 326 ? 28.543  87.244  0.991   1.00 60.43 ? 326 GLN A NE2 1 
ATOM   2325 N  N   . CYS A 1 327 ? 33.011  90.490  4.027   1.00 52.04 ? 327 CYS A N   1 
ATOM   2326 C  CA  . CYS A 1 327 ? 34.223  90.556  4.830   1.00 51.47 ? 327 CYS A CA  1 
ATOM   2327 C  C   . CYS A 1 327 ? 34.305  89.316  5.711   1.00 52.03 ? 327 CYS A C   1 
ATOM   2328 O  O   . CYS A 1 327 ? 33.312  88.609  5.904   1.00 50.48 ? 327 CYS A O   1 
ATOM   2329 C  CB  . CYS A 1 327 ? 34.211  91.801  5.715   1.00 51.00 ? 327 CYS A CB  1 
ATOM   2330 S  SG  . CYS A 1 327 ? 32.990  91.729  7.043   1.00 48.08 ? 327 CYS A SG  1 
ATOM   2331 N  N   . ASP A 1 328 ? 35.494  89.057  6.243   1.00 52.40 ? 328 ASP A N   1 
ATOM   2332 C  CA  . ASP A 1 328 ? 35.701  87.915  7.118   1.00 52.79 ? 328 ASP A CA  1 
ATOM   2333 C  C   . ASP A 1 328 ? 35.254  88.331  8.519   1.00 50.91 ? 328 ASP A C   1 
ATOM   2334 O  O   . ASP A 1 328 ? 35.361  89.502  8.885   1.00 50.41 ? 328 ASP A O   1 
ATOM   2335 C  CB  . ASP A 1 328 ? 37.182  87.527  7.127   1.00 56.85 ? 328 ASP A CB  1 
ATOM   2336 C  CG  . ASP A 1 328 ? 37.416  86.128  7.666   1.00 60.97 ? 328 ASP A CG  1 
ATOM   2337 O  OD1 . ASP A 1 328 ? 38.593  85.714  7.757   1.00 62.82 ? 328 ASP A OD1 1 
ATOM   2338 O  OD2 . ASP A 1 328 ? 36.422  85.442  7.996   1.00 62.49 ? 328 ASP A OD2 1 
ATOM   2339 N  N   . ASN A 1 329 ? 34.747  87.377  9.294   1.00 48.85 ? 329 ASN A N   1 
ATOM   2340 C  CA  . ASN A 1 329 ? 34.278  87.660  10.650  1.00 46.74 ? 329 ASN A CA  1 
ATOM   2341 C  C   . ASN A 1 329 ? 33.094  88.621  10.622  1.00 43.27 ? 329 ASN A C   1 
ATOM   2342 O  O   . ASN A 1 329 ? 33.068  89.604  11.362  1.00 41.34 ? 329 ASN A O   1 
ATOM   2343 C  CB  . ASN A 1 329 ? 35.401  88.272  11.493  1.00 49.52 ? 329 ASN A CB  1 
ATOM   2344 C  CG  . ASN A 1 329 ? 36.590  87.346  11.646  1.00 53.41 ? 329 ASN A CG  1 
ATOM   2345 O  OD1 . ASN A 1 329 ? 36.453  86.206  12.104  1.00 55.44 ? 329 ASN A OD1 1 
ATOM   2346 N  ND2 . ASN A 1 329 ? 37.770  87.831  11.268  1.00 53.71 ? 329 ASN A ND2 1 
ATOM   2347 N  N   . LYS A 1 330 ? 32.117  88.328  9.771   1.00 40.52 ? 330 LYS A N   1 
ATOM   2348 C  CA  . LYS A 1 330 ? 30.932  89.167  9.633   1.00 39.48 ? 330 LYS A CA  1 
ATOM   2349 C  C   . LYS A 1 330 ? 30.241  89.462  10.964  1.00 37.66 ? 330 LYS A C   1 
ATOM   2350 O  O   . LYS A 1 330 ? 29.857  90.600  11.230  1.00 35.75 ? 330 LYS A O   1 
ATOM   2351 C  CB  . LYS A 1 330 ? 29.926  88.509  8.684   1.00 41.50 ? 330 LYS A CB  1 
ATOM   2352 C  CG  . LYS A 1 330 ? 28.692  89.360  8.409   1.00 44.70 ? 330 LYS A CG  1 
ATOM   2353 C  CD  . LYS A 1 330 ? 27.589  88.562  7.722   1.00 48.32 ? 330 LYS A CD  1 
ATOM   2354 C  CE  . LYS A 1 330 ? 26.995  87.508  8.654   1.00 50.85 ? 330 LYS A CE  1 
ATOM   2355 N  NZ  . LYS A 1 330 ? 26.389  88.120  9.873   1.00 51.70 ? 330 LYS A NZ  1 
ATOM   2356 N  N   . GLU A 1 331 ? 30.075  88.436  11.794  1.00 36.36 ? 331 GLU A N   1 
ATOM   2357 C  CA  . GLU A 1 331 ? 29.414  88.611  13.084  1.00 36.33 ? 331 GLU A CA  1 
ATOM   2358 C  C   . GLU A 1 331 ? 30.125  89.622  13.971  1.00 34.84 ? 331 GLU A C   1 
ATOM   2359 O  O   . GLU A 1 331 ? 29.483  90.443  14.629  1.00 33.85 ? 331 GLU A O   1 
ATOM   2360 C  CB  . GLU A 1 331 ? 29.315  87.277  13.828  1.00 38.84 ? 331 GLU A CB  1 
ATOM   2361 C  CG  . GLU A 1 331 ? 28.321  86.294  13.232  1.00 43.59 ? 331 GLU A CG  1 
ATOM   2362 C  CD  . GLU A 1 331 ? 26.957  86.914  12.986  1.00 47.19 ? 331 GLU A CD  1 
ATOM   2363 O  OE1 . GLU A 1 331 ? 26.492  87.706  13.835  1.00 48.65 ? 331 GLU A OE1 1 
ATOM   2364 O  OE2 . GLU A 1 331 ? 26.343  86.597  11.944  1.00 50.59 ? 331 GLU A OE2 1 
ATOM   2365 N  N   . ASP A 1 332 ? 31.452  89.557  13.991  1.00 33.12 ? 332 ASP A N   1 
ATOM   2366 C  CA  . ASP A 1 332 ? 32.247  90.466  14.803  1.00 33.00 ? 332 ASP A CA  1 
ATOM   2367 C  C   . ASP A 1 332 ? 32.147  91.907  14.301  1.00 30.52 ? 332 ASP A C   1 
ATOM   2368 O  O   . ASP A 1 332 ? 32.029  92.842  15.094  1.00 27.84 ? 332 ASP A O   1 
ATOM   2369 C  CB  . ASP A 1 332 ? 33.710  90.023  14.809  1.00 36.49 ? 332 ASP A CB  1 
ATOM   2370 C  CG  . ASP A 1 332 ? 34.586  90.924  15.659  1.00 41.96 ? 332 ASP A CG  1 
ATOM   2371 O  OD1 . ASP A 1 332 ? 34.333  91.017  16.878  1.00 45.04 ? 332 ASP A OD1 1 
ATOM   2372 O  OD2 . ASP A 1 332 ? 35.525  91.543  15.110  1.00 45.32 ? 332 ASP A OD2 1 
ATOM   2373 N  N   . ILE A 1 333 ? 32.200  92.075  12.982  1.00 27.95 ? 333 ILE A N   1 
ATOM   2374 C  CA  . ILE A 1 333 ? 32.120  93.395  12.370  1.00 25.11 ? 333 ILE A CA  1 
ATOM   2375 C  C   . ILE A 1 333 ? 30.753  94.008  12.642  1.00 23.68 ? 333 ILE A C   1 
ATOM   2376 O  O   . ILE A 1 333 ? 30.647  95.180  12.998  1.00 23.14 ? 333 ILE A O   1 
ATOM   2377 C  CB  . ILE A 1 333 ? 32.353  93.309  10.844  1.00 26.34 ? 333 ILE A CB  1 
ATOM   2378 C  CG1 . ILE A 1 333 ? 33.786  92.835  10.568  1.00 27.20 ? 333 ILE A CG1 1 
ATOM   2379 C  CG2 . ILE A 1 333 ? 32.099  94.664  10.187  1.00 22.56 ? 333 ILE A CG2 1 
ATOM   2380 C  CD1 . ILE A 1 333 ? 34.862  93.730  11.171  1.00 28.34 ? 333 ILE A CD1 1 
ATOM   2381 N  N   . LEU A 1 334 ? 29.709  93.204  12.484  1.00 21.83 ? 334 LEU A N   1 
ATOM   2382 C  CA  . LEU A 1 334 ? 28.351  93.672  12.717  1.00 22.04 ? 334 LEU A CA  1 
ATOM   2383 C  C   . LEU A 1 334 ? 28.172  94.147  14.161  1.00 22.12 ? 334 LEU A C   1 
ATOM   2384 O  O   . LEU A 1 334 ? 27.602  95.210  14.403  1.00 18.77 ? 334 LEU A O   1 
ATOM   2385 C  CB  . LEU A 1 334 ? 27.343  92.561  12.405  1.00 21.70 ? 334 LEU A CB  1 
ATOM   2386 C  CG  . LEU A 1 334 ? 25.867  92.904  12.659  1.00 23.53 ? 334 LEU A CG  1 
ATOM   2387 C  CD1 . LEU A 1 334 ? 25.466  94.107  11.809  1.00 22.22 ? 334 LEU A CD1 1 
ATOM   2388 C  CD2 . LEU A 1 334 ? 24.990  91.698  12.339  1.00 22.48 ? 334 LEU A CD2 1 
ATOM   2389 N  N   . ASN A 1 335 ? 28.661  93.364  15.120  1.00 22.72 ? 335 ASN A N   1 
ATOM   2390 C  CA  . ASN A 1 335 ? 28.536  93.736  16.526  1.00 24.65 ? 335 ASN A CA  1 
ATOM   2391 C  C   . ASN A 1 335 ? 29.239  95.053  16.828  1.00 23.83 ? 335 ASN A C   1 
ATOM   2392 O  O   . ASN A 1 335 ? 28.729  95.881  17.586  1.00 21.46 ? 335 ASN A O   1 
ATOM   2393 C  CB  . ASN A 1 335 ? 29.094  92.631  17.431  1.00 30.99 ? 335 ASN A CB  1 
ATOM   2394 C  CG  . ASN A 1 335 ? 28.225  91.383  17.430  1.00 38.35 ? 335 ASN A CG  1 
ATOM   2395 O  OD1 . ASN A 1 335 ? 27.003  91.464  17.572  1.00 42.51 ? 335 ASN A OD1 1 
ATOM   2396 N  ND2 . ASN A 1 335 ? 28.853  90.219  17.280  1.00 43.01 ? 335 ASN A ND2 1 
ATOM   2397 N  N   . LYS A 1 336 ? 30.415  95.244  16.238  1.00 23.96 ? 336 LYS A N   1 
ATOM   2398 C  CA  . LYS A 1 336 ? 31.175  96.470  16.445  1.00 23.98 ? 336 LYS A CA  1 
ATOM   2399 C  C   . LYS A 1 336 ? 30.438  97.663  15.843  1.00 21.95 ? 336 LYS A C   1 
ATOM   2400 O  O   . LYS A 1 336 ? 30.376  98.734  16.446  1.00 21.26 ? 336 LYS A O   1 
ATOM   2401 C  CB  . LYS A 1 336 ? 32.565  96.347  15.816  1.00 26.52 ? 336 LYS A CB  1 
ATOM   2402 C  CG  . LYS A 1 336 ? 33.484  95.373  16.540  1.00 30.44 ? 336 LYS A CG  1 
ATOM   2403 C  CD  . LYS A 1 336 ? 34.836  95.270  15.856  1.00 35.34 ? 336 LYS A CD  1 
ATOM   2404 C  CE  . LYS A 1 336 ? 35.729  94.263  16.564  1.00 37.32 ? 336 LYS A CE  1 
ATOM   2405 N  NZ  . LYS A 1 336 ? 37.007  94.054  15.827  1.00 40.40 ? 336 LYS A NZ  1 
ATOM   2406 N  N   . ALA A 1 337 ? 29.879  97.473  14.652  1.00 20.83 ? 337 ALA A N   1 
ATOM   2407 C  CA  . ALA A 1 337 ? 29.147  98.545  13.989  1.00 20.36 ? 337 ALA A CA  1 
ATOM   2408 C  C   . ALA A 1 337 ? 27.912  98.946  14.791  1.00 20.04 ? 337 ALA A C   1 
ATOM   2409 O  O   . ALA A 1 337 ? 27.637  100.134 14.965  1.00 20.45 ? 337 ALA A O   1 
ATOM   2410 C  CB  . ALA A 1 337 ? 28.744  98.116  12.588  1.00 19.32 ? 337 ALA A CB  1 
ATOM   2411 N  N   . LEU A 1 338 ? 27.168  97.960  15.282  1.00 19.11 ? 338 LEU A N   1 
ATOM   2412 C  CA  . LEU A 1 338 ? 25.967  98.254  16.057  1.00 21.40 ? 338 LEU A CA  1 
ATOM   2413 C  C   . LEU A 1 338 ? 26.306  98.951  17.372  1.00 21.29 ? 338 LEU A C   1 
ATOM   2414 O  O   . LEU A 1 338 ? 25.566  99.817  17.827  1.00 19.98 ? 338 LEU A O   1 
ATOM   2415 C  CB  . LEU A 1 338 ? 25.173  96.971  16.324  1.00 21.22 ? 338 LEU A CB  1 
ATOM   2416 C  CG  . LEU A 1 338 ? 24.534  96.322  15.089  1.00 23.30 ? 338 LEU A CG  1 
ATOM   2417 C  CD1 . LEU A 1 338 ? 23.865  95.012  15.482  1.00 21.36 ? 338 LEU A CD1 1 
ATOM   2418 C  CD2 . LEU A 1 338 ? 23.513  97.273  14.473  1.00 22.18 ? 338 LEU A CD2 1 
ATOM   2419 N  N   . GLU A 1 339 ? 27.420  98.571  17.987  1.00 23.23 ? 339 GLU A N   1 
ATOM   2420 C  CA  . GLU A 1 339 ? 27.838  99.207  19.232  1.00 25.33 ? 339 GLU A CA  1 
ATOM   2421 C  C   . GLU A 1 339 ? 28.151  100.683 18.981  1.00 24.03 ? 339 GLU A C   1 
ATOM   2422 O  O   . GLU A 1 339 ? 27.774  101.550 19.771  1.00 24.09 ? 339 GLU A O   1 
ATOM   2423 C  CB  . GLU A 1 339 ? 29.080  98.512  19.796  1.00 29.93 ? 339 GLU A CB  1 
ATOM   2424 C  CG  . GLU A 1 339 ? 28.788  97.223  20.548  1.00 38.48 ? 339 GLU A CG  1 
ATOM   2425 C  CD  . GLU A 1 339 ? 30.057  96.496  20.960  1.00 43.63 ? 339 GLU A CD  1 
ATOM   2426 O  OE1 . GLU A 1 339 ? 31.012  97.170  21.406  1.00 46.74 ? 339 GLU A OE1 1 
ATOM   2427 O  OE2 . GLU A 1 339 ? 30.096  95.252  20.844  1.00 47.40 ? 339 GLU A OE2 1 
ATOM   2428 N  N   . LEU A 1 340 ? 28.840  100.967 17.879  1.00 22.99 ? 340 LEU A N   1 
ATOM   2429 C  CA  . LEU A 1 340 ? 29.191  102.345 17.551  1.00 23.06 ? 340 LEU A CA  1 
ATOM   2430 C  C   . LEU A 1 340 ? 27.950  103.160 17.213  1.00 22.11 ? 340 LEU A C   1 
ATOM   2431 O  O   . LEU A 1 340 ? 27.853  104.331 17.584  1.00 21.34 ? 340 LEU A O   1 
ATOM   2432 C  CB  . LEU A 1 340 ? 30.187  102.390 16.386  1.00 21.88 ? 340 LEU A CB  1 
ATOM   2433 C  CG  . LEU A 1 340 ? 31.553  101.741 16.645  1.00 23.11 ? 340 LEU A CG  1 
ATOM   2434 C  CD1 . LEU A 1 340 ? 32.469  102.009 15.461  1.00 23.57 ? 340 LEU A CD1 1 
ATOM   2435 C  CD2 . LEU A 1 340 ? 32.165  102.301 17.925  1.00 21.03 ? 340 LEU A CD2 1 
ATOM   2436 N  N   . CYS A 1 341 ? 27.003  102.540 16.511  1.00 22.50 ? 341 CYS A N   1 
ATOM   2437 C  CA  . CYS A 1 341 ? 25.756  103.218 16.161  1.00 22.86 ? 341 CYS A CA  1 
ATOM   2438 C  C   . CYS A 1 341 ? 25.030  103.657 17.438  1.00 22.95 ? 341 CYS A C   1 
ATOM   2439 O  O   . CYS A 1 341 ? 24.484  104.757 17.502  1.00 23.57 ? 341 CYS A O   1 
ATOM   2440 C  CB  . CYS A 1 341 ? 24.844  102.292 15.342  1.00 21.84 ? 341 CYS A CB  1 
ATOM   2441 S  SG  . CYS A 1 341 ? 25.297  102.102 13.590  1.00 24.05 ? 341 CYS A SG  1 
ATOM   2442 N  N   . GLU A 1 342 ? 25.029  102.791 18.449  1.00 23.36 ? 342 GLU A N   1 
ATOM   2443 C  CA  . GLU A 1 342 ? 24.379  103.088 19.725  1.00 25.28 ? 342 GLU A CA  1 
ATOM   2444 C  C   . GLU A 1 342 ? 25.125  104.202 20.464  1.00 23.92 ? 342 GLU A C   1 
ATOM   2445 O  O   . GLU A 1 342 ? 24.510  105.084 21.063  1.00 23.66 ? 342 GLU A O   1 
ATOM   2446 C  CB  . GLU A 1 342 ? 24.340  101.831 20.598  1.00 29.10 ? 342 GLU A CB  1 
ATOM   2447 C  CG  . GLU A 1 342 ? 22.954  101.442 21.102  1.00 37.37 ? 342 GLU A CG  1 
ATOM   2448 C  CD  . GLU A 1 342 ? 22.355  102.459 22.062  1.00 41.04 ? 342 GLU A CD  1 
ATOM   2449 O  OE1 . GLU A 1 342 ? 22.986  102.746 23.104  1.00 43.82 ? 342 GLU A OE1 1 
ATOM   2450 O  OE2 . GLU A 1 342 ? 21.248  102.967 21.776  1.00 43.31 ? 342 GLU A OE2 1 
ATOM   2451 N  N   . ILE A 1 343 ? 26.454  104.153 20.426  1.00 24.08 ? 343 ILE A N   1 
ATOM   2452 C  CA  . ILE A 1 343 ? 27.273  105.169 21.082  1.00 24.47 ? 343 ILE A CA  1 
ATOM   2453 C  C   . ILE A 1 343 ? 27.016  106.529 20.434  1.00 22.28 ? 343 ILE A C   1 
ATOM   2454 O  O   . ILE A 1 343 ? 26.909  107.546 21.117  1.00 20.91 ? 343 ILE A O   1 
ATOM   2455 C  CB  . ILE A 1 343 ? 28.781  104.833 20.969  1.00 25.98 ? 343 ILE A CB  1 
ATOM   2456 C  CG1 . ILE A 1 343 ? 29.105  103.627 21.858  1.00 28.81 ? 343 ILE A CG1 1 
ATOM   2457 C  CG2 . ILE A 1 343 ? 29.626  106.046 21.355  1.00 26.71 ? 343 ILE A CG2 1 
ATOM   2458 C  CD1 . ILE A 1 343 ? 30.542  103.151 21.762  1.00 30.99 ? 343 ILE A CD1 1 
ATOM   2459 N  N   . LEU A 1 344 ? 26.917  106.537 19.110  1.00 20.65 ? 344 LEU A N   1 
ATOM   2460 C  CA  . LEU A 1 344 ? 26.667  107.771 18.381  1.00 20.98 ? 344 LEU A CA  1 
ATOM   2461 C  C   . LEU A 1 344 ? 25.265  108.286 18.677  1.00 20.94 ? 344 LEU A C   1 
ATOM   2462 O  O   . LEU A 1 344 ? 25.072  109.468 18.947  1.00 21.40 ? 344 LEU A O   1 
ATOM   2463 C  CB  . LEU A 1 344 ? 26.830  107.534 16.875  1.00 20.05 ? 344 LEU A CB  1 
ATOM   2464 C  CG  . LEU A 1 344 ? 28.264  107.332 16.373  1.00 19.32 ? 344 LEU A CG  1 
ATOM   2465 C  CD1 . LEU A 1 344 ? 28.247  106.617 15.032  1.00 20.05 ? 344 LEU A CD1 1 
ATOM   2466 C  CD2 . LEU A 1 344 ? 28.963  108.686 16.259  1.00 19.30 ? 344 LEU A CD2 1 
ATOM   2467 N  N   . ALA A 1 345 ? 24.287  107.390 18.647  1.00 21.99 ? 345 ALA A N   1 
ATOM   2468 C  CA  . ALA A 1 345 ? 22.902  107.779 18.885  1.00 23.88 ? 345 ALA A CA  1 
ATOM   2469 C  C   . ALA A 1 345 ? 22.619  108.260 20.303  1.00 24.07 ? 345 ALA A C   1 
ATOM   2470 O  O   . ALA A 1 345 ? 21.826  109.176 20.507  1.00 22.91 ? 345 ALA A O   1 
ATOM   2471 C  CB  . ALA A 1 345 ? 21.974  106.618 18.549  1.00 21.06 ? 345 ALA A CB  1 
ATOM   2472 N  N   . LYS A 1 346 ? 23.280  107.651 21.278  1.00 25.63 ? 346 LYS A N   1 
ATOM   2473 C  CA  . LYS A 1 346 ? 23.046  107.991 22.673  1.00 28.36 ? 346 LYS A CA  1 
ATOM   2474 C  C   . LYS A 1 346 ? 24.014  108.980 23.316  1.00 27.96 ? 346 LYS A C   1 
ATOM   2475 O  O   . LYS A 1 346 ? 23.639  109.687 24.249  1.00 26.46 ? 346 LYS A O   1 
ATOM   2476 C  CB  . LYS A 1 346 ? 23.014  106.699 23.499  1.00 32.84 ? 346 LYS A CB  1 
ATOM   2477 C  CG  . LYS A 1 346 ? 22.975  106.894 25.011  1.00 40.12 ? 346 LYS A CG  1 
ATOM   2478 C  CD  . LYS A 1 346 ? 21.729  107.657 25.483  1.00 45.50 ? 346 LYS A CD  1 
ATOM   2479 C  CE  . LYS A 1 346 ? 20.446  106.824 25.385  1.00 47.03 ? 346 LYS A CE  1 
ATOM   2480 N  NZ  . LYS A 1 346 ? 20.035  106.519 23.981  1.00 49.99 ? 346 LYS A NZ  1 
ATOM   2481 N  N   . GLU A 1 347 ? 25.244  109.055 22.820  1.00 27.21 ? 347 GLU A N   1 
ATOM   2482 C  CA  . GLU A 1 347 ? 26.213  109.945 23.445  1.00 29.01 ? 347 GLU A CA  1 
ATOM   2483 C  C   . GLU A 1 347 ? 27.009  110.909 22.571  1.00 26.73 ? 347 GLU A C   1 
ATOM   2484 O  O   . GLU A 1 347 ? 27.007  112.119 22.817  1.00 26.54 ? 347 GLU A O   1 
ATOM   2485 C  CB  . GLU A 1 347 ? 27.206  109.109 24.265  1.00 32.37 ? 347 GLU A CB  1 
ATOM   2486 C  CG  . GLU A 1 347 ? 28.348  109.927 24.856  1.00 41.06 ? 347 GLU A CG  1 
ATOM   2487 C  CD  . GLU A 1 347 ? 29.496  109.071 25.369  1.00 46.01 ? 347 GLU A CD  1 
ATOM   2488 O  OE1 . GLU A 1 347 ? 30.515  109.652 25.804  1.00 48.21 ? 347 GLU A OE1 1 
ATOM   2489 O  OE2 . GLU A 1 347 ? 29.384  107.824 25.337  1.00 48.13 ? 347 GLU A OE2 1 
ATOM   2490 N  N   . LYS A 1 348 ? 27.691  110.373 21.564  1.00 24.94 ? 348 LYS A N   1 
ATOM   2491 C  CA  . LYS A 1 348 ? 28.560  111.169 20.700  1.00 25.41 ? 348 LYS A CA  1 
ATOM   2492 C  C   . LYS A 1 348 ? 27.941  111.991 19.572  1.00 24.64 ? 348 LYS A C   1 
ATOM   2493 O  O   . LYS A 1 348 ? 28.535  112.975 19.130  1.00 23.10 ? 348 LYS A O   1 
ATOM   2494 C  CB  . LYS A 1 348 ? 29.645  110.264 20.103  1.00 28.27 ? 348 LYS A CB  1 
ATOM   2495 C  CG  . LYS A 1 348 ? 30.541  109.579 21.132  1.00 33.04 ? 348 LYS A CG  1 
ATOM   2496 C  CD  . LYS A 1 348 ? 31.311  110.596 21.962  1.00 38.18 ? 348 LYS A CD  1 
ATOM   2497 C  CE  . LYS A 1 348 ? 32.303  109.921 22.902  1.00 41.45 ? 348 LYS A CE  1 
ATOM   2498 N  NZ  . LYS A 1 348 ? 33.387  109.216 22.160  1.00 42.01 ? 348 LYS A NZ  1 
ATOM   2499 N  N   . ASP A 1 349 ? 26.765  111.606 19.094  1.00 21.61 ? 349 ASP A N   1 
ATOM   2500 C  CA  . ASP A 1 349 ? 26.156  112.343 17.992  1.00 19.46 ? 349 ASP A CA  1 
ATOM   2501 C  C   . ASP A 1 349 ? 24.639  112.259 18.101  1.00 18.38 ? 349 ASP A C   1 
ATOM   2502 O  O   . ASP A 1 349 ? 23.953  111.897 17.145  1.00 17.41 ? 349 ASP A O   1 
ATOM   2503 C  CB  . ASP A 1 349 ? 26.652  111.737 16.673  1.00 19.69 ? 349 ASP A CB  1 
ATOM   2504 C  CG  . ASP A 1 349 ? 26.522  112.684 15.499  1.00 22.15 ? 349 ASP A CG  1 
ATOM   2505 O  OD1 . ASP A 1 349 ? 26.627  113.911 15.701  1.00 23.19 ? 349 ASP A OD1 1 
ATOM   2506 O  OD2 . ASP A 1 349 ? 26.340  112.195 14.366  1.00 22.69 ? 349 ASP A OD2 1 
ATOM   2507 N  N   . THR A 1 350 ? 24.127  112.618 19.277  1.00 17.67 ? 350 THR A N   1 
ATOM   2508 C  CA  . THR A 1 350 ? 22.696  112.556 19.562  1.00 17.42 ? 350 THR A CA  1 
ATOM   2509 C  C   . THR A 1 350 ? 21.790  113.368 18.641  1.00 17.00 ? 350 THR A C   1 
ATOM   2510 O  O   . THR A 1 350 ? 20.617  113.035 18.491  1.00 16.66 ? 350 THR A O   1 
ATOM   2511 C  CB  . THR A 1 350 ? 22.401  112.961 21.036  1.00 17.11 ? 350 THR A CB  1 
ATOM   2512 O  OG1 . THR A 1 350 ? 22.732  114.341 21.240  1.00 19.70 ? 350 THR A OG1 1 
ATOM   2513 C  CG2 . THR A 1 350 ? 23.227  112.107 21.990  1.00 18.88 ? 350 THR A CG2 1 
ATOM   2514 N  N   . ILE A 1 351 ? 22.307  114.424 18.021  1.00 16.64 ? 351 ILE A N   1 
ATOM   2515 C  CA  . ILE A 1 351 ? 21.466  115.220 17.131  1.00 16.93 ? 351 ILE A CA  1 
ATOM   2516 C  C   . ILE A 1 351 ? 21.030  114.348 15.944  1.00 18.61 ? 351 ILE A C   1 
ATOM   2517 O  O   . ILE A 1 351 ? 19.989  114.579 15.324  1.00 17.37 ? 351 ILE A O   1 
ATOM   2518 C  CB  . ILE A 1 351 ? 22.214  116.484 16.613  1.00 17.87 ? 351 ILE A CB  1 
ATOM   2519 C  CG1 . ILE A 1 351 ? 21.223  117.439 15.934  1.00 17.07 ? 351 ILE A CG1 1 
ATOM   2520 C  CG2 . ILE A 1 351 ? 23.328  116.088 15.640  1.00 16.56 ? 351 ILE A CG2 1 
ATOM   2521 C  CD1 . ILE A 1 351 ? 20.275  118.133 16.902  1.00 13.24 ? 351 ILE A CD1 1 
ATOM   2522 N  N   . ARG A 1 352 ? 21.825  113.324 15.651  1.00 18.46 ? 352 ARG A N   1 
ATOM   2523 C  CA  . ARG A 1 352 ? 21.533  112.420 14.546  1.00 18.37 ? 352 ARG A CA  1 
ATOM   2524 C  C   . ARG A 1 352 ? 21.077  111.040 15.025  1.00 18.80 ? 352 ARG A C   1 
ATOM   2525 O  O   . ARG A 1 352 ? 21.210  110.050 14.305  1.00 18.19 ? 352 ARG A O   1 
ATOM   2526 C  CB  . ARG A 1 352 ? 22.778  112.286 13.652  1.00 19.89 ? 352 ARG A CB  1 
ATOM   2527 C  CG  . ARG A 1 352 ? 22.926  113.407 12.616  1.00 21.59 ? 352 ARG A CG  1 
ATOM   2528 C  CD  . ARG A 1 352 ? 24.316  113.441 11.996  1.00 23.32 ? 352 ARG A CD  1 
ATOM   2529 N  NE  . ARG A 1 352 ? 25.270  114.143 12.858  1.00 25.10 ? 352 ARG A NE  1 
ATOM   2530 C  CZ  . ARG A 1 352 ? 25.323  115.466 13.009  1.00 23.50 ? 352 ARG A CZ  1 
ATOM   2531 N  NH1 . ARG A 1 352 ? 24.478  116.258 12.351  1.00 21.83 ? 352 ARG A NH1 1 
ATOM   2532 N  NH2 . ARG A 1 352 ? 26.219  115.998 13.832  1.00 20.75 ? 352 ARG A NH2 1 
ATOM   2533 N  N   . LYS A 1 353 ? 20.517  110.975 16.229  1.00 20.80 ? 353 LYS A N   1 
ATOM   2534 C  CA  . LYS A 1 353 ? 20.077  109.698 16.772  1.00 22.40 ? 353 LYS A CA  1 
ATOM   2535 C  C   . LYS A 1 353 ? 19.142  108.926 15.840  1.00 21.52 ? 353 LYS A C   1 
ATOM   2536 O  O   . LYS A 1 353 ? 19.271  107.710 15.721  1.00 18.34 ? 353 LYS A O   1 
ATOM   2537 C  CB  . LYS A 1 353 ? 19.409  109.881 18.141  1.00 25.40 ? 353 LYS A CB  1 
ATOM   2538 C  CG  . LYS A 1 353 ? 18.013  110.467 18.110  1.00 33.74 ? 353 LYS A CG  1 
ATOM   2539 C  CD  . LYS A 1 353 ? 17.325  110.247 19.458  1.00 40.00 ? 353 LYS A CD  1 
ATOM   2540 C  CE  . LYS A 1 353 ? 15.934  110.863 19.495  1.00 41.01 ? 353 LYS A CE  1 
ATOM   2541 N  NZ  . LYS A 1 353 ? 15.989  112.335 19.318  1.00 41.91 ? 353 LYS A NZ  1 
ATOM   2542 N  N   . GLU A 1 354 ? 18.207  109.618 15.187  1.00 19.35 ? 354 GLU A N   1 
ATOM   2543 C  CA  . GLU A 1 354 ? 17.284  108.944 14.271  1.00 20.52 ? 354 GLU A CA  1 
ATOM   2544 C  C   . GLU A 1 354 ? 18.039  108.338 13.092  1.00 20.36 ? 354 GLU A C   1 
ATOM   2545 O  O   . GLU A 1 354 ? 17.702  107.254 12.616  1.00 19.92 ? 354 GLU A O   1 
ATOM   2546 C  CB  . GLU A 1 354 ? 16.212  109.909 13.746  1.00 22.51 ? 354 GLU A CB  1 
ATOM   2547 C  CG  . GLU A 1 354 ? 15.073  110.192 14.715  1.00 23.69 ? 354 GLU A CG  1 
ATOM   2548 C  CD  . GLU A 1 354 ? 14.384  108.926 15.220  1.00 27.74 ? 354 GLU A CD  1 
ATOM   2549 O  OE1 . GLU A 1 354 ? 14.170  107.985 14.424  1.00 25.70 ? 354 GLU A OE1 1 
ATOM   2550 O  OE2 . GLU A 1 354 ? 14.037  108.881 16.420  1.00 29.76 ? 354 GLU A OE2 1 
ATOM   2551 N  N   . TYR A 1 355 ? 19.057  109.041 12.612  1.00 19.07 ? 355 TYR A N   1 
ATOM   2552 C  CA  . TYR A 1 355 ? 19.857  108.528 11.508  1.00 19.10 ? 355 TYR A CA  1 
ATOM   2553 C  C   . TYR A 1 355 ? 20.637  107.286 11.967  1.00 19.01 ? 355 TYR A C   1 
ATOM   2554 O  O   . TYR A 1 355 ? 20.640  106.262 11.291  1.00 19.95 ? 355 TYR A O   1 
ATOM   2555 C  CB  . TYR A 1 355 ? 20.846  109.591 11.026  1.00 18.43 ? 355 TYR A CB  1 
ATOM   2556 C  CG  . TYR A 1 355 ? 21.837  109.070 10.008  1.00 20.18 ? 355 TYR A CG  1 
ATOM   2557 C  CD1 . TYR A 1 355 ? 21.448  108.810 8.697   1.00 19.18 ? 355 TYR A CD1 1 
ATOM   2558 C  CD2 . TYR A 1 355 ? 23.158  108.808 10.366  1.00 21.39 ? 355 TYR A CD2 1 
ATOM   2559 C  CE1 . TYR A 1 355 ? 22.350  108.300 7.765   1.00 20.93 ? 355 TYR A CE1 1 
ATOM   2560 C  CE2 . TYR A 1 355 ? 24.067  108.294 9.444   1.00 21.71 ? 355 TYR A CE2 1 
ATOM   2561 C  CZ  . TYR A 1 355 ? 23.654  108.042 8.145   1.00 21.05 ? 355 TYR A CZ  1 
ATOM   2562 O  OH  . TYR A 1 355 ? 24.540  107.511 7.237   1.00 21.50 ? 355 TYR A OH  1 
ATOM   2563 N  N   . TRP A 1 356 ? 21.293  107.376 13.119  1.00 19.08 ? 356 TRP A N   1 
ATOM   2564 C  CA  . TRP A 1 356 ? 22.077  106.247 13.613  1.00 19.94 ? 356 TRP A CA  1 
ATOM   2565 C  C   . TRP A 1 356 ? 21.245  105.020 13.962  1.00 20.24 ? 356 TRP A C   1 
ATOM   2566 O  O   . TRP A 1 356 ? 21.714  103.894 13.811  1.00 20.75 ? 356 TRP A O   1 
ATOM   2567 C  CB  . TRP A 1 356 ? 22.948  106.684 14.796  1.00 18.65 ? 356 TRP A CB  1 
ATOM   2568 C  CG  . TRP A 1 356 ? 24.043  107.610 14.345  1.00 19.24 ? 356 TRP A CG  1 
ATOM   2569 C  CD1 . TRP A 1 356 ? 24.235  108.911 14.726  1.00 18.02 ? 356 TRP A CD1 1 
ATOM   2570 C  CD2 . TRP A 1 356 ? 25.026  107.340 13.335  1.00 19.05 ? 356 TRP A CD2 1 
ATOM   2571 N  NE1 . TRP A 1 356 ? 25.270  109.470 14.006  1.00 18.79 ? 356 TRP A NE1 1 
ATOM   2572 C  CE2 . TRP A 1 356 ? 25.771  108.528 13.146  1.00 18.53 ? 356 TRP A CE2 1 
ATOM   2573 C  CE3 . TRP A 1 356 ? 25.345  106.210 12.567  1.00 19.49 ? 356 TRP A CE3 1 
ATOM   2574 C  CZ2 . TRP A 1 356 ? 26.815  108.618 12.218  1.00 19.46 ? 356 TRP A CZ2 1 
ATOM   2575 C  CZ3 . TRP A 1 356 ? 26.386  106.301 11.643  1.00 19.89 ? 356 TRP A CZ3 1 
ATOM   2576 C  CH2 . TRP A 1 356 ? 27.107  107.499 11.478  1.00 18.43 ? 356 TRP A CH2 1 
ATOM   2577 N  N   . ARG A 1 357 ? 20.012  105.227 14.416  1.00 21.43 ? 357 ARG A N   1 
ATOM   2578 C  CA  . ARG A 1 357 ? 19.144  104.100 14.729  1.00 22.82 ? 357 ARG A CA  1 
ATOM   2579 C  C   . ARG A 1 357 ? 18.717  103.451 13.413  1.00 21.84 ? 357 ARG A C   1 
ATOM   2580 O  O   . ARG A 1 357 ? 18.573  102.231 13.325  1.00 22.28 ? 357 ARG A O   1 
ATOM   2581 C  CB  . ARG A 1 357 ? 17.918  104.561 15.522  1.00 26.87 ? 357 ARG A CB  1 
ATOM   2582 C  CG  . ARG A 1 357 ? 17.997  104.247 17.011  1.00 32.98 ? 357 ARG A CG  1 
ATOM   2583 C  CD  . ARG A 1 357 ? 18.051  105.504 17.849  1.00 39.11 ? 357 ARG A CD  1 
ATOM   2584 N  NE  . ARG A 1 357 ? 18.030  105.230 19.288  1.00 45.08 ? 357 ARG A NE  1 
ATOM   2585 C  CZ  . ARG A 1 357 ? 18.931  104.492 19.933  1.00 46.49 ? 357 ARG A CZ  1 
ATOM   2586 N  NH1 . ARG A 1 357 ? 19.939  103.934 19.275  1.00 48.71 ? 357 ARG A NH1 1 
ATOM   2587 N  NH2 . ARG A 1 357 ? 18.834  104.323 21.246  1.00 48.74 ? 357 ARG A NH2 1 
ATOM   2588 N  N   . TYR A 1 358 ? 18.512  104.271 12.387  1.00 18.83 ? 358 TYR A N   1 
ATOM   2589 C  CA  . TYR A 1 358 ? 18.132  103.752 11.081  1.00 18.16 ? 358 TYR A CA  1 
ATOM   2590 C  C   . TYR A 1 358 ? 19.281  102.892 10.543  1.00 18.80 ? 358 TYR A C   1 
ATOM   2591 O  O   . TYR A 1 358 ? 19.059  101.798 10.029  1.00 18.14 ? 358 TYR A O   1 
ATOM   2592 C  CB  . TYR A 1 358 ? 17.841  104.901 10.112  1.00 18.02 ? 358 TYR A CB  1 
ATOM   2593 C  CG  . TYR A 1 358 ? 17.867  104.487 8.659   1.00 18.37 ? 358 TYR A CG  1 
ATOM   2594 C  CD1 . TYR A 1 358 ? 16.827  103.739 8.099   1.00 17.87 ? 358 TYR A CD1 1 
ATOM   2595 C  CD2 . TYR A 1 358 ? 18.954  104.811 7.850   1.00 18.88 ? 358 TYR A CD2 1 
ATOM   2596 C  CE1 . TYR A 1 358 ? 16.877  103.324 6.763   1.00 19.01 ? 358 TYR A CE1 1 
ATOM   2597 C  CE2 . TYR A 1 358 ? 19.014  104.401 6.519   1.00 18.77 ? 358 TYR A CE2 1 
ATOM   2598 C  CZ  . TYR A 1 358 ? 17.977  103.662 5.984   1.00 19.91 ? 358 TYR A CZ  1 
ATOM   2599 O  OH  . TYR A 1 358 ? 18.049  103.266 4.670   1.00 21.79 ? 358 TYR A OH  1 
ATOM   2600 N  N   . ILE A 1 359 ? 20.507  103.397 10.660  1.00 18.52 ? 359 ILE A N   1 
ATOM   2601 C  CA  . ILE A 1 359 ? 21.681  102.662 10.202  1.00 18.83 ? 359 ILE A CA  1 
ATOM   2602 C  C   . ILE A 1 359 ? 21.791  101.327 10.947  1.00 20.58 ? 359 ILE A C   1 
ATOM   2603 O  O   . ILE A 1 359 ? 22.112  100.297 10.349  1.00 21.79 ? 359 ILE A O   1 
ATOM   2604 C  CB  . ILE A 1 359 ? 22.975  103.489 10.416  1.00 19.43 ? 359 ILE A CB  1 
ATOM   2605 C  CG1 . ILE A 1 359 ? 22.956  104.727 9.504   1.00 18.50 ? 359 ILE A CG1 1 
ATOM   2606 C  CG2 . ILE A 1 359 ? 24.208  102.633 10.125  1.00 16.54 ? 359 ILE A CG2 1 
ATOM   2607 C  CD1 . ILE A 1 359 ? 22.875  104.392 8.010   1.00 16.96 ? 359 ILE A CD1 1 
ATOM   2608 N  N   . GLY A 1 360 ? 21.514  101.348 12.248  1.00 20.09 ? 360 GLY A N   1 
ATOM   2609 C  CA  . GLY A 1 360 ? 21.570  100.128 13.032  1.00 19.14 ? 360 GLY A CA  1 
ATOM   2610 C  C   . GLY A 1 360 ? 20.579  99.100  12.516  1.00 21.29 ? 360 GLY A C   1 
ATOM   2611 O  O   . GLY A 1 360 ? 20.904  97.915  12.386  1.00 20.17 ? 360 GLY A O   1 
ATOM   2612 N  N   . ARG A 1 361 ? 19.362  99.546  12.218  1.00 19.90 ? 361 ARG A N   1 
ATOM   2613 C  CA  . ARG A 1 361 ? 18.345  98.641  11.702  1.00 20.01 ? 361 ARG A CA  1 
ATOM   2614 C  C   . ARG A 1 361 ? 18.689  98.158  10.290  1.00 19.84 ? 361 ARG A C   1 
ATOM   2615 O  O   . ARG A 1 361 ? 18.479  96.988  9.973   1.00 20.00 ? 361 ARG A O   1 
ATOM   2616 C  CB  . ARG A 1 361 ? 16.964  99.316  11.712  1.00 19.11 ? 361 ARG A CB  1 
ATOM   2617 C  CG  . ARG A 1 361 ? 16.463  99.680  13.106  1.00 18.66 ? 361 ARG A CG  1 
ATOM   2618 C  CD  . ARG A 1 361 ? 14.987  100.046 13.086  1.00 19.34 ? 361 ARG A CD  1 
ATOM   2619 N  NE  . ARG A 1 361 ? 14.716  101.224 12.265  1.00 21.39 ? 361 ARG A NE  1 
ATOM   2620 C  CZ  . ARG A 1 361 ? 14.833  102.480 12.685  1.00 22.44 ? 361 ARG A CZ  1 
ATOM   2621 N  NH1 . ARG A 1 361 ? 15.215  102.737 13.930  1.00 20.98 ? 361 ARG A NH1 1 
ATOM   2622 N  NH2 . ARG A 1 361 ? 14.569  103.483 11.856  1.00 20.85 ? 361 ARG A NH2 1 
ATOM   2623 N  N   . SER A 1 362 ? 19.228  99.042  9.449   1.00 19.96 ? 362 SER A N   1 
ATOM   2624 C  CA  . SER A 1 362 ? 19.596  98.659  8.080   1.00 21.90 ? 362 SER A CA  1 
ATOM   2625 C  C   . SER A 1 362 ? 20.636  97.548  8.113   1.00 20.85 ? 362 SER A C   1 
ATOM   2626 O  O   . SER A 1 362 ? 20.523  96.559  7.389   1.00 21.77 ? 362 SER A O   1 
ATOM   2627 C  CB  . SER A 1 362 ? 20.184  99.843  7.304   1.00 21.24 ? 362 SER A CB  1 
ATOM   2628 O  OG  . SER A 1 362 ? 19.349  100.976 7.386   1.00 30.12 ? 362 SER A OG  1 
ATOM   2629 N  N   . LEU A 1 363 ? 21.658  97.729  8.945   1.00 20.24 ? 363 LEU A N   1 
ATOM   2630 C  CA  . LEU A 1 363 ? 22.726  96.743  9.079   1.00 21.32 ? 363 LEU A CA  1 
ATOM   2631 C  C   . LEU A 1 363 ? 22.164  95.375  9.454   1.00 20.70 ? 363 LEU A C   1 
ATOM   2632 O  O   . LEU A 1 363 ? 22.591  94.350  8.921   1.00 22.80 ? 363 LEU A O   1 
ATOM   2633 C  CB  . LEU A 1 363 ? 23.728  97.189  10.147  1.00 22.19 ? 363 LEU A CB  1 
ATOM   2634 C  CG  . LEU A 1 363 ? 24.610  98.388  9.794   1.00 24.53 ? 363 LEU A CG  1 
ATOM   2635 C  CD1 . LEU A 1 363 ? 25.400  98.825  11.020  1.00 24.56 ? 363 LEU A CD1 1 
ATOM   2636 C  CD2 . LEU A 1 363 ? 25.544  98.014  8.652   1.00 25.14 ? 363 LEU A CD2 1 
ATOM   2637 N  N   . GLN A 1 364 ? 21.207  95.361  10.375  1.00 19.77 ? 364 GLN A N   1 
ATOM   2638 C  CA  . GLN A 1 364 ? 20.596  94.113  10.815  1.00 21.84 ? 364 GLN A CA  1 
ATOM   2639 C  C   . GLN A 1 364 ? 19.709  93.485  9.748   1.00 22.83 ? 364 GLN A C   1 
ATOM   2640 O  O   . GLN A 1 364 ? 19.583  92.261  9.672   1.00 23.33 ? 364 GLN A O   1 
ATOM   2641 C  CB  . GLN A 1 364 ? 19.776  94.352  12.081  1.00 22.69 ? 364 GLN A CB  1 
ATOM   2642 C  CG  . GLN A 1 364 ? 20.619  94.661  13.306  1.00 24.82 ? 364 GLN A CG  1 
ATOM   2643 C  CD  . GLN A 1 364 ? 19.771  95.027  14.500  1.00 28.05 ? 364 GLN A CD  1 
ATOM   2644 O  OE1 . GLN A 1 364 ? 19.612  96.208  14.828  1.00 30.14 ? 364 GLN A OE1 1 
ATOM   2645 N  NE2 . GLN A 1 364 ? 19.203  94.019  15.149  1.00 25.13 ? 364 GLN A NE2 1 
ATOM   2646 N  N   . SER A 1 365 ? 19.088  94.317  8.923   1.00 22.31 ? 365 SER A N   1 
ATOM   2647 C  CA  . SER A 1 365 ? 18.214  93.797  7.881   1.00 25.29 ? 365 SER A CA  1 
ATOM   2648 C  C   . SER A 1 365 ? 19.039  93.231  6.730   1.00 26.50 ? 365 SER A C   1 
ATOM   2649 O  O   . SER A 1 365 ? 18.567  92.382  5.978   1.00 27.12 ? 365 SER A O   1 
ATOM   2650 C  CB  . SER A 1 365 ? 17.297  94.903  7.356   1.00 25.26 ? 365 SER A CB  1 
ATOM   2651 O  OG  . SER A 1 365 ? 18.040  95.854  6.616   1.00 27.38 ? 365 SER A OG  1 
ATOM   2652 N  N   . LYS A 1 366 ? 20.278  93.694  6.607   1.00 28.00 ? 366 LYS A N   1 
ATOM   2653 C  CA  . LYS A 1 366 ? 21.152  93.243  5.529   1.00 29.48 ? 366 LYS A CA  1 
ATOM   2654 C  C   . LYS A 1 366 ? 22.188  92.179  5.883   1.00 29.65 ? 366 LYS A C   1 
ATOM   2655 O  O   . LYS A 1 366 ? 22.587  91.407  5.014   1.00 29.61 ? 366 LYS A O   1 
ATOM   2656 C  CB  . LYS A 1 366 ? 21.910  94.432  4.936   1.00 29.81 ? 366 LYS A CB  1 
ATOM   2657 C  CG  . LYS A 1 366 ? 21.057  95.527  4.341   1.00 30.80 ? 366 LYS A CG  1 
ATOM   2658 C  CD  . LYS A 1 366 ? 21.946  96.679  3.915   1.00 33.34 ? 366 LYS A CD  1 
ATOM   2659 C  CE  . LYS A 1 366 ? 21.144  97.825  3.342   1.00 35.62 ? 366 LYS A CE  1 
ATOM   2660 N  NZ  . LYS A 1 366 ? 22.045  98.949  2.972   1.00 41.18 ? 366 LYS A NZ  1 
ATOM   2661 N  N   . HIS A 1 367 ? 22.621  92.123  7.140   1.00 31.72 ? 367 HIS A N   1 
ATOM   2662 C  CA  . HIS A 1 367 ? 23.684  91.186  7.505   1.00 34.89 ? 367 HIS A CA  1 
ATOM   2663 C  C   . HIS A 1 367 ? 23.511  90.292  8.735   1.00 38.32 ? 367 HIS A C   1 
ATOM   2664 O  O   . HIS A 1 367 ? 24.443  89.569  9.099   1.00 36.67 ? 367 HIS A O   1 
ATOM   2665 C  CB  . HIS A 1 367 ? 24.987  91.972  7.674   1.00 32.89 ? 367 HIS A CB  1 
ATOM   2666 C  CG  . HIS A 1 367 ? 25.210  93.008  6.614   1.00 33.28 ? 367 HIS A CG  1 
ATOM   2667 N  ND1 . HIS A 1 367 ? 25.519  92.686  5.310   1.00 32.58 ? 367 HIS A ND1 1 
ATOM   2668 C  CD2 . HIS A 1 367 ? 25.136  94.360  6.661   1.00 32.41 ? 367 HIS A CD2 1 
ATOM   2669 C  CE1 . HIS A 1 367 ? 25.625  93.795  4.598   1.00 33.30 ? 367 HIS A CE1 1 
ATOM   2670 N  NE2 . HIS A 1 367 ? 25.397  94.824  5.394   1.00 33.07 ? 367 HIS A NE2 1 
ATOM   2671 N  N   . SER A 1 368 ? 22.349  90.325  9.378   1.00 42.03 ? 368 SER A N   1 
ATOM   2672 C  CA  . SER A 1 368 ? 22.150  89.501  10.570  1.00 45.62 ? 368 SER A CA  1 
ATOM   2673 C  C   . SER A 1 368 ? 22.203  87.999  10.309  1.00 48.01 ? 368 SER A C   1 
ATOM   2674 O  O   . SER A 1 368 ? 22.567  87.225  11.197  1.00 50.20 ? 368 SER A O   1 
ATOM   2675 C  CB  . SER A 1 368 ? 20.833  89.864  11.256  1.00 45.15 ? 368 SER A CB  1 
ATOM   2676 O  OG  . SER A 1 368 ? 20.940  91.123  11.897  1.00 43.42 ? 368 SER A OG  1 
ATOM   2677 N  N   . THR A 1 369 ? 21.846  87.582  9.099   1.00 49.13 ? 369 THR A N   1 
ATOM   2678 C  CA  . THR A 1 369 ? 21.877  86.163  8.758   1.00 49.94 ? 369 THR A CA  1 
ATOM   2679 C  C   . THR A 1 369 ? 21.116  85.335  9.788   1.00 50.96 ? 369 THR A C   1 
ATOM   2680 C  CB  . THR A 1 369 ? 23.327  85.643  8.684   1.00 49.51 ? 369 THR A CB  1 
ATOM   2681 O  OG1 . THR A 1 369 ? 24.044  86.372  7.681   1.00 48.68 ? 369 THR A OG1 1 
ATOM   2682 C  CG2 . THR A 1 369 ? 23.350  84.157  8.342   1.00 50.33 ? 369 THR A CG2 1 
ATOM   2683 N  N   . SER B 2 15  ? 5.765   112.018 35.497  1.00 52.78 ? 15  SER B N   1 
ATOM   2684 C  CA  . SER B 2 15  ? 6.281   112.801 34.336  1.00 52.08 ? 15  SER B CA  1 
ATOM   2685 C  C   . SER B 2 15  ? 6.531   114.242 34.775  1.00 50.74 ? 15  SER B C   1 
ATOM   2686 O  O   . SER B 2 15  ? 7.213   114.485 35.770  1.00 51.99 ? 15  SER B O   1 
ATOM   2687 C  CB  . SER B 2 15  ? 5.259   112.787 33.198  1.00 53.14 ? 15  SER B CB  1 
ATOM   2688 O  OG  . SER B 2 15  ? 4.846   111.470 32.896  1.00 55.66 ? 15  SER B OG  1 
ATOM   2689 N  N   . SER B 2 16  ? 5.981   115.185 34.026  1.00 47.32 ? 16  SER B N   1 
ATOM   2690 C  CA  . SER B 2 16  ? 6.132   116.597 34.341  1.00 43.92 ? 16  SER B CA  1 
ATOM   2691 C  C   . SER B 2 16  ? 4.762   117.251 34.295  1.00 39.54 ? 16  SER B C   1 
ATOM   2692 O  O   . SER B 2 16  ? 3.886   116.816 33.547  1.00 39.03 ? 16  SER B O   1 
ATOM   2693 C  CB  . SER B 2 16  ? 7.041   117.289 33.322  1.00 44.54 ? 16  SER B CB  1 
ATOM   2694 O  OG  . SER B 2 16  ? 8.330   116.706 33.299  1.00 50.83 ? 16  SER B OG  1 
ATOM   2695 N  N   . PRO B 2 17  ? 4.551   118.293 35.110  1.00 35.52 ? 17  PRO B N   1 
ATOM   2696 C  CA  . PRO B 2 17  ? 3.252   118.977 35.099  1.00 31.18 ? 17  PRO B CA  1 
ATOM   2697 C  C   . PRO B 2 17  ? 3.053   119.458 33.663  1.00 28.26 ? 17  PRO B C   1 
ATOM   2698 O  O   . PRO B 2 17  ? 4.025   119.570 32.924  1.00 24.37 ? 17  PRO B O   1 
ATOM   2699 C  CB  . PRO B 2 17  ? 3.459   120.133 36.077  1.00 33.10 ? 17  PRO B CB  1 
ATOM   2700 C  CG  . PRO B 2 17  ? 4.498   119.595 37.028  1.00 34.68 ? 17  PRO B CG  1 
ATOM   2701 C  CD  . PRO B 2 17  ? 5.457   118.887 36.109  1.00 34.23 ? 17  PRO B CD  1 
ATOM   2702 N  N   . VAL B 2 18  ? 1.816   119.737 33.259  1.00 25.79 ? 18  VAL B N   1 
ATOM   2703 C  CA  . VAL B 2 18  ? 1.575   120.182 31.890  1.00 23.76 ? 18  VAL B CA  1 
ATOM   2704 C  C   . VAL B 2 18  ? 2.153   121.557 31.583  1.00 24.35 ? 18  VAL B C   1 
ATOM   2705 O  O   . VAL B 2 18  ? 2.349   121.911 30.418  1.00 24.62 ? 18  VAL B O   1 
ATOM   2706 C  CB  . VAL B 2 18  ? 0.071   120.221 31.568  1.00 22.88 ? 18  VAL B CB  1 
ATOM   2707 C  CG1 . VAL B 2 18  ? -0.527  118.831 31.708  1.00 24.93 ? 18  VAL B CG1 1 
ATOM   2708 C  CG2 . VAL B 2 18  ? -0.635  121.213 32.488  1.00 20.18 ? 18  VAL B CG2 1 
ATOM   2709 N  N   . TRP B 2 19  ? 2.429   122.333 32.627  1.00 23.58 ? 19  TRP B N   1 
ATOM   2710 C  CA  . TRP B 2 19  ? 2.961   123.678 32.447  1.00 23.35 ? 19  TRP B CA  1 
ATOM   2711 C  C   . TRP B 2 19  ? 4.478   123.779 32.356  1.00 23.85 ? 19  TRP B C   1 
ATOM   2712 O  O   . TRP B 2 19  ? 5.030   124.878 32.323  1.00 25.23 ? 19  TRP B O   1 
ATOM   2713 C  CB  . TRP B 2 19  ? 2.453   124.608 33.556  1.00 23.41 ? 19  TRP B CB  1 
ATOM   2714 C  CG  . TRP B 2 19  ? 2.476   124.008 34.929  1.00 25.02 ? 19  TRP B CG  1 
ATOM   2715 C  CD1 . TRP B 2 19  ? 1.418   123.476 35.608  1.00 24.74 ? 19  TRP B CD1 1 
ATOM   2716 C  CD2 . TRP B 2 19  ? 3.615   123.872 35.787  1.00 25.11 ? 19  TRP B CD2 1 
ATOM   2717 N  NE1 . TRP B 2 19  ? 1.826   123.018 36.838  1.00 26.33 ? 19  TRP B NE1 1 
ATOM   2718 C  CE2 . TRP B 2 19  ? 3.170   123.249 36.975  1.00 26.23 ? 19  TRP B CE2 1 
ATOM   2719 C  CE3 . TRP B 2 19  ? 4.968   124.217 35.668  1.00 25.25 ? 19  TRP B CE3 1 
ATOM   2720 C  CZ2 . TRP B 2 19  ? 4.031   122.961 38.040  1.00 24.79 ? 19  TRP B CZ2 1 
ATOM   2721 C  CZ3 . TRP B 2 19  ? 5.828   123.930 36.730  1.00 25.93 ? 19  TRP B CZ3 1 
ATOM   2722 C  CH2 . TRP B 2 19  ? 5.352   123.307 37.901  1.00 25.35 ? 19  TRP B CH2 1 
ATOM   2723 N  N   . SER B 2 20  ? 5.157   122.640 32.331  1.00 23.68 ? 20  SER B N   1 
ATOM   2724 C  CA  . SER B 2 20  ? 6.608   122.643 32.210  1.00 24.29 ? 20  SER B CA  1 
ATOM   2725 C  C   . SER B 2 20  ? 6.996   121.541 31.241  1.00 24.02 ? 20  SER B C   1 
ATOM   2726 O  O   . SER B 2 20  ? 6.553   120.401 31.375  1.00 25.12 ? 20  SER B O   1 
ATOM   2727 C  CB  . SER B 2 20  ? 7.276   122.410 33.566  1.00 25.35 ? 20  SER B CB  1 
ATOM   2728 O  OG  . SER B 2 20  ? 8.684   122.582 33.461  1.00 28.00 ? 20  SER B OG  1 
ATOM   2729 N  N   . GLU B 2 21  ? 7.811   121.885 30.253  1.00 23.55 ? 21  GLU B N   1 
ATOM   2730 C  CA  . GLU B 2 21  ? 8.238   120.905 29.264  1.00 23.50 ? 21  GLU B CA  1 
ATOM   2731 C  C   . GLU B 2 21  ? 9.745   120.971 29.039  1.00 22.95 ? 21  GLU B C   1 
ATOM   2732 O  O   . GLU B 2 21  ? 10.258  121.935 28.469  1.00 23.23 ? 21  GLU B O   1 
ATOM   2733 C  CB  . GLU B 2 21  ? 7.486   121.135 27.950  1.00 24.17 ? 21  GLU B CB  1 
ATOM   2734 C  CG  . GLU B 2 21  ? 7.883   120.199 26.819  1.00 27.42 ? 21  GLU B CG  1 
ATOM   2735 C  CD  . GLU B 2 21  ? 6.927   120.282 25.636  1.00 30.07 ? 21  GLU B CD  1 
ATOM   2736 O  OE1 . GLU B 2 21  ? 6.640   121.405 25.163  1.00 27.30 ? 21  GLU B OE1 1 
ATOM   2737 O  OE2 . GLU B 2 21  ? 6.463   119.218 25.176  1.00 32.72 ? 21  GLU B OE2 1 
ATOM   2738 N  N   . PRO B 2 22  ? 10.474  119.946 29.506  1.00 23.84 ? 22  PRO B N   1 
ATOM   2739 C  CA  . PRO B 2 22  ? 11.933  119.859 29.370  1.00 23.99 ? 22  PRO B CA  1 
ATOM   2740 C  C   . PRO B 2 22  ? 12.353  119.983 27.909  1.00 23.12 ? 22  PRO B C   1 
ATOM   2741 O  O   . PRO B 2 22  ? 11.700  119.431 27.020  1.00 22.94 ? 22  PRO B O   1 
ATOM   2742 C  CB  . PRO B 2 22  ? 12.251  118.480 29.944  1.00 25.29 ? 22  PRO B CB  1 
ATOM   2743 C  CG  . PRO B 2 22  ? 11.166  118.287 30.976  1.00 26.01 ? 22  PRO B CG  1 
ATOM   2744 C  CD  . PRO B 2 22  ? 9.945   118.780 30.239  1.00 25.49 ? 22  PRO B CD  1 
ATOM   2745 N  N   . LEU B 2 23  ? 13.443  120.702 27.662  1.00 20.47 ? 23  LEU B N   1 
ATOM   2746 C  CA  . LEU B 2 23  ? 13.924  120.894 26.299  1.00 22.05 ? 23  LEU B CA  1 
ATOM   2747 C  C   . LEU B 2 23  ? 15.302  120.279 26.064  1.00 20.84 ? 23  LEU B C   1 
ATOM   2748 O  O   . LEU B 2 23  ? 16.169  120.301 26.937  1.00 21.63 ? 23  LEU B O   1 
ATOM   2749 C  CB  . LEU B 2 23  ? 13.958  122.391 25.950  1.00 19.62 ? 23  LEU B CB  1 
ATOM   2750 C  CG  . LEU B 2 23  ? 12.612  123.135 25.981  1.00 22.12 ? 23  LEU B CG  1 
ATOM   2751 C  CD1 . LEU B 2 23  ? 12.817  124.589 25.603  1.00 19.49 ? 23  LEU B CD1 1 
ATOM   2752 C  CD2 . LEU B 2 23  ? 11.624  122.469 25.019  1.00 21.55 ? 23  LEU B CD2 1 
ATOM   2753 N  N   . TYR B 2 24  ? 15.485  119.737 24.867  1.00 20.79 ? 24  TYR B N   1 
ATOM   2754 C  CA  . TYR B 2 24  ? 16.737  119.112 24.460  1.00 21.66 ? 24  TYR B CA  1 
ATOM   2755 C  C   . TYR B 2 24  ? 17.906  120.101 24.550  1.00 21.92 ? 24  TYR B C   1 
ATOM   2756 O  O   . TYR B 2 24  ? 18.960  119.789 25.105  1.00 21.36 ? 24  TYR B O   1 
ATOM   2757 C  CB  . TYR B 2 24  ? 16.584  118.606 23.024  1.00 20.52 ? 24  TYR B CB  1 
ATOM   2758 C  CG  . TYR B 2 24  ? 17.822  118.008 22.404  1.00 20.71 ? 24  TYR B CG  1 
ATOM   2759 C  CD1 . TYR B 2 24  ? 18.261  116.729 22.757  1.00 20.75 ? 24  TYR B CD1 1 
ATOM   2760 C  CD2 . TYR B 2 24  ? 18.520  118.696 21.413  1.00 21.88 ? 24  TYR B CD2 1 
ATOM   2761 C  CE1 . TYR B 2 24  ? 19.361  116.150 22.124  1.00 21.86 ? 24  TYR B CE1 1 
ATOM   2762 C  CE2 . TYR B 2 24  ? 19.621  118.128 20.777  1.00 20.84 ? 24  TYR B CE2 1 
ATOM   2763 C  CZ  . TYR B 2 24  ? 20.031  116.860 21.131  1.00 21.98 ? 24  TYR B CZ  1 
ATOM   2764 O  OH  . TYR B 2 24  ? 21.087  116.292 20.464  1.00 20.56 ? 24  TYR B OH  1 
ATOM   2765 N  N   . SER B 2 25  ? 17.704  121.299 24.012  1.00 21.04 ? 25  SER B N   1 
ATOM   2766 C  CA  . SER B 2 25  ? 18.740  122.328 24.009  1.00 23.13 ? 25  SER B CA  1 
ATOM   2767 C  C   . SER B 2 25  ? 19.115  122.837 25.396  1.00 23.68 ? 25  SER B C   1 
ATOM   2768 O  O   . SER B 2 25  ? 20.141  123.496 25.554  1.00 23.55 ? 25  SER B O   1 
ATOM   2769 C  CB  . SER B 2 25  ? 18.293  123.516 23.154  1.00 21.52 ? 25  SER B CB  1 
ATOM   2770 O  OG  . SER B 2 25  ? 17.938  123.095 21.855  1.00 24.29 ? 25  SER B OG  1 
ATOM   2771 N  N   . LEU B 2 26  ? 18.284  122.537 26.390  1.00 25.19 ? 26  LEU B N   1 
ATOM   2772 C  CA  . LEU B 2 26  ? 18.523  122.981 27.760  1.00 26.49 ? 26  LEU B CA  1 
ATOM   2773 C  C   . LEU B 2 26  ? 19.086  121.914 28.700  1.00 27.72 ? 26  LEU B C   1 
ATOM   2774 O  O   . LEU B 2 26  ? 19.295  122.179 29.886  1.00 28.26 ? 26  LEU B O   1 
ATOM   2775 C  CB  . LEU B 2 26  ? 17.229  123.548 28.356  1.00 27.73 ? 26  LEU B CB  1 
ATOM   2776 C  CG  . LEU B 2 26  ? 16.832  124.981 27.970  1.00 28.84 ? 26  LEU B CG  1 
ATOM   2777 C  CD1 . LEU B 2 26  ? 16.836  125.163 26.463  1.00 30.42 ? 26  LEU B CD1 1 
ATOM   2778 C  CD2 . LEU B 2 26  ? 15.452  125.274 28.535  1.00 30.46 ? 26  LEU B CD2 1 
ATOM   2779 N  N   . ARG B 2 27  ? 19.329  120.712 28.186  1.00 27.14 ? 27  ARG B N   1 
ATOM   2780 C  CA  . ARG B 2 27  ? 19.886  119.649 29.019  1.00 29.58 ? 27  ARG B CA  1 
ATOM   2781 C  C   . ARG B 2 27  ? 21.324  120.012 29.382  1.00 29.49 ? 27  ARG B C   1 
ATOM   2782 O  O   . ARG B 2 27  ? 22.013  120.691 28.619  1.00 27.41 ? 27  ARG B O   1 
ATOM   2783 C  CB  . ARG B 2 27  ? 19.876  118.309 28.273  1.00 31.12 ? 27  ARG B CB  1 
ATOM   2784 C  CG  . ARG B 2 27  ? 18.491  117.806 27.909  1.00 37.18 ? 27  ARG B CG  1 
ATOM   2785 C  CD  . ARG B 2 27  ? 18.560  116.476 27.169  1.00 42.04 ? 27  ARG B CD  1 
ATOM   2786 N  NE  . ARG B 2 27  ? 17.243  116.062 26.693  1.00 48.65 ? 27  ARG B NE  1 
ATOM   2787 C  CZ  . ARG B 2 27  ? 17.010  114.968 25.973  1.00 50.70 ? 27  ARG B CZ  1 
ATOM   2788 N  NH1 . ARG B 2 27  ? 18.012  114.161 25.641  1.00 52.01 ? 27  ARG B NH1 1 
ATOM   2789 N  NH2 . ARG B 2 27  ? 15.775  114.686 25.575  1.00 51.37 ? 27  ARG B NH2 1 
ATOM   2790 N  N   . PRO B 2 28  ? 21.798  119.567 30.555  1.00 30.27 ? 28  PRO B N   1 
ATOM   2791 C  CA  . PRO B 2 28  ? 23.175  119.891 30.944  1.00 30.81 ? 28  PRO B CA  1 
ATOM   2792 C  C   . PRO B 2 28  ? 24.218  119.312 29.993  1.00 30.65 ? 28  PRO B C   1 
ATOM   2793 O  O   . PRO B 2 28  ? 25.274  119.909 29.792  1.00 31.91 ? 28  PRO B O   1 
ATOM   2794 C  CB  . PRO B 2 28  ? 23.281  119.320 32.361  1.00 31.26 ? 28  PRO B CB  1 
ATOM   2795 C  CG  . PRO B 2 28  ? 22.314  118.178 32.342  1.00 31.04 ? 28  PRO B CG  1 
ATOM   2796 C  CD  . PRO B 2 28  ? 21.133  118.764 31.596  1.00 30.56 ? 28  PRO B CD  1 
ATOM   2797 N  N   . GLU B 2 29  ? 23.918  118.160 29.399  1.00 31.07 ? 29  GLU B N   1 
ATOM   2798 C  CA  . GLU B 2 29  ? 24.851  117.524 28.472  1.00 31.22 ? 29  GLU B CA  1 
ATOM   2799 C  C   . GLU B 2 29  ? 24.978  118.338 27.193  1.00 28.65 ? 29  GLU B C   1 
ATOM   2800 O  O   . GLU B 2 29  ? 25.959  118.208 26.462  1.00 28.38 ? 29  GLU B O   1 
ATOM   2801 C  CB  . GLU B 2 29  ? 24.386  116.118 28.068  1.00 34.16 ? 29  GLU B CB  1 
ATOM   2802 C  CG  . GLU B 2 29  ? 23.690  115.299 29.129  1.00 40.14 ? 29  GLU B CG  1 
ATOM   2803 C  CD  . GLU B 2 29  ? 22.221  115.638 29.247  1.00 42.06 ? 29  GLU B CD  1 
ATOM   2804 O  OE1 . GLU B 2 29  ? 21.892  116.614 29.948  1.00 43.80 ? 29  GLU B OE1 1 
ATOM   2805 O  OE2 . GLU B 2 29  ? 21.395  114.931 28.625  1.00 44.12 ? 29  GLU B OE2 1 
ATOM   2806 N  N   . HIS B 2 30  ? 23.979  119.165 26.913  1.00 25.98 ? 30  HIS B N   1 
ATOM   2807 C  CA  . HIS B 2 30  ? 23.997  119.948 25.688  1.00 24.84 ? 30  HIS B CA  1 
ATOM   2808 C  C   . HIS B 2 30  ? 25.208  120.873 25.583  1.00 24.76 ? 30  HIS B C   1 
ATOM   2809 O  O   . HIS B 2 30  ? 25.680  121.157 24.480  1.00 24.01 ? 30  HIS B O   1 
ATOM   2810 C  CB  . HIS B 2 30  ? 22.694  120.744 25.543  1.00 23.80 ? 30  HIS B CB  1 
ATOM   2811 C  CG  . HIS B 2 30  ? 22.443  121.225 24.148  1.00 23.58 ? 30  HIS B CG  1 
ATOM   2812 N  ND1 . HIS B 2 30  ? 22.588  122.544 23.776  1.00 23.94 ? 30  HIS B ND1 1 
ATOM   2813 C  CD2 . HIS B 2 30  ? 22.106  120.551 23.022  1.00 22.61 ? 30  HIS B CD2 1 
ATOM   2814 C  CE1 . HIS B 2 30  ? 22.353  122.663 22.481  1.00 23.10 ? 30  HIS B CE1 1 
ATOM   2815 N  NE2 . HIS B 2 30  ? 22.059  121.469 21.999  1.00 23.53 ? 30  HIS B NE2 1 
ATOM   2816 N  N   . ALA B 2 31  ? 25.724  121.325 26.723  1.00 25.22 ? 31  ALA B N   1 
ATOM   2817 C  CA  . ALA B 2 31  ? 26.889  122.211 26.724  1.00 25.61 ? 31  ALA B CA  1 
ATOM   2818 C  C   . ALA B 2 31  ? 28.097  121.542 26.077  1.00 25.86 ? 31  ALA B C   1 
ATOM   2819 O  O   . ALA B 2 31  ? 29.003  122.216 25.584  1.00 24.47 ? 31  ALA B O   1 
ATOM   2820 C  CB  . ALA B 2 31  ? 27.234  122.638 28.151  1.00 26.23 ? 31  ALA B CB  1 
ATOM   2821 N  N   . ARG B 2 32  ? 28.108  120.214 26.065  1.00 26.70 ? 32  ARG B N   1 
ATOM   2822 C  CA  . ARG B 2 32  ? 29.221  119.487 25.471  1.00 28.85 ? 32  ARG B CA  1 
ATOM   2823 C  C   . ARG B 2 32  ? 29.196  119.532 23.952  1.00 27.43 ? 32  ARG B C   1 
ATOM   2824 O  O   . ARG B 2 32  ? 30.154  119.114 23.301  1.00 26.36 ? 32  ARG B O   1 
ATOM   2825 C  CB  . ARG B 2 32  ? 29.217  118.030 25.937  1.00 34.34 ? 32  ARG B CB  1 
ATOM   2826 C  CG  . ARG B 2 32  ? 30.038  117.792 27.190  1.00 41.93 ? 32  ARG B CG  1 
ATOM   2827 C  CD  . ARG B 2 32  ? 29.199  117.238 28.327  1.00 47.30 ? 32  ARG B CD  1 
ATOM   2828 N  NE  . ARG B 2 32  ? 28.618  115.938 28.006  1.00 51.71 ? 32  ARG B NE  1 
ATOM   2829 C  CZ  . ARG B 2 32  ? 27.964  115.182 28.883  1.00 54.57 ? 32  ARG B CZ  1 
ATOM   2830 N  NH1 . ARG B 2 32  ? 27.813  115.601 30.133  1.00 55.40 ? 32  ARG B NH1 1 
ATOM   2831 N  NH2 . ARG B 2 32  ? 27.459  114.011 28.512  1.00 55.65 ? 32  ARG B NH2 1 
ATOM   2832 N  N   . GLU B 2 33  ? 28.105  120.046 23.394  1.00 24.45 ? 33  GLU B N   1 
ATOM   2833 C  CA  . GLU B 2 33  ? 27.955  120.131 21.948  1.00 24.62 ? 33  GLU B CA  1 
ATOM   2834 C  C   . GLU B 2 33  ? 28.533  121.422 21.383  1.00 24.31 ? 33  GLU B C   1 
ATOM   2835 O  O   . GLU B 2 33  ? 28.455  121.666 20.176  1.00 23.40 ? 33  GLU B O   1 
ATOM   2836 C  CB  . GLU B 2 33  ? 26.477  120.020 21.561  1.00 24.59 ? 33  GLU B CB  1 
ATOM   2837 C  CG  . GLU B 2 33  ? 25.806  118.739 22.027  1.00 27.84 ? 33  GLU B CG  1 
ATOM   2838 C  CD  . GLU B 2 33  ? 26.487  117.499 21.486  1.00 33.34 ? 33  GLU B CD  1 
ATOM   2839 O  OE1 . GLU B 2 33  ? 26.771  117.458 20.271  1.00 36.27 ? 33  GLU B OE1 1 
ATOM   2840 O  OE2 . GLU B 2 33  ? 26.733  116.559 22.270  1.00 37.02 ? 33  GLU B OE2 1 
ATOM   2841 N  N   . ARG B 2 34  ? 29.108  122.249 22.253  1.00 23.37 ? 34  ARG B N   1 
ATOM   2842 C  CA  . ARG B 2 34  ? 29.708  123.504 21.814  1.00 23.34 ? 34  ARG B CA  1 
ATOM   2843 C  C   . ARG B 2 34  ? 30.920  123.189 20.945  1.00 23.12 ? 34  ARG B C   1 
ATOM   2844 O  O   . ARG B 2 34  ? 31.570  122.158 21.113  1.00 22.57 ? 34  ARG B O   1 
ATOM   2845 C  CB  . ARG B 2 34  ? 30.132  124.359 23.017  1.00 25.64 ? 34  ARG B CB  1 
ATOM   2846 C  CG  . ARG B 2 34  ? 28.978  125.014 23.775  1.00 28.10 ? 34  ARG B CG  1 
ATOM   2847 C  CD  . ARG B 2 34  ? 28.264  126.060 22.924  1.00 30.05 ? 34  ARG B CD  1 
ATOM   2848 N  NE  . ARG B 2 34  ? 29.016  127.306 22.780  1.00 31.48 ? 34  ARG B NE  1 
ATOM   2849 C  CZ  . ARG B 2 34  ? 29.062  128.267 23.700  1.00 32.17 ? 34  ARG B CZ  1 
ATOM   2850 N  NH1 . ARG B 2 34  ? 28.401  128.133 24.842  1.00 33.20 ? 34  ARG B NH1 1 
ATOM   2851 N  NH2 . ARG B 2 34  ? 29.760  129.372 23.475  1.00 32.31 ? 34  ARG B NH2 1 
ATOM   2852 N  N   . LEU B 2 35  ? 31.215  124.088 20.016  1.00 22.17 ? 35  LEU B N   1 
ATOM   2853 C  CA  . LEU B 2 35  ? 32.328  123.920 19.092  1.00 24.96 ? 35  LEU B CA  1 
ATOM   2854 C  C   . LEU B 2 35  ? 33.686  123.650 19.740  1.00 25.31 ? 35  LEU B C   1 
ATOM   2855 O  O   . LEU B 2 35  ? 34.069  124.307 20.705  1.00 25.47 ? 35  LEU B O   1 
ATOM   2856 C  CB  . LEU B 2 35  ? 32.451  125.164 18.206  1.00 23.56 ? 35  LEU B CB  1 
ATOM   2857 C  CG  . LEU B 2 35  ? 33.671  125.223 17.282  1.00 24.76 ? 35  LEU B CG  1 
ATOM   2858 C  CD1 . LEU B 2 35  ? 33.503  124.232 16.136  1.00 24.73 ? 35  LEU B CD1 1 
ATOM   2859 C  CD2 . LEU B 2 35  ? 33.828  126.637 16.738  1.00 24.47 ? 35  LEU B CD2 1 
ATOM   2860 N  N   . GLN B 2 36  ? 34.402  122.674 19.192  1.00 25.18 ? 36  GLN B N   1 
ATOM   2861 C  CA  . GLN B 2 36  ? 35.748  122.337 19.649  1.00 24.94 ? 36  GLN B CA  1 
ATOM   2862 C  C   . GLN B 2 36  ? 36.646  122.773 18.499  1.00 24.52 ? 36  GLN B C   1 
ATOM   2863 O  O   . GLN B 2 36  ? 36.688  122.112 17.461  1.00 26.54 ? 36  GLN B O   1 
ATOM   2864 C  CB  . GLN B 2 36  ? 35.881  120.828 19.882  1.00 26.20 ? 36  GLN B CB  1 
ATOM   2865 C  CG  . GLN B 2 36  ? 35.262  120.346 21.188  1.00 26.68 ? 36  GLN B CG  1 
ATOM   2866 C  CD  . GLN B 2 36  ? 35.307  118.836 21.338  1.00 29.31 ? 36  GLN B CD  1 
ATOM   2867 O  OE1 . GLN B 2 36  ? 34.342  118.139 21.025  1.00 32.91 ? 36  GLN B OE1 1 
ATOM   2868 N  NE2 . GLN B 2 36  ? 36.434  118.322 21.808  1.00 28.98 ? 36  GLN B NE2 1 
ATOM   2869 N  N   . ASP B 2 37  ? 37.349  123.889 18.667  1.00 24.46 ? 37  ASP B N   1 
ATOM   2870 C  CA  . ASP B 2 37  ? 38.204  124.392 17.595  1.00 24.23 ? 37  ASP B CA  1 
ATOM   2871 C  C   . ASP B 2 37  ? 39.624  123.843 17.587  1.00 24.65 ? 37  ASP B C   1 
ATOM   2872 O  O   . ASP B 2 37  ? 40.472  124.320 16.830  1.00 23.03 ? 37  ASP B O   1 
ATOM   2873 C  CB  . ASP B 2 37  ? 38.244  125.925 17.609  1.00 25.70 ? 37  ASP B CB  1 
ATOM   2874 C  CG  . ASP B 2 37  ? 38.941  126.493 18.837  1.00 27.71 ? 37  ASP B CG  1 
ATOM   2875 O  OD1 . ASP B 2 37  ? 39.472  125.717 19.660  1.00 28.20 ? 37  ASP B OD1 1 
ATOM   2876 O  OD2 . ASP B 2 37  ? 38.956  127.733 18.971  1.00 30.67 ? 37  ASP B OD2 1 
ATOM   2877 N  N   . ASP B 2 38  ? 39.877  122.840 18.423  1.00 24.82 ? 38  ASP B N   1 
ATOM   2878 C  CA  . ASP B 2 38  ? 41.198  122.214 18.500  1.00 26.30 ? 38  ASP B CA  1 
ATOM   2879 C  C   . ASP B 2 38  ? 42.321  123.230 18.704  1.00 26.98 ? 38  ASP B C   1 
ATOM   2880 O  O   . ASP B 2 38  ? 43.468  122.975 18.337  1.00 26.64 ? 38  ASP B O   1 
ATOM   2881 C  CB  . ASP B 2 38  ? 41.470  121.412 17.224  1.00 24.86 ? 38  ASP B CB  1 
ATOM   2882 C  CG  . ASP B 2 38  ? 40.364  120.421 16.913  1.00 25.67 ? 38  ASP B CG  1 
ATOM   2883 O  OD1 . ASP B 2 38  ? 40.042  119.595 17.795  1.00 24.39 ? 38  ASP B OD1 1 
ATOM   2884 O  OD2 . ASP B 2 38  ? 39.816  120.469 15.789  1.00 25.34 ? 38  ASP B OD2 1 
ATOM   2885 N  N   . SER B 2 39  ? 41.987  124.376 19.287  1.00 27.11 ? 39  SER B N   1 
ATOM   2886 C  CA  . SER B 2 39  ? 42.963  125.430 19.533  1.00 28.72 ? 39  SER B CA  1 
ATOM   2887 C  C   . SER B 2 39  ? 43.559  125.967 18.236  1.00 29.19 ? 39  SER B C   1 
ATOM   2888 O  O   . SER B 2 39  ? 44.662  126.509 18.229  1.00 30.99 ? 39  SER B O   1 
ATOM   2889 C  CB  . SER B 2 39  ? 44.084  124.920 20.445  1.00 30.19 ? 39  SER B CB  1 
ATOM   2890 O  OG  . SER B 2 39  ? 43.577  124.574 21.722  1.00 31.99 ? 39  SER B OG  1 
ATOM   2891 N  N   . VAL B 2 40  ? 42.836  125.796 17.135  1.00 28.00 ? 40  VAL B N   1 
ATOM   2892 C  CA  . VAL B 2 40  ? 43.284  126.304 15.842  1.00 28.40 ? 40  VAL B CA  1 
ATOM   2893 C  C   . VAL B 2 40  ? 42.177  127.212 15.322  1.00 28.44 ? 40  VAL B C   1 
ATOM   2894 O  O   . VAL B 2 40  ? 41.139  126.741 14.865  1.00 27.66 ? 40  VAL B O   1 
ATOM   2895 C  CB  . VAL B 2 40  ? 43.534  125.168 14.827  1.00 27.92 ? 40  VAL B CB  1 
ATOM   2896 C  CG1 . VAL B 2 40  ? 43.907  125.757 13.467  1.00 28.40 ? 40  VAL B CG1 1 
ATOM   2897 C  CG2 . VAL B 2 40  ? 44.655  124.267 15.325  1.00 28.47 ? 40  VAL B CG2 1 
ATOM   2898 N  N   . GLU B 2 41  ? 42.404  128.518 15.409  1.00 28.87 ? 41  GLU B N   1 
ATOM   2899 C  CA  . GLU B 2 41  ? 41.418  129.498 14.977  1.00 30.50 ? 41  GLU B CA  1 
ATOM   2900 C  C   . GLU B 2 41  ? 41.522  129.926 13.523  1.00 29.35 ? 41  GLU B C   1 
ATOM   2901 O  O   . GLU B 2 41  ? 42.609  130.196 13.017  1.00 29.17 ? 41  GLU B O   1 
ATOM   2902 C  CB  . GLU B 2 41  ? 41.506  130.753 15.848  1.00 34.00 ? 41  GLU B CB  1 
ATOM   2903 C  CG  . GLU B 2 41  ? 41.201  130.531 17.312  1.00 38.79 ? 41  GLU B CG  1 
ATOM   2904 C  CD  . GLU B 2 41  ? 41.192  131.829 18.098  1.00 43.26 ? 41  GLU B CD  1 
ATOM   2905 O  OE1 . GLU B 2 41  ? 40.905  131.783 19.312  1.00 45.85 ? 41  GLU B OE1 1 
ATOM   2906 O  OE2 . GLU B 2 41  ? 41.470  132.895 17.503  1.00 45.23 ? 41  GLU B OE2 1 
ATOM   2907 N  N   . THR B 2 42  ? 40.372  129.982 12.859  1.00 26.51 ? 42  THR B N   1 
ATOM   2908 C  CA  . THR B 2 42  ? 40.289  130.428 11.475  1.00 24.84 ? 42  THR B CA  1 
ATOM   2909 C  C   . THR B 2 42  ? 38.990  131.216 11.412  1.00 23.78 ? 42  THR B C   1 
ATOM   2910 O  O   . THR B 2 42  ? 38.183  131.151 12.338  1.00 21.94 ? 42  THR B O   1 
ATOM   2911 C  CB  . THR B 2 42  ? 40.229  129.251 10.470  1.00 25.30 ? 42  THR B CB  1 
ATOM   2912 O  OG1 . THR B 2 42  ? 39.020  128.509 10.662  1.00 24.98 ? 42  THR B OG1 1 
ATOM   2913 C  CG2 . THR B 2 42  ? 41.424  128.329 10.657  1.00 25.15 ? 42  THR B CG2 1 
ATOM   2914 N  N   . VAL B 2 43  ? 38.795  131.966 10.336  1.00 23.28 ? 43  VAL B N   1 
ATOM   2915 C  CA  . VAL B 2 43  ? 37.589  132.766 10.184  1.00 24.72 ? 43  VAL B CA  1 
ATOM   2916 C  C   . VAL B 2 43  ? 36.339  131.928 10.431  1.00 23.74 ? 43  VAL B C   1 
ATOM   2917 O  O   . VAL B 2 43  ? 35.397  132.380 11.078  1.00 23.68 ? 43  VAL B O   1 
ATOM   2918 C  CB  . VAL B 2 43  ? 37.514  133.392 8.772   1.00 25.63 ? 43  VAL B CB  1 
ATOM   2919 C  CG1 . VAL B 2 43  ? 36.187  134.117 8.588   1.00 29.19 ? 43  VAL B CG1 1 
ATOM   2920 C  CG2 . VAL B 2 43  ? 38.666  134.363 8.582   1.00 28.09 ? 43  VAL B CG2 1 
ATOM   2921 N  N   . THR B 2 44  ? 36.342  130.700 9.924   1.00 23.16 ? 44  THR B N   1 
ATOM   2922 C  CA  . THR B 2 44  ? 35.200  129.806 10.088  1.00 22.44 ? 44  THR B CA  1 
ATOM   2923 C  C   . THR B 2 44  ? 34.856  129.510 11.547  1.00 22.41 ? 44  THR B C   1 
ATOM   2924 O  O   . THR B 2 44  ? 33.705  129.674 11.957  1.00 22.20 ? 44  THR B O   1 
ATOM   2925 C  CB  . THR B 2 44  ? 35.438  128.465 9.364   1.00 21.73 ? 44  THR B CB  1 
ATOM   2926 O  OG1 . THR B 2 44  ? 35.576  128.703 7.958   1.00 23.37 ? 44  THR B OG1 1 
ATOM   2927 C  CG2 . THR B 2 44  ? 34.268  127.505 9.606   1.00 21.27 ? 44  THR B CG2 1 
ATOM   2928 N  N   . SER B 2 45  ? 35.842  129.069 12.329  1.00 22.34 ? 45  SER B N   1 
ATOM   2929 C  CA  . SER B 2 45  ? 35.589  128.742 13.731  1.00 22.78 ? 45  SER B CA  1 
ATOM   2930 C  C   . SER B 2 45  ? 35.209  129.965 14.562  1.00 23.24 ? 45  SER B C   1 
ATOM   2931 O  O   . SER B 2 45  ? 34.389  129.869 15.478  1.00 23.76 ? 45  SER B O   1 
ATOM   2932 C  CB  . SER B 2 45  ? 36.799  128.030 14.358  1.00 22.19 ? 45  SER B CB  1 
ATOM   2933 O  OG  . SER B 2 45  ? 37.961  128.843 14.371  1.00 22.49 ? 45  SER B OG  1 
ATOM   2934 N  N   . ILE B 2 46  ? 35.797  131.113 14.239  1.00 22.57 ? 46  ILE B N   1 
ATOM   2935 C  CA  . ILE B 2 46  ? 35.501  132.348 14.953  1.00 22.38 ? 46  ILE B CA  1 
ATOM   2936 C  C   . ILE B 2 46  ? 34.037  132.753 14.761  1.00 23.34 ? 46  ILE B C   1 
ATOM   2937 O  O   . ILE B 2 46  ? 33.362  133.143 15.719  1.00 21.50 ? 46  ILE B O   1 
ATOM   2938 C  CB  . ILE B 2 46  ? 36.424  133.495 14.472  1.00 23.17 ? 46  ILE B CB  1 
ATOM   2939 C  CG1 . ILE B 2 46  ? 37.851  133.242 14.970  1.00 21.16 ? 46  ILE B CG1 1 
ATOM   2940 C  CG2 . ILE B 2 46  ? 35.902  134.847 14.969  1.00 22.35 ? 46  ILE B CG2 1 
ATOM   2941 C  CD1 . ILE B 2 46  ? 38.865  134.235 14.454  1.00 25.93 ? 46  ILE B CD1 1 
ATOM   2942 N  N   . GLU B 2 47  ? 33.548  132.657 13.527  1.00 23.16 ? 47  GLU B N   1 
ATOM   2943 C  CA  . GLU B 2 47  ? 32.163  133.015 13.241  1.00 23.75 ? 47  GLU B CA  1 
ATOM   2944 C  C   . GLU B 2 47  ? 31.188  132.034 13.886  1.00 22.58 ? 47  GLU B C   1 
ATOM   2945 O  O   . GLU B 2 47  ? 30.158  132.433 14.429  1.00 21.49 ? 47  GLU B O   1 
ATOM   2946 C  CB  . GLU B 2 47  ? 31.928  133.072 11.730  1.00 24.72 ? 47  GLU B CB  1 
ATOM   2947 C  CG  . GLU B 2 47  ? 32.664  134.208 11.049  1.00 28.03 ? 47  GLU B CG  1 
ATOM   2948 C  CD  . GLU B 2 47  ? 32.370  135.551 11.696  1.00 33.26 ? 47  GLU B CD  1 
ATOM   2949 O  OE1 . GLU B 2 47  ? 31.188  135.962 11.705  1.00 35.91 ? 47  GLU B OE1 1 
ATOM   2950 O  OE2 . GLU B 2 47  ? 33.318  136.193 12.204  1.00 33.63 ? 47  GLU B OE2 1 
ATOM   2951 N  N   . GLN B 2 48  ? 31.522  130.751 13.825  1.00 21.37 ? 48  GLN B N   1 
ATOM   2952 C  CA  . GLN B 2 48  ? 30.687  129.707 14.408  1.00 21.31 ? 48  GLN B CA  1 
ATOM   2953 C  C   . GLN B 2 48  ? 30.578  129.895 15.925  1.00 22.19 ? 48  GLN B C   1 
ATOM   2954 O  O   . GLN B 2 48  ? 29.497  129.775 16.498  1.00 22.28 ? 48  GLN B O   1 
ATOM   2955 C  CB  . GLN B 2 48  ? 31.282  128.332 14.077  1.00 19.50 ? 48  GLN B CB  1 
ATOM   2956 C  CG  . GLN B 2 48  ? 30.537  127.132 14.657  1.00 19.22 ? 48  GLN B CG  1 
ATOM   2957 C  CD  . GLN B 2 48  ? 29.067  127.099 14.269  1.00 21.44 ? 48  GLN B CD  1 
ATOM   2958 O  OE1 . GLN B 2 48  ? 28.687  127.561 13.192  1.00 19.98 ? 48  GLN B OE1 1 
ATOM   2959 N  NE2 . GLN B 2 48  ? 28.234  126.537 15.143  1.00 18.03 ? 48  GLN B NE2 1 
ATOM   2960 N  N   . ALA B 2 49  ? 31.700  130.199 16.569  1.00 22.94 ? 49  ALA B N   1 
ATOM   2961 C  CA  . ALA B 2 49  ? 31.724  130.398 18.014  1.00 22.49 ? 49  ALA B CA  1 
ATOM   2962 C  C   . ALA B 2 49  ? 30.889  131.610 18.409  1.00 22.53 ? 49  ALA B C   1 
ATOM   2963 O  O   . ALA B 2 49  ? 30.231  131.612 19.450  1.00 22.55 ? 49  ALA B O   1 
ATOM   2964 C  CB  . ALA B 2 49  ? 33.164  130.570 18.495  1.00 23.27 ? 49  ALA B CB  1 
ATOM   2965 N  N   . LYS B 2 50  ? 30.913  132.646 17.581  1.00 22.62 ? 50  LYS B N   1 
ATOM   2966 C  CA  . LYS B 2 50  ? 30.138  133.843 17.871  1.00 23.19 ? 50  LYS B CA  1 
ATOM   2967 C  C   . LYS B 2 50  ? 28.638  133.544 17.837  1.00 23.19 ? 50  LYS B C   1 
ATOM   2968 O  O   . LYS B 2 50  ? 27.888  134.021 18.688  1.00 22.51 ? 50  LYS B O   1 
ATOM   2969 C  CB  . LYS B 2 50  ? 30.497  134.958 16.883  1.00 25.61 ? 50  LYS B CB  1 
ATOM   2970 C  CG  . LYS B 2 50  ? 31.733  135.744 17.315  1.00 30.40 ? 50  LYS B CG  1 
ATOM   2971 C  CD  . LYS B 2 50  ? 32.453  136.415 16.154  1.00 34.64 ? 50  LYS B CD  1 
ATOM   2972 C  CE  . LYS B 2 50  ? 31.618  137.487 15.486  1.00 38.94 ? 50  LYS B CE  1 
ATOM   2973 N  NZ  . LYS B 2 50  ? 32.403  138.177 14.412  1.00 40.54 ? 50  LYS B NZ  1 
ATOM   2974 N  N   . VAL B 2 51  ? 28.199  132.752 16.862  1.00 20.56 ? 51  VAL B N   1 
ATOM   2975 C  CA  . VAL B 2 51  ? 26.786  132.406 16.775  1.00 19.97 ? 51  VAL B CA  1 
ATOM   2976 C  C   . VAL B 2 51  ? 26.390  131.536 17.969  1.00 19.82 ? 51  VAL B C   1 
ATOM   2977 O  O   . VAL B 2 51  ? 25.363  131.771 18.607  1.00 20.49 ? 51  VAL B O   1 
ATOM   2978 C  CB  . VAL B 2 51  ? 26.467  131.646 15.457  1.00 21.49 ? 51  VAL B CB  1 
ATOM   2979 C  CG1 . VAL B 2 51  ? 25.044  131.079 15.505  1.00 20.27 ? 51  VAL B CG1 1 
ATOM   2980 C  CG2 . VAL B 2 51  ? 26.608  132.595 14.262  1.00 22.59 ? 51  VAL B CG2 1 
ATOM   2981 N  N   . GLU B 2 52  ? 27.209  130.536 18.277  1.00 19.65 ? 52  GLU B N   1 
ATOM   2982 C  CA  . GLU B 2 52  ? 26.911  129.646 19.395  1.00 21.50 ? 52  GLU B CA  1 
ATOM   2983 C  C   . GLU B 2 52  ? 26.789  130.404 20.715  1.00 23.14 ? 52  GLU B C   1 
ATOM   2984 O  O   . GLU B 2 52  ? 25.928  130.094 21.539  1.00 21.00 ? 52  GLU B O   1 
ATOM   2985 C  CB  . GLU B 2 52  ? 27.984  128.559 19.516  1.00 21.42 ? 52  GLU B CB  1 
ATOM   2986 C  CG  . GLU B 2 52  ? 28.007  127.583 18.342  1.00 23.63 ? 52  GLU B CG  1 
ATOM   2987 C  CD  . GLU B 2 52  ? 28.928  126.396 18.578  1.00 24.48 ? 52  GLU B CD  1 
ATOM   2988 O  OE1 . GLU B 2 52  ? 29.483  126.277 19.689  1.00 25.91 ? 52  GLU B OE1 1 
ATOM   2989 O  OE2 . GLU B 2 52  ? 29.091  125.575 17.655  1.00 26.20 ? 52  GLU B OE2 1 
ATOM   2990 N  N   . GLU B 2 53  ? 27.647  131.399 20.910  1.00 24.81 ? 53  GLU B N   1 
ATOM   2991 C  CA  . GLU B 2 53  ? 27.628  132.196 22.133  1.00 26.49 ? 53  GLU B CA  1 
ATOM   2992 C  C   . GLU B 2 53  ? 26.286  132.923 22.279  1.00 25.83 ? 53  GLU B C   1 
ATOM   2993 O  O   . GLU B 2 53  ? 25.686  132.939 23.356  1.00 23.66 ? 53  GLU B O   1 
ATOM   2994 C  CB  . GLU B 2 53  ? 28.774  133.209 22.107  1.00 31.07 ? 53  GLU B CB  1 
ATOM   2995 C  CG  . GLU B 2 53  ? 28.917  134.034 23.374  1.00 39.22 ? 53  GLU B CG  1 
ATOM   2996 C  CD  . GLU B 2 53  ? 29.212  133.182 24.592  1.00 44.71 ? 53  GLU B CD  1 
ATOM   2997 O  OE1 . GLU B 2 53  ? 30.202  132.415 24.564  1.00 49.55 ? 53  GLU B OE1 1 
ATOM   2998 O  OE2 . GLU B 2 53  ? 28.458  133.281 25.581  1.00 47.58 ? 53  GLU B OE2 1 
ATOM   2999 N  N   . LYS B 2 54  ? 25.822  133.523 21.188  1.00 23.40 ? 54  LYS B N   1 
ATOM   3000 C  CA  . LYS B 2 54  ? 24.552  134.237 21.192  1.00 24.21 ? 54  LYS B CA  1 
ATOM   3001 C  C   . LYS B 2 54  ? 23.388  133.269 21.410  1.00 23.11 ? 54  LYS B C   1 
ATOM   3002 O  O   . LYS B 2 54  ? 22.478  133.549 22.186  1.00 22.32 ? 54  LYS B O   1 
ATOM   3003 C  CB  . LYS B 2 54  ? 24.365  134.983 19.866  1.00 24.85 ? 54  LYS B CB  1 
ATOM   3004 C  CG  . LYS B 2 54  ? 23.001  135.645 19.702  1.00 30.07 ? 54  LYS B CG  1 
ATOM   3005 C  CD  . LYS B 2 54  ? 22.710  136.623 20.834  1.00 33.22 ? 54  LYS B CD  1 
ATOM   3006 C  CE  . LYS B 2 54  ? 21.376  137.326 20.627  1.00 36.17 ? 54  LYS B CE  1 
ATOM   3007 N  NZ  . LYS B 2 54  ? 21.088  138.288 21.728  1.00 38.33 ? 54  LYS B NZ  1 
ATOM   3008 N  N   . ILE B 2 55  ? 23.430  132.129 20.726  1.00 21.97 ? 55  ILE B N   1 
ATOM   3009 C  CA  . ILE B 2 55  ? 22.377  131.122 20.842  1.00 21.82 ? 55  ILE B CA  1 
ATOM   3010 C  C   . ILE B 2 55  ? 22.259  130.575 22.264  1.00 21.19 ? 55  ILE B C   1 
ATOM   3011 O  O   . ILE B 2 55  ? 21.152  130.348 22.755  1.00 20.97 ? 55  ILE B O   1 
ATOM   3012 C  CB  . ILE B 2 55  ? 22.617  129.948 19.853  1.00 21.26 ? 55  ILE B CB  1 
ATOM   3013 C  CG1 . ILE B 2 55  ? 22.552  130.468 18.412  1.00 24.59 ? 55  ILE B CG1 1 
ATOM   3014 C  CG2 . ILE B 2 55  ? 21.580  128.846 20.060  1.00 21.78 ? 55  ILE B CG2 1 
ATOM   3015 C  CD1 . ILE B 2 55  ? 21.265  131.166 18.068  1.00 24.46 ? 55  ILE B CD1 1 
ATOM   3016 N  N   . GLN B 2 56  ? 23.392  130.361 22.928  1.00 20.46 ? 56  GLN B N   1 
ATOM   3017 C  CA  . GLN B 2 56  ? 23.368  129.858 24.300  1.00 22.31 ? 56  GLN B CA  1 
ATOM   3018 C  C   . GLN B 2 56  ? 22.645  130.859 25.200  1.00 22.85 ? 56  GLN B C   1 
ATOM   3019 O  O   . GLN B 2 56  ? 21.860  130.478 26.072  1.00 21.48 ? 56  GLN B O   1 
ATOM   3020 C  CB  . GLN B 2 56  ? 24.790  129.633 24.819  1.00 22.36 ? 56  GLN B CB  1 
ATOM   3021 C  CG  . GLN B 2 56  ? 24.860  129.093 26.247  1.00 24.71 ? 56  GLN B CG  1 
ATOM   3022 C  CD  . GLN B 2 56  ? 24.026  127.833 26.449  1.00 28.35 ? 56  GLN B CD  1 
ATOM   3023 O  OE1 . GLN B 2 56  ? 22.841  127.899 26.782  1.00 31.14 ? 56  GLN B OE1 1 
ATOM   3024 N  NE2 . GLN B 2 56  ? 24.642  126.678 26.238  1.00 27.47 ? 56  GLN B NE2 1 
ATOM   3025 N  N   . GLU B 2 57  ? 22.916  132.143 24.987  1.00 23.06 ? 57  GLU B N   1 
ATOM   3026 C  CA  . GLU B 2 57  ? 22.266  133.185 25.771  1.00 24.29 ? 57  GLU B CA  1 
ATOM   3027 C  C   . GLU B 2 57  ? 20.759  133.111 25.558  1.00 23.27 ? 57  GLU B C   1 
ATOM   3028 O  O   . GLU B 2 57  ? 19.979  133.221 26.504  1.00 21.45 ? 57  GLU B O   1 
ATOM   3029 C  CB  . GLU B 2 57  ? 22.774  134.562 25.348  1.00 27.23 ? 57  GLU B CB  1 
ATOM   3030 C  CG  . GLU B 2 57  ? 24.188  134.869 25.795  1.00 35.03 ? 57  GLU B CG  1 
ATOM   3031 C  CD  . GLU B 2 57  ? 24.694  136.180 25.222  1.00 40.34 ? 57  GLU B CD  1 
ATOM   3032 O  OE1 . GLU B 2 57  ? 23.890  137.135 25.131  1.00 43.33 ? 57  GLU B OE1 1 
ATOM   3033 O  OE2 . GLU B 2 57  ? 25.893  136.258 24.872  1.00 43.01 ? 57  GLU B OE2 1 
ATOM   3034 N  N   . VAL B 2 58  ? 20.351  132.934 24.305  1.00 21.89 ? 58  VAL B N   1 
ATOM   3035 C  CA  . VAL B 2 58  ? 18.935  132.836 23.987  1.00 20.86 ? 58  VAL B CA  1 
ATOM   3036 C  C   . VAL B 2 58  ? 18.338  131.620 24.691  1.00 20.69 ? 58  VAL B C   1 
ATOM   3037 O  O   . VAL B 2 58  ? 17.337  131.733 25.398  1.00 21.02 ? 58  VAL B O   1 
ATOM   3038 C  CB  . VAL B 2 58  ? 18.718  132.714 22.460  1.00 22.12 ? 58  VAL B CB  1 
ATOM   3039 C  CG1 . VAL B 2 58  ? 17.240  132.518 22.154  1.00 21.05 ? 58  VAL B CG1 1 
ATOM   3040 C  CG2 . VAL B 2 58  ? 19.246  133.972 21.762  1.00 22.51 ? 58  VAL B CG2 1 
ATOM   3041 N  N   . PHE B 2 59  ? 18.966  130.461 24.507  1.00 20.67 ? 59  PHE B N   1 
ATOM   3042 C  CA  . PHE B 2 59  ? 18.503  129.222 25.133  1.00 21.14 ? 59  PHE B CA  1 
ATOM   3043 C  C   . PHE B 2 59  ? 18.279  129.409 26.636  1.00 21.83 ? 59  PHE B C   1 
ATOM   3044 O  O   . PHE B 2 59  ? 17.243  129.019 27.183  1.00 21.04 ? 59  PHE B O   1 
ATOM   3045 C  CB  . PHE B 2 59  ? 19.538  128.106 24.922  1.00 21.09 ? 59  PHE B CB  1 
ATOM   3046 C  CG  . PHE B 2 59  ? 19.513  127.482 23.546  1.00 21.36 ? 59  PHE B CG  1 
ATOM   3047 C  CD1 . PHE B 2 59  ? 20.551  126.647 23.138  1.00 21.63 ? 59  PHE B CD1 1 
ATOM   3048 C  CD2 . PHE B 2 59  ? 18.442  127.688 22.681  1.00 20.28 ? 59  PHE B CD2 1 
ATOM   3049 C  CE1 . PHE B 2 59  ? 20.521  126.025 21.887  1.00 23.18 ? 59  PHE B CE1 1 
ATOM   3050 C  CE2 . PHE B 2 59  ? 18.402  127.070 21.429  1.00 22.19 ? 59  PHE B CE2 1 
ATOM   3051 C  CZ  . PHE B 2 59  ? 19.442  126.238 21.031  1.00 20.84 ? 59  PHE B CZ  1 
ATOM   3052 N  N   . SER B 2 60  ? 19.268  130.001 27.297  1.00 21.98 ? 60  SER B N   1 
ATOM   3053 C  CA  . SER B 2 60  ? 19.208  130.231 28.736  1.00 22.89 ? 60  SER B CA  1 
ATOM   3054 C  C   . SER B 2 60  ? 18.042  131.098 29.199  1.00 23.78 ? 60  SER B C   1 
ATOM   3055 O  O   . SER B 2 60  ? 17.545  130.922 30.313  1.00 23.12 ? 60  SER B O   1 
ATOM   3056 C  CB  . SER B 2 60  ? 20.522  130.845 29.215  1.00 25.12 ? 60  SER B CB  1 
ATOM   3057 O  OG  . SER B 2 60  ? 21.560  129.881 29.169  1.00 26.98 ? 60  SER B OG  1 
ATOM   3058 N  N   . SER B 2 61  ? 17.596  132.024 28.353  1.00 22.40 ? 61  SER B N   1 
ATOM   3059 C  CA  . SER B 2 61  ? 16.493  132.899 28.735  1.00 22.64 ? 61  SER B CA  1 
ATOM   3060 C  C   . SER B 2 61  ? 15.156  132.170 28.798  1.00 22.76 ? 61  SER B C   1 
ATOM   3061 O  O   . SER B 2 61  ? 14.178  132.717 29.303  1.00 23.44 ? 61  SER B O   1 
ATOM   3062 C  CB  . SER B 2 61  ? 16.385  134.086 27.770  1.00 22.79 ? 61  SER B CB  1 
ATOM   3063 O  OG  . SER B 2 61  ? 16.038  133.657 26.466  1.00 21.92 ? 61  SER B OG  1 
ATOM   3064 N  N   . TYR B 2 62  ? 15.106  130.943 28.286  1.00 22.23 ? 62  TYR B N   1 
ATOM   3065 C  CA  . TYR B 2 62  ? 13.865  130.173 28.317  1.00 23.04 ? 62  TYR B CA  1 
ATOM   3066 C  C   . TYR B 2 62  ? 13.847  129.159 29.456  1.00 22.91 ? 62  TYR B C   1 
ATOM   3067 O  O   . TYR B 2 62  ? 12.913  128.366 29.583  1.00 23.38 ? 62  TYR B O   1 
ATOM   3068 C  CB  . TYR B 2 62  ? 13.641  129.447 26.983  1.00 22.58 ? 62  TYR B CB  1 
ATOM   3069 C  CG  . TYR B 2 62  ? 13.267  130.378 25.858  1.00 22.34 ? 62  TYR B CG  1 
ATOM   3070 C  CD1 . TYR B 2 62  ? 14.245  131.064 25.140  1.00 22.15 ? 62  TYR B CD1 1 
ATOM   3071 C  CD2 . TYR B 2 62  ? 11.929  130.624 25.553  1.00 21.01 ? 62  TYR B CD2 1 
ATOM   3072 C  CE1 . TYR B 2 62  ? 13.900  131.978 24.147  1.00 21.33 ? 62  TYR B CE1 1 
ATOM   3073 C  CE2 . TYR B 2 62  ? 11.574  131.534 24.567  1.00 22.76 ? 62  TYR B CE2 1 
ATOM   3074 C  CZ  . TYR B 2 62  ? 12.566  132.209 23.870  1.00 22.17 ? 62  TYR B CZ  1 
ATOM   3075 O  OH  . TYR B 2 62  ? 12.219  133.133 22.917  1.00 24.92 ? 62  TYR B OH  1 
ATOM   3076 N  N   . LYS B 2 63  ? 14.879  129.201 30.290  1.00 23.10 ? 63  LYS B N   1 
ATOM   3077 C  CA  . LYS B 2 63  ? 14.996  128.278 31.412  1.00 24.62 ? 63  LYS B CA  1 
ATOM   3078 C  C   . LYS B 2 63  ? 15.067  129.025 32.740  1.00 23.71 ? 63  LYS B C   1 
ATOM   3079 O  O   . LYS B 2 63  ? 15.790  130.012 32.870  1.00 21.31 ? 63  LYS B O   1 
ATOM   3080 C  CB  . LYS B 2 63  ? 16.252  127.412 31.236  1.00 25.41 ? 63  LYS B CB  1 
ATOM   3081 C  CG  . LYS B 2 63  ? 16.531  126.432 32.367  1.00 28.11 ? 63  LYS B CG  1 
ATOM   3082 C  CD  . LYS B 2 63  ? 17.788  125.616 32.068  1.00 29.37 ? 63  LYS B CD  1 
ATOM   3083 C  CE  . LYS B 2 63  ? 18.240  124.793 33.271  1.00 30.31 ? 63  LYS B CE  1 
ATOM   3084 N  NZ  . LYS B 2 63  ? 17.222  123.794 33.707  1.00 30.07 ? 63  LYS B NZ  1 
ATOM   3085 N  N   . PHE B 2 64  ? 14.304  128.546 33.718  1.00 22.95 ? 64  PHE B N   1 
ATOM   3086 C  CA  . PHE B 2 64  ? 14.283  129.140 35.051  1.00 22.71 ? 64  PHE B CA  1 
ATOM   3087 C  C   . PHE B 2 64  ? 14.500  127.975 36.001  1.00 21.79 ? 64  PHE B C   1 
ATOM   3088 O  O   . PHE B 2 64  ? 13.581  127.515 36.683  1.00 20.39 ? 64  PHE B O   1 
ATOM   3089 C  CB  . PHE B 2 64  ? 12.937  129.829 35.294  1.00 24.62 ? 64  PHE B CB  1 
ATOM   3090 C  CG  . PHE B 2 64  ? 12.565  130.802 34.207  1.00 26.41 ? 64  PHE B CG  1 
ATOM   3091 C  CD1 . PHE B 2 64  ? 11.911  130.366 33.057  1.00 26.62 ? 64  PHE B CD1 1 
ATOM   3092 C  CD2 . PHE B 2 64  ? 12.946  132.139 34.294  1.00 27.74 ? 64  PHE B CD2 1 
ATOM   3093 C  CE1 . PHE B 2 64  ? 11.646  131.248 32.003  1.00 26.76 ? 64  PHE B CE1 1 
ATOM   3094 C  CE2 . PHE B 2 64  ? 12.687  133.029 33.245  1.00 28.71 ? 64  PHE B CE2 1 
ATOM   3095 C  CZ  . PHE B 2 64  ? 12.037  132.580 32.097  1.00 27.78 ? 64  PHE B CZ  1 
ATOM   3096 N  N   . ASN B 2 65  ? 15.741  127.506 36.021  1.00 21.08 ? 65  ASN B N   1 
ATOM   3097 C  CA  . ASN B 2 65  ? 16.136  126.354 36.812  1.00 22.70 ? 65  ASN B CA  1 
ATOM   3098 C  C   . ASN B 2 65  ? 15.287  125.170 36.362  1.00 22.21 ? 65  ASN B C   1 
ATOM   3099 O  O   . ASN B 2 65  ? 15.303  124.833 35.180  1.00 24.08 ? 65  ASN B O   1 
ATOM   3100 C  CB  . ASN B 2 65  ? 15.993  126.634 38.314  1.00 22.22 ? 65  ASN B CB  1 
ATOM   3101 C  CG  . ASN B 2 65  ? 17.099  127.542 38.830  1.00 23.90 ? 65  ASN B CG  1 
ATOM   3102 O  OD1 . ASN B 2 65  ? 18.275  127.315 38.544  1.00 24.24 ? 65  ASN B OD1 1 
ATOM   3103 N  ND2 . ASN B 2 65  ? 16.733  128.570 39.584  1.00 22.07 ? 65  ASN B ND2 1 
ATOM   3104 N  N   . HIS B 2 66  ? 14.528  124.555 37.264  1.00 21.57 ? 66  HIS B N   1 
ATOM   3105 C  CA  . HIS B 2 66  ? 13.720  123.399 36.877  1.00 22.34 ? 66  HIS B CA  1 
ATOM   3106 C  C   . HIS B 2 66  ? 12.402  123.776 36.189  1.00 22.45 ? 66  HIS B C   1 
ATOM   3107 O  O   . HIS B 2 66  ? 11.690  122.911 35.677  1.00 22.69 ? 66  HIS B O   1 
ATOM   3108 C  CB  . HIS B 2 66  ? 13.446  122.518 38.102  1.00 22.58 ? 66  HIS B CB  1 
ATOM   3109 C  CG  . HIS B 2 66  ? 12.913  121.160 37.763  1.00 26.85 ? 66  HIS B CG  1 
ATOM   3110 N  ND1 . HIS B 2 66  ? 13.573  120.289 36.923  1.00 28.62 ? 66  HIS B ND1 1 
ATOM   3111 C  CD2 . HIS B 2 66  ? 11.782  120.522 38.151  1.00 27.97 ? 66  HIS B CD2 1 
ATOM   3112 C  CE1 . HIS B 2 66  ? 12.872  119.175 36.805  1.00 28.22 ? 66  HIS B CE1 1 
ATOM   3113 N  NE2 . HIS B 2 66  ? 11.780  119.291 37.540  1.00 29.69 ? 66  HIS B NE2 1 
ATOM   3114 N  N   . LEU B 2 67  ? 12.072  125.063 36.183  1.00 21.54 ? 67  LEU B N   1 
ATOM   3115 C  CA  . LEU B 2 67  ? 10.849  125.516 35.527  1.00 21.41 ? 67  LEU B CA  1 
ATOM   3116 C  C   . LEU B 2 67  ? 11.173  125.852 34.073  1.00 21.16 ? 67  LEU B C   1 
ATOM   3117 O  O   . LEU B 2 67  ? 12.002  126.719 33.801  1.00 20.11 ? 67  LEU B O   1 
ATOM   3118 C  CB  . LEU B 2 67  ? 10.284  126.759 36.226  1.00 19.84 ? 67  LEU B CB  1 
ATOM   3119 C  CG  . LEU B 2 67  ? 9.101   127.442 35.528  1.00 20.21 ? 67  LEU B CG  1 
ATOM   3120 C  CD1 . LEU B 2 67  ? 7.927   126.478 35.444  1.00 21.16 ? 67  LEU B CD1 1 
ATOM   3121 C  CD2 . LEU B 2 67  ? 8.703   128.705 36.287  1.00 19.05 ? 67  LEU B CD2 1 
ATOM   3122 N  N   . VAL B 2 68  ? 10.526  125.158 33.140  1.00 21.59 ? 68  VAL B N   1 
ATOM   3123 C  CA  . VAL B 2 68  ? 10.755  125.404 31.717  1.00 20.58 ? 68  VAL B CA  1 
ATOM   3124 C  C   . VAL B 2 68  ? 9.400   125.569 31.026  1.00 20.62 ? 68  VAL B C   1 
ATOM   3125 O  O   . VAL B 2 68  ? 8.815   124.603 30.536  1.00 22.44 ? 68  VAL B O   1 
ATOM   3126 C  CB  . VAL B 2 68  ? 11.542  124.229 31.080  1.00 21.68 ? 68  VAL B CB  1 
ATOM   3127 C  CG1 . VAL B 2 68  ? 12.038  124.613 29.687  1.00 20.02 ? 68  VAL B CG1 1 
ATOM   3128 C  CG2 . VAL B 2 68  ? 12.719  123.849 31.986  1.00 22.14 ? 68  VAL B CG2 1 
ATOM   3129 N  N   . PRO B 2 69  ? 8.881   126.806 30.981  1.00 21.26 ? 69  PRO B N   1 
ATOM   3130 C  CA  . PRO B 2 69  ? 7.583   127.091 30.352  1.00 21.63 ? 69  PRO B CA  1 
ATOM   3131 C  C   . PRO B 2 69  ? 7.488   126.615 28.903  1.00 21.36 ? 69  PRO B C   1 
ATOM   3132 O  O   . PRO B 2 69  ? 8.479   126.617 28.174  1.00 20.14 ? 69  PRO B O   1 
ATOM   3133 C  CB  . PRO B 2 69  ? 7.467   128.611 30.464  1.00 20.51 ? 69  PRO B CB  1 
ATOM   3134 C  CG  . PRO B 2 69  ? 8.297   128.939 31.677  1.00 21.87 ? 69  PRO B CG  1 
ATOM   3135 C  CD  . PRO B 2 69  ? 9.501   128.045 31.484  1.00 21.71 ? 69  PRO B CD  1 
ATOM   3136 N  N   . ARG B 2 70  ? 6.291   126.209 28.490  1.00 20.75 ? 70  ARG B N   1 
ATOM   3137 C  CA  . ARG B 2 70  ? 6.094   125.740 27.126  1.00 21.08 ? 70  ARG B CA  1 
ATOM   3138 C  C   . ARG B 2 70  ? 6.385   126.849 26.125  1.00 20.84 ? 70  ARG B C   1 
ATOM   3139 O  O   . ARG B 2 70  ? 6.076   128.017 26.369  1.00 20.12 ? 70  ARG B O   1 
ATOM   3140 C  CB  . ARG B 2 70  ? 4.665   125.220 26.939  1.00 22.07 ? 70  ARG B CB  1 
ATOM   3141 C  CG  . ARG B 2 70  ? 4.456   123.827 27.512  1.00 22.59 ? 70  ARG B CG  1 
ATOM   3142 C  CD  . ARG B 2 70  ? 3.054   123.299 27.254  1.00 23.83 ? 70  ARG B CD  1 
ATOM   3143 N  NE  . ARG B 2 70  ? 2.885   121.966 27.824  1.00 24.35 ? 70  ARG B NE  1 
ATOM   3144 C  CZ  . ARG B 2 70  ? 2.891   120.835 27.125  1.00 25.36 ? 70  ARG B CZ  1 
ATOM   3145 N  NH1 . ARG B 2 70  ? 3.052   120.857 25.807  1.00 25.98 ? 70  ARG B NH1 1 
ATOM   3146 N  NH2 . ARG B 2 70  ? 2.744   119.673 27.750  1.00 26.05 ? 70  ARG B NH2 1 
ATOM   3147 N  N   . LEU B 2 71  ? 6.998   126.479 25.005  1.00 20.02 ? 71  LEU B N   1 
ATOM   3148 C  CA  . LEU B 2 71  ? 7.328   127.444 23.962  1.00 20.29 ? 71  LEU B CA  1 
ATOM   3149 C  C   . LEU B 2 71  ? 6.064   127.876 23.226  1.00 19.93 ? 71  LEU B C   1 
ATOM   3150 O  O   . LEU B 2 71  ? 5.130   127.087 23.060  1.00 20.15 ? 71  LEU B O   1 
ATOM   3151 C  CB  . LEU B 2 71  ? 8.326   126.833 22.976  1.00 19.42 ? 71  LEU B CB  1 
ATOM   3152 C  CG  . LEU B 2 71  ? 9.646   126.379 23.602  1.00 18.94 ? 71  LEU B CG  1 
ATOM   3153 C  CD1 . LEU B 2 71  ? 10.534  125.759 22.532  1.00 19.87 ? 71  LEU B CD1 1 
ATOM   3154 C  CD2 . LEU B 2 71  ? 10.338  127.573 24.259  1.00 18.55 ? 71  LEU B CD2 1 
ATOM   3155 N  N   . VAL B 2 72  ? 6.040   129.127 22.785  1.00 20.02 ? 72  VAL B N   1 
ATOM   3156 C  CA  . VAL B 2 72  ? 4.879   129.663 22.084  1.00 20.38 ? 72  VAL B CA  1 
ATOM   3157 C  C   . VAL B 2 72  ? 5.194   130.274 20.723  1.00 21.51 ? 72  VAL B C   1 
ATOM   3158 O  O   . VAL B 2 72  ? 6.078   131.124 20.600  1.00 20.41 ? 72  VAL B O   1 
ATOM   3159 C  CB  . VAL B 2 72  ? 4.178   130.759 22.930  1.00 22.09 ? 72  VAL B CB  1 
ATOM   3160 C  CG1 . VAL B 2 72  ? 2.970   131.311 22.179  1.00 21.74 ? 72  VAL B CG1 1 
ATOM   3161 C  CG2 . VAL B 2 72  ? 3.760   130.193 24.279  1.00 21.67 ? 72  VAL B CG2 1 
ATOM   3162 N  N   . LEU B 2 73  ? 4.467   129.824 19.703  1.00 22.02 ? 73  LEU B N   1 
ATOM   3163 C  CA  . LEU B 2 73  ? 4.604   130.366 18.358  1.00 20.48 ? 73  LEU B CA  1 
ATOM   3164 C  C   . LEU B 2 73  ? 3.694   131.592 18.424  1.00 20.32 ? 73  LEU B C   1 
ATOM   3165 O  O   . LEU B 2 73  ? 2.499   131.459 18.694  1.00 20.30 ? 73  LEU B O   1 
ATOM   3166 C  CB  . LEU B 2 73  ? 4.071   129.377 17.313  1.00 18.50 ? 73  LEU B CB  1 
ATOM   3167 C  CG  . LEU B 2 73  ? 4.006   129.892 15.866  1.00 19.17 ? 73  LEU B CG  1 
ATOM   3168 C  CD1 . LEU B 2 73  ? 5.409   130.132 15.332  1.00 18.28 ? 73  LEU B CD1 1 
ATOM   3169 C  CD2 . LEU B 2 73  ? 3.281   128.885 14.995  1.00 19.37 ? 73  LEU B CD2 1 
ATOM   3170 N  N   . GLN B 2 74  ? 4.255   132.776 18.197  1.00 19.22 ? 74  GLN B N   1 
ATOM   3171 C  CA  . GLN B 2 74  ? 3.480   134.011 18.273  1.00 22.21 ? 74  GLN B CA  1 
ATOM   3172 C  C   . GLN B 2 74  ? 2.593   134.239 17.053  1.00 22.22 ? 74  GLN B C   1 
ATOM   3173 O  O   . GLN B 2 74  ? 2.773   135.205 16.305  1.00 21.43 ? 74  GLN B O   1 
ATOM   3174 C  CB  . GLN B 2 74  ? 4.421   135.201 18.467  1.00 23.09 ? 74  GLN B CB  1 
ATOM   3175 C  CG  . GLN B 2 74  ? 5.272   135.129 19.733  1.00 25.42 ? 74  GLN B CG  1 
ATOM   3176 C  CD  . GLN B 2 74  ? 4.441   135.043 21.006  1.00 30.93 ? 74  GLN B CD  1 
ATOM   3177 O  OE1 . GLN B 2 74  ? 3.374   135.651 21.111  1.00 32.18 ? 74  GLN B OE1 1 
ATOM   3178 N  NE2 . GLN B 2 74  ? 4.938   134.299 21.987  1.00 31.85 ? 74  GLN B NE2 1 
ATOM   3179 N  N   . ARG B 2 75  ? 1.626   133.343 16.880  1.00 21.79 ? 75  ARG B N   1 
ATOM   3180 C  CA  . ARG B 2 75  ? 0.674   133.373 15.771  1.00 24.41 ? 75  ARG B CA  1 
ATOM   3181 C  C   . ARG B 2 75  ? 0.108   134.727 15.378  1.00 24.34 ? 75  ARG B C   1 
ATOM   3182 O  O   . ARG B 2 75  ? 0.229   135.144 14.225  1.00 23.19 ? 75  ARG B O   1 
ATOM   3183 C  CB  . ARG B 2 75  ? -0.506  132.456 16.076  1.00 25.06 ? 75  ARG B CB  1 
ATOM   3184 C  CG  . ARG B 2 75  ? -0.155  131.003 16.099  1.00 30.30 ? 75  ARG B CG  1 
ATOM   3185 C  CD  . ARG B 2 75  ? -1.306  130.177 16.638  1.00 31.27 ? 75  ARG B CD  1 
ATOM   3186 N  NE  . ARG B 2 75  ? -1.185  128.805 16.175  1.00 30.22 ? 75  ARG B NE  1 
ATOM   3187 C  CZ  . ARG B 2 75  ? -1.439  128.428 14.931  1.00 27.64 ? 75  ARG B CZ  1 
ATOM   3188 N  NH1 . ARG B 2 75  ? -1.840  129.323 14.040  1.00 26.74 ? 75  ARG B NH1 1 
ATOM   3189 N  NH2 . ARG B 2 75  ? -1.269  127.165 14.576  1.00 28.26 ? 75  ARG B NH2 1 
ATOM   3190 N  N   . GLU B 2 76  ? -0.539  135.397 16.326  1.00 24.93 ? 76  GLU B N   1 
ATOM   3191 C  CA  . GLU B 2 76  ? -1.154  136.687 16.037  1.00 27.52 ? 76  GLU B CA  1 
ATOM   3192 C  C   . GLU B 2 76  ? -0.195  137.766 15.563  1.00 24.78 ? 76  GLU B C   1 
ATOM   3193 O  O   . GLU B 2 76  ? -0.541  138.559 14.687  1.00 25.03 ? 76  GLU B O   1 
ATOM   3194 C  CB  . GLU B 2 76  ? -1.951  137.178 17.245  1.00 30.22 ? 76  GLU B CB  1 
ATOM   3195 C  CG  . GLU B 2 76  ? -3.206  136.355 17.503  1.00 40.69 ? 76  GLU B CG  1 
ATOM   3196 C  CD  . GLU B 2 76  ? -3.993  136.060 16.226  1.00 46.14 ? 76  GLU B CD  1 
ATOM   3197 O  OE1 . GLU B 2 76  ? -3.561  135.189 15.435  1.00 47.33 ? 76  GLU B OE1 1 
ATOM   3198 O  OE2 . GLU B 2 76  ? -5.042  136.707 16.007  1.00 50.60 ? 76  GLU B OE2 1 
ATOM   3199 N  N   . LYS B 2 77  ? 1.005   137.806 16.133  1.00 24.76 ? 77  LYS B N   1 
ATOM   3200 C  CA  . LYS B 2 77  ? 1.986   138.800 15.712  1.00 23.05 ? 77  LYS B CA  1 
ATOM   3201 C  C   . LYS B 2 77  ? 2.400   138.501 14.272  1.00 23.11 ? 77  LYS B C   1 
ATOM   3202 O  O   . LYS B 2 77  ? 2.521   139.407 13.448  1.00 21.37 ? 77  LYS B O   1 
ATOM   3203 C  CB  . LYS B 2 77  ? 3.225   138.759 16.605  1.00 27.54 ? 77  LYS B CB  1 
ATOM   3204 C  CG  . LYS B 2 77  ? 2.976   139.045 18.076  1.00 31.90 ? 77  LYS B CG  1 
ATOM   3205 C  CD  . LYS B 2 77  ? 4.291   138.922 18.833  1.00 37.78 ? 77  LYS B CD  1 
ATOM   3206 C  CE  . LYS B 2 77  ? 4.121   139.059 20.336  1.00 41.70 ? 77  LYS B CE  1 
ATOM   3207 N  NZ  . LYS B 2 77  ? 5.441   138.897 21.014  1.00 42.10 ? 77  LYS B NZ  1 
ATOM   3208 N  N   . HIS B 2 78  ? 2.623   137.225 13.973  1.00 20.98 ? 78  HIS B N   1 
ATOM   3209 C  CA  . HIS B 2 78  ? 3.016   136.843 12.623  1.00 20.93 ? 78  HIS B CA  1 
ATOM   3210 C  C   . HIS B 2 78  ? 1.883   137.153 11.654  1.00 21.06 ? 78  HIS B C   1 
ATOM   3211 O  O   . HIS B 2 78  ? 2.122   137.646 10.554  1.00 20.74 ? 78  HIS B O   1 
ATOM   3212 C  CB  . HIS B 2 78  ? 3.370   135.353 12.567  1.00 19.81 ? 78  HIS B CB  1 
ATOM   3213 C  CG  . HIS B 2 78  ? 4.483   134.969 13.492  1.00 17.76 ? 78  HIS B CG  1 
ATOM   3214 N  ND1 . HIS B 2 78  ? 5.608   135.745 13.658  1.00 18.69 ? 78  HIS B ND1 1 
ATOM   3215 C  CD2 . HIS B 2 78  ? 4.644   133.893 14.297  1.00 18.49 ? 78  HIS B CD2 1 
ATOM   3216 C  CE1 . HIS B 2 78  ? 6.417   135.165 14.528  1.00 18.93 ? 78  HIS B CE1 1 
ATOM   3217 N  NE2 . HIS B 2 78  ? 5.855   134.038 14.930  1.00 17.92 ? 78  HIS B NE2 1 
ATOM   3218 N  N   . PHE B 2 79  ? 0.651   136.868 12.071  1.00 21.00 ? 79  PHE B N   1 
ATOM   3219 C  CA  . PHE B 2 79  ? -0.516  137.128 11.240  1.00 21.97 ? 79  PHE B CA  1 
ATOM   3220 C  C   . PHE B 2 79  ? -0.637  138.604 10.854  1.00 21.49 ? 79  PHE B C   1 
ATOM   3221 O  O   . PHE B 2 79  ? -0.874  138.928 9.691   1.00 22.73 ? 79  PHE B O   1 
ATOM   3222 C  CB  . PHE B 2 79  ? -1.791  136.679 11.964  1.00 22.81 ? 79  PHE B CB  1 
ATOM   3223 C  CG  . PHE B 2 79  ? -3.058  137.130 11.293  1.00 24.61 ? 79  PHE B CG  1 
ATOM   3224 C  CD1 . PHE B 2 79  ? -3.338  136.761 9.982   1.00 26.77 ? 79  PHE B CD1 1 
ATOM   3225 C  CD2 . PHE B 2 79  ? -3.962  137.943 11.965  1.00 27.75 ? 79  PHE B CD2 1 
ATOM   3226 C  CE1 . PHE B 2 79  ? -4.499  137.196 9.345   1.00 26.44 ? 79  PHE B CE1 1 
ATOM   3227 C  CE2 . PHE B 2 79  ? -5.129  138.387 11.338  1.00 28.64 ? 79  PHE B CE2 1 
ATOM   3228 C  CZ  . PHE B 2 79  ? -5.396  138.012 10.025  1.00 28.86 ? 79  PHE B CZ  1 
ATOM   3229 N  N   . HIS B 2 80  ? -0.475  139.499 11.824  1.00 22.57 ? 80  HIS B N   1 
ATOM   3230 C  CA  . HIS B 2 80  ? -0.585  140.931 11.548  1.00 24.33 ? 80  HIS B CA  1 
ATOM   3231 C  C   . HIS B 2 80  ? 0.512   141.440 10.617  1.00 23.22 ? 80  HIS B C   1 
ATOM   3232 O  O   . HIS B 2 80  ? 0.265   142.297 9.766   1.00 20.35 ? 80  HIS B O   1 
ATOM   3233 C  CB  . HIS B 2 80  ? -0.592  141.722 12.857  1.00 28.24 ? 80  HIS B CB  1 
ATOM   3234 C  CG  . HIS B 2 80  ? -1.844  141.533 13.655  1.00 33.84 ? 80  HIS B CG  1 
ATOM   3235 N  ND1 . HIS B 2 80  ? -3.097  141.796 13.141  1.00 36.24 ? 80  HIS B ND1 1 
ATOM   3236 C  CD2 . HIS B 2 80  ? -2.044  141.064 14.910  1.00 36.16 ? 80  HIS B CD2 1 
ATOM   3237 C  CE1 . HIS B 2 80  ? -4.014  141.491 14.043  1.00 36.72 ? 80  HIS B CE1 1 
ATOM   3238 N  NE2 . HIS B 2 80  ? -3.401  141.045 15.125  1.00 36.74 ? 80  HIS B NE2 1 
ATOM   3239 N  N   . TYR B 2 81  ? 1.717   140.901 10.775  1.00 21.53 ? 81  TYR B N   1 
ATOM   3240 C  CA  . TYR B 2 81  ? 2.855   141.267 9.935   1.00 19.75 ? 81  TYR B CA  1 
ATOM   3241 C  C   . TYR B 2 81  ? 2.569   140.834 8.489   1.00 19.78 ? 81  TYR B C   1 
ATOM   3242 O  O   . TYR B 2 81  ? 2.752   141.605 7.543   1.00 19.87 ? 81  TYR B O   1 
ATOM   3243 C  CB  . TYR B 2 81  ? 4.115   140.577 10.480  1.00 18.35 ? 81  TYR B CB  1 
ATOM   3244 C  CG  . TYR B 2 81  ? 5.329   140.581 9.569   1.00 20.45 ? 81  TYR B CG  1 
ATOM   3245 C  CD1 . TYR B 2 81  ? 5.924   141.776 9.156   1.00 19.72 ? 81  TYR B CD1 1 
ATOM   3246 C  CD2 . TYR B 2 81  ? 5.912   139.381 9.159   1.00 17.99 ? 81  TYR B CD2 1 
ATOM   3247 C  CE1 . TYR B 2 81  ? 7.075   141.772 8.359   1.00 20.46 ? 81  TYR B CE1 1 
ATOM   3248 C  CE2 . TYR B 2 81  ? 7.059   139.365 8.365   1.00 19.67 ? 81  TYR B CE2 1 
ATOM   3249 C  CZ  . TYR B 2 81  ? 7.636   140.560 7.969   1.00 20.96 ? 81  TYR B CZ  1 
ATOM   3250 O  OH  . TYR B 2 81  ? 8.773   140.533 7.191   1.00 19.91 ? 81  TYR B OH  1 
ATOM   3251 N  N   . LEU B 2 82  ? 2.091   139.603 8.333   1.00 20.21 ? 82  LEU B N   1 
ATOM   3252 C  CA  . LEU B 2 82  ? 1.769   139.047 7.020   1.00 20.87 ? 82  LEU B CA  1 
ATOM   3253 C  C   . LEU B 2 82  ? 0.609   139.788 6.348   1.00 23.19 ? 82  LEU B C   1 
ATOM   3254 O  O   . LEU B 2 82  ? 0.685   140.157 5.170   1.00 23.47 ? 82  LEU B O   1 
ATOM   3255 C  CB  . LEU B 2 82  ? 1.408   137.564 7.161   1.00 19.71 ? 82  LEU B CB  1 
ATOM   3256 C  CG  . LEU B 2 82  ? 2.541   136.633 7.610   1.00 20.53 ? 82  LEU B CG  1 
ATOM   3257 C  CD1 . LEU B 2 82  ? 1.961   135.344 8.180   1.00 18.83 ? 82  LEU B CD1 1 
ATOM   3258 C  CD2 . LEU B 2 82  ? 3.468   136.353 6.421   1.00 19.87 ? 82  LEU B CD2 1 
ATOM   3259 N  N   . LYS B 2 83  ? -0.465  139.999 7.101   1.00 23.63 ? 83  LYS B N   1 
ATOM   3260 C  CA  . LYS B 2 83  ? -1.644  140.682 6.579   1.00 26.23 ? 83  LYS B CA  1 
ATOM   3261 C  C   . LYS B 2 83  ? -1.291  142.051 6.006   1.00 25.82 ? 83  LYS B C   1 
ATOM   3262 O  O   . LYS B 2 83  ? -1.802  142.452 4.961   1.00 24.10 ? 83  LYS B O   1 
ATOM   3263 C  CB  . LYS B 2 83  ? -2.688  140.841 7.685   1.00 27.81 ? 83  LYS B CB  1 
ATOM   3264 C  CG  . LYS B 2 83  ? -3.949  141.554 7.237   1.00 33.03 ? 83  LYS B CG  1 
ATOM   3265 C  CD  . LYS B 2 83  ? -4.910  141.774 8.395   1.00 36.17 ? 83  LYS B CD  1 
ATOM   3266 C  CE  . LYS B 2 83  ? -6.102  142.612 7.957   1.00 37.25 ? 83  LYS B CE  1 
ATOM   3267 N  NZ  . LYS B 2 83  ? -7.024  142.879 9.092   1.00 40.58 ? 83  LYS B NZ  1 
ATOM   3268 N  N   . ARG B 2 84  ? -0.412  142.761 6.700   1.00 26.27 ? 84  ARG B N   1 
ATOM   3269 C  CA  . ARG B 2 84  ? 0.023   144.083 6.276   1.00 28.48 ? 84  ARG B CA  1 
ATOM   3270 C  C   . ARG B 2 84  ? 0.871   144.018 5.002   1.00 28.49 ? 84  ARG B C   1 
ATOM   3271 O  O   . ARG B 2 84  ? 0.669   144.801 4.068   1.00 26.99 ? 84  ARG B O   1 
ATOM   3272 C  CB  . ARG B 2 84  ? 0.811   144.745 7.412   1.00 31.93 ? 84  ARG B CB  1 
ATOM   3273 C  CG  . ARG B 2 84  ? 1.463   146.073 7.062   1.00 39.97 ? 84  ARG B CG  1 
ATOM   3274 C  CD  . ARG B 2 84  ? 0.447   147.098 6.576   1.00 45.68 ? 84  ARG B CD  1 
ATOM   3275 N  NE  . ARG B 2 84  ? 1.070   148.385 6.274   1.00 50.08 ? 84  ARG B NE  1 
ATOM   3276 C  CZ  . ARG B 2 84  ? 0.467   149.376 5.623   1.00 53.84 ? 84  ARG B CZ  1 
ATOM   3277 N  NH1 . ARG B 2 84  ? -0.783  149.234 5.197   1.00 55.40 ? 84  ARG B NH1 1 
ATOM   3278 N  NH2 . ARG B 2 84  ? 1.112   150.514 5.398   1.00 54.55 ? 84  ARG B NH2 1 
ATOM   3279 N  N   . GLY B 2 85  ? 1.803   143.070 4.955   1.00 25.96 ? 85  GLY B N   1 
ATOM   3280 C  CA  . GLY B 2 85  ? 2.666   142.948 3.792   1.00 25.77 ? 85  GLY B CA  1 
ATOM   3281 C  C   . GLY B 2 85  ? 1.976   142.560 2.495   1.00 25.42 ? 85  GLY B C   1 
ATOM   3282 O  O   . GLY B 2 85  ? 2.426   142.928 1.409   1.00 23.84 ? 85  GLY B O   1 
ATOM   3283 N  N   . LEU B 2 86  ? 0.880   141.822 2.603   1.00 25.57 ? 86  LEU B N   1 
ATOM   3284 C  CA  . LEU B 2 86  ? 0.147   141.368 1.429   1.00 26.77 ? 86  LEU B CA  1 
ATOM   3285 C  C   . LEU B 2 86  ? -0.478  142.543 0.686   1.00 28.47 ? 86  LEU B C   1 
ATOM   3286 O  O   . LEU B 2 86  ? -0.820  142.445 -0.495  1.00 27.72 ? 86  LEU B O   1 
ATOM   3287 C  CB  . LEU B 2 86  ? -0.941  140.373 1.853   1.00 25.56 ? 86  LEU B CB  1 
ATOM   3288 C  CG  . LEU B 2 86  ? -1.685  139.617 0.749   1.00 27.79 ? 86  LEU B CG  1 
ATOM   3289 C  CD1 . LEU B 2 86  ? -0.695  138.851 -0.123  1.00 26.91 ? 86  LEU B CD1 1 
ATOM   3290 C  CD2 . LEU B 2 86  ? -2.694  138.669 1.373   1.00 25.78 ? 86  LEU B CD2 1 
ATOM   3291 N  N   . ARG B 2 87  ? -0.603  143.667 1.376   1.00 30.18 ? 87  ARG B N   1 
ATOM   3292 C  CA  . ARG B 2 87  ? -1.212  144.836 0.776   1.00 32.66 ? 87  ARG B CA  1 
ATOM   3293 C  C   . ARG B 2 87  ? -0.211  145.895 0.333   1.00 33.92 ? 87  ARG B C   1 
ATOM   3294 O  O   . ARG B 2 87  ? -0.143  146.244 -0.843  1.00 32.96 ? 87  ARG B O   1 
ATOM   3295 C  CB  . ARG B 2 87  ? -2.203  145.456 1.764   1.00 35.72 ? 87  ARG B CB  1 
ATOM   3296 C  CG  . ARG B 2 87  ? -3.437  146.055 1.121   1.00 38.69 ? 87  ARG B CG  1 
ATOM   3297 C  CD  . ARG B 2 87  ? -4.438  144.978 0.715   1.00 40.47 ? 87  ARG B CD  1 
ATOM   3298 N  NE  . ARG B 2 87  ? -4.758  145.060 -0.704  1.00 41.78 ? 87  ARG B NE  1 
ATOM   3299 C  CZ  . ARG B 2 87  ? -5.773  144.431 -1.290  1.00 40.79 ? 87  ARG B CZ  1 
ATOM   3300 N  NH1 . ARG B 2 87  ? -6.589  143.661 -0.582  1.00 39.30 ? 87  ARG B NH1 1 
ATOM   3301 N  NH2 . ARG B 2 87  ? -5.966  144.574 -2.591  1.00 38.54 ? 87  ARG B NH2 1 
ATOM   3302 N  N   . GLN B 2 88  ? 0.581   146.394 1.274   1.00 36.51 ? 88  GLN B N   1 
ATOM   3303 C  CA  . GLN B 2 88  ? 1.528   147.456 0.963   1.00 38.26 ? 88  GLN B CA  1 
ATOM   3304 C  C   . GLN B 2 88  ? 2.906   147.253 1.584   1.00 37.73 ? 88  GLN B C   1 
ATOM   3305 O  O   . GLN B 2 88  ? 3.050   146.564 2.597   1.00 38.33 ? 88  GLN B O   1 
ATOM   3306 C  CB  . GLN B 2 88  ? 0.938   148.780 1.441   1.00 40.45 ? 88  GLN B CB  1 
ATOM   3307 C  CG  . GLN B 2 88  ? 1.388   149.993 0.673   1.00 45.98 ? 88  GLN B CG  1 
ATOM   3308 C  CD  . GLN B 2 88  ? 0.659   151.244 1.119   1.00 49.22 ? 88  GLN B CD  1 
ATOM   3309 O  OE1 . GLN B 2 88  ? 0.805   151.686 2.261   1.00 52.09 ? 88  GLN B OE1 1 
ATOM   3310 N  NE2 . GLN B 2 88  ? -0.138  151.819 0.223   1.00 50.55 ? 88  GLN B NE2 1 
ATOM   3311 N  N   . LEU B 2 89  ? 3.914   147.870 0.971   1.00 35.03 ? 89  LEU B N   1 
ATOM   3312 C  CA  . LEU B 2 89  ? 5.293   147.776 1.442   1.00 33.01 ? 89  LEU B CA  1 
ATOM   3313 C  C   . LEU B 2 89  ? 5.997   149.115 1.218   1.00 32.56 ? 89  LEU B C   1 
ATOM   3314 O  O   . LEU B 2 89  ? 5.664   149.842 0.284   1.00 32.26 ? 89  LEU B O   1 
ATOM   3315 C  CB  . LEU B 2 89  ? 6.029   146.670 0.680   1.00 31.15 ? 89  LEU B CB  1 
ATOM   3316 C  CG  . LEU B 2 89  ? 5.391   145.280 0.745   1.00 31.80 ? 89  LEU B CG  1 
ATOM   3317 C  CD1 . LEU B 2 89  ? 6.067   144.347 -0.250  1.00 31.22 ? 89  LEU B CD1 1 
ATOM   3318 C  CD2 . LEU B 2 89  ? 5.503   144.739 2.161   1.00 30.93 ? 89  LEU B CD2 1 
ATOM   3319 N  N   . THR B 2 90  ? 6.967   149.438 2.071   1.00 33.35 ? 90  THR B N   1 
ATOM   3320 C  CA  . THR B 2 90  ? 7.702   150.698 1.940   1.00 34.74 ? 90  THR B CA  1 
ATOM   3321 C  C   . THR B 2 90  ? 8.766   150.583 0.852   1.00 36.10 ? 90  THR B C   1 
ATOM   3322 O  O   . THR B 2 90  ? 9.029   149.487 0.348   1.00 35.01 ? 90  THR B O   1 
ATOM   3323 C  CB  . THR B 2 90  ? 8.407   151.078 3.250   1.00 35.47 ? 90  THR B CB  1 
ATOM   3324 O  OG1 . THR B 2 90  ? 9.438   150.123 3.528   1.00 35.89 ? 90  THR B OG1 1 
ATOM   3325 C  CG2 . THR B 2 90  ? 7.411   151.101 4.402   1.00 36.57 ? 90  THR B CG2 1 
ATOM   3326 N  N   . ASP B 2 91  ? 9.385   151.708 0.498   1.00 35.56 ? 91  ASP B N   1 
ATOM   3327 C  CA  . ASP B 2 91  ? 10.410  151.697 -0.537  1.00 36.80 ? 91  ASP B CA  1 
ATOM   3328 C  C   . ASP B 2 91  ? 11.615  150.854 -0.140  1.00 35.70 ? 91  ASP B C   1 
ATOM   3329 O  O   . ASP B 2 91  ? 12.550  150.688 -0.921  1.00 37.20 ? 91  ASP B O   1 
ATOM   3330 C  CB  . ASP B 2 91  ? 10.855  153.123 -0.894  1.00 38.85 ? 91  ASP B CB  1 
ATOM   3331 C  CG  . ASP B 2 91  ? 11.413  153.888 0.292   1.00 40.66 ? 91  ASP B CG  1 
ATOM   3332 O  OD1 . ASP B 2 91  ? 11.659  153.276 1.352   1.00 40.62 ? 91  ASP B OD1 1 
ATOM   3333 O  OD2 . ASP B 2 91  ? 11.617  155.114 0.151   1.00 42.67 ? 91  ASP B OD2 1 
ATOM   3334 N  N   . ALA B 2 92  ? 11.591  150.317 1.074   1.00 34.59 ? 92  ALA B N   1 
ATOM   3335 C  CA  . ALA B 2 92  ? 12.679  149.468 1.539   1.00 33.89 ? 92  ALA B CA  1 
ATOM   3336 C  C   . ALA B 2 92  ? 12.608  148.159 0.756   1.00 33.46 ? 92  ALA B C   1 
ATOM   3337 O  O   . ALA B 2 92  ? 13.562  147.383 0.728   1.00 32.84 ? 92  ALA B O   1 
ATOM   3338 C  CB  . ALA B 2 92  ? 12.536  149.196 3.032   1.00 33.57 ? 92  ALA B CB  1 
ATOM   3339 N  N   . TYR B 2 93  ? 11.465  147.924 0.118   1.00 32.77 ? 93  TYR B N   1 
ATOM   3340 C  CA  . TYR B 2 93  ? 11.265  146.715 -0.669  1.00 32.18 ? 93  TYR B CA  1 
ATOM   3341 C  C   . TYR B 2 93  ? 11.526  146.904 -2.160  1.00 30.46 ? 93  TYR B C   1 
ATOM   3342 O  O   . TYR B 2 93  ? 11.187  146.042 -2.975  1.00 28.65 ? 93  TYR B O   1 
ATOM   3343 C  CB  . TYR B 2 93  ? 9.851   146.171 -0.449  1.00 35.66 ? 93  TYR B CB  1 
ATOM   3344 C  CG  . TYR B 2 93  ? 9.773   145.235 0.734   1.00 40.32 ? 93  TYR B CG  1 
ATOM   3345 C  CD1 . TYR B 2 93  ? 9.662   145.720 2.039   1.00 42.50 ? 93  TYR B CD1 1 
ATOM   3346 C  CD2 . TYR B 2 93  ? 9.906   143.861 0.552   1.00 43.20 ? 93  TYR B CD2 1 
ATOM   3347 C  CE1 . TYR B 2 93  ? 9.696   144.848 3.135   1.00 43.88 ? 93  TYR B CE1 1 
ATOM   3348 C  CE2 . TYR B 2 93  ? 9.944   142.989 1.632   1.00 44.98 ? 93  TYR B CE2 1 
ATOM   3349 C  CZ  . TYR B 2 93  ? 9.842   143.485 2.918   1.00 44.52 ? 93  TYR B CZ  1 
ATOM   3350 O  OH  . TYR B 2 93  ? 9.921   142.602 3.972   1.00 48.49 ? 93  TYR B OH  1 
ATOM   3351 N  N   . GLU B 2 94  ? 12.137  148.027 -2.519  1.00 27.73 ? 94  GLU B N   1 
ATOM   3352 C  CA  . GLU B 2 94  ? 12.439  148.290 -3.918  1.00 27.05 ? 94  GLU B CA  1 
ATOM   3353 C  C   . GLU B 2 94  ? 13.329  147.198 -4.503  1.00 25.05 ? 94  GLU B C   1 
ATOM   3354 O  O   . GLU B 2 94  ? 13.231  146.881 -5.687  1.00 25.15 ? 94  GLU B O   1 
ATOM   3355 C  CB  . GLU B 2 94  ? 13.109  149.661 -4.071  1.00 27.10 ? 94  GLU B CB  1 
ATOM   3356 C  CG  . GLU B 2 94  ? 12.122  150.822 -3.986  1.00 28.05 ? 94  GLU B CG  1 
ATOM   3357 C  CD  . GLU B 2 94  ? 12.788  152.188 -4.089  1.00 29.32 ? 94  GLU B CD  1 
ATOM   3358 O  OE1 . GLU B 2 94  ? 12.052  153.191 -4.220  1.00 29.65 ? 94  GLU B OE1 1 
ATOM   3359 O  OE2 . GLU B 2 94  ? 14.036  152.261 -4.033  1.00 27.09 ? 94  GLU B OE2 1 
ATOM   3360 N  N   . CYS B 2 95  ? 14.186  146.617 -3.669  1.00 25.64 ? 95  CYS B N   1 
ATOM   3361 C  CA  . CYS B 2 95  ? 15.092  145.555 -4.106  1.00 25.94 ? 95  CYS B CA  1 
ATOM   3362 C  C   . CYS B 2 95  ? 14.358  144.269 -4.496  1.00 24.36 ? 95  CYS B C   1 
ATOM   3363 O  O   . CYS B 2 95  ? 14.958  143.356 -5.067  1.00 24.56 ? 95  CYS B O   1 
ATOM   3364 C  CB  . CYS B 2 95  ? 16.118  145.256 -3.006  1.00 27.41 ? 95  CYS B CB  1 
ATOM   3365 S  SG  . CYS B 2 95  ? 15.384  144.862 -1.397  1.00 32.58 ? 95  CYS B SG  1 
ATOM   3366 N  N   . LEU B 2 96  ? 13.065  144.199 -4.191  1.00 22.70 ? 96  LEU B N   1 
ATOM   3367 C  CA  . LEU B 2 96  ? 12.257  143.028 -4.530  1.00 21.85 ? 96  LEU B CA  1 
ATOM   3368 C  C   . LEU B 2 96  ? 11.221  143.363 -5.602  1.00 21.31 ? 96  LEU B C   1 
ATOM   3369 O  O   . LEU B 2 96  ? 10.254  142.624 -5.793  1.00 20.40 ? 96  LEU B O   1 
ATOM   3370 C  CB  . LEU B 2 96  ? 11.542  142.491 -3.284  1.00 23.02 ? 96  LEU B CB  1 
ATOM   3371 C  CG  . LEU B 2 96  ? 12.439  141.997 -2.142  1.00 25.28 ? 96  LEU B CG  1 
ATOM   3372 C  CD1 . LEU B 2 96  ? 11.576  141.399 -1.042  1.00 27.55 ? 96  LEU B CD1 1 
ATOM   3373 C  CD2 . LEU B 2 96  ? 13.421  140.962 -2.661  1.00 24.31 ? 96  LEU B CD2 1 
ATOM   3374 N  N   . ASP B 2 97  ? 11.431  144.471 -6.308  1.00 20.89 ? 97  ASP B N   1 
ATOM   3375 C  CA  . ASP B 2 97  ? 10.500  144.903 -7.351  1.00 21.96 ? 97  ASP B CA  1 
ATOM   3376 C  C   . ASP B 2 97  ? 10.405  143.900 -8.503  1.00 21.49 ? 97  ASP B C   1 
ATOM   3377 O  O   . ASP B 2 97  ? 9.461   143.935 -9.294  1.00 21.44 ? 97  ASP B O   1 
ATOM   3378 C  CB  . ASP B 2 97  ? 10.907  146.286 -7.877  1.00 22.23 ? 97  ASP B CB  1 
ATOM   3379 C  CG  . ASP B 2 97  ? 9.900   146.859 -8.857  1.00 22.77 ? 97  ASP B CG  1 
ATOM   3380 O  OD1 . ASP B 2 97  ? 8.691   146.854 -8.546  1.00 23.90 ? 97  ASP B OD1 1 
ATOM   3381 O  OD2 . ASP B 2 97  ? 10.318  147.321 -9.940  1.00 25.00 ? 97  ASP B OD2 1 
ATOM   3382 N  N   . ALA B 2 98  ? 11.383  143.003 -8.590  1.00 21.76 ? 98  ALA B N   1 
ATOM   3383 C  CA  . ALA B 2 98  ? 11.391  141.983 -9.631  1.00 20.81 ? 98  ALA B CA  1 
ATOM   3384 C  C   . ALA B 2 98  ? 11.099  140.608 -9.023  1.00 21.04 ? 98  ALA B C   1 
ATOM   3385 O  O   . ALA B 2 98  ? 11.424  139.579 -9.613  1.00 20.05 ? 98  ALA B O   1 
ATOM   3386 C  CB  . ALA B 2 98  ? 12.741  141.967 -10.342 1.00 18.48 ? 98  ALA B CB  1 
ATOM   3387 N  N   . SER B 2 99  ? 10.487  140.598 -7.844  1.00 20.60 ? 99  SER B N   1 
ATOM   3388 C  CA  . SER B 2 99  ? 10.151  139.345 -7.159  1.00 21.54 ? 99  SER B CA  1 
ATOM   3389 C  C   . SER B 2 99  ? 8.811   139.436 -6.438  1.00 20.76 ? 99  SER B C   1 
ATOM   3390 O  O   . SER B 2 99  ? 8.616   138.808 -5.398  1.00 20.35 ? 99  SER B O   1 
ATOM   3391 C  CB  . SER B 2 99  ? 11.231  138.994 -6.129  1.00 22.47 ? 99  SER B CB  1 
ATOM   3392 O  OG  . SER B 2 99  ? 12.444  138.625 -6.758  1.00 27.92 ? 99  SER B OG  1 
ATOM   3393 N  N   . ARG B 2 100 ? 7.880   140.204 -6.987  1.00 18.44 ? 100 ARG B N   1 
ATOM   3394 C  CA  . ARG B 2 100 ? 6.597   140.363 -6.322  1.00 19.18 ? 100 ARG B CA  1 
ATOM   3395 C  C   . ARG B 2 100 ? 5.760   139.086 -6.222  1.00 18.83 ? 100 ARG B C   1 
ATOM   3396 O  O   . ARG B 2 100 ? 5.066   138.879 -5.224  1.00 19.84 ? 100 ARG B O   1 
ATOM   3397 C  CB  . ARG B 2 100 ? 5.842   141.535 -6.956  1.00 17.48 ? 100 ARG B CB  1 
ATOM   3398 C  CG  . ARG B 2 100 ? 6.586   142.856 -6.678  1.00 19.60 ? 100 ARG B CG  1 
ATOM   3399 C  CD  . ARG B 2 100 ? 5.960   144.067 -7.340  1.00 20.67 ? 100 ARG B CD  1 
ATOM   3400 N  NE  . ARG B 2 100 ? 4.622   144.353 -6.837  1.00 22.13 ? 100 ARG B NE  1 
ATOM   3401 C  CZ  . ARG B 2 100 ? 3.752   145.133 -7.467  1.00 22.72 ? 100 ARG B CZ  1 
ATOM   3402 N  NH1 . ARG B 2 100 ? 4.093   145.699 -8.622  1.00 20.11 ? 100 ARG B NH1 1 
ATOM   3403 N  NH2 . ARG B 2 100 ? 2.547   145.345 -6.950  1.00 20.64 ? 100 ARG B NH2 1 
ATOM   3404 N  N   . PRO B 2 101 ? 5.806   138.211 -7.242  1.00 19.07 ? 101 PRO B N   1 
ATOM   3405 C  CA  . PRO B 2 101 ? 5.003   136.994 -7.088  1.00 18.26 ? 101 PRO B CA  1 
ATOM   3406 C  C   . PRO B 2 101 ? 5.558   136.176 -5.908  1.00 18.56 ? 101 PRO B C   1 
ATOM   3407 O  O   . PRO B 2 101 ? 4.821   135.448 -5.248  1.00 16.51 ? 101 PRO B O   1 
ATOM   3408 C  CB  . PRO B 2 101 ? 5.183   136.294 -8.431  1.00 19.02 ? 101 PRO B CB  1 
ATOM   3409 C  CG  . PRO B 2 101 ? 5.275   137.459 -9.384  1.00 18.44 ? 101 PRO B CG  1 
ATOM   3410 C  CD  . PRO B 2 101 ? 6.234   138.379 -8.644  1.00 19.39 ? 101 PRO B CD  1 
ATOM   3411 N  N   . TRP B 2 102 ? 6.863   136.296 -5.657  1.00 18.04 ? 102 TRP B N   1 
ATOM   3412 C  CA  . TRP B 2 102 ? 7.491   135.597 -4.532  1.00 18.34 ? 102 TRP B CA  1 
ATOM   3413 C  C   . TRP B 2 102 ? 6.840   136.084 -3.237  1.00 18.96 ? 102 TRP B C   1 
ATOM   3414 O  O   . TRP B 2 102 ? 6.553   135.294 -2.334  1.00 20.38 ? 102 TRP B O   1 
ATOM   3415 C  CB  . TRP B 2 102 ? 8.994   135.902 -4.460  1.00 16.66 ? 102 TRP B CB  1 
ATOM   3416 C  CG  . TRP B 2 102 ? 9.891   134.949 -5.200  1.00 18.53 ? 102 TRP B CG  1 
ATOM   3417 C  CD1 . TRP B 2 102 ? 10.811  135.270 -6.161  1.00 17.74 ? 102 TRP B CD1 1 
ATOM   3418 C  CD2 . TRP B 2 102 ? 10.008  133.533 -4.992  1.00 18.34 ? 102 TRP B CD2 1 
ATOM   3419 N  NE1 . TRP B 2 102 ? 11.494  134.145 -6.560  1.00 18.91 ? 102 TRP B NE1 1 
ATOM   3420 C  CE2 . TRP B 2 102 ? 11.023  133.066 -5.858  1.00 18.91 ? 102 TRP B CE2 1 
ATOM   3421 C  CE3 . TRP B 2 102 ? 9.356   132.614 -4.154  1.00 18.20 ? 102 TRP B CE3 1 
ATOM   3422 C  CZ2 . TRP B 2 102 ? 11.403  131.719 -5.913  1.00 19.14 ? 102 TRP B CZ2 1 
ATOM   3423 C  CZ3 . TRP B 2 102 ? 9.734   131.275 -4.208  1.00 18.18 ? 102 TRP B CZ3 1 
ATOM   3424 C  CH2 . TRP B 2 102 ? 10.750  130.841 -5.083  1.00 20.05 ? 102 TRP B CH2 1 
ATOM   3425 N  N   . LEU B 2 103 ? 6.623   137.393 -3.142  1.00 17.86 ? 103 LEU B N   1 
ATOM   3426 C  CA  . LEU B 2 103 ? 6.006   137.965 -1.951  1.00 19.41 ? 103 LEU B CA  1 
ATOM   3427 C  C   . LEU B 2 103 ? 4.599   137.403 -1.757  1.00 19.33 ? 103 LEU B C   1 
ATOM   3428 O  O   . LEU B 2 103 ? 4.207   137.061 -0.640  1.00 18.17 ? 103 LEU B O   1 
ATOM   3429 C  CB  . LEU B 2 103 ? 5.971   139.493 -2.049  1.00 20.33 ? 103 LEU B CB  1 
ATOM   3430 C  CG  . LEU B 2 103 ? 7.328   140.187 -1.858  1.00 21.77 ? 103 LEU B CG  1 
ATOM   3431 C  CD1 . LEU B 2 103 ? 7.243   141.645 -2.313  1.00 23.29 ? 103 LEU B CD1 1 
ATOM   3432 C  CD2 . LEU B 2 103 ? 7.743   140.101 -0.388  1.00 23.28 ? 103 LEU B CD2 1 
ATOM   3433 N  N   . CYS B 2 104 ? 3.848   137.289 -2.846  1.00 17.98 ? 104 CYS B N   1 
ATOM   3434 C  CA  . CYS B 2 104 ? 2.499   136.745 -2.768  1.00 19.40 ? 104 CYS B CA  1 
ATOM   3435 C  C   . CYS B 2 104 ? 2.546   135.316 -2.231  1.00 20.66 ? 104 CYS B C   1 
ATOM   3436 O  O   . CYS B 2 104 ? 1.775   134.957 -1.336  1.00 20.70 ? 104 CYS B O   1 
ATOM   3437 C  CB  . CYS B 2 104 ? 1.835   136.740 -4.147  1.00 19.41 ? 104 CYS B CB  1 
ATOM   3438 S  SG  . CYS B 2 104 ? 1.407   138.377 -4.797  1.00 21.18 ? 104 CYS B SG  1 
ATOM   3439 N  N   . TYR B 2 105 ? 3.454   134.509 -2.780  1.00 18.48 ? 105 TYR B N   1 
ATOM   3440 C  CA  . TYR B 2 105 ? 3.591   133.117 -2.362  1.00 18.53 ? 105 TYR B CA  1 
ATOM   3441 C  C   . TYR B 2 105 ? 4.040   132.968 -0.909  1.00 17.26 ? 105 TYR B C   1 
ATOM   3442 O  O   . TYR B 2 105 ? 3.402   132.259 -0.138  1.00 18.07 ? 105 TYR B O   1 
ATOM   3443 C  CB  . TYR B 2 105 ? 4.573   132.369 -3.277  1.00 18.53 ? 105 TYR B CB  1 
ATOM   3444 C  CG  . TYR B 2 105 ? 5.025   131.052 -2.689  1.00 19.41 ? 105 TYR B CG  1 
ATOM   3445 C  CD1 . TYR B 2 105 ? 4.112   130.025 -2.443  1.00 19.26 ? 105 TYR B CD1 1 
ATOM   3446 C  CD2 . TYR B 2 105 ? 6.353   130.858 -2.310  1.00 19.49 ? 105 TYR B CD2 1 
ATOM   3447 C  CE1 . TYR B 2 105 ? 4.509   128.842 -1.825  1.00 18.72 ? 105 TYR B CE1 1 
ATOM   3448 C  CE2 . TYR B 2 105 ? 6.761   129.676 -1.696  1.00 19.88 ? 105 TYR B CE2 1 
ATOM   3449 C  CZ  . TYR B 2 105 ? 5.836   128.676 -1.454  1.00 18.98 ? 105 TYR B CZ  1 
ATOM   3450 O  OH  . TYR B 2 105 ? 6.237   127.522 -0.828  1.00 20.78 ? 105 TYR B OH  1 
ATOM   3451 N  N   . TRP B 2 106 ? 5.134   133.624 -0.536  1.00 16.67 ? 106 TRP B N   1 
ATOM   3452 C  CA  . TRP B 2 106 ? 5.632   133.534 0.838   1.00 17.49 ? 106 TRP B CA  1 
ATOM   3453 C  C   . TRP B 2 106 ? 4.567   133.943 1.857   1.00 18.58 ? 106 TRP B C   1 
ATOM   3454 O  O   . TRP B 2 106 ? 4.379   133.282 2.886   1.00 18.17 ? 106 TRP B O   1 
ATOM   3455 C  CB  . TRP B 2 106 ? 6.866   134.424 1.044   1.00 17.78 ? 106 TRP B CB  1 
ATOM   3456 C  CG  . TRP B 2 106 ? 8.080   134.027 0.249   1.00 19.02 ? 106 TRP B CG  1 
ATOM   3457 C  CD1 . TRP B 2 106 ? 8.473   132.759 -0.078  1.00 19.50 ? 106 TRP B CD1 1 
ATOM   3458 C  CD2 . TRP B 2 106 ? 9.062   134.909 -0.312  1.00 18.77 ? 106 TRP B CD2 1 
ATOM   3459 N  NE1 . TRP B 2 106 ? 9.635   132.798 -0.811  1.00 18.86 ? 106 TRP B NE1 1 
ATOM   3460 C  CE2 . TRP B 2 106 ? 10.018  134.104 -0.971  1.00 18.88 ? 106 TRP B CE2 1 
ATOM   3461 C  CE3 . TRP B 2 106 ? 9.226   136.301 -0.322  1.00 19.16 ? 106 TRP B CE3 1 
ATOM   3462 C  CZ2 . TRP B 2 106 ? 11.123  134.644 -1.638  1.00 18.50 ? 106 TRP B CZ2 1 
ATOM   3463 C  CZ3 . TRP B 2 106 ? 10.331  136.841 -0.986  1.00 20.48 ? 106 TRP B CZ3 1 
ATOM   3464 C  CH2 . TRP B 2 106 ? 11.262  136.012 -1.635  1.00 19.23 ? 106 TRP B CH2 1 
ATOM   3465 N  N   . ILE B 2 107 ? 3.876   135.042 1.577   1.00 17.64 ? 107 ILE B N   1 
ATOM   3466 C  CA  . ILE B 2 107 ? 2.850   135.528 2.490   1.00 18.30 ? 107 ILE B CA  1 
ATOM   3467 C  C   . ILE B 2 107 ? 1.627   134.616 2.541   1.00 18.70 ? 107 ILE B C   1 
ATOM   3468 O  O   . ILE B 2 107 ? 1.149   134.278 3.627   1.00 19.55 ? 107 ILE B O   1 
ATOM   3469 C  CB  . ILE B 2 107 ? 2.426   136.971 2.124   1.00 18.48 ? 107 ILE B CB  1 
ATOM   3470 C  CG1 . ILE B 2 107 ? 3.606   137.919 2.376   1.00 17.04 ? 107 ILE B CG1 1 
ATOM   3471 C  CG2 . ILE B 2 107 ? 1.208   137.390 2.952   1.00 17.42 ? 107 ILE B CG2 1 
ATOM   3472 C  CD1 . ILE B 2 107 ? 3.375   139.352 1.932   1.00 19.68 ? 107 ILE B CD1 1 
ATOM   3473 N  N   . LEU B 2 108 ? 1.128   134.203 1.380   1.00 17.64 ? 108 LEU B N   1 
ATOM   3474 C  CA  . LEU B 2 108 ? -0.037  133.322 1.340   1.00 18.79 ? 108 LEU B CA  1 
ATOM   3475 C  C   . LEU B 2 108 ? 0.236   131.961 1.973   1.00 19.44 ? 108 LEU B C   1 
ATOM   3476 O  O   . LEU B 2 108 ? -0.615  131.414 2.677   1.00 18.85 ? 108 LEU B O   1 
ATOM   3477 C  CB  . LEU B 2 108 ? -0.519  133.134 -0.103  1.00 18.77 ? 108 LEU B CB  1 
ATOM   3478 C  CG  . LEU B 2 108 ? -1.221  134.355 -0.710  1.00 20.65 ? 108 LEU B CG  1 
ATOM   3479 C  CD1 . LEU B 2 108 ? -1.668  134.065 -2.141  1.00 21.55 ? 108 LEU B CD1 1 
ATOM   3480 C  CD2 . LEU B 2 108 ? -2.418  134.710 0.150   1.00 22.44 ? 108 LEU B CD2 1 
ATOM   3481 N  N   . HIS B 2 109 ? 1.423   131.414 1.727   1.00 17.71 ? 109 HIS B N   1 
ATOM   3482 C  CA  . HIS B 2 109 ? 1.766   130.113 2.286   1.00 16.83 ? 109 HIS B CA  1 
ATOM   3483 C  C   . HIS B 2 109 ? 1.915   130.188 3.803   1.00 16.66 ? 109 HIS B C   1 
ATOM   3484 O  O   . HIS B 2 109 ? 1.558   129.250 4.511   1.00 15.38 ? 109 HIS B O   1 
ATOM   3485 C  CB  . HIS B 2 109 ? 3.057   129.579 1.662   1.00 16.34 ? 109 HIS B CB  1 
ATOM   3486 C  CG  . HIS B 2 109 ? 3.429   128.213 2.146   1.00 16.89 ? 109 HIS B CG  1 
ATOM   3487 N  ND1 . HIS B 2 109 ? 2.520   127.179 2.214   1.00 15.55 ? 109 HIS B ND1 1 
ATOM   3488 C  CD2 . HIS B 2 109 ? 4.607   127.709 2.580   1.00 15.51 ? 109 HIS B CD2 1 
ATOM   3489 C  CE1 . HIS B 2 109 ? 3.124   126.094 2.666   1.00 17.14 ? 109 HIS B CE1 1 
ATOM   3490 N  NE2 . HIS B 2 109 ? 4.391   126.388 2.896   1.00 16.88 ? 109 HIS B NE2 1 
ATOM   3491 N  N   . SER B 2 110 ? 2.446   131.304 4.297   1.00 17.46 ? 110 SER B N   1 
ATOM   3492 C  CA  . SER B 2 110 ? 2.610   131.495 5.737   1.00 17.97 ? 110 SER B CA  1 
ATOM   3493 C  C   . SER B 2 110 ? 1.231   131.562 6.391   1.00 18.67 ? 110 SER B C   1 
ATOM   3494 O  O   . SER B 2 110 ? 1.001   130.946 7.429   1.00 17.96 ? 110 SER B O   1 
ATOM   3495 C  CB  . SER B 2 110 ? 3.387   132.783 6.023   1.00 17.68 ? 110 SER B CB  1 
ATOM   3496 O  OG  . SER B 2 110 ? 4.714   132.695 5.528   1.00 18.35 ? 110 SER B OG  1 
ATOM   3497 N  N   . LEU B 2 111 ? 0.313   132.306 5.774   1.00 17.79 ? 111 LEU B N   1 
ATOM   3498 C  CA  . LEU B 2 111 ? -1.051  132.423 6.293   1.00 18.89 ? 111 LEU B CA  1 
ATOM   3499 C  C   . LEU B 2 111 ? -1.723  131.054 6.269   1.00 19.00 ? 111 LEU B C   1 
ATOM   3500 O  O   . LEU B 2 111 ? -2.443  130.678 7.197   1.00 20.39 ? 111 LEU B O   1 
ATOM   3501 C  CB  . LEU B 2 111 ? -1.853  133.410 5.442   1.00 19.15 ? 111 LEU B CB  1 
ATOM   3502 C  CG  . LEU B 2 111 ? -1.407  134.866 5.574   1.00 19.76 ? 111 LEU B CG  1 
ATOM   3503 C  CD1 . LEU B 2 111 ? -2.033  135.710 4.466   1.00 21.10 ? 111 LEU B CD1 1 
ATOM   3504 C  CD2 . LEU B 2 111 ? -1.801  135.380 6.953   1.00 19.81 ? 111 LEU B CD2 1 
ATOM   3505 N  N   . GLU B 2 112 ? -1.487  130.315 5.191   1.00 18.76 ? 112 GLU B N   1 
ATOM   3506 C  CA  . GLU B 2 112 ? -2.038  128.975 5.035   1.00 20.60 ? 112 GLU B CA  1 
ATOM   3507 C  C   . GLU B 2 112 ? -1.521  128.058 6.150   1.00 19.65 ? 112 GLU B C   1 
ATOM   3508 O  O   . GLU B 2 112 ? -2.286  127.308 6.757   1.00 19.61 ? 112 GLU B O   1 
ATOM   3509 C  CB  . GLU B 2 112 ? -1.644  128.421 3.661   1.00 21.85 ? 112 GLU B CB  1 
ATOM   3510 C  CG  . GLU B 2 112 ? -1.759  126.918 3.532   1.00 26.12 ? 112 GLU B CG  1 
ATOM   3511 C  CD  . GLU B 2 112 ? -1.232  126.410 2.204   1.00 25.98 ? 112 GLU B CD  1 
ATOM   3512 O  OE1 . GLU B 2 112 ? -0.132  126.840 1.788   1.00 24.06 ? 112 GLU B OE1 1 
ATOM   3513 O  OE2 . GLU B 2 112 ? -1.913  125.573 1.583   1.00 27.60 ? 112 GLU B OE2 1 
ATOM   3514 N  N   . LEU B 2 113 ? -0.220  128.119 6.423   1.00 18.82 ? 113 LEU B N   1 
ATOM   3515 C  CA  . LEU B 2 113 ? 0.361   127.291 7.473   1.00 17.94 ? 113 LEU B CA  1 
ATOM   3516 C  C   . LEU B 2 113 ? -0.236  127.646 8.835   1.00 18.82 ? 113 LEU B C   1 
ATOM   3517 O  O   . LEU B 2 113 ? -0.471  126.769 9.670   1.00 17.35 ? 113 LEU B O   1 
ATOM   3518 C  CB  . LEU B 2 113 ? 1.883   127.472 7.508   1.00 18.09 ? 113 LEU B CB  1 
ATOM   3519 C  CG  . LEU B 2 113 ? 2.669   126.873 6.333   1.00 19.37 ? 113 LEU B CG  1 
ATOM   3520 C  CD1 . LEU B 2 113 ? 4.114   127.335 6.386   1.00 17.72 ? 113 LEU B CD1 1 
ATOM   3521 C  CD2 . LEU B 2 113 ? 2.600   125.351 6.386   1.00 20.53 ? 113 LEU B CD2 1 
ATOM   3522 N  N   . LEU B 2 114 ? -0.478  128.938 9.047   1.00 17.37 ? 114 LEU B N   1 
ATOM   3523 C  CA  . LEU B 2 114 ? -1.040  129.438 10.295  1.00 19.86 ? 114 LEU B CA  1 
ATOM   3524 C  C   . LEU B 2 114 ? -2.554  129.248 10.350  1.00 22.01 ? 114 LEU B C   1 
ATOM   3525 O  O   . LEU B 2 114 ? -3.202  129.647 11.314  1.00 23.08 ? 114 LEU B O   1 
ATOM   3526 C  CB  . LEU B 2 114 ? -0.700  130.924 10.458  1.00 17.79 ? 114 LEU B CB  1 
ATOM   3527 C  CG  . LEU B 2 114 ? 0.777   131.251 10.684  1.00 20.52 ? 114 LEU B CG  1 
ATOM   3528 C  CD1 . LEU B 2 114 ? 1.011   132.755 10.592  1.00 19.03 ? 114 LEU B CD1 1 
ATOM   3529 C  CD2 . LEU B 2 114 ? 1.198   130.719 12.055  1.00 20.85 ? 114 LEU B CD2 1 
ATOM   3530 N  N   . ASP B 2 115 ? -3.112  128.648 9.307   1.00 24.44 ? 115 ASP B N   1 
ATOM   3531 C  CA  . ASP B 2 115 ? -4.547  128.399 9.237   1.00 28.17 ? 115 ASP B CA  1 
ATOM   3532 C  C   . ASP B 2 115 ? -5.351  129.696 9.358   1.00 29.57 ? 115 ASP B C   1 
ATOM   3533 O  O   . ASP B 2 115 ? -6.368  129.748 10.050  1.00 29.75 ? 115 ASP B O   1 
ATOM   3534 C  CB  . ASP B 2 115 ? -4.959  127.408 10.336  1.00 30.46 ? 115 ASP B CB  1 
ATOM   3535 C  CG  . ASP B 2 115 ? -6.300  126.751 10.060  1.00 34.04 ? 115 ASP B CG  1 
ATOM   3536 O  OD1 . ASP B 2 115 ? -6.576  126.433 8.883   1.00 36.27 ? 115 ASP B OD1 1 
ATOM   3537 O  OD2 . ASP B 2 115 ? -7.074  126.536 11.017  1.00 37.68 ? 115 ASP B OD2 1 
ATOM   3538 N  N   . GLU B 2 116 ? -4.878  130.742 8.686   1.00 30.94 ? 116 GLU B N   1 
ATOM   3539 C  CA  . GLU B 2 116 ? -5.551  132.040 8.680   1.00 32.32 ? 116 GLU B CA  1 
ATOM   3540 C  C   . GLU B 2 116 ? -6.239  132.150 7.324   1.00 34.27 ? 116 GLU B C   1 
ATOM   3541 O  O   . GLU B 2 116 ? -5.579  132.203 6.288   1.00 34.10 ? 116 GLU B O   1 
ATOM   3542 C  CB  . GLU B 2 116 ? -4.534  133.177 8.832   1.00 31.96 ? 116 GLU B CB  1 
ATOM   3543 C  CG  . GLU B 2 116 ? -3.735  133.146 10.126  1.00 32.09 ? 116 GLU B CG  1 
ATOM   3544 C  CD  . GLU B 2 116 ? -4.491  133.726 11.309  1.00 35.27 ? 116 GLU B CD  1 
ATOM   3545 O  OE1 . GLU B 2 116 ? -5.701  134.008 11.171  1.00 33.80 ? 116 GLU B OE1 1 
ATOM   3546 O  OE2 . GLU B 2 116 ? -3.868  133.897 12.381  1.00 35.21 ? 116 GLU B OE2 1 
ATOM   3547 N  N   . PRO B 2 117 ? -7.578  132.187 7.310   1.00 36.65 ? 117 PRO B N   1 
ATOM   3548 C  CA  . PRO B 2 117 ? -8.307  132.284 6.043   1.00 37.20 ? 117 PRO B CA  1 
ATOM   3549 C  C   . PRO B 2 117 ? -7.953  133.509 5.204   1.00 37.19 ? 117 PRO B C   1 
ATOM   3550 O  O   . PRO B 2 117 ? -7.613  134.568 5.732   1.00 37.54 ? 117 PRO B O   1 
ATOM   3551 C  CB  . PRO B 2 117 ? -9.768  132.285 6.487   1.00 37.90 ? 117 PRO B CB  1 
ATOM   3552 C  CG  . PRO B 2 117 ? -9.707  132.977 7.819   1.00 37.94 ? 117 PRO B CG  1 
ATOM   3553 C  CD  . PRO B 2 117 ? -8.496  132.321 8.456   1.00 38.21 ? 117 PRO B CD  1 
ATOM   3554 N  N   . ILE B 2 118 ? -8.027  133.343 3.890   1.00 36.38 ? 118 ILE B N   1 
ATOM   3555 C  CA  . ILE B 2 118 ? -7.737  134.423 2.962   1.00 36.85 ? 118 ILE B CA  1 
ATOM   3556 C  C   . ILE B 2 118 ? -9.066  135.042 2.537   1.00 35.82 ? 118 ILE B C   1 
ATOM   3557 O  O   . ILE B 2 118 ? -9.869  134.398 1.867   1.00 36.33 ? 118 ILE B O   1 
ATOM   3558 C  CB  . ILE B 2 118 ? -7.007  133.897 1.704   1.00 37.64 ? 118 ILE B CB  1 
ATOM   3559 C  CG1 . ILE B 2 118 ? -5.775  133.080 2.118   1.00 39.56 ? 118 ILE B CG1 1 
ATOM   3560 C  CG2 . ILE B 2 118 ? -6.611  135.058 0.801   1.00 37.57 ? 118 ILE B CG2 1 
ATOM   3561 C  CD1 . ILE B 2 118 ? -4.834  133.802 3.068   1.00 39.23 ? 118 ILE B CD1 1 
ATOM   3562 N  N   . PRO B 2 119 ? -9.324  136.294 2.938   1.00 34.72 ? 119 PRO B N   1 
ATOM   3563 C  CA  . PRO B 2 119 ? -10.584 136.938 2.557   1.00 34.40 ? 119 PRO B CA  1 
ATOM   3564 C  C   . PRO B 2 119 ? -10.806 136.850 1.048   1.00 34.70 ? 119 PRO B C   1 
ATOM   3565 O  O   . PRO B 2 119 ? -9.866  136.985 0.268   1.00 33.87 ? 119 PRO B O   1 
ATOM   3566 C  CB  . PRO B 2 119 ? -10.391 138.369 3.038   1.00 34.52 ? 119 PRO B CB  1 
ATOM   3567 C  CG  . PRO B 2 119 ? -9.551  138.187 4.264   1.00 34.55 ? 119 PRO B CG  1 
ATOM   3568 C  CD  . PRO B 2 119 ? -8.525  137.174 3.808   1.00 34.37 ? 119 PRO B CD  1 
ATOM   3569 N  N   . GLN B 2 120 ? -12.051 136.615 0.649   1.00 34.90 ? 120 GLN B N   1 
ATOM   3570 C  CA  . GLN B 2 120 ? -12.418 136.493 -0.759  1.00 37.18 ? 120 GLN B CA  1 
ATOM   3571 C  C   . GLN B 2 120 ? -11.907 137.663 -1.613  1.00 36.48 ? 120 GLN B C   1 
ATOM   3572 O  O   . GLN B 2 120 ? -11.418 137.461 -2.725  1.00 36.15 ? 120 GLN B O   1 
ATOM   3573 C  CB  . GLN B 2 120 ? -13.941 136.387 -0.870  1.00 41.34 ? 120 GLN B CB  1 
ATOM   3574 C  CG  . GLN B 2 120 ? -14.440 135.415 -1.930  1.00 49.01 ? 120 GLN B CG  1 
ATOM   3575 C  CD  . GLN B 2 120 ? -14.371 135.980 -3.335  1.00 53.24 ? 120 GLN B CD  1 
ATOM   3576 O  OE1 . GLN B 2 120 ? -13.297 136.331 -3.831  1.00 56.26 ? 120 GLN B OE1 1 
ATOM   3577 N  NE2 . GLN B 2 120 ? -15.525 136.069 -3.989  1.00 55.66 ? 120 GLN B NE2 1 
ATOM   3578 N  N   . ILE B 2 121 ? -12.018 138.881 -1.087  1.00 35.18 ? 121 ILE B N   1 
ATOM   3579 C  CA  . ILE B 2 121 ? -11.568 140.073 -1.801  1.00 34.96 ? 121 ILE B CA  1 
ATOM   3580 C  C   . ILE B 2 121 ? -10.060 140.057 -2.027  1.00 32.92 ? 121 ILE B C   1 
ATOM   3581 O  O   . ILE B 2 121 ? -9.575  140.443 -3.092  1.00 32.44 ? 121 ILE B O   1 
ATOM   3582 C  CB  . ILE B 2 121 ? -11.937 141.363 -1.026  1.00 37.05 ? 121 ILE B CB  1 
ATOM   3583 C  CG1 . ILE B 2 121 ? -13.458 141.520 -0.972  1.00 39.14 ? 121 ILE B CG1 1 
ATOM   3584 C  CG2 . ILE B 2 121 ? -11.300 142.575 -1.687  1.00 36.85 ? 121 ILE B CG2 1 
ATOM   3585 C  CD1 . ILE B 2 121 ? -14.121 141.590 -2.335  1.00 43.07 ? 121 ILE B CD1 1 
ATOM   3586 N  N   . VAL B 2 122 ? -9.321  139.622 -1.014  1.00 30.39 ? 122 VAL B N   1 
ATOM   3587 C  CA  . VAL B 2 122 ? -7.873  139.552 -1.113  1.00 29.79 ? 122 VAL B CA  1 
ATOM   3588 C  C   . VAL B 2 122 ? -7.492  138.506 -2.163  1.00 27.50 ? 122 VAL B C   1 
ATOM   3589 O  O   . VAL B 2 122 ? -6.622  138.743 -3.004  1.00 26.60 ? 122 VAL B O   1 
ATOM   3590 C  CB  . VAL B 2 122 ? -7.247  139.189 0.255   1.00 30.51 ? 122 VAL B CB  1 
ATOM   3591 C  CG1 . VAL B 2 122 ? -5.770  138.875 0.098   1.00 30.15 ? 122 VAL B CG1 1 
ATOM   3592 C  CG2 . VAL B 2 122 ? -7.426  140.349 1.218   1.00 33.39 ? 122 VAL B CG2 1 
ATOM   3593 N  N   . ALA B 2 123 ? -8.164  137.360 -2.117  1.00 24.99 ? 123 ALA B N   1 
ATOM   3594 C  CA  . ALA B 2 123 ? -7.905  136.280 -3.059  1.00 25.78 ? 123 ALA B CA  1 
ATOM   3595 C  C   . ALA B 2 123 ? -8.085  136.760 -4.494  1.00 26.57 ? 123 ALA B C   1 
ATOM   3596 O  O   . ALA B 2 123 ? -7.262  136.472 -5.364  1.00 26.03 ? 123 ALA B O   1 
ATOM   3597 C  CB  . ALA B 2 123 ? -8.837  135.116 -2.781  1.00 26.80 ? 123 ALA B CB  1 
ATOM   3598 N  N   . THR B 2 124 ? -9.165  137.496 -4.736  1.00 26.03 ? 124 THR B N   1 
ATOM   3599 C  CA  . THR B 2 124 ? -9.450  138.015 -6.067  1.00 26.93 ? 124 THR B CA  1 
ATOM   3600 C  C   . THR B 2 124 ? -8.400  139.031 -6.511  1.00 24.75 ? 124 THR B C   1 
ATOM   3601 O  O   . THR B 2 124 ? -7.952  139.009 -7.659  1.00 25.53 ? 124 THR B O   1 
ATOM   3602 C  CB  . THR B 2 124 ? -10.853 138.654 -6.115  1.00 28.96 ? 124 THR B CB  1 
ATOM   3603 O  OG1 . THR B 2 124 ? -11.834 137.637 -5.880  1.00 32.70 ? 124 THR B OG1 1 
ATOM   3604 C  CG2 . THR B 2 124 ? -11.115 139.289 -7.478  1.00 29.36 ? 124 THR B CG2 1 
ATOM   3605 N  N   . ASP B 2 125 ? -8.001  139.910 -5.598  1.00 24.08 ? 125 ASP B N   1 
ATOM   3606 C  CA  . ASP B 2 125 ? -6.995  140.916 -5.906  1.00 23.47 ? 125 ASP B CA  1 
ATOM   3607 C  C   . ASP B 2 125 ? -5.656  140.262 -6.252  1.00 23.56 ? 125 ASP B C   1 
ATOM   3608 O  O   . ASP B 2 125 ? -4.976  140.688 -7.184  1.00 22.74 ? 125 ASP B O   1 
ATOM   3609 C  CB  . ASP B 2 125 ? -6.828  141.875 -4.724  1.00 25.15 ? 125 ASP B CB  1 
ATOM   3610 C  CG  . ASP B 2 125 ? -8.054  142.763 -4.514  1.00 28.11 ? 125 ASP B CG  1 
ATOM   3611 O  OD1 . ASP B 2 125 ? -8.108  143.488 -3.497  1.00 27.47 ? 125 ASP B OD1 1 
ATOM   3612 O  OD2 . ASP B 2 125 ? -8.961  142.739 -5.370  1.00 26.82 ? 125 ASP B OD2 1 
ATOM   3613 N  N   . VAL B 2 126 ? -5.276  139.224 -5.510  1.00 22.77 ? 126 VAL B N   1 
ATOM   3614 C  CA  . VAL B 2 126 ? -4.018  138.543 -5.794  1.00 22.25 ? 126 VAL B CA  1 
ATOM   3615 C  C   . VAL B 2 126 ? -4.077  137.929 -7.187  1.00 21.91 ? 126 VAL B C   1 
ATOM   3616 O  O   . VAL B 2 126 ? -3.125  138.046 -7.960  1.00 22.98 ? 126 VAL B O   1 
ATOM   3617 C  CB  . VAL B 2 126 ? -3.714  137.434 -4.763  1.00 20.84 ? 126 VAL B CB  1 
ATOM   3618 C  CG1 . VAL B 2 126 ? -2.466  136.662 -5.183  1.00 21.59 ? 126 VAL B CG1 1 
ATOM   3619 C  CG2 . VAL B 2 126 ? -3.496  138.051 -3.397  1.00 20.31 ? 126 VAL B CG2 1 
ATOM   3620 N  N   . CYS B 2 127 ? -5.190  137.274 -7.508  1.00 20.39 ? 127 CYS B N   1 
ATOM   3621 C  CA  . CYS B 2 127 ? -5.351  136.670 -8.828  1.00 23.91 ? 127 CYS B CA  1 
ATOM   3622 C  C   . CYS B 2 127 ? -5.169  137.726 -9.917  1.00 24.82 ? 127 CYS B C   1 
ATOM   3623 O  O   . CYS B 2 127 ? -4.413  137.524 -10.868 1.00 24.60 ? 127 CYS B O   1 
ATOM   3624 C  CB  . CYS B 2 127 ? -6.742  136.043 -8.978  1.00 23.35 ? 127 CYS B CB  1 
ATOM   3625 S  SG  . CYS B 2 127 ? -7.017  134.553 -8.007  1.00 25.29 ? 127 CYS B SG  1 
ATOM   3626 N  N   . GLN B 2 128 ? -5.869  138.850 -9.772  1.00 24.96 ? 128 GLN B N   1 
ATOM   3627 C  CA  . GLN B 2 128 ? -5.784  139.930 -10.752 1.00 26.31 ? 128 GLN B CA  1 
ATOM   3628 C  C   . GLN B 2 128 ? -4.354  140.428 -10.894 1.00 24.64 ? 128 GLN B C   1 
ATOM   3629 O  O   . GLN B 2 128 ? -3.888  140.690 -12.005 1.00 24.13 ? 128 GLN B O   1 
ATOM   3630 C  CB  . GLN B 2 128 ? -6.694  141.100 -10.354 1.00 28.40 ? 128 GLN B CB  1 
ATOM   3631 C  CG  . GLN B 2 128 ? -8.162  140.723 -10.196 1.00 36.50 ? 128 GLN B CG  1 
ATOM   3632 C  CD  . GLN B 2 128 ? -9.072  141.931 -10.015 1.00 41.37 ? 128 GLN B CD  1 
ATOM   3633 O  OE1 . GLN B 2 128 ? -8.816  142.806 -9.182  1.00 44.20 ? 128 GLN B OE1 1 
ATOM   3634 N  NE2 . GLN B 2 128 ? -10.147 141.978 -10.793 1.00 44.16 ? 128 GLN B NE2 1 
ATOM   3635 N  N   . PHE B 2 129 ? -3.656  140.562 -9.770  1.00 22.66 ? 129 PHE B N   1 
ATOM   3636 C  CA  . PHE B 2 129 ? -2.282  141.034 -9.812  1.00 22.91 ? 129 PHE B CA  1 
ATOM   3637 C  C   . PHE B 2 129 ? -1.364  140.050 -10.531 1.00 21.42 ? 129 PHE B C   1 
ATOM   3638 O  O   . PHE B 2 129 ? -0.535  140.453 -11.343 1.00 21.22 ? 129 PHE B O   1 
ATOM   3639 C  CB  . PHE B 2 129 ? -1.735  141.284 -8.407  1.00 22.49 ? 129 PHE B CB  1 
ATOM   3640 C  CG  . PHE B 2 129 ? -0.260  141.579 -8.393  1.00 23.97 ? 129 PHE B CG  1 
ATOM   3641 C  CD1 . PHE B 2 129 ? 0.237   142.722 -9.016  1.00 23.53 ? 129 PHE B CD1 1 
ATOM   3642 C  CD2 . PHE B 2 129 ? 0.639   140.681 -7.825  1.00 22.67 ? 129 PHE B CD2 1 
ATOM   3643 C  CE1 . PHE B 2 129 ? 1.605   142.963 -9.077  1.00 24.48 ? 129 PHE B CE1 1 
ATOM   3644 C  CE2 . PHE B 2 129 ? 2.012   140.911 -7.878  1.00 23.04 ? 129 PHE B CE2 1 
ATOM   3645 C  CZ  . PHE B 2 129 ? 2.498   142.052 -8.505  1.00 23.06 ? 129 PHE B CZ  1 
ATOM   3646 N  N   . LEU B 2 130 ? -1.507  138.762 -10.227 1.00 22.29 ? 130 LEU B N   1 
ATOM   3647 C  CA  . LEU B 2 130 ? -0.671  137.748 -10.865 1.00 22.39 ? 130 LEU B CA  1 
ATOM   3648 C  C   . LEU B 2 130 ? -0.986  137.660 -12.355 1.00 22.86 ? 130 LEU B C   1 
ATOM   3649 O  O   . LEU B 2 130 ? -0.119  137.333 -13.165 1.00 22.90 ? 130 LEU B O   1 
ATOM   3650 C  CB  . LEU B 2 130 ? -0.864  136.387 -10.186 1.00 20.83 ? 130 LEU B CB  1 
ATOM   3651 C  CG  . LEU B 2 130 ? -0.387  136.337 -8.730  1.00 22.98 ? 130 LEU B CG  1 
ATOM   3652 C  CD1 . LEU B 2 130 ? -0.662  134.963 -8.135  1.00 21.49 ? 130 LEU B CD1 1 
ATOM   3653 C  CD2 . LEU B 2 130 ? 1.109   136.662 -8.665  1.00 22.41 ? 130 LEU B CD2 1 
ATOM   3654 N  N   . GLU B 2 131 ? -2.229  137.957 -12.721 1.00 22.74 ? 131 GLU B N   1 
ATOM   3655 C  CA  . GLU B 2 131 ? -2.608  137.932 -14.127 1.00 24.66 ? 131 GLU B CA  1 
ATOM   3656 C  C   . GLU B 2 131 ? -1.801  139.007 -14.860 1.00 23.94 ? 131 GLU B C   1 
ATOM   3657 O  O   . GLU B 2 131 ? -1.333  138.794 -15.983 1.00 23.10 ? 131 GLU B O   1 
ATOM   3658 C  CB  . GLU B 2 131 ? -4.108  138.200 -14.278 1.00 28.06 ? 131 GLU B CB  1 
ATOM   3659 C  CG  . GLU B 2 131 ? -4.594  138.241 -15.714 1.00 35.65 ? 131 GLU B CG  1 
ATOM   3660 C  CD  . GLU B 2 131 ? -6.109  138.161 -15.813 1.00 41.64 ? 131 GLU B CD  1 
ATOM   3661 O  OE1 . GLU B 2 131 ? -6.795  138.989 -15.173 1.00 45.81 ? 131 GLU B OE1 1 
ATOM   3662 O  OE2 . GLU B 2 131 ? -6.615  137.268 -16.532 1.00 43.74 ? 131 GLU B OE2 1 
ATOM   3663 N  N   . LEU B 2 132 ? -1.627  140.154 -14.206 1.00 21.58 ? 132 LEU B N   1 
ATOM   3664 C  CA  . LEU B 2 132 ? -0.870  141.260 -14.782 1.00 21.78 ? 132 LEU B CA  1 
ATOM   3665 C  C   . LEU B 2 132 ? 0.618   140.923 -14.883 1.00 21.83 ? 132 LEU B C   1 
ATOM   3666 O  O   . LEU B 2 132 ? 1.338   141.507 -15.688 1.00 19.26 ? 132 LEU B O   1 
ATOM   3667 C  CB  . LEU B 2 132 ? -1.052  142.524 -13.938 1.00 19.84 ? 132 LEU B CB  1 
ATOM   3668 C  CG  . LEU B 2 132 ? -2.474  143.094 -13.867 1.00 23.76 ? 132 LEU B CG  1 
ATOM   3669 C  CD1 . LEU B 2 132 ? -2.523  144.241 -12.859 1.00 24.15 ? 132 LEU B CD1 1 
ATOM   3670 C  CD2 . LEU B 2 132 ? -2.903  143.571 -15.251 1.00 22.99 ? 132 LEU B CD2 1 
ATOM   3671 N  N   . CYS B 2 133 ? 1.075   139.983 -14.060 1.00 21.84 ? 133 CYS B N   1 
ATOM   3672 C  CA  . CYS B 2 133 ? 2.477   139.573 -14.072 1.00 21.50 ? 133 CYS B CA  1 
ATOM   3673 C  C   . CYS B 2 133 ? 2.738   138.514 -15.135 1.00 20.71 ? 133 CYS B C   1 
ATOM   3674 O  O   . CYS B 2 133 ? 3.886   138.263 -15.501 1.00 20.22 ? 133 CYS B O   1 
ATOM   3675 C  CB  . CYS B 2 133 ? 2.887   139.010 -12.707 1.00 20.61 ? 133 CYS B CB  1 
ATOM   3676 S  SG  . CYS B 2 133 ? 2.972   140.222 -11.378 1.00 20.40 ? 133 CYS B SG  1 
ATOM   3677 N  N   . GLN B 2 134 ? 1.676   137.885 -15.624 1.00 20.76 ? 134 GLN B N   1 
ATOM   3678 C  CA  . GLN B 2 134 ? 1.827   136.843 -16.632 1.00 21.09 ? 134 GLN B CA  1 
ATOM   3679 C  C   . GLN B 2 134 ? 2.221   137.445 -17.975 1.00 22.69 ? 134 GLN B C   1 
ATOM   3680 O  O   . GLN B 2 134 ? 1.650   138.438 -18.420 1.00 22.51 ? 134 GLN B O   1 
ATOM   3681 C  CB  . GLN B 2 134 ? 0.532   136.034 -16.762 1.00 20.61 ? 134 GLN B CB  1 
ATOM   3682 C  CG  . GLN B 2 134 ? 0.652   134.813 -17.666 1.00 19.42 ? 134 GLN B CG  1 
ATOM   3683 C  CD  . GLN B 2 134 ? -0.492  133.835 -17.472 1.00 21.65 ? 134 GLN B CD  1 
ATOM   3684 O  OE1 . GLN B 2 134 ? -1.659  134.229 -17.397 1.00 23.87 ? 134 GLN B OE1 1 
ATOM   3685 N  NE2 . GLN B 2 134 ? -0.166  132.553 -17.396 1.00 19.27 ? 134 GLN B NE2 1 
ATOM   3686 N  N   . SER B 2 135 ? 3.218   136.837 -18.604 1.00 23.12 ? 135 SER B N   1 
ATOM   3687 C  CA  . SER B 2 135 ? 3.719   137.299 -19.887 1.00 24.80 ? 135 SER B CA  1 
ATOM   3688 C  C   . SER B 2 135 ? 2.938   136.704 -21.046 1.00 25.92 ? 135 SER B C   1 
ATOM   3689 O  O   . SER B 2 135 ? 2.430   135.581 -20.964 1.00 23.39 ? 135 SER B O   1 
ATOM   3690 C  CB  . SER B 2 135 ? 5.198   136.927 -20.032 1.00 24.65 ? 135 SER B CB  1 
ATOM   3691 O  OG  . SER B 2 135 ? 5.670   137.192 -21.341 1.00 27.38 ? 135 SER B OG  1 
ATOM   3692 N  N   . PRO B 2 136 ? 2.813   137.461 -22.142 1.00 26.82 ? 136 PRO B N   1 
ATOM   3693 C  CA  . PRO B 2 136 ? 2.080   136.935 -23.293 1.00 28.55 ? 136 PRO B CA  1 
ATOM   3694 C  C   . PRO B 2 136 ? 2.829   135.755 -23.916 1.00 27.72 ? 136 PRO B C   1 
ATOM   3695 O  O   . PRO B 2 136 ? 2.244   134.953 -24.636 1.00 28.74 ? 136 PRO B O   1 
ATOM   3696 C  CB  . PRO B 2 136 ? 1.982   138.147 -24.225 1.00 28.53 ? 136 PRO B CB  1 
ATOM   3697 C  CG  . PRO B 2 136 ? 3.198   138.950 -23.873 1.00 30.20 ? 136 PRO B CG  1 
ATOM   3698 C  CD  . PRO B 2 136 ? 3.214   138.861 -22.364 1.00 28.48 ? 136 PRO B CD  1 
ATOM   3699 N  N   . GLU B 2 137 ? 4.125   135.642 -23.627 1.00 29.02 ? 137 GLU B N   1 
ATOM   3700 C  CA  . GLU B 2 137 ? 4.914   134.536 -24.166 1.00 29.08 ? 137 GLU B CA  1 
ATOM   3701 C  C   . GLU B 2 137 ? 4.840   133.310 -23.256 1.00 27.03 ? 137 GLU B C   1 
ATOM   3702 O  O   . GLU B 2 137 ? 5.415   132.264 -23.562 1.00 26.57 ? 137 GLU B O   1 
ATOM   3703 C  CB  . GLU B 2 137 ? 6.381   134.946 -24.348 1.00 31.30 ? 137 GLU B CB  1 
ATOM   3704 C  CG  . GLU B 2 137 ? 7.161   135.113 -23.051 1.00 34.88 ? 137 GLU B CG  1 
ATOM   3705 C  CD  . GLU B 2 137 ? 8.629   135.437 -23.288 1.00 37.87 ? 137 GLU B CD  1 
ATOM   3706 O  OE1 . GLU B 2 137 ? 9.348   134.592 -23.863 1.00 36.86 ? 137 GLU B OE1 1 
ATOM   3707 O  OE2 . GLU B 2 137 ? 9.067   136.541 -22.901 1.00 38.97 ? 137 GLU B OE2 1 
ATOM   3708 N  N   . GLY B 2 138 ? 4.125   133.441 -22.142 1.00 24.92 ? 138 GLY B N   1 
ATOM   3709 C  CA  . GLY B 2 138 ? 4.001   132.334 -21.209 1.00 20.69 ? 138 GLY B CA  1 
ATOM   3710 C  C   . GLY B 2 138 ? 4.862   132.552 -19.980 1.00 20.65 ? 138 GLY B C   1 
ATOM   3711 O  O   . GLY B 2 138 ? 5.902   133.209 -20.053 1.00 19.72 ? 138 GLY B O   1 
ATOM   3712 N  N   . GLY B 2 139 ? 4.438   131.997 -18.849 1.00 20.16 ? 139 GLY B N   1 
ATOM   3713 C  CA  . GLY B 2 139 ? 5.192   132.167 -17.619 1.00 20.00 ? 139 GLY B CA  1 
ATOM   3714 C  C   . GLY B 2 139 ? 4.847   133.485 -16.950 1.00 20.11 ? 139 GLY B C   1 
ATOM   3715 O  O   . GLY B 2 139 ? 4.055   134.268 -17.479 1.00 20.88 ? 139 GLY B O   1 
ATOM   3716 N  N   . PHE B 2 140 ? 5.443   133.731 -15.788 1.00 19.83 ? 140 PHE B N   1 
ATOM   3717 C  CA  . PHE B 2 140 ? 5.200   134.961 -15.044 1.00 20.01 ? 140 PHE B CA  1 
ATOM   3718 C  C   . PHE B 2 140 ? 6.501   135.721 -14.792 1.00 20.40 ? 140 PHE B C   1 
ATOM   3719 O  O   . PHE B 2 140 ? 7.565   135.113 -14.630 1.00 19.98 ? 140 PHE B O   1 
ATOM   3720 C  CB  . PHE B 2 140 ? 4.535   134.657 -13.692 1.00 19.17 ? 140 PHE B CB  1 
ATOM   3721 C  CG  . PHE B 2 140 ? 3.181   134.009 -13.804 1.00 17.58 ? 140 PHE B CG  1 
ATOM   3722 C  CD1 . PHE B 2 140 ? 3.062   132.661 -14.121 1.00 18.90 ? 140 PHE B CD1 1 
ATOM   3723 C  CD2 . PHE B 2 140 ? 2.019   134.754 -13.596 1.00 19.10 ? 140 PHE B CD2 1 
ATOM   3724 C  CE1 . PHE B 2 140 ? 1.804   132.053 -14.232 1.00 19.19 ? 140 PHE B CE1 1 
ATOM   3725 C  CE2 . PHE B 2 140 ? 0.751   134.160 -13.705 1.00 18.64 ? 140 PHE B CE2 1 
ATOM   3726 C  CZ  . PHE B 2 140 ? 0.645   132.804 -14.024 1.00 19.58 ? 140 PHE B CZ  1 
ATOM   3727 N  N   . GLY B 2 141 ? 6.400   137.049 -14.764 1.00 18.55 ? 141 GLY B N   1 
ATOM   3728 C  CA  . GLY B 2 141 ? 7.549   137.897 -14.503 1.00 16.05 ? 141 GLY B CA  1 
ATOM   3729 C  C   . GLY B 2 141 ? 7.490   138.401 -13.069 1.00 17.73 ? 141 GLY B C   1 
ATOM   3730 O  O   . GLY B 2 141 ? 6.498   138.183 -12.367 1.00 17.09 ? 141 GLY B O   1 
ATOM   3731 N  N   . GLY B 2 142 ? 8.541   139.090 -12.638 1.00 17.97 ? 142 GLY B N   1 
ATOM   3732 C  CA  . GLY B 2 142 ? 8.600   139.596 -11.276 1.00 20.10 ? 142 GLY B CA  1 
ATOM   3733 C  C   . GLY B 2 142 ? 7.677   140.761 -10.986 1.00 20.85 ? 142 GLY B C   1 
ATOM   3734 O  O   . GLY B 2 142 ? 7.551   141.195 -9.842  1.00 19.73 ? 142 GLY B O   1 
ATOM   3735 N  N   . GLY B 2 143 ? 7.033   141.269 -12.028 1.00 22.32 ? 143 GLY B N   1 
ATOM   3736 C  CA  . GLY B 2 143 ? 6.120   142.385 -11.874 1.00 21.09 ? 143 GLY B CA  1 
ATOM   3737 C  C   . GLY B 2 143 ? 5.446   142.646 -13.206 1.00 21.67 ? 143 GLY B C   1 
ATOM   3738 O  O   . GLY B 2 143 ? 5.851   142.077 -14.220 1.00 19.64 ? 143 GLY B O   1 
ATOM   3739 N  N   . PRO B 2 144 ? 4.409   143.492 -13.242 1.00 22.84 ? 144 PRO B N   1 
ATOM   3740 C  CA  . PRO B 2 144 ? 3.720   143.781 -14.503 1.00 23.60 ? 144 PRO B CA  1 
ATOM   3741 C  C   . PRO B 2 144 ? 4.669   144.288 -15.593 1.00 23.03 ? 144 PRO B C   1 
ATOM   3742 O  O   . PRO B 2 144 ? 5.455   145.206 -15.367 1.00 21.42 ? 144 PRO B O   1 
ATOM   3743 C  CB  . PRO B 2 144 ? 2.692   144.835 -14.095 1.00 23.66 ? 144 PRO B CB  1 
ATOM   3744 C  CG  . PRO B 2 144 ? 2.369   144.447 -12.676 1.00 23.75 ? 144 PRO B CG  1 
ATOM   3745 C  CD  . PRO B 2 144 ? 3.747   144.173 -12.113 1.00 22.49 ? 144 PRO B CD  1 
ATOM   3746 N  N   . GLY B 2 145 ? 4.601   143.673 -16.770 1.00 23.78 ? 145 GLY B N   1 
ATOM   3747 C  CA  . GLY B 2 145 ? 5.448   144.100 -17.872 1.00 24.27 ? 145 GLY B CA  1 
ATOM   3748 C  C   . GLY B 2 145 ? 6.865   143.556 -17.884 1.00 25.01 ? 145 GLY B C   1 
ATOM   3749 O  O   . GLY B 2 145 ? 7.624   143.817 -18.819 1.00 25.05 ? 145 GLY B O   1 
ATOM   3750 N  N   . GLN B 2 146 ? 7.237   142.807 -16.852 1.00 23.01 ? 146 GLN B N   1 
ATOM   3751 C  CA  . GLN B 2 146 ? 8.577   142.240 -16.803 1.00 22.59 ? 146 GLN B CA  1 
ATOM   3752 C  C   . GLN B 2 146 ? 8.620   140.941 -17.603 1.00 22.13 ? 146 GLN B C   1 
ATOM   3753 O  O   . GLN B 2 146 ? 7.596   140.289 -17.799 1.00 21.44 ? 146 GLN B O   1 
ATOM   3754 C  CB  . GLN B 2 146 ? 8.990   141.979 -15.349 1.00 22.19 ? 146 GLN B CB  1 
ATOM   3755 C  CG  . GLN B 2 146 ? 9.244   143.250 -14.548 1.00 21.98 ? 146 GLN B CG  1 
ATOM   3756 C  CD  . GLN B 2 146 ? 9.561   142.972 -13.090 1.00 23.82 ? 146 GLN B CD  1 
ATOM   3757 O  OE1 . GLN B 2 146 ? 10.321  142.058 -12.773 1.00 21.02 ? 146 GLN B OE1 1 
ATOM   3758 N  NE2 . GLN B 2 146 ? 8.991   143.774 -12.195 1.00 21.51 ? 146 GLN B NE2 1 
ATOM   3759 N  N   . TYR B 2 147 ? 9.804   140.583 -18.086 1.00 21.57 ? 147 TYR B N   1 
ATOM   3760 C  CA  . TYR B 2 147 ? 9.973   139.348 -18.842 1.00 22.68 ? 147 TYR B CA  1 
ATOM   3761 C  C   . TYR B 2 147 ? 9.691   138.177 -17.905 1.00 22.35 ? 147 TYR B C   1 
ATOM   3762 O  O   . TYR B 2 147 ? 9.875   138.286 -16.690 1.00 21.94 ? 147 TYR B O   1 
ATOM   3763 C  CB  . TYR B 2 147 ? 11.407  139.240 -19.369 1.00 23.12 ? 147 TYR B CB  1 
ATOM   3764 C  CG  . TYR B 2 147 ? 11.747  140.219 -20.472 1.00 27.62 ? 147 TYR B CG  1 
ATOM   3765 C  CD1 . TYR B 2 147 ? 13.063  140.616 -20.694 1.00 30.18 ? 147 TYR B CD1 1 
ATOM   3766 C  CD2 . TYR B 2 147 ? 10.755  140.732 -21.306 1.00 31.82 ? 147 TYR B CD2 1 
ATOM   3767 C  CE1 . TYR B 2 147 ? 13.384  141.503 -21.723 1.00 34.74 ? 147 TYR B CE1 1 
ATOM   3768 C  CE2 . TYR B 2 147 ? 11.064  141.617 -22.338 1.00 34.04 ? 147 TYR B CE2 1 
ATOM   3769 C  CZ  . TYR B 2 147 ? 12.378  141.997 -22.541 1.00 35.54 ? 147 TYR B CZ  1 
ATOM   3770 O  OH  . TYR B 2 147 ? 12.681  142.868 -23.565 1.00 40.14 ? 147 TYR B OH  1 
ATOM   3771 N  N   . PRO B 2 148 ? 9.230   137.043 -18.454 1.00 20.80 ? 148 PRO B N   1 
ATOM   3772 C  CA  . PRO B 2 148 ? 8.948   135.880 -17.606 1.00 20.37 ? 148 PRO B CA  1 
ATOM   3773 C  C   . PRO B 2 148 ? 10.260  135.291 -17.073 1.00 20.24 ? 148 PRO B C   1 
ATOM   3774 O  O   . PRO B 2 148 ? 11.314  135.433 -17.696 1.00 20.69 ? 148 PRO B O   1 
ATOM   3775 C  CB  . PRO B 2 148 ? 8.209   134.939 -18.553 1.00 21.35 ? 148 PRO B CB  1 
ATOM   3776 C  CG  . PRO B 2 148 ? 8.857   135.237 -19.874 1.00 21.90 ? 148 PRO B CG  1 
ATOM   3777 C  CD  . PRO B 2 148 ? 8.937   136.752 -19.868 1.00 20.09 ? 148 PRO B CD  1 
ATOM   3778 N  N   . HIS B 2 149 ? 10.186  134.637 -15.918 1.00 19.02 ? 149 HIS B N   1 
ATOM   3779 C  CA  . HIS B 2 149 ? 11.350  134.047 -15.266 1.00 17.50 ? 149 HIS B CA  1 
ATOM   3780 C  C   . HIS B 2 149 ? 10.805  132.855 -14.466 1.00 18.83 ? 149 HIS B C   1 
ATOM   3781 O  O   . HIS B 2 149 ? 9.697   132.919 -13.921 1.00 16.92 ? 149 HIS B O   1 
ATOM   3782 C  CB  . HIS B 2 149 ? 11.971  135.119 -14.360 1.00 18.77 ? 149 HIS B CB  1 
ATOM   3783 C  CG  . HIS B 2 149 ? 13.277  134.739 -13.733 1.00 19.48 ? 149 HIS B CG  1 
ATOM   3784 N  ND1 . HIS B 2 149 ? 13.382  133.780 -12.747 1.00 19.25 ? 149 HIS B ND1 1 
ATOM   3785 C  CD2 . HIS B 2 149 ? 14.515  135.273 -13.871 1.00 19.47 ? 149 HIS B CD2 1 
ATOM   3786 C  CE1 . HIS B 2 149 ? 14.626  133.746 -12.299 1.00 18.88 ? 149 HIS B CE1 1 
ATOM   3787 N  NE2 . HIS B 2 149 ? 15.333  134.643 -12.964 1.00 20.75 ? 149 HIS B NE2 1 
ATOM   3788 N  N   . LEU B 2 150 ? 11.563  131.764 -14.408 1.00 17.65 ? 150 LEU B N   1 
ATOM   3789 C  CA  . LEU B 2 150 ? 11.100  130.572 -13.700 1.00 17.49 ? 150 LEU B CA  1 
ATOM   3790 C  C   . LEU B 2 150 ? 10.851  130.729 -12.206 1.00 17.67 ? 150 LEU B C   1 
ATOM   3791 O  O   . LEU B 2 150 ? 9.971   130.063 -11.661 1.00 18.29 ? 150 LEU B O   1 
ATOM   3792 C  CB  . LEU B 2 150 ? 12.057  129.399 -13.948 1.00 15.39 ? 150 LEU B CB  1 
ATOM   3793 C  CG  . LEU B 2 150 ? 11.834  128.720 -15.305 1.00 15.52 ? 150 LEU B CG  1 
ATOM   3794 C  CD1 . LEU B 2 150 ? 12.867  127.626 -15.537 1.00 14.76 ? 150 LEU B CD1 1 
ATOM   3795 C  CD2 . LEU B 2 150 ? 10.427  128.136 -15.335 1.00 17.00 ? 150 LEU B CD2 1 
ATOM   3796 N  N   . ALA B 2 151 ? 11.610  131.597 -11.539 1.00 16.83 ? 151 ALA B N   1 
ATOM   3797 C  CA  . ALA B 2 151 ? 11.413  131.796 -10.106 1.00 17.43 ? 151 ALA B CA  1 
ATOM   3798 C  C   . ALA B 2 151 ? 10.030  132.403 -9.863  1.00 18.70 ? 151 ALA B C   1 
ATOM   3799 O  O   . ALA B 2 151 ? 9.205   131.807 -9.168  1.00 18.57 ? 151 ALA B O   1 
ATOM   3800 C  CB  . ALA B 2 151 ? 12.514  132.689 -9.527  1.00 18.09 ? 151 ALA B CB  1 
ATOM   3801 N  N   . PRO B 2 152 ? 9.754   133.602 -10.418 1.00 18.79 ? 152 PRO B N   1 
ATOM   3802 C  CA  . PRO B 2 152 ? 8.417   134.163 -10.185 1.00 17.72 ? 152 PRO B CA  1 
ATOM   3803 C  C   . PRO B 2 152 ? 7.298   133.282 -10.764 1.00 18.13 ? 152 PRO B C   1 
ATOM   3804 O  O   . PRO B 2 152 ? 6.162   133.323 -10.292 1.00 17.61 ? 152 PRO B O   1 
ATOM   3805 C  CB  . PRO B 2 152 ? 8.492   135.551 -10.845 1.00 18.47 ? 152 PRO B CB  1 
ATOM   3806 C  CG  . PRO B 2 152 ? 9.637   135.435 -11.819 1.00 18.56 ? 152 PRO B CG  1 
ATOM   3807 C  CD  . PRO B 2 152 ? 10.630  134.590 -11.073 1.00 18.34 ? 152 PRO B CD  1 
ATOM   3808 N  N   . THR B 2 153 ? 7.616   132.486 -11.784 1.00 18.14 ? 153 THR B N   1 
ATOM   3809 C  CA  . THR B 2 153 ? 6.620   131.597 -12.383 1.00 16.48 ? 153 THR B CA  1 
ATOM   3810 C  C   . THR B 2 153 ? 6.252   130.526 -11.353 1.00 17.13 ? 153 THR B C   1 
ATOM   3811 O  O   . THR B 2 153 ? 5.077   130.226 -11.139 1.00 14.53 ? 153 THR B O   1 
ATOM   3812 C  CB  . THR B 2 153 ? 7.162   130.917 -13.669 1.00 16.41 ? 153 THR B CB  1 
ATOM   3813 O  OG1 . THR B 2 153 ? 7.335   131.907 -14.692 1.00 16.66 ? 153 THR B OG1 1 
ATOM   3814 C  CG2 . THR B 2 153 ? 6.193   129.846 -14.171 1.00 14.82 ? 153 THR B CG2 1 
ATOM   3815 N  N   . TYR B 2 154 ? 7.270   129.955 -10.718 1.00 17.79 ? 154 TYR B N   1 
ATOM   3816 C  CA  . TYR B 2 154 ? 7.071   128.940 -9.692  1.00 16.72 ? 154 TYR B CA  1 
ATOM   3817 C  C   . TYR B 2 154 ? 6.216   129.530 -8.570  1.00 16.88 ? 154 TYR B C   1 
ATOM   3818 O  O   . TYR B 2 154 ? 5.245   128.915 -8.118  1.00 16.09 ? 154 TYR B O   1 
ATOM   3819 C  CB  . TYR B 2 154 ? 8.429   128.506 -9.129  1.00 16.75 ? 154 TYR B CB  1 
ATOM   3820 C  CG  . TYR B 2 154 ? 8.358   127.770 -7.806  1.00 16.09 ? 154 TYR B CG  1 
ATOM   3821 C  CD1 . TYR B 2 154 ? 8.011   126.420 -7.747  1.00 17.14 ? 154 TYR B CD1 1 
ATOM   3822 C  CD2 . TYR B 2 154 ? 8.655   128.426 -6.614  1.00 16.20 ? 154 TYR B CD2 1 
ATOM   3823 C  CE1 . TYR B 2 154 ? 7.968   125.739 -6.524  1.00 16.26 ? 154 TYR B CE1 1 
ATOM   3824 C  CE2 . TYR B 2 154 ? 8.617   127.759 -5.391  1.00 17.04 ? 154 TYR B CE2 1 
ATOM   3825 C  CZ  . TYR B 2 154 ? 8.278   126.418 -5.352  1.00 17.26 ? 154 TYR B CZ  1 
ATOM   3826 O  OH  . TYR B 2 154 ? 8.289   125.757 -4.143  1.00 16.59 ? 154 TYR B OH  1 
ATOM   3827 N  N   . ALA B 2 155 ? 6.586   130.731 -8.137  1.00 14.51 ? 155 ALA B N   1 
ATOM   3828 C  CA  . ALA B 2 155 ? 5.886   131.424 -7.062  1.00 16.86 ? 155 ALA B CA  1 
ATOM   3829 C  C   . ALA B 2 155 ? 4.434   131.734 -7.400  1.00 17.33 ? 155 ALA B C   1 
ATOM   3830 O  O   . ALA B 2 155 ? 3.539   131.513 -6.582  1.00 18.70 ? 155 ALA B O   1 
ATOM   3831 C  CB  . ALA B 2 155 ? 6.624   132.717 -6.708  1.00 15.15 ? 155 ALA B CB  1 
ATOM   3832 N  N   . ALA B 2 156 ? 4.200   132.246 -8.603  1.00 16.19 ? 156 ALA B N   1 
ATOM   3833 C  CA  . ALA B 2 156 ? 2.846   132.591 -9.025  1.00 16.25 ? 156 ALA B CA  1 
ATOM   3834 C  C   . ALA B 2 156 ? 1.934   131.372 -9.071  1.00 16.56 ? 156 ALA B C   1 
ATOM   3835 O  O   . ALA B 2 156 ? 0.798   131.419 -8.595  1.00 17.11 ? 156 ALA B O   1 
ATOM   3836 C  CB  . ALA B 2 156 ? 2.879   133.270 -10.391 1.00 17.20 ? 156 ALA B CB  1 
ATOM   3837 N  N   . VAL B 2 157 ? 2.427   130.282 -9.650  1.00 16.28 ? 157 VAL B N   1 
ATOM   3838 C  CA  . VAL B 2 157 ? 1.641   129.062 -9.750  1.00 16.29 ? 157 VAL B CA  1 
ATOM   3839 C  C   . VAL B 2 157 ? 1.306   128.509 -8.358  1.00 16.88 ? 157 VAL B C   1 
ATOM   3840 O  O   . VAL B 2 157 ? 0.182   128.067 -8.119  1.00 18.28 ? 157 VAL B O   1 
ATOM   3841 C  CB  . VAL B 2 157 ? 2.388   127.997 -10.595 1.00 17.60 ? 157 VAL B CB  1 
ATOM   3842 C  CG1 . VAL B 2 157 ? 1.673   126.646 -10.512 1.00 15.72 ? 157 VAL B CG1 1 
ATOM   3843 C  CG2 . VAL B 2 157 ? 2.452   128.457 -12.056 1.00 17.46 ? 157 VAL B CG2 1 
ATOM   3844 N  N   . ASN B 2 158 ? 2.270   128.542 -7.440  1.00 17.81 ? 158 ASN B N   1 
ATOM   3845 C  CA  . ASN B 2 158 ? 2.037   128.052 -6.077  1.00 18.59 ? 158 ASN B CA  1 
ATOM   3846 C  C   . ASN B 2 158 ? 1.000   128.925 -5.359  1.00 18.44 ? 158 ASN B C   1 
ATOM   3847 O  O   . ASN B 2 158 ? 0.105   128.411 -4.688  1.00 17.74 ? 158 ASN B O   1 
ATOM   3848 C  CB  . ASN B 2 158 ? 3.344   128.049 -5.274  1.00 17.38 ? 158 ASN B CB  1 
ATOM   3849 C  CG  . ASN B 2 158 ? 4.024   126.689 -5.263  1.00 18.79 ? 158 ASN B CG  1 
ATOM   3850 O  OD1 . ASN B 2 158 ? 3.605   125.761 -5.959  1.00 16.33 ? 158 ASN B OD1 1 
ATOM   3851 N  ND2 . ASN B 2 158 ? 5.084   126.566 -4.468  1.00 18.47 ? 158 ASN B ND2 1 
ATOM   3852 N  N   . ALA B 2 159 ? 1.130   130.243 -5.503  1.00 17.33 ? 159 ALA B N   1 
ATOM   3853 C  CA  . ALA B 2 159 ? 0.200   131.182 -4.876  1.00 17.41 ? 159 ALA B CA  1 
ATOM   3854 C  C   . ALA B 2 159 ? -1.212  130.942 -5.405  1.00 18.90 ? 159 ALA B C   1 
ATOM   3855 O  O   . ALA B 2 159 ? -2.176  130.915 -4.638  1.00 19.84 ? 159 ALA B O   1 
ATOM   3856 C  CB  . ALA B 2 159 ? 0.628   132.622 -5.163  1.00 16.18 ? 159 ALA B CB  1 
ATOM   3857 N  N   . LEU B 2 160 ? -1.332  130.771 -6.718  1.00 17.96 ? 160 LEU B N   1 
ATOM   3858 C  CA  . LEU B 2 160 ? -2.636  130.524 -7.322  1.00 19.17 ? 160 LEU B CA  1 
ATOM   3859 C  C   . LEU B 2 160 ? -3.231  129.218 -6.808  1.00 19.88 ? 160 LEU B C   1 
ATOM   3860 O  O   . LEU B 2 160 ? -4.444  129.126 -6.587  1.00 19.93 ? 160 LEU B O   1 
ATOM   3861 C  CB  . LEU B 2 160 ? -2.523  130.490 -8.853  1.00 18.42 ? 160 LEU B CB  1 
ATOM   3862 C  CG  . LEU B 2 160 ? -2.241  131.843 -9.512  1.00 18.56 ? 160 LEU B CG  1 
ATOM   3863 C  CD1 . LEU B 2 160 ? -1.987  131.659 -11.002 1.00 19.60 ? 160 LEU B CD1 1 
ATOM   3864 C  CD2 . LEU B 2 160 ? -3.423  132.775 -9.286  1.00 16.68 ? 160 LEU B CD2 1 
ATOM   3865 N  N   . CYS B 2 161 ? -2.386  128.208 -6.609  1.00 18.24 ? 161 CYS B N   1 
ATOM   3866 C  CA  . CYS B 2 161 ? -2.872  126.926 -6.109  1.00 19.86 ? 161 CYS B CA  1 
ATOM   3867 C  C   . CYS B 2 161 ? -3.279  127.022 -4.637  1.00 20.34 ? 161 CYS B C   1 
ATOM   3868 O  O   . CYS B 2 161 ? -4.198  126.331 -4.198  1.00 20.47 ? 161 CYS B O   1 
ATOM   3869 C  CB  . CYS B 2 161 ? -1.818  125.831 -6.319  1.00 17.85 ? 161 CYS B CB  1 
ATOM   3870 S  SG  . CYS B 2 161 ? -1.655  125.363 -8.068  1.00 20.60 ? 161 CYS B SG  1 
ATOM   3871 N  N   . ILE B 2 162 ? -2.607  127.881 -3.877  1.00 19.45 ? 162 ILE B N   1 
ATOM   3872 C  CA  . ILE B 2 162 ? -2.967  128.066 -2.473  1.00 19.56 ? 162 ILE B CA  1 
ATOM   3873 C  C   . ILE B 2 162 ? -4.375  128.688 -2.422  1.00 21.48 ? 162 ILE B C   1 
ATOM   3874 O  O   . ILE B 2 162 ? -5.204  128.303 -1.599  1.00 21.03 ? 162 ILE B O   1 
ATOM   3875 C  CB  . ILE B 2 162 ? -1.945  128.970 -1.748  1.00 19.99 ? 162 ILE B CB  1 
ATOM   3876 C  CG1 . ILE B 2 162 ? -0.597  128.240 -1.659  1.00 19.40 ? 162 ILE B CG1 1 
ATOM   3877 C  CG2 . ILE B 2 162 ? -2.455  129.336 -0.347  1.00 18.12 ? 162 ILE B CG2 1 
ATOM   3878 C  CD1 . ILE B 2 162 ? 0.540   129.075 -1.102  1.00 16.48 ? 162 ILE B CD1 1 
ATOM   3879 N  N   . ILE B 2 163 ? -4.646  129.643 -3.309  1.00 21.25 ? 163 ILE B N   1 
ATOM   3880 C  CA  . ILE B 2 163 ? -5.968  130.262 -3.358  1.00 23.00 ? 163 ILE B CA  1 
ATOM   3881 C  C   . ILE B 2 163 ? -6.946  129.153 -3.742  1.00 23.60 ? 163 ILE B C   1 
ATOM   3882 O  O   . ILE B 2 163 ? -8.024  129.038 -3.169  1.00 24.60 ? 163 ILE B O   1 
ATOM   3883 C  CB  . ILE B 2 163 ? -6.003  131.415 -4.385  1.00 22.57 ? 163 ILE B CB  1 
ATOM   3884 C  CG1 . ILE B 2 163 ? -5.111  132.556 -3.886  1.00 22.68 ? 163 ILE B CG1 1 
ATOM   3885 C  CG2 . ILE B 2 163 ? -7.430  131.909 -4.584  1.00 22.80 ? 163 ILE B CG2 1 
ATOM   3886 C  CD1 . ILE B 2 163 ? -5.003  133.721 -4.835  1.00 24.68 ? 163 ILE B CD1 1 
ATOM   3887 N  N   . GLY B 2 164 ? -6.545  128.339 -4.714  1.00 24.31 ? 164 GLY B N   1 
ATOM   3888 C  CA  . GLY B 2 164 ? -7.334  127.193 -5.137  1.00 24.93 ? 164 GLY B CA  1 
ATOM   3889 C  C   . GLY B 2 164 ? -8.727  127.340 -5.714  1.00 26.42 ? 164 GLY B C   1 
ATOM   3890 O  O   . GLY B 2 164 ? -9.484  126.372 -5.729  1.00 26.31 ? 164 GLY B O   1 
ATOM   3891 N  N   . THR B 2 165 ? -9.081  128.525 -6.189  1.00 27.38 ? 165 THR B N   1 
ATOM   3892 C  CA  . THR B 2 165 ? -10.400 128.717 -6.773  1.00 28.23 ? 165 THR B CA  1 
ATOM   3893 C  C   . THR B 2 165 ? -10.264 128.528 -8.275  1.00 29.81 ? 165 THR B C   1 
ATOM   3894 O  O   . THR B 2 165 ? -9.170  128.670 -8.819  1.00 29.65 ? 165 THR B O   1 
ATOM   3895 C  CB  . THR B 2 165 ? -10.932 130.127 -6.500  1.00 27.69 ? 165 THR B CB  1 
ATOM   3896 O  OG1 . THR B 2 165 ? -10.017 131.090 -7.041  1.00 27.72 ? 165 THR B OG1 1 
ATOM   3897 C  CG2 . THR B 2 165 ? -11.085 130.358 -4.998  1.00 27.05 ? 165 THR B CG2 1 
ATOM   3898 N  N   . GLU B 2 166 ? -11.360 128.197 -8.949  1.00 30.32 ? 166 GLU B N   1 
ATOM   3899 C  CA  . GLU B 2 166 ? -11.297 128.022 -10.392 1.00 32.18 ? 166 GLU B CA  1 
ATOM   3900 C  C   . GLU B 2 166 ? -10.844 129.323 -11.044 1.00 30.70 ? 166 GLU B C   1 
ATOM   3901 O  O   . GLU B 2 166 ? -10.207 129.312 -12.099 1.00 29.91 ? 166 GLU B O   1 
ATOM   3902 C  CB  . GLU B 2 166 ? -12.653 127.574 -10.943 1.00 36.02 ? 166 GLU B CB  1 
ATOM   3903 C  CG  . GLU B 2 166 ? -12.899 126.083 -10.745 1.00 43.19 ? 166 GLU B CG  1 
ATOM   3904 C  CD  . GLU B 2 166 ? -14.183 125.604 -11.386 1.00 47.30 ? 166 GLU B CD  1 
ATOM   3905 O  OE1 . GLU B 2 166 ? -14.393 125.884 -12.587 1.00 49.97 ? 166 GLU B OE1 1 
ATOM   3906 O  OE2 . GLU B 2 166 ? -14.978 124.940 -10.688 1.00 49.81 ? 166 GLU B OE2 1 
ATOM   3907 N  N   . GLU B 2 167 ? -11.164 130.442 -10.403 1.00 28.94 ? 167 GLU B N   1 
ATOM   3908 C  CA  . GLU B 2 167 ? -10.752 131.742 -10.912 1.00 28.55 ? 167 GLU B CA  1 
ATOM   3909 C  C   . GLU B 2 167 ? -9.224  131.789 -10.942 1.00 26.88 ? 167 GLU B C   1 
ATOM   3910 O  O   . GLU B 2 167 ? -8.622  132.235 -11.918 1.00 25.51 ? 167 GLU B O   1 
ATOM   3911 C  CB  . GLU B 2 167 ? -11.278 132.863 -10.009 1.00 31.62 ? 167 GLU B CB  1 
ATOM   3912 C  CG  . GLU B 2 167 ? -10.604 134.212 -10.251 1.00 36.69 ? 167 GLU B CG  1 
ATOM   3913 C  CD  . GLU B 2 167 ? -11.108 135.310 -9.326  1.00 40.03 ? 167 GLU B CD  1 
ATOM   3914 O  OE1 . GLU B 2 167 ? -11.110 135.114 -8.093  1.00 41.39 ? 167 GLU B OE1 1 
ATOM   3915 O  OE2 . GLU B 2 167 ? -11.495 136.380 -9.836  1.00 44.57 ? 167 GLU B OE2 1 
ATOM   3916 N  N   . ALA B 2 168 ? -8.607  131.323 -9.861  1.00 24.91 ? 168 ALA B N   1 
ATOM   3917 C  CA  . ALA B 2 168 ? -7.152  131.310 -9.749  1.00 24.21 ? 168 ALA B CA  1 
ATOM   3918 C  C   . ALA B 2 168 ? -6.523  130.336 -10.743 1.00 23.34 ? 168 ALA B C   1 
ATOM   3919 O  O   . ALA B 2 168 ? -5.573  130.682 -11.442 1.00 24.86 ? 168 ALA B O   1 
ATOM   3920 C  CB  . ALA B 2 168 ? -6.742  130.947 -8.316  1.00 22.29 ? 168 ALA B CB  1 
ATOM   3921 N  N   . TYR B 2 169 ? -7.055  129.119 -10.798 1.00 22.92 ? 169 TYR B N   1 
ATOM   3922 C  CA  . TYR B 2 169 ? -6.552  128.094 -11.710 1.00 23.47 ? 169 TYR B CA  1 
ATOM   3923 C  C   . TYR B 2 169 ? -6.576  128.559 -13.159 1.00 24.42 ? 169 TYR B C   1 
ATOM   3924 O  O   . TYR B 2 169 ? -5.613  128.364 -13.899 1.00 24.60 ? 169 TYR B O   1 
ATOM   3925 C  CB  . TYR B 2 169 ? -7.409  126.829 -11.628 1.00 22.71 ? 169 TYR B CB  1 
ATOM   3926 C  CG  . TYR B 2 169 ? -7.396  126.100 -10.309 1.00 23.21 ? 169 TYR B CG  1 
ATOM   3927 C  CD1 . TYR B 2 169 ? -8.509  125.367 -9.898  1.00 21.82 ? 169 TYR B CD1 1 
ATOM   3928 C  CD2 . TYR B 2 169 ? -6.268  126.104 -9.484  1.00 22.72 ? 169 TYR B CD2 1 
ATOM   3929 C  CE1 . TYR B 2 169 ? -8.506  124.656 -8.702  1.00 23.75 ? 169 TYR B CE1 1 
ATOM   3930 C  CE2 . TYR B 2 169 ? -6.253  125.392 -8.280  1.00 22.44 ? 169 TYR B CE2 1 
ATOM   3931 C  CZ  . TYR B 2 169 ? -7.377  124.671 -7.898  1.00 23.52 ? 169 TYR B CZ  1 
ATOM   3932 O  OH  . TYR B 2 169 ? -7.380  123.959 -6.720  1.00 24.37 ? 169 TYR B OH  1 
ATOM   3933 N  N   . ASP B 2 170 ? -7.690  129.163 -13.562 1.00 24.65 ? 170 ASP B N   1 
ATOM   3934 C  CA  . ASP B 2 170 ? -7.859  129.608 -14.941 1.00 25.75 ? 170 ASP B CA  1 
ATOM   3935 C  C   . ASP B 2 170 ? -7.004  130.790 -15.378 1.00 25.07 ? 170 ASP B C   1 
ATOM   3936 O  O   . ASP B 2 170 ? -6.924  131.084 -16.568 1.00 24.66 ? 170 ASP B O   1 
ATOM   3937 C  CB  . ASP B 2 170 ? -9.333  129.901 -15.220 1.00 27.69 ? 170 ASP B CB  1 
ATOM   3938 C  CG  . ASP B 2 170 ? -10.211 128.673 -15.055 1.00 32.63 ? 170 ASP B CG  1 
ATOM   3939 O  OD1 . ASP B 2 170 ? -9.733  127.552 -15.343 1.00 33.38 ? 170 ASP B OD1 1 
ATOM   3940 O  OD2 . ASP B 2 170 ? -11.383 128.828 -14.649 1.00 35.37 ? 170 ASP B OD2 1 
ATOM   3941 N  N   . ILE B 2 171 ? -6.370  131.467 -14.427 1.00 24.74 ? 171 ILE B N   1 
ATOM   3942 C  CA  . ILE B 2 171 ? -5.504  132.592 -14.759 1.00 24.17 ? 171 ILE B CA  1 
ATOM   3943 C  C   . ILE B 2 171 ? -4.347  132.077 -15.619 1.00 23.48 ? 171 ILE B C   1 
ATOM   3944 O  O   . ILE B 2 171 ? -3.956  132.699 -16.606 1.00 21.68 ? 171 ILE B O   1 
ATOM   3945 C  CB  . ILE B 2 171 ? -4.897  133.236 -13.489 1.00 25.40 ? 171 ILE B CB  1 
ATOM   3946 C  CG1 . ILE B 2 171 ? -5.976  133.983 -12.700 1.00 28.13 ? 171 ILE B CG1 1 
ATOM   3947 C  CG2 . ILE B 2 171 ? -3.762  134.175 -13.872 1.00 25.75 ? 171 ILE B CG2 1 
ATOM   3948 C  CD1 . ILE B 2 171 ? -6.641  135.101 -13.479 1.00 28.88 ? 171 ILE B CD1 1 
ATOM   3949 N  N   . ILE B 2 172 ? -3.812  130.924 -15.236 1.00 22.31 ? 172 ILE B N   1 
ATOM   3950 C  CA  . ILE B 2 172 ? -2.682  130.332 -15.934 1.00 21.39 ? 172 ILE B CA  1 
ATOM   3951 C  C   . ILE B 2 172 ? -2.944  129.982 -17.396 1.00 21.71 ? 172 ILE B C   1 
ATOM   3952 O  O   . ILE B 2 172 ? -3.861  129.227 -17.710 1.00 23.07 ? 172 ILE B O   1 
ATOM   3953 C  CB  . ILE B 2 172 ? -2.205  129.051 -15.210 1.00 22.93 ? 172 ILE B CB  1 
ATOM   3954 C  CG1 . ILE B 2 172 ? -1.978  129.350 -13.725 1.00 22.23 ? 172 ILE B CG1 1 
ATOM   3955 C  CG2 . ILE B 2 172 ? -0.919  128.529 -15.860 1.00 20.01 ? 172 ILE B CG2 1 
ATOM   3956 C  CD1 . ILE B 2 172 ? -1.680  128.118 -12.882 1.00 23.23 ? 172 ILE B CD1 1 
ATOM   3957 N  N   . ASN B 2 173 ? -2.134  130.545 -18.285 1.00 20.65 ? 173 ASN B N   1 
ATOM   3958 C  CA  . ASN B 2 173 ? -2.238  130.253 -19.708 1.00 19.92 ? 173 ASN B CA  1 
ATOM   3959 C  C   . ASN B 2 173 ? -1.336  129.032 -19.886 1.00 19.35 ? 173 ASN B C   1 
ATOM   3960 O  O   . ASN B 2 173 ? -0.128  129.164 -20.086 1.00 18.69 ? 173 ASN B O   1 
ATOM   3961 C  CB  . ASN B 2 173 ? -1.701  131.421 -20.538 1.00 21.04 ? 173 ASN B CB  1 
ATOM   3962 C  CG  . ASN B 2 173 ? -1.850  131.191 -22.027 1.00 22.70 ? 173 ASN B CG  1 
ATOM   3963 O  OD1 . ASN B 2 173 ? -1.775  130.057 -22.505 1.00 22.99 ? 173 ASN B OD1 1 
ATOM   3964 N  ND2 . ASN B 2 173 ? -2.048  132.270 -22.773 1.00 22.69 ? 173 ASN B ND2 1 
ATOM   3965 N  N   . ARG B 2 174 ? -1.932  127.849 -19.800 1.00 17.83 ? 174 ARG B N   1 
ATOM   3966 C  CA  . ARG B 2 174 ? -1.195  126.600 -19.906 1.00 18.56 ? 174 ARG B CA  1 
ATOM   3967 C  C   . ARG B 2 174 ? -0.502  126.364 -21.243 1.00 19.00 ? 174 ARG B C   1 
ATOM   3968 O  O   . ARG B 2 174 ? 0.604   125.821 -21.276 1.00 19.55 ? 174 ARG B O   1 
ATOM   3969 C  CB  . ARG B 2 174 ? -2.130  125.432 -19.566 1.00 19.76 ? 174 ARG B CB  1 
ATOM   3970 C  CG  . ARG B 2 174 ? -2.677  125.525 -18.144 1.00 19.90 ? 174 ARG B CG  1 
ATOM   3971 C  CD  . ARG B 2 174 ? -3.767  124.501 -17.838 1.00 22.51 ? 174 ARG B CD  1 
ATOM   3972 N  NE  . ARG B 2 174 ? -3.299  123.120 -17.923 1.00 21.61 ? 174 ARG B NE  1 
ATOM   3973 C  CZ  . ARG B 2 174 ? -3.528  122.318 -18.956 1.00 23.64 ? 174 ARG B CZ  1 
ATOM   3974 N  NH1 . ARG B 2 174 ? -4.221  122.758 -19.999 1.00 19.37 ? 174 ARG B NH1 1 
ATOM   3975 N  NH2 . ARG B 2 174 ? -3.071  121.072 -18.942 1.00 22.79 ? 174 ARG B NH2 1 
ATOM   3976 N  N   . GLU B 2 175 ? -1.144  126.758 -22.342 1.00 20.86 ? 175 GLU B N   1 
ATOM   3977 C  CA  . GLU B 2 175 ? -0.550  126.581 -23.666 1.00 21.46 ? 175 GLU B CA  1 
ATOM   3978 C  C   . GLU B 2 175 ? 0.771   127.341 -23.769 1.00 21.47 ? 175 GLU B C   1 
ATOM   3979 O  O   . GLU B 2 175 ? 1.779   126.787 -24.201 1.00 21.73 ? 175 GLU B O   1 
ATOM   3980 C  CB  . GLU B 2 175 ? -1.492  127.087 -24.767 1.00 25.09 ? 175 GLU B CB  1 
ATOM   3981 C  CG  . GLU B 2 175 ? -2.783  126.297 -24.962 1.00 29.94 ? 175 GLU B CG  1 
ATOM   3982 C  CD  . GLU B 2 175 ? -3.740  126.394 -23.782 1.00 33.83 ? 175 GLU B CD  1 
ATOM   3983 O  OE1 . GLU B 2 175 ? -3.744  127.435 -23.086 1.00 32.33 ? 175 GLU B OE1 1 
ATOM   3984 O  OE2 . GLU B 2 175 ? -4.507  125.429 -23.564 1.00 36.60 ? 175 GLU B OE2 1 
ATOM   3985 N  N   . LYS B 2 176 ? 0.764   128.614 -23.376 1.00 19.80 ? 176 LYS B N   1 
ATOM   3986 C  CA  . LYS B 2 176 ? 1.972   129.431 -23.443 1.00 21.48 ? 176 LYS B CA  1 
ATOM   3987 C  C   . LYS B 2 176 ? 3.000   129.032 -22.391 1.00 20.94 ? 176 LYS B C   1 
ATOM   3988 O  O   . LYS B 2 176 ? 4.204   129.158 -22.618 1.00 20.73 ? 176 LYS B O   1 
ATOM   3989 C  CB  . LYS B 2 176 ? 1.633   130.920 -23.289 1.00 22.49 ? 176 LYS B CB  1 
ATOM   3990 C  CG  . LYS B 2 176 ? 0.722   131.476 -24.376 1.00 26.56 ? 176 LYS B CG  1 
ATOM   3991 C  CD  . LYS B 2 176 ? 1.272   131.234 -25.784 1.00 29.29 ? 176 LYS B CD  1 
ATOM   3992 C  CE  . LYS B 2 176 ? 2.577   131.977 -26.021 1.00 33.14 ? 176 LYS B CE  1 
ATOM   3993 N  NZ  . LYS B 2 176 ? 2.989   131.934 -27.459 1.00 34.48 ? 176 LYS B NZ  1 
ATOM   3994 N  N   . LEU B 2 177 ? 2.534   128.556 -21.240 1.00 20.08 ? 177 LEU B N   1 
ATOM   3995 C  CA  . LEU B 2 177 ? 3.462   128.143 -20.192 1.00 19.47 ? 177 LEU B CA  1 
ATOM   3996 C  C   . LEU B 2 177 ? 4.345   127.014 -20.711 1.00 18.32 ? 177 LEU B C   1 
ATOM   3997 O  O   . LEU B 2 177 ? 5.561   127.051 -20.542 1.00 19.47 ? 177 LEU B O   1 
ATOM   3998 C  CB  . LEU B 2 177 ? 2.711   127.673 -18.940 1.00 17.89 ? 177 LEU B CB  1 
ATOM   3999 C  CG  . LEU B 2 177 ? 3.579   127.166 -17.775 1.00 19.56 ? 177 LEU B CG  1 
ATOM   4000 C  CD1 . LEU B 2 177 ? 4.590   128.237 -17.366 1.00 14.37 ? 177 LEU B CD1 1 
ATOM   4001 C  CD2 . LEU B 2 177 ? 2.685   126.788 -16.591 1.00 16.34 ? 177 LEU B CD2 1 
ATOM   4002 N  N   . LEU B 2 178 ? 3.736   126.017 -21.349 1.00 19.47 ? 178 LEU B N   1 
ATOM   4003 C  CA  . LEU B 2 178 ? 4.497   124.885 -21.875 1.00 19.19 ? 178 LEU B CA  1 
ATOM   4004 C  C   . LEU B 2 178 ? 5.461   125.341 -22.965 1.00 19.62 ? 178 LEU B C   1 
ATOM   4005 O  O   . LEU B 2 178 ? 6.612   124.903 -23.013 1.00 20.10 ? 178 LEU B O   1 
ATOM   4006 C  CB  . LEU B 2 178 ? 3.557   123.802 -22.423 1.00 19.02 ? 178 LEU B CB  1 
ATOM   4007 C  CG  . LEU B 2 178 ? 4.249   122.527 -22.935 1.00 18.62 ? 178 LEU B CG  1 
ATOM   4008 C  CD1 . LEU B 2 178 ? 5.177   121.968 -21.855 1.00 18.57 ? 178 LEU B CD1 1 
ATOM   4009 C  CD2 . LEU B 2 178 ? 3.202   121.488 -23.333 1.00 18.47 ? 178 LEU B CD2 1 
ATOM   4010 N  N   . GLN B 2 179 ? 4.996   126.221 -23.842 1.00 19.32 ? 179 GLN B N   1 
ATOM   4011 C  CA  . GLN B 2 179 ? 5.857   126.733 -24.899 1.00 20.11 ? 179 GLN B CA  1 
ATOM   4012 C  C   . GLN B 2 179 ? 7.034   127.472 -24.271 1.00 18.99 ? 179 GLN B C   1 
ATOM   4013 O  O   . GLN B 2 179 ? 8.170   127.358 -24.727 1.00 19.27 ? 179 GLN B O   1 
ATOM   4014 C  CB  . GLN B 2 179 ? 5.072   127.674 -25.809 1.00 21.74 ? 179 GLN B CB  1 
ATOM   4015 C  CG  . GLN B 2 179 ? 4.134   126.943 -26.751 1.00 24.99 ? 179 GLN B CG  1 
ATOM   4016 C  CD  . GLN B 2 179 ? 3.342   127.887 -27.624 1.00 29.21 ? 179 GLN B CD  1 
ATOM   4017 O  OE1 . GLN B 2 179 ? 3.878   128.863 -28.145 1.00 30.03 ? 179 GLN B OE1 1 
ATOM   4018 N  NE2 . GLN B 2 179 ? 2.059   127.596 -27.799 1.00 30.61 ? 179 GLN B NE2 1 
ATOM   4019 N  N   . TYR B 2 180 ? 6.753   128.229 -23.217 1.00 18.67 ? 180 TYR B N   1 
ATOM   4020 C  CA  . TYR B 2 180 ? 7.792   128.966 -22.518 1.00 18.00 ? 180 TYR B CA  1 
ATOM   4021 C  C   . TYR B 2 180 ? 8.841   128.004 -21.939 1.00 17.92 ? 180 TYR B C   1 
ATOM   4022 O  O   . TYR B 2 180 ? 10.044  128.225 -22.086 1.00 17.68 ? 180 TYR B O   1 
ATOM   4023 C  CB  . TYR B 2 180 ? 7.176   129.807 -21.397 1.00 18.60 ? 180 TYR B CB  1 
ATOM   4024 C  CG  . TYR B 2 180 ? 8.207   130.561 -20.596 1.00 19.85 ? 180 TYR B CG  1 
ATOM   4025 C  CD1 . TYR B 2 180 ? 9.083   131.449 -21.219 1.00 20.90 ? 180 TYR B CD1 1 
ATOM   4026 C  CD2 . TYR B 2 180 ? 8.330   130.366 -19.221 1.00 20.82 ? 180 TYR B CD2 1 
ATOM   4027 C  CE1 . TYR B 2 180 ? 10.061  132.124 -20.496 1.00 22.51 ? 180 TYR B CE1 1 
ATOM   4028 C  CE2 . TYR B 2 180 ? 9.303   131.039 -18.484 1.00 23.33 ? 180 TYR B CE2 1 
ATOM   4029 C  CZ  . TYR B 2 180 ? 10.166  131.916 -19.129 1.00 23.33 ? 180 TYR B CZ  1 
ATOM   4030 O  OH  . TYR B 2 180 ? 11.138  132.581 -18.414 1.00 24.58 ? 180 TYR B OH  1 
ATOM   4031 N  N   . LEU B 2 181 ? 8.390   126.939 -21.280 1.00 17.60 ? 181 LEU B N   1 
ATOM   4032 C  CA  . LEU B 2 181 ? 9.328   125.971 -20.716 1.00 17.71 ? 181 LEU B CA  1 
ATOM   4033 C  C   . LEU B 2 181 ? 10.211  125.404 -21.829 1.00 19.38 ? 181 LEU B C   1 
ATOM   4034 O  O   . LEU B 2 181 ? 11.422  125.252 -21.658 1.00 19.65 ? 181 LEU B O   1 
ATOM   4035 C  CB  . LEU B 2 181 ? 8.569   124.845 -20.001 1.00 18.15 ? 181 LEU B CB  1 
ATOM   4036 C  CG  . LEU B 2 181 ? 7.750   125.260 -18.769 1.00 17.36 ? 181 LEU B CG  1 
ATOM   4037 C  CD1 . LEU B 2 181 ? 7.094   124.037 -18.147 1.00 17.65 ? 181 LEU B CD1 1 
ATOM   4038 C  CD2 . LEU B 2 181 ? 8.660   125.940 -17.752 1.00 17.66 ? 181 LEU B CD2 1 
ATOM   4039 N  N   . TYR B 2 182 ? 9.606   125.103 -22.976 1.00 18.85 ? 182 TYR B N   1 
ATOM   4040 C  CA  . TYR B 2 182 ? 10.360  124.578 -24.110 1.00 19.47 ? 182 TYR B CA  1 
ATOM   4041 C  C   . TYR B 2 182 ? 11.447  125.567 -24.519 1.00 19.02 ? 182 TYR B C   1 
ATOM   4042 O  O   . TYR B 2 182 ? 12.572  125.171 -24.835 1.00 19.13 ? 182 TYR B O   1 
ATOM   4043 C  CB  . TYR B 2 182 ? 9.429   124.321 -25.307 1.00 21.10 ? 182 TYR B CB  1 
ATOM   4044 C  CG  . TYR B 2 182 ? 8.856   122.919 -25.369 1.00 23.02 ? 182 TYR B CG  1 
ATOM   4045 C  CD1 . TYR B 2 182 ? 8.220   122.350 -24.265 1.00 22.60 ? 182 TYR B CD1 1 
ATOM   4046 C  CD2 . TYR B 2 182 ? 8.958   122.157 -26.534 1.00 23.81 ? 182 TYR B CD2 1 
ATOM   4047 C  CE1 . TYR B 2 182 ? 7.703   121.049 -24.320 1.00 24.27 ? 182 TYR B CE1 1 
ATOM   4048 C  CE2 . TYR B 2 182 ? 8.442   120.856 -26.601 1.00 23.26 ? 182 TYR B CE2 1 
ATOM   4049 C  CZ  . TYR B 2 182 ? 7.818   120.309 -25.492 1.00 23.66 ? 182 TYR B CZ  1 
ATOM   4050 O  OH  . TYR B 2 182 ? 7.318   119.025 -25.551 1.00 21.43 ? 182 TYR B OH  1 
ATOM   4051 N  N   . SER B 2 183 ? 11.110  126.856 -24.501 1.00 18.74 ? 183 SER B N   1 
ATOM   4052 C  CA  . SER B 2 183 ? 12.054  127.901 -24.895 1.00 18.99 ? 183 SER B CA  1 
ATOM   4053 C  C   . SER B 2 183 ? 13.243  128.041 -23.947 1.00 18.44 ? 183 SER B C   1 
ATOM   4054 O  O   . SER B 2 183 ? 14.200  128.753 -24.252 1.00 18.62 ? 183 SER B O   1 
ATOM   4055 C  CB  . SER B 2 183 ? 11.334  129.253 -25.008 1.00 19.64 ? 183 SER B CB  1 
ATOM   4056 O  OG  . SER B 2 183 ? 11.120  129.831 -23.732 1.00 18.82 ? 183 SER B OG  1 
ATOM   4057 N  N   . LEU B 2 184 ? 13.183  127.371 -22.800 1.00 18.20 ? 184 LEU B N   1 
ATOM   4058 C  CA  . LEU B 2 184 ? 14.270  127.435 -21.824 1.00 18.97 ? 184 LEU B CA  1 
ATOM   4059 C  C   . LEU B 2 184 ? 15.056  126.132 -21.729 1.00 18.85 ? 184 LEU B C   1 
ATOM   4060 O  O   . LEU B 2 184 ? 16.127  126.102 -21.134 1.00 20.42 ? 184 LEU B O   1 
ATOM   4061 C  CB  . LEU B 2 184 ? 13.723  127.764 -20.431 1.00 18.32 ? 184 LEU B CB  1 
ATOM   4062 C  CG  . LEU B 2 184 ? 12.912  129.055 -20.268 1.00 19.82 ? 184 LEU B CG  1 
ATOM   4063 C  CD1 . LEU B 2 184 ? 12.370  129.128 -18.841 1.00 19.29 ? 184 LEU B CD1 1 
ATOM   4064 C  CD2 . LEU B 2 184 ? 13.783  130.267 -20.586 1.00 18.68 ? 184 LEU B CD2 1 
ATOM   4065 N  N   . LYS B 2 185 ? 14.520  125.064 -22.313 1.00 18.98 ? 185 LYS B N   1 
ATOM   4066 C  CA  . LYS B 2 185 ? 15.155  123.747 -22.256 1.00 20.48 ? 185 LYS B CA  1 
ATOM   4067 C  C   . LYS B 2 185 ? 16.439  123.649 -23.070 1.00 22.60 ? 185 LYS B C   1 
ATOM   4068 O  O   . LYS B 2 185 ? 16.460  123.997 -24.255 1.00 22.53 ? 185 LYS B O   1 
ATOM   4069 C  CB  . LYS B 2 185 ? 14.170  122.670 -22.728 1.00 20.92 ? 185 LYS B CB  1 
ATOM   4070 C  CG  . LYS B 2 185 ? 14.733  121.247 -22.731 1.00 20.64 ? 185 LYS B CG  1 
ATOM   4071 C  CD  . LYS B 2 185 ? 14.998  120.746 -21.316 1.00 23.35 ? 185 LYS B CD  1 
ATOM   4072 C  CE  . LYS B 2 185 ? 15.613  119.350 -21.318 1.00 23.26 ? 185 LYS B CE  1 
ATOM   4073 N  NZ  . LYS B 2 185 ? 14.764  118.367 -22.040 1.00 22.37 ? 185 LYS B NZ  1 
ATOM   4074 N  N   . GLN B 2 186 ? 17.498  123.163 -22.421 1.00 21.75 ? 186 GLN B N   1 
ATOM   4075 C  CA  . GLN B 2 186 ? 18.809  122.993 -23.047 1.00 23.03 ? 186 GLN B CA  1 
ATOM   4076 C  C   . GLN B 2 186 ? 19.028  121.536 -23.461 1.00 24.67 ? 186 GLN B C   1 
ATOM   4077 O  O   . GLN B 2 186 ? 18.417  120.622 -22.907 1.00 24.75 ? 186 GLN B O   1 
ATOM   4078 C  CB  . GLN B 2 186 ? 19.915  123.407 -22.072 1.00 24.03 ? 186 GLN B CB  1 
ATOM   4079 C  CG  . GLN B 2 186 ? 19.769  124.817 -21.527 1.00 26.74 ? 186 GLN B CG  1 
ATOM   4080 C  CD  . GLN B 2 186 ? 19.946  125.870 -22.598 1.00 29.32 ? 186 GLN B CD  1 
ATOM   4081 O  OE1 . GLN B 2 186 ? 21.057  126.096 -23.083 1.00 30.13 ? 186 GLN B OE1 1 
ATOM   4082 N  NE2 . GLN B 2 186 ? 18.847  126.518 -22.984 1.00 28.32 ? 186 GLN B NE2 1 
ATOM   4083 N  N   . PRO B 2 187 ? 19.913  121.305 -24.443 1.00 26.27 ? 187 PRO B N   1 
ATOM   4084 C  CA  . PRO B 2 187 ? 20.228  119.963 -24.945 1.00 27.08 ? 187 PRO B CA  1 
ATOM   4085 C  C   . PRO B 2 187 ? 20.758  118.999 -23.877 1.00 26.23 ? 187 PRO B C   1 
ATOM   4086 O  O   . PRO B 2 187 ? 20.495  117.799 -23.938 1.00 26.36 ? 187 PRO B O   1 
ATOM   4087 C  CB  . PRO B 2 187 ? 21.273  120.238 -26.027 1.00 27.65 ? 187 PRO B CB  1 
ATOM   4088 C  CG  . PRO B 2 187 ? 20.900  121.599 -26.520 1.00 29.63 ? 187 PRO B CG  1 
ATOM   4089 C  CD  . PRO B 2 187 ? 20.610  122.334 -25.235 1.00 27.64 ? 187 PRO B CD  1 
ATOM   4090 N  N   . ASP B 2 188 ? 21.502  119.520 -22.905 1.00 25.70 ? 188 ASP B N   1 
ATOM   4091 C  CA  . ASP B 2 188 ? 22.072  118.678 -21.855 1.00 25.03 ? 188 ASP B CA  1 
ATOM   4092 C  C   . ASP B 2 188 ? 21.106  118.337 -20.722 1.00 24.31 ? 188 ASP B C   1 
ATOM   4093 O  O   . ASP B 2 188 ? 21.504  117.728 -19.729 1.00 23.49 ? 188 ASP B O   1 
ATOM   4094 C  CB  . ASP B 2 188 ? 23.335  119.331 -21.271 1.00 25.35 ? 188 ASP B CB  1 
ATOM   4095 C  CG  . ASP B 2 188 ? 23.040  120.598 -20.492 1.00 27.30 ? 188 ASP B CG  1 
ATOM   4096 O  OD1 . ASP B 2 188 ? 24.009  121.229 -20.013 1.00 25.47 ? 188 ASP B OD1 1 
ATOM   4097 O  OD2 . ASP B 2 188 ? 21.851  120.966 -20.352 1.00 25.47 ? 188 ASP B OD2 1 
ATOM   4098 N  N   . GLY B 2 189 ? 19.843  118.731 -20.871 1.00 22.74 ? 189 GLY B N   1 
ATOM   4099 C  CA  . GLY B 2 189 ? 18.854  118.435 -19.850 1.00 21.91 ? 189 GLY B CA  1 
ATOM   4100 C  C   . GLY B 2 189 ? 18.551  119.561 -18.872 1.00 20.43 ? 189 GLY B C   1 
ATOM   4101 O  O   . GLY B 2 189 ? 17.555  119.506 -18.152 1.00 19.84 ? 189 GLY B O   1 
ATOM   4102 N  N   . SER B 2 190 ? 19.395  120.584 -18.839 1.00 18.70 ? 190 SER B N   1 
ATOM   4103 C  CA  . SER B 2 190 ? 19.174  121.701 -17.927 1.00 17.66 ? 190 SER B CA  1 
ATOM   4104 C  C   . SER B 2 190 ? 18.205  122.723 -18.519 1.00 17.58 ? 190 SER B C   1 
ATOM   4105 O  O   . SER B 2 190 ? 17.824  122.630 -19.689 1.00 16.87 ? 190 SER B O   1 
ATOM   4106 C  CB  . SER B 2 190 ? 20.500  122.395 -17.609 1.00 17.83 ? 190 SER B CB  1 
ATOM   4107 O  OG  . SER B 2 190 ? 21.038  123.003 -18.771 1.00 20.40 ? 190 SER B OG  1 
ATOM   4108 N  N   . PHE B 2 191 ? 17.811  123.691 -17.695 1.00 16.91 ? 191 PHE B N   1 
ATOM   4109 C  CA  . PHE B 2 191 ? 16.913  124.763 -18.113 1.00 17.69 ? 191 PHE B CA  1 
ATOM   4110 C  C   . PHE B 2 191 ? 17.524  126.108 -17.752 1.00 17.75 ? 191 PHE B C   1 
ATOM   4111 O  O   . PHE B 2 191 ? 18.208  126.228 -16.738 1.00 17.33 ? 191 PHE B O   1 
ATOM   4112 C  CB  . PHE B 2 191 ? 15.557  124.691 -17.392 1.00 17.11 ? 191 PHE B CB  1 
ATOM   4113 C  CG  . PHE B 2 191 ? 14.655  123.593 -17.867 1.00 19.98 ? 191 PHE B CG  1 
ATOM   4114 C  CD1 . PHE B 2 191 ? 14.839  122.282 -17.435 1.00 19.64 ? 191 PHE B CD1 1 
ATOM   4115 C  CD2 . PHE B 2 191 ? 13.591  123.877 -18.722 1.00 19.26 ? 191 PHE B CD2 1 
ATOM   4116 C  CE1 . PHE B 2 191 ? 13.972  121.269 -17.844 1.00 20.36 ? 191 PHE B CE1 1 
ATOM   4117 C  CE2 . PHE B 2 191 ? 12.718  122.872 -19.136 1.00 20.25 ? 191 PHE B CE2 1 
ATOM   4118 C  CZ  . PHE B 2 191 ? 12.910  121.564 -18.694 1.00 20.82 ? 191 PHE B CZ  1 
ATOM   4119 N  N   . LEU B 2 192 ? 17.271  127.118 -18.577 1.00 17.61 ? 192 LEU B N   1 
ATOM   4120 C  CA  . LEU B 2 192 ? 17.732  128.469 -18.277 1.00 18.62 ? 192 LEU B CA  1 
ATOM   4121 C  C   . LEU B 2 192 ? 16.692  128.994 -17.287 1.00 19.50 ? 192 LEU B C   1 
ATOM   4122 O  O   . LEU B 2 192 ? 15.546  128.535 -17.307 1.00 18.31 ? 192 LEU B O   1 
ATOM   4123 C  CB  . LEU B 2 192 ? 17.692  129.353 -19.524 1.00 18.83 ? 192 LEU B CB  1 
ATOM   4124 C  CG  . LEU B 2 192 ? 18.527  128.977 -20.747 1.00 20.80 ? 192 LEU B CG  1 
ATOM   4125 C  CD1 . LEU B 2 192 ? 18.318  130.040 -21.829 1.00 20.28 ? 192 LEU B CD1 1 
ATOM   4126 C  CD2 . LEU B 2 192 ? 19.993  128.877 -20.365 1.00 19.12 ? 192 LEU B CD2 1 
ATOM   4127 N  N   . MET B 2 193 ? 17.074  129.933 -16.422 1.00 19.85 ? 193 MET B N   1 
ATOM   4128 C  CA  . MET B 2 193 ? 16.116  130.504 -15.472 1.00 19.84 ? 193 MET B CA  1 
ATOM   4129 C  C   . MET B 2 193 ? 15.170  131.438 -16.226 1.00 20.50 ? 193 MET B C   1 
ATOM   4130 O  O   . MET B 2 193 ? 14.026  131.652 -15.818 1.00 20.36 ? 193 MET B O   1 
ATOM   4131 C  CB  . MET B 2 193 ? 16.839  131.281 -14.366 1.00 21.24 ? 193 MET B CB  1 
ATOM   4132 C  CG  . MET B 2 193 ? 17.486  130.399 -13.293 1.00 21.04 ? 193 MET B CG  1 
ATOM   4133 S  SD  . MET B 2 193 ? 16.306  129.305 -12.466 1.00 23.15 ? 193 MET B SD  1 
ATOM   4134 C  CE  . MET B 2 193 ? 15.355  130.452 -11.498 1.00 23.26 ? 193 MET B CE  1 
ATOM   4135 N  N   . HIS B 2 194 ? 15.669  131.999 -17.325 1.00 19.42 ? 194 HIS B N   1 
ATOM   4136 C  CA  . HIS B 2 194 ? 14.892  132.891 -18.183 1.00 19.20 ? 194 HIS B CA  1 
ATOM   4137 C  C   . HIS B 2 194 ? 15.632  133.052 -19.507 1.00 18.70 ? 194 HIS B C   1 
ATOM   4138 O  O   . HIS B 2 194 ? 16.791  132.641 -19.630 1.00 17.32 ? 194 HIS B O   1 
ATOM   4139 C  CB  . HIS B 2 194 ? 14.657  134.250 -17.500 1.00 18.91 ? 194 HIS B CB  1 
ATOM   4140 C  CG  . HIS B 2 194 ? 15.890  135.081 -17.323 1.00 21.07 ? 194 HIS B CG  1 
ATOM   4141 N  ND1 . HIS B 2 194 ? 16.249  136.076 -18.206 1.00 21.24 ? 194 HIS B ND1 1 
ATOM   4142 C  CD2 . HIS B 2 194 ? 16.827  135.093 -16.343 1.00 21.54 ? 194 HIS B CD2 1 
ATOM   4143 C  CE1 . HIS B 2 194 ? 17.351  136.667 -17.777 1.00 22.34 ? 194 HIS B CE1 1 
ATOM   4144 N  NE2 . HIS B 2 194 ? 17.722  136.090 -16.649 1.00 21.83 ? 194 HIS B NE2 1 
ATOM   4145 N  N   . VAL B 2 195 ? 14.963  133.621 -20.503 1.00 19.55 ? 195 VAL B N   1 
ATOM   4146 C  CA  . VAL B 2 195 ? 15.584  133.799 -21.815 1.00 21.02 ? 195 VAL B CA  1 
ATOM   4147 C  C   . VAL B 2 195 ? 16.900  134.551 -21.687 1.00 21.48 ? 195 VAL B C   1 
ATOM   4148 O  O   . VAL B 2 195 ? 16.944  135.654 -21.149 1.00 21.84 ? 195 VAL B O   1 
ATOM   4149 C  CB  . VAL B 2 195 ? 14.649  134.557 -22.787 1.00 19.97 ? 195 VAL B CB  1 
ATOM   4150 C  CG1 . VAL B 2 195 ? 15.350  134.765 -24.122 1.00 21.67 ? 195 VAL B CG1 1 
ATOM   4151 C  CG2 . VAL B 2 195 ? 13.365  133.763 -22.996 1.00 20.55 ? 195 VAL B CG2 1 
ATOM   4152 N  N   . GLY B 2 196 ? 17.974  133.942 -22.181 1.00 22.18 ? 196 GLY B N   1 
ATOM   4153 C  CA  . GLY B 2 196 ? 19.281  134.564 -22.087 1.00 23.33 ? 196 GLY B CA  1 
ATOM   4154 C  C   . GLY B 2 196 ? 19.770  134.611 -20.648 1.00 25.59 ? 196 GLY B C   1 
ATOM   4155 O  O   . GLY B 2 196 ? 20.677  135.381 -20.317 1.00 27.15 ? 196 GLY B O   1 
ATOM   4156 N  N   . GLY B 2 197 ? 19.174  133.783 -19.792 1.00 23.50 ? 197 GLY B N   1 
ATOM   4157 C  CA  . GLY B 2 197 ? 19.553  133.758 -18.390 1.00 21.59 ? 197 GLY B CA  1 
ATOM   4158 C  C   . GLY B 2 197 ? 20.542  132.674 -17.991 1.00 21.95 ? 197 GLY B C   1 
ATOM   4159 O  O   . GLY B 2 197 ? 21.026  131.912 -18.827 1.00 20.54 ? 197 GLY B O   1 
ATOM   4160 N  N   . GLU B 2 198 ? 20.823  132.607 -16.692 1.00 21.62 ? 198 GLU B N   1 
ATOM   4161 C  CA  . GLU B 2 198 ? 21.764  131.647 -16.129 1.00 20.66 ? 198 GLU B CA  1 
ATOM   4162 C  C   . GLU B 2 198 ? 21.146  130.270 -15.906 1.00 20.90 ? 198 GLU B C   1 
ATOM   4163 O  O   . GLU B 2 198 ? 19.922  130.114 -15.865 1.00 20.55 ? 198 GLU B O   1 
ATOM   4164 C  CB  . GLU B 2 198 ? 22.312  132.163 -14.789 1.00 22.16 ? 198 GLU B CB  1 
ATOM   4165 C  CG  . GLU B 2 198 ? 21.325  132.064 -13.611 1.00 22.52 ? 198 GLU B CG  1 
ATOM   4166 C  CD  . GLU B 2 198 ? 20.311  133.206 -13.557 1.00 26.68 ? 198 GLU B CD  1 
ATOM   4167 O  OE1 . GLU B 2 198 ? 20.074  133.862 -14.598 1.00 26.53 ? 198 GLU B OE1 1 
ATOM   4168 O  OE2 . GLU B 2 198 ? 19.739  133.439 -12.466 1.00 24.49 ? 198 GLU B OE2 1 
ATOM   4169 N  N   . VAL B 2 199 ? 22.013  129.277 -15.749 1.00 20.95 ? 199 VAL B N   1 
ATOM   4170 C  CA  . VAL B 2 199 ? 21.582  127.909 -15.515 1.00 21.79 ? 199 VAL B CA  1 
ATOM   4171 C  C   . VAL B 2 199 ? 22.079  127.351 -14.182 1.00 21.47 ? 199 VAL B C   1 
ATOM   4172 O  O   . VAL B 2 199 ? 23.257  127.475 -13.845 1.00 21.75 ? 199 VAL B O   1 
ATOM   4173 C  CB  . VAL B 2 199 ? 22.106  126.952 -16.615 1.00 22.50 ? 199 VAL B CB  1 
ATOM   4174 C  CG1 . VAL B 2 199 ? 21.779  125.509 -16.249 1.00 21.99 ? 199 VAL B CG1 1 
ATOM   4175 C  CG2 . VAL B 2 199 ? 21.503  127.305 -17.955 1.00 23.98 ? 199 VAL B CG2 1 
ATOM   4176 N  N   . ASP B 2 200 ? 21.159  126.760 -13.424 1.00 19.55 ? 200 ASP B N   1 
ATOM   4177 C  CA  . ASP B 2 200 ? 21.471  126.075 -12.175 1.00 19.08 ? 200 ASP B CA  1 
ATOM   4178 C  C   . ASP B 2 200 ? 20.253  125.215 -11.832 1.00 17.91 ? 200 ASP B C   1 
ATOM   4179 O  O   . ASP B 2 200 ? 19.196  125.365 -12.442 1.00 17.46 ? 200 ASP B O   1 
ATOM   4180 C  CB  . ASP B 2 200 ? 21.894  127.033 -11.034 1.00 17.31 ? 200 ASP B CB  1 
ATOM   4181 C  CG  . ASP B 2 200 ? 20.821  128.017 -10.631 1.00 19.29 ? 200 ASP B CG  1 
ATOM   4182 O  OD1 . ASP B 2 200 ? 19.738  127.586 -10.178 1.00 18.81 ? 200 ASP B OD1 1 
ATOM   4183 O  OD2 . ASP B 2 200 ? 21.081  129.238 -10.748 1.00 21.17 ? 200 ASP B OD2 1 
ATOM   4184 N  N   . VAL B 2 201 ? 20.403  124.298 -10.885 1.00 17.16 ? 201 VAL B N   1 
ATOM   4185 C  CA  . VAL B 2 201 ? 19.323  123.375 -10.554 1.00 17.76 ? 201 VAL B CA  1 
ATOM   4186 C  C   . VAL B 2 201 ? 17.983  123.990 -10.136 1.00 17.80 ? 201 VAL B C   1 
ATOM   4187 O  O   . VAL B 2 201 ? 16.966  123.303 -10.145 1.00 16.45 ? 201 VAL B O   1 
ATOM   4188 C  CB  . VAL B 2 201 ? 19.802  122.332 -9.499  1.00 19.32 ? 201 VAL B CB  1 
ATOM   4189 C  CG1 . VAL B 2 201 ? 19.936  122.977 -8.146  1.00 19.81 ? 201 VAL B CG1 1 
ATOM   4190 C  CG2 . VAL B 2 201 ? 18.849  121.151 -9.457  1.00 19.59 ? 201 VAL B CG2 1 
ATOM   4191 N  N   . ARG B 2 202 ? 17.963  125.275 -9.787  1.00 18.20 ? 202 ARG B N   1 
ATOM   4192 C  CA  . ARG B 2 202 ? 16.698  125.911 -9.415  1.00 18.05 ? 202 ARG B CA  1 
ATOM   4193 C  C   . ARG B 2 202 ? 15.710  125.824 -10.579 1.00 18.86 ? 202 ARG B C   1 
ATOM   4194 O  O   . ARG B 2 202 ? 14.518  125.587 -10.381 1.00 19.13 ? 202 ARG B O   1 
ATOM   4195 C  CB  . ARG B 2 202 ? 16.890  127.395 -9.087  1.00 17.39 ? 202 ARG B CB  1 
ATOM   4196 C  CG  . ARG B 2 202 ? 17.552  127.720 -7.757  1.00 17.35 ? 202 ARG B CG  1 
ATOM   4197 C  CD  . ARG B 2 202 ? 17.748  129.232 -7.675  1.00 19.93 ? 202 ARG B CD  1 
ATOM   4198 N  NE  . ARG B 2 202 ? 18.524  129.710 -8.820  1.00 19.67 ? 202 ARG B NE  1 
ATOM   4199 C  CZ  . ARG B 2 202 ? 18.471  130.945 -9.315  1.00 21.07 ? 202 ARG B CZ  1 
ATOM   4200 N  NH1 . ARG B 2 202 ? 17.675  131.861 -8.772  1.00 17.30 ? 202 ARG B NH1 1 
ATOM   4201 N  NH2 . ARG B 2 202 ? 19.212  131.260 -10.368 1.00 20.20 ? 202 ARG B NH2 1 
ATOM   4202 N  N   . SER B 2 203 ? 16.211  126.026 -11.795 1.00 17.70 ? 203 SER B N   1 
ATOM   4203 C  CA  . SER B 2 203 ? 15.353  126.006 -12.971 1.00 17.14 ? 203 SER B CA  1 
ATOM   4204 C  C   . SER B 2 203 ? 14.652  124.668 -13.166 1.00 16.75 ? 203 SER B C   1 
ATOM   4205 O  O   . SER B 2 203 ? 13.461  124.628 -13.477 1.00 17.45 ? 203 SER B O   1 
ATOM   4206 C  CB  . SER B 2 203 ? 16.157  126.372 -14.227 1.00 17.51 ? 203 SER B CB  1 
ATOM   4207 O  OG  . SER B 2 203 ? 17.154  125.408 -14.514 1.00 19.36 ? 203 SER B OG  1 
ATOM   4208 N  N   . ALA B 2 204 ? 15.382  123.575 -12.970 1.00 16.13 ? 204 ALA B N   1 
ATOM   4209 C  CA  . ALA B 2 204 ? 14.805  122.247 -13.132 1.00 15.87 ? 204 ALA B CA  1 
ATOM   4210 C  C   . ALA B 2 204 ? 13.643  122.035 -12.169 1.00 16.28 ? 204 ALA B C   1 
ATOM   4211 O  O   . ALA B 2 204 ? 12.624  121.448 -12.531 1.00 16.26 ? 204 ALA B O   1 
ATOM   4212 C  CB  . ALA B 2 204 ? 15.874  121.178 -12.909 1.00 15.93 ? 204 ALA B CB  1 
ATOM   4213 N  N   . TYR B 2 205 ? 13.799  122.509 -10.938 1.00 14.67 ? 205 TYR B N   1 
ATOM   4214 C  CA  . TYR B 2 205 ? 12.750  122.358 -9.940  1.00 16.13 ? 205 TYR B CA  1 
ATOM   4215 C  C   . TYR B 2 205 ? 11.554  123.246 -10.250 1.00 16.22 ? 205 TYR B C   1 
ATOM   4216 O  O   . TYR B 2 205 ? 10.412  122.798 -10.175 1.00 15.49 ? 205 TYR B O   1 
ATOM   4217 C  CB  . TYR B 2 205 ? 13.282  122.691 -8.542  1.00 15.15 ? 205 TYR B CB  1 
ATOM   4218 C  CG  . TYR B 2 205 ? 12.191  122.774 -7.499  1.00 16.04 ? 205 TYR B CG  1 
ATOM   4219 C  CD1 . TYR B 2 205 ? 11.425  121.654 -7.165  1.00 16.38 ? 205 TYR B CD1 1 
ATOM   4220 C  CD2 . TYR B 2 205 ? 11.898  123.984 -6.872  1.00 16.22 ? 205 TYR B CD2 1 
ATOM   4221 C  CE1 . TYR B 2 205 ? 10.387  121.743 -6.232  1.00 16.68 ? 205 TYR B CE1 1 
ATOM   4222 C  CE2 . TYR B 2 205 ? 10.870  124.084 -5.942  1.00 16.05 ? 205 TYR B CE2 1 
ATOM   4223 C  CZ  . TYR B 2 205 ? 10.119  122.966 -5.627  1.00 15.57 ? 205 TYR B CZ  1 
ATOM   4224 O  OH  . TYR B 2 205 ? 9.097   123.086 -4.719  1.00 15.35 ? 205 TYR B OH  1 
ATOM   4225 N  N   . CYS B 2 206 ? 11.812  124.508 -10.589 1.00 15.88 ? 206 CYS B N   1 
ATOM   4226 C  CA  . CYS B 2 206 ? 10.722  125.429 -10.903 1.00 17.25 ? 206 CYS B CA  1 
ATOM   4227 C  C   . CYS B 2 206 ? 9.901   124.897 -12.075 1.00 16.54 ? 206 CYS B C   1 
ATOM   4228 O  O   . CYS B 2 206 ? 8.668   124.902 -12.033 1.00 17.23 ? 206 CYS B O   1 
ATOM   4229 C  CB  . CYS B 2 206 ? 11.268  126.828 -11.231 1.00 16.24 ? 206 CYS B CB  1 
ATOM   4230 S  SG  . CYS B 2 206 ? 11.959  127.720 -9.791  1.00 20.59 ? 206 CYS B SG  1 
ATOM   4231 N  N   . ALA B 2 207 ? 10.586  124.420 -13.111 1.00 16.20 ? 207 ALA B N   1 
ATOM   4232 C  CA  . ALA B 2 207 ? 9.909   123.882 -14.291 1.00 16.83 ? 207 ALA B CA  1 
ATOM   4233 C  C   . ALA B 2 207 ? 9.101   122.632 -13.954 1.00 16.97 ? 207 ALA B C   1 
ATOM   4234 O  O   . ALA B 2 207 ? 7.930   122.524 -14.325 1.00 16.52 ? 207 ALA B O   1 
ATOM   4235 C  CB  . ALA B 2 207 ? 10.932  123.563 -15.391 1.00 15.66 ? 207 ALA B CB  1 
ATOM   4236 N  N   . ALA B 2 208 ? 9.727   121.694 -13.247 1.00 17.30 ? 208 ALA B N   1 
ATOM   4237 C  CA  . ALA B 2 208 ? 9.063   120.445 -12.873 1.00 16.71 ? 208 ALA B CA  1 
ATOM   4238 C  C   . ALA B 2 208 ? 7.862   120.702 -11.971 1.00 17.06 ? 208 ALA B C   1 
ATOM   4239 O  O   . ALA B 2 208 ? 6.823   120.055 -12.101 1.00 17.50 ? 208 ALA B O   1 
ATOM   4240 C  CB  . ALA B 2 208 ? 10.059  119.502 -12.175 1.00 16.27 ? 208 ALA B CB  1 
ATOM   4241 N  N   . SER B 2 209 ? 8.007   121.645 -11.050 1.00 16.56 ? 209 SER B N   1 
ATOM   4242 C  CA  . SER B 2 209 ? 6.915   121.973 -10.147 1.00 17.85 ? 209 SER B CA  1 
ATOM   4243 C  C   . SER B 2 209 ? 5.693   122.522 -10.889 1.00 17.27 ? 209 SER B C   1 
ATOM   4244 O  O   . SER B 2 209 ? 4.594   121.983 -10.765 1.00 16.55 ? 209 SER B O   1 
ATOM   4245 C  CB  . SER B 2 209 ? 7.379   122.993 -9.103  1.00 18.65 ? 209 SER B CB  1 
ATOM   4246 O  OG  . SER B 2 209 ? 6.303   123.387 -8.262  1.00 17.97 ? 209 SER B OG  1 
ATOM   4247 N  N   . VAL B 2 210 ? 5.873   123.584 -11.669 1.00 17.51 ? 210 VAL B N   1 
ATOM   4248 C  CA  . VAL B 2 210 ? 4.730   124.159 -12.371 1.00 17.65 ? 210 VAL B CA  1 
ATOM   4249 C  C   . VAL B 2 210 ? 4.141   123.240 -13.441 1.00 17.81 ? 210 VAL B C   1 
ATOM   4250 O  O   . VAL B 2 210 ? 2.926   123.231 -13.650 1.00 18.70 ? 210 VAL B O   1 
ATOM   4251 C  CB  . VAL B 2 210 ? 5.072   125.539 -13.016 1.00 17.63 ? 210 VAL B CB  1 
ATOM   4252 C  CG1 . VAL B 2 210 ? 5.615   126.487 -11.949 1.00 16.89 ? 210 VAL B CG1 1 
ATOM   4253 C  CG2 . VAL B 2 210 ? 6.062   125.373 -14.152 1.00 16.82 ? 210 VAL B CG2 1 
ATOM   4254 N  N   . ALA B 2 211 ? 4.988   122.457 -14.102 1.00 18.37 ? 211 ALA B N   1 
ATOM   4255 C  CA  . ALA B 2 211 ? 4.520   121.561 -15.156 1.00 18.74 ? 211 ALA B CA  1 
ATOM   4256 C  C   . ALA B 2 211 ? 3.695   120.392 -14.618 1.00 19.83 ? 211 ALA B C   1 
ATOM   4257 O  O   . ALA B 2 211 ? 2.701   119.987 -15.235 1.00 18.55 ? 211 ALA B O   1 
ATOM   4258 C  CB  . ALA B 2 211 ? 5.707   121.044 -15.969 1.00 18.69 ? 211 ALA B CB  1 
ATOM   4259 N  N   . SER B 2 212 ? 4.095   119.849 -13.472 1.00 19.29 ? 212 SER B N   1 
ATOM   4260 C  CA  . SER B 2 212 ? 3.355   118.734 -12.893 1.00 19.35 ? 212 SER B CA  1 
ATOM   4261 C  C   . SER B 2 212 ? 2.041   119.224 -12.291 1.00 19.46 ? 212 SER B C   1 
ATOM   4262 O  O   . SER B 2 212 ? 1.007   118.581 -12.448 1.00 20.03 ? 212 SER B O   1 
ATOM   4263 C  CB  . SER B 2 212 ? 4.195   118.015 -11.832 1.00 21.66 ? 212 SER B CB  1 
ATOM   4264 O  OG  . SER B 2 212 ? 4.633   118.902 -10.822 1.00 23.82 ? 212 SER B OG  1 
ATOM   4265 N  N   . LEU B 2 213 ? 2.075   120.368 -11.612 1.00 19.29 ? 213 LEU B N   1 
ATOM   4266 C  CA  . LEU B 2 213 ? 0.860   120.915 -11.016 1.00 20.88 ? 213 LEU B CA  1 
ATOM   4267 C  C   . LEU B 2 213 ? -0.203  121.268 -12.062 1.00 21.53 ? 213 LEU B C   1 
ATOM   4268 O  O   . LEU B 2 213 ? -1.397  121.029 -11.850 1.00 21.65 ? 213 LEU B O   1 
ATOM   4269 C  CB  . LEU B 2 213 ? 1.178   122.165 -10.186 1.00 20.30 ? 213 LEU B CB  1 
ATOM   4270 C  CG  . LEU B 2 213 ? 1.856   121.977 -8.825  1.00 21.11 ? 213 LEU B CG  1 
ATOM   4271 C  CD1 . LEU B 2 213 ? 2.199   123.343 -8.237  1.00 18.50 ? 213 LEU B CD1 1 
ATOM   4272 C  CD2 . LEU B 2 213 ? 0.933   121.207 -7.884  1.00 18.38 ? 213 LEU B CD2 1 
ATOM   4273 N  N   . THR B 2 214 ? 0.225   121.828 -13.191 1.00 19.55 ? 214 THR B N   1 
ATOM   4274 C  CA  . THR B 2 214 ? -0.718  122.233 -14.230 1.00 18.87 ? 214 THR B CA  1 
ATOM   4275 C  C   . THR B 2 214 ? -0.949  121.199 -15.320 1.00 20.27 ? 214 THR B C   1 
ATOM   4276 O  O   . THR B 2 214 ? -1.619  121.479 -16.317 1.00 20.05 ? 214 THR B O   1 
ATOM   4277 C  CB  . THR B 2 214 ? -0.279  123.553 -14.893 1.00 18.04 ? 214 THR B CB  1 
ATOM   4278 O  OG1 . THR B 2 214 ? 0.986   123.371 -15.538 1.00 17.14 ? 214 THR B OG1 1 
ATOM   4279 C  CG2 . THR B 2 214 ? -0.157  124.648 -13.852 1.00 14.99 ? 214 THR B CG2 1 
ATOM   4280 N  N   . ASN B 2 215 ? -0.393  120.007 -15.130 1.00 20.20 ? 215 ASN B N   1 
ATOM   4281 C  CA  . ASN B 2 215 ? -0.548  118.918 -16.086 1.00 21.07 ? 215 ASN B CA  1 
ATOM   4282 C  C   . ASN B 2 215 ? -0.143  119.279 -17.521 1.00 21.50 ? 215 ASN B C   1 
ATOM   4283 O  O   . ASN B 2 215 ? -0.933  119.132 -18.459 1.00 20.27 ? 215 ASN B O   1 
ATOM   4284 C  CB  . ASN B 2 215 ? -2.000  118.416 -16.049 1.00 20.20 ? 215 ASN B CB  1 
ATOM   4285 C  CG  . ASN B 2 215 ? -2.241  117.251 -16.985 1.00 21.35 ? 215 ASN B CG  1 
ATOM   4286 O  OD1 . ASN B 2 215 ? -1.374  116.399 -17.171 1.00 20.95 ? 215 ASN B OD1 1 
ATOM   4287 N  ND2 . ASN B 2 215 ? -3.432  117.201 -17.570 1.00 21.90 ? 215 ASN B ND2 1 
ATOM   4288 N  N   . ILE B 2 216 ? 1.092   119.749 -17.693 1.00 21.56 ? 216 ILE B N   1 
ATOM   4289 C  CA  . ILE B 2 216 ? 1.576   120.099 -19.028 1.00 21.44 ? 216 ILE B CA  1 
ATOM   4290 C  C   . ILE B 2 216 ? 2.875   119.379 -19.368 1.00 21.90 ? 216 ILE B C   1 
ATOM   4291 O  O   . ILE B 2 216 ? 3.600   119.779 -20.279 1.00 22.43 ? 216 ILE B O   1 
ATOM   4292 C  CB  . ILE B 2 216 ? 1.804   121.618 -19.178 1.00 21.35 ? 216 ILE B CB  1 
ATOM   4293 C  CG1 . ILE B 2 216 ? 2.844   122.098 -18.164 1.00 20.02 ? 216 ILE B CG1 1 
ATOM   4294 C  CG2 . ILE B 2 216 ? 0.482   122.361 -18.990 1.00 20.43 ? 216 ILE B CG2 1 
ATOM   4295 C  CD1 . ILE B 2 216 ? 3.169   123.578 -18.291 1.00 17.09 ? 216 ILE B CD1 1 
ATOM   4296 N  N   . ILE B 2 217 ? 3.169   118.310 -18.639 1.00 23.21 ? 217 ILE B N   1 
ATOM   4297 C  CA  . ILE B 2 217 ? 4.386   117.554 -18.894 1.00 23.43 ? 217 ILE B CA  1 
ATOM   4298 C  C   . ILE B 2 217 ? 4.262   116.670 -20.129 1.00 25.30 ? 217 ILE B C   1 
ATOM   4299 O  O   . ILE B 2 217 ? 3.306   115.913 -20.267 1.00 24.79 ? 217 ILE B O   1 
ATOM   4300 C  CB  . ILE B 2 217 ? 4.751   116.646 -17.705 1.00 24.29 ? 217 ILE B CB  1 
ATOM   4301 C  CG1 . ILE B 2 217 ? 5.087   117.501 -16.482 1.00 22.54 ? 217 ILE B CG1 1 
ATOM   4302 C  CG2 . ILE B 2 217 ? 5.949   115.755 -18.075 1.00 23.24 ? 217 ILE B CG2 1 
ATOM   4303 C  CD1 . ILE B 2 217 ? 5.442   116.684 -15.265 1.00 27.08 ? 217 ILE B CD1 1 
ATOM   4304 N  N   . THR B 2 218 ? 5.235   116.778 -21.027 1.00 25.86 ? 218 THR B N   1 
ATOM   4305 C  CA  . THR B 2 218 ? 5.261   115.962 -22.229 1.00 26.41 ? 218 THR B CA  1 
ATOM   4306 C  C   . THR B 2 218 ? 6.427   114.994 -22.065 1.00 28.81 ? 218 THR B C   1 
ATOM   4307 O  O   . THR B 2 218 ? 7.292   115.191 -21.209 1.00 27.47 ? 218 THR B O   1 
ATOM   4308 C  CB  . THR B 2 218 ? 5.492   116.807 -23.499 1.00 27.04 ? 218 THR B CB  1 
ATOM   4309 O  OG1 . THR B 2 218 ? 6.717   117.536 -23.374 1.00 24.13 ? 218 THR B OG1 1 
ATOM   4310 C  CG2 . THR B 2 218 ? 4.343   117.778 -23.713 1.00 25.14 ? 218 THR B CG2 1 
ATOM   4311 N  N   . PRO B 2 219 ? 6.465   113.930 -22.878 1.00 31.52 ? 219 PRO B N   1 
ATOM   4312 C  CA  . PRO B 2 219 ? 7.541   112.940 -22.800 1.00 32.02 ? 219 PRO B CA  1 
ATOM   4313 C  C   . PRO B 2 219 ? 8.940   113.526 -23.004 1.00 31.26 ? 219 PRO B C   1 
ATOM   4314 O  O   . PRO B 2 219 ? 9.889   113.105 -22.350 1.00 33.84 ? 219 PRO B O   1 
ATOM   4315 C  CB  . PRO B 2 219 ? 7.171   111.946 -23.900 1.00 33.62 ? 219 PRO B CB  1 
ATOM   4316 C  CG  . PRO B 2 219 ? 5.676   112.027 -23.937 1.00 33.78 ? 219 PRO B CG  1 
ATOM   4317 C  CD  . PRO B 2 219 ? 5.449   113.516 -23.863 1.00 33.42 ? 219 PRO B CD  1 
ATOM   4318 N  N   . ASP B 2 220 ? 9.064   114.502 -23.899 1.00 29.21 ? 220 ASP B N   1 
ATOM   4319 C  CA  . ASP B 2 220 ? 10.365  115.102 -24.187 1.00 29.43 ? 220 ASP B CA  1 
ATOM   4320 C  C   . ASP B 2 220 ? 10.766  116.320 -23.354 1.00 27.12 ? 220 ASP B C   1 
ATOM   4321 O  O   . ASP B 2 220 ? 11.948  116.663 -23.305 1.00 26.15 ? 220 ASP B O   1 
ATOM   4322 C  CB  . ASP B 2 220 ? 10.458  115.464 -25.678 1.00 33.31 ? 220 ASP B CB  1 
ATOM   4323 C  CG  . ASP B 2 220 ? 9.364   116.420 -26.122 1.00 37.47 ? 220 ASP B CG  1 
ATOM   4324 O  OD1 . ASP B 2 220 ? 8.169   116.097 -25.936 1.00 40.34 ? 220 ASP B OD1 1 
ATOM   4325 O  OD2 . ASP B 2 220 ? 9.698   117.492 -26.671 1.00 41.53 ? 220 ASP B OD2 1 
ATOM   4326 N  N   . LEU B 2 221 ? 9.804   116.970 -22.703 1.00 24.12 ? 221 LEU B N   1 
ATOM   4327 C  CA  . LEU B 2 221 ? 10.105  118.152 -21.897 1.00 22.11 ? 221 LEU B CA  1 
ATOM   4328 C  C   . LEU B 2 221 ? 11.284  117.957 -20.946 1.00 21.06 ? 221 LEU B C   1 
ATOM   4329 O  O   . LEU B 2 221 ? 12.197  118.786 -20.900 1.00 20.30 ? 221 LEU B O   1 
ATOM   4330 C  CB  . LEU B 2 221 ? 8.872   118.584 -21.091 1.00 22.34 ? 221 LEU B CB  1 
ATOM   4331 C  CG  . LEU B 2 221 ? 9.054   119.774 -20.138 1.00 22.86 ? 221 LEU B CG  1 
ATOM   4332 C  CD1 . LEU B 2 221 ? 9.525   121.003 -20.910 1.00 22.29 ? 221 LEU B CD1 1 
ATOM   4333 C  CD2 . LEU B 2 221 ? 7.735   120.059 -19.425 1.00 24.18 ? 221 LEU B CD2 1 
ATOM   4334 N  N   . PHE B 2 222 ? 11.273  116.865 -20.188 1.00 19.89 ? 222 PHE B N   1 
ATOM   4335 C  CA  . PHE B 2 222 ? 12.349  116.611 -19.237 1.00 20.98 ? 222 PHE B CA  1 
ATOM   4336 C  C   . PHE B 2 222 ? 13.366  115.551 -19.640 1.00 22.93 ? 222 PHE B C   1 
ATOM   4337 O  O   . PHE B 2 222 ? 14.035  114.963 -18.788 1.00 21.03 ? 222 PHE B O   1 
ATOM   4338 C  CB  . PHE B 2 222 ? 11.758  116.283 -17.865 1.00 20.44 ? 222 PHE B CB  1 
ATOM   4339 C  CG  . PHE B 2 222 ? 11.008  117.429 -17.256 1.00 21.03 ? 222 PHE B CG  1 
ATOM   4340 C  CD1 . PHE B 2 222 ? 9.622   117.423 -17.208 1.00 20.51 ? 222 PHE B CD1 1 
ATOM   4341 C  CD2 . PHE B 2 222 ? 11.693  118.540 -16.770 1.00 20.01 ? 222 PHE B CD2 1 
ATOM   4342 C  CE1 . PHE B 2 222 ? 8.925   118.505 -16.686 1.00 21.08 ? 222 PHE B CE1 1 
ATOM   4343 C  CE2 . PHE B 2 222 ? 11.006  119.631 -16.247 1.00 20.43 ? 222 PHE B CE2 1 
ATOM   4344 C  CZ  . PHE B 2 222 ? 9.620   119.614 -16.205 1.00 21.05 ? 222 PHE B CZ  1 
ATOM   4345 N  N   . GLU B 2 223 ? 13.491  115.314 -20.940 1.00 24.82 ? 223 GLU B N   1 
ATOM   4346 C  CA  . GLU B 2 223 ? 14.459  114.344 -21.428 1.00 26.71 ? 223 GLU B CA  1 
ATOM   4347 C  C   . GLU B 2 223 ? 15.848  114.835 -21.033 1.00 25.52 ? 223 GLU B C   1 
ATOM   4348 O  O   . GLU B 2 223 ? 16.204  115.985 -21.300 1.00 24.27 ? 223 GLU B O   1 
ATOM   4349 C  CB  . GLU B 2 223 ? 14.362  114.216 -22.952 1.00 30.52 ? 223 GLU B CB  1 
ATOM   4350 C  CG  . GLU B 2 223 ? 15.431  113.326 -23.567 1.00 39.25 ? 223 GLU B CG  1 
ATOM   4351 C  CD  . GLU B 2 223 ? 15.238  113.120 -25.058 1.00 45.70 ? 223 GLU B CD  1 
ATOM   4352 O  OE1 . GLU B 2 223 ? 16.145  112.546 -25.699 1.00 50.02 ? 223 GLU B OE1 1 
ATOM   4353 O  OE2 . GLU B 2 223 ? 14.180  113.523 -25.591 1.00 49.24 ? 223 GLU B OE2 1 
ATOM   4354 N  N   . GLY B 2 224 ? 16.614  113.969 -20.374 1.00 23.99 ? 224 GLY B N   1 
ATOM   4355 C  CA  . GLY B 2 224 ? 17.960  114.320 -19.952 1.00 22.06 ? 224 GLY B CA  1 
ATOM   4356 C  C   . GLY B 2 224 ? 18.062  115.098 -18.647 1.00 21.32 ? 224 GLY B C   1 
ATOM   4357 O  O   . GLY B 2 224 ? 19.141  115.208 -18.078 1.00 21.47 ? 224 GLY B O   1 
ATOM   4358 N  N   . THR B 2 225 ? 16.947  115.635 -18.165 1.00 21.61 ? 225 THR B N   1 
ATOM   4359 C  CA  . THR B 2 225 ? 16.950  116.420 -16.933 1.00 20.66 ? 225 THR B CA  1 
ATOM   4360 C  C   . THR B 2 225 ? 17.386  115.634 -15.697 1.00 21.61 ? 225 THR B C   1 
ATOM   4361 O  O   . THR B 2 225 ? 18.191  116.122 -14.902 1.00 22.31 ? 225 THR B O   1 
ATOM   4362 C  CB  . THR B 2 225 ? 15.563  117.035 -16.673 1.00 19.86 ? 225 THR B CB  1 
ATOM   4363 O  OG1 . THR B 2 225 ? 15.202  117.863 -17.783 1.00 21.94 ? 225 THR B OG1 1 
ATOM   4364 C  CG2 . THR B 2 225 ? 15.580  117.887 -15.407 1.00 18.34 ? 225 THR B CG2 1 
ATOM   4365 N  N   . ALA B 2 226 ? 16.861  114.423 -15.529 1.00 20.02 ? 226 ALA B N   1 
ATOM   4366 C  CA  . ALA B 2 226 ? 17.231  113.607 -14.380 1.00 19.80 ? 226 ALA B CA  1 
ATOM   4367 C  C   . ALA B 2 226 ? 18.740  113.365 -14.342 1.00 20.58 ? 226 ALA B C   1 
ATOM   4368 O  O   . ALA B 2 226 ? 19.367  113.465 -13.282 1.00 21.16 ? 226 ALA B O   1 
ATOM   4369 C  CB  . ALA B 2 226 ? 16.485  112.274 -14.417 1.00 19.93 ? 226 ALA B CB  1 
ATOM   4370 N  N   . GLU B 2 227 ? 19.323  113.054 -15.499 1.00 20.87 ? 227 GLU B N   1 
ATOM   4371 C  CA  . GLU B 2 227 ? 20.760  112.796 -15.587 1.00 20.63 ? 227 GLU B CA  1 
ATOM   4372 C  C   . GLU B 2 227 ? 21.583  114.046 -15.273 1.00 21.11 ? 227 GLU B C   1 
ATOM   4373 O  O   . GLU B 2 227 ? 22.645  113.961 -14.648 1.00 20.32 ? 227 GLU B O   1 
ATOM   4374 C  CB  . GLU B 2 227 ? 21.134  112.292 -16.986 1.00 23.25 ? 227 GLU B CB  1 
ATOM   4375 C  CG  . GLU B 2 227 ? 20.571  110.923 -17.369 1.00 26.90 ? 227 GLU B CG  1 
ATOM   4376 C  CD  . GLU B 2 227 ? 19.066  110.926 -17.588 1.00 30.40 ? 227 GLU B CD  1 
ATOM   4377 O  OE1 . GLU B 2 227 ? 18.494  112.002 -17.858 1.00 30.43 ? 227 GLU B OE1 1 
ATOM   4378 O  OE2 . GLU B 2 227 ? 18.454  109.839 -17.507 1.00 33.86 ? 227 GLU B OE2 1 
ATOM   4379 N  N   . TRP B 2 228 ? 21.105  115.204 -15.721 1.00 18.91 ? 228 TRP B N   1 
ATOM   4380 C  CA  . TRP B 2 228 ? 21.816  116.450 -15.470 1.00 20.40 ? 228 TRP B CA  1 
ATOM   4381 C  C   . TRP B 2 228 ? 21.814  116.728 -13.969 1.00 19.23 ? 228 TRP B C   1 
ATOM   4382 O  O   . TRP B 2 228 ? 22.829  117.131 -13.401 1.00 20.12 ? 228 TRP B O   1 
ATOM   4383 C  CB  . TRP B 2 228 ? 21.154  117.620 -16.208 1.00 19.55 ? 228 TRP B CB  1 
ATOM   4384 C  CG  . TRP B 2 228 ? 21.922  118.902 -16.048 1.00 20.07 ? 228 TRP B CG  1 
ATOM   4385 C  CD1 . TRP B 2 228 ? 23.019  119.294 -16.758 1.00 19.27 ? 228 TRP B CD1 1 
ATOM   4386 C  CD2 . TRP B 2 228 ? 21.692  119.925 -15.067 1.00 19.03 ? 228 TRP B CD2 1 
ATOM   4387 N  NE1 . TRP B 2 228 ? 23.488  120.496 -16.280 1.00 20.56 ? 228 TRP B NE1 1 
ATOM   4388 C  CE2 . TRP B 2 228 ? 22.692  120.903 -15.241 1.00 19.45 ? 228 TRP B CE2 1 
ATOM   4389 C  CE3 . TRP B 2 228 ? 20.738  120.105 -14.056 1.00 18.77 ? 228 TRP B CE3 1 
ATOM   4390 C  CZ2 . TRP B 2 228 ? 22.769  122.050 -14.441 1.00 20.08 ? 228 TRP B CZ2 1 
ATOM   4391 C  CZ3 . TRP B 2 228 ? 20.812  121.243 -13.260 1.00 18.00 ? 228 TRP B CZ3 1 
ATOM   4392 C  CH2 . TRP B 2 228 ? 21.822  122.201 -13.459 1.00 20.21 ? 228 TRP B CH2 1 
ATOM   4393 N  N   . ILE B 2 229 ? 20.668  116.515 -13.328 1.00 19.69 ? 229 ILE B N   1 
ATOM   4394 C  CA  . ILE B 2 229 ? 20.564  116.742 -11.893 1.00 17.74 ? 229 ILE B CA  1 
ATOM   4395 C  C   . ILE B 2 229 ? 21.519  115.811 -11.147 1.00 19.20 ? 229 ILE B C   1 
ATOM   4396 O  O   . ILE B 2 229 ? 22.206  116.232 -10.216 1.00 19.72 ? 229 ILE B O   1 
ATOM   4397 C  CB  . ILE B 2 229 ? 19.113  116.515 -11.392 1.00 18.22 ? 229 ILE B CB  1 
ATOM   4398 C  CG1 . ILE B 2 229 ? 18.191  117.590 -11.976 1.00 16.67 ? 229 ILE B CG1 1 
ATOM   4399 C  CG2 . ILE B 2 229 ? 19.068  116.556 -9.863  1.00 18.57 ? 229 ILE B CG2 1 
ATOM   4400 C  CD1 . ILE B 2 229 ? 16.714  117.378 -11.672 1.00 19.15 ? 229 ILE B CD1 1 
ATOM   4401 N  N   . ALA B 2 230 ? 21.569  114.548 -11.558 1.00 19.16 ? 230 ALA B N   1 
ATOM   4402 C  CA  . ALA B 2 230 ? 22.456  113.585 -10.913 1.00 19.92 ? 230 ALA B CA  1 
ATOM   4403 C  C   . ALA B 2 230 ? 23.912  114.049 -11.003 1.00 20.16 ? 230 ALA B C   1 
ATOM   4404 O  O   . ALA B 2 230 ? 24.698  113.842 -10.077 1.00 20.30 ? 230 ALA B O   1 
ATOM   4405 C  CB  . ALA B 2 230 ? 22.298  112.214 -11.556 1.00 19.69 ? 230 ALA B CB  1 
ATOM   4406 N  N   . ARG B 2 231 ? 24.270  114.677 -12.120 1.00 19.96 ? 231 ARG B N   1 
ATOM   4407 C  CA  . ARG B 2 231 ? 25.630  115.174 -12.303 1.00 20.01 ? 231 ARG B CA  1 
ATOM   4408 C  C   . ARG B 2 231 ? 25.935  116.300 -11.319 1.00 19.18 ? 231 ARG B C   1 
ATOM   4409 O  O   . ARG B 2 231 ? 27.103  116.618 -11.077 1.00 18.05 ? 231 ARG B O   1 
ATOM   4410 C  CB  . ARG B 2 231 ? 25.832  115.686 -13.734 1.00 21.52 ? 231 ARG B CB  1 
ATOM   4411 C  CG  . ARG B 2 231 ? 25.937  114.597 -14.804 1.00 27.02 ? 231 ARG B CG  1 
ATOM   4412 C  CD  . ARG B 2 231 ? 26.097  115.233 -16.183 1.00 30.85 ? 231 ARG B CD  1 
ATOM   4413 N  NE  . ARG B 2 231 ? 27.208  116.181 -16.195 1.00 33.24 ? 231 ARG B NE  1 
ATOM   4414 C  CZ  . ARG B 2 231 ? 27.276  117.252 -16.981 1.00 35.62 ? 231 ARG B CZ  1 
ATOM   4415 N  NH1 . ARG B 2 231 ? 26.292  117.523 -17.831 1.00 35.35 ? 231 ARG B NH1 1 
ATOM   4416 N  NH2 . ARG B 2 231 ? 28.325  118.061 -16.909 1.00 33.61 ? 231 ARG B NH2 1 
ATOM   4417 N  N   . CYS B 2 232 ? 24.886  116.904 -10.762 1.00 17.66 ? 232 CYS B N   1 
ATOM   4418 C  CA  . CYS B 2 232 ? 25.044  117.992 -9.794  1.00 17.67 ? 232 CYS B CA  1 
ATOM   4419 C  C   . CYS B 2 232 ? 25.334  117.481 -8.388  1.00 17.66 ? 232 CYS B C   1 
ATOM   4420 O  O   . CYS B 2 232 ? 25.797  118.241 -7.531  1.00 17.51 ? 232 CYS B O   1 
ATOM   4421 C  CB  . CYS B 2 232 ? 23.799  118.883 -9.763  1.00 18.44 ? 232 CYS B CB  1 
ATOM   4422 S  SG  . CYS B 2 232 ? 23.572  119.888 -11.254 1.00 19.05 ? 232 CYS B SG  1 
ATOM   4423 N  N   . GLN B 2 233 ? 25.035  116.208 -8.134  1.00 16.43 ? 233 GLN B N   1 
ATOM   4424 C  CA  . GLN B 2 233 ? 25.341  115.630 -6.830  1.00 17.59 ? 233 GLN B CA  1 
ATOM   4425 C  C   . GLN B 2 233 ? 26.865  115.511 -6.834  1.00 17.88 ? 233 GLN B C   1 
ATOM   4426 O  O   . GLN B 2 233 ? 27.442  115.065 -7.826  1.00 17.49 ? 233 GLN B O   1 
ATOM   4427 C  CB  . GLN B 2 233 ? 24.703  114.242 -6.673  1.00 17.30 ? 233 GLN B CB  1 
ATOM   4428 C  CG  . GLN B 2 233 ? 25.147  113.514 -5.405  1.00 17.08 ? 233 GLN B CG  1 
ATOM   4429 C  CD  . GLN B 2 233 ? 24.349  112.255 -5.128  1.00 20.40 ? 233 GLN B CD  1 
ATOM   4430 O  OE1 . GLN B 2 233 ? 24.094  111.455 -6.029  1.00 19.61 ? 233 GLN B OE1 1 
ATOM   4431 N  NE2 . GLN B 2 233 ? 23.962  112.065 -3.869  1.00 19.02 ? 233 GLN B NE2 1 
ATOM   4432 N  N   . ASN B 2 234 ? 27.529  115.922 -5.758  1.00 17.14 ? 234 ASN B N   1 
ATOM   4433 C  CA  . ASN B 2 234 ? 28.987  115.844 -5.744  1.00 17.54 ? 234 ASN B CA  1 
ATOM   4434 C  C   . ASN B 2 234 ? 29.539  114.863 -4.716  1.00 17.62 ? 234 ASN B C   1 
ATOM   4435 O  O   . ASN B 2 234 ? 28.787  114.077 -4.131  1.00 17.75 ? 234 ASN B O   1 
ATOM   4436 C  CB  . ASN B 2 234 ? 29.593  117.245 -5.540  1.00 16.40 ? 234 ASN B CB  1 
ATOM   4437 C  CG  . ASN B 2 234 ? 29.522  117.726 -4.100  1.00 18.59 ? 234 ASN B CG  1 
ATOM   4438 O  OD1 . ASN B 2 234 ? 28.838  117.138 -3.261  1.00 19.33 ? 234 ASN B OD1 1 
ATOM   4439 N  ND2 . ASN B 2 234 ? 30.231  118.809 -3.810  1.00 16.83 ? 234 ASN B ND2 1 
ATOM   4440 N  N   . TRP B 2 235 ? 30.853  114.916 -4.508  1.00 16.60 ? 235 TRP B N   1 
ATOM   4441 C  CA  . TRP B 2 235 ? 31.547  114.029 -3.574  1.00 17.65 ? 235 TRP B CA  1 
ATOM   4442 C  C   . TRP B 2 235 ? 31.020  114.088 -2.144  1.00 18.16 ? 235 TRP B C   1 
ATOM   4443 O  O   . TRP B 2 235 ? 31.175  113.130 -1.384  1.00 18.94 ? 235 TRP B O   1 
ATOM   4444 C  CB  . TRP B 2 235 ? 33.047  114.354 -3.555  1.00 17.53 ? 235 TRP B CB  1 
ATOM   4445 C  CG  . TRP B 2 235 ? 33.328  115.791 -3.220  1.00 19.09 ? 235 TRP B CG  1 
ATOM   4446 C  CD1 . TRP B 2 235 ? 33.299  116.850 -4.080  1.00 19.66 ? 235 TRP B CD1 1 
ATOM   4447 C  CD2 . TRP B 2 235 ? 33.641  116.332 -1.928  1.00 18.75 ? 235 TRP B CD2 1 
ATOM   4448 N  NE1 . TRP B 2 235 ? 33.574  118.017 -3.407  1.00 20.74 ? 235 TRP B NE1 1 
ATOM   4449 C  CE2 . TRP B 2 235 ? 33.787  117.729 -2.084  1.00 19.07 ? 235 TRP B CE2 1 
ATOM   4450 C  CE3 . TRP B 2 235 ? 33.809  115.773 -0.653  1.00 18.58 ? 235 TRP B CE3 1 
ATOM   4451 C  CZ2 . TRP B 2 235 ? 34.096  118.579 -1.012  1.00 20.18 ? 235 TRP B CZ2 1 
ATOM   4452 C  CZ3 . TRP B 2 235 ? 34.115  116.616 0.413   1.00 18.96 ? 235 TRP B CZ3 1 
ATOM   4453 C  CH2 . TRP B 2 235 ? 34.256  118.005 0.225   1.00 21.41 ? 235 TRP B CH2 1 
ATOM   4454 N  N   . GLU B 2 236 ? 30.417  115.215 -1.775  1.00 18.11 ? 236 GLU B N   1 
ATOM   4455 C  CA  . GLU B 2 236 ? 29.869  115.400 -0.429  1.00 17.04 ? 236 GLU B CA  1 
ATOM   4456 C  C   . GLU B 2 236 ? 28.577  114.616 -0.196  1.00 16.50 ? 236 GLU B C   1 
ATOM   4457 O  O   . GLU B 2 236 ? 28.238  114.300 0.944   1.00 17.03 ? 236 GLU B O   1 
ATOM   4458 C  CB  . GLU B 2 236 ? 29.568  116.879 -0.174  1.00 16.70 ? 236 GLU B CB  1 
ATOM   4459 C  CG  . GLU B 2 236 ? 30.756  117.813 -0.219  1.00 16.43 ? 236 GLU B CG  1 
ATOM   4460 C  CD  . GLU B 2 236 ? 30.327  119.261 -0.038  1.00 17.94 ? 236 GLU B CD  1 
ATOM   4461 O  OE1 . GLU B 2 236 ? 30.235  119.988 -1.051  1.00 16.79 ? 236 GLU B OE1 1 
ATOM   4462 O  OE2 . GLU B 2 236 ? 30.061  119.664 1.118   1.00 17.44 ? 236 GLU B OE2 1 
ATOM   4463 N  N   . GLY B 2 237 ? 27.857  114.318 -1.273  1.00 16.39 ? 237 GLY B N   1 
ATOM   4464 C  CA  . GLY B 2 237 ? 26.600  113.597 -1.149  1.00 16.79 ? 237 GLY B CA  1 
ATOM   4465 C  C   . GLY B 2 237 ? 25.417  114.510 -1.439  1.00 17.09 ? 237 GLY B C   1 
ATOM   4466 O  O   . GLY B 2 237 ? 24.345  114.052 -1.844  1.00 16.74 ? 237 GLY B O   1 
ATOM   4467 N  N   . GLY B 2 238 ? 25.610  115.806 -1.214  1.00 17.86 ? 238 GLY B N   1 
ATOM   4468 C  CA  . GLY B 2 238 ? 24.565  116.779 -1.480  1.00 17.49 ? 238 GLY B CA  1 
ATOM   4469 C  C   . GLY B 2 238 ? 24.618  117.186 -2.944  1.00 17.60 ? 238 GLY B C   1 
ATOM   4470 O  O   . GLY B 2 238 ? 25.398  116.622 -3.713  1.00 17.85 ? 238 GLY B O   1 
ATOM   4471 N  N   . ILE B 2 239 ? 23.812  118.175 -3.322  1.00 17.58 ? 239 ILE B N   1 
ATOM   4472 C  CA  . ILE B 2 239 ? 23.742  118.649 -4.704  1.00 16.85 ? 239 ILE B CA  1 
ATOM   4473 C  C   . ILE B 2 239 ? 24.166  120.113 -4.848  1.00 18.02 ? 239 ILE B C   1 
ATOM   4474 O  O   . ILE B 2 239 ? 23.796  120.961 -4.035  1.00 17.26 ? 239 ILE B O   1 
ATOM   4475 C  CB  . ILE B 2 239 ? 22.302  118.484 -5.252  1.00 16.83 ? 239 ILE B CB  1 
ATOM   4476 C  CG1 . ILE B 2 239 ? 21.909  117.001 -5.225  1.00 18.15 ? 239 ILE B CG1 1 
ATOM   4477 C  CG2 . ILE B 2 239 ? 22.202  119.044 -6.668  1.00 17.61 ? 239 ILE B CG2 1 
ATOM   4478 C  CD1 . ILE B 2 239 ? 20.478  116.713 -5.674  1.00 17.02 ? 239 ILE B CD1 1 
ATOM   4479 N  N   . GLY B 2 240 ? 24.948  120.401 -5.887  1.00 18.14 ? 240 GLY B N   1 
ATOM   4480 C  CA  . GLY B 2 240 ? 25.400  121.762 -6.120  1.00 16.45 ? 240 GLY B CA  1 
ATOM   4481 C  C   . GLY B 2 240 ? 24.554  122.449 -7.173  1.00 16.88 ? 240 GLY B C   1 
ATOM   4482 O  O   . GLY B 2 240 ? 23.723  121.804 -7.811  1.00 15.96 ? 240 GLY B O   1 
ATOM   4483 N  N   . GLY B 2 241 ? 24.758  123.754 -7.356  1.00 17.54 ? 241 GLY B N   1 
ATOM   4484 C  CA  . GLY B 2 241 ? 23.991  124.506 -8.342  1.00 17.04 ? 241 GLY B CA  1 
ATOM   4485 C  C   . GLY B 2 241 ? 24.165  123.996 -9.760  1.00 16.81 ? 241 GLY B C   1 
ATOM   4486 O  O   . GLY B 2 241 ? 23.224  124.008 -10.552 1.00 18.27 ? 241 GLY B O   1 
ATOM   4487 N  N   . VAL B 2 242 ? 25.385  123.570 -10.079 1.00 17.17 ? 242 VAL B N   1 
ATOM   4488 C  CA  . VAL B 2 242 ? 25.724  123.013 -11.388 1.00 18.32 ? 242 VAL B CA  1 
ATOM   4489 C  C   . VAL B 2 242 ? 26.776  121.933 -11.140 1.00 18.66 ? 242 VAL B C   1 
ATOM   4490 O  O   . VAL B 2 242 ? 27.369  121.876 -10.062 1.00 18.64 ? 242 VAL B O   1 
ATOM   4491 C  CB  . VAL B 2 242 ? 26.335  124.076 -12.351 1.00 19.20 ? 242 VAL B CB  1 
ATOM   4492 C  CG1 . VAL B 2 242 ? 25.300  125.142 -12.699 1.00 17.51 ? 242 VAL B CG1 1 
ATOM   4493 C  CG2 . VAL B 2 242 ? 27.562  124.706 -11.718 1.00 20.02 ? 242 VAL B CG2 1 
ATOM   4494 N  N   . PRO B 2 243 ? 27.021  121.058 -12.129 1.00 19.29 ? 243 PRO B N   1 
ATOM   4495 C  CA  . PRO B 2 243 ? 28.026  120.007 -11.935 1.00 18.65 ? 243 PRO B CA  1 
ATOM   4496 C  C   . PRO B 2 243 ? 29.371  120.574 -11.494 1.00 18.84 ? 243 PRO B C   1 
ATOM   4497 O  O   . PRO B 2 243 ? 29.852  121.553 -12.061 1.00 19.21 ? 243 PRO B O   1 
ATOM   4498 C  CB  . PRO B 2 243 ? 28.098  119.346 -13.310 1.00 17.65 ? 243 PRO B CB  1 
ATOM   4499 C  CG  . PRO B 2 243 ? 26.681  119.453 -13.781 1.00 18.43 ? 243 PRO B CG  1 
ATOM   4500 C  CD  . PRO B 2 243 ? 26.335  120.890 -13.421 1.00 18.24 ? 243 PRO B CD  1 
ATOM   4501 N  N   . GLY B 2 244 ? 29.962  119.957 -10.475 1.00 20.26 ? 244 GLY B N   1 
ATOM   4502 C  CA  . GLY B 2 244 ? 31.252  120.398 -9.971  1.00 19.70 ? 244 GLY B CA  1 
ATOM   4503 C  C   . GLY B 2 244 ? 31.196  121.313 -8.760  1.00 20.73 ? 244 GLY B C   1 
ATOM   4504 O  O   . GLY B 2 244 ? 32.173  121.412 -8.011  1.00 21.26 ? 244 GLY B O   1 
ATOM   4505 N  N   . MET B 2 245 ? 30.060  121.972 -8.547  1.00 20.26 ? 245 MET B N   1 
ATOM   4506 C  CA  . MET B 2 245 ? 29.928  122.894 -7.426  1.00 18.29 ? 245 MET B CA  1 
ATOM   4507 C  C   . MET B 2 245 ? 29.577  122.287 -6.073  1.00 18.59 ? 245 MET B C   1 
ATOM   4508 O  O   . MET B 2 245 ? 29.027  121.186 -5.980  1.00 16.00 ? 245 MET B O   1 
ATOM   4509 C  CB  . MET B 2 245 ? 28.931  124.006 -7.767  1.00 19.66 ? 245 MET B CB  1 
ATOM   4510 C  CG  . MET B 2 245 ? 29.588  125.219 -8.423  1.00 21.83 ? 245 MET B CG  1 
ATOM   4511 S  SD  . MET B 2 245 ? 30.964  125.861 -7.425  1.00 26.16 ? 245 MET B SD  1 
ATOM   4512 C  CE  . MET B 2 245 ? 30.083  126.722 -6.127  1.00 24.03 ? 245 MET B CE  1 
ATOM   4513 N  N   . GLU B 2 246 ? 29.914  123.042 -5.030  1.00 17.99 ? 246 GLU B N   1 
ATOM   4514 C  CA  . GLU B 2 246 ? 29.703  122.666 -3.638  1.00 18.00 ? 246 GLU B CA  1 
ATOM   4515 C  C   . GLU B 2 246 ? 28.246  122.359 -3.321  1.00 17.93 ? 246 GLU B C   1 
ATOM   4516 O  O   . GLU B 2 246 ? 27.339  123.047 -3.793  1.00 17.97 ? 246 GLU B O   1 
ATOM   4517 C  CB  . GLU B 2 246 ? 30.221  123.796 -2.735  1.00 18.89 ? 246 GLU B CB  1 
ATOM   4518 C  CG  . GLU B 2 246 ? 29.990  123.608 -1.235  1.00 19.85 ? 246 GLU B CG  1 
ATOM   4519 C  CD  . GLU B 2 246 ? 30.572  124.748 -0.416  1.00 19.92 ? 246 GLU B CD  1 
ATOM   4520 O  OE1 . GLU B 2 246 ? 30.712  125.862 -0.969  1.00 18.11 ? 246 GLU B OE1 1 
ATOM   4521 O  OE2 . GLU B 2 246 ? 30.876  124.543 0.782   1.00 20.00 ? 246 GLU B OE2 1 
ATOM   4522 N  N   . ALA B 2 247 ? 28.033  121.317 -2.522  1.00 17.02 ? 247 ALA B N   1 
ATOM   4523 C  CA  . ALA B 2 247 ? 26.695  120.903 -2.128  1.00 15.95 ? 247 ALA B CA  1 
ATOM   4524 C  C   . ALA B 2 247 ? 26.047  121.973 -1.249  1.00 16.69 ? 247 ALA B C   1 
ATOM   4525 O  O   . ALA B 2 247 ? 26.661  122.469 -0.302  1.00 15.61 ? 247 ALA B O   1 
ATOM   4526 C  CB  . ALA B 2 247 ? 26.763  119.579 -1.377  1.00 13.59 ? 247 ALA B CB  1 
ATOM   4527 N  N   . HIS B 2 248 ? 24.798  122.310 -1.555  1.00 16.47 ? 248 HIS B N   1 
ATOM   4528 C  CA  . HIS B 2 248 ? 24.085  123.328 -0.797  1.00 16.00 ? 248 HIS B CA  1 
ATOM   4529 C  C   . HIS B 2 248 ? 22.622  122.927 -0.605  1.00 15.35 ? 248 HIS B C   1 
ATOM   4530 O  O   . HIS B 2 248 ? 21.990  122.410 -1.522  1.00 15.85 ? 248 HIS B O   1 
ATOM   4531 C  CB  . HIS B 2 248 ? 24.181  124.670 -1.535  1.00 16.43 ? 248 HIS B CB  1 
ATOM   4532 C  CG  . HIS B 2 248 ? 23.828  125.850 -0.685  1.00 18.07 ? 248 HIS B CG  1 
ATOM   4533 N  ND1 . HIS B 2 248 ? 22.533  126.137 -0.309  1.00 17.53 ? 248 HIS B ND1 1 
ATOM   4534 C  CD2 . HIS B 2 248 ? 24.609  126.782 -0.090  1.00 17.09 ? 248 HIS B CD2 1 
ATOM   4535 C  CE1 . HIS B 2 248 ? 22.533  127.192 0.487   1.00 17.67 ? 248 HIS B CE1 1 
ATOM   4536 N  NE2 . HIS B 2 248 ? 23.780  127.602 0.636   1.00 19.98 ? 248 HIS B NE2 1 
ATOM   4537 N  N   . GLY B 2 249 ? 22.095  123.162 0.595   1.00 16.33 ? 249 GLY B N   1 
ATOM   4538 C  CA  . GLY B 2 249 ? 20.715  122.809 0.890   1.00 15.91 ? 249 GLY B CA  1 
ATOM   4539 C  C   . GLY B 2 249 ? 19.700  123.337 -0.107  1.00 17.33 ? 249 GLY B C   1 
ATOM   4540 O  O   . GLY B 2 249 ? 18.759  122.634 -0.476  1.00 17.64 ? 249 GLY B O   1 
ATOM   4541 N  N   . GLY B 2 250 ? 19.878  124.577 -0.548  1.00 17.44 ? 250 GLY B N   1 
ATOM   4542 C  CA  . GLY B 2 250 ? 18.943  125.138 -1.505  1.00 16.89 ? 250 GLY B CA  1 
ATOM   4543 C  C   . GLY B 2 250 ? 18.872  124.352 -2.800  1.00 16.81 ? 250 GLY B C   1 
ATOM   4544 O  O   . GLY B 2 250 ? 17.788  124.015 -3.279  1.00 17.40 ? 250 GLY B O   1 
ATOM   4545 N  N   . TYR B 2 251 ? 20.037  124.057 -3.366  1.00 15.46 ? 251 TYR B N   1 
ATOM   4546 C  CA  . TYR B 2 251 ? 20.126  123.314 -4.616  1.00 16.71 ? 251 TYR B CA  1 
ATOM   4547 C  C   . TYR B 2 251 ? 19.829  121.827 -4.435  1.00 15.39 ? 251 TYR B C   1 
ATOM   4548 O  O   . TYR B 2 251 ? 19.369  121.169 -5.365  1.00 16.26 ? 251 TYR B O   1 
ATOM   4549 C  CB  . TYR B 2 251 ? 21.517  123.506 -5.229  1.00 16.13 ? 251 TYR B CB  1 
ATOM   4550 C  CG  . TYR B 2 251 ? 21.788  124.932 -5.652  1.00 16.60 ? 251 TYR B CG  1 
ATOM   4551 C  CD1 . TYR B 2 251 ? 22.987  125.564 -5.323  1.00 17.14 ? 251 TYR B CD1 1 
ATOM   4552 C  CD2 . TYR B 2 251 ? 20.854  125.642 -6.407  1.00 19.03 ? 251 TYR B CD2 1 
ATOM   4553 C  CE1 . TYR B 2 251 ? 23.251  126.873 -5.742  1.00 18.18 ? 251 TYR B CE1 1 
ATOM   4554 C  CE2 . TYR B 2 251 ? 21.103  126.946 -6.828  1.00 19.10 ? 251 TYR B CE2 1 
ATOM   4555 C  CZ  . TYR B 2 251 ? 22.302  127.554 -6.496  1.00 19.75 ? 251 TYR B CZ  1 
ATOM   4556 O  OH  . TYR B 2 251 ? 22.555  128.833 -6.937  1.00 21.95 ? 251 TYR B OH  1 
ATOM   4557 N  N   . THR B 2 252 ? 20.084  121.300 -3.242  1.00 15.82 ? 252 THR B N   1 
ATOM   4558 C  CA  . THR B 2 252 ? 19.815  119.887 -2.980  1.00 14.09 ? 252 THR B CA  1 
ATOM   4559 C  C   . THR B 2 252 ? 18.303  119.673 -2.884  1.00 15.17 ? 252 THR B C   1 
ATOM   4560 O  O   . THR B 2 252 ? 17.780  118.650 -3.348  1.00 13.49 ? 252 THR B O   1 
ATOM   4561 C  CB  . THR B 2 252 ? 20.514  119.413 -1.686  1.00 15.11 ? 252 THR B CB  1 
ATOM   4562 O  OG1 . THR B 2 252 ? 21.913  119.712 -1.775  1.00 14.20 ? 252 THR B OG1 1 
ATOM   4563 C  CG2 . THR B 2 252 ? 20.347  117.895 -1.499  1.00 12.66 ? 252 THR B CG2 1 
ATOM   4564 N  N   . PHE B 2 253 ? 17.592  120.629 -2.290  1.00 15.13 ? 253 PHE B N   1 
ATOM   4565 C  CA  . PHE B 2 253 ? 16.142  120.498 -2.210  1.00 15.91 ? 253 PHE B CA  1 
ATOM   4566 C  C   . PHE B 2 253 ? 15.595  120.521 -3.635  1.00 15.42 ? 253 PHE B C   1 
ATOM   4567 O  O   . PHE B 2 253 ? 14.814  119.656 -4.027  1.00 15.85 ? 253 PHE B O   1 
ATOM   4568 C  CB  . PHE B 2 253 ? 15.486  121.644 -1.434  1.00 14.78 ? 253 PHE B CB  1 
ATOM   4569 C  CG  . PHE B 2 253 ? 13.980  121.590 -1.480  1.00 16.69 ? 253 PHE B CG  1 
ATOM   4570 C  CD1 . PHE B 2 253 ? 13.278  120.714 -0.653  1.00 16.06 ? 253 PHE B CD1 1 
ATOM   4571 C  CD2 . PHE B 2 253 ? 13.275  122.315 -2.435  1.00 15.91 ? 253 PHE B CD2 1 
ATOM   4572 C  CE1 . PHE B 2 253 ? 11.898  120.553 -0.785  1.00 16.61 ? 253 PHE B CE1 1 
ATOM   4573 C  CE2 . PHE B 2 253 ? 11.892  122.163 -2.580  1.00 17.79 ? 253 PHE B CE2 1 
ATOM   4574 C  CZ  . PHE B 2 253 ? 11.203  121.277 -1.754  1.00 17.16 ? 253 PHE B CZ  1 
ATOM   4575 N  N   . CYS B 2 254 ? 16.001  121.525 -4.405  1.00 13.81 ? 254 CYS B N   1 
ATOM   4576 C  CA  . CYS B 2 254 ? 15.547  121.641 -5.784  1.00 15.82 ? 254 CYS B CA  1 
ATOM   4577 C  C   . CYS B 2 254 ? 15.808  120.363 -6.576  1.00 16.29 ? 254 CYS B C   1 
ATOM   4578 O  O   . CYS B 2 254 ? 14.931  119.873 -7.286  1.00 17.05 ? 254 CYS B O   1 
ATOM   4579 C  CB  . CYS B 2 254 ? 16.251  122.808 -6.488  1.00 13.21 ? 254 CYS B CB  1 
ATOM   4580 S  SG  . CYS B 2 254 ? 15.730  124.449 -5.952  1.00 18.20 ? 254 CYS B SG  1 
ATOM   4581 N  N   . GLY B 2 255 ? 17.023  119.838 -6.450  1.00 15.83 ? 255 GLY B N   1 
ATOM   4582 C  CA  . GLY B 2 255 ? 17.396  118.639 -7.176  1.00 16.11 ? 255 GLY B CA  1 
ATOM   4583 C  C   . GLY B 2 255 ? 16.573  117.413 -6.837  1.00 16.76 ? 255 GLY B C   1 
ATOM   4584 O  O   . GLY B 2 255 ? 16.019  116.771 -7.728  1.00 14.55 ? 255 GLY B O   1 
ATOM   4585 N  N   . LEU B 2 256 ? 16.477  117.088 -5.552  1.00 16.21 ? 256 LEU B N   1 
ATOM   4586 C  CA  . LEU B 2 256 ? 15.723  115.911 -5.141  1.00 15.52 ? 256 LEU B CA  1 
ATOM   4587 C  C   . LEU B 2 256 ? 14.226  116.060 -5.386  1.00 15.67 ? 256 LEU B C   1 
ATOM   4588 O  O   . LEU B 2 256 ? 13.571  115.115 -5.819  1.00 17.34 ? 256 LEU B O   1 
ATOM   4589 C  CB  . LEU B 2 256 ? 15.981  115.592 -3.662  1.00 14.84 ? 256 LEU B CB  1 
ATOM   4590 C  CG  . LEU B 2 256 ? 15.269  114.338 -3.135  1.00 15.58 ? 256 LEU B CG  1 
ATOM   4591 C  CD1 . LEU B 2 256 ? 15.674  113.120 -3.974  1.00 15.58 ? 256 LEU B CD1 1 
ATOM   4592 C  CD2 . LEU B 2 256 ? 15.627  114.115 -1.672  1.00 16.75 ? 256 LEU B CD2 1 
ATOM   4593 N  N   . ALA B 2 257 ? 13.683  117.243 -5.115  1.00 15.04 ? 257 ALA B N   1 
ATOM   4594 C  CA  . ALA B 2 257 ? 12.257  117.475 -5.322  1.00 16.15 ? 257 ALA B CA  1 
ATOM   4595 C  C   . ALA B 2 257 ? 11.907  117.329 -6.806  1.00 15.33 ? 257 ALA B C   1 
ATOM   4596 O  O   . ALA B 2 257 ? 10.874  116.762 -7.153  1.00 15.88 ? 257 ALA B O   1 
ATOM   4597 C  CB  . ALA B 2 257 ? 11.862  118.871 -4.805  1.00 16.01 ? 257 ALA B CB  1 
ATOM   4598 N  N   . ALA B 2 258 ? 12.768  117.836 -7.684  1.00 15.69 ? 258 ALA B N   1 
ATOM   4599 C  CA  . ALA B 2 258 ? 12.514  117.717 -9.113  1.00 16.08 ? 258 ALA B CA  1 
ATOM   4600 C  C   . ALA B 2 258 ? 12.540  116.235 -9.522  1.00 17.73 ? 258 ALA B C   1 
ATOM   4601 O  O   . ALA B 2 258 ? 11.687  115.775 -10.286 1.00 16.98 ? 258 ALA B O   1 
ATOM   4602 C  CB  . ALA B 2 258 ? 13.559  118.510 -9.907  1.00 14.89 ? 258 ALA B CB  1 
ATOM   4603 N  N   . LEU B 2 259 ? 13.514  115.488 -9.008  1.00 17.13 ? 259 LEU B N   1 
ATOM   4604 C  CA  . LEU B 2 259 ? 13.612  114.069 -9.337  1.00 17.80 ? 259 LEU B CA  1 
ATOM   4605 C  C   . LEU B 2 259 ? 12.418  113.285 -8.810  1.00 17.88 ? 259 LEU B C   1 
ATOM   4606 O  O   . LEU B 2 259 ? 11.979  112.332 -9.446  1.00 19.45 ? 259 LEU B O   1 
ATOM   4607 C  CB  . LEU B 2 259 ? 14.916  113.472 -8.794  1.00 17.06 ? 259 LEU B CB  1 
ATOM   4608 C  CG  . LEU B 2 259 ? 16.188  113.902 -9.532  1.00 18.56 ? 259 LEU B CG  1 
ATOM   4609 C  CD1 . LEU B 2 259 ? 17.403  113.325 -8.826  1.00 18.57 ? 259 LEU B CD1 1 
ATOM   4610 C  CD2 . LEU B 2 259 ? 16.135  113.426 -10.988 1.00 15.79 ? 259 LEU B CD2 1 
ATOM   4611 N  N   . VAL B 2 260 ? 11.894  113.673 -7.650  1.00 18.30 ? 260 VAL B N   1 
ATOM   4612 C  CA  . VAL B 2 260 ? 10.724  112.986 -7.101  1.00 19.17 ? 260 VAL B CA  1 
ATOM   4613 C  C   . VAL B 2 260 ? 9.550   113.195 -8.060  1.00 19.80 ? 260 VAL B C   1 
ATOM   4614 O  O   . VAL B 2 260 ? 8.802   112.265 -8.358  1.00 21.67 ? 260 VAL B O   1 
ATOM   4615 C  CB  . VAL B 2 260 ? 10.351  113.528 -5.698  1.00 20.03 ? 260 VAL B CB  1 
ATOM   4616 C  CG1 . VAL B 2 260 ? 8.985   112.986 -5.260  1.00 17.61 ? 260 VAL B CG1 1 
ATOM   4617 C  CG2 . VAL B 2 260 ? 11.425  113.120 -4.688  1.00 20.41 ? 260 VAL B CG2 1 
ATOM   4618 N  N   . ILE B 2 261 ? 9.398   114.420 -8.552  1.00 19.04 ? 261 ILE B N   1 
ATOM   4619 C  CA  . ILE B 2 261 ? 8.326   114.736 -9.494  1.00 19.50 ? 261 ILE B CA  1 
ATOM   4620 C  C   . ILE B 2 261 ? 8.489   113.903 -10.769 1.00 20.80 ? 261 ILE B C   1 
ATOM   4621 O  O   . ILE B 2 261 ? 7.510   113.408 -11.330 1.00 20.67 ? 261 ILE B O   1 
ATOM   4622 C  CB  . ILE B 2 261 ? 8.343   116.241 -9.868  1.00 19.25 ? 261 ILE B CB  1 
ATOM   4623 C  CG1 . ILE B 2 261 ? 7.928   117.073 -8.651  1.00 16.29 ? 261 ILE B CG1 1 
ATOM   4624 C  CG2 . ILE B 2 261 ? 7.427   116.500 -11.062 1.00 17.14 ? 261 ILE B CG2 1 
ATOM   4625 C  CD1 . ILE B 2 261 ? 8.167   118.554 -8.790  1.00 16.74 ? 261 ILE B CD1 1 
ATOM   4626 N  N   . LEU B 2 262 ? 9.730   113.749 -11.221 1.00 19.65 ? 262 LEU B N   1 
ATOM   4627 C  CA  . LEU B 2 262 ? 10.011  112.975 -12.428 1.00 21.70 ? 262 LEU B CA  1 
ATOM   4628 C  C   . LEU B 2 262 ? 10.063  111.471 -12.158 1.00 22.87 ? 262 LEU B C   1 
ATOM   4629 O  O   . LEU B 2 262 ? 10.190  110.668 -13.086 1.00 22.62 ? 262 LEU B O   1 
ATOM   4630 C  CB  . LEU B 2 262 ? 11.340  113.425 -13.043 1.00 22.08 ? 262 LEU B CB  1 
ATOM   4631 C  CG  . LEU B 2 262 ? 11.464  114.895 -13.458 1.00 22.21 ? 262 LEU B CG  1 
ATOM   4632 C  CD1 . LEU B 2 262 ? 12.854  115.151 -14.022 1.00 22.06 ? 262 LEU B CD1 1 
ATOM   4633 C  CD2 . LEU B 2 262 ? 10.405  115.232 -14.492 1.00 23.90 ? 262 LEU B CD2 1 
ATOM   4634 N  N   . LYS B 2 263 ? 9.958   111.091 -10.888 1.00 22.84 ? 263 LYS B N   1 
ATOM   4635 C  CA  . LYS B 2 263 ? 10.012  109.686 -10.504 1.00 24.80 ? 263 LYS B CA  1 
ATOM   4636 C  C   . LYS B 2 263 ? 11.359  109.084 -10.883 1.00 24.41 ? 263 LYS B C   1 
ATOM   4637 O  O   . LYS B 2 263 ? 11.436  107.951 -11.359 1.00 23.73 ? 263 LYS B O   1 
ATOM   4638 C  CB  . LYS B 2 263 ? 8.875   108.906 -11.176 1.00 29.38 ? 263 LYS B CB  1 
ATOM   4639 C  CG  . LYS B 2 263 ? 7.496   109.224 -10.608 1.00 33.07 ? 263 LYS B CG  1 
ATOM   4640 C  CD  . LYS B 2 263 ? 6.387   108.418 -11.282 1.00 39.47 ? 263 LYS B CD  1 
ATOM   4641 C  CE  . LYS B 2 263 ? 6.011   108.980 -12.655 1.00 43.75 ? 263 LYS B CE  1 
ATOM   4642 N  NZ  . LYS B 2 263 ? 7.111   108.907 -13.662 1.00 47.61 ? 263 LYS B NZ  1 
ATOM   4643 N  N   . ARG B 2 264 ? 12.424  109.847 -10.659 1.00 23.06 ? 264 ARG B N   1 
ATOM   4644 C  CA  . ARG B 2 264 ? 13.775  109.395 -10.979 1.00 23.26 ? 264 ARG B CA  1 
ATOM   4645 C  C   . ARG B 2 264 ? 14.764  109.582 -9.819  1.00 23.21 ? 264 ARG B C   1 
ATOM   4646 O  O   . ARG B 2 264 ? 15.961  109.759 -10.046 1.00 21.35 ? 264 ARG B O   1 
ATOM   4647 C  CB  . ARG B 2 264 ? 14.290  110.146 -12.217 1.00 24.09 ? 264 ARG B CB  1 
ATOM   4648 C  CG  . ARG B 2 264 ? 13.551  109.823 -13.520 1.00 25.69 ? 264 ARG B CG  1 
ATOM   4649 C  CD  . ARG B 2 264 ? 13.909  108.425 -14.013 1.00 28.49 ? 264 ARG B CD  1 
ATOM   4650 N  NE  . ARG B 2 264 ? 15.343  108.303 -14.270 1.00 33.00 ? 264 ARG B NE  1 
ATOM   4651 C  CZ  . ARG B 2 264 ? 15.948  108.695 -15.390 1.00 32.81 ? 264 ARG B CZ  1 
ATOM   4652 N  NH1 . ARG B 2 264 ? 15.250  109.231 -16.382 1.00 32.45 ? 264 ARG B NH1 1 
ATOM   4653 N  NH2 . ARG B 2 264 ? 17.261  108.562 -15.511 1.00 35.47 ? 264 ARG B NH2 1 
ATOM   4654 N  N   . GLU B 2 265 ? 14.271  109.534 -8.582  1.00 23.93 ? 265 GLU B N   1 
ATOM   4655 C  CA  . GLU B 2 265 ? 15.131  109.711 -7.407  1.00 26.48 ? 265 GLU B CA  1 
ATOM   4656 C  C   . GLU B 2 265 ? 16.296  108.727 -7.379  1.00 26.31 ? 265 GLU B C   1 
ATOM   4657 O  O   . GLU B 2 265 ? 17.385  109.051 -6.897  1.00 25.41 ? 265 GLU B O   1 
ATOM   4658 C  CB  . GLU B 2 265 ? 14.347  109.524 -6.100  1.00 27.22 ? 265 GLU B CB  1 
ATOM   4659 C  CG  . GLU B 2 265 ? 13.012  110.218 -6.021  1.00 31.86 ? 265 GLU B CG  1 
ATOM   4660 C  CD  . GLU B 2 265 ? 11.885  109.355 -6.547  1.00 32.58 ? 265 GLU B CD  1 
ATOM   4661 O  OE1 . GLU B 2 265 ? 11.790  109.173 -7.776  1.00 31.42 ? 265 GLU B OE1 1 
ATOM   4662 O  OE2 . GLU B 2 265 ? 11.098  108.848 -5.723  1.00 36.67 ? 265 GLU B OE2 1 
ATOM   4663 N  N   . ARG B 2 266 ? 16.064  107.523 -7.888  1.00 27.30 ? 266 ARG B N   1 
ATOM   4664 C  CA  . ARG B 2 266 ? 17.092  106.495 -7.885  1.00 30.40 ? 266 ARG B CA  1 
ATOM   4665 C  C   . ARG B 2 266 ? 18.297  106.818 -8.759  1.00 29.96 ? 266 ARG B C   1 
ATOM   4666 O  O   . ARG B 2 266 ? 19.286  106.084 -8.762  1.00 30.84 ? 266 ARG B O   1 
ATOM   4667 C  CB  . ARG B 2 266 ? 16.472  105.148 -8.270  1.00 35.24 ? 266 ARG B CB  1 
ATOM   4668 C  CG  . ARG B 2 266 ? 15.306  104.775 -7.356  1.00 40.24 ? 266 ARG B CG  1 
ATOM   4669 C  CD  . ARG B 2 266 ? 14.762  103.378 -7.618  1.00 47.20 ? 266 ARG B CD  1 
ATOM   4670 N  NE  . ARG B 2 266 ? 15.704  102.331 -7.226  1.00 51.54 ? 266 ARG B NE  1 
ATOM   4671 C  CZ  . ARG B 2 266 ? 15.389  101.042 -7.134  1.00 54.30 ? 266 ARG B CZ  1 
ATOM   4672 N  NH1 . ARG B 2 266 ? 14.154  100.638 -7.406  1.00 54.24 ? 266 ARG B NH1 1 
ATOM   4673 N  NH2 . ARG B 2 266 ? 16.308  100.156 -6.769  1.00 55.18 ? 266 ARG B NH2 1 
ATOM   4674 N  N   . SER B 2 267 ? 18.224  107.918 -9.498  1.00 28.80 ? 267 SER B N   1 
ATOM   4675 C  CA  . SER B 2 267 ? 19.349  108.329 -10.330 1.00 28.48 ? 267 SER B CA  1 
ATOM   4676 C  C   . SER B 2 267 ? 20.452  108.871 -9.425  1.00 26.94 ? 267 SER B C   1 
ATOM   4677 O  O   . SER B 2 267 ? 21.595  109.037 -9.850  1.00 26.97 ? 267 SER B O   1 
ATOM   4678 C  CB  . SER B 2 267 ? 18.924  109.418 -11.313 1.00 29.63 ? 267 SER B CB  1 
ATOM   4679 O  OG  . SER B 2 267 ? 18.031  108.898 -12.279 1.00 35.18 ? 267 SER B OG  1 
ATOM   4680 N  N   . LEU B 2 268 ? 20.100  109.154 -8.175  1.00 24.20 ? 268 LEU B N   1 
ATOM   4681 C  CA  . LEU B 2 268 ? 21.062  109.675 -7.209  1.00 23.66 ? 268 LEU B CA  1 
ATOM   4682 C  C   . LEU B 2 268 ? 21.564  108.585 -6.272  1.00 24.04 ? 268 LEU B C   1 
ATOM   4683 O  O   . LEU B 2 268 ? 20.990  107.496 -6.195  1.00 23.81 ? 268 LEU B O   1 
ATOM   4684 C  CB  . LEU B 2 268 ? 20.419  110.760 -6.336  1.00 23.27 ? 268 LEU B CB  1 
ATOM   4685 C  CG  . LEU B 2 268 ? 19.879  112.061 -6.931  1.00 22.53 ? 268 LEU B CG  1 
ATOM   4686 C  CD1 . LEU B 2 268 ? 19.181  112.856 -5.837  1.00 23.17 ? 268 LEU B CD1 1 
ATOM   4687 C  CD2 . LEU B 2 268 ? 21.011  112.868 -7.534  1.00 22.40 ? 268 LEU B CD2 1 
ATOM   4688 N  N   . ASN B 2 269 ? 22.646  108.889 -5.566  1.00 22.13 ? 269 ASN B N   1 
ATOM   4689 C  CA  . ASN B 2 269 ? 23.174  107.983 -4.559  1.00 21.87 ? 269 ASN B CA  1 
ATOM   4690 C  C   . ASN B 2 269 ? 22.425  108.500 -3.327  1.00 21.48 ? 269 ASN B C   1 
ATOM   4691 O  O   . ASN B 2 269 ? 22.816  109.507 -2.734  1.00 20.12 ? 269 ASN B O   1 
ATOM   4692 C  CB  . ASN B 2 269 ? 24.678  108.186 -4.371  1.00 21.06 ? 269 ASN B CB  1 
ATOM   4693 C  CG  . ASN B 2 269 ? 25.237  107.358 -3.227  1.00 24.31 ? 269 ASN B CG  1 
ATOM   4694 O  OD1 . ASN B 2 269 ? 24.499  106.949 -2.325  1.00 20.11 ? 269 ASN B OD1 1 
ATOM   4695 N  ND2 . ASN B 2 269 ? 26.547  107.117 -3.250  1.00 20.63 ? 269 ASN B ND2 1 
ATOM   4696 N  N   . LEU B 2 270 ? 21.333  107.835 -2.966  1.00 21.35 ? 270 LEU B N   1 
ATOM   4697 C  CA  . LEU B 2 270 ? 20.524  108.270 -1.828  1.00 22.41 ? 270 LEU B CA  1 
ATOM   4698 C  C   . LEU B 2 270 ? 21.218  108.098 -0.484  1.00 23.02 ? 270 LEU B C   1 
ATOM   4699 O  O   . LEU B 2 270 ? 20.911  108.807 0.474   1.00 21.85 ? 270 LEU B O   1 
ATOM   4700 C  CB  . LEU B 2 270 ? 19.185  107.527 -1.825  1.00 22.99 ? 270 LEU B CB  1 
ATOM   4701 C  CG  . LEU B 2 270 ? 18.319  107.740 -3.073  1.00 24.69 ? 270 LEU B CG  1 
ATOM   4702 C  CD1 . LEU B 2 270 ? 17.039  106.915 -2.964  1.00 25.67 ? 270 LEU B CD1 1 
ATOM   4703 C  CD2 . LEU B 2 270 ? 17.992  109.219 -3.229  1.00 21.63 ? 270 LEU B CD2 1 
ATOM   4704 N  N   . LYS B 2 271 ? 22.155  107.160 -0.420  1.00 22.87 ? 271 LYS B N   1 
ATOM   4705 C  CA  . LYS B 2 271 ? 22.896  106.896 0.804   1.00 24.04 ? 271 LYS B CA  1 
ATOM   4706 C  C   . LYS B 2 271 ? 23.812  108.065 1.158   1.00 22.13 ? 271 LYS B C   1 
ATOM   4707 O  O   . LYS B 2 271 ? 23.823  108.530 2.302   1.00 20.31 ? 271 LYS B O   1 
ATOM   4708 C  CB  . LYS B 2 271 ? 23.713  105.601 0.648   1.00 28.13 ? 271 LYS B CB  1 
ATOM   4709 C  CG  . LYS B 2 271 ? 24.679  105.291 1.793   1.00 34.06 ? 271 LYS B CG  1 
ATOM   4710 C  CD  . LYS B 2 271 ? 26.118  105.671 1.431   1.00 40.93 ? 271 LYS B CD  1 
ATOM   4711 C  CE  . LYS B 2 271 ? 26.640  104.849 0.241   1.00 44.73 ? 271 LYS B CE  1 
ATOM   4712 N  NZ  . LYS B 2 271 ? 28.004  105.269 -0.231  1.00 44.89 ? 271 LYS B NZ  1 
ATOM   4713 N  N   . SER B 2 272 ? 24.570  108.551 0.179   1.00 19.02 ? 272 SER B N   1 
ATOM   4714 C  CA  . SER B 2 272 ? 25.476  109.662 0.438   1.00 18.42 ? 272 SER B CA  1 
ATOM   4715 C  C   . SER B 2 272 ? 24.696  110.958 0.647   1.00 17.66 ? 272 SER B C   1 
ATOM   4716 O  O   . SER B 2 272 ? 25.143  111.846 1.379   1.00 16.45 ? 272 SER B O   1 
ATOM   4717 C  CB  . SER B 2 272 ? 26.491  109.821 -0.705  1.00 16.84 ? 272 SER B CB  1 
ATOM   4718 O  OG  . SER B 2 272 ? 25.860  110.103 -1.940  1.00 20.05 ? 272 SER B OG  1 
ATOM   4719 N  N   . LEU B 2 273 ? 23.527  111.057 0.021   1.00 16.54 ? 273 LEU B N   1 
ATOM   4720 C  CA  . LEU B 2 273 ? 22.695  112.249 0.162   1.00 17.69 ? 273 LEU B CA  1 
ATOM   4721 C  C   . LEU B 2 273 ? 22.113  112.290 1.574   1.00 17.12 ? 273 LEU B C   1 
ATOM   4722 O  O   . LEU B 2 273 ? 22.112  113.334 2.226   1.00 17.12 ? 273 LEU B O   1 
ATOM   4723 C  CB  . LEU B 2 273 ? 21.552  112.229 -0.857  1.00 17.70 ? 273 LEU B CB  1 
ATOM   4724 C  CG  . LEU B 2 273 ? 20.928  113.574 -1.264  1.00 22.74 ? 273 LEU B CG  1 
ATOM   4725 C  CD1 . LEU B 2 273 ? 19.759  113.307 -2.204  1.00 22.28 ? 273 LEU B CD1 1 
ATOM   4726 C  CD2 . LEU B 2 273 ? 20.453  114.349 -0.057  1.00 23.14 ? 273 LEU B CD2 1 
ATOM   4727 N  N   . LEU B 2 274 ? 21.613  111.149 2.037   1.00 18.24 ? 274 LEU B N   1 
ATOM   4728 C  CA  . LEU B 2 274 ? 21.028  111.051 3.373   1.00 18.11 ? 274 LEU B CA  1 
ATOM   4729 C  C   . LEU B 2 274 ? 22.054  111.407 4.438   1.00 18.16 ? 274 LEU B C   1 
ATOM   4730 O  O   . LEU B 2 274 ? 21.782  112.192 5.349   1.00 17.48 ? 274 LEU B O   1 
ATOM   4731 C  CB  . LEU B 2 274 ? 20.506  109.631 3.625   1.00 16.87 ? 274 LEU B CB  1 
ATOM   4732 C  CG  . LEU B 2 274 ? 19.970  109.337 5.034   1.00 19.26 ? 274 LEU B CG  1 
ATOM   4733 C  CD1 . LEU B 2 274 ? 18.752  110.206 5.342   1.00 16.41 ? 274 LEU B CD1 1 
ATOM   4734 C  CD2 . LEU B 2 274 ? 19.597  107.859 5.128   1.00 17.38 ? 274 LEU B CD2 1 
ATOM   4735 N  N   . GLN B 2 275 ? 23.243  110.831 4.322   1.00 19.35 ? 275 GLN B N   1 
ATOM   4736 C  CA  . GLN B 2 275 ? 24.283  111.101 5.299   1.00 20.20 ? 275 GLN B CA  1 
ATOM   4737 C  C   . GLN B 2 275 ? 24.689  112.571 5.270   1.00 19.52 ? 275 GLN B C   1 
ATOM   4738 O  O   . GLN B 2 275 ? 24.956  113.164 6.312   1.00 17.80 ? 275 GLN B O   1 
ATOM   4739 C  CB  . GLN B 2 275 ? 25.493  110.199 5.052   1.00 21.09 ? 275 GLN B CB  1 
ATOM   4740 C  CG  . GLN B 2 275 ? 26.508  110.226 6.185   1.00 25.15 ? 275 GLN B CG  1 
ATOM   4741 C  CD  . GLN B 2 275 ? 27.273  108.923 6.313   1.00 28.26 ? 275 GLN B CD  1 
ATOM   4742 O  OE1 . GLN B 2 275 ? 27.613  108.287 5.312   1.00 31.02 ? 275 GLN B OE1 1 
ATOM   4743 N  NE2 . GLN B 2 275 ? 27.558  108.522 7.551   1.00 30.11 ? 275 GLN B NE2 1 
ATOM   4744 N  N   . TRP B 2 276 ? 24.716  113.162 4.079   1.00 18.38 ? 276 TRP B N   1 
ATOM   4745 C  CA  . TRP B 2 276 ? 25.084  114.566 3.946   1.00 17.56 ? 276 TRP B CA  1 
ATOM   4746 C  C   . TRP B 2 276 ? 24.067  115.499 4.599   1.00 16.84 ? 276 TRP B C   1 
ATOM   4747 O  O   . TRP B 2 276 ? 24.440  116.336 5.420   1.00 17.22 ? 276 TRP B O   1 
ATOM   4748 C  CB  . TRP B 2 276 ? 25.232  114.959 2.471   1.00 15.24 ? 276 TRP B CB  1 
ATOM   4749 C  CG  . TRP B 2 276 ? 25.522  116.425 2.283   1.00 16.36 ? 276 TRP B CG  1 
ATOM   4750 C  CD1 . TRP B 2 276 ? 26.738  117.047 2.386   1.00 15.65 ? 276 TRP B CD1 1 
ATOM   4751 C  CD2 . TRP B 2 276 ? 24.569  117.454 1.982   1.00 16.18 ? 276 TRP B CD2 1 
ATOM   4752 N  NE1 . TRP B 2 276 ? 26.599  118.401 2.163   1.00 16.83 ? 276 TRP B NE1 1 
ATOM   4753 C  CE2 . TRP B 2 276 ? 25.279  118.676 1.913   1.00 17.06 ? 276 TRP B CE2 1 
ATOM   4754 C  CE3 . TRP B 2 276 ? 23.183  117.461 1.762   1.00 15.32 ? 276 TRP B CE3 1 
ATOM   4755 C  CZ2 . TRP B 2 276 ? 24.646  119.900 1.631   1.00 17.71 ? 276 TRP B CZ2 1 
ATOM   4756 C  CZ3 . TRP B 2 276 ? 22.555  118.676 1.481   1.00 18.31 ? 276 TRP B CZ3 1 
ATOM   4757 C  CH2 . TRP B 2 276 ? 23.290  119.879 1.418   1.00 17.52 ? 276 TRP B CH2 1 
ATOM   4758 N  N   . VAL B 2 277 ? 22.787  115.362 4.247   1.00 17.05 ? 277 VAL B N   1 
ATOM   4759 C  CA  . VAL B 2 277 ? 21.772  116.254 4.818   1.00 17.13 ? 277 VAL B CA  1 
ATOM   4760 C  C   . VAL B 2 277 ? 21.631  116.136 6.337   1.00 16.66 ? 277 VAL B C   1 
ATOM   4761 O  O   . VAL B 2 277 ? 21.499  117.148 7.032   1.00 16.14 ? 277 VAL B O   1 
ATOM   4762 C  CB  . VAL B 2 277 ? 20.374  116.066 4.151   1.00 16.75 ? 277 VAL B CB  1 
ATOM   4763 C  CG1 . VAL B 2 277 ? 19.827  114.676 4.425   1.00 17.59 ? 277 VAL B CG1 1 
ATOM   4764 C  CG2 . VAL B 2 277 ? 19.406  117.131 4.674   1.00 16.28 ? 277 VAL B CG2 1 
ATOM   4765 N  N   . THR B 2 278 ? 21.672  114.919 6.866   1.00 16.79 ? 278 THR B N   1 
ATOM   4766 C  CA  . THR B 2 278 ? 21.551  114.755 8.311   1.00 17.93 ? 278 THR B CA  1 
ATOM   4767 C  C   . THR B 2 278 ? 22.734  115.415 9.025   1.00 18.57 ? 278 THR B C   1 
ATOM   4768 O  O   . THR B 2 278 ? 22.598  115.916 10.143  1.00 17.18 ? 278 THR B O   1 
ATOM   4769 C  CB  . THR B 2 278 ? 21.449  113.261 8.716   1.00 18.69 ? 278 THR B CB  1 
ATOM   4770 O  OG1 . THR B 2 278 ? 22.552  112.524 8.174   1.00 18.95 ? 278 THR B OG1 1 
ATOM   4771 C  CG2 . THR B 2 278 ? 20.140  112.665 8.208   1.00 17.04 ? 278 THR B CG2 1 
ATOM   4772 N  N   . SER B 2 279 ? 23.890  115.433 8.366   1.00 17.33 ? 279 SER B N   1 
ATOM   4773 C  CA  . SER B 2 279 ? 25.082  116.048 8.935   1.00 17.85 ? 279 SER B CA  1 
ATOM   4774 C  C   . SER B 2 279 ? 24.981  117.574 8.956   1.00 17.74 ? 279 SER B C   1 
ATOM   4775 O  O   . SER B 2 279 ? 25.753  118.240 9.648   1.00 16.05 ? 279 SER B O   1 
ATOM   4776 C  CB  . SER B 2 279 ? 26.327  115.635 8.139   1.00 18.82 ? 279 SER B CB  1 
ATOM   4777 O  OG  . SER B 2 279 ? 26.592  114.252 8.288   1.00 23.63 ? 279 SER B OG  1 
ATOM   4778 N  N   . ARG B 2 280 ? 24.027  118.121 8.202   1.00 15.41 ? 280 ARG B N   1 
ATOM   4779 C  CA  . ARG B 2 280 ? 23.849  119.568 8.134   1.00 16.14 ? 280 ARG B CA  1 
ATOM   4780 C  C   . ARG B 2 280 ? 23.075  120.159 9.319   1.00 17.86 ? 280 ARG B C   1 
ATOM   4781 O  O   . ARG B 2 280 ? 22.948  121.382 9.435   1.00 16.28 ? 280 ARG B O   1 
ATOM   4782 C  CB  . ARG B 2 280 ? 23.168  119.949 6.814   1.00 16.45 ? 280 ARG B CB  1 
ATOM   4783 C  CG  . ARG B 2 280 ? 23.954  119.540 5.560   1.00 14.84 ? 280 ARG B CG  1 
ATOM   4784 C  CD  . ARG B 2 280 ? 25.190  120.418 5.315   1.00 16.68 ? 280 ARG B CD  1 
ATOM   4785 N  NE  . ARG B 2 280 ? 26.252  120.243 6.307   1.00 16.97 ? 280 ARG B NE  1 
ATOM   4786 C  CZ  . ARG B 2 280 ? 27.066  119.191 6.373   1.00 18.12 ? 280 ARG B CZ  1 
ATOM   4787 N  NH1 . ARG B 2 280 ? 26.953  118.197 5.500   1.00 17.47 ? 280 ARG B NH1 1 
ATOM   4788 N  NH2 . ARG B 2 280 ? 28.000  119.129 7.318   1.00 14.77 ? 280 ARG B NH2 1 
ATOM   4789 N  N   . GLN B 2 281 ? 22.541  119.304 10.189  1.00 16.41 ? 281 GLN B N   1 
ATOM   4790 C  CA  . GLN B 2 281 ? 21.842  119.807 11.365  1.00 17.76 ? 281 GLN B CA  1 
ATOM   4791 C  C   . GLN B 2 281 ? 22.924  120.090 12.410  1.00 18.29 ? 281 GLN B C   1 
ATOM   4792 O  O   . GLN B 2 281 ? 23.764  119.237 12.691  1.00 19.00 ? 281 GLN B O   1 
ATOM   4793 C  CB  . GLN B 2 281 ? 20.823  118.786 11.893  1.00 16.55 ? 281 GLN B CB  1 
ATOM   4794 C  CG  . GLN B 2 281 ? 19.983  119.319 13.060  1.00 16.22 ? 281 GLN B CG  1 
ATOM   4795 C  CD  . GLN B 2 281 ? 18.732  118.498 13.347  1.00 18.33 ? 281 GLN B CD  1 
ATOM   4796 O  OE1 . GLN B 2 281 ? 18.681  117.289 13.097  1.00 17.53 ? 281 GLN B OE1 1 
ATOM   4797 N  NE2 . GLN B 2 281 ? 17.717  119.155 13.898  1.00 21.25 ? 281 GLN B NE2 1 
ATOM   4798 N  N   . MET B 2 282 ? 22.906  121.298 12.967  1.00 19.54 ? 282 MET B N   1 
ATOM   4799 C  CA  . MET B 2 282 ? 23.903  121.724 13.947  1.00 19.92 ? 282 MET B CA  1 
ATOM   4800 C  C   . MET B 2 282 ? 23.684  121.096 15.318  1.00 20.31 ? 282 MET B C   1 
ATOM   4801 O  O   . MET B 2 282 ? 22.625  121.263 15.929  1.00 19.08 ? 282 MET B O   1 
ATOM   4802 C  CB  . MET B 2 282 ? 23.883  123.251 14.068  1.00 20.43 ? 282 MET B CB  1 
ATOM   4803 C  CG  . MET B 2 282 ? 23.920  123.977 12.729  1.00 22.34 ? 282 MET B CG  1 
ATOM   4804 S  SD  . MET B 2 282 ? 25.363  123.557 11.718  1.00 22.86 ? 282 MET B SD  1 
ATOM   4805 C  CE  . MET B 2 282 ? 26.568  124.770 12.344  1.00 21.19 ? 282 MET B CE  1 
ATOM   4806 N  N   . ARG B 2 283 ? 24.695  120.384 15.806  1.00 19.09 ? 283 ARG B N   1 
ATOM   4807 C  CA  . ARG B 2 283 ? 24.587  119.719 17.098  1.00 19.51 ? 283 ARG B CA  1 
ATOM   4808 C  C   . ARG B 2 283 ? 24.228  120.679 18.228  1.00 19.27 ? 283 ARG B C   1 
ATOM   4809 O  O   . ARG B 2 283 ? 23.467  120.322 19.125  1.00 20.45 ? 283 ARG B O   1 
ATOM   4810 C  CB  . ARG B 2 283 ? 25.885  118.968 17.429  1.00 19.47 ? 283 ARG B CB  1 
ATOM   4811 C  CG  . ARG B 2 283 ? 27.117  119.845 17.557  1.00 22.10 ? 283 ARG B CG  1 
ATOM   4812 C  CD  . ARG B 2 283 ? 28.366  119.022 17.881  1.00 24.57 ? 283 ARG B CD  1 
ATOM   4813 N  NE  . ARG B 2 283 ? 28.737  118.121 16.791  1.00 30.20 ? 283 ARG B NE  1 
ATOM   4814 C  CZ  . ARG B 2 283 ? 28.482  116.815 16.771  1.00 35.31 ? 283 ARG B CZ  1 
ATOM   4815 N  NH1 . ARG B 2 283 ? 27.850  116.234 17.787  1.00 37.58 ? 283 ARG B NH1 1 
ATOM   4816 N  NH2 . ARG B 2 283 ? 28.861  116.084 15.730  1.00 37.66 ? 283 ARG B NH2 1 
ATOM   4817 N  N   . PHE B 2 284 ? 24.753  121.899 18.188  1.00 19.76 ? 284 PHE B N   1 
ATOM   4818 C  CA  . PHE B 2 284 ? 24.445  122.851 19.252  1.00 20.18 ? 284 PHE B CA  1 
ATOM   4819 C  C   . PHE B 2 284 ? 23.177  123.668 19.015  1.00 19.56 ? 284 PHE B C   1 
ATOM   4820 O  O   . PHE B 2 284 ? 22.263  123.638 19.834  1.00 20.13 ? 284 PHE B O   1 
ATOM   4821 C  CB  . PHE B 2 284 ? 25.615  123.814 19.493  1.00 21.91 ? 284 PHE B CB  1 
ATOM   4822 C  CG  . PHE B 2 284 ? 25.393  124.735 20.662  1.00 22.82 ? 284 PHE B CG  1 
ATOM   4823 C  CD1 . PHE B 2 284 ? 25.441  124.246 21.966  1.00 24.30 ? 284 PHE B CD1 1 
ATOM   4824 C  CD2 . PHE B 2 284 ? 25.049  126.069 20.461  1.00 23.12 ? 284 PHE B CD2 1 
ATOM   4825 C  CE1 . PHE B 2 284 ? 25.143  125.069 23.055  1.00 25.43 ? 284 PHE B CE1 1 
ATOM   4826 C  CE2 . PHE B 2 284 ? 24.749  126.902 21.542  1.00 24.21 ? 284 PHE B CE2 1 
ATOM   4827 C  CZ  . PHE B 2 284 ? 24.794  126.400 22.841  1.00 23.85 ? 284 PHE B CZ  1 
ATOM   4828 N  N   . GLU B 2 285 ? 23.116  124.389 17.897  1.00 18.65 ? 285 GLU B N   1 
ATOM   4829 C  CA  . GLU B 2 285 ? 21.956  125.230 17.596  1.00 19.33 ? 285 GLU B CA  1 
ATOM   4830 C  C   . GLU B 2 285 ? 20.645  124.476 17.358  1.00 19.09 ? 285 GLU B C   1 
ATOM   4831 O  O   . GLU B 2 285 ? 19.569  124.991 17.663  1.00 19.18 ? 285 GLU B O   1 
ATOM   4832 C  CB  . GLU B 2 285 ? 22.240  126.121 16.380  1.00 19.39 ? 285 GLU B CB  1 
ATOM   4833 C  CG  . GLU B 2 285 ? 23.491  126.986 16.496  1.00 21.07 ? 285 GLU B CG  1 
ATOM   4834 C  CD  . GLU B 2 285 ? 24.724  126.308 15.922  1.00 23.14 ? 285 GLU B CD  1 
ATOM   4835 O  OE1 . GLU B 2 285 ? 25.147  125.265 16.460  1.00 22.74 ? 285 GLU B OE1 1 
ATOM   4836 O  OE2 . GLU B 2 285 ? 25.265  126.821 14.921  1.00 24.44 ? 285 GLU B OE2 1 
ATOM   4837 N  N   . GLY B 2 286 ? 20.729  123.270 16.801  1.00 18.39 ? 286 GLY B N   1 
ATOM   4838 C  CA  . GLY B 2 286 ? 19.523  122.505 16.539  1.00 16.11 ? 286 GLY B CA  1 
ATOM   4839 C  C   . GLY B 2 286 ? 18.935  122.758 15.161  1.00 17.02 ? 286 GLY B C   1 
ATOM   4840 O  O   . GLY B 2 286 ? 18.178  121.932 14.646  1.00 15.85 ? 286 GLY B O   1 
ATOM   4841 N  N   . GLY B 2 287 ? 19.266  123.905 14.570  1.00 17.56 ? 287 GLY B N   1 
ATOM   4842 C  CA  . GLY B 2 287 ? 18.779  124.227 13.237  1.00 16.90 ? 287 GLY B CA  1 
ATOM   4843 C  C   . GLY B 2 287 ? 19.734  123.656 12.200  1.00 17.11 ? 287 GLY B C   1 
ATOM   4844 O  O   . GLY B 2 287 ? 20.656  122.917 12.551  1.00 16.08 ? 287 GLY B O   1 
ATOM   4845 N  N   . PHE B 2 288 ? 19.524  123.991 10.929  1.00 15.89 ? 288 PHE B N   1 
ATOM   4846 C  CA  . PHE B 2 288 ? 20.377  123.502 9.850   1.00 16.20 ? 288 PHE B CA  1 
ATOM   4847 C  C   . PHE B 2 288 ? 21.217  124.606 9.201   1.00 16.47 ? 288 PHE B C   1 
ATOM   4848 O  O   . PHE B 2 288 ? 20.796  125.761 9.138   1.00 16.85 ? 288 PHE B O   1 
ATOM   4849 C  CB  . PHE B 2 288 ? 19.539  122.853 8.736   1.00 14.97 ? 288 PHE B CB  1 
ATOM   4850 C  CG  . PHE B 2 288 ? 18.980  121.499 9.084   1.00 16.86 ? 288 PHE B CG  1 
ATOM   4851 C  CD1 . PHE B 2 288 ? 17.882  121.374 9.932   1.00 15.29 ? 288 PHE B CD1 1 
ATOM   4852 C  CD2 . PHE B 2 288 ? 19.540  120.348 8.538   1.00 14.67 ? 288 PHE B CD2 1 
ATOM   4853 C  CE1 . PHE B 2 288 ? 17.347  120.116 10.226  1.00 16.04 ? 288 PHE B CE1 1 
ATOM   4854 C  CE2 . PHE B 2 288 ? 19.014  119.085 8.824   1.00 15.47 ? 288 PHE B CE2 1 
ATOM   4855 C  CZ  . PHE B 2 288 ? 17.918  118.968 9.666   1.00 14.58 ? 288 PHE B CZ  1 
ATOM   4856 N  N   . GLN B 2 289 ? 22.401  124.230 8.718   1.00 17.59 ? 289 GLN B N   1 
ATOM   4857 C  CA  . GLN B 2 289 ? 23.300  125.142 8.006   1.00 18.14 ? 289 GLN B CA  1 
ATOM   4858 C  C   . GLN B 2 289 ? 23.058  124.820 6.520   1.00 18.05 ? 289 GLN B C   1 
ATOM   4859 O  O   . GLN B 2 289 ? 22.530  123.755 6.205   1.00 17.07 ? 289 GLN B O   1 
ATOM   4860 C  CB  . GLN B 2 289 ? 24.769  124.852 8.374   1.00 16.11 ? 289 GLN B CB  1 
ATOM   4861 C  CG  . GLN B 2 289 ? 25.248  123.468 7.924   1.00 15.84 ? 289 GLN B CG  1 
ATOM   4862 C  CD  . GLN B 2 289 ? 26.622  123.091 8.464   1.00 18.77 ? 289 GLN B CD  1 
ATOM   4863 O  OE1 . GLN B 2 289 ? 27.352  123.930 9.001   1.00 18.78 ? 289 GLN B OE1 1 
ATOM   4864 N  NE2 . GLN B 2 289 ? 26.983  121.820 8.316   1.00 14.66 ? 289 GLN B NE2 1 
ATOM   4865 N  N   . GLY B 2 290 ? 23.443  125.724 5.616   1.00 18.55 ? 290 GLY B N   1 
ATOM   4866 C  CA  . GLY B 2 290 ? 23.234  125.498 4.192   1.00 16.92 ? 290 GLY B CA  1 
ATOM   4867 C  C   . GLY B 2 290 ? 24.290  124.637 3.520   1.00 18.07 ? 290 GLY B C   1 
ATOM   4868 O  O   . GLY B 2 290 ? 24.039  123.990 2.502   1.00 17.30 ? 290 GLY B O   1 
ATOM   4869 N  N   . ARG B 2 291 ? 25.490  124.648 4.081   1.00 17.60 ? 291 ARG B N   1 
ATOM   4870 C  CA  . ARG B 2 291 ? 26.587  123.848 3.560   1.00 17.84 ? 291 ARG B CA  1 
ATOM   4871 C  C   . ARG B 2 291 ? 27.580  123.639 4.686   1.00 17.38 ? 291 ARG B C   1 
ATOM   4872 O  O   . ARG B 2 291 ? 27.590  124.392 5.661   1.00 16.94 ? 291 ARG B O   1 
ATOM   4873 C  CB  . ARG B 2 291 ? 27.257  124.535 2.358   1.00 16.37 ? 291 ARG B CB  1 
ATOM   4874 C  CG  . ARG B 2 291 ? 27.261  126.057 2.413   1.00 18.11 ? 291 ARG B CG  1 
ATOM   4875 C  CD  . ARG B 2 291 ? 28.024  126.653 1.223   1.00 15.99 ? 291 ARG B CD  1 
ATOM   4876 N  NE  . ARG B 2 291 ? 27.817  128.098 1.126   1.00 16.20 ? 291 ARG B NE  1 
ATOM   4877 C  CZ  . ARG B 2 291 ? 28.629  128.928 0.480   1.00 17.45 ? 291 ARG B CZ  1 
ATOM   4878 N  NH1 . ARG B 2 291 ? 29.715  128.459 -0.129  1.00 16.15 ? 291 ARG B NH1 1 
ATOM   4879 N  NH2 . ARG B 2 291 ? 28.353  130.225 0.437   1.00 16.65 ? 291 ARG B NH2 1 
ATOM   4880 N  N   . CYS B 2 292 ? 28.406  122.609 4.552   1.00 16.61 ? 292 CYS B N   1 
ATOM   4881 C  CA  . CYS B 2 292 ? 29.387  122.283 5.571   1.00 18.01 ? 292 CYS B CA  1 
ATOM   4882 C  C   . CYS B 2 292 ? 30.253  123.473 5.961   1.00 18.03 ? 292 CYS B C   1 
ATOM   4883 O  O   . CYS B 2 292 ? 30.752  124.211 5.108   1.00 15.92 ? 292 CYS B O   1 
ATOM   4884 C  CB  . CYS B 2 292 ? 30.280  121.134 5.097   1.00 18.73 ? 292 CYS B CB  1 
ATOM   4885 S  SG  . CYS B 2 292 ? 31.480  120.594 6.343   1.00 21.15 ? 292 CYS B SG  1 
ATOM   4886 N  N   . ASN B 2 293 ? 30.419  123.643 7.267   1.00 17.99 ? 293 ASN B N   1 
ATOM   4887 C  CA  . ASN B 2 293 ? 31.223  124.714 7.837   1.00 18.19 ? 293 ASN B CA  1 
ATOM   4888 C  C   . ASN B 2 293 ? 30.735  126.145 7.636   1.00 18.53 ? 293 ASN B C   1 
ATOM   4889 O  O   . ASN B 2 293 ? 31.531  127.083 7.674   1.00 17.83 ? 293 ASN B O   1 
ATOM   4890 C  CB  . ASN B 2 293 ? 32.687  124.589 7.392   1.00 18.56 ? 293 ASN B CB  1 
ATOM   4891 C  CG  . ASN B 2 293 ? 33.504  123.716 8.334   1.00 20.98 ? 293 ASN B CG  1 
ATOM   4892 O  OD1 . ASN B 2 293 ? 33.341  123.785 9.554   1.00 22.62 ? 293 ASN B OD1 1 
ATOM   4893 N  ND2 . ASN B 2 293 ? 34.399  122.902 7.775   1.00 21.92 ? 293 ASN B ND2 1 
ATOM   4894 N  N   . LYS B 2 294 ? 29.437  126.316 7.400   1.00 18.73 ? 294 LYS B N   1 
ATOM   4895 C  CA  . LYS B 2 294 ? 28.876  127.658 7.305   1.00 18.08 ? 294 LYS B CA  1 
ATOM   4896 C  C   . LYS B 2 294 ? 27.873  127.752 8.459   1.00 17.66 ? 294 LYS B C   1 
ATOM   4897 O  O   . LYS B 2 294 ? 27.765  126.815 9.254   1.00 17.76 ? 294 LYS B O   1 
ATOM   4898 C  CB  . LYS B 2 294 ? 28.251  127.935 5.927   1.00 19.02 ? 294 LYS B CB  1 
ATOM   4899 C  CG  . LYS B 2 294 ? 29.328  128.093 4.838   1.00 20.90 ? 294 LYS B CG  1 
ATOM   4900 C  CD  . LYS B 2 294 ? 29.060  129.237 3.860   1.00 19.42 ? 294 LYS B CD  1 
ATOM   4901 C  CE  . LYS B 2 294 ? 29.232  130.609 4.510   1.00 19.39 ? 294 LYS B CE  1 
ATOM   4902 N  NZ  . LYS B 2 294 ? 28.769  131.712 3.612   1.00 19.41 ? 294 LYS B NZ  1 
ATOM   4903 N  N   . LEU B 2 295 ? 27.143  128.856 8.561   1.00 17.76 ? 295 LEU B N   1 
ATOM   4904 C  CA  . LEU B 2 295 ? 26.244  129.066 9.696   1.00 17.32 ? 295 LEU B CA  1 
ATOM   4905 C  C   . LEU B 2 295 ? 24.802  128.580 9.630   1.00 17.44 ? 295 LEU B C   1 
ATOM   4906 O  O   . LEU B 2 295 ? 24.224  128.424 8.555   1.00 17.77 ? 295 LEU B O   1 
ATOM   4907 C  CB  . LEU B 2 295 ? 26.244  130.559 10.060  1.00 17.46 ? 295 LEU B CB  1 
ATOM   4908 C  CG  . LEU B 2 295 ? 27.623  131.234 10.143  1.00 20.13 ? 295 LEU B CG  1 
ATOM   4909 C  CD1 . LEU B 2 295 ? 27.461  132.740 10.404  1.00 18.20 ? 295 LEU B CD1 1 
ATOM   4910 C  CD2 . LEU B 2 295 ? 28.447  130.579 11.241  1.00 18.39 ? 295 LEU B CD2 1 
ATOM   4911 N  N   . VAL B 2 296 ? 24.237  128.352 10.815  1.00 17.10 ? 296 VAL B N   1 
ATOM   4912 C  CA  . VAL B 2 296 ? 22.852  127.923 10.972  1.00 16.74 ? 296 VAL B CA  1 
ATOM   4913 C  C   . VAL B 2 296 ? 21.977  129.037 10.389  1.00 17.96 ? 296 VAL B C   1 
ATOM   4914 O  O   . VAL B 2 296 ? 22.359  130.207 10.418  1.00 17.83 ? 296 VAL B O   1 
ATOM   4915 C  CB  . VAL B 2 296 ? 22.498  127.735 12.482  1.00 16.88 ? 296 VAL B CB  1 
ATOM   4916 C  CG1 . VAL B 2 296 ? 22.415  129.099 13.180  1.00 15.01 ? 296 VAL B CG1 1 
ATOM   4917 C  CG2 . VAL B 2 296 ? 21.188  126.983 12.631  1.00 13.73 ? 296 VAL B CG2 1 
ATOM   4918 N  N   . ASP B 2 297 ? 20.811  128.679 9.862   1.00 17.64 ? 297 ASP B N   1 
ATOM   4919 C  CA  . ASP B 2 297 ? 19.907  129.663 9.272   1.00 18.34 ? 297 ASP B CA  1 
ATOM   4920 C  C   . ASP B 2 297 ? 18.495  129.080 9.246   1.00 17.87 ? 297 ASP B C   1 
ATOM   4921 O  O   . ASP B 2 297 ? 18.272  127.989 8.726   1.00 18.38 ? 297 ASP B O   1 
ATOM   4922 C  CB  . ASP B 2 297 ? 20.375  130.010 7.849   1.00 18.41 ? 297 ASP B CB  1 
ATOM   4923 C  CG  . ASP B 2 297 ? 19.444  130.983 7.131   1.00 19.21 ? 297 ASP B CG  1 
ATOM   4924 O  OD1 . ASP B 2 297 ? 18.283  131.147 7.560   1.00 17.42 ? 297 ASP B OD1 1 
ATOM   4925 O  OD2 . ASP B 2 297 ? 19.876  131.572 6.112   1.00 18.70 ? 297 ASP B OD2 1 
ATOM   4926 N  N   . GLY B 2 298 ? 17.549  129.819 9.814   1.00 17.65 ? 298 GLY B N   1 
ATOM   4927 C  CA  . GLY B 2 298 ? 16.169  129.372 9.871   1.00 18.67 ? 298 GLY B CA  1 
ATOM   4928 C  C   . GLY B 2 298 ? 15.502  128.900 8.584   1.00 19.09 ? 298 GLY B C   1 
ATOM   4929 O  O   . GLY B 2 298 ? 14.657  127.998 8.629   1.00 19.23 ? 298 GLY B O   1 
ATOM   4930 N  N   . CYS B 2 299 ? 15.851  129.476 7.436   1.00 17.41 ? 299 CYS B N   1 
ATOM   4931 C  CA  . CYS B 2 299 ? 15.199  129.037 6.201   1.00 16.28 ? 299 CYS B CA  1 
ATOM   4932 C  C   . CYS B 2 299 ? 15.580  127.607 5.820   1.00 16.68 ? 299 CYS B C   1 
ATOM   4933 O  O   . CYS B 2 299 ? 14.819  126.921 5.134   1.00 15.60 ? 299 CYS B O   1 
ATOM   4934 C  CB  . CYS B 2 299 ? 15.504  129.994 5.038   1.00 15.96 ? 299 CYS B CB  1 
ATOM   4935 S  SG  . CYS B 2 299 ? 17.214  130.031 4.463   1.00 16.20 ? 299 CYS B SG  1 
ATOM   4936 N  N   . TYR B 2 300 ? 16.750  127.149 6.260   1.00 15.33 ? 300 TYR B N   1 
ATOM   4937 C  CA  . TYR B 2 300 ? 17.164  125.785 5.943   1.00 16.38 ? 300 TYR B CA  1 
ATOM   4938 C  C   . TYR B 2 300 ? 16.311  124.779 6.717   1.00 15.53 ? 300 TYR B C   1 
ATOM   4939 O  O   . TYR B 2 300 ? 16.408  123.571 6.496   1.00 15.42 ? 300 TYR B O   1 
ATOM   4940 C  CB  . TYR B 2 300 ? 18.664  125.595 6.226   1.00 16.07 ? 300 TYR B CB  1 
ATOM   4941 C  CG  . TYR B 2 300 ? 19.529  126.459 5.327   1.00 15.41 ? 300 TYR B CG  1 
ATOM   4942 C  CD1 . TYR B 2 300 ? 20.564  127.236 5.848   1.00 14.66 ? 300 TYR B CD1 1 
ATOM   4943 C  CD2 . TYR B 2 300 ? 19.250  126.563 3.963   1.00 15.20 ? 300 TYR B CD2 1 
ATOM   4944 C  CE1 . TYR B 2 300 ? 21.292  128.107 5.032   1.00 15.84 ? 300 TYR B CE1 1 
ATOM   4945 C  CE2 . TYR B 2 300 ? 19.968  127.425 3.140   1.00 15.28 ? 300 TYR B CE2 1 
ATOM   4946 C  CZ  . TYR B 2 300 ? 20.985  128.198 3.680   1.00 15.37 ? 300 TYR B CZ  1 
ATOM   4947 O  OH  . TYR B 2 300 ? 21.672  129.071 2.866   1.00 15.91 ? 300 TYR B OH  1 
ATOM   4948 N  N   . SER B 2 301 ? 15.475  125.281 7.623   1.00 16.50 ? 301 SER B N   1 
ATOM   4949 C  CA  . SER B 2 301 ? 14.570  124.414 8.372   1.00 17.68 ? 301 SER B CA  1 
ATOM   4950 C  C   . SER B 2 301 ? 13.705  123.713 7.324   1.00 18.12 ? 301 SER B C   1 
ATOM   4951 O  O   . SER B 2 301 ? 13.195  122.613 7.553   1.00 18.17 ? 301 SER B O   1 
ATOM   4952 C  CB  . SER B 2 301 ? 13.673  125.229 9.308   1.00 16.57 ? 301 SER B CB  1 
ATOM   4953 O  OG  . SER B 2 301 ? 14.434  125.895 10.298  1.00 19.46 ? 301 SER B OG  1 
ATOM   4954 N  N   . PHE B 2 302 ? 13.529  124.361 6.173   1.00 17.16 ? 302 PHE B N   1 
ATOM   4955 C  CA  . PHE B 2 302 ? 12.753  123.750 5.098   1.00 17.62 ? 302 PHE B CA  1 
ATOM   4956 C  C   . PHE B 2 302 ? 13.631  123.152 4.001   1.00 16.91 ? 302 PHE B C   1 
ATOM   4957 O  O   . PHE B 2 302 ? 13.488  121.979 3.659   1.00 17.45 ? 302 PHE B O   1 
ATOM   4958 C  CB  . PHE B 2 302 ? 11.798  124.738 4.423   1.00 16.19 ? 302 PHE B CB  1 
ATOM   4959 C  CG  . PHE B 2 302 ? 11.073  124.130 3.248   1.00 17.23 ? 302 PHE B CG  1 
ATOM   4960 C  CD1 . PHE B 2 302 ? 10.024  123.234 3.452   1.00 18.13 ? 302 PHE B CD1 1 
ATOM   4961 C  CD2 . PHE B 2 302 ? 11.520  124.351 1.948   1.00 14.86 ? 302 PHE B CD2 1 
ATOM   4962 C  CE1 . PHE B 2 302 ? 9.434   122.559 2.375   1.00 18.62 ? 302 PHE B CE1 1 
ATOM   4963 C  CE2 . PHE B 2 302 ? 10.938  123.680 0.861   1.00 16.12 ? 302 PHE B CE2 1 
ATOM   4964 C  CZ  . PHE B 2 302 ? 9.896   122.784 1.077   1.00 15.99 ? 302 PHE B CZ  1 
ATOM   4965 N  N   . TRP B 2 303 ? 14.526  123.959 3.438   1.00 17.64 ? 303 TRP B N   1 
ATOM   4966 C  CA  . TRP B 2 303 ? 15.380  123.481 2.353   1.00 18.06 ? 303 TRP B CA  1 
ATOM   4967 C  C   . TRP B 2 303 ? 16.133  122.202 2.710   1.00 17.89 ? 303 TRP B C   1 
ATOM   4968 O  O   . TRP B 2 303 ? 16.233  121.295 1.885   1.00 16.53 ? 303 TRP B O   1 
ATOM   4969 C  CB  . TRP B 2 303 ? 16.380  124.565 1.932   1.00 17.48 ? 303 TRP B CB  1 
ATOM   4970 C  CG  . TRP B 2 303 ? 15.741  125.848 1.473   1.00 17.63 ? 303 TRP B CG  1 
ATOM   4971 C  CD1 . TRP B 2 303 ? 15.954  127.093 1.988   1.00 16.03 ? 303 TRP B CD1 1 
ATOM   4972 C  CD2 . TRP B 2 303 ? 14.794  126.010 0.408   1.00 16.91 ? 303 TRP B CD2 1 
ATOM   4973 N  NE1 . TRP B 2 303 ? 15.201  128.021 1.312   1.00 16.15 ? 303 TRP B NE1 1 
ATOM   4974 C  CE2 . TRP B 2 303 ? 14.479  127.385 0.338   1.00 16.14 ? 303 TRP B CE2 1 
ATOM   4975 C  CE3 . TRP B 2 303 ? 14.180  125.127 -0.494  1.00 18.54 ? 303 TRP B CE3 1 
ATOM   4976 C  CZ2 . TRP B 2 303 ? 13.574  127.903 -0.599  1.00 16.52 ? 303 TRP B CZ2 1 
ATOM   4977 C  CZ3 . TRP B 2 303 ? 13.275  125.644 -1.431  1.00 18.57 ? 303 TRP B CZ3 1 
ATOM   4978 C  CH2 . TRP B 2 303 ? 12.984  127.022 -1.471  1.00 19.12 ? 303 TRP B CH2 1 
ATOM   4979 N  N   . GLN B 2 304 ? 16.659  122.130 3.932   1.00 16.72 ? 304 GLN B N   1 
ATOM   4980 C  CA  . GLN B 2 304 ? 17.402  120.944 4.372   1.00 16.72 ? 304 GLN B CA  1 
ATOM   4981 C  C   . GLN B 2 304 ? 16.497  119.888 5.002   1.00 17.36 ? 304 GLN B C   1 
ATOM   4982 O  O   . GLN B 2 304 ? 16.430  118.758 4.518   1.00 15.75 ? 304 GLN B O   1 
ATOM   4983 C  CB  . GLN B 2 304 ? 18.499  121.333 5.378   1.00 16.96 ? 304 GLN B CB  1 
ATOM   4984 C  CG  . GLN B 2 304 ? 19.612  122.202 4.797   1.00 15.39 ? 304 GLN B CG  1 
ATOM   4985 C  CD  . GLN B 2 304 ? 20.609  121.416 3.957   1.00 18.20 ? 304 GLN B CD  1 
ATOM   4986 O  OE1 . GLN B 2 304 ? 20.249  120.450 3.284   1.00 16.17 ? 304 GLN B OE1 1 
ATOM   4987 N  NE2 . GLN B 2 304 ? 21.870  121.846 3.979   1.00 16.81 ? 304 GLN B NE2 1 
ATOM   4988 N  N   . ALA B 2 305 ? 15.799  120.252 6.077   1.00 16.10 ? 305 ALA B N   1 
ATOM   4989 C  CA  . ALA B 2 305 ? 14.930  119.296 6.760   1.00 17.84 ? 305 ALA B CA  1 
ATOM   4990 C  C   . ALA B 2 305 ? 13.866  118.717 5.835   1.00 17.05 ? 305 ALA B C   1 
ATOM   4991 O  O   . ALA B 2 305 ? 13.450  117.570 6.004   1.00 16.61 ? 305 ALA B O   1 
ATOM   4992 C  CB  . ALA B 2 305 ? 14.278  119.947 7.975   1.00 17.66 ? 305 ALA B CB  1 
ATOM   4993 N  N   . GLY B 2 306 ? 13.435  119.512 4.858   1.00 17.21 ? 306 GLY B N   1 
ATOM   4994 C  CA  . GLY B 2 306 ? 12.431  119.055 3.910   1.00 16.95 ? 306 GLY B CA  1 
ATOM   4995 C  C   . GLY B 2 306 ? 12.919  117.890 3.064   1.00 18.23 ? 306 GLY B C   1 
ATOM   4996 O  O   . GLY B 2 306 ? 12.122  117.188 2.435   1.00 18.04 ? 306 GLY B O   1 
ATOM   4997 N  N   . LEU B 2 307 ? 14.231  117.680 3.039   1.00 16.89 ? 307 LEU B N   1 
ATOM   4998 C  CA  . LEU B 2 307 ? 14.808  116.576 2.274   1.00 16.96 ? 307 LEU B CA  1 
ATOM   4999 C  C   . LEU B 2 307 ? 14.520  115.227 2.931   1.00 16.83 ? 307 LEU B C   1 
ATOM   5000 O  O   . LEU B 2 307 ? 14.470  114.198 2.253   1.00 17.16 ? 307 LEU B O   1 
ATOM   5001 C  CB  . LEU B 2 307 ? 16.328  116.763 2.126   1.00 16.30 ? 307 LEU B CB  1 
ATOM   5002 C  CG  . LEU B 2 307 ? 16.793  117.884 1.182   1.00 17.14 ? 307 LEU B CG  1 
ATOM   5003 C  CD1 . LEU B 2 307 ? 18.292  118.152 1.355   1.00 15.89 ? 307 LEU B CD1 1 
ATOM   5004 C  CD2 . LEU B 2 307 ? 16.482  117.483 -0.263  1.00 16.25 ? 307 LEU B CD2 1 
ATOM   5005 N  N   . LEU B 2 308 ? 14.328  115.218 4.249   1.00 15.88 ? 308 LEU B N   1 
ATOM   5006 C  CA  . LEU B 2 308 ? 14.065  113.954 4.928   1.00 16.46 ? 308 LEU B CA  1 
ATOM   5007 C  C   . LEU B 2 308 ? 12.735  113.315 4.529   1.00 16.35 ? 308 LEU B C   1 
ATOM   5008 O  O   . LEU B 2 308 ? 12.665  112.104 4.345   1.00 17.58 ? 308 LEU B O   1 
ATOM   5009 C  CB  . LEU B 2 308 ? 14.170  114.115 6.450   1.00 15.29 ? 308 LEU B CB  1 
ATOM   5010 C  CG  . LEU B 2 308 ? 15.615  114.136 6.990   1.00 16.53 ? 308 LEU B CG  1 
ATOM   5011 C  CD1 . LEU B 2 308 ? 16.410  112.972 6.377   1.00 17.05 ? 308 LEU B CD1 1 
ATOM   5012 C  CD2 . LEU B 2 308 ? 16.297  115.457 6.655   1.00 14.34 ? 308 LEU B CD2 1 
ATOM   5013 N  N   . PRO B 2 309 ? 11.655  114.108 4.408   1.00 16.72 ? 309 PRO B N   1 
ATOM   5014 C  CA  . PRO B 2 309 ? 10.405  113.452 4.007   1.00 17.95 ? 309 PRO B CA  1 
ATOM   5015 C  C   . PRO B 2 309 ? 10.537  112.903 2.584   1.00 17.67 ? 309 PRO B C   1 
ATOM   5016 O  O   . PRO B 2 309 ? 9.971   111.862 2.256   1.00 18.33 ? 309 PRO B O   1 
ATOM   5017 C  CB  . PRO B 2 309 ? 9.378   114.580 4.091   1.00 18.93 ? 309 PRO B CB  1 
ATOM   5018 C  CG  . PRO B 2 309 ? 9.903   115.421 5.205   1.00 19.63 ? 309 PRO B CG  1 
ATOM   5019 C  CD  . PRO B 2 309 ? 11.393  115.466 4.919   1.00 17.36 ? 309 PRO B CD  1 
ATOM   5020 N  N   . LEU B 2 310 ? 11.292  113.608 1.743   1.00 17.99 ? 310 LEU B N   1 
ATOM   5021 C  CA  . LEU B 2 310 ? 11.502  113.179 0.358   1.00 18.83 ? 310 LEU B CA  1 
ATOM   5022 C  C   . LEU B 2 310 ? 12.329  111.896 0.307   1.00 18.98 ? 310 LEU B C   1 
ATOM   5023 O  O   . LEU B 2 310 ? 12.028  110.984 -0.459  1.00 20.00 ? 310 LEU B O   1 
ATOM   5024 C  CB  . LEU B 2 310 ? 12.202  114.282 -0.447  1.00 17.25 ? 310 LEU B CB  1 
ATOM   5025 C  CG  . LEU B 2 310 ? 11.437  115.608 -0.582  1.00 17.97 ? 310 LEU B CG  1 
ATOM   5026 C  CD1 . LEU B 2 310 ? 12.246  116.590 -1.421  1.00 16.61 ? 310 LEU B CD1 1 
ATOM   5027 C  CD2 . LEU B 2 310 ? 10.078  115.362 -1.226  1.00 16.57 ? 310 LEU B CD2 1 
ATOM   5028 N  N   . LEU B 2 311 ? 13.374  111.832 1.122   1.00 18.73 ? 311 LEU B N   1 
ATOM   5029 C  CA  . LEU B 2 311 ? 14.220  110.646 1.175   1.00 19.48 ? 311 LEU B CA  1 
ATOM   5030 C  C   . LEU B 2 311 ? 13.429  109.462 1.735   1.00 20.04 ? 311 LEU B C   1 
ATOM   5031 O  O   . LEU B 2 311 ? 13.564  108.335 1.263   1.00 20.13 ? 311 LEU B O   1 
ATOM   5032 C  CB  . LEU B 2 311 ? 15.454  110.920 2.038   1.00 16.81 ? 311 LEU B CB  1 
ATOM   5033 C  CG  . LEU B 2 311 ? 16.499  111.826 1.372   1.00 17.73 ? 311 LEU B CG  1 
ATOM   5034 C  CD1 . LEU B 2 311 ? 17.582  112.211 2.366   1.00 13.80 ? 311 LEU B CD1 1 
ATOM   5035 C  CD2 . LEU B 2 311 ? 17.102  111.096 0.176   1.00 18.70 ? 311 LEU B CD2 1 
ATOM   5036 N  N   . HIS B 2 312 ? 12.599  109.729 2.737   1.00 20.56 ? 312 HIS B N   1 
ATOM   5037 C  CA  . HIS B 2 312 ? 11.778  108.690 3.355   1.00 23.10 ? 312 HIS B CA  1 
ATOM   5038 C  C   . HIS B 2 312 ? 10.888  108.032 2.296   1.00 24.08 ? 312 HIS B C   1 
ATOM   5039 O  O   . HIS B 2 312 ? 10.789  106.804 2.210   1.00 22.50 ? 312 HIS B O   1 
ATOM   5040 C  CB  . HIS B 2 312 ? 10.892  109.302 4.441   1.00 24.43 ? 312 HIS B CB  1 
ATOM   5041 C  CG  . HIS B 2 312 ? 10.166  108.288 5.266   1.00 27.81 ? 312 HIS B CG  1 
ATOM   5042 N  ND1 . HIS B 2 312 ? 10.716  107.712 6.391   1.00 27.62 ? 312 HIS B ND1 1 
ATOM   5043 C  CD2 . HIS B 2 312 ? 8.948   107.718 5.109   1.00 29.30 ? 312 HIS B CD2 1 
ATOM   5044 C  CE1 . HIS B 2 312 ? 9.868   106.832 6.892   1.00 28.91 ? 312 HIS B CE1 1 
ATOM   5045 N  NE2 . HIS B 2 312 ? 8.787   106.815 6.132   1.00 28.57 ? 312 HIS B NE2 1 
ATOM   5046 N  N   . ARG B 2 313 ? 10.236  108.869 1.499   1.00 24.17 ? 313 ARG B N   1 
ATOM   5047 C  CA  . ARG B 2 313 ? 9.356   108.412 0.435   1.00 27.26 ? 313 ARG B CA  1 
ATOM   5048 C  C   . ARG B 2 313 ? 10.156  107.664 -0.630  1.00 26.53 ? 313 ARG B C   1 
ATOM   5049 O  O   . ARG B 2 313 ? 9.721   106.629 -1.129  1.00 26.57 ? 313 ARG B O   1 
ATOM   5050 C  CB  . ARG B 2 313 ? 8.636   109.623 -0.168  1.00 32.46 ? 313 ARG B CB  1 
ATOM   5051 C  CG  . ARG B 2 313 ? 7.777   109.351 -1.388  1.00 40.35 ? 313 ARG B CG  1 
ATOM   5052 C  CD  . ARG B 2 313 ? 6.919   110.577 -1.678  1.00 46.61 ? 313 ARG B CD  1 
ATOM   5053 N  NE  . ARG B 2 313 ? 6.495   110.673 -3.074  1.00 52.25 ? 313 ARG B NE  1 
ATOM   5054 C  CZ  . ARG B 2 313 ? 5.744   111.660 -3.557  1.00 54.09 ? 313 ARG B CZ  1 
ATOM   5055 N  NH1 . ARG B 2 313 ? 5.329   112.635 -2.757  1.00 53.71 ? 313 ARG B NH1 1 
ATOM   5056 N  NH2 . ARG B 2 313 ? 5.420   111.682 -4.842  1.00 55.42 ? 313 ARG B NH2 1 
ATOM   5057 N  N   . ALA B 2 314 ? 11.334  108.181 -0.965  1.00 25.75 ? 314 ALA B N   1 
ATOM   5058 C  CA  . ALA B 2 314 ? 12.181  107.546 -1.966  1.00 25.94 ? 314 ALA B CA  1 
ATOM   5059 C  C   . ALA B 2 314 ? 12.611  106.153 -1.514  1.00 27.49 ? 314 ALA B C   1 
ATOM   5060 O  O   . ALA B 2 314 ? 12.485  105.178 -2.258  1.00 28.50 ? 314 ALA B O   1 
ATOM   5061 C  CB  . ALA B 2 314 ? 13.408  108.405 -2.234  1.00 25.79 ? 314 ALA B CB  1 
ATOM   5062 N  N   . LEU B 2 315 ? 13.123  106.064 -0.292  1.00 26.69 ? 315 LEU B N   1 
ATOM   5063 C  CA  . LEU B 2 315 ? 13.572  104.789 0.249   1.00 27.09 ? 315 LEU B CA  1 
ATOM   5064 C  C   . LEU B 2 315 ? 12.411  103.823 0.446   1.00 28.34 ? 315 LEU B C   1 
ATOM   5065 O  O   . LEU B 2 315 ? 12.547  102.624 0.204   1.00 28.03 ? 315 LEU B O   1 
ATOM   5066 C  CB  . LEU B 2 315 ? 14.304  105.012 1.575   1.00 23.74 ? 315 LEU B CB  1 
ATOM   5067 C  CG  . LEU B 2 315 ? 15.614  105.793 1.440   1.00 25.08 ? 315 LEU B CG  1 
ATOM   5068 C  CD1 . LEU B 2 315 ? 16.186  106.089 2.814   1.00 24.23 ? 315 LEU B CD1 1 
ATOM   5069 C  CD2 . LEU B 2 315 ? 16.608  104.988 0.595   1.00 23.19 ? 315 LEU B CD2 1 
ATOM   5070 N  N   . HIS B 2 316 ? 11.270  104.355 0.877   1.00 30.30 ? 316 HIS B N   1 
ATOM   5071 C  CA  . HIS B 2 316 ? 10.077  103.550 1.111   1.00 33.97 ? 316 HIS B CA  1 
ATOM   5072 C  C   . HIS B 2 316 ? 9.583   102.898 -0.179  1.00 36.47 ? 316 HIS B C   1 
ATOM   5073 O  O   . HIS B 2 316 ? 9.069   101.775 -0.163  1.00 36.45 ? 316 HIS B O   1 
ATOM   5074 C  CB  . HIS B 2 316 ? 8.967   104.419 1.700   1.00 35.06 ? 316 HIS B CB  1 
ATOM   5075 C  CG  . HIS B 2 316 ? 7.708   103.670 2.004   1.00 38.76 ? 316 HIS B CG  1 
ATOM   5076 N  ND1 . HIS B 2 316 ? 7.625   102.729 3.009   1.00 39.99 ? 316 HIS B ND1 1 
ATOM   5077 C  CD2 . HIS B 2 316 ? 6.478   103.727 1.440   1.00 39.29 ? 316 HIS B CD2 1 
ATOM   5078 C  CE1 . HIS B 2 316 ? 6.398   102.242 3.051   1.00 39.40 ? 316 HIS B CE1 1 
ATOM   5079 N  NE2 . HIS B 2 316 ? 5.682   102.831 2.110   1.00 39.60 ? 316 HIS B NE2 1 
ATOM   5080 N  N   . ALA B 2 317 ? 9.732   103.611 -1.292  1.00 36.89 ? 317 ALA B N   1 
ATOM   5081 C  CA  . ALA B 2 317 ? 9.309   103.097 -2.589  1.00 37.80 ? 317 ALA B CA  1 
ATOM   5082 C  C   . ALA B 2 317 ? 10.195  101.918 -2.978  1.00 38.14 ? 317 ALA B C   1 
ATOM   5083 O  O   . ALA B 2 317 ? 9.786   101.049 -3.744  1.00 39.50 ? 317 ALA B O   1 
ATOM   5084 C  CB  . ALA B 2 317 ? 9.401   104.193 -3.642  1.00 35.83 ? 317 ALA B CB  1 
ATOM   5085 N  N   . GLN B 2 318 ? 11.411  101.900 -2.441  1.00 39.21 ? 318 GLN B N   1 
ATOM   5086 C  CA  . GLN B 2 318 ? 12.371  100.833 -2.711  1.00 39.49 ? 318 GLN B CA  1 
ATOM   5087 C  C   . GLN B 2 318 ? 12.197  99.663  -1.745  1.00 39.04 ? 318 GLN B C   1 
ATOM   5088 O  O   . GLN B 2 318 ? 12.904  98.663  -1.841  1.00 40.02 ? 318 GLN B O   1 
ATOM   5089 C  CB  . GLN B 2 318 ? 13.796  101.370 -2.598  1.00 40.31 ? 318 GLN B CB  1 
ATOM   5090 C  CG  . GLN B 2 318 ? 14.224  102.244 -3.751  1.00 43.84 ? 318 GLN B CG  1 
ATOM   5091 C  CD  . GLN B 2 318 ? 15.482  103.027 -3.442  1.00 45.76 ? 318 GLN B CD  1 
ATOM   5092 O  OE1 . GLN B 2 318 ? 16.432  102.498 -2.865  1.00 48.03 ? 318 GLN B OE1 1 
ATOM   5093 N  NE2 . GLN B 2 318 ? 15.497  104.296 -3.833  1.00 47.62 ? 318 GLN B NE2 1 
ATOM   5094 N  N   . GLY B 2 319 ? 11.264  99.798  -0.809  1.00 38.61 ? 319 GLY B N   1 
ATOM   5095 C  CA  . GLY B 2 319 ? 11.019  98.736  0.150   1.00 37.86 ? 319 GLY B CA  1 
ATOM   5096 C  C   . GLY B 2 319 ? 12.017  98.634  1.295   1.00 37.65 ? 319 GLY B C   1 
ATOM   5097 O  O   . GLY B 2 319 ? 12.222  97.549  1.841   1.00 39.14 ? 319 GLY B O   1 
ATOM   5098 N  N   . ASP B 2 320 ? 12.637  99.752  1.663   1.00 34.59 ? 320 ASP B N   1 
ATOM   5099 C  CA  . ASP B 2 320 ? 13.603  99.768  2.757   1.00 31.60 ? 320 ASP B CA  1 
ATOM   5100 C  C   . ASP B 2 320 ? 12.907  99.310  4.043   1.00 30.57 ? 320 ASP B C   1 
ATOM   5101 O  O   . ASP B 2 320 ? 12.052  100.016 4.580   1.00 30.96 ? 320 ASP B O   1 
ATOM   5102 C  CB  . ASP B 2 320 ? 14.148  101.183 2.948   1.00 30.59 ? 320 ASP B CB  1 
ATOM   5103 C  CG  . ASP B 2 320 ? 15.350  101.226 3.867   1.00 29.79 ? 320 ASP B CG  1 
ATOM   5104 O  OD1 . ASP B 2 320 ? 15.352  100.505 4.888   1.00 28.29 ? 320 ASP B OD1 1 
ATOM   5105 O  OD2 . ASP B 2 320 ? 16.291  101.990 3.569   1.00 29.75 ? 320 ASP B OD2 1 
ATOM   5106 N  N   . PRO B 2 321 ? 13.273  98.126  4.560   1.00 28.89 ? 321 PRO B N   1 
ATOM   5107 C  CA  . PRO B 2 321 ? 12.664  97.592  5.782   1.00 27.86 ? 321 PRO B CA  1 
ATOM   5108 C  C   . PRO B 2 321 ? 13.131  98.228  7.094   1.00 26.48 ? 321 PRO B C   1 
ATOM   5109 O  O   . PRO B 2 321 ? 12.590  97.924  8.158   1.00 26.83 ? 321 PRO B O   1 
ATOM   5110 C  CB  . PRO B 2 321 ? 13.010  96.109  5.706   1.00 28.35 ? 321 PRO B CB  1 
ATOM   5111 C  CG  . PRO B 2 321 ? 14.376  96.136  5.109   1.00 29.09 ? 321 PRO B CG  1 
ATOM   5112 C  CD  . PRO B 2 321 ? 14.237  97.163  3.994   1.00 28.76 ? 321 PRO B CD  1 
ATOM   5113 N  N   . ALA B 2 322 ? 14.117  99.118  7.021   1.00 24.85 ? 322 ALA B N   1 
ATOM   5114 C  CA  . ALA B 2 322 ? 14.643  99.763  8.222   1.00 23.13 ? 322 ALA B CA  1 
ATOM   5115 C  C   . ALA B 2 322 ? 14.057  101.143 8.513   1.00 22.88 ? 322 ALA B C   1 
ATOM   5116 O  O   . ALA B 2 322 ? 14.324  101.719 9.570   1.00 22.74 ? 322 ALA B O   1 
ATOM   5117 C  CB  . ALA B 2 322 ? 16.163  99.863  8.129   1.00 21.18 ? 322 ALA B CB  1 
ATOM   5118 N  N   . LEU B 2 323 ? 13.265  101.674 7.587   1.00 22.53 ? 323 LEU B N   1 
ATOM   5119 C  CA  . LEU B 2 323 ? 12.669  102.998 7.768   1.00 21.70 ? 323 LEU B CA  1 
ATOM   5120 C  C   . LEU B 2 323 ? 11.779  103.115 8.998   1.00 21.42 ? 323 LEU B C   1 
ATOM   5121 O  O   . LEU B 2 323 ? 11.052  102.188 9.340   1.00 20.71 ? 323 LEU B O   1 
ATOM   5122 C  CB  . LEU B 2 323 ? 11.840  103.395 6.541   1.00 22.16 ? 323 LEU B CB  1 
ATOM   5123 C  CG  . LEU B 2 323 ? 12.560  103.924 5.302   1.00 22.41 ? 323 LEU B CG  1 
ATOM   5124 C  CD1 . LEU B 2 323 ? 11.513  104.306 4.249   1.00 23.05 ? 323 LEU B CD1 1 
ATOM   5125 C  CD2 . LEU B 2 323 ? 13.406  105.138 5.670   1.00 22.60 ? 323 LEU B CD2 1 
ATOM   5126 N  N   . SER B 2 324 ? 11.834  104.271 9.651   1.00 20.89 ? 324 SER B N   1 
ATOM   5127 C  CA  . SER B 2 324 ? 11.010  104.522 10.821  1.00 22.07 ? 324 SER B CA  1 
ATOM   5128 C  C   . SER B 2 324 ? 9.554   104.660 10.398  1.00 24.20 ? 324 SER B C   1 
ATOM   5129 O  O   . SER B 2 324 ? 9.260   105.053 9.267   1.00 22.29 ? 324 SER B O   1 
ATOM   5130 C  CB  . SER B 2 324 ? 11.443  105.813 11.513  1.00 21.96 ? 324 SER B CB  1 
ATOM   5131 O  OG  . SER B 2 324 ? 10.490  106.203 12.489  1.00 21.12 ? 324 SER B OG  1 
ATOM   5132 N  N   . MET B 2 325 ? 8.645   104.333 11.309  1.00 25.17 ? 325 MET B N   1 
ATOM   5133 C  CA  . MET B 2 325 ? 7.222   104.455 11.029  1.00 27.32 ? 325 MET B CA  1 
ATOM   5134 C  C   . MET B 2 325 ? 6.628   105.602 11.842  1.00 25.46 ? 325 MET B C   1 
ATOM   5135 O  O   . MET B 2 325 ? 5.412   105.769 11.877  1.00 24.73 ? 325 MET B O   1 
ATOM   5136 C  CB  . MET B 2 325 ? 6.486   103.159 11.384  1.00 32.59 ? 325 MET B CB  1 
ATOM   5137 C  CG  . MET B 2 325 ? 6.855   101.956 10.527  1.00 41.14 ? 325 MET B CG  1 
ATOM   5138 S  SD  . MET B 2 325 ? 5.873   100.497 10.974  1.00 51.56 ? 325 MET B SD  1 
ATOM   5139 C  CE  . MET B 2 325 ? 6.768   99.936  12.452  1.00 49.27 ? 325 MET B CE  1 
ATOM   5140 N  N   . SER B 2 326 ? 7.481   106.402 12.480  1.00 23.72 ? 326 SER B N   1 
ATOM   5141 C  CA  . SER B 2 326 ? 6.988   107.502 13.304  1.00 22.68 ? 326 SER B CA  1 
ATOM   5142 C  C   . SER B 2 326 ? 7.785   108.813 13.272  1.00 20.94 ? 326 SER B C   1 
ATOM   5143 O  O   . SER B 2 326 ? 7.267   109.855 13.687  1.00 20.91 ? 326 SER B O   1 
ATOM   5144 C  CB  . SER B 2 326 ? 6.874   107.028 14.756  1.00 23.48 ? 326 SER B CB  1 
ATOM   5145 O  OG  . SER B 2 326 ? 8.141   106.610 15.245  1.00 23.50 ? 326 SER B OG  1 
ATOM   5146 N  N   . HIS B 2 327 ? 9.032   108.773 12.804  1.00 19.77 ? 327 HIS B N   1 
ATOM   5147 C  CA  . HIS B 2 327 ? 9.855   109.985 12.761  1.00 19.83 ? 327 HIS B CA  1 
ATOM   5148 C  C   . HIS B 2 327 ? 10.660  110.162 11.478  1.00 18.35 ? 327 HIS B C   1 
ATOM   5149 O  O   . HIS B 2 327 ? 10.963  109.194 10.787  1.00 17.57 ? 327 HIS B O   1 
ATOM   5150 C  CB  . HIS B 2 327 ? 10.853  110.015 13.928  1.00 21.90 ? 327 HIS B CB  1 
ATOM   5151 C  CG  . HIS B 2 327 ? 10.218  110.043 15.282  1.00 26.53 ? 327 HIS B CG  1 
ATOM   5152 N  ND1 . HIS B 2 327 ? 9.796   108.902 15.931  1.00 30.15 ? 327 HIS B ND1 1 
ATOM   5153 C  CD2 . HIS B 2 327 ? 9.932   111.074 16.111  1.00 28.44 ? 327 HIS B CD2 1 
ATOM   5154 C  CE1 . HIS B 2 327 ? 9.277   109.230 17.101  1.00 29.30 ? 327 HIS B CE1 1 
ATOM   5155 N  NE2 . HIS B 2 327 ? 9.347   110.541 17.235  1.00 30.85 ? 327 HIS B NE2 1 
ATOM   5156 N  N   . TRP B 2 328 ? 10.997  111.416 11.175  1.00 18.14 ? 328 TRP B N   1 
ATOM   5157 C  CA  . TRP B 2 328 ? 11.824  111.736 10.018  1.00 18.06 ? 328 TRP B CA  1 
ATOM   5158 C  C   . TRP B 2 328 ? 13.233  111.487 10.546  1.00 19.00 ? 328 TRP B C   1 
ATOM   5159 O  O   . TRP B 2 328 ? 13.441  111.452 11.761  1.00 16.35 ? 328 TRP B O   1 
ATOM   5160 C  CB  . TRP B 2 328 ? 11.688  113.215 9.624   1.00 17.42 ? 328 TRP B CB  1 
ATOM   5161 C  CG  . TRP B 2 328 ? 10.304  113.640 9.206   1.00 15.86 ? 328 TRP B CG  1 
ATOM   5162 C  CD1 . TRP B 2 328 ? 9.589   114.697 9.700   1.00 17.49 ? 328 TRP B CD1 1 
ATOM   5163 C  CD2 . TRP B 2 328 ? 9.484   113.040 8.190   1.00 17.07 ? 328 TRP B CD2 1 
ATOM   5164 N  NE1 . TRP B 2 328 ? 8.374   114.794 9.055   1.00 16.58 ? 328 TRP B NE1 1 
ATOM   5165 C  CE2 . TRP B 2 328 ? 8.284   113.788 8.125   1.00 18.17 ? 328 TRP B CE2 1 
ATOM   5166 C  CE3 . TRP B 2 328 ? 9.645   111.941 7.330   1.00 17.66 ? 328 TRP B CE3 1 
ATOM   5167 C  CZ2 . TRP B 2 328 ? 7.248   113.472 7.234   1.00 16.93 ? 328 TRP B CZ2 1 
ATOM   5168 C  CZ3 . TRP B 2 328 ? 8.613   111.626 6.442   1.00 17.02 ? 328 TRP B CZ3 1 
ATOM   5169 C  CH2 . TRP B 2 328 ? 7.428   112.393 6.405   1.00 17.62 ? 328 TRP B CH2 1 
ATOM   5170 N  N   . MET B 2 329 ? 14.202  111.331 9.654   1.00 18.31 ? 329 MET B N   1 
ATOM   5171 C  CA  . MET B 2 329 ? 15.558  111.074 10.101  1.00 19.93 ? 329 MET B CA  1 
ATOM   5172 C  C   . MET B 2 329 ? 16.401  112.305 10.420  1.00 19.51 ? 329 MET B C   1 
ATOM   5173 O  O   . MET B 2 329 ? 17.500  112.481 9.893   1.00 19.21 ? 329 MET B O   1 
ATOM   5174 C  CB  . MET B 2 329 ? 16.283  110.167 9.099   1.00 20.01 ? 329 MET B CB  1 
ATOM   5175 C  CG  . MET B 2 329 ? 15.741  108.735 9.099   1.00 23.17 ? 329 MET B CG  1 
ATOM   5176 S  SD  . MET B 2 329 ? 16.602  107.590 7.981   1.00 24.72 ? 329 MET B SD  1 
ATOM   5177 C  CE  . MET B 2 329 ? 15.774  107.947 6.433   1.00 22.57 ? 329 MET B CE  1 
ATOM   5178 N  N   . PHE B 2 330 ? 15.858  113.167 11.273  1.00 18.03 ? 330 PHE B N   1 
ATOM   5179 C  CA  . PHE B 2 330 ? 16.571  114.345 11.760  1.00 17.78 ? 330 PHE B CA  1 
ATOM   5180 C  C   . PHE B 2 330 ? 15.963  114.613 13.132  1.00 17.66 ? 330 PHE B C   1 
ATOM   5181 O  O   . PHE B 2 330 ? 14.932  114.026 13.477  1.00 18.35 ? 330 PHE B O   1 
ATOM   5182 C  CB  . PHE B 2 330 ? 16.458  115.554 10.794  1.00 16.72 ? 330 PHE B CB  1 
ATOM   5183 C  CG  . PHE B 2 330 ? 15.110  116.231 10.768  1.00 17.80 ? 330 PHE B CG  1 
ATOM   5184 C  CD1 . PHE B 2 330 ? 14.812  117.262 11.659  1.00 16.89 ? 330 PHE B CD1 1 
ATOM   5185 C  CD2 . PHE B 2 330 ? 14.160  115.878 9.809   1.00 16.19 ? 330 PHE B CD2 1 
ATOM   5186 C  CE1 . PHE B 2 330 ? 13.589  117.939 11.593  1.00 17.39 ? 330 PHE B CE1 1 
ATOM   5187 C  CE2 . PHE B 2 330 ? 12.928  116.548 9.732   1.00 16.10 ? 330 PHE B CE2 1 
ATOM   5188 C  CZ  . PHE B 2 330 ? 12.643  117.580 10.624  1.00 17.13 ? 330 PHE B CZ  1 
ATOM   5189 N  N   . HIS B 2 331 ? 16.601  115.457 13.934  1.00 16.59 ? 331 HIS B N   1 
ATOM   5190 C  CA  . HIS B 2 331 ? 16.090  115.721 15.274  1.00 15.81 ? 331 HIS B CA  1 
ATOM   5191 C  C   . HIS B 2 331 ? 14.935  116.705 15.203  1.00 16.21 ? 331 HIS B C   1 
ATOM   5192 O  O   . HIS B 2 331 ? 15.135  117.921 15.203  1.00 15.06 ? 331 HIS B O   1 
ATOM   5193 C  CB  . HIS B 2 331 ? 17.209  116.267 16.167  1.00 16.33 ? 331 HIS B CB  1 
ATOM   5194 C  CG  . HIS B 2 331 ? 17.018  115.964 17.621  1.00 16.94 ? 331 HIS B CG  1 
ATOM   5195 N  ND1 . HIS B 2 331 ? 16.002  116.515 18.369  1.00 18.02 ? 331 HIS B ND1 1 
ATOM   5196 C  CD2 . HIS B 2 331 ? 17.708  115.156 18.461  1.00 19.06 ? 331 HIS B CD2 1 
ATOM   5197 C  CE1 . HIS B 2 331 ? 16.074  116.062 19.609  1.00 19.98 ? 331 HIS B CE1 1 
ATOM   5198 N  NE2 . HIS B 2 331 ? 17.101  115.235 19.691  1.00 19.01 ? 331 HIS B NE2 1 
ATOM   5199 N  N   . GLN B 2 332 ? 13.722  116.168 15.139  1.00 17.27 ? 332 GLN B N   1 
ATOM   5200 C  CA  . GLN B 2 332 ? 12.528  116.994 15.044  1.00 17.25 ? 332 GLN B CA  1 
ATOM   5201 C  C   . GLN B 2 332 ? 12.353  117.976 16.200  1.00 18.48 ? 332 GLN B C   1 
ATOM   5202 O  O   . GLN B 2 332 ? 11.992  119.134 15.982  1.00 17.64 ? 332 GLN B O   1 
ATOM   5203 C  CB  . GLN B 2 332 ? 11.293  116.095 14.905  1.00 16.70 ? 332 GLN B CB  1 
ATOM   5204 C  CG  . GLN B 2 332 ? 11.155  115.480 13.513  1.00 14.84 ? 332 GLN B CG  1 
ATOM   5205 C  CD  . GLN B 2 332 ? 10.147  114.347 13.468  1.00 17.72 ? 332 GLN B CD  1 
ATOM   5206 O  OE1 . GLN B 2 332 ? 10.517  113.176 13.384  1.00 16.98 ? 332 GLN B OE1 1 
ATOM   5207 N  NE2 . GLN B 2 332 ? 8.864   114.691 13.531  1.00 14.79 ? 332 GLN B NE2 1 
ATOM   5208 N  N   . GLN B 2 333 ? 12.623  117.530 17.425  1.00 17.89 ? 333 GLN B N   1 
ATOM   5209 C  CA  . GLN B 2 333 ? 12.473  118.406 18.584  1.00 19.44 ? 333 GLN B CA  1 
ATOM   5210 C  C   . GLN B 2 333 ? 13.494  119.541 18.563  1.00 18.42 ? 333 GLN B C   1 
ATOM   5211 O  O   . GLN B 2 333 ? 13.151  120.703 18.776  1.00 16.71 ? 333 GLN B O   1 
ATOM   5212 C  CB  . GLN B 2 333 ? 12.629  117.615 19.890  1.00 21.05 ? 333 GLN B CB  1 
ATOM   5213 C  CG  . GLN B 2 333 ? 12.044  118.335 21.100  1.00 28.14 ? 333 GLN B CG  1 
ATOM   5214 C  CD  . GLN B 2 333 ? 12.482  117.738 22.432  1.00 31.43 ? 333 GLN B CD  1 
ATOM   5215 O  OE1 . GLN B 2 333 ? 12.731  116.533 22.542  1.00 35.28 ? 333 GLN B OE1 1 
ATOM   5216 N  NE2 . GLN B 2 333 ? 12.566  118.581 23.455  1.00 27.09 ? 333 GLN B NE2 1 
ATOM   5217 N  N   . ALA B 2 334 ? 14.753  119.204 18.312  1.00 17.61 ? 334 ALA B N   1 
ATOM   5218 C  CA  . ALA B 2 334 ? 15.799  120.219 18.278  1.00 18.70 ? 334 ALA B CA  1 
ATOM   5219 C  C   . ALA B 2 334 ? 15.508  121.318 17.251  1.00 19.09 ? 334 ALA B C   1 
ATOM   5220 O  O   . ALA B 2 334 ? 15.748  122.502 17.522  1.00 18.44 ? 334 ALA B O   1 
ATOM   5221 C  CB  . ALA B 2 334 ? 17.155  119.570 17.994  1.00 17.35 ? 334 ALA B CB  1 
ATOM   5222 N  N   . LEU B 2 335 ? 14.990  120.940 16.083  1.00 16.67 ? 335 LEU B N   1 
ATOM   5223 C  CA  . LEU B 2 335 ? 14.691  121.934 15.053  1.00 17.40 ? 335 LEU B CA  1 
ATOM   5224 C  C   . LEU B 2 335 ? 13.583  122.865 15.519  1.00 17.90 ? 335 LEU B C   1 
ATOM   5225 O  O   . LEU B 2 335 ? 13.647  124.073 15.301  1.00 17.51 ? 335 LEU B O   1 
ATOM   5226 C  CB  . LEU B 2 335 ? 14.276  121.264 13.734  1.00 17.57 ? 335 LEU B CB  1 
ATOM   5227 C  CG  . LEU B 2 335 ? 13.951  122.244 12.596  1.00 16.68 ? 335 LEU B CG  1 
ATOM   5228 C  CD1 . LEU B 2 335 ? 15.155  123.147 12.348  1.00 16.28 ? 335 LEU B CD1 1 
ATOM   5229 C  CD2 . LEU B 2 335 ? 13.590  121.483 11.318  1.00 15.44 ? 335 LEU B CD2 1 
ATOM   5230 N  N   . GLN B 2 336 ? 12.561  122.302 16.155  1.00 18.11 ? 336 GLN B N   1 
ATOM   5231 C  CA  . GLN B 2 336 ? 11.458  123.114 16.653  1.00 19.19 ? 336 GLN B CA  1 
ATOM   5232 C  C   . GLN B 2 336 ? 11.965  124.087 17.717  1.00 18.82 ? 336 GLN B C   1 
ATOM   5233 O  O   . GLN B 2 336 ? 11.529  125.238 17.785  1.00 19.12 ? 336 GLN B O   1 
ATOM   5234 C  CB  . GLN B 2 336 ? 10.354  122.213 17.216  1.00 18.85 ? 336 GLN B CB  1 
ATOM   5235 C  CG  . GLN B 2 336 ? 9.681   121.362 16.138  1.00 19.96 ? 336 GLN B CG  1 
ATOM   5236 C  CD  . GLN B 2 336 ? 8.498   120.568 16.657  1.00 18.94 ? 336 GLN B CD  1 
ATOM   5237 O  OE1 . GLN B 2 336 ? 7.620   121.107 17.328  1.00 20.83 ? 336 GLN B OE1 1 
ATOM   5238 N  NE2 . GLN B 2 336 ? 8.462   119.283 16.333  1.00 20.98 ? 336 GLN B NE2 1 
ATOM   5239 N  N   . GLU B 2 337 ? 12.906  123.628 18.534  1.00 17.06 ? 337 GLU B N   1 
ATOM   5240 C  CA  . GLU B 2 337 ? 13.471  124.470 19.578  1.00 18.07 ? 337 GLU B CA  1 
ATOM   5241 C  C   . GLU B 2 337 ? 14.222  125.657 18.985  1.00 17.58 ? 337 GLU B C   1 
ATOM   5242 O  O   . GLU B 2 337 ? 14.079  126.784 19.459  1.00 17.53 ? 337 GLU B O   1 
ATOM   5243 C  CB  . GLU B 2 337 ? 14.385  123.634 20.480  1.00 15.79 ? 337 GLU B CB  1 
ATOM   5244 C  CG  . GLU B 2 337 ? 13.602  122.708 21.409  1.00 20.02 ? 337 GLU B CG  1 
ATOM   5245 C  CD  . GLU B 2 337 ? 14.487  121.787 22.231  1.00 22.77 ? 337 GLU B CD  1 
ATOM   5246 O  OE1 . GLU B 2 337 ? 15.684  122.105 22.411  1.00 22.45 ? 337 GLU B OE1 1 
ATOM   5247 O  OE2 . GLU B 2 337 ? 13.977  120.750 22.710  1.00 22.59 ? 337 GLU B OE2 1 
ATOM   5248 N  N   . TYR B 2 338 ? 15.010  125.410 17.941  1.00 17.81 ? 338 TYR B N   1 
ATOM   5249 C  CA  . TYR B 2 338 ? 15.758  126.486 17.300  1.00 17.69 ? 338 TYR B CA  1 
ATOM   5250 C  C   . TYR B 2 338 ? 14.811  127.525 16.700  1.00 18.91 ? 338 TYR B C   1 
ATOM   5251 O  O   . TYR B 2 338 ? 14.981  128.730 16.898  1.00 18.58 ? 338 TYR B O   1 
ATOM   5252 C  CB  . TYR B 2 338 ? 16.667  125.944 16.190  1.00 17.41 ? 338 TYR B CB  1 
ATOM   5253 C  CG  . TYR B 2 338 ? 17.391  127.055 15.457  1.00 15.92 ? 338 TYR B CG  1 
ATOM   5254 C  CD1 . TYR B 2 338 ? 18.349  127.831 16.110  1.00 16.89 ? 338 TYR B CD1 1 
ATOM   5255 C  CD2 . TYR B 2 338 ? 17.056  127.388 14.145  1.00 17.55 ? 338 TYR B CD2 1 
ATOM   5256 C  CE1 . TYR B 2 338 ? 18.953  128.918 15.482  1.00 16.60 ? 338 TYR B CE1 1 
ATOM   5257 C  CE2 . TYR B 2 338 ? 17.657  128.482 13.503  1.00 16.42 ? 338 TYR B CE2 1 
ATOM   5258 C  CZ  . TYR B 2 338 ? 18.599  129.241 14.182  1.00 16.97 ? 338 TYR B CZ  1 
ATOM   5259 O  OH  . TYR B 2 338 ? 19.167  130.345 13.577  1.00 18.28 ? 338 TYR B OH  1 
ATOM   5260 N  N   . ILE B 2 339 ? 13.811  127.058 15.963  1.00 18.26 ? 339 ILE B N   1 
ATOM   5261 C  CA  . ILE B 2 339 ? 12.854  127.960 15.332  1.00 17.54 ? 339 ILE B CA  1 
ATOM   5262 C  C   . ILE B 2 339 ? 12.057  128.780 16.353  1.00 18.15 ? 339 ILE B C   1 
ATOM   5263 O  O   . ILE B 2 339 ? 12.011  130.015 16.278  1.00 16.91 ? 339 ILE B O   1 
ATOM   5264 C  CB  . ILE B 2 339 ? 11.869  127.169 14.439  1.00 18.31 ? 339 ILE B CB  1 
ATOM   5265 C  CG1 . ILE B 2 339 ? 12.637  126.496 13.296  1.00 16.88 ? 339 ILE B CG1 1 
ATOM   5266 C  CG2 . ILE B 2 339 ? 10.781  128.097 13.904  1.00 16.17 ? 339 ILE B CG2 1 
ATOM   5267 C  CD1 . ILE B 2 339 ? 11.777  125.596 12.421  1.00 17.72 ? 339 ILE B CD1 1 
ATOM   5268 N  N   . LEU B 2 340 ? 11.442  128.098 17.312  1.00 16.91 ? 340 LEU B N   1 
ATOM   5269 C  CA  . LEU B 2 340 ? 10.630  128.777 18.318  1.00 18.30 ? 340 LEU B CA  1 
ATOM   5270 C  C   . LEU B 2 340 ? 11.394  129.723 19.247  1.00 18.51 ? 340 LEU B C   1 
ATOM   5271 O  O   . LEU B 2 340 ? 10.901  130.808 19.558  1.00 17.72 ? 340 LEU B O   1 
ATOM   5272 C  CB  . LEU B 2 340 ? 9.845   127.749 19.146  1.00 17.20 ? 340 LEU B CB  1 
ATOM   5273 C  CG  . LEU B 2 340 ? 8.796   126.950 18.359  1.00 18.38 ? 340 LEU B CG  1 
ATOM   5274 C  CD1 . LEU B 2 340 ? 8.168   125.870 19.244  1.00 18.41 ? 340 LEU B CD1 1 
ATOM   5275 C  CD2 . LEU B 2 340 ? 7.724   127.905 17.830  1.00 18.01 ? 340 LEU B CD2 1 
ATOM   5276 N  N   . MET B 2 341 ? 12.586  129.328 19.686  1.00 17.53 ? 341 MET B N   1 
ATOM   5277 C  CA  . MET B 2 341 ? 13.367  130.178 20.584  1.00 19.00 ? 341 MET B CA  1 
ATOM   5278 C  C   . MET B 2 341 ? 14.276  131.200 19.912  1.00 20.13 ? 341 MET B C   1 
ATOM   5279 O  O   . MET B 2 341 ? 14.496  132.277 20.457  1.00 20.53 ? 341 MET B O   1 
ATOM   5280 C  CB  . MET B 2 341 ? 14.233  129.333 21.523  1.00 17.51 ? 341 MET B CB  1 
ATOM   5281 C  CG  . MET B 2 341 ? 13.463  128.540 22.572  1.00 17.37 ? 341 MET B CG  1 
ATOM   5282 S  SD  . MET B 2 341 ? 14.579  127.753 23.762  1.00 21.08 ? 341 MET B SD  1 
ATOM   5283 C  CE  . MET B 2 341 ? 14.926  126.183 22.923  1.00 18.58 ? 341 MET B CE  1 
ATOM   5284 N  N   . CYS B 2 342 ? 14.796  130.880 18.733  1.00 18.55 ? 342 CYS B N   1 
ATOM   5285 C  CA  . CYS B 2 342 ? 15.737  131.783 18.076  1.00 19.57 ? 342 CYS B CA  1 
ATOM   5286 C  C   . CYS B 2 342 ? 15.298  132.499 16.809  1.00 19.39 ? 342 CYS B C   1 
ATOM   5287 O  O   . CYS B 2 342 ? 15.906  133.500 16.438  1.00 20.45 ? 342 CYS B O   1 
ATOM   5288 C  CB  . CYS B 2 342 ? 17.029  131.022 17.744  1.00 19.88 ? 342 CYS B CB  1 
ATOM   5289 S  SG  . CYS B 2 342 ? 17.748  130.090 19.117  1.00 21.88 ? 342 CYS B SG  1 
ATOM   5290 N  N   . CYS B 2 343 ? 14.254  132.011 16.145  1.00 18.28 ? 343 CYS B N   1 
ATOM   5291 C  CA  . CYS B 2 343 ? 13.854  132.613 14.878  1.00 19.38 ? 343 CYS B CA  1 
ATOM   5292 C  C   . CYS B 2 343 ? 12.586  133.457 14.841  1.00 19.90 ? 343 CYS B C   1 
ATOM   5293 O  O   . CYS B 2 343 ? 12.120  133.811 13.761  1.00 19.53 ? 343 CYS B O   1 
ATOM   5294 C  CB  . CYS B 2 343 ? 13.763  131.514 13.808  1.00 17.36 ? 343 CYS B CB  1 
ATOM   5295 S  SG  . CYS B 2 343 ? 15.308  130.579 13.592  1.00 19.28 ? 343 CYS B SG  1 
ATOM   5296 N  N   . GLN B 2 344 ? 12.025  133.787 15.997  1.00 19.04 ? 344 GLN B N   1 
ATOM   5297 C  CA  . GLN B 2 344 ? 10.821  134.604 16.009  1.00 20.37 ? 344 GLN B CA  1 
ATOM   5298 C  C   . GLN B 2 344 ? 11.125  136.058 16.340  1.00 21.25 ? 344 GLN B C   1 
ATOM   5299 O  O   . GLN B 2 344 ? 11.821  136.350 17.306  1.00 19.82 ? 344 GLN B O   1 
ATOM   5300 C  CB  . GLN B 2 344 ? 9.810   134.077 17.030  1.00 21.68 ? 344 GLN B CB  1 
ATOM   5301 C  CG  . GLN B 2 344 ? 9.185   132.731 16.685  1.00 21.04 ? 344 GLN B CG  1 
ATOM   5302 C  CD  . GLN B 2 344 ? 8.081   132.354 17.653  1.00 22.06 ? 344 GLN B CD  1 
ATOM   5303 O  OE1 . GLN B 2 344 ? 8.333   131.798 18.727  1.00 24.51 ? 344 GLN B OE1 1 
ATOM   5304 N  NE2 . GLN B 2 344 ? 6.847   132.672 17.287  1.00 19.81 ? 344 GLN B NE2 1 
ATOM   5305 N  N   . CYS B 2 345 ? 10.612  136.974 15.530  1.00 21.92 ? 345 CYS B N   1 
ATOM   5306 C  CA  . CYS B 2 345 ? 10.802  138.389 15.810  1.00 23.85 ? 345 CYS B CA  1 
ATOM   5307 C  C   . CYS B 2 345 ? 9.667   138.739 16.769  1.00 24.38 ? 345 CYS B C   1 
ATOM   5308 O  O   . CYS B 2 345 ? 8.505   138.446 16.493  1.00 23.61 ? 345 CYS B O   1 
ATOM   5309 C  CB  . CYS B 2 345 ? 10.684  139.218 14.530  1.00 23.05 ? 345 CYS B CB  1 
ATOM   5310 S  SG  . CYS B 2 345 ? 10.719  141.008 14.810  1.00 25.75 ? 345 CYS B SG  1 
ATOM   5311 N  N   . PRO B 2 346 ? 9.986   139.349 17.919  1.00 27.11 ? 346 PRO B N   1 
ATOM   5312 C  CA  . PRO B 2 346 ? 8.917   139.697 18.860  1.00 28.76 ? 346 PRO B CA  1 
ATOM   5313 C  C   . PRO B 2 346 ? 7.829   140.585 18.257  1.00 28.36 ? 346 PRO B C   1 
ATOM   5314 O  O   . PRO B 2 346 ? 6.694   140.579 18.724  1.00 30.88 ? 346 PRO B O   1 
ATOM   5315 C  CB  . PRO B 2 346 ? 9.669   140.368 20.015  1.00 29.62 ? 346 PRO B CB  1 
ATOM   5316 C  CG  . PRO B 2 346 ? 10.924  140.887 19.369  1.00 31.31 ? 346 PRO B CG  1 
ATOM   5317 C  CD  . PRO B 2 346 ? 11.302  139.770 18.430  1.00 29.12 ? 346 PRO B CD  1 
ATOM   5318 N  N   . ALA B 2 347 ? 8.172   141.333 17.212  1.00 27.90 ? 347 ALA B N   1 
ATOM   5319 C  CA  . ALA B 2 347 ? 7.213   142.218 16.555  1.00 27.46 ? 347 ALA B CA  1 
ATOM   5320 C  C   . ALA B 2 347 ? 6.415   141.508 15.460  1.00 26.75 ? 347 ALA B C   1 
ATOM   5321 O  O   . ALA B 2 347 ? 5.565   142.116 14.809  1.00 28.07 ? 347 ALA B O   1 
ATOM   5322 C  CB  . ALA B 2 347 ? 7.939   143.426 15.964  1.00 26.58 ? 347 ALA B CB  1 
ATOM   5323 N  N   . GLY B 2 348 ? 6.685   140.220 15.262  1.00 25.60 ? 348 GLY B N   1 
ATOM   5324 C  CA  . GLY B 2 348 ? 5.988   139.473 14.231  1.00 23.31 ? 348 GLY B CA  1 
ATOM   5325 C  C   . GLY B 2 348 ? 6.932   139.130 13.092  1.00 22.99 ? 348 GLY B C   1 
ATOM   5326 O  O   . GLY B 2 348 ? 7.803   139.928 12.742  1.00 23.05 ? 348 GLY B O   1 
ATOM   5327 N  N   . GLY B 2 349 ? 6.756   137.948 12.510  1.00 21.81 ? 349 GLY B N   1 
ATOM   5328 C  CA  . GLY B 2 349 ? 7.627   137.516 11.430  1.00 20.42 ? 349 GLY B CA  1 
ATOM   5329 C  C   . GLY B 2 349 ? 8.754   136.650 11.968  1.00 20.15 ? 349 GLY B C   1 
ATOM   5330 O  O   . GLY B 2 349 ? 9.028   136.656 13.170  1.00 18.82 ? 349 GLY B O   1 
ATOM   5331 N  N   . LEU B 2 350 ? 9.410   135.894 11.092  1.00 19.77 ? 350 LEU B N   1 
ATOM   5332 C  CA  . LEU B 2 350 ? 10.508  135.049 11.531  1.00 19.65 ? 350 LEU B CA  1 
ATOM   5333 C  C   . LEU B 2 350 ? 11.788  135.375 10.784  1.00 21.45 ? 350 LEU B C   1 
ATOM   5334 O  O   . LEU B 2 350 ? 11.785  136.169 9.839   1.00 22.13 ? 350 LEU B O   1 
ATOM   5335 C  CB  . LEU B 2 350 ? 10.147  133.569 11.392  1.00 19.75 ? 350 LEU B CB  1 
ATOM   5336 C  CG  . LEU B 2 350 ? 9.041   133.151 12.372  1.00 19.26 ? 350 LEU B CG  1 
ATOM   5337 C  CD1 . LEU B 2 350 ? 7.680   133.405 11.739  1.00 18.79 ? 350 LEU B CD1 1 
ATOM   5338 C  CD2 . LEU B 2 350 ? 9.184   131.688 12.735  1.00 20.38 ? 350 LEU B CD2 1 
ATOM   5339 N  N   . LEU B 2 351 ? 12.888  134.765 11.199  1.00 22.10 ? 351 LEU B N   1 
ATOM   5340 C  CA  . LEU B 2 351 ? 14.148  135.085 10.570  1.00 23.60 ? 351 LEU B CA  1 
ATOM   5341 C  C   . LEU B 2 351 ? 15.238  134.032 10.524  1.00 22.17 ? 351 LEU B C   1 
ATOM   5342 O  O   . LEU B 2 351 ? 15.069  132.898 10.966  1.00 18.96 ? 351 LEU B O   1 
ATOM   5343 C  CB  . LEU B 2 351 ? 14.687  136.362 11.209  1.00 28.46 ? 351 LEU B CB  1 
ATOM   5344 C  CG  . LEU B 2 351 ? 14.231  136.570 12.654  1.00 28.83 ? 351 LEU B CG  1 
ATOM   5345 C  CD1 . LEU B 2 351 ? 15.134  135.789 13.576  1.00 31.19 ? 351 LEU B CD1 1 
ATOM   5346 C  CD2 . LEU B 2 351 ? 14.258  138.045 13.000  1.00 29.73 ? 351 LEU B CD2 1 
ATOM   5347 N  N   . ASP B 2 352 ? 16.353  134.455 9.942   1.00 20.70 ? 352 ASP B N   1 
ATOM   5348 C  CA  . ASP B 2 352 ? 17.569  133.674 9.750   1.00 20.38 ? 352 ASP B CA  1 
ATOM   5349 C  C   . ASP B 2 352 ? 18.120  133.171 11.088  1.00 20.49 ? 352 ASP B C   1 
ATOM   5350 O  O   . ASP B 2 352 ? 18.194  131.966 11.342  1.00 18.25 ? 352 ASP B O   1 
ATOM   5351 C  CB  . ASP B 2 352 ? 18.581  134.592 9.047   1.00 20.75 ? 352 ASP B CB  1 
ATOM   5352 C  CG  . ASP B 2 352 ? 19.959  133.982 8.897   1.00 21.02 ? 352 ASP B CG  1 
ATOM   5353 O  OD1 . ASP B 2 352 ? 20.311  133.035 9.627   1.00 21.56 ? 352 ASP B OD1 1 
ATOM   5354 O  OD2 . ASP B 2 352 ? 20.709  134.487 8.040   1.00 24.03 ? 352 ASP B OD2 1 
ATOM   5355 N  N   . LYS B 2 353 ? 18.521  134.111 11.934  1.00 20.75 ? 353 LYS B N   1 
ATOM   5356 C  CA  . LYS B 2 353 ? 19.069  133.788 13.244  1.00 21.80 ? 353 LYS B CA  1 
ATOM   5357 C  C   . LYS B 2 353 ? 18.943  135.033 14.116  1.00 22.65 ? 353 LYS B C   1 
ATOM   5358 O  O   . LYS B 2 353 ? 18.639  136.120 13.617  1.00 22.51 ? 353 LYS B O   1 
ATOM   5359 C  CB  . LYS B 2 353 ? 20.545  133.369 13.121  1.00 21.42 ? 353 LYS B CB  1 
ATOM   5360 C  CG  . LYS B 2 353 ? 21.445  134.411 12.455  1.00 23.15 ? 353 LYS B CG  1 
ATOM   5361 C  CD  . LYS B 2 353 ? 22.931  134.050 12.565  1.00 24.70 ? 353 LYS B CD  1 
ATOM   5362 C  CE  . LYS B 2 353 ? 23.301  132.830 11.722  1.00 24.63 ? 353 LYS B CE  1 
ATOM   5363 N  NZ  . LYS B 2 353 ? 23.057  133.053 10.258  1.00 20.92 ? 353 LYS B NZ  1 
ATOM   5364 N  N   . PRO B 2 354 ? 19.160  134.891 15.432  1.00 23.17 ? 354 PRO B N   1 
ATOM   5365 C  CA  . PRO B 2 354 ? 19.061  136.039 16.341  1.00 25.02 ? 354 PRO B CA  1 
ATOM   5366 C  C   . PRO B 2 354 ? 19.961  137.187 15.891  1.00 25.34 ? 354 PRO B C   1 
ATOM   5367 O  O   . PRO B 2 354 ? 21.125  136.974 15.540  1.00 26.23 ? 354 PRO B O   1 
ATOM   5368 C  CB  . PRO B 2 354 ? 19.504  135.454 17.678  1.00 24.64 ? 354 PRO B CB  1 
ATOM   5369 C  CG  . PRO B 2 354 ? 19.036  134.022 17.582  1.00 23.53 ? 354 PRO B CG  1 
ATOM   5370 C  CD  . PRO B 2 354 ? 19.451  133.653 16.177  1.00 22.55 ? 354 PRO B CD  1 
ATOM   5371 N  N   . GLY B 2 355 ? 19.424  138.400 15.897  1.00 27.50 ? 355 GLY B N   1 
ATOM   5372 C  CA  . GLY B 2 355 ? 20.218  139.546 15.489  1.00 28.06 ? 355 GLY B CA  1 
ATOM   5373 C  C   . GLY B 2 355 ? 19.935  139.998 14.070  1.00 28.88 ? 355 GLY B C   1 
ATOM   5374 O  O   . GLY B 2 355 ? 20.298  141.111 13.685  1.00 28.28 ? 355 GLY B O   1 
ATOM   5375 N  N   . LYS B 2 356 ? 19.300  139.135 13.284  1.00 27.82 ? 356 LYS B N   1 
ATOM   5376 C  CA  . LYS B 2 356 ? 18.959  139.469 11.904  1.00 27.79 ? 356 LYS B CA  1 
ATOM   5377 C  C   . LYS B 2 356 ? 17.575  140.097 11.895  1.00 28.55 ? 356 LYS B C   1 
ATOM   5378 O  O   . LYS B 2 356 ? 16.807  139.937 12.841  1.00 27.63 ? 356 LYS B O   1 
ATOM   5379 C  CB  . LYS B 2 356 ? 18.933  138.208 11.035  1.00 29.97 ? 356 LYS B CB  1 
ATOM   5380 C  CG  . LYS B 2 356 ? 20.249  137.454 10.967  1.00 31.03 ? 356 LYS B CG  1 
ATOM   5381 C  CD  . LYS B 2 356 ? 21.322  138.284 10.288  1.00 33.81 ? 356 LYS B CD  1 
ATOM   5382 C  CE  . LYS B 2 356 ? 22.548  137.441 9.989   1.00 36.15 ? 356 LYS B CE  1 
ATOM   5383 N  NZ  . LYS B 2 356 ? 23.611  138.227 9.308   1.00 40.00 ? 356 LYS B NZ  1 
ATOM   5384 N  N   . SER B 2 357 ? 17.244  140.805 10.825  1.00 28.56 ? 357 SER B N   1 
ATOM   5385 C  CA  . SER B 2 357 ? 15.930  141.421 10.741  1.00 28.37 ? 357 SER B CA  1 
ATOM   5386 C  C   . SER B 2 357 ? 14.962  140.480 10.035  1.00 26.57 ? 357 SER B C   1 
ATOM   5387 O  O   . SER B 2 357 ? 15.363  139.647 9.223   1.00 25.81 ? 357 SER B O   1 
ATOM   5388 C  CB  . SER B 2 357 ? 16.014  142.751 9.992   1.00 30.99 ? 357 SER B CB  1 
ATOM   5389 O  OG  . SER B 2 357 ? 16.538  142.565 8.690   1.00 36.18 ? 357 SER B OG  1 
ATOM   5390 N  N   . ARG B 2 358 ? 13.684  140.615 10.356  1.00 23.88 ? 358 ARG B N   1 
ATOM   5391 C  CA  . ARG B 2 358 ? 12.655  139.781 9.755   1.00 23.25 ? 358 ARG B CA  1 
ATOM   5392 C  C   . ARG B 2 358 ? 12.474  140.097 8.268   1.00 21.65 ? 358 ARG B C   1 
ATOM   5393 O  O   . ARG B 2 358 ? 12.856  141.165 7.791   1.00 21.96 ? 358 ARG B O   1 
ATOM   5394 C  CB  . ARG B 2 358 ? 11.327  140.011 10.473  1.00 22.78 ? 358 ARG B CB  1 
ATOM   5395 C  CG  . ARG B 2 358 ? 10.785  141.428 10.281  1.00 23.08 ? 358 ARG B CG  1 
ATOM   5396 C  CD  . ARG B 2 358 ? 9.550   141.682 11.116  1.00 22.98 ? 358 ARG B CD  1 
ATOM   5397 N  NE  . ARG B 2 358 ? 8.986   143.006 10.853  1.00 25.12 ? 358 ARG B NE  1 
ATOM   5398 C  CZ  . ARG B 2 358 ? 7.908   143.494 11.459  1.00 24.98 ? 358 ARG B CZ  1 
ATOM   5399 N  NH1 . ARG B 2 358 ? 7.276   142.770 12.371  1.00 22.93 ? 358 ARG B NH1 1 
ATOM   5400 N  NH2 . ARG B 2 358 ? 7.449   144.698 11.137  1.00 24.38 ? 358 ARG B NH2 1 
ATOM   5401 N  N   . ASP B 2 359 ? 11.903  139.146 7.542   1.00 20.19 ? 359 ASP B N   1 
ATOM   5402 C  CA  . ASP B 2 359 ? 11.602  139.314 6.126   1.00 19.78 ? 359 ASP B CA  1 
ATOM   5403 C  C   . ASP B 2 359 ? 10.602  138.216 5.798   1.00 19.48 ? 359 ASP B C   1 
ATOM   5404 O  O   . ASP B 2 359 ? 10.529  137.209 6.510   1.00 19.25 ? 359 ASP B O   1 
ATOM   5405 C  CB  . ASP B 2 359 ? 12.869  139.224 5.258   1.00 20.22 ? 359 ASP B CB  1 
ATOM   5406 C  CG  . ASP B 2 359 ? 13.504  137.845 5.268   1.00 22.35 ? 359 ASP B CG  1 
ATOM   5407 O  OD1 . ASP B 2 359 ? 12.890  136.899 4.723   1.00 20.75 ? 359 ASP B OD1 1 
ATOM   5408 O  OD2 . ASP B 2 359 ? 14.621  137.715 5.815   1.00 20.92 ? 359 ASP B OD2 1 
ATOM   5409 N  N   . PHE B 2 360 ? 9.816   138.411 4.746   1.00 17.72 ? 360 PHE B N   1 
ATOM   5410 C  CA  . PHE B 2 360 ? 8.797   137.435 4.380   1.00 19.06 ? 360 PHE B CA  1 
ATOM   5411 C  C   . PHE B 2 360 ? 9.312   136.079 3.900   1.00 18.66 ? 360 PHE B C   1 
ATOM   5412 O  O   . PHE B 2 360 ? 8.617   135.070 4.024   1.00 19.80 ? 360 PHE B O   1 
ATOM   5413 C  CB  . PHE B 2 360 ? 7.852   138.050 3.347   1.00 19.00 ? 360 PHE B CB  1 
ATOM   5414 C  CG  . PHE B 2 360 ? 7.107   139.244 3.870   1.00 20.30 ? 360 PHE B CG  1 
ATOM   5415 C  CD1 . PHE B 2 360 ? 7.450   140.532 3.466   1.00 21.91 ? 360 PHE B CD1 1 
ATOM   5416 C  CD2 . PHE B 2 360 ? 6.088   139.084 4.810   1.00 20.56 ? 360 PHE B CD2 1 
ATOM   5417 C  CE1 . PHE B 2 360 ? 6.791   141.646 3.992   1.00 21.65 ? 360 PHE B CE1 1 
ATOM   5418 C  CE2 . PHE B 2 360 ? 5.424   140.191 5.342   1.00 20.74 ? 360 PHE B CE2 1 
ATOM   5419 C  CZ  . PHE B 2 360 ? 5.778   141.474 4.932   1.00 20.55 ? 360 PHE B CZ  1 
ATOM   5420 N  N   . TYR B 2 361 ? 10.521  136.060 3.352   1.00 17.72 ? 361 TYR B N   1 
ATOM   5421 C  CA  . TYR B 2 361 ? 11.133  134.827 2.870   1.00 17.49 ? 361 TYR B CA  1 
ATOM   5422 C  C   . TYR B 2 361 ? 11.402  133.910 4.067   1.00 18.16 ? 361 TYR B C   1 
ATOM   5423 O  O   . TYR B 2 361 ? 10.965  132.761 4.079   1.00 17.66 ? 361 TYR B O   1 
ATOM   5424 C  CB  . TYR B 2 361 ? 12.439  135.156 2.129   1.00 16.05 ? 361 TYR B CB  1 
ATOM   5425 C  CG  . TYR B 2 361 ? 13.398  133.998 1.951   1.00 17.44 ? 361 TYR B CG  1 
ATOM   5426 C  CD1 . TYR B 2 361 ? 13.292  133.130 0.860   1.00 18.50 ? 361 TYR B CD1 1 
ATOM   5427 C  CD2 . TYR B 2 361 ? 14.414  133.767 2.882   1.00 16.93 ? 361 TYR B CD2 1 
ATOM   5428 C  CE1 . TYR B 2 361 ? 14.180  132.058 0.702   1.00 18.75 ? 361 TYR B CE1 1 
ATOM   5429 C  CE2 . TYR B 2 361 ? 15.304  132.702 2.736   1.00 18.01 ? 361 TYR B CE2 1 
ATOM   5430 C  CZ  . TYR B 2 361 ? 15.182  131.853 1.646   1.00 19.23 ? 361 TYR B CZ  1 
ATOM   5431 O  OH  . TYR B 2 361 ? 16.065  130.807 1.503   1.00 19.42 ? 361 TYR B OH  1 
ATOM   5432 N  N   . HIS B 2 362 ? 12.111  134.420 5.077   1.00 17.35 ? 362 HIS B N   1 
ATOM   5433 C  CA  . HIS B 2 362 ? 12.409  133.613 6.255   1.00 16.93 ? 362 HIS B CA  1 
ATOM   5434 C  C   . HIS B 2 362 ? 11.150  133.295 7.049   1.00 17.10 ? 362 HIS B C   1 
ATOM   5435 O  O   . HIS B 2 362 ? 11.079  132.268 7.725   1.00 18.21 ? 362 HIS B O   1 
ATOM   5436 C  CB  . HIS B 2 362 ? 13.456  134.296 7.151   1.00 15.92 ? 362 HIS B CB  1 
ATOM   5437 C  CG  . HIS B 2 362 ? 14.855  134.187 6.624   1.00 16.49 ? 362 HIS B CG  1 
ATOM   5438 N  ND1 . HIS B 2 362 ? 15.496  135.227 5.985   1.00 15.43 ? 362 HIS B ND1 1 
ATOM   5439 C  CD2 . HIS B 2 362 ? 15.715  133.141 6.594   1.00 15.90 ? 362 HIS B CD2 1 
ATOM   5440 C  CE1 . HIS B 2 362 ? 16.689  134.827 5.582   1.00 16.47 ? 362 HIS B CE1 1 
ATOM   5441 N  NE2 . HIS B 2 362 ? 16.847  133.564 5.938   1.00 17.91 ? 362 HIS B NE2 1 
ATOM   5442 N  N   . THR B 2 363 ? 10.148  134.163 6.964   1.00 16.02 ? 363 THR B N   1 
ATOM   5443 C  CA  . THR B 2 363 ? 8.904   133.899 7.671   1.00 16.91 ? 363 THR B CA  1 
ATOM   5444 C  C   . THR B 2 363 ? 8.277   132.661 7.035   1.00 17.84 ? 363 THR B C   1 
ATOM   5445 O  O   . THR B 2 363 ? 7.826   131.759 7.731   1.00 18.05 ? 363 THR B O   1 
ATOM   5446 C  CB  . THR B 2 363 ? 7.937   135.098 7.574   1.00 17.44 ? 363 THR B CB  1 
ATOM   5447 O  OG1 . THR B 2 363 ? 8.468   136.188 8.340   1.00 17.56 ? 363 THR B OG1 1 
ATOM   5448 C  CG2 . THR B 2 363 ? 6.548   134.729 8.115   1.00 16.73 ? 363 THR B CG2 1 
ATOM   5449 N  N   . CYS B 2 364 ? 8.277   132.613 5.706   1.00 17.47 ? 364 CYS B N   1 
ATOM   5450 C  CA  . CYS B 2 364 ? 7.714   131.477 4.988   1.00 16.71 ? 364 CYS B CA  1 
ATOM   5451 C  C   . CYS B 2 364 ? 8.444   130.164 5.286   1.00 17.16 ? 364 CYS B C   1 
ATOM   5452 O  O   . CYS B 2 364 ? 7.826   129.176 5.695   1.00 17.36 ? 364 CYS B O   1 
ATOM   5453 C  CB  . CYS B 2 364 ? 7.747   131.739 3.476   1.00 18.23 ? 364 CYS B CB  1 
ATOM   5454 S  SG  . CYS B 2 364 ? 7.311   130.310 2.429   1.00 18.83 ? 364 CYS B SG  1 
ATOM   5455 N  N   . TYR B 2 365 ? 9.759   130.152 5.108   1.00 14.88 ? 365 TYR B N   1 
ATOM   5456 C  CA  . TYR B 2 365 ? 10.496  128.916 5.314   1.00 16.81 ? 365 TYR B CA  1 
ATOM   5457 C  C   . TYR B 2 365 ? 10.713  128.463 6.755   1.00 17.68 ? 365 TYR B C   1 
ATOM   5458 O  O   . TYR B 2 365 ? 10.864  127.264 7.002   1.00 17.50 ? 365 TYR B O   1 
ATOM   5459 C  CB  . TYR B 2 365 ? 11.800  128.956 4.506   1.00 14.74 ? 365 TYR B CB  1 
ATOM   5460 C  CG  . TYR B 2 365 ? 11.491  129.019 3.021   1.00 16.79 ? 365 TYR B CG  1 
ATOM   5461 C  CD1 . TYR B 2 365 ? 11.531  130.231 2.324   1.00 15.09 ? 365 TYR B CD1 1 
ATOM   5462 C  CD2 . TYR B 2 365 ? 11.039  127.886 2.339   1.00 14.81 ? 365 TYR B CD2 1 
ATOM   5463 C  CE1 . TYR B 2 365 ? 11.118  130.315 0.986   1.00 16.26 ? 365 TYR B CE1 1 
ATOM   5464 C  CE2 . TYR B 2 365 ? 10.625  127.959 1.004   1.00 16.51 ? 365 TYR B CE2 1 
ATOM   5465 C  CZ  . TYR B 2 365 ? 10.667  129.176 0.337   1.00 15.77 ? 365 TYR B CZ  1 
ATOM   5466 O  OH  . TYR B 2 365 ? 10.245  129.249 -0.970  1.00 15.52 ? 365 TYR B OH  1 
ATOM   5467 N  N   . CYS B 2 366 ? 10.716  129.390 7.711   1.00 17.19 ? 366 CYS B N   1 
ATOM   5468 C  CA  . CYS B 2 366 ? 10.854  128.974 9.104   1.00 17.02 ? 366 CYS B CA  1 
ATOM   5469 C  C   . CYS B 2 366 ? 9.574   128.240 9.494   1.00 17.35 ? 366 CYS B C   1 
ATOM   5470 O  O   . CYS B 2 366 ? 9.618   127.210 10.167  1.00 16.82 ? 366 CYS B O   1 
ATOM   5471 C  CB  . CYS B 2 366 ? 11.059  130.175 10.033  1.00 18.13 ? 366 CYS B CB  1 
ATOM   5472 S  SG  . CYS B 2 366 ? 12.768  130.746 10.150  1.00 19.47 ? 366 CYS B SG  1 
ATOM   5473 N  N   . LEU B 2 367 ? 8.430   128.767 9.062   1.00 17.52 ? 367 LEU B N   1 
ATOM   5474 C  CA  . LEU B 2 367 ? 7.146   128.135 9.375   1.00 17.24 ? 367 LEU B CA  1 
ATOM   5475 C  C   . LEU B 2 367 ? 6.985   126.819 8.615   1.00 16.78 ? 367 LEU B C   1 
ATOM   5476 O  O   . LEU B 2 367 ? 6.459   125.845 9.156   1.00 14.89 ? 367 LEU B O   1 
ATOM   5477 C  CB  . LEU B 2 367 ? 5.983   129.084 9.042   1.00 17.49 ? 367 LEU B CB  1 
ATOM   5478 C  CG  . LEU B 2 367 ? 5.876   130.356 9.901   1.00 16.58 ? 367 LEU B CG  1 
ATOM   5479 C  CD1 . LEU B 2 367 ? 4.830   131.296 9.316   1.00 18.43 ? 367 LEU B CD1 1 
ATOM   5480 C  CD2 . LEU B 2 367 ? 5.516   129.978 11.334  1.00 17.24 ? 367 LEU B CD2 1 
ATOM   5481 N  N   . SER B 2 368 ? 7.434   126.789 7.362   1.00 15.16 ? 368 SER B N   1 
ATOM   5482 C  CA  . SER B 2 368 ? 7.339   125.574 6.556   1.00 16.22 ? 368 SER B CA  1 
ATOM   5483 C  C   . SER B 2 368 ? 8.163   124.467 7.202   1.00 16.68 ? 368 SER B C   1 
ATOM   5484 O  O   . SER B 2 368 ? 7.738   123.311 7.247   1.00 17.93 ? 368 SER B O   1 
ATOM   5485 C  CB  . SER B 2 368 ? 7.847   125.823 5.131   1.00 15.84 ? 368 SER B CB  1 
ATOM   5486 O  OG  . SER B 2 368 ? 7.036   126.768 4.458   1.00 17.68 ? 368 SER B OG  1 
ATOM   5487 N  N   . GLY B 2 369 ? 9.344   124.826 7.699   1.00 16.91 ? 369 GLY B N   1 
ATOM   5488 C  CA  . GLY B 2 369 ? 10.203  123.847 8.344   1.00 15.73 ? 369 GLY B CA  1 
ATOM   5489 C  C   . GLY B 2 369 ? 9.617   123.381 9.664   1.00 15.70 ? 369 GLY B C   1 
ATOM   5490 O  O   . GLY B 2 369 ? 9.720   122.206 10.019  1.00 15.24 ? 369 GLY B O   1 
ATOM   5491 N  N   . LEU B 2 370 ? 9.002   124.305 10.401  1.00 16.05 ? 370 LEU B N   1 
ATOM   5492 C  CA  . LEU B 2 370 ? 8.384   123.966 11.679  1.00 15.68 ? 370 LEU B CA  1 
ATOM   5493 C  C   . LEU B 2 370 ? 7.277   122.929 11.446  1.00 16.90 ? 370 LEU B C   1 
ATOM   5494 O  O   . LEU B 2 370 ? 7.129   121.980 12.215  1.00 15.56 ? 370 LEU B O   1 
ATOM   5495 C  CB  . LEU B 2 370 ? 7.789   125.219 12.338  1.00 16.74 ? 370 LEU B CB  1 
ATOM   5496 C  CG  . LEU B 2 370 ? 7.134   125.022 13.714  1.00 19.06 ? 370 LEU B CG  1 
ATOM   5497 C  CD1 . LEU B 2 370 ? 8.165   124.494 14.699  1.00 21.26 ? 370 LEU B CD1 1 
ATOM   5498 C  CD2 . LEU B 2 370 ? 6.559   126.336 14.224  1.00 18.97 ? 370 LEU B CD2 1 
ATOM   5499 N  N   . SER B 2 371 ? 6.504   123.119 10.380  1.00 16.00 ? 371 SER B N   1 
ATOM   5500 C  CA  . SER B 2 371 ? 5.417   122.198 10.058  1.00 16.83 ? 371 SER B CA  1 
ATOM   5501 C  C   . SER B 2 371 ? 5.957   120.811 9.720   1.00 17.88 ? 371 SER B C   1 
ATOM   5502 O  O   . SER B 2 371 ? 5.403   119.801 10.143  1.00 15.99 ? 371 SER B O   1 
ATOM   5503 C  CB  . SER B 2 371 ? 4.600   122.733 8.883   1.00 17.64 ? 371 SER B CB  1 
ATOM   5504 O  OG  . SER B 2 371 ? 3.564   121.829 8.546   1.00 18.28 ? 371 SER B OG  1 
ATOM   5505 N  N   . ILE B 2 372 ? 7.033   120.758 8.944   1.00 17.86 ? 372 ILE B N   1 
ATOM   5506 C  CA  . ILE B 2 372 ? 7.614   119.474 8.592   1.00 19.02 ? 372 ILE B CA  1 
ATOM   5507 C  C   . ILE B 2 372 ? 8.121   118.781 9.856   1.00 18.76 ? 372 ILE B C   1 
ATOM   5508 O  O   . ILE B 2 372 ? 7.975   117.570 10.013  1.00 19.71 ? 372 ILE B O   1 
ATOM   5509 C  CB  . ILE B 2 372 ? 8.759   119.653 7.575   1.00 20.32 ? 372 ILE B CB  1 
ATOM   5510 C  CG1 . ILE B 2 372 ? 8.155   119.988 6.206   1.00 20.87 ? 372 ILE B CG1 1 
ATOM   5511 C  CG2 . ILE B 2 372 ? 9.627   118.392 7.517   1.00 18.78 ? 372 ILE B CG2 1 
ATOM   5512 C  CD1 . ILE B 2 372 ? 9.164   120.132 5.101   1.00 25.77 ? 372 ILE B CD1 1 
ATOM   5513 N  N   . ALA B 2 373 ? 8.693   119.560 10.767  1.00 18.01 ? 373 ALA B N   1 
ATOM   5514 C  CA  . ALA B 2 373 ? 9.224   119.019 12.014  1.00 18.20 ? 373 ALA B CA  1 
ATOM   5515 C  C   . ALA B 2 373 ? 8.127   118.490 12.936  1.00 18.83 ? 373 ALA B C   1 
ATOM   5516 O  O   . ALA B 2 373 ? 8.361   117.573 13.725  1.00 18.05 ? 373 ALA B O   1 
ATOM   5517 C  CB  . ALA B 2 373 ? 10.035  120.087 12.737  1.00 17.66 ? 373 ALA B CB  1 
ATOM   5518 N  N   . GLN B 2 374 ? 6.931   119.061 12.833  1.00 18.31 ? 374 GLN B N   1 
ATOM   5519 C  CA  . GLN B 2 374 ? 5.819   118.642 13.682  1.00 20.14 ? 374 GLN B CA  1 
ATOM   5520 C  C   . GLN B 2 374 ? 5.053   117.434 13.155  1.00 19.53 ? 374 GLN B C   1 
ATOM   5521 O  O   . GLN B 2 374 ? 4.476   116.682 13.936  1.00 20.08 ? 374 GLN B O   1 
ATOM   5522 C  CB  . GLN B 2 374 ? 4.801   119.780 13.855  1.00 20.66 ? 374 GLN B CB  1 
ATOM   5523 C  CG  . GLN B 2 374 ? 5.341   121.085 14.401  1.00 21.04 ? 374 GLN B CG  1 
ATOM   5524 C  CD  . GLN B 2 374 ? 4.282   122.181 14.395  1.00 23.55 ? 374 GLN B CD  1 
ATOM   5525 O  OE1 . GLN B 2 374 ? 3.434   122.231 13.500  1.00 21.24 ? 374 GLN B OE1 1 
ATOM   5526 N  NE2 . GLN B 2 374 ? 4.338   123.072 15.381  1.00 21.38 ? 374 GLN B NE2 1 
ATOM   5527 N  N   . HIS B 2 375 ? 5.050   117.244 11.839  1.00 19.56 ? 375 HIS B N   1 
ATOM   5528 C  CA  . HIS B 2 375 ? 4.264   116.165 11.254  1.00 20.64 ? 375 HIS B CA  1 
ATOM   5529 C  C   . HIS B 2 375 ? 4.960   115.087 10.443  1.00 20.98 ? 375 HIS B C   1 
ATOM   5530 O  O   . HIS B 2 375 ? 5.592   115.371 9.426   1.00 19.21 ? 375 HIS B O   1 
ATOM   5531 C  CB  . HIS B 2 375 ? 3.167   116.764 10.376  1.00 20.13 ? 375 HIS B CB  1 
ATOM   5532 C  CG  . HIS B 2 375 ? 2.342   117.806 11.061  1.00 23.23 ? 375 HIS B CG  1 
ATOM   5533 N  ND1 . HIS B 2 375 ? 2.391   119.139 10.713  1.00 24.72 ? 375 HIS B ND1 1 
ATOM   5534 C  CD2 . HIS B 2 375 ? 1.426   117.708 12.053  1.00 22.95 ? 375 HIS B CD2 1 
ATOM   5535 C  CE1 . HIS B 2 375 ? 1.536   119.818 11.458  1.00 23.07 ? 375 HIS B CE1 1 
ATOM   5536 N  NE2 . HIS B 2 375 ? 0.938   118.973 12.279  1.00 26.33 ? 375 HIS B NE2 1 
ATOM   5537 N  N   . PHE B 2 376 ? 4.809   113.846 10.889  1.00 21.92 ? 376 PHE B N   1 
ATOM   5538 C  CA  . PHE B 2 376 ? 5.361   112.705 10.180  1.00 23.13 ? 376 PHE B CA  1 
ATOM   5539 C  C   . PHE B 2 376 ? 4.176   111.993 9.555   1.00 26.13 ? 376 PHE B C   1 
ATOM   5540 O  O   . PHE B 2 376 ? 3.124   111.850 10.186  1.00 23.69 ? 376 PHE B O   1 
ATOM   5541 C  CB  . PHE B 2 376 ? 6.062   111.721 11.119  1.00 22.99 ? 376 PHE B CB  1 
ATOM   5542 C  CG  . PHE B 2 376 ? 6.446   110.424 10.448  1.00 23.45 ? 376 PHE B CG  1 
ATOM   5543 C  CD1 . PHE B 2 376 ? 7.647   110.311 9.751   1.00 23.21 ? 376 PHE B CD1 1 
ATOM   5544 C  CD2 . PHE B 2 376 ? 5.576   109.335 10.463  1.00 23.83 ? 376 PHE B CD2 1 
ATOM   5545 C  CE1 . PHE B 2 376 ? 7.976   109.133 9.075   1.00 23.01 ? 376 PHE B CE1 1 
ATOM   5546 C  CE2 . PHE B 2 376 ? 5.895   108.152 9.790   1.00 23.22 ? 376 PHE B CE2 1 
ATOM   5547 C  CZ  . PHE B 2 376 ? 7.097   108.051 9.094   1.00 21.90 ? 376 PHE B CZ  1 
ATOM   5548 N  N   . GLY B 2 377 ? 4.351   111.544 8.319   1.00 27.19 ? 377 GLY B N   1 
ATOM   5549 C  CA  . GLY B 2 377 ? 3.291   110.833 7.636   1.00 31.93 ? 377 GLY B CA  1 
ATOM   5550 C  C   . GLY B 2 377 ? 3.872   109.886 6.607   1.00 35.05 ? 377 GLY B C   1 
ATOM   5551 O  O   . GLY B 2 377 ? 4.681   110.291 5.773   1.00 37.15 ? 377 GLY B O   1 
ATOM   5552 N  N   . SER B 2 378 ? 3.474   108.622 6.673   1.00 37.02 ? 378 SER B N   1 
ATOM   5553 C  CA  . SER B 2 378 ? 3.947   107.610 5.735   1.00 40.05 ? 378 SER B CA  1 
ATOM   5554 C  C   . SER B 2 378 ? 2.890   106.514 5.642   1.00 41.70 ? 378 SER B C   1 
ATOM   5555 O  O   . SER B 2 378 ? 2.671   105.767 6.599   1.00 41.74 ? 378 SER B O   1 
ATOM   5556 C  CB  . SER B 2 378 ? 5.274   107.015 6.211   1.00 40.08 ? 378 SER B CB  1 
ATOM   5557 O  OG  . SER B 2 378 ? 5.795   106.106 5.256   1.00 41.01 ? 378 SER B OG  1 
ATOM   5558 N  N   . GLY B 2 379 ? 2.236   106.423 4.488   1.00 42.84 ? 379 GLY B N   1 
ATOM   5559 C  CA  . GLY B 2 379 ? 1.197   105.427 4.317   1.00 44.85 ? 379 GLY B CA  1 
ATOM   5560 C  C   . GLY B 2 379 ? 0.033   105.789 5.215   1.00 46.25 ? 379 GLY B C   1 
ATOM   5561 O  O   . GLY B 2 379 ? -0.493  106.899 5.136   1.00 47.48 ? 379 GLY B O   1 
ATOM   5562 N  N   . ALA B 2 380 ? -0.369  104.863 6.078   1.00 47.30 ? 380 ALA B N   1 
ATOM   5563 C  CA  . ALA B 2 380 ? -1.473  105.113 6.996   1.00 48.43 ? 380 ALA B CA  1 
ATOM   5564 C  C   . ALA B 2 380 ? -0.932  105.634 8.324   1.00 48.91 ? 380 ALA B C   1 
ATOM   5565 O  O   . ALA B 2 380 ? -1.690  106.097 9.178   1.00 49.12 ? 380 ALA B O   1 
ATOM   5566 C  CB  . ALA B 2 380 ? -2.268  103.829 7.221   1.00 49.12 ? 380 ALA B CB  1 
ATOM   5567 N  N   . MET B 2 381 ? 0.385   105.556 8.487   1.00 48.18 ? 381 MET B N   1 
ATOM   5568 C  CA  . MET B 2 381 ? 1.037   106.011 9.708   1.00 47.84 ? 381 MET B CA  1 
ATOM   5569 C  C   . MET B 2 381 ? 1.167   107.529 9.791   1.00 46.12 ? 381 MET B C   1 
ATOM   5570 O  O   . MET B 2 381 ? 1.684   108.174 8.877   1.00 46.55 ? 381 MET B O   1 
ATOM   5571 C  CB  . MET B 2 381 ? 2.430   105.385 9.824   1.00 50.98 ? 381 MET B CB  1 
ATOM   5572 C  CG  . MET B 2 381 ? 2.531   104.249 10.828  1.00 55.66 ? 381 MET B CG  1 
ATOM   5573 S  SD  . MET B 2 381 ? 1.377   102.908 10.508  1.00 59.94 ? 381 MET B SD  1 
ATOM   5574 C  CE  . MET B 2 381 ? 2.289   101.981 9.250   1.00 59.56 ? 381 MET B CE  1 
ATOM   5575 N  N   . LEU B 2 382 ? 0.689   108.089 10.897  1.00 42.46 ? 382 LEU B N   1 
ATOM   5576 C  CA  . LEU B 2 382 ? 0.767   109.522 11.144  1.00 39.15 ? 382 LEU B CA  1 
ATOM   5577 C  C   . LEU B 2 382 ? 1.202   109.722 12.591  1.00 37.00 ? 382 LEU B C   1 
ATOM   5578 O  O   . LEU B 2 382 ? 0.590   109.176 13.509  1.00 35.44 ? 382 LEU B O   1 
ATOM   5579 C  CB  . LEU B 2 382 ? -0.591  110.188 10.916  1.00 40.50 ? 382 LEU B CB  1 
ATOM   5580 C  CG  . LEU B 2 382 ? -1.085  110.327 9.473   1.00 42.18 ? 382 LEU B CG  1 
ATOM   5581 C  CD1 . LEU B 2 382 ? -2.483  110.920 9.480   1.00 42.13 ? 382 LEU B CD1 1 
ATOM   5582 C  CD2 . LEU B 2 382 ? -0.134  111.214 8.675   1.00 41.92 ? 382 LEU B CD2 1 
ATOM   5583 N  N   . HIS B 2 383 ? 2.267   110.490 12.794  1.00 32.83 ? 383 HIS B N   1 
ATOM   5584 C  CA  . HIS B 2 383 ? 2.763   110.741 14.140  1.00 29.59 ? 383 HIS B CA  1 
ATOM   5585 C  C   . HIS B 2 383 ? 3.191   112.198 14.300  1.00 28.54 ? 383 HIS B C   1 
ATOM   5586 O  O   . HIS B 2 383 ? 4.144   112.656 13.664  1.00 26.84 ? 383 HIS B O   1 
ATOM   5587 C  CB  . HIS B 2 383 ? 3.938   109.811 14.457  1.00 29.12 ? 383 HIS B CB  1 
ATOM   5588 C  CG  . HIS B 2 383 ? 4.432   109.926 15.866  1.00 32.92 ? 383 HIS B CG  1 
ATOM   5589 N  ND1 . HIS B 2 383 ? 3.671   109.554 16.954  1.00 32.44 ? 383 HIS B ND1 1 
ATOM   5590 C  CD2 . HIS B 2 383 ? 5.593   110.412 16.369  1.00 30.91 ? 383 HIS B CD2 1 
ATOM   5591 C  CE1 . HIS B 2 383 ? 4.341   109.807 18.065  1.00 33.02 ? 383 HIS B CE1 1 
ATOM   5592 N  NE2 . HIS B 2 383 ? 5.509   110.328 17.737  1.00 31.47 ? 383 HIS B NE2 1 
ATOM   5593 N  N   . ASP B 2 384 ? 2.478   112.923 15.156  1.00 26.09 ? 384 ASP B N   1 
ATOM   5594 C  CA  . ASP B 2 384 ? 2.776   114.326 15.395  1.00 26.61 ? 384 ASP B CA  1 
ATOM   5595 C  C   . ASP B 2 384 ? 3.601   114.572 16.649  1.00 27.14 ? 384 ASP B C   1 
ATOM   5596 O  O   . ASP B 2 384 ? 3.441   113.890 17.664  1.00 26.45 ? 384 ASP B O   1 
ATOM   5597 C  CB  . ASP B 2 384 ? 1.480   115.127 15.494  1.00 29.10 ? 384 ASP B CB  1 
ATOM   5598 C  CG  . ASP B 2 384 ? 0.813   115.334 14.149  1.00 32.55 ? 384 ASP B CG  1 
ATOM   5599 O  OD1 . ASP B 2 384 ? -0.299  115.900 14.131  1.00 37.21 ? 384 ASP B OD1 1 
ATOM   5600 O  OD2 . ASP B 2 384 ? 1.395   114.942 13.112  1.00 32.42 ? 384 ASP B OD2 1 
ATOM   5601 N  N   . VAL B 2 385 ? 4.484   115.561 16.562  1.00 26.28 ? 385 VAL B N   1 
ATOM   5602 C  CA  . VAL B 2 385 ? 5.337   115.961 17.674  1.00 26.75 ? 385 VAL B CA  1 
ATOM   5603 C  C   . VAL B 2 385 ? 5.280   117.482 17.724  1.00 25.83 ? 385 VAL B C   1 
ATOM   5604 O  O   . VAL B 2 385 ? 6.094   118.161 17.101  1.00 28.25 ? 385 VAL B O   1 
ATOM   5605 C  CB  . VAL B 2 385 ? 6.806   115.524 17.459  1.00 28.27 ? 385 VAL B CB  1 
ATOM   5606 C  CG1 . VAL B 2 385 ? 7.674   116.064 18.584  1.00 29.59 ? 385 VAL B CG1 1 
ATOM   5607 C  CG2 . VAL B 2 385 ? 6.901   114.002 17.409  1.00 30.01 ? 385 VAL B CG2 1 
ATOM   5608 N  N   . VAL B 2 386 ? 4.301   118.015 18.445  1.00 23.85 ? 386 VAL B N   1 
ATOM   5609 C  CA  . VAL B 2 386 ? 4.153   119.457 18.550  1.00 21.88 ? 386 VAL B CA  1 
ATOM   5610 C  C   . VAL B 2 386 ? 4.732   119.962 19.862  1.00 22.06 ? 386 VAL B C   1 
ATOM   5611 O  O   . VAL B 2 386 ? 4.145   119.793 20.933  1.00 21.54 ? 386 VAL B O   1 
ATOM   5612 C  CB  . VAL B 2 386 ? 2.670   119.879 18.445  1.00 21.63 ? 386 VAL B CB  1 
ATOM   5613 C  CG1 . VAL B 2 386 ? 2.553   121.399 18.510  1.00 20.55 ? 386 VAL B CG1 1 
ATOM   5614 C  CG2 . VAL B 2 386 ? 2.081   119.361 17.145  1.00 21.73 ? 386 VAL B CG2 1 
ATOM   5615 N  N   . LEU B 2 387 ? 5.901   120.578 19.766  1.00 21.17 ? 387 LEU B N   1 
ATOM   5616 C  CA  . LEU B 2 387 ? 6.577   121.116 20.933  1.00 21.93 ? 387 LEU B CA  1 
ATOM   5617 C  C   . LEU B 2 387 ? 5.869   122.384 21.406  1.00 20.42 ? 387 LEU B C   1 
ATOM   5618 O  O   . LEU B 2 387 ? 5.391   123.174 20.591  1.00 21.06 ? 387 LEU B O   1 
ATOM   5619 C  CB  . LEU B 2 387 ? 8.033   121.419 20.574  1.00 23.68 ? 387 LEU B CB  1 
ATOM   5620 C  CG  . LEU B 2 387 ? 8.965   121.869 21.695  1.00 26.86 ? 387 LEU B CG  1 
ATOM   5621 C  CD1 . LEU B 2 387 ? 9.010   120.811 22.793  1.00 24.95 ? 387 LEU B CD1 1 
ATOM   5622 C  CD2 . LEU B 2 387 ? 10.352  122.108 21.117  1.00 24.68 ? 387 LEU B CD2 1 
ATOM   5623 N  N   . GLY B 2 388 ? 5.791   122.563 22.723  1.00 20.52 ? 388 GLY B N   1 
ATOM   5624 C  CA  . GLY B 2 388 ? 5.159   123.746 23.290  1.00 19.16 ? 388 GLY B CA  1 
ATOM   5625 C  C   . GLY B 2 388 ? 3.656   123.639 23.469  1.00 19.23 ? 388 GLY B C   1 
ATOM   5626 O  O   . GLY B 2 388 ? 3.108   122.536 23.553  1.00 17.97 ? 388 GLY B O   1 
ATOM   5627 N  N   . VAL B 2 389 ? 2.982   124.784 23.541  1.00 19.15 ? 389 VAL B N   1 
ATOM   5628 C  CA  . VAL B 2 389 ? 1.533   124.789 23.700  1.00 19.59 ? 389 VAL B CA  1 
ATOM   5629 C  C   . VAL B 2 389 ? 0.911   124.160 22.454  1.00 20.88 ? 389 VAL B C   1 
ATOM   5630 O  O   . VAL B 2 389 ? 1.441   124.301 21.350  1.00 19.31 ? 389 VAL B O   1 
ATOM   5631 C  CB  . VAL B 2 389 ? 0.981   126.230 23.902  1.00 18.81 ? 389 VAL B CB  1 
ATOM   5632 C  CG1 . VAL B 2 389 ? 1.556   126.828 25.180  1.00 19.51 ? 389 VAL B CG1 1 
ATOM   5633 C  CG2 . VAL B 2 389 ? 1.330   127.113 22.710  1.00 17.29 ? 389 VAL B CG2 1 
ATOM   5634 N  N   . PRO B 2 390 ? -0.218  123.446 22.617  1.00 22.24 ? 390 PRO B N   1 
ATOM   5635 C  CA  . PRO B 2 390 ? -0.921  122.782 21.510  1.00 23.46 ? 390 PRO B CA  1 
ATOM   5636 C  C   . PRO B 2 390 ? -1.230  123.677 20.309  1.00 22.97 ? 390 PRO B C   1 
ATOM   5637 O  O   . PRO B 2 390 ? -1.229  123.212 19.167  1.00 22.86 ? 390 PRO B O   1 
ATOM   5638 C  CB  . PRO B 2 390 ? -2.194  122.254 22.176  1.00 22.74 ? 390 PRO B CB  1 
ATOM   5639 C  CG  . PRO B 2 390 ? -1.744  121.971 23.576  1.00 24.10 ? 390 PRO B CG  1 
ATOM   5640 C  CD  . PRO B 2 390 ? -0.903  123.190 23.898  1.00 22.95 ? 390 PRO B CD  1 
ATOM   5641 N  N   . GLU B 2 391 ? -1.494  124.954 20.566  1.00 23.47 ? 391 GLU B N   1 
ATOM   5642 C  CA  . GLU B 2 391 ? -1.811  125.892 19.493  1.00 24.36 ? 391 GLU B CA  1 
ATOM   5643 C  C   . GLU B 2 391 ? -0.658  126.090 18.515  1.00 23.37 ? 391 GLU B C   1 
ATOM   5644 O  O   . GLU B 2 391 ? -0.837  126.708 17.467  1.00 22.08 ? 391 GLU B O   1 
ATOM   5645 C  CB  . GLU B 2 391 ? -2.214  127.258 20.059  1.00 28.06 ? 391 GLU B CB  1 
ATOM   5646 C  CG  . GLU B 2 391 ? -3.434  127.239 20.968  1.00 33.88 ? 391 GLU B CG  1 
ATOM   5647 C  CD  . GLU B 2 391 ? -3.076  126.986 22.424  1.00 38.26 ? 391 GLU B CD  1 
ATOM   5648 O  OE1 . GLU B 2 391 ? -2.498  125.921 22.732  1.00 35.79 ? 391 GLU B OE1 1 
ATOM   5649 O  OE2 . GLU B 2 391 ? -3.373  127.863 23.264  1.00 43.67 ? 391 GLU B OE2 1 
ATOM   5650 N  N   . ASN B 2 392 ? 0.523   125.578 18.855  1.00 20.59 ? 392 ASN B N   1 
ATOM   5651 C  CA  . ASN B 2 392 ? 1.678   125.725 17.974  1.00 21.30 ? 392 ASN B CA  1 
ATOM   5652 C  C   . ASN B 2 392 ? 1.536   124.903 16.697  1.00 19.50 ? 392 ASN B C   1 
ATOM   5653 O  O   . ASN B 2 392 ? 2.189   125.190 15.696  1.00 19.42 ? 392 ASN B O   1 
ATOM   5654 C  CB  . ASN B 2 392 ? 2.969   125.308 18.690  1.00 18.15 ? 392 ASN B CB  1 
ATOM   5655 C  CG  . ASN B 2 392 ? 3.423   126.322 19.727  1.00 19.40 ? 392 ASN B CG  1 
ATOM   5656 O  OD1 . ASN B 2 392 ? 2.879   127.425 19.820  1.00 17.37 ? 392 ASN B OD1 1 
ATOM   5657 N  ND2 . ASN B 2 392 ? 4.439   125.956 20.506  1.00 18.88 ? 392 ASN B ND2 1 
ATOM   5658 N  N   . ALA B 2 393 ? 0.684   123.883 16.738  1.00 19.99 ? 393 ALA B N   1 
ATOM   5659 C  CA  . ALA B 2 393 ? 0.478   123.005 15.587  1.00 19.81 ? 393 ALA B CA  1 
ATOM   5660 C  C   . ALA B 2 393 ? 0.083   123.763 14.329  1.00 20.35 ? 393 ALA B C   1 
ATOM   5661 O  O   . ALA B 2 393 ? -0.924  124.472 14.301  1.00 20.34 ? 393 ALA B O   1 
ATOM   5662 C  CB  . ALA B 2 393 ? -0.578  121.944 15.913  1.00 18.54 ? 393 ALA B CB  1 
ATOM   5663 N  N   . LEU B 2 394 ? 0.888   123.606 13.284  1.00 18.94 ? 394 LEU B N   1 
ATOM   5664 C  CA  . LEU B 2 394 ? 0.624   124.265 12.014  1.00 18.26 ? 394 LEU B CA  1 
ATOM   5665 C  C   . LEU B 2 394 ? -0.045  123.292 11.055  1.00 19.65 ? 394 LEU B C   1 
ATOM   5666 O  O   . LEU B 2 394 ? -0.100  122.082 11.301  1.00 19.15 ? 394 LEU B O   1 
ATOM   5667 C  CB  . LEU B 2 394 ? 1.933   124.759 11.385  1.00 19.14 ? 394 LEU B CB  1 
ATOM   5668 C  CG  . LEU B 2 394 ? 2.746   125.833 12.118  1.00 20.94 ? 394 LEU B CG  1 
ATOM   5669 C  CD1 . LEU B 2 394 ? 4.100   126.005 11.436  1.00 19.23 ? 394 LEU B CD1 1 
ATOM   5670 C  CD2 . LEU B 2 394 ? 1.974   127.150 12.117  1.00 18.01 ? 394 LEU B CD2 1 
ATOM   5671 N  N   . GLN B 2 395 ? -0.562  123.830 9.961   1.00 18.66 ? 395 GLN B N   1 
ATOM   5672 C  CA  . GLN B 2 395 ? -1.181  123.001 8.947   1.00 20.52 ? 395 GLN B CA  1 
ATOM   5673 C  C   . GLN B 2 395 ? -0.029  122.299 8.239   1.00 19.39 ? 395 GLN B C   1 
ATOM   5674 O  O   . GLN B 2 395 ? 1.070   122.844 8.136   1.00 18.41 ? 395 GLN B O   1 
ATOM   5675 C  CB  . GLN B 2 395 ? -1.961  123.874 7.960   1.00 22.59 ? 395 GLN B CB  1 
ATOM   5676 C  CG  . GLN B 2 395 ? -3.225  124.463 8.554   1.00 26.98 ? 395 GLN B CG  1 
ATOM   5677 C  CD  . GLN B 2 395 ? -4.241  123.384 8.904   1.00 30.92 ? 395 GLN B CD  1 
ATOM   5678 O  OE1 . GLN B 2 395 ? -4.721  122.668 8.029   1.00 34.52 ? 395 GLN B OE1 1 
ATOM   5679 N  NE2 . GLN B 2 395 ? -4.563  123.260 10.185  1.00 32.47 ? 395 GLN B NE2 1 
ATOM   5680 N  N   . PRO B 2 396 ? -0.254  121.071 7.763   1.00 19.18 ? 396 PRO B N   1 
ATOM   5681 C  CA  . PRO B 2 396 ? 0.814   120.345 7.071   1.00 19.40 ? 396 PRO B CA  1 
ATOM   5682 C  C   . PRO B 2 396 ? 1.174   120.983 5.727   1.00 19.42 ? 396 PRO B C   1 
ATOM   5683 O  O   . PRO B 2 396 ? 0.390   121.742 5.152   1.00 16.72 ? 396 PRO B O   1 
ATOM   5684 C  CB  . PRO B 2 396 ? 0.226   118.944 6.909   1.00 19.25 ? 396 PRO B CB  1 
ATOM   5685 C  CG  . PRO B 2 396 ? -1.242  119.213 6.775   1.00 23.66 ? 396 PRO B CG  1 
ATOM   5686 C  CD  . PRO B 2 396 ? -1.485  120.263 7.841   1.00 20.57 ? 396 PRO B CD  1 
ATOM   5687 N  N   . THR B 2 397 ? 2.371   120.687 5.239   1.00 19.29 ? 397 THR B N   1 
ATOM   5688 C  CA  . THR B 2 397 ? 2.803   121.217 3.957   1.00 19.78 ? 397 THR B CA  1 
ATOM   5689 C  C   . THR B 2 397 ? 3.337   120.054 3.125   1.00 20.02 ? 397 THR B C   1 
ATOM   5690 O  O   . THR B 2 397 ? 3.883   119.091 3.672   1.00 19.83 ? 397 THR B O   1 
ATOM   5691 C  CB  . THR B 2 397 ? 3.897   122.308 4.134   1.00 19.16 ? 397 THR B CB  1 
ATOM   5692 O  OG1 . THR B 2 397 ? 4.080   123.004 2.895   1.00 21.44 ? 397 THR B OG1 1 
ATOM   5693 C  CG2 . THR B 2 397 ? 5.227   121.691 4.562   1.00 19.34 ? 397 THR B CG2 1 
ATOM   5694 N  N   . HIS B 2 398 ? 3.147   120.130 1.811   1.00 19.81 ? 398 HIS B N   1 
ATOM   5695 C  CA  . HIS B 2 398 ? 3.618   119.085 0.905   1.00 18.91 ? 398 HIS B CA  1 
ATOM   5696 C  C   . HIS B 2 398 ? 5.131   119.267 0.754   1.00 19.30 ? 398 HIS B C   1 
ATOM   5697 O  O   . HIS B 2 398 ? 5.600   120.351 0.414   1.00 17.90 ? 398 HIS B O   1 
ATOM   5698 C  CB  . HIS B 2 398 ? 2.918   119.212 -0.454  1.00 18.50 ? 398 HIS B CB  1 
ATOM   5699 C  CG  . HIS B 2 398 ? 3.059   117.998 -1.319  1.00 19.72 ? 398 HIS B CG  1 
ATOM   5700 N  ND1 . HIS B 2 398 ? 4.257   117.626 -1.892  1.00 18.85 ? 398 HIS B ND1 1 
ATOM   5701 C  CD2 . HIS B 2 398 ? 2.163   117.044 -1.667  1.00 18.47 ? 398 HIS B CD2 1 
ATOM   5702 C  CE1 . HIS B 2 398 ? 4.094   116.492 -2.552  1.00 19.26 ? 398 HIS B CE1 1 
ATOM   5703 N  NE2 . HIS B 2 398 ? 2.833   116.118 -2.431  1.00 20.14 ? 398 HIS B NE2 1 
ATOM   5704 N  N   . PRO B 2 399 ? 5.914   118.203 1.007   1.00 19.54 ? 399 PRO B N   1 
ATOM   5705 C  CA  . PRO B 2 399 ? 7.377   118.289 0.902   1.00 19.74 ? 399 PRO B CA  1 
ATOM   5706 C  C   . PRO B 2 399 ? 7.955   118.597 -0.483  1.00 20.33 ? 399 PRO B C   1 
ATOM   5707 O  O   . PRO B 2 399 ? 9.074   119.098 -0.592  1.00 20.21 ? 399 PRO B O   1 
ATOM   5708 C  CB  . PRO B 2 399 ? 7.841   116.942 1.464   1.00 19.92 ? 399 PRO B CB  1 
ATOM   5709 C  CG  . PRO B 2 399 ? 6.731   116.021 1.085   1.00 20.77 ? 399 PRO B CG  1 
ATOM   5710 C  CD  . PRO B 2 399 ? 5.492   116.843 1.387   1.00 19.98 ? 399 PRO B CD  1 
ATOM   5711 N  N   . VAL B 2 400 ? 7.198   118.310 -1.536  1.00 19.52 ? 400 VAL B N   1 
ATOM   5712 C  CA  . VAL B 2 400 ? 7.665   118.585 -2.890  1.00 17.94 ? 400 VAL B CA  1 
ATOM   5713 C  C   . VAL B 2 400 ? 7.391   120.029 -3.332  1.00 19.37 ? 400 VAL B C   1 
ATOM   5714 O  O   . VAL B 2 400 ? 8.311   120.745 -3.745  1.00 19.06 ? 400 VAL B O   1 
ATOM   5715 C  CB  . VAL B 2 400 ? 7.002   117.632 -3.925  1.00 17.43 ? 400 VAL B CB  1 
ATOM   5716 C  CG1 . VAL B 2 400 ? 7.308   118.106 -5.344  1.00 15.50 ? 400 VAL B CG1 1 
ATOM   5717 C  CG2 . VAL B 2 400 ? 7.514   116.206 -3.731  1.00 16.71 ? 400 VAL B CG2 1 
ATOM   5718 N  N   . TYR B 2 401 ? 6.132   120.452 -3.236  1.00 17.59 ? 401 TYR B N   1 
ATOM   5719 C  CA  . TYR B 2 401 ? 5.727   121.792 -3.673  1.00 17.72 ? 401 TYR B CA  1 
ATOM   5720 C  C   . TYR B 2 401 ? 5.732   122.887 -2.612  1.00 17.22 ? 401 TYR B C   1 
ATOM   5721 O  O   . TYR B 2 401 ? 5.770   124.076 -2.936  1.00 15.50 ? 401 TYR B O   1 
ATOM   5722 C  CB  . TYR B 2 401 ? 4.319   121.733 -4.286  1.00 17.54 ? 401 TYR B CB  1 
ATOM   5723 C  CG  . TYR B 2 401 ? 4.164   120.683 -5.358  1.00 18.80 ? 401 TYR B CG  1 
ATOM   5724 C  CD1 . TYR B 2 401 ? 3.705   119.402 -5.048  1.00 18.33 ? 401 TYR B CD1 1 
ATOM   5725 C  CD2 . TYR B 2 401 ? 4.529   120.953 -6.675  1.00 19.57 ? 401 TYR B CD2 1 
ATOM   5726 C  CE1 . TYR B 2 401 ? 3.619   118.414 -6.024  1.00 19.28 ? 401 TYR B CE1 1 
ATOM   5727 C  CE2 . TYR B 2 401 ? 4.449   119.973 -7.657  1.00 19.24 ? 401 TYR B CE2 1 
ATOM   5728 C  CZ  . TYR B 2 401 ? 3.996   118.707 -7.327  1.00 20.96 ? 401 TYR B CZ  1 
ATOM   5729 O  OH  . TYR B 2 401 ? 3.939   117.732 -8.297  1.00 20.34 ? 401 TYR B OH  1 
ATOM   5730 N  N   . ASN B 2 402 ? 5.696   122.482 -1.350  1.00 16.23 ? 402 ASN B N   1 
ATOM   5731 C  CA  . ASN B 2 402 ? 5.642   123.404 -0.223  1.00 16.70 ? 402 ASN B CA  1 
ATOM   5732 C  C   . ASN B 2 402 ? 4.408   124.308 -0.237  1.00 18.33 ? 402 ASN B C   1 
ATOM   5733 O  O   . ASN B 2 402 ? 4.501   125.537 -0.173  1.00 17.57 ? 402 ASN B O   1 
ATOM   5734 C  CB  . ASN B 2 402 ? 6.912   124.260 -0.099  1.00 15.63 ? 402 ASN B CB  1 
ATOM   5735 C  CG  . ASN B 2 402 ? 7.019   124.933 1.272   1.00 17.98 ? 402 ASN B CG  1 
ATOM   5736 O  OD1 . ASN B 2 402 ? 6.455   124.442 2.253   1.00 16.80 ? 402 ASN B OD1 1 
ATOM   5737 N  ND2 . ASN B 2 402 ? 7.749   126.045 1.349   1.00 16.27 ? 402 ASN B ND2 1 
ATOM   5738 N  N   . ILE B 2 403 ? 3.252   123.665 -0.367  1.00 19.39 ? 403 ILE B N   1 
ATOM   5739 C  CA  . ILE B 2 403 ? 1.947   124.308 -0.287  1.00 20.01 ? 403 ILE B CA  1 
ATOM   5740 C  C   . ILE B 2 403 ? 1.149   123.187 0.390   1.00 19.91 ? 403 ILE B C   1 
ATOM   5741 O  O   . ILE B 2 403 ? 1.601   122.041 0.404   1.00 19.68 ? 403 ILE B O   1 
ATOM   5742 C  CB  . ILE B 2 403 ? 1.320   124.669 -1.678  1.00 19.99 ? 403 ILE B CB  1 
ATOM   5743 C  CG1 . ILE B 2 403 ? 1.053   123.412 -2.498  1.00 20.13 ? 403 ILE B CG1 1 
ATOM   5744 C  CG2 . ILE B 2 403 ? 2.223   125.647 -2.428  1.00 20.84 ? 403 ILE B CG2 1 
ATOM   5745 C  CD1 . ILE B 2 403 ? 0.291   123.690 -3.792  1.00 22.37 ? 403 ILE B CD1 1 
ATOM   5746 N  N   . GLY B 2 404 ? -0.009  123.498 0.962   1.00 20.81 ? 404 GLY B N   1 
ATOM   5747 C  CA  . GLY B 2 404 ? -0.786  122.463 1.629   1.00 20.92 ? 404 GLY B CA  1 
ATOM   5748 C  C   . GLY B 2 404 ? -1.037  121.245 0.760   1.00 21.26 ? 404 GLY B C   1 
ATOM   5749 O  O   . GLY B 2 404 ? -1.308  121.394 -0.430  1.00 23.40 ? 404 GLY B O   1 
ATOM   5750 N  N   . PRO B 2 405 ? -0.941  120.022 1.311   1.00 21.07 ? 405 PRO B N   1 
ATOM   5751 C  CA  . PRO B 2 405 ? -1.183  118.828 0.495   1.00 21.05 ? 405 PRO B CA  1 
ATOM   5752 C  C   . PRO B 2 405 ? -2.597  118.808 -0.070  1.00 22.12 ? 405 PRO B C   1 
ATOM   5753 O  O   . PRO B 2 405 ? -2.848  118.213 -1.118  1.00 21.63 ? 405 PRO B O   1 
ATOM   5754 C  CB  . PRO B 2 405 ? -0.900  117.673 1.461   1.00 21.74 ? 405 PRO B CB  1 
ATOM   5755 C  CG  . PRO B 2 405 ? -1.126  118.281 2.819   1.00 24.14 ? 405 PRO B CG  1 
ATOM   5756 C  CD  . PRO B 2 405 ? -0.530  119.653 2.675   1.00 20.85 ? 405 PRO B CD  1 
ATOM   5757 N  N   . ASP B 2 406 ? -3.516  119.468 0.625   1.00 22.17 ? 406 ASP B N   1 
ATOM   5758 C  CA  . ASP B 2 406 ? -4.893  119.546 0.163   1.00 23.87 ? 406 ASP B CA  1 
ATOM   5759 C  C   . ASP B 2 406 ? -4.923  120.394 -1.108  1.00 23.30 ? 406 ASP B C   1 
ATOM   5760 O  O   . ASP B 2 406 ? -5.664  120.096 -2.048  1.00 20.47 ? 406 ASP B O   1 
ATOM   5761 C  CB  . ASP B 2 406 ? -5.788  120.168 1.248   1.00 26.97 ? 406 ASP B CB  1 
ATOM   5762 C  CG  . ASP B 2 406 ? -5.323  121.559 1.677   1.00 32.24 ? 406 ASP B CG  1 
ATOM   5763 O  OD1 . ASP B 2 406 ? -4.106  121.749 1.889   1.00 34.75 ? 406 ASP B OD1 1 
ATOM   5764 O  OD2 . ASP B 2 406 ? -6.179  122.462 1.820   1.00 33.74 ? 406 ASP B OD2 1 
ATOM   5765 N  N   . LYS B 2 407 ? -4.106  121.446 -1.135  1.00 22.12 ? 407 LYS B N   1 
ATOM   5766 C  CA  . LYS B 2 407 ? -4.037  122.331 -2.296  1.00 22.51 ? 407 LYS B CA  1 
ATOM   5767 C  C   . LYS B 2 407 ? -3.410  121.609 -3.491  1.00 21.17 ? 407 LYS B C   1 
ATOM   5768 O  O   . LYS B 2 407 ? -3.808  121.834 -4.633  1.00 21.66 ? 407 LYS B O   1 
ATOM   5769 C  CB  . LYS B 2 407 ? -3.220  123.586 -1.968  1.00 23.33 ? 407 LYS B CB  1 
ATOM   5770 C  CG  . LYS B 2 407 ? -3.748  124.395 -0.791  1.00 26.97 ? 407 LYS B CG  1 
ATOM   5771 C  CD  . LYS B 2 407 ? -5.147  124.923 -1.054  1.00 28.32 ? 407 LYS B CD  1 
ATOM   5772 C  CE  . LYS B 2 407 ? -5.654  125.747 0.121   1.00 30.76 ? 407 LYS B CE  1 
ATOM   5773 N  NZ  . LYS B 2 407 ? -7.010  126.303 -0.172  1.00 34.67 ? 407 LYS B NZ  1 
ATOM   5774 N  N   . VAL B 2 408 ? -2.426  120.750 -3.225  1.00 20.47 ? 408 VAL B N   1 
ATOM   5775 C  CA  . VAL B 2 408 ? -1.771  119.988 -4.290  1.00 21.31 ? 408 VAL B CA  1 
ATOM   5776 C  C   . VAL B 2 408 ? -2.773  119.041 -4.949  1.00 22.68 ? 408 VAL B C   1 
ATOM   5777 O  O   . VAL B 2 408 ? -2.871  118.976 -6.173  1.00 22.76 ? 408 VAL B O   1 
ATOM   5778 C  CB  . VAL B 2 408 ? -0.595  119.134 -3.751  1.00 19.50 ? 408 VAL B CB  1 
ATOM   5779 C  CG1 . VAL B 2 408 ? -0.057  118.231 -4.858  1.00 17.83 ? 408 VAL B CG1 1 
ATOM   5780 C  CG2 . VAL B 2 408 ? 0.513   120.034 -3.233  1.00 18.91 ? 408 VAL B CG2 1 
ATOM   5781 N  N   . ILE B 2 409 ? -3.517  118.308 -4.127  1.00 22.98 ? 409 ILE B N   1 
ATOM   5782 C  CA  . ILE B 2 409 ? -4.502  117.359 -4.631  1.00 25.55 ? 409 ILE B CA  1 
ATOM   5783 C  C   . ILE B 2 409 ? -5.588  118.046 -5.452  1.00 24.61 ? 409 ILE B C   1 
ATOM   5784 O  O   . ILE B 2 409 ? -5.939  117.590 -6.539  1.00 24.00 ? 409 ILE B O   1 
ATOM   5785 C  CB  . ILE B 2 409 ? -5.174  116.586 -3.472  1.00 27.09 ? 409 ILE B CB  1 
ATOM   5786 C  CG1 . ILE B 2 409 ? -4.127  115.743 -2.739  1.00 28.78 ? 409 ILE B CG1 1 
ATOM   5787 C  CG2 . ILE B 2 409 ? -6.290  115.690 -4.016  1.00 28.25 ? 409 ILE B CG2 1 
ATOM   5788 C  CD1 . ILE B 2 409 ? -4.678  114.961 -1.563  1.00 29.97 ? 409 ILE B CD1 1 
ATOM   5789 N  N   . GLN B 2 410 ? -6.115  119.143 -4.924  1.00 24.23 ? 410 GLN B N   1 
ATOM   5790 C  CA  . GLN B 2 410 ? -7.167  119.882 -5.602  1.00 25.34 ? 410 GLN B CA  1 
ATOM   5791 C  C   . GLN B 2 410 ? -6.691  120.469 -6.934  1.00 25.33 ? 410 GLN B C   1 
ATOM   5792 O  O   . GLN B 2 410 ? -7.419  120.442 -7.927  1.00 23.46 ? 410 GLN B O   1 
ATOM   5793 C  CB  . GLN B 2 410 ? -7.687  120.995 -4.689  1.00 27.36 ? 410 GLN B CB  1 
ATOM   5794 C  CG  . GLN B 2 410 ? -8.979  121.627 -5.166  1.00 34.31 ? 410 GLN B CG  1 
ATOM   5795 C  CD  . GLN B 2 410 ? -9.467  122.712 -4.232  1.00 39.24 ? 410 GLN B CD  1 
ATOM   5796 O  OE1 . GLN B 2 410 ? -9.607  122.491 -3.027  1.00 42.92 ? 410 GLN B OE1 1 
ATOM   5797 N  NE2 . GLN B 2 410 ? -9.732  123.893 -4.781  1.00 38.84 ? 410 GLN B NE2 1 
ATOM   5798 N  N   . ALA B 2 411 ? -5.471  120.995 -6.959  1.00 24.08 ? 411 ALA B N   1 
ATOM   5799 C  CA  . ALA B 2 411 ? -4.929  121.573 -8.186  1.00 24.24 ? 411 ALA B CA  1 
ATOM   5800 C  C   . ALA B 2 411 ? -4.662  120.502 -9.242  1.00 24.63 ? 411 ALA B C   1 
ATOM   5801 O  O   . ALA B 2 411 ? -5.121  120.613 -10.381 1.00 23.54 ? 411 ALA B O   1 
ATOM   5802 C  CB  . ALA B 2 411 ? -3.643  122.337 -7.885  1.00 21.99 ? 411 ALA B CB  1 
ATOM   5803 N  N   . THR B 2 412 ? -3.919  119.463 -8.872  1.00 25.28 ? 412 THR B N   1 
ATOM   5804 C  CA  . THR B 2 412 ? -3.606  118.404 -9.826  1.00 26.60 ? 412 THR B CA  1 
ATOM   5805 C  C   . THR B 2 412 ? -4.871  117.739 -10.356 1.00 27.21 ? 412 THR B C   1 
ATOM   5806 O  O   . THR B 2 412 ? -4.939  117.374 -11.528 1.00 27.57 ? 412 THR B O   1 
ATOM   5807 C  CB  . THR B 2 412 ? -2.696  117.327 -9.209  1.00 26.94 ? 412 THR B CB  1 
ATOM   5808 O  OG1 . THR B 2 412 ? -3.381  116.687 -8.128  1.00 32.89 ? 412 THR B OG1 1 
ATOM   5809 C  CG2 . THR B 2 412 ? -1.410  117.953 -8.691  1.00 26.41 ? 412 THR B CG2 1 
ATOM   5810 N  N   . THR B 2 413 ? -5.877  117.590 -9.500  1.00 26.19 ? 413 THR B N   1 
ATOM   5811 C  CA  . THR B 2 413 ? -7.133  116.976 -9.918  1.00 27.34 ? 413 THR B CA  1 
ATOM   5812 C  C   . THR B 2 413 ? -7.842  117.857 -10.944 1.00 26.61 ? 413 THR B C   1 
ATOM   5813 O  O   . THR B 2 413 ? -8.399  117.369 -11.929 1.00 26.73 ? 413 THR B O   1 
ATOM   5814 C  CB  . THR B 2 413 ? -8.073  116.751 -8.711  1.00 27.90 ? 413 THR B CB  1 
ATOM   5815 O  OG1 . THR B 2 413 ? -7.511  115.748 -7.854  1.00 29.98 ? 413 THR B OG1 1 
ATOM   5816 C  CG2 . THR B 2 413 ? -9.447  116.295 -9.176  1.00 29.98 ? 413 THR B CG2 1 
ATOM   5817 N  N   . TYR B 2 414 ? -7.811  119.161 -10.707 1.00 25.42 ? 414 TYR B N   1 
ATOM   5818 C  CA  . TYR B 2 414 ? -8.447  120.114 -11.601 1.00 25.10 ? 414 TYR B CA  1 
ATOM   5819 C  C   . TYR B 2 414 ? -7.776  120.135 -12.973 1.00 24.29 ? 414 TYR B C   1 
ATOM   5820 O  O   . TYR B 2 414 ? -8.436  120.016 -14.004 1.00 23.55 ? 414 TYR B O   1 
ATOM   5821 C  CB  . TYR B 2 414 ? -8.389  121.514 -10.991 1.00 26.12 ? 414 TYR B CB  1 
ATOM   5822 C  CG  . TYR B 2 414 ? -9.054  122.569 -11.837 1.00 28.20 ? 414 TYR B CG  1 
ATOM   5823 C  CD1 . TYR B 2 414 ? -10.442 122.709 -11.844 1.00 28.96 ? 414 TYR B CD1 1 
ATOM   5824 C  CD2 . TYR B 2 414 ? -8.297  123.423 -12.643 1.00 27.64 ? 414 TYR B CD2 1 
ATOM   5825 C  CE1 . TYR B 2 414 ? -11.063 123.677 -12.633 1.00 30.61 ? 414 TYR B CE1 1 
ATOM   5826 C  CE2 . TYR B 2 414 ? -8.906  124.392 -13.435 1.00 28.33 ? 414 TYR B CE2 1 
ATOM   5827 C  CZ  . TYR B 2 414 ? -10.289 124.514 -13.425 1.00 30.63 ? 414 TYR B CZ  1 
ATOM   5828 O  OH  . TYR B 2 414 ? -10.898 125.475 -14.196 1.00 30.70 ? 414 TYR B OH  1 
ATOM   5829 N  N   . PHE B 2 415 ? -6.457  120.287 -12.980 1.00 22.69 ? 415 PHE B N   1 
ATOM   5830 C  CA  . PHE B 2 415 ? -5.718  120.349 -14.230 1.00 22.53 ? 415 PHE B CA  1 
ATOM   5831 C  C   . PHE B 2 415 ? -5.634  119.030 -14.986 1.00 21.98 ? 415 PHE B C   1 
ATOM   5832 O  O   . PHE B 2 415 ? -5.494  119.030 -16.209 1.00 22.51 ? 415 PHE B O   1 
ATOM   5833 C  CB  . PHE B 2 415 ? -4.318  120.915 -13.981 1.00 19.10 ? 415 PHE B CB  1 
ATOM   5834 C  CG  . PHE B 2 415 ? -4.318  122.371 -13.619 1.00 19.34 ? 415 PHE B CG  1 
ATOM   5835 C  CD1 . PHE B 2 415 ? -3.908  122.791 -12.358 1.00 19.89 ? 415 PHE B CD1 1 
ATOM   5836 C  CD2 . PHE B 2 415 ? -4.751  123.328 -14.536 1.00 19.16 ? 415 PHE B CD2 1 
ATOM   5837 C  CE1 . PHE B 2 415 ? -3.930  124.150 -12.013 1.00 19.17 ? 415 PHE B CE1 1 
ATOM   5838 C  CE2 . PHE B 2 415 ? -4.777  124.681 -14.200 1.00 19.16 ? 415 PHE B CE2 1 
ATOM   5839 C  CZ  . PHE B 2 415 ? -4.366  125.092 -12.937 1.00 19.16 ? 415 PHE B CZ  1 
ATOM   5840 N  N   . LEU B 2 416 ? -5.714  117.910 -14.273 1.00 23.10 ? 416 LEU B N   1 
ATOM   5841 C  CA  . LEU B 2 416 ? -5.664  116.607 -14.925 1.00 26.18 ? 416 LEU B CA  1 
ATOM   5842 C  C   . LEU B 2 416 ? -6.878  116.414 -15.825 1.00 28.21 ? 416 LEU B C   1 
ATOM   5843 O  O   . LEU B 2 416 ? -6.878  115.551 -16.704 1.00 29.04 ? 416 LEU B O   1 
ATOM   5844 C  CB  . LEU B 2 416 ? -5.605  115.480 -13.893 1.00 27.91 ? 416 LEU B CB  1 
ATOM   5845 C  CG  . LEU B 2 416 ? -4.220  115.167 -13.320 1.00 30.81 ? 416 LEU B CG  1 
ATOM   5846 C  CD1 . LEU B 2 416 ? -4.352  114.159 -12.185 1.00 29.83 ? 416 LEU B CD1 1 
ATOM   5847 C  CD2 . LEU B 2 416 ? -3.317  114.625 -14.421 1.00 30.07 ? 416 LEU B CD2 1 
ATOM   5848 N  N   . GLN B 2 417 ? -7.912  117.219 -15.599 1.00 28.62 ? 417 GLN B N   1 
ATOM   5849 C  CA  . GLN B 2 417 ? -9.125  117.145 -16.403 1.00 32.04 ? 417 GLN B CA  1 
ATOM   5850 C  C   . GLN B 2 417 ? -8.966  117.939 -17.693 1.00 31.51 ? 417 GLN B C   1 
ATOM   5851 O  O   . GLN B 2 417 ? -9.873  117.985 -18.521 1.00 32.03 ? 417 GLN B O   1 
ATOM   5852 C  CB  . GLN B 2 417 ? -10.317 117.679 -15.611 1.00 33.97 ? 417 GLN B CB  1 
ATOM   5853 C  CG  . GLN B 2 417 ? -10.648 116.837 -14.398 1.00 40.47 ? 417 GLN B CG  1 
ATOM   5854 C  CD  . GLN B 2 417 ? -11.840 117.365 -13.640 1.00 45.94 ? 417 GLN B CD  1 
ATOM   5855 O  OE1 . GLN B 2 417 ? -11.826 118.495 -13.146 1.00 49.03 ? 417 GLN B OE1 1 
ATOM   5856 N  NE2 . GLN B 2 417 ? -12.886 116.549 -13.541 1.00 49.11 ? 417 GLN B NE2 1 
ATOM   5857 N  N   . LYS B 2 418 ? -7.813  118.578 -17.849 1.00 30.61 ? 418 LYS B N   1 
ATOM   5858 C  CA  . LYS B 2 418 ? -7.533  119.349 -19.049 1.00 30.30 ? 418 LYS B CA  1 
ATOM   5859 C  C   . LYS B 2 418 ? -6.472  118.590 -19.828 1.00 30.27 ? 418 LYS B C   1 
ATOM   5860 O  O   . LYS B 2 418 ? -5.690  117.835 -19.254 1.00 29.86 ? 418 LYS B O   1 
ATOM   5861 C  CB  . LYS B 2 418 ? -7.017  120.744 -18.693 1.00 31.00 ? 418 LYS B CB  1 
ATOM   5862 C  CG  . LYS B 2 418 ? -7.984  121.574 -17.868 1.00 32.37 ? 418 LYS B CG  1 
ATOM   5863 C  CD  . LYS B 2 418 ? -7.473  122.993 -17.713 1.00 35.68 ? 418 LYS B CD  1 
ATOM   5864 C  CE  . LYS B 2 418 ? -8.366  123.805 -16.793 1.00 38.31 ? 418 LYS B CE  1 
ATOM   5865 N  NZ  . LYS B 2 418 ? -9.782  123.794 -17.246 1.00 40.96 ? 418 LYS B NZ  1 
ATOM   5866 N  N   . PRO B 2 419 ? -6.439  118.763 -21.154 1.00 30.54 ? 419 PRO B N   1 
ATOM   5867 C  CA  . PRO B 2 419 ? -5.433  118.049 -21.939 1.00 28.61 ? 419 PRO B CA  1 
ATOM   5868 C  C   . PRO B 2 419 ? -4.086  118.757 -21.876 1.00 27.05 ? 419 PRO B C   1 
ATOM   5869 O  O   . PRO B 2 419 ? -4.013  119.938 -21.533 1.00 24.88 ? 419 PRO B O   1 
ATOM   5870 C  CB  . PRO B 2 419 ? -6.024  118.079 -23.341 1.00 30.23 ? 419 PRO B CB  1 
ATOM   5871 C  CG  . PRO B 2 419 ? -6.644  119.448 -23.382 1.00 31.20 ? 419 PRO B CG  1 
ATOM   5872 C  CD  . PRO B 2 419 ? -7.343  119.535 -22.029 1.00 30.76 ? 419 PRO B CD  1 
ATOM   5873 N  N   . VAL B 2 420 ? -3.021  118.021 -22.179 1.00 25.88 ? 420 VAL B N   1 
ATOM   5874 C  CA  . VAL B 2 420 ? -1.689  118.603 -22.211 1.00 25.83 ? 420 VAL B CA  1 
ATOM   5875 C  C   . VAL B 2 420 ? -1.729  119.432 -23.498 1.00 26.19 ? 420 VAL B C   1 
ATOM   5876 O  O   . VAL B 2 420 ? -2.031  118.905 -24.566 1.00 24.65 ? 420 VAL B O   1 
ATOM   5877 C  CB  . VAL B 2 420 ? -0.608  117.506 -22.310 1.00 25.30 ? 420 VAL B CB  1 
ATOM   5878 C  CG1 . VAL B 2 420 ? 0.781   118.135 -22.354 1.00 24.57 ? 420 VAL B CG1 1 
ATOM   5879 C  CG2 . VAL B 2 420 ? -0.721  116.563 -21.114 1.00 27.60 ? 420 VAL B CG2 1 
ATOM   5880 N  N   . PRO B 2 421 ? -1.437  120.740 -23.407 1.00 26.90 ? 421 PRO B N   1 
ATOM   5881 C  CA  . PRO B 2 421 ? -1.442  121.675 -24.539 1.00 26.93 ? 421 PRO B CA  1 
ATOM   5882 C  C   . PRO B 2 421 ? -0.893  121.172 -25.875 1.00 27.16 ? 421 PRO B C   1 
ATOM   5883 O  O   . PRO B 2 421 ? 0.320   121.048 -26.053 1.00 27.22 ? 421 PRO B O   1 
ATOM   5884 C  CB  . PRO B 2 421 ? -0.650  122.864 -24.001 1.00 28.57 ? 421 PRO B CB  1 
ATOM   5885 C  CG  . PRO B 2 421 ? -1.012  122.861 -22.551 1.00 26.04 ? 421 PRO B CG  1 
ATOM   5886 C  CD  . PRO B 2 421 ? -0.897  121.394 -22.201 1.00 26.27 ? 421 PRO B CD  1 
ATOM   5887 N  N   . GLY B 2 422 ? -1.802  120.892 -26.807 1.00 27.60 ? 422 GLY B N   1 
ATOM   5888 C  CA  . GLY B 2 422 ? -1.417  120.435 -28.133 1.00 29.32 ? 422 GLY B CA  1 
ATOM   5889 C  C   . GLY B 2 422 ? -0.722  119.089 -28.190 1.00 31.86 ? 422 GLY B C   1 
ATOM   5890 O  O   . GLY B 2 422 ? -0.018  118.789 -29.154 1.00 29.00 ? 422 GLY B O   1 
ATOM   5891 N  N   . PHE B 2 423 ? -0.926  118.268 -27.167 1.00 34.61 ? 423 PHE B N   1 
ATOM   5892 C  CA  . PHE B 2 423 ? -0.289  116.961 -27.124 1.00 40.12 ? 423 PHE B CA  1 
ATOM   5893 C  C   . PHE B 2 423 ? -1.252  115.862 -26.695 1.00 42.86 ? 423 PHE B C   1 
ATOM   5894 O  O   . PHE B 2 423 ? -2.070  116.057 -25.798 1.00 44.18 ? 423 PHE B O   1 
ATOM   5895 C  CB  . PHE B 2 423 ? 0.899   116.984 -26.160 1.00 39.61 ? 423 PHE B CB  1 
ATOM   5896 C  CG  . PHE B 2 423 ? 1.658   115.693 -26.116 1.00 41.89 ? 423 PHE B CG  1 
ATOM   5897 C  CD1 . PHE B 2 423 ? 2.427   115.289 -27.203 1.00 41.91 ? 423 PHE B CD1 1 
ATOM   5898 C  CD2 . PHE B 2 423 ? 1.573   114.859 -25.005 1.00 42.02 ? 423 PHE B CD2 1 
ATOM   5899 C  CE1 . PHE B 2 423 ? 3.101   114.069 -27.186 1.00 44.08 ? 423 PHE B CE1 1 
ATOM   5900 C  CE2 . PHE B 2 423 ? 2.243   113.636 -24.977 1.00 43.27 ? 423 PHE B CE2 1 
ATOM   5901 C  CZ  . PHE B 2 423 ? 3.007   113.240 -26.070 1.00 43.43 ? 423 PHE B CZ  1 
ATOM   5902 N  N   . GLU B 2 424 ? -1.140  114.704 -27.338 1.00 46.10 ? 424 GLU B N   1 
ATOM   5903 C  CA  . GLU B 2 424 ? -1.992  113.564 -27.019 1.00 49.16 ? 424 GLU B CA  1 
ATOM   5904 C  C   . GLU B 2 424 ? -1.188  112.267 -27.016 1.00 47.95 ? 424 GLU B C   1 
ATOM   5905 C  CB  . GLU B 2 424 ? -3.139  113.461 -28.030 1.00 52.36 ? 424 GLU B CB  1 
ATOM   5906 C  CG  . GLU B 2 424 ? -4.001  112.221 -27.849 1.00 56.37 ? 424 GLU B CG  1 
ATOM   5907 C  CD  . GLU B 2 424 ? -5.062  112.079 -28.921 1.00 58.03 ? 424 GLU B CD  1 
ATOM   5908 O  OE1 . GLU B 2 424 ? -5.653  110.985 -29.026 1.00 59.00 ? 424 GLU B OE1 1 
ATOM   5909 O  OE2 . GLU B 2 424 ? -5.308  113.061 -29.652 1.00 60.43 ? 424 GLU B OE2 1 
HETATM 5910 C  C1  . GLC C 3 .   ? 29.353  112.536 -7.672  1.00 32.24 ? 1   GLC C C1  1 
HETATM 5911 C  C2  . GLC C 3 .   ? 29.847  113.515 -8.773  1.00 33.43 ? 1   GLC C C2  1 
HETATM 5912 C  C3  . GLC C 3 .   ? 31.084  112.749 -9.560  1.00 33.78 ? 1   GLC C C3  1 
HETATM 5913 C  C4  . GLC C 3 .   ? 32.228  112.436 -8.539  1.00 34.34 ? 1   GLC C C4  1 
HETATM 5914 C  C5  . GLC C 3 .   ? 31.667  111.597 -7.322  1.00 34.06 ? 1   GLC C C5  1 
HETATM 5915 C  C6  . GLC C 3 .   ? 32.650  111.435 -6.154  1.00 34.71 ? 1   GLC C C6  1 
HETATM 5916 O  O2  . GLC C 3 .   ? 28.806  113.793 -9.715  1.00 32.67 ? 1   GLC C O2  1 
HETATM 5917 O  O3  . GLC C 3 .   ? 31.541  113.672 -10.547 1.00 32.45 ? 1   GLC C O3  1 
HETATM 5918 O  O4  . GLC C 3 .   ? 33.262  111.735 -9.248  1.00 35.65 ? 1   GLC C O4  1 
HETATM 5919 O  O5  . GLC C 3 .   ? 30.464  112.249 -6.756  1.00 32.99 ? 1   GLC C O5  1 
HETATM 5920 O  O6  . GLC C 3 .   ? 32.133  110.507 -5.198  1.00 36.08 ? 1   GLC C O6  1 
HETATM 5921 C  C1  . FRU C 3 .   ? 26.399  111.191 -8.586  1.00 28.87 ? 2   FRU C C1  1 
HETATM 5922 C  C2  . FRU C 3 .   ? 27.612  110.663 -7.753  1.00 29.62 ? 2   FRU C C2  1 
HETATM 5923 C  C3  . FRU C 3 .   ? 27.715  109.128 -7.613  1.00 30.28 ? 2   FRU C C3  1 
HETATM 5924 C  C4  . FRU C 3 .   ? 28.418  108.979 -6.260  1.00 29.92 ? 2   FRU C C4  1 
HETATM 5925 C  C5  . FRU C 3 .   ? 27.771  110.107 -5.424  1.00 28.41 ? 2   FRU C C5  1 
HETATM 5926 C  C6  . FRU C 3 .   ? 28.667  110.748 -4.341  1.00 27.32 ? 2   FRU C C6  1 
HETATM 5927 O  O1  . FRU C 3 .   ? 25.133  110.688 -8.154  1.00 27.72 ? 2   FRU C O1  1 
HETATM 5928 O  O2  . FRU C 3 .   ? 28.851  111.286 -8.239  1.00 31.37 ? 2   FRU C O2  1 
HETATM 5929 O  O3  . FRU C 3 .   ? 28.462  108.495 -8.656  1.00 32.53 ? 2   FRU C O3  1 
HETATM 5930 O  O4  . FRU C 3 .   ? 28.259  107.670 -5.723  1.00 30.19 ? 2   FRU C O4  1 
HETATM 5931 O  O5  . FRU C 3 .   ? 27.406  111.130 -6.390  1.00 27.51 ? 2   FRU C O5  1 
HETATM 5932 O  O6  . FRU C 3 .   ? 27.868  111.478 -3.425  1.00 25.47 ? 2   FRU C O6  1 
HETATM 5933 ZN ZN  . ZN  D 4 .   ? 18.095  132.036 5.233   1.00 18.73 ? 439 ZN  B ZN  1 
HETATM 5934 C  C1  . FPP E 5 .   ? 24.593  131.331 -1.044  1.00 25.19 ? 440 FPP B C1  1 
HETATM 5935 O  O1  . FPP E 5 .   ? 24.227  132.357 -0.132  1.00 24.46 ? 440 FPP B O1  1 
HETATM 5936 C  C2  . FPP E 5 .   ? 23.420  130.436 -1.405  1.00 25.14 ? 440 FPP B C2  1 
HETATM 5937 C  C3  . FPP E 5 .   ? 22.936  130.336 -2.676  1.00 25.93 ? 440 FPP B C3  1 
HETATM 5938 C  C4  . FPP E 5 .   ? 23.517  131.105 -3.844  1.00 29.01 ? 440 FPP B C4  1 
HETATM 5939 C  C5  . FPP E 5 .   ? 21.780  129.461 -3.073  1.00 26.24 ? 440 FPP B C5  1 
HETATM 5940 C  C6  . FPP E 5 .   ? 20.594  129.498 -2.124  1.00 25.45 ? 440 FPP B C6  1 
HETATM 5941 C  C7  . FPP E 5 .   ? 19.415  128.741 -2.657  1.00 23.11 ? 440 FPP B C7  1 
HETATM 5942 C  C8  . FPP E 5 .   ? 18.320  128.452 -1.918  1.00 24.68 ? 440 FPP B C8  1 
HETATM 5943 C  C10 . FPP E 5 .   ? 18.153  128.852 -0.468  1.00 21.52 ? 440 FPP B C10 1 
HETATM 5944 C  C9  . FPP E 5 .   ? 17.146  127.691 -2.464  1.00 25.22 ? 440 FPP B C9  1 
HETATM 5945 C  C11 . FPP E 5 .   ? 16.444  128.333 -3.640  1.00 25.97 ? 440 FPP B C11 1 
HETATM 5946 C  C12 . FPP E 5 .   ? 15.233  127.536 -4.041  1.00 24.98 ? 440 FPP B C12 1 
HETATM 5947 C  C13 . FPP E 5 .   ? 14.375  127.896 -5.015  1.00 24.35 ? 440 FPP B C13 1 
HETATM 5948 C  C14 . FPP E 5 .   ? 14.520  129.156 -5.831  1.00 23.42 ? 440 FPP B C14 1 
HETATM 5949 C  C15 . FPP E 5 .   ? 13.177  127.067 -5.377  1.00 23.31 ? 440 FPP B C15 1 
HETATM 5950 P  PA  . FPP E 5 .   ? 25.085  132.372 1.166   1.00 22.80 ? 440 FPP B PA  1 
HETATM 5951 O  O1A . FPP E 5 .   ? 26.572  132.394 0.943   1.00 23.78 ? 440 FPP B O1A 1 
HETATM 5952 O  O2A . FPP E 5 .   ? 24.572  133.661 1.860   1.00 24.15 ? 440 FPP B O2A 1 
HETATM 5953 O  O3A . FPP E 5 .   ? 24.579  131.084 1.942   1.00 22.49 ? 440 FPP B O3A 1 
HETATM 5954 P  PB  . FPP E 5 .   ? 25.047  130.250 3.193   1.00 19.03 ? 440 FPP B PB  1 
HETATM 5955 O  O1B . FPP E 5 .   ? 26.105  130.902 4.064   1.00 19.48 ? 440 FPP B O1B 1 
HETATM 5956 O  O2B . FPP E 5 .   ? 25.517  128.997 2.464   1.00 20.71 ? 440 FPP B O2B 1 
HETATM 5957 O  O3B . FPP E 5 .   ? 23.771  129.866 3.969   1.00 20.18 ? 440 FPP B O3B 1 
HETATM 5958 C  C1  . JAN F 6 .   ? 21.297  132.372 0.705   1.00 19.43 ? 441 JAN B C1  1 
HETATM 5959 N  N1  . JAN F 6 .   ? 20.244  132.726 1.692   1.00 19.33 ? 441 JAN B N1  1 
HETATM 5960 C  C2  . JAN F 6 .   ? 20.019  132.084 2.837   1.00 17.45 ? 441 JAN B C2  1 
HETATM 5961 N  N2  . JAN F 6 .   ? 18.969  132.698 3.444   1.00 18.66 ? 441 JAN B N2  1 
HETATM 5962 C  C3  . JAN F 6 .   ? 18.549  133.720 2.669   1.00 16.78 ? 441 JAN B C3  1 
HETATM 5963 C  C4  . JAN F 6 .   ? 19.355  133.698 1.615   1.00 19.37 ? 441 JAN B C4  1 
HETATM 5964 C  C5  . JAN F 6 .   ? 19.210  134.577 0.472   1.00 20.67 ? 441 JAN B C5  1 
HETATM 5965 C  C6  . JAN F 6 .   ? 18.920  133.862 -0.735  1.00 20.70 ? 441 JAN B C6  1 
HETATM 5966 C  C7  . JAN F 6 .   ? 17.922  132.855 -0.740  1.00 21.08 ? 441 JAN B C7  1 
HETATM 5967 C  C8  . JAN F 6 .   ? 17.586  132.186 -1.925  1.00 21.56 ? 441 JAN B C8  1 
HETATM 5968 C  C9  . JAN F 6 .   ? 18.236  132.507 -3.124  1.00 22.96 ? 441 JAN B C9  1 
HETATM 5969 CL CL1 . JAN F 6 .   ? 17.761  131.677 -4.625  1.00 26.89 ? 441 JAN B CL1 1 
HETATM 5970 C  C10 . JAN F 6 .   ? 19.236  133.502 -3.142  1.00 22.08 ? 441 JAN B C10 1 
HETATM 5971 C  C11 . JAN F 6 .   ? 19.579  134.179 -1.950  1.00 21.58 ? 441 JAN B C11 1 
HETATM 5972 N  N3  . JAN F 6 .   ? 20.548  135.175 0.286   1.00 22.80 ? 441 JAN B N3  1 
HETATM 5973 C  C12 . JAN F 6 .   ? 18.357  135.721 0.698   1.00 19.85 ? 441 JAN B C12 1 
HETATM 5974 C  C13 . JAN F 6 .   ? 17.179  135.935 -0.075  1.00 19.83 ? 441 JAN B C13 1 
HETATM 5975 C  C14 . JAN F 6 .   ? 16.235  136.936 0.285   1.00 20.16 ? 441 JAN B C14 1 
HETATM 5976 C  C15 . JAN F 6 .   ? 18.591  136.556 1.820   1.00 20.41 ? 441 JAN B C15 1 
HETATM 5977 C  C16 . JAN F 6 .   ? 17.664  137.545 2.184   1.00 20.73 ? 441 JAN B C16 1 
HETATM 5978 C  C17 . JAN F 6 .   ? 16.482  137.736 1.436   1.00 21.09 ? 441 JAN B C17 1 
HETATM 5979 N  N4  . JAN F 6 .   ? 15.500  138.687 1.862   1.00 20.91 ? 441 JAN B N4  1 
HETATM 5980 C  C18 . JAN F 6 .   ? 15.736  139.547 3.058   1.00 20.23 ? 441 JAN B C18 1 
HETATM 5981 C  C19 . JAN F 6 .   ? 14.291  138.827 1.145   1.00 22.47 ? 441 JAN B C19 1 
HETATM 5982 O  O1  . JAN F 6 .   ? 13.425  139.609 1.538   1.00 22.92 ? 441 JAN B O1  1 
HETATM 5983 C  C20 . JAN F 6 .   ? 14.060  138.051 0.005   1.00 22.04 ? 441 JAN B C20 1 
HETATM 5984 C  C21 . JAN F 6 .   ? 15.015  137.114 -0.447  1.00 20.64 ? 441 JAN B C21 1 
HETATM 5985 C  C22 . JAN F 6 .   ? 14.764  136.452 -1.677  1.00 21.65 ? 441 JAN B C22 1 
HETATM 5986 C  C23 . JAN F 6 .   ? 14.685  135.042 -1.755  1.00 20.99 ? 441 JAN B C23 1 
HETATM 5987 C  C24 . JAN F 6 .   ? 14.378  134.423 -2.987  1.00 22.35 ? 441 JAN B C24 1 
HETATM 5988 CL CL2 . JAN F 6 .   ? 14.252  132.661 -3.090  1.00 26.30 ? 441 JAN B CL2 1 
HETATM 5989 C  C25 . JAN F 6 .   ? 14.152  135.198 -4.140  1.00 21.98 ? 441 JAN B C25 1 
HETATM 5990 C  C26 . JAN F 6 .   ? 14.230  136.597 -4.068  1.00 20.12 ? 441 JAN B C26 1 
HETATM 5991 C  C27 . JAN F 6 .   ? 14.534  137.221 -2.845  1.00 21.15 ? 441 JAN B C27 1 
HETATM 5992 O  O   . HOH G 7 .   ? 34.329  125.194 -4.976  1.00 25.67 ? 383 HOH A O   1 
HETATM 5993 O  O   . HOH G 7 .   ? 38.652  138.339 -18.621 1.00 25.65 ? 384 HOH A O   1 
HETATM 5994 O  O   . HOH G 7 .   ? 15.044  159.242 -11.352 1.00 22.36 ? 385 HOH A O   1 
HETATM 5995 O  O   . HOH G 7 .   ? 44.612  129.163 -10.897 1.00 20.76 ? 386 HOH A O   1 
HETATM 5996 O  O   . HOH G 7 .   ? 30.773  149.907 -23.565 1.00 31.07 ? 387 HOH A O   1 
HETATM 5997 O  O   . HOH G 7 .   ? 31.667  151.954 -26.788 1.00 40.74 ? 388 HOH A O   1 
HETATM 5998 O  O   . HOH G 7 .   ? 46.535  115.954 -9.030  1.00 28.16 ? 389 HOH A O   1 
HETATM 5999 O  O   . HOH G 7 .   ? 21.857  159.539 -15.031 1.00 20.97 ? 390 HOH A O   1 
HETATM 6000 O  O   . HOH G 7 .   ? 22.183  138.943 -16.008 1.00 21.68 ? 391 HOH A O   1 
HETATM 6001 O  O   . HOH G 7 .   ? 31.181  123.927 -12.192 1.00 22.10 ? 392 HOH A O   1 
HETATM 6002 O  O   . HOH G 7 .   ? 31.772  130.421 7.643   1.00 23.00 ? 393 HOH A O   1 
HETATM 6003 O  O   . HOH G 7 .   ? 8.287   151.662 -10.530 1.00 28.02 ? 394 HOH A O   1 
HETATM 6004 O  O   . HOH G 7 .   ? 4.557   148.036 -6.474  1.00 31.70 ? 395 HOH A O   1 
HETATM 6005 O  O   . HOH G 7 .   ? -0.778  145.249 -7.325  1.00 36.74 ? 396 HOH A O   1 
HETATM 6006 O  O   . HOH G 7 .   ? 20.468  158.241 -27.828 1.00 31.71 ? 397 HOH A O   1 
HETATM 6007 O  O   . HOH G 7 .   ? 40.897  132.549 2.745   1.00 24.09 ? 398 HOH A O   1 
HETATM 6008 O  O   . HOH G 7 .   ? 46.808  122.967 -10.703 1.00 26.00 ? 399 HOH A O   1 
HETATM 6009 O  O   . HOH G 7 .   ? 18.225  112.537 14.727  1.00 39.34 ? 400 HOH A O   1 
HETATM 6010 O  O   . HOH G 7 .   ? 30.359  126.577 -13.218 1.00 21.00 ? 401 HOH A O   1 
HETATM 6011 O  O   . HOH G 7 .   ? 23.497  107.044 4.714   1.00 24.96 ? 402 HOH A O   1 
HETATM 6012 O  O   . HOH G 7 .   ? 19.848  161.575 -20.167 1.00 24.66 ? 403 HOH A O   1 
HETATM 6013 O  O   . HOH G 7 .   ? 8.376   159.196 -10.022 1.00 45.52 ? 404 HOH A O   1 
HETATM 6014 O  O   . HOH G 7 .   ? 32.749  98.890  18.166  1.00 39.96 ? 405 HOH A O   1 
HETATM 6015 O  O   . HOH G 7 .   ? 43.851  127.003 8.377   1.00 22.98 ? 406 HOH A O   1 
HETATM 6016 O  O   . HOH G 7 .   ? 45.150  128.061 -13.282 1.00 29.58 ? 407 HOH A O   1 
HETATM 6017 O  O   . HOH G 7 .   ? 21.306  158.622 -18.527 1.00 35.17 ? 408 HOH A O   1 
HETATM 6018 O  O   . HOH G 7 .   ? 44.139  133.245 -8.616  1.00 29.29 ? 409 HOH A O   1 
HETATM 6019 O  O   . HOH G 7 .   ? 42.055  135.271 -3.113  1.00 26.31 ? 410 HOH A O   1 
HETATM 6020 O  O   . HOH G 7 .   ? 35.093  114.875 20.355  1.00 34.05 ? 411 HOH A O   1 
HETATM 6021 O  O   . HOH G 7 .   ? 32.171  102.948 0.829   1.00 24.04 ? 412 HOH A O   1 
HETATM 6022 O  O   . HOH G 7 .   ? 42.437  135.429 -0.360  1.00 38.31 ? 413 HOH A O   1 
HETATM 6023 O  O   . HOH G 7 .   ? 41.607  96.024  -0.679  1.00 24.94 ? 414 HOH A O   1 
HETATM 6024 O  O   . HOH G 7 .   ? 31.761  118.639 3.128   1.00 22.40 ? 415 HOH A O   1 
HETATM 6025 O  O   . HOH G 7 .   ? 31.880  126.828 2.074   1.00 15.14 ? 416 HOH A O   1 
HETATM 6026 O  O   . HOH G 7 .   ? 44.551  100.672 2.783   1.00 24.99 ? 417 HOH A O   1 
HETATM 6027 O  O   . HOH G 7 .   ? 19.369  139.005 -16.971 1.00 42.16 ? 418 HOH A O   1 
HETATM 6028 O  O   . HOH G 7 .   ? 11.895  164.486 -20.100 1.00 25.00 ? 419 HOH A O   1 
HETATM 6029 O  O   . HOH G 7 .   ? 39.943  129.959 2.687   1.00 23.18 ? 420 HOH A O   1 
HETATM 6030 O  O   . HOH G 7 .   ? 25.455  152.542 -19.349 1.00 33.77 ? 421 HOH A O   1 
HETATM 6031 O  O   . HOH G 7 .   ? 8.796   160.826 -13.394 1.00 21.78 ? 422 HOH A O   1 
HETATM 6032 O  O   . HOH G 7 .   ? 41.156  132.042 8.650   1.00 30.07 ? 423 HOH A O   1 
HETATM 6033 O  O   . HOH G 7 .   ? 24.427  133.773 -12.090 1.00 22.54 ? 424 HOH A O   1 
HETATM 6034 O  O   . HOH G 7 .   ? 45.921  118.293 -10.172 1.00 31.99 ? 425 HOH A O   1 
HETATM 6035 O  O   . HOH G 7 .   ? 24.799  129.349 -8.155  1.00 35.54 ? 426 HOH A O   1 
HETATM 6036 O  O   . HOH G 7 .   ? 31.771  113.029 2.544   1.00 21.93 ? 427 HOH A O   1 
HETATM 6037 O  O   . HOH G 7 .   ? 29.833  114.446 7.768   1.00 39.90 ? 428 HOH A O   1 
HETATM 6038 O  O   . HOH G 7 .   ? 41.350  119.434 9.019   1.00 28.11 ? 429 HOH A O   1 
HETATM 6039 O  O   . HOH G 7 .   ? 28.266  132.218 -10.884 1.00 24.91 ? 430 HOH A O   1 
HETATM 6040 O  O   . HOH G 7 .   ? 40.343  142.473 -1.738  1.00 42.13 ? 431 HOH A O   1 
HETATM 6041 O  O   . HOH G 7 .   ? 30.375  128.873 -22.111 1.00 45.37 ? 432 HOH A O   1 
HETATM 6042 O  O   . HOH G 7 .   ? 32.638  117.875 17.323  1.00 40.64 ? 433 HOH A O   1 
HETATM 6043 O  O   . HOH G 7 .   ? 32.946  142.348 -2.468  1.00 41.33 ? 434 HOH A O   1 
HETATM 6044 O  O   . HOH G 7 .   ? 18.204  98.137  16.458  1.00 34.21 ? 435 HOH A O   1 
HETATM 6045 O  O   . HOH G 7 .   ? 40.361  105.943 -6.864  1.00 39.65 ? 436 HOH A O   1 
HETATM 6046 O  O   . HOH G 7 .   ? -6.671  144.954 -8.519  1.00 45.26 ? 437 HOH A O   1 
HETATM 6047 O  O   . HOH G 7 .   ? 15.774  138.827 -9.689  1.00 22.07 ? 438 HOH A O   1 
HETATM 6048 O  O   . HOH G 7 .   ? 28.906  132.869 -13.579 1.00 25.04 ? 439 HOH A O   1 
HETATM 6049 O  O   . HOH G 7 .   ? 25.507  141.459 -2.980  1.00 30.69 ? 440 HOH A O   1 
HETATM 6050 O  O   . HOH G 7 .   ? 18.210  144.332 -5.660  1.00 29.38 ? 441 HOH A O   1 
HETATM 6051 O  O   . HOH G 7 .   ? 48.685  124.298 -9.360  1.00 33.42 ? 442 HOH A O   1 
HETATM 6052 O  O   . HOH G 7 .   ? 17.942  135.720 -13.181 1.00 39.90 ? 443 HOH A O   1 
HETATM 6053 O  O   . HOH G 7 .   ? 30.460  137.907 -1.143  1.00 31.80 ? 444 HOH A O   1 
HETATM 6054 O  O   . HOH G 7 .   ? 35.731  122.906 13.137  1.00 19.56 ? 445 HOH A O   1 
HETATM 6055 O  O   . HOH G 7 .   ? 38.551  135.593 4.744   1.00 32.93 ? 446 HOH A O   1 
HETATM 6056 O  O   . HOH G 7 .   ? 40.265  134.552 1.154   1.00 30.25 ? 447 HOH A O   1 
HETATM 6057 O  O   . HOH G 7 .   ? 38.753  113.406 15.188  1.00 30.82 ? 448 HOH A O   1 
HETATM 6058 O  O   . HOH G 7 .   ? 25.745  132.331 -10.049 1.00 27.06 ? 449 HOH A O   1 
HETATM 6059 O  O   . HOH G 7 .   ? 15.228  106.129 12.821  1.00 28.78 ? 450 HOH A O   1 
HETATM 6060 O  O   . HOH G 7 .   ? 39.671  117.357 10.154  1.00 27.90 ? 451 HOH A O   1 
HETATM 6061 O  O   . HOH G 7 .   ? 37.688  145.062 -16.267 1.00 32.51 ? 452 HOH A O   1 
HETATM 6062 O  O   . HOH G 7 .   ? 28.390  112.290 5.056   1.00 35.84 ? 453 HOH A O   1 
HETATM 6063 O  O   . HOH G 7 .   ? 21.599  156.310 -30.040 1.00 43.35 ? 454 HOH A O   1 
HETATM 6064 O  O   . HOH G 7 .   ? 15.964  101.382 16.253  1.00 21.79 ? 455 HOH A O   1 
HETATM 6065 O  O   . HOH G 7 .   ? 33.065  148.873 -7.200  1.00 41.09 ? 456 HOH A O   1 
HETATM 6066 O  O   . HOH G 7 .   ? 42.383  134.763 -15.719 1.00 23.73 ? 457 HOH A O   1 
HETATM 6067 O  O   . HOH G 7 .   ? 26.299  133.021 -14.166 1.00 29.85 ? 458 HOH A O   1 
HETATM 6068 O  O   . HOH G 7 .   ? 24.639  150.692 -12.452 1.00 31.34 ? 459 HOH A O   1 
HETATM 6069 O  O   . HOH G 7 .   ? 37.386  131.407 5.360   1.00 20.97 ? 460 HOH A O   1 
HETATM 6070 O  O   . HOH G 7 .   ? 35.976  135.135 4.022   1.00 26.81 ? 461 HOH A O   1 
HETATM 6071 O  O   . HOH G 7 .   ? 46.580  104.825 -3.855  1.00 24.10 ? 462 HOH A O   1 
HETATM 6072 O  O   . HOH G 7 .   ? 8.713   147.295 -15.260 1.00 32.30 ? 463 HOH A O   1 
HETATM 6073 O  O   . HOH G 7 .   ? 45.128  135.405 -10.087 1.00 40.78 ? 464 HOH A O   1 
HETATM 6074 O  O   . HOH G 7 .   ? 36.345  148.347 -12.827 1.00 36.43 ? 465 HOH A O   1 
HETATM 6075 O  O   . HOH G 7 .   ? 47.362  120.380 -10.874 1.00 40.99 ? 466 HOH A O   1 
HETATM 6076 O  O   . HOH G 7 .   ? 22.950  115.469 23.689  1.00 47.54 ? 467 HOH A O   1 
HETATM 6077 O  O   . HOH G 7 .   ? 46.345  133.118 -2.597  1.00 56.15 ? 468 HOH A O   1 
HETATM 6078 O  O   . HOH G 7 .   ? 44.733  135.683 -3.872  1.00 43.63 ? 469 HOH A O   1 
HETATM 6079 O  O   . HOH G 7 .   ? 23.793  155.634 -11.684 1.00 44.24 ? 470 HOH A O   1 
HETATM 6080 O  O   . HOH G 7 .   ? 38.552  146.505 -13.841 1.00 38.74 ? 471 HOH A O   1 
HETATM 6081 O  O   . HOH G 7 .   ? 42.583  130.077 -22.837 1.00 51.51 ? 472 HOH A O   1 
HETATM 6082 O  O   . HOH G 7 .   ? 6.592   161.299 -15.233 1.00 46.76 ? 473 HOH A O   1 
HETATM 6083 O  O   . HOH G 7 .   ? 20.021  137.986 -7.880  1.00 31.09 ? 474 HOH A O   1 
HETATM 6084 O  O   . HOH G 7 .   ? 20.100  139.451 -5.616  1.00 45.11 ? 475 HOH A O   1 
HETATM 6085 O  O   . HOH G 7 .   ? 18.802  100.700 15.771  1.00 24.87 ? 476 HOH A O   1 
HETATM 6086 O  O   . HOH G 7 .   ? 26.038  97.307  4.947   1.00 30.58 ? 477 HOH A O   1 
HETATM 6087 O  O   . HOH G 7 .   ? 29.655  107.531 1.022   1.00 31.65 ? 478 HOH A O   1 
HETATM 6088 O  O   . HOH G 7 .   ? 26.827  89.928  15.124  1.00 38.97 ? 479 HOH A O   1 
HETATM 6089 O  O   . HOH G 7 .   ? 44.836  139.176 -14.335 1.00 44.51 ? 480 HOH A O   1 
HETATM 6090 O  O   . HOH G 7 .   ? 35.077  132.914 5.012   1.00 25.17 ? 481 HOH A O   1 
HETATM 6091 O  O   . HOH G 7 .   ? 32.678  98.250  -1.899  1.00 51.97 ? 482 HOH A O   1 
HETATM 6092 O  O   . HOH G 7 .   ? 33.125  111.853 6.702   1.00 37.55 ? 483 HOH A O   1 
HETATM 6093 O  O   . HOH G 7 .   ? 27.352  100.767 22.406  1.00 41.17 ? 484 HOH A O   1 
HETATM 6094 O  O   . HOH G 7 .   ? 23.440  133.790 -21.766 1.00 39.79 ? 485 HOH A O   1 
HETATM 6095 O  O   . HOH G 7 .   ? 25.601  132.207 -21.185 1.00 43.34 ? 486 HOH A O   1 
HETATM 6096 O  O   . HOH G 7 .   ? 44.892  119.178 -17.631 1.00 50.77 ? 487 HOH A O   1 
HETATM 6097 O  O   . HOH G 7 .   ? 13.292  160.057 -4.716  1.00 30.22 ? 488 HOH A O   1 
HETATM 6098 O  O   . HOH G 7 .   ? 39.526  133.086 5.080   1.00 30.19 ? 489 HOH A O   1 
HETATM 6099 O  O   . HOH G 7 .   ? 37.911  142.524 -14.334 1.00 24.17 ? 490 HOH A O   1 
HETATM 6100 O  O   . HOH G 7 .   ? 11.164  146.153 -15.238 1.00 30.22 ? 491 HOH A O   1 
HETATM 6101 O  O   . HOH G 7 .   ? 22.621  134.993 -4.012  1.00 43.77 ? 492 HOH A O   1 
HETATM 6102 O  O   . HOH G 7 .   ? 31.978  121.043 12.728  1.00 28.69 ? 493 HOH A O   1 
HETATM 6103 O  O   . HOH G 7 .   ? 20.691  147.386 -6.631  1.00 31.85 ? 494 HOH A O   1 
HETATM 6104 O  O   . HOH G 7 .   ? 30.140  102.877 3.764   1.00 30.47 ? 495 HOH A O   1 
HETATM 6105 O  O   . HOH G 7 .   ? 4.493   153.802 -12.293 1.00 26.29 ? 496 HOH A O   1 
HETATM 6106 O  O   . HOH G 7 .   ? 31.129  116.991 19.141  1.00 30.07 ? 497 HOH A O   1 
HETATM 6107 O  O   . HOH G 7 .   ? 8.700   167.636 -12.848 1.00 39.51 ? 498 HOH A O   1 
HETATM 6108 O  O   . HOH G 7 .   ? 20.892  138.011 -22.980 1.00 37.11 ? 499 HOH A O   1 
HETATM 6109 O  O   . HOH G 7 .   ? 6.906   162.933 -17.845 1.00 50.47 ? 500 HOH A O   1 
HETATM 6110 O  O   . HOH G 7 .   ? 50.680  114.452 0.616   1.00 41.10 ? 501 HOH A O   1 
HETATM 6111 O  O   . HOH G 7 .   ? 45.803  131.421 -9.824  1.00 39.92 ? 502 HOH A O   1 
HETATM 6112 O  O   . HOH G 7 .   ? 39.097  105.897 -4.436  1.00 31.16 ? 503 HOH A O   1 
HETATM 6113 O  O   . HOH G 7 .   ? 3.346   147.913 -16.482 1.00 44.58 ? 504 HOH A O   1 
HETATM 6114 O  O   . HOH G 7 .   ? 29.198  130.338 -14.468 1.00 30.94 ? 505 HOH A O   1 
HETATM 6115 O  O   . HOH G 7 .   ? 50.014  120.113 -4.585  1.00 49.33 ? 506 HOH A O   1 
HETATM 6116 O  O   . HOH G 7 .   ? 39.088  100.376 5.430   1.00 30.18 ? 507 HOH A O   1 
HETATM 6117 O  O   . HOH G 7 .   ? 43.404  136.718 -14.260 1.00 27.23 ? 508 HOH A O   1 
HETATM 6118 O  O   . HOH G 7 .   ? 33.080  111.061 9.349   1.00 28.09 ? 509 HOH A O   1 
HETATM 6119 O  O   . HOH G 7 .   ? 34.988  108.308 -4.616  1.00 29.42 ? 510 HOH A O   1 
HETATM 6120 O  O   . HOH G 7 .   ? 29.986  149.929 -20.992 1.00 28.39 ? 511 HOH A O   1 
HETATM 6121 O  O   . HOH G 7 .   ? 17.711  136.648 -8.809  1.00 43.13 ? 512 HOH A O   1 
HETATM 6122 O  O   . HOH G 7 .   ? 24.828  91.512  15.878  1.00 29.85 ? 513 HOH A O   1 
HETATM 6123 O  O   . HOH G 7 .   ? 6.035   155.956 -24.467 1.00 39.25 ? 514 HOH A O   1 
HETATM 6124 O  O   . HOH G 7 .   ? 19.430  89.997  7.885   1.00 33.25 ? 515 HOH A O   1 
HETATM 6125 O  O   . HOH G 7 .   ? 9.420   162.801 -21.471 1.00 30.03 ? 516 HOH A O   1 
HETATM 6126 O  O   . HOH G 7 .   ? 19.943  158.553 -20.973 1.00 34.14 ? 517 HOH A O   1 
HETATM 6127 O  O   . HOH G 7 .   ? 35.265  99.410  16.382  1.00 39.16 ? 518 HOH A O   1 
HETATM 6128 O  O   . HOH G 7 .   ? 23.684  99.919  6.009   1.00 47.56 ? 519 HOH A O   1 
HETATM 6129 O  O   . HOH G 7 .   ? 12.312  163.802 -6.544  1.00 36.42 ? 520 HOH A O   1 
HETATM 6130 O  O   . HOH G 7 .   ? 23.610  91.035  2.493   1.00 52.04 ? 521 HOH A O   1 
HETATM 6131 O  O   . HOH G 7 .   ? 45.368  134.543 -6.417  1.00 42.60 ? 522 HOH A O   1 
HETATM 6132 O  O   . HOH G 7 .   ? 27.860  112.180 12.174  1.00 45.85 ? 523 HOH A O   1 
HETATM 6133 O  O   . HOH G 7 .   ? 21.165  102.140 17.094  1.00 42.43 ? 524 HOH A O   1 
HETATM 6134 O  O   . HOH G 7 .   ? 43.453  109.067 -12.554 1.00 39.25 ? 525 HOH A O   1 
HETATM 6135 O  O   . HOH G 7 .   ? 22.280  104.657 4.402   1.00 34.71 ? 526 HOH A O   1 
HETATM 6136 O  O   . HOH G 7 .   ? 32.074  133.504 4.287   1.00 38.43 ? 527 HOH A O   1 
HETATM 6137 O  O   . HOH G 7 .   ? 43.469  139.292 -7.213  1.00 34.17 ? 528 HOH A O   1 
HETATM 6138 O  O   . HOH G 7 .   ? 37.969  96.430  14.022  1.00 46.04 ? 529 HOH A O   1 
HETATM 6139 O  O   . HOH G 7 .   ? 7.219   148.211 -20.803 1.00 44.46 ? 530 HOH A O   1 
HETATM 6140 O  O   . HOH G 7 .   ? 40.472  95.038  1.793   1.00 43.28 ? 531 HOH A O   1 
HETATM 6141 O  O   . HOH G 7 .   ? 2.858   161.907 -27.146 1.00 44.56 ? 532 HOH A O   1 
HETATM 6142 O  O   . HOH G 7 .   ? 3.896   156.708 -12.724 1.00 50.60 ? 533 HOH A O   1 
HETATM 6143 O  O   . HOH G 7 .   ? 33.533  118.267 -12.251 1.00 44.50 ? 534 HOH A O   1 
HETATM 6144 O  O   . HOH G 7 .   ? 29.570  105.482 -3.174  1.00 51.02 ? 535 HOH A O   1 
HETATM 6145 O  O   . HOH G 7 .   ? 38.660  145.781 -19.315 1.00 42.89 ? 536 HOH A O   1 
HETATM 6146 O  O   . HOH G 7 .   ? 33.202  142.052 2.432   1.00 52.19 ? 537 HOH A O   1 
HETATM 6147 O  O   . HOH G 7 .   ? 36.411  98.913  -5.899  1.00 61.70 ? 538 HOH A O   1 
HETATM 6148 O  O   . HOH G 7 .   ? 28.335  126.095 -17.285 1.00 42.01 ? 539 HOH A O   1 
HETATM 6149 O  O   . HOH G 7 .   ? 44.748  133.497 -16.701 1.00 45.67 ? 540 HOH A O   1 
HETATM 6150 O  O   . HOH G 7 .   ? 39.795  99.773  -5.538  1.00 50.39 ? 541 HOH A O   1 
HETATM 6151 O  O   . HOH G 7 .   ? 41.754  141.243 -13.077 1.00 55.41 ? 542 HOH A O   1 
HETATM 6152 O  O   . HOH G 7 .   ? 22.709  90.527  14.841  1.00 43.96 ? 543 HOH A O   1 
HETATM 6153 O  O   . HOH G 7 .   ? 39.056  110.393 -10.714 1.00 42.72 ? 544 HOH A O   1 
HETATM 6154 O  O   . HOH G 7 .   ? 22.692  99.708  17.475  1.00 41.50 ? 545 HOH A O   1 
HETATM 6155 O  O   . HOH G 7 .   ? 30.089  125.434 -15.575 1.00 45.58 ? 546 HOH A O   1 
HETATM 6156 O  O   . HOH G 7 .   ? 38.700  97.645  6.050   1.00 35.22 ? 547 HOH A O   1 
HETATM 6157 O  O   . HOH G 7 .   ? 14.495  99.280  16.592  1.00 33.86 ? 548 HOH A O   1 
HETATM 6158 O  O   . HOH G 7 .   ? 24.948  97.207  20.063  1.00 34.79 ? 549 HOH A O   1 
HETATM 6159 O  O   . HOH G 7 .   ? 26.419  105.614 7.789   1.00 31.82 ? 550 HOH A O   1 
HETATM 6160 O  O   . HOH G 7 .   ? 7.386   158.820 -12.405 1.00 31.58 ? 551 HOH A O   1 
HETATM 6161 O  O   . HOH G 7 .   ? 31.207  109.646 8.290   1.00 37.29 ? 552 HOH A O   1 
HETATM 6162 O  O   . HOH G 7 .   ? 12.662  99.769  19.509  1.00 45.02 ? 553 HOH A O   1 
HETATM 6163 O  O   . HOH G 7 .   ? 36.471  106.035 -4.700  1.00 39.56 ? 554 HOH A O   1 
HETATM 6164 O  O   . HOH G 7 .   ? 39.067  140.850 -20.041 1.00 41.18 ? 555 HOH A O   1 
HETATM 6165 O  O   . HOH G 7 .   ? 25.587  134.315 -2.714  1.00 44.79 ? 556 HOH A O   1 
HETATM 6166 O  O   . HOH G 7 .   ? 26.136  154.277 -28.788 1.00 38.94 ? 557 HOH A O   1 
HETATM 6167 O  O   . HOH G 7 .   ? 5.024   147.842 -19.105 1.00 37.68 ? 558 HOH A O   1 
HETATM 6168 O  O   . HOH G 7 .   ? 45.647  136.377 -17.002 1.00 45.55 ? 559 HOH A O   1 
HETATM 6169 O  O   . HOH G 7 .   ? 50.513  128.125 0.127   1.00 47.69 ? 560 HOH A O   1 
HETATM 6170 O  O   . HOH G 7 .   ? 45.701  135.593 -13.198 1.00 42.34 ? 561 HOH A O   1 
HETATM 6171 O  O   . HOH G 7 .   ? 19.911  104.592 2.817   1.00 43.97 ? 562 HOH A O   1 
HETATM 6172 O  O   . HOH G 7 .   ? 42.360  118.610 -18.200 1.00 54.14 ? 563 HOH A O   1 
HETATM 6173 O  O   . HOH G 7 .   ? 12.240  166.385 -6.536  1.00 44.95 ? 564 HOH A O   1 
HETATM 6174 O  O   . HOH G 7 .   ? 3.411   155.663 -24.197 1.00 53.16 ? 565 HOH A O   1 
HETATM 6175 O  O   . HOH G 7 .   ? 21.324  102.019 4.807   1.00 45.70 ? 566 HOH A O   1 
HETATM 6176 O  O   . HOH G 7 .   ? 48.018  104.016 -10.765 1.00 46.71 ? 567 HOH A O   1 
HETATM 6177 O  O   . HOH G 7 .   ? 12.865  107.009 18.108  1.00 53.44 ? 568 HOH A O   1 
HETATM 6178 O  O   . HOH G 7 .   ? 35.988  109.837 -6.727  1.00 55.10 ? 569 HOH A O   1 
HETATM 6179 O  O   . HOH G 7 .   ? 26.019  113.272 25.518  1.00 53.30 ? 570 HOH A O   1 
HETATM 6180 O  O   . HOH G 7 .   ? 19.852  110.452 22.086  1.00 50.33 ? 571 HOH A O   1 
HETATM 6181 O  O   . HOH G 7 .   ? 14.184  165.146 -27.130 1.00 42.98 ? 572 HOH A O   1 
HETATM 6182 O  O   . HOH G 7 .   ? 23.965  156.438 -16.963 1.00 40.22 ? 573 HOH A O   1 
HETATM 6183 O  O   . HOH G 7 .   ? 39.843  143.127 -12.159 1.00 52.80 ? 574 HOH A O   1 
HETATM 6184 O  O   . HOH G 7 .   ? 10.705  160.062 -3.051  1.00 35.94 ? 575 HOH A O   1 
HETATM 6185 O  O   . HOH G 7 .   ? 50.944  115.503 3.327   1.00 43.26 ? 576 HOH A O   1 
HETATM 6186 O  O   . HOH G 7 .   ? 40.527  143.344 -9.256  1.00 43.72 ? 577 HOH A O   1 
HETATM 6187 O  O   . HOH G 7 .   ? 34.345  145.458 -27.736 1.00 40.71 ? 578 HOH A O   1 
HETATM 6188 O  O   . HOH G 7 .   ? 20.049  103.170 0.709   1.00 50.94 ? 579 HOH A O   1 
HETATM 6189 O  O   . HOH G 7 .   ? 45.348  127.858 10.637  1.00 39.85 ? 580 HOH A O   1 
HETATM 6190 O  O   . HOH G 7 .   ? 7.924   154.407 0.625   1.00 46.85 ? 581 HOH A O   1 
HETATM 6191 O  O   . HOH G 7 .   ? 19.116  137.796 -20.650 1.00 53.23 ? 582 HOH A O   1 
HETATM 6192 O  O   . HOH G 7 .   ? 33.037  123.594 -14.568 1.00 43.72 ? 583 HOH A O   1 
HETATM 6193 O  O   . HOH G 7 .   ? 12.410  167.524 -28.234 1.00 46.95 ? 584 HOH A O   1 
HETATM 6194 O  O   . HOH G 7 .   ? 12.771  102.095 18.500  1.00 56.12 ? 585 HOH A O   1 
HETATM 6195 O  O   . HOH G 7 .   ? 40.435  99.570  -8.611  1.00 42.74 ? 586 HOH A O   1 
HETATM 6196 O  O   . HOH G 7 .   ? 36.287  101.252 17.760  1.00 48.14 ? 587 HOH A O   1 
HETATM 6197 O  O   . HOH G 7 .   ? 40.301  135.467 -28.043 1.00 54.39 ? 588 HOH A O   1 
HETATM 6198 O  O   . HOH G 7 .   ? 52.627  112.587 0.073   1.00 54.77 ? 589 HOH A O   1 
HETATM 6199 O  O   . HOH G 7 .   ? 34.335  144.112 1.038   1.00 48.24 ? 590 HOH A O   1 
HETATM 6200 O  O   . HOH G 7 .   ? 39.112  130.302 -26.890 1.00 54.65 ? 591 HOH A O   1 
HETATM 6201 O  O   . HOH G 7 .   ? 17.810  162.507 -27.106 1.00 47.15 ? 592 HOH A O   1 
HETATM 6202 O  O   . HOH G 7 .   ? 46.652  133.023 -12.461 1.00 53.97 ? 593 HOH A O   1 
HETATM 6203 O  O   . HOH G 7 .   ? 37.166  91.343  12.366  1.00 53.13 ? 594 HOH A O   1 
HETATM 6204 O  O   . HOH G 7 .   ? 32.635  124.635 -19.882 1.00 53.01 ? 595 HOH A O   1 
HETATM 6205 O  O   . HOH G 7 .   ? 27.344  106.064 25.567  1.00 55.30 ? 596 HOH A O   1 
HETATM 6206 O  O   . HOH G 7 .   ? 45.679  137.102 -8.150  1.00 51.05 ? 597 HOH A O   1 
HETATM 6207 O  O   . HOH G 7 .   ? 5.331   152.303 -10.231 1.00 46.64 ? 598 HOH A O   1 
HETATM 6208 O  O   . HOH G 7 .   ? 3.385   151.780 -5.995  1.00 37.21 ? 599 HOH A O   1 
HETATM 6209 O  O   . HOH G 7 .   ? 38.126  143.456 -20.618 1.00 40.66 ? 600 HOH A O   1 
HETATM 6210 O  O   . HOH G 7 .   ? 14.256  162.482 -5.398  1.00 42.83 ? 601 HOH A O   1 
HETATM 6211 O  O   . HOH G 7 .   ? 31.854  120.714 -14.614 1.00 48.80 ? 602 HOH A O   1 
HETATM 6212 O  O   . HOH G 7 .   ? 40.280  136.626 2.935   1.00 50.50 ? 603 HOH A O   1 
HETATM 6213 O  O   . HOH G 7 .   ? 50.162  120.123 -9.769  1.00 52.71 ? 604 HOH A O   1 
HETATM 6214 O  O   . HOH G 7 .   ? 13.695  107.964 11.429  1.00 45.15 ? 605 HOH A O   1 
HETATM 6215 O  O   . HOH G 7 .   ? 18.557  112.845 20.687  1.00 48.68 ? 606 HOH A O   1 
HETATM 6216 O  O   . HOH G 7 .   ? 45.179  130.603 9.387   1.00 51.58 ? 607 HOH A O   1 
HETATM 6217 O  O   . HOH G 7 .   ? 48.765  119.906 -2.579  1.00 36.63 ? 608 HOH A O   1 
HETATM 6218 O  O   . HOH G 7 .   ? 32.790  139.518 -1.500  1.00 42.22 ? 609 HOH A O   1 
HETATM 6219 O  O   . HOH G 7 .   ? 38.156  106.855 -7.852  1.00 53.03 ? 610 HOH A O   1 
HETATM 6220 O  O   . HOH G 7 .   ? 38.229  109.275 -5.917  1.00 50.84 ? 611 HOH A O   1 
HETATM 6221 O  O   . HOH G 7 .   ? 20.618  142.866 -5.886  1.00 46.33 ? 612 HOH A O   1 
HETATM 6222 O  O   . HOH G 7 .   ? 17.717  136.513 -6.200  1.00 54.80 ? 613 HOH A O   1 
HETATM 6223 O  O   . HOH G 7 .   ? 12.061  106.382 15.098  1.00 49.70 ? 614 HOH A O   1 
HETATM 6224 O  O   . HOH G 7 .   ? 52.029  109.520 -3.528  1.00 36.32 ? 615 HOH A O   1 
HETATM 6225 O  O   . HOH G 7 .   ? 52.300  110.229 -0.980  1.00 44.15 ? 616 HOH A O   1 
HETATM 6226 O  O   . HOH G 7 .   ? 44.740  127.158 -21.760 1.00 48.24 ? 617 HOH A O   1 
HETATM 6227 O  O   . HOH G 7 .   ? 7.305   166.684 -16.034 1.00 53.49 ? 618 HOH A O   1 
HETATM 6228 O  O   . HOH G 7 .   ? 8.052   165.247 -18.257 1.00 48.68 ? 619 HOH A O   1 
HETATM 6229 O  O   . HOH G 7 .   ? 35.999  94.728  0.013   1.00 44.14 ? 620 HOH A O   1 
HETATM 6230 O  O   . HOH G 7 .   ? 18.003  147.306 -4.507  1.00 50.86 ? 621 HOH A O   1 
HETATM 6231 O  O   . HOH G 7 .   ? 20.647  91.821  14.621  1.00 57.80 ? 622 HOH A O   1 
HETATM 6232 O  O   . HOH G 7 .   ? 3.282   163.987 -24.394 1.00 41.09 ? 623 HOH A O   1 
HETATM 6233 O  O   . HOH G 7 .   ? 29.616  144.754 -28.909 1.00 47.09 ? 624 HOH A O   1 
HETATM 6234 O  O   . HOH G 7 .   ? 11.609  145.756 -26.283 1.00 48.32 ? 625 HOH A O   1 
HETATM 6235 O  O   . HOH G 7 .   ? 13.169  168.982 -25.904 1.00 47.40 ? 626 HOH A O   1 
HETATM 6236 O  O   . HOH G 7 .   ? 43.212  103.207 -9.363  1.00 45.80 ? 627 HOH A O   1 
HETATM 6237 O  O   . HOH G 7 .   ? 14.671  103.335 17.412  1.00 47.06 ? 628 HOH A O   1 
HETATM 6238 O  O   . HOH G 7 .   ? 47.901  120.494 -13.472 1.00 48.08 ? 629 HOH A O   1 
HETATM 6239 O  O   . HOH G 7 .   ? 49.996  122.349 -8.336  1.00 51.02 ? 630 HOH A O   1 
HETATM 6240 O  O   . HOH G 7 .   ? 29.057  139.965 0.514   1.00 46.05 ? 631 HOH A O   1 
HETATM 6241 O  O   . HOH G 7 .   ? 16.440  151.144 -4.763  1.00 41.83 ? 632 HOH A O   1 
HETATM 6242 O  O   . HOH G 7 .   ? 40.449  132.483 -25.654 1.00 47.73 ? 633 HOH A O   1 
HETATM 6243 O  O   . HOH G 7 .   ? 28.828  153.465 -28.896 1.00 50.39 ? 634 HOH A O   1 
HETATM 6244 O  O   . HOH G 7 .   ? 1.841   150.461 -7.600  1.00 45.62 ? 635 HOH A O   1 
HETATM 6245 O  O   . HOH G 7 .   ? -4.622  143.534 -7.627  1.00 37.06 ? 636 HOH A O   1 
HETATM 6246 O  O   . HOH G 7 .   ? 25.482  131.842 -15.878 1.00 28.14 ? 637 HOH A O   1 
HETATM 6247 O  O   . HOH G 7 .   ? 45.246  102.650 -4.001  1.00 40.30 ? 638 HOH A O   1 
HETATM 6248 O  O   . HOH G 7 .   ? 20.762  143.050 -30.060 1.00 41.97 ? 639 HOH A O   1 
HETATM 6249 O  O   . HOH G 7 .   ? 24.368  88.052  4.564   1.00 46.47 ? 640 HOH A O   1 
HETATM 6250 O  O   . HOH G 7 .   ? 50.226  127.518 -2.631  1.00 40.59 ? 641 HOH A O   1 
HETATM 6251 O  O   . HOH G 7 .   ? 31.950  124.739 -17.240 1.00 51.35 ? 642 HOH A O   1 
HETATM 6252 O  O   . HOH G 7 .   ? 28.073  152.131 -18.732 1.00 53.13 ? 643 HOH A O   1 
HETATM 6253 O  O   . HOH G 7 .   ? 41.253  134.044 6.747   1.00 48.28 ? 644 HOH A O   1 
HETATM 6254 O  O   . HOH G 7 .   ? 0.597   162.098 -28.322 1.00 51.49 ? 645 HOH A O   1 
HETATM 6255 O  O   . HOH G 7 .   ? 27.989  127.948 -13.921 1.00 29.60 ? 646 HOH A O   1 
HETATM 6256 O  O   . HOH G 7 .   ? 33.425  120.260 14.808  1.00 32.85 ? 647 HOH A O   1 
HETATM 6257 O  O   . HOH G 7 .   ? 25.955  89.846  5.146   1.00 37.41 ? 648 HOH A O   1 
HETATM 6258 O  O   . HOH G 7 .   ? 32.840  86.894  13.246  1.00 36.67 ? 649 HOH A O   1 
HETATM 6259 O  O   . HOH G 7 .   ? 13.142  111.533 17.347  1.00 47.17 ? 650 HOH A O   1 
HETATM 6260 O  O   . HOH G 7 .   ? 41.708  102.671 -5.307  1.00 44.94 ? 651 HOH A O   1 
HETATM 6261 O  O   . HOH G 7 .   ? 40.354  95.667  6.930   1.00 46.68 ? 652 HOH A O   1 
HETATM 6262 O  O   . HOH G 7 .   ? 42.130  96.509  8.537   1.00 45.92 ? 653 HOH A O   1 
HETATM 6263 O  O   . HOH G 7 .   ? 45.099  134.726 -0.329  1.00 47.09 ? 654 HOH A O   1 
HETATM 6264 O  O   . HOH G 7 .   ? 35.852  151.947 -18.635 1.00 48.75 ? 655 HOH A O   1 
HETATM 6265 O  O   . HOH G 7 .   ? 44.164  133.601 -19.407 1.00 47.75 ? 656 HOH A O   1 
HETATM 6266 O  O   . HOH G 7 .   ? 38.599  93.575  0.124   1.00 55.74 ? 657 HOH A O   1 
HETATM 6267 O  O   . HOH G 7 .   ? 15.158  158.552 -3.416  1.00 47.39 ? 658 HOH A O   1 
HETATM 6268 O  O   . HOH G 7 .   ? 38.001  111.940 -13.112 1.00 49.13 ? 659 HOH A O   1 
HETATM 6269 O  O   . HOH G 7 .   ? 31.184  142.758 -0.287  1.00 51.20 ? 660 HOH A O   1 
HETATM 6270 O  O   . HOH G 7 .   ? 25.957  98.236  22.271  1.00 47.05 ? 661 HOH A O   1 
HETATM 6271 O  O   . HOH G 7 .   ? 50.471  122.008 -12.620 1.00 53.72 ? 662 HOH A O   1 
HETATM 6272 O  O   . HOH G 7 .   ? 26.673  129.371 -22.206 1.00 50.51 ? 663 HOH A O   1 
HETATM 6273 O  O   . HOH G 7 .   ? 28.792  160.673 -11.462 1.00 56.27 ? 664 HOH A O   1 
HETATM 6274 O  O   . HOH G 7 .   ? 47.785  130.070 -8.152  1.00 48.09 ? 665 HOH A O   1 
HETATM 6275 O  O   . HOH G 7 .   ? 10.630  160.431 -30.715 1.00 56.32 ? 666 HOH A O   1 
HETATM 6276 O  O   . HOH G 7 .   ? 5.287   158.804 -15.514 1.00 47.14 ? 667 HOH A O   1 
HETATM 6277 O  O   . HOH G 7 .   ? 42.747  115.701 -18.308 1.00 51.73 ? 668 HOH A O   1 
HETATM 6278 O  O   . HOH G 7 .   ? 40.719  101.888 18.915  1.00 52.06 ? 669 HOH A O   1 
HETATM 6279 O  O   . HOH G 7 .   ? 45.528  123.493 -18.477 1.00 51.18 ? 670 HOH A O   1 
HETATM 6280 O  O   . HOH G 7 .   ? 1.296   151.587 -22.055 1.00 52.00 ? 671 HOH A O   1 
HETATM 6281 O  O   . HOH G 7 .   ? 47.640  123.509 2.244   1.00 49.41 ? 672 HOH A O   1 
HETATM 6282 O  O   . HOH G 7 .   ? 24.926  150.264 -9.678  1.00 51.72 ? 673 HOH A O   1 
HETATM 6283 O  O   . HOH G 7 .   ? 38.460  139.346 -27.423 1.00 55.61 ? 674 HOH A O   1 
HETATM 6284 O  O   . HOH G 7 .   ? 41.024  103.483 -7.916  1.00 55.46 ? 675 HOH A O   1 
HETATM 6285 O  O   . HOH G 7 .   ? 28.397  101.957 2.119   1.00 43.88 ? 676 HOH A O   1 
HETATM 6286 O  O   . HOH G 7 .   ? 21.357  160.468 -22.925 1.00 44.18 ? 677 HOH A O   1 
HETATM 6287 O  O   . HOH G 7 .   ? 40.460  128.424 -25.038 1.00 55.20 ? 678 HOH A O   1 
HETATM 6288 O  O   . HOH G 7 .   ? 33.665  117.619 -16.024 1.00 56.53 ? 679 HOH A O   1 
HETATM 6289 O  O   . HOH G 7 .   ? 43.016  140.781 -4.905  1.00 57.53 ? 680 HOH A O   1 
HETATM 6290 O  O   . HOH G 7 .   ? 28.830  103.780 26.358  1.00 51.58 ? 681 HOH A O   1 
HETATM 6291 O  O   . HOH G 7 .   ? 46.769  111.001 -14.503 1.00 50.16 ? 682 HOH A O   1 
HETATM 6292 O  O   . HOH G 7 .   ? 15.557  151.793 -32.008 1.00 48.31 ? 683 HOH A O   1 
HETATM 6293 O  O   . HOH G 7 .   ? 29.564  124.688 -19.668 1.00 56.55 ? 684 HOH A O   1 
HETATM 6294 O  O   . HOH H 7 .   ? 26.064  128.588 13.212  1.00 18.24 ? 442 HOH B O   1 
HETATM 6295 O  O   . HOH H 7 .   ? 12.522  141.778 -14.260 1.00 18.04 ? 443 HOH B O   1 
HETATM 6296 O  O   . HOH H 7 .   ? 12.837  147.017 -10.435 1.00 22.91 ? 444 HOH B O   1 
HETATM 6297 O  O   . HOH H 7 .   ? 17.443  125.797 10.398  1.00 13.41 ? 445 HOH B O   1 
HETATM 6298 O  O   . HOH H 7 .   ? 5.939   123.227 17.682  1.00 18.31 ? 446 HOH B O   1 
HETATM 6299 O  O   . HOH H 7 .   ? -5.229  124.109 -5.184  1.00 19.03 ? 447 HOH B O   1 
HETATM 6300 O  O   . HOH H 7 .   ? 29.099  122.967 17.768  1.00 20.64 ? 448 HOH B O   1 
HETATM 6301 O  O   . HOH H 7 .   ? 8.571   149.121 -11.172 1.00 22.76 ? 449 HOH B O   1 
HETATM 6302 O  O   . HOH H 7 .   ? 9.629   142.919 6.385   1.00 33.98 ? 450 HOH B O   1 
HETATM 6303 O  O   . HOH H 7 .   ? 37.867  122.184 14.986  1.00 19.09 ? 451 HOH B O   1 
HETATM 6304 O  O   . HOH H 7 .   ? 12.316  135.106 -20.100 1.00 20.09 ? 452 HOH B O   1 
HETATM 6305 O  O   . HOH H 7 .   ? 20.027  115.391 11.497  1.00 18.02 ? 453 HOH B O   1 
HETATM 6306 O  O   . HOH H 7 .   ? 4.823   125.761 -8.514  1.00 17.40 ? 454 HOH B O   1 
HETATM 6307 O  O   . HOH H 7 .   ? 4.000   119.316 7.141   1.00 20.77 ? 455 HOH B O   1 
HETATM 6308 O  O   . HOH H 7 .   ? 7.088   145.876 -13.466 1.00 24.35 ? 456 HOH B O   1 
HETATM 6309 O  O   . HOH H 7 .   ? 28.465  115.654 5.412   1.00 16.89 ? 457 HOH B O   1 
HETATM 6310 O  O   . HOH H 7 .   ? 1.770   131.153 -18.732 1.00 20.78 ? 458 HOH B O   1 
HETATM 6311 O  O   . HOH H 7 .   ? 12.869  112.972 14.951  1.00 17.77 ? 459 HOH B O   1 
HETATM 6312 O  O   . HOH H 7 .   ? 23.850  111.639 -14.574 1.00 26.54 ? 460 HOH B O   1 
HETATM 6313 O  O   . HOH H 7 .   ? 23.948  124.052 25.950  1.00 44.18 ? 461 HOH B O   1 
HETATM 6314 O  O   . HOH H 7 .   ? -5.362  127.394 -16.572 1.00 25.22 ? 462 HOH B O   1 
HETATM 6315 O  O   . HOH H 7 .   ? 26.416  119.106 13.863  1.00 26.63 ? 463 HOH B O   1 
HETATM 6316 O  O   . HOH H 7 .   ? 27.068  126.305 26.189  1.00 36.74 ? 464 HOH B O   1 
HETATM 6317 O  O   . HOH H 7 .   ? 14.659  113.229 -17.074 1.00 22.86 ? 465 HOH B O   1 
HETATM 6318 O  O   . HOH H 7 .   ? 0.804   129.176 19.497  1.00 23.71 ? 466 HOH B O   1 
HETATM 6319 O  O   . HOH H 7 .   ? 29.236  134.915 13.303  1.00 30.90 ? 467 HOH B O   1 
HETATM 6320 O  O   . HOH H 7 .   ? 13.090  105.573 -4.862  1.00 45.82 ? 468 HOH B O   1 
HETATM 6321 O  O   . HOH H 7 .   ? 18.505  122.956 -14.822 1.00 19.39 ? 469 HOH B O   1 
HETATM 6322 O  O   . HOH H 7 .   ? 26.808  123.089 16.226  1.00 16.99 ? 470 HOH B O   1 
HETATM 6323 O  O   . HOH H 7 .   ? 28.203  119.425 -7.863  1.00 18.79 ? 471 HOH B O   1 
HETATM 6324 O  O   . HOH H 7 .   ? 19.675  112.740 11.675  1.00 21.29 ? 472 HOH B O   1 
HETATM 6325 O  O   . HOH H 7 .   ? 17.844  99.742  5.006   1.00 40.32 ? 473 HOH B O   1 
HETATM 6326 O  O   . HOH H 7 .   ? 6.752   145.458 -9.970  1.00 18.76 ? 474 HOH B O   1 
HETATM 6327 O  O   . HOH H 7 .   ? 5.130   139.753 -17.594 1.00 29.25 ? 475 HOH B O   1 
HETATM 6328 O  O   . HOH H 7 .   ? 14.077  106.096 9.351   1.00 21.44 ? 476 HOH B O   1 
HETATM 6329 O  O   . HOH H 7 .   ? 24.853  115.818 18.836  1.00 24.20 ? 477 HOH B O   1 
HETATM 6330 O  O   . HOH H 7 .   ? 32.673  126.275 4.542   1.00 16.03 ? 478 HOH B O   1 
HETATM 6331 O  O   . HOH H 7 .   ? 8.833   126.985 -1.726  1.00 18.84 ? 479 HOH B O   1 
HETATM 6332 O  O   . HOH H 7 .   ? 34.050  121.617 11.272  1.00 19.48 ? 480 HOH B O   1 
HETATM 6333 O  O   . HOH H 7 .   ? 32.123  115.753 -6.980  1.00 28.76 ? 481 HOH B O   1 
HETATM 6334 O  O   . HOH H 7 .   ? -6.036  139.881 4.798   1.00 35.24 ? 482 HOH B O   1 
HETATM 6335 O  O   . HOH H 7 .   ? 17.951  132.098 -24.297 1.00 37.57 ? 483 HOH B O   1 
HETATM 6336 O  O   . HOH H 7 .   ? 30.005  127.053 10.963  1.00 19.38 ? 484 HOH B O   1 
HETATM 6337 O  O   . HOH H 7 .   ? 6.990   112.493 14.256  1.00 20.55 ? 485 HOH B O   1 
HETATM 6338 O  O   . HOH H 7 .   ? 1.448   116.358 -17.177 1.00 25.38 ? 486 HOH B O   1 
HETATM 6339 O  O   . HOH H 7 .   ? 31.505  129.594 10.145  1.00 20.34 ? 487 HOH B O   1 
HETATM 6340 O  O   . HOH H 7 .   ? 36.874  125.123 21.151  1.00 34.11 ? 488 HOH B O   1 
HETATM 6341 O  O   . HOH H 7 .   ? 18.775  122.814 19.571  1.00 46.38 ? 489 HOH B O   1 
HETATM 6342 O  O   . HOH H 7 .   ? 20.514  121.218 19.487  1.00 30.46 ? 490 HOH B O   1 
HETATM 6343 O  O   . HOH H 7 .   ? 29.808  122.798 9.920   1.00 26.22 ? 491 HOH B O   1 
HETATM 6344 O  O   . HOH H 7 .   ? 14.535  137.455 -20.026 1.00 41.78 ? 492 HOH B O   1 
HETATM 6345 O  O   . HOH H 7 .   ? 31.880  125.171 11.580  1.00 25.63 ? 493 HOH B O   1 
HETATM 6346 O  O   . HOH H 7 .   ? 29.702  114.901 3.083   1.00 23.61 ? 494 HOH B O   1 
HETATM 6347 O  O   . HOH H 7 .   ? 21.492  114.650 -19.603 1.00 26.75 ? 495 HOH B O   1 
HETATM 6348 O  O   . HOH H 7 .   ? 12.220  133.461 18.898  1.00 37.13 ? 496 HOH B O   1 
HETATM 6349 O  O   . HOH H 7 .   ? 26.519  120.614 11.179  1.00 30.17 ? 497 HOH B O   1 
HETATM 6350 O  O   . HOH H 7 .   ? 33.006  120.641 17.446  1.00 25.65 ? 498 HOH B O   1 
HETATM 6351 O  O   . HOH H 7 .   ? 24.869  111.729 9.322   1.00 29.87 ? 499 HOH B O   1 
HETATM 6352 O  O   . HOH H 7 .   ? 15.362  154.759 -4.292  1.00 45.73 ? 500 HOH B O   1 
HETATM 6353 O  O   . HOH H 7 .   ? 6.778   139.734 -20.783 1.00 34.19 ? 501 HOH B O   1 
HETATM 6354 O  O   . HOH H 7 .   ? 39.802  126.232 22.239  1.00 42.34 ? 502 HOH B O   1 
HETATM 6355 O  O   . HOH H 7 .   ? 39.071  121.851 21.026  1.00 28.07 ? 503 HOH B O   1 
HETATM 6356 O  O   . HOH H 7 .   ? 27.720  132.983 -1.311  1.00 20.51 ? 504 HOH B O   1 
HETATM 6357 O  O   . HOH H 7 .   ? 17.768  134.600 -10.546 1.00 30.71 ? 505 HOH B O   1 
HETATM 6358 O  O   . HOH H 7 .   ? 24.811  127.912 6.009   1.00 15.58 ? 506 HOH B O   1 
HETATM 6359 O  O   . HOH H 7 .   ? 10.819  139.891 2.708   1.00 37.17 ? 507 HOH B O   1 
HETATM 6360 O  O   . HOH H 7 .   ? 26.445  131.043 6.687   1.00 14.91 ? 508 HOH B O   1 
HETATM 6361 O  O   . HOH H 7 .   ? 13.958  142.531 -7.216  1.00 22.67 ? 509 HOH B O   1 
HETATM 6362 O  O   . HOH H 7 .   ? 23.983  131.473 7.665   1.00 27.37 ? 510 HOH B O   1 
HETATM 6363 O  O   . HOH H 7 .   ? 5.365   116.877 7.386   1.00 22.08 ? 511 HOH B O   1 
HETATM 6364 O  O   . HOH H 7 .   ? 27.721  111.538 2.310   1.00 21.05 ? 512 HOH B O   1 
HETATM 6365 O  O   . HOH H 7 .   ? 13.091  114.651 17.955  1.00 26.22 ? 513 HOH B O   1 
HETATM 6366 O  O   . HOH H 7 .   ? 25.969  133.894 4.714   1.00 39.24 ? 514 HOH B O   1 
HETATM 6367 O  O   . HOH H 7 .   ? 23.688  129.900 -10.976 1.00 27.51 ? 515 HOH B O   1 
HETATM 6368 O  O   . HOH H 7 .   ? 22.546  131.752 5.349   1.00 16.10 ? 516 HOH B O   1 
HETATM 6369 O  O   . HOH H 7 .   ? 21.275  117.785 24.528  1.00 33.06 ? 517 HOH B O   1 
HETATM 6370 O  O   . HOH H 7 .   ? 23.174  122.984 28.564  1.00 32.80 ? 518 HOH B O   1 
HETATM 6371 O  O   . HOH H 7 .   ? -4.805  127.633 -20.457 1.00 26.99 ? 519 HOH B O   1 
HETATM 6372 O  O   . HOH H 7 .   ? 22.446  109.349 -14.363 1.00 39.87 ? 520 HOH B O   1 
HETATM 6373 O  O   . HOH H 7 .   ? 34.616  133.648 18.029  1.00 35.29 ? 521 HOH B O   1 
HETATM 6374 O  O   . HOH H 7 .   ? -10.081 120.517 -8.127  1.00 34.60 ? 522 HOH B O   1 
HETATM 6375 O  O   . HOH H 7 .   ? 6.635   147.588 4.584   1.00 57.58 ? 523 HOH B O   1 
HETATM 6376 O  O   . HOH H 7 .   ? 20.236  136.604 -15.586 1.00 29.70 ? 524 HOH B O   1 
HETATM 6377 O  O   . HOH H 7 .   ? -9.230  114.856 -12.573 1.00 47.67 ? 525 HOH B O   1 
HETATM 6378 O  O   . HOH H 7 .   ? 30.254  111.800 0.792   1.00 23.11 ? 526 HOH B O   1 
HETATM 6379 O  O   . HOH H 7 .   ? 13.331  142.964 12.204  1.00 33.52 ? 527 HOH B O   1 
HETATM 6380 O  O   . HOH H 7 .   ? 27.340  111.111 9.736   1.00 36.37 ? 528 HOH B O   1 
HETATM 6381 O  O   . HOH H 7 .   ? 14.791  139.843 -7.410  1.00 40.34 ? 529 HOH B O   1 
HETATM 6382 O  O   . HOH H 7 .   ? 29.786  133.174 1.289   1.00 24.81 ? 530 HOH B O   1 
HETATM 6383 O  O   . HOH H 7 .   ? 16.193  137.054 8.711   1.00 20.95 ? 531 HOH B O   1 
HETATM 6384 O  O   . HOH H 7 .   ? 26.134  114.236 21.033  1.00 21.77 ? 532 HOH B O   1 
HETATM 6385 O  O   . HOH H 7 .   ? 25.540  127.408 -15.326 1.00 25.96 ? 533 HOH B O   1 
HETATM 6386 O  O   . HOH H 7 .   ? 27.929  117.126 11.049  1.00 21.86 ? 534 HOH B O   1 
HETATM 6387 O  O   . HOH H 7 .   ? 9.326   114.634 -19.582 1.00 31.77 ? 535 HOH B O   1 
HETATM 6388 O  O   . HOH H 7 .   ? 38.036  129.502 17.025  1.00 32.32 ? 536 HOH B O   1 
HETATM 6389 O  O   . HOH H 7 .   ? 6.558   107.225 2.759   1.00 44.75 ? 537 HOH B O   1 
HETATM 6390 O  O   . HOH H 7 .   ? 32.811  134.012 20.408  1.00 34.65 ? 538 HOH B O   1 
HETATM 6391 O  O   . HOH H 7 .   ? 33.910  119.462 -6.967  1.00 23.77 ? 539 HOH B O   1 
HETATM 6392 O  O   . HOH H 7 .   ? 28.084  114.594 10.800  1.00 32.55 ? 540 HOH B O   1 
HETATM 6393 O  O   . HOH H 7 .   ? 8.012   130.809 23.587  1.00 29.57 ? 541 HOH B O   1 
HETATM 6394 O  O   . HOH H 7 .   ? 16.579  139.367 -5.417  1.00 42.23 ? 542 HOH B O   1 
HETATM 6395 O  O   . HOH H 7 .   ? 7.918   123.686 24.961  1.00 17.45 ? 543 HOH B O   1 
HETATM 6396 O  O   . HOH H 7 .   ? 24.650  129.640 -16.857 1.00 24.98 ? 544 HOH B O   1 
HETATM 6397 O  O   . HOH H 7 .   ? 17.120  121.997 31.740  1.00 46.38 ? 545 HOH B O   1 
HETATM 6398 O  O   . HOH H 7 .   ? 23.108  117.896 19.960  1.00 20.21 ? 546 HOH B O   1 
HETATM 6399 O  O   . HOH H 7 .   ? -2.340  118.087 -12.745 1.00 28.43 ? 547 HOH B O   1 
HETATM 6400 O  O   . HOH H 7 .   ? 10.463  128.534 28.250  1.00 23.66 ? 548 HOH B O   1 
HETATM 6401 O  O   . HOH H 7 .   ? 1.111   113.816 10.703  1.00 30.67 ? 549 HOH B O   1 
HETATM 6402 O  O   . HOH H 7 .   ? -1.046  139.918 -18.923 1.00 54.96 ? 550 HOH B O   1 
HETATM 6403 O  O   . HOH H 7 .   ? 25.400  116.059 24.484  1.00 39.79 ? 551 HOH B O   1 
HETATM 6404 O  O   . HOH H 7 .   ? 11.243  133.363 27.987  1.00 36.86 ? 552 HOH B O   1 
HETATM 6405 O  O   . HOH H 7 .   ? 25.803  122.505 -16.556 1.00 42.80 ? 553 HOH B O   1 
HETATM 6406 O  O   . HOH H 7 .   ? 18.988  129.831 32.520  1.00 28.85 ? 554 HOH B O   1 
HETATM 6407 O  O   . HOH H 7 .   ? 1.795   120.539 22.206  1.00 24.95 ? 555 HOH B O   1 
HETATM 6408 O  O   . HOH H 7 .   ? -2.355  121.944 4.810   1.00 26.45 ? 556 HOH B O   1 
HETATM 6409 O  O   . HOH H 7 .   ? 4.214   144.111 7.186   1.00 30.03 ? 557 HOH B O   1 
HETATM 6410 O  O   . HOH H 7 .   ? 4.154   126.446 30.453  1.00 24.36 ? 558 HOH B O   1 
HETATM 6411 O  O   . HOH H 7 .   ? 0.701   143.697 -17.406 1.00 32.39 ? 559 HOH B O   1 
HETATM 6412 O  O   . HOH H 7 .   ? -3.687  129.710 -24.690 1.00 36.76 ? 560 HOH B O   1 
HETATM 6413 O  O   . HOH H 7 .   ? 14.337  135.044 -7.956  1.00 36.45 ? 561 HOH B O   1 
HETATM 6414 O  O   . HOH H 7 .   ? -0.808  134.522 19.126  1.00 32.92 ? 562 HOH B O   1 
HETATM 6415 O  O   . HOH H 7 .   ? 23.607  123.638 -19.039 1.00 32.84 ? 563 HOH B O   1 
HETATM 6416 O  O   . HOH H 7 .   ? -13.651 130.825 -8.701  1.00 38.89 ? 564 HOH B O   1 
HETATM 6417 O  O   . HOH H 7 .   ? 5.952   116.822 4.782   1.00 41.55 ? 565 HOH B O   1 
HETATM 6418 O  O   . HOH H 7 .   ? 14.478  130.989 -26.088 1.00 41.24 ? 566 HOH B O   1 
HETATM 6419 O  O   . HOH H 7 .   ? 2.890   142.059 14.107  1.00 28.70 ? 567 HOH B O   1 
HETATM 6420 O  O   . HOH H 7 .   ? 30.557  121.458 16.344  1.00 30.54 ? 568 HOH B O   1 
HETATM 6421 O  O   . HOH H 7 .   ? -5.823  141.411 -13.800 1.00 25.09 ? 569 HOH B O   1 
HETATM 6422 O  O   . HOH H 7 .   ? 4.736   118.753 30.052  1.00 31.64 ? 570 HOH B O   1 
HETATM 6423 O  O   . HOH H 7 .   ? -1.782  106.622 12.599  1.00 45.62 ? 571 HOH B O   1 
HETATM 6424 O  O   . HOH H 7 .   ? 7.123   145.076 5.896   1.00 48.34 ? 572 HOH B O   1 
HETATM 6425 O  O   . HOH H 7 .   ? 4.064   114.071 21.082  1.00 50.57 ? 573 HOH B O   1 
HETATM 6426 O  O   . HOH H 7 .   ? 27.886  133.220 6.646   1.00 38.26 ? 574 HOH B O   1 
HETATM 6427 O  O   . HOH H 7 .   ? 29.547  115.494 -11.864 1.00 28.09 ? 575 HOH B O   1 
HETATM 6428 O  O   . HOH H 7 .   ? 10.704  120.958 34.144  1.00 28.08 ? 576 HOH B O   1 
HETATM 6429 O  O   . HOH H 7 .   ? 2.452   116.898 4.567   1.00 31.39 ? 577 HOH B O   1 
HETATM 6430 O  O   . HOH H 7 .   ? 8.725   109.759 -7.088  1.00 29.69 ? 578 HOH B O   1 
HETATM 6431 O  O   . HOH H 7 .   ? -13.974 128.012 -7.516  1.00 39.49 ? 579 HOH B O   1 
HETATM 6432 O  O   . HOH H 7 .   ? 9.485   124.236 27.225  1.00 21.89 ? 580 HOH B O   1 
HETATM 6433 O  O   . HOH H 7 .   ? -2.138  126.550 12.087  1.00 24.98 ? 581 HOH B O   1 
HETATM 6434 O  O   . HOH H 7 .   ? 27.936  108.813 2.782   1.00 26.18 ? 582 HOH B O   1 
HETATM 6435 O  O   . HOH H 7 .   ? 33.962  118.069 -9.350  1.00 32.27 ? 583 HOH B O   1 
HETATM 6436 O  O   . HOH H 7 .   ? 18.026  128.570 34.939  1.00 26.67 ? 584 HOH B O   1 
HETATM 6437 O  O   . HOH H 7 .   ? 29.171  122.613 -14.774 1.00 37.22 ? 585 HOH B O   1 
HETATM 6438 O  O   . HOH H 7 .   ? -3.326  124.035 3.270   1.00 35.81 ? 586 HOH B O   1 
HETATM 6439 O  O   . HOH H 7 .   ? 29.384  117.454 -9.224  1.00 34.05 ? 587 HOH B O   1 
HETATM 6440 O  O   . HOH H 7 .   ? 13.662  106.484 -9.219  1.00 32.66 ? 588 HOH B O   1 
HETATM 6441 O  O   . HOH H 7 .   ? 31.176  127.897 21.095  1.00 32.93 ? 589 HOH B O   1 
HETATM 6442 O  O   . HOH H 7 .   ? 34.293  125.690 12.973  1.00 35.30 ? 590 HOH B O   1 
HETATM 6443 O  O   . HOH H 7 .   ? 4.754   118.843 23.404  1.00 31.01 ? 591 HOH B O   1 
HETATM 6444 O  O   . HOH H 7 .   ? -6.604  138.449 6.549   1.00 37.20 ? 592 HOH B O   1 
HETATM 6445 O  O   . HOH H 7 .   ? 1.189   136.279 19.170  1.00 25.55 ? 593 HOH B O   1 
HETATM 6446 O  O   . HOH H 7 .   ? 31.496  119.469 20.743  1.00 28.43 ? 594 HOH B O   1 
HETATM 6447 O  O   . HOH H 7 .   ? 28.203  111.958 -11.981 1.00 32.21 ? 595 HOH B O   1 
HETATM 6448 O  O   . HOH H 7 .   ? 18.451  138.011 7.163   1.00 50.91 ? 596 HOH B O   1 
HETATM 6449 O  O   . HOH H 7 .   ? 7.056   112.172 2.582   1.00 42.52 ? 597 HOH B O   1 
HETATM 6450 O  O   . HOH H 7 .   ? 24.840  135.294 9.831   1.00 34.78 ? 598 HOH B O   1 
HETATM 6451 O  O   . HOH H 7 .   ? 22.865  134.863 16.123  1.00 45.82 ? 599 HOH B O   1 
HETATM 6452 O  O   . HOH H 7 .   ? 17.284  122.908 -26.549 1.00 37.39 ? 600 HOH B O   1 
HETATM 6453 O  O   . HOH H 7 .   ? 23.308  122.075 -23.103 1.00 39.42 ? 601 HOH B O   1 
HETATM 6454 O  O   . HOH H 7 .   ? -5.750  125.075 -20.486 1.00 29.02 ? 602 HOH B O   1 
HETATM 6455 O  O   . HOH H 7 .   ? -1.135  116.111 -1.538  1.00 37.16 ? 603 HOH B O   1 
HETATM 6456 O  O   . HOH H 7 .   ? 15.292  135.783 17.877  1.00 47.29 ? 604 HOH B O   1 
HETATM 6457 O  O   . HOH H 7 .   ? 23.101  134.580 -1.481  1.00 39.80 ? 605 HOH B O   1 
HETATM 6458 O  O   . HOH H 7 .   ? 4.011   129.242 27.791  1.00 35.39 ? 606 HOH B O   1 
HETATM 6459 O  O   . HOH H 7 .   ? 15.383  148.104 -1.340  1.00 41.26 ? 607 HOH B O   1 
HETATM 6460 O  O   . HOH H 7 .   ? -3.504  144.636 5.157   1.00 42.03 ? 608 HOH B O   1 
HETATM 6461 O  O   . HOH H 7 .   ? -10.951 121.146 -15.091 1.00 42.46 ? 609 HOH B O   1 
HETATM 6462 O  O   . HOH H 7 .   ? 14.613  134.743 30.997  1.00 34.74 ? 610 HOH B O   1 
HETATM 6463 O  O   . HOH H 7 .   ? 10.049  132.380 21.592  1.00 48.82 ? 611 HOH B O   1 
HETATM 6464 O  O   . HOH H 7 .   ? -9.748  133.374 -14.135 1.00 34.99 ? 612 HOH B O   1 
HETATM 6465 O  O   . HOH H 7 .   ? -0.262  116.218 -12.964 1.00 45.28 ? 613 HOH B O   1 
HETATM 6466 O  O   . HOH H 7 .   ? 21.453  125.450 27.232  1.00 44.10 ? 614 HOH B O   1 
HETATM 6467 O  O   . HOH H 7 .   ? -5.713  131.357 -21.163 1.00 43.64 ? 615 HOH B O   1 
HETATM 6468 O  O   . HOH H 7 .   ? 23.921  116.260 -18.477 1.00 37.67 ? 616 HOH B O   1 
HETATM 6469 O  O   . HOH H 7 .   ? 3.510   113.098 5.536   1.00 45.15 ? 617 HOH B O   1 
HETATM 6470 O  O   . HOH H 7 .   ? -2.725  137.137 -17.934 1.00 38.36 ? 618 HOH B O   1 
HETATM 6471 O  O   . HOH H 7 .   ? 16.328  132.613 32.616  1.00 35.11 ? 619 HOH B O   1 
HETATM 6472 O  O   . HOH H 7 .   ? 24.107  130.051 -19.535 1.00 48.56 ? 620 HOH B O   1 
HETATM 6473 O  O   . HOH H 7 .   ? 20.641  115.261 -22.402 1.00 42.89 ? 621 HOH B O   1 
HETATM 6474 O  O   . HOH H 7 .   ? 12.539  98.983  10.722  1.00 38.04 ? 622 HOH B O   1 
HETATM 6475 O  O   . HOH H 7 .   ? 11.383  112.843 -19.633 1.00 39.59 ? 623 HOH B O   1 
HETATM 6476 O  O   . HOH H 7 .   ? 14.143  116.050 -26.341 1.00 40.81 ? 624 HOH B O   1 
HETATM 6477 O  O   . HOH H 7 .   ? 5.255   114.381 4.051   1.00 39.02 ? 625 HOH B O   1 
HETATM 6478 O  O   . HOH H 7 .   ? 0.954   108.197 16.829  1.00 45.85 ? 626 HOH B O   1 
HETATM 6479 O  O   . HOH H 7 .   ? -8.551  143.812 1.943   1.00 36.43 ? 627 HOH B O   1 
HETATM 6480 O  O   . HOH H 7 .   ? 36.587  131.719 18.504  1.00 39.45 ? 628 HOH B O   1 
HETATM 6481 O  O   . HOH H 7 .   ? 12.076  137.074 -22.442 1.00 49.50 ? 629 HOH B O   1 
HETATM 6482 O  O   . HOH H 7 .   ? 8.021   146.518 -17.772 1.00 44.59 ? 630 HOH B O   1 
HETATM 6483 O  O   . HOH H 7 .   ? 21.707  131.864 -21.480 1.00 33.43 ? 631 HOH B O   1 
HETATM 6484 O  O   . HOH H 7 .   ? 11.262  136.031 20.096  1.00 39.65 ? 632 HOH B O   1 
HETATM 6485 O  O   . HOH H 7 .   ? -4.836  126.443 5.924   1.00 45.16 ? 633 HOH B O   1 
HETATM 6486 O  O   . HOH H 7 .   ? 0.509   111.255 16.562  1.00 38.81 ? 634 HOH B O   1 
HETATM 6487 O  O   . HOH H 7 .   ? 8.062   130.298 26.535  1.00 37.07 ? 635 HOH B O   1 
HETATM 6488 O  O   . HOH H 7 .   ? 20.771  128.045 31.385  1.00 47.21 ? 636 HOH B O   1 
HETATM 6489 O  O   . HOH H 7 .   ? -0.909  130.508 21.105  1.00 36.13 ? 637 HOH B O   1 
HETATM 6490 O  O   . HOH H 7 .   ? 25.130  111.736 -17.020 1.00 44.26 ? 638 HOH B O   1 
HETATM 6491 O  O   . HOH H 7 .   ? 17.556  98.640  1.741   1.00 41.19 ? 639 HOH B O   1 
HETATM 6492 O  O   . HOH H 7 .   ? 19.588  130.283 39.277  1.00 51.80 ? 640 HOH B O   1 
HETATM 6493 O  O   . HOH H 7 .   ? -0.411  134.770 -21.160 1.00 37.69 ? 641 HOH B O   1 
HETATM 6494 O  O   . HOH H 7 .   ? -1.420  120.003 18.832  1.00 37.73 ? 642 HOH B O   1 
HETATM 6495 O  O   . HOH H 7 .   ? -3.170  124.762 15.711  1.00 41.79 ? 643 HOH B O   1 
HETATM 6496 O  O   . HOH H 7 .   ? 20.251  134.386 28.916  1.00 46.51 ? 644 HOH B O   1 
HETATM 6497 O  O   . HOH H 7 .   ? -9.705  145.490 -2.758  1.00 40.55 ? 645 HOH B O   1 
HETATM 6498 O  O   . HOH H 7 .   ? -5.431  130.184 13.121  1.00 44.07 ? 646 HOH B O   1 
HETATM 6499 O  O   . HOH H 7 .   ? 24.393  108.423 -9.336  1.00 38.36 ? 647 HOH B O   1 
HETATM 6500 O  O   . HOH H 7 .   ? 3.780   145.421 9.761   1.00 46.06 ? 648 HOH B O   1 
HETATM 6501 O  O   . HOH H 7 .   ? -6.767  129.981 -19.076 1.00 47.08 ? 649 HOH B O   1 
HETATM 6502 O  O   . HOH H 7 .   ? 14.377  143.071 1.712   1.00 47.76 ? 650 HOH B O   1 
HETATM 6503 O  O   . HOH H 7 .   ? 5.121   128.964 -30.700 1.00 42.23 ? 651 HOH B O   1 
HETATM 6504 O  O   . HOH H 7 .   ? 19.376  141.466 8.787   1.00 35.27 ? 652 HOH B O   1 
HETATM 6505 O  O   . HOH H 7 .   ? 20.494  137.951 -1.726  1.00 50.95 ? 653 HOH B O   1 
HETATM 6506 O  O   . HOH H 7 .   ? 3.621   144.103 12.166  1.00 43.98 ? 654 HOH B O   1 
HETATM 6507 O  O   . HOH H 7 .   ? 26.470  136.103 12.545  1.00 43.11 ? 655 HOH B O   1 
HETATM 6508 O  O   . HOH H 7 .   ? -0.683  115.681 -30.394 1.00 47.55 ? 656 HOH B O   1 
HETATM 6509 O  O   . HOH H 7 .   ? 27.115  105.742 4.557   1.00 44.49 ? 657 HOH B O   1 
HETATM 6510 O  O   . HOH H 7 .   ? -2.129  120.259 12.442  1.00 43.92 ? 658 HOH B O   1 
HETATM 6511 O  O   . HOH H 7 .   ? 15.895  135.976 24.352  1.00 49.79 ? 659 HOH B O   1 
HETATM 6512 O  O   . HOH H 7 .   ? 32.933  121.720 23.953  1.00 50.95 ? 660 HOH B O   1 
HETATM 6513 O  O   . HOH H 7 .   ? 7.300   131.085 -25.236 1.00 26.34 ? 661 HOH B O   1 
HETATM 6514 O  O   . HOH H 7 .   ? 28.584  136.225 20.043  1.00 33.45 ? 662 HOH B O   1 
HETATM 6515 O  O   . HOH H 7 .   ? 25.955  111.284 -12.780 1.00 39.32 ? 663 HOH B O   1 
HETATM 6516 O  O   . HOH H 7 .   ? 16.011  139.845 6.583   1.00 30.32 ? 664 HOH B O   1 
HETATM 6517 O  O   . HOH H 7 .   ? 7.570   104.093 7.100   1.00 43.93 ? 665 HOH B O   1 
HETATM 6518 O  O   . HOH H 7 .   ? 33.316  126.541 21.770  1.00 34.88 ? 666 HOH B O   1 
HETATM 6519 O  O   . HOH H 7 .   ? 24.579  132.400 28.223  1.00 45.95 ? 667 HOH B O   1 
HETATM 6520 O  O   . HOH H 7 .   ? -11.317 119.143 -10.052 1.00 48.61 ? 668 HOH B O   1 
HETATM 6521 O  O   . HOH H 7 .   ? 12.476  132.734 -26.602 1.00 36.79 ? 669 HOH B O   1 
HETATM 6522 O  O   . HOH H 7 .   ? 2.939   116.958 30.792  1.00 46.95 ? 670 HOH B O   1 
HETATM 6523 O  O   . HOH H 7 .   ? 40.351  129.067 20.703  1.00 50.96 ? 671 HOH B O   1 
HETATM 6524 O  O   . HOH H 7 .   ? 4.288   114.341 -5.028  1.00 45.20 ? 672 HOH B O   1 
HETATM 6525 O  O   . HOH H 7 .   ? 19.999  121.591 34.585  1.00 50.27 ? 673 HOH B O   1 
HETATM 6526 O  O   . HOH H 7 .   ? 0.913   130.495 -29.603 1.00 42.68 ? 674 HOH B O   1 
HETATM 6527 O  O   . HOH H 7 .   ? 41.254  118.506 20.188  1.00 48.66 ? 675 HOH B O   1 
HETATM 6528 O  O   . HOH H 7 .   ? 19.758  135.726 5.421   1.00 42.88 ? 676 HOH B O   1 
HETATM 6529 O  O   . HOH H 7 .   ? 28.193  121.229 1.891   1.00 15.82 ? 677 HOH B O   1 
HETATM 6530 O  O   . HOH H 7 .   ? 13.349  110.691 6.892   1.00 17.58 ? 678 HOH B O   1 
HETATM 6531 O  O   . HOH H 7 .   ? -13.481 139.631 1.429   1.00 50.72 ? 679 HOH B O   1 
HETATM 6532 O  O   . HOH H 7 .   ? 14.149  134.933 21.980  1.00 44.02 ? 680 HOH B O   1 
HETATM 6533 O  O   . HOH H 7 .   ? -4.155  108.733 13.251  1.00 59.28 ? 681 HOH B O   1 
HETATM 6534 O  O   . HOH H 7 .   ? -5.767  129.926 5.063   1.00 50.09 ? 682 HOH B O   1 
HETATM 6535 O  O   . HOH H 7 .   ? -2.433  143.671 10.239  1.00 34.45 ? 683 HOH B O   1 
HETATM 6536 O  O   . HOH H 7 .   ? 12.495  111.295 -16.676 1.00 44.99 ? 684 HOH B O   1 
HETATM 6537 O  O   . HOH H 7 .   ? 12.172  108.536 8.127   1.00 23.77 ? 685 HOH B O   1 
HETATM 6538 O  O   . HOH H 7 .   ? 15.394  132.398 -7.077  1.00 38.56 ? 686 HOH B O   1 
HETATM 6539 O  O   . HOH H 7 .   ? 22.902  134.071 3.895   1.00 43.85 ? 687 HOH B O   1 
HETATM 6540 O  O   . HOH H 7 .   ? -0.581  114.681 -3.936  1.00 41.53 ? 688 HOH B O   1 
HETATM 6541 O  O   . HOH H 7 .   ? -3.531  124.553 12.191  1.00 45.85 ? 689 HOH B O   1 
HETATM 6542 O  O   . HOH H 7 .   ? 20.887  105.070 -3.799  1.00 35.86 ? 690 HOH B O   1 
HETATM 6543 O  O   . HOH H 7 .   ? 2.735   115.287 6.747   1.00 45.35 ? 691 HOH B O   1 
HETATM 6544 O  O   . HOH H 7 .   ? 30.676  123.378 13.129  1.00 45.98 ? 692 HOH B O   1 
HETATM 6545 O  O   . HOH H 7 .   ? 38.665  119.553 21.953  1.00 41.63 ? 693 HOH B O   1 
HETATM 6546 O  O   . HOH H 7 .   ? 17.041  101.334 0.723   1.00 40.44 ? 694 HOH B O   1 
HETATM 6547 O  O   . HOH H 7 .   ? 13.175  143.726 8.459   1.00 42.62 ? 695 HOH B O   1 
HETATM 6548 O  O   . HOH H 7 .   ? 29.454  119.759 14.782  1.00 35.74 ? 696 HOH B O   1 
HETATM 6549 O  O   . HOH H 7 .   ? -7.940  141.584 5.372   1.00 55.06 ? 697 HOH B O   1 
HETATM 6550 O  O   . HOH H 7 .   ? -1.080  138.071 -21.107 1.00 50.32 ? 698 HOH B O   1 
HETATM 6551 O  O   . HOH H 7 .   ? 1.840   114.064 -4.275  1.00 50.24 ? 699 HOH B O   1 
HETATM 6552 O  O   . HOH H 7 .   ? 23.196  134.140 29.620  1.00 44.58 ? 700 HOH B O   1 
HETATM 6553 O  O   . HOH H 7 .   ? -5.168  133.661 -19.331 1.00 53.76 ? 701 HOH B O   1 
HETATM 6554 O  O   . HOH H 7 .   ? -9.085  130.732 -1.078  1.00 45.49 ? 702 HOH B O   1 
HETATM 6555 O  O   . HOH H 7 .   ? 5.509   145.388 13.253  1.00 50.80 ? 703 HOH B O   1 
HETATM 6556 O  O   . HOH H 7 .   ? 29.733  115.541 -14.470 1.00 44.31 ? 704 HOH B O   1 
HETATM 6557 O  O   . HOH H 7 .   ? 10.140  144.706 8.642   1.00 43.50 ? 705 HOH B O   1 
HETATM 6558 O  O   . HOH H 7 .   ? 14.246  117.975 -24.624 1.00 49.00 ? 706 HOH B O   1 
HETATM 6559 O  O   . HOH H 7 .   ? 11.679  136.867 -8.904  1.00 51.80 ? 707 HOH B O   1 
HETATM 6560 O  O   . HOH H 7 .   ? 30.890  123.903 26.603  1.00 46.07 ? 708 HOH B O   1 
HETATM 6561 O  O   . HOH H 7 .   ? 5.534   112.093 -8.117  1.00 51.07 ? 709 HOH B O   1 
HETATM 6562 O  O   . HOH H 7 .   ? 14.847  142.654 5.230   1.00 46.42 ? 710 HOH B O   1 
HETATM 6563 O  O   . HOH H 7 .   ? 43.574  119.981 20.837  1.00 52.97 ? 711 HOH B O   1 
HETATM 6564 O  O   . HOH H 7 .   ? 16.125  141.901 0.022   1.00 54.22 ? 712 HOH B O   1 
HETATM 6565 O  O   . HOH H 7 .   ? 29.039  134.864 4.031   1.00 57.02 ? 713 HOH B O   1 
HETATM 6566 O  O   . HOH H 7 .   ? 8.760   135.526 20.454  1.00 45.52 ? 714 HOH B O   1 
HETATM 6567 O  O   . HOH H 7 .   ? 18.722  139.993 5.316   1.00 56.13 ? 715 HOH B O   1 
HETATM 6568 O  O   . HOH H 7 .   ? 17.744  141.557 -4.113  1.00 52.43 ? 716 HOH B O   1 
HETATM 6569 O  O   . HOH H 7 .   ? 22.644  105.411 -8.283  1.00 52.45 ? 717 HOH B O   1 
HETATM 6570 O  O   . HOH H 7 .   ? 10.094  111.039 -15.711 1.00 53.24 ? 718 HOH B O   1 
HETATM 6571 O  O   . HOH H 7 .   ? 23.301  134.419 7.348   1.00 55.58 ? 719 HOH B O   1 
HETATM 6572 O  O   . HOH H 7 .   ? -2.611  119.049 16.640  1.00 55.59 ? 720 HOH B O   1 
HETATM 6573 O  O   . HOH H 7 .   ? 13.645  104.895 -11.928 1.00 48.09 ? 721 HOH B O   1 
HETATM 6574 O  O   . HOH H 7 .   ? 2.248   112.294 20.698  1.00 54.12 ? 722 HOH B O   1 
HETATM 6575 O  O   . HOH H 7 .   ? 10.264  96.103  8.556   1.00 55.32 ? 723 HOH B O   1 
HETATM 6576 O  O   . HOH H 7 .   ? 9.978   117.237 26.720  1.00 53.89 ? 724 HOH B O   1 
HETATM 6577 O  O   . HOH H 7 .   ? 18.618  113.762 29.577  1.00 57.87 ? 725 HOH B O   1 
HETATM 6578 O  O   . HOH H 7 .   ? -12.143 122.813 -7.572  1.00 58.59 ? 726 HOH B O   1 
HETATM 6579 O  O   . HOH H 7 .   ? 13.765  136.915 -10.367 1.00 35.53 ? 727 HOH B O   1 
HETATM 6580 O  O   . HOH H 7 .   ? 28.158  122.263 14.036  1.00 41.86 ? 728 HOH B O   1 
HETATM 6581 O  O   . HOH H 7 .   ? 29.022  117.381 13.575  1.00 47.96 ? 729 HOH B O   1 
HETATM 6582 O  O   . HOH H 7 .   ? 4.606   145.943 5.337   1.00 46.92 ? 730 HOH B O   1 
HETATM 6583 O  O   . HOH H 7 .   ? 1.923   115.143 2.174   1.00 43.91 ? 731 HOH B O   1 
HETATM 6584 O  O   . HOH H 7 .   ? 20.970  114.324 25.276  1.00 47.83 ? 732 HOH B O   1 
HETATM 6585 O  O   . HOH H 7 .   ? 31.299  130.455 21.604  1.00 40.78 ? 733 HOH B O   1 
HETATM 6586 O  O   . HOH H 7 .   ? 0.261   132.897 20.697  1.00 47.81 ? 734 HOH B O   1 
HETATM 6587 O  O   . HOH H 7 .   ? 25.274  136.269 14.951  1.00 51.12 ? 735 HOH B O   1 
HETATM 6588 O  O   . HOH H 7 .   ? 31.810  116.487 -9.354  1.00 45.90 ? 736 HOH B O   1 
HETATM 6589 O  O   . HOH H 7 .   ? -4.252  141.482 3.751   1.00 43.76 ? 737 HOH B O   1 
HETATM 6590 O  O   . HOH H 7 .   ? 1.577   114.206 -18.750 1.00 47.84 ? 738 HOH B O   1 
HETATM 6591 O  O   . HOH H 7 .   ? 2.518   141.762 -20.351 1.00 50.67 ? 739 HOH B O   1 
HETATM 6592 O  O   . HOH H 7 .   ? 15.420  151.016 -0.856  1.00 48.72 ? 740 HOH B O   1 
HETATM 6593 O  O   . HOH H 7 .   ? 11.594  111.334 19.776  1.00 47.39 ? 741 HOH B O   1 
HETATM 6594 O  O   . HOH H 7 .   ? 25.764  122.211 31.634  1.00 50.06 ? 742 HOH B O   1 
HETATM 6595 O  O   . HOH H 7 .   ? 20.699  126.064 29.686  1.00 51.97 ? 743 HOH B O   1 
HETATM 6596 O  O   . HOH H 7 .   ? 26.577  105.938 -7.318  1.00 54.71 ? 744 HOH B O   1 
HETATM 6597 O  O   . HOH H 7 .   ? -12.101 125.386 -6.818  1.00 46.91 ? 745 HOH B O   1 
HETATM 6598 O  O   . HOH H 7 .   ? 8.540   112.866 -17.195 1.00 49.10 ? 746 HOH B O   1 
HETATM 6599 O  O   . HOH H 7 .   ? 15.452  121.008 34.614  1.00 47.01 ? 747 HOH B O   1 
HETATM 6600 O  O   . HOH H 7 .   ? 9.442   118.724 34.779  1.00 42.26 ? 748 HOH B O   1 
HETATM 6601 O  O   . HOH H 7 .   ? -1.362  113.585 -18.096 1.00 43.38 ? 749 HOH B O   1 
HETATM 6602 O  O   . HOH H 7 .   ? 10.021  131.136 28.776  1.00 47.03 ? 750 HOH B O   1 
HETATM 6603 O  O   . HOH H 7 .   ? 2.278   116.441 19.775  1.00 45.56 ? 751 HOH B O   1 
HETATM 6604 O  O   . HOH H 7 .   ? 7.596   111.207 19.629  1.00 43.72 ? 752 HOH B O   1 
HETATM 6605 O  O   . HOH H 7 .   ? 6.690   117.346 29.185  1.00 40.77 ? 753 HOH B O   1 
HETATM 6606 O  O   . HOH H 7 .   ? 0.417   124.459 4.217   1.00 46.89 ? 754 HOH B O   1 
HETATM 6607 O  O   . HOH H 7 .   ? 12.623  134.985 26.418  1.00 49.12 ? 755 HOH B O   1 
HETATM 6608 O  O   . HOH H 7 .   ? 16.875  131.215 37.242  1.00 45.50 ? 756 HOH B O   1 
HETATM 6609 O  O   . HOH H 7 .   ? 6.322   112.801 -14.173 1.00 45.39 ? 757 HOH B O   1 
HETATM 6610 O  O   . HOH H 7 .   ? 3.568   113.987 -13.883 1.00 49.49 ? 758 HOH B O   1 
HETATM 6611 O  O   . HOH H 7 .   ? 10.714  100.617 11.553  1.00 48.96 ? 759 HOH B O   1 
HETATM 6612 O  O   . HOH H 7 .   ? 7.271   137.009 18.286  1.00 48.40 ? 760 HOH B O   1 
HETATM 6613 O  O   . HOH H 7 .   ? -2.208  108.349 15.032  1.00 54.23 ? 761 HOH B O   1 
HETATM 6614 O  O   . HOH H 7 .   ? 17.828  140.324 -1.057  1.00 55.86 ? 762 HOH B O   1 
HETATM 6615 O  O   . HOH H 7 .   ? 22.885  104.346 -2.228  1.00 51.91 ? 763 HOH B O   1 
HETATM 6616 O  O   . HOH H 7 .   ? -6.779  129.352 0.362   1.00 52.76 ? 764 HOH B O   1 
HETATM 6617 O  O   . HOH H 7 .   ? 33.528  131.593 22.275  1.00 49.06 ? 765 HOH B O   1 
HETATM 6618 O  O   . HOH H 7 .   ? 29.769  109.778 -10.939 1.00 51.15 ? 766 HOH B O   1 
HETATM 6619 O  O   . HOH H 7 .   ? 32.152  112.642 -13.025 1.00 48.08 ? 767 HOH B O   1 
HETATM 6620 O  O   . HOH H 7 .   ? 19.709  115.418 31.279  1.00 51.84 ? 768 HOH B O   1 
HETATM 6621 O  O   . HOH H 7 .   ? 1.329   134.168 23.145  1.00 47.66 ? 769 HOH B O   1 
HETATM 6622 O  O   . HOH H 7 .   ? -9.707  142.440 3.942   1.00 49.41 ? 770 HOH B O   1 
HETATM 6623 O  O   . HOH H 7 .   ? 1.555   115.647 -14.613 1.00 48.62 ? 771 HOH B O   1 
HETATM 6624 O  O   . HOH H 7 .   ? 3.238   141.405 -17.823 1.00 40.45 ? 772 HOH B O   1 
HETATM 6625 O  O   . HOH H 7 .   ? 13.489  120.332 32.890  1.00 44.13 ? 773 HOH B O   1 
HETATM 6626 O  O   . HOH H 7 .   ? 0.677   111.466 18.990  1.00 51.44 ? 774 HOH B O   1 
HETATM 6627 O  O   . HOH H 7 .   ? -1.269  109.349 17.089  1.00 52.16 ? 775 HOH B O   1 
HETATM 6628 O  O   . HOH H 7 .   ? 23.895  128.131 -21.304 1.00 48.87 ? 776 HOH B O   1 
HETATM 6629 O  O   . HOH H 7 .   ? 7.674   133.478 22.083  1.00 42.27 ? 777 HOH B O   1 
HETATM 6630 O  O   . HOH H 7 .   ? 14.805  121.357 30.237  1.00 36.34 ? 778 HOH B O   1 
HETATM 6631 O  O   . HOH H 7 .   ? 16.035  111.571 -18.814 1.00 42.26 ? 779 HOH B O   1 
HETATM 6632 O  O   . HOH H 7 .   ? 9.784   132.115 -24.837 1.00 32.40 ? 780 HOH B O   1 
HETATM 6633 O  O   . HOH H 7 .   ? 44.874  129.412 16.399  1.00 47.21 ? 781 HOH B O   1 
HETATM 6634 O  O   . HOH H 7 .   ? -11.526 132.817 -2.379  1.00 43.94 ? 782 HOH B O   1 
HETATM 6635 O  O   . HOH H 7 .   ? 0.759   143.025 16.018  1.00 44.42 ? 783 HOH B O   1 
HETATM 6636 O  O   . HOH H 7 .   ? 29.283  112.875 -14.250 1.00 50.04 ? 784 HOH B O   1 
HETATM 6637 O  O   . HOH H 7 .   ? 6.970   109.743 3.648   1.00 51.64 ? 785 HOH B O   1 
HETATM 6638 O  O   . HOH H 7 .   ? -11.906 134.283 -4.588  1.00 44.32 ? 786 HOH B O   1 
HETATM 6639 O  O   . HOH H 7 .   ? -10.042 133.603 -6.375  1.00 32.87 ? 787 HOH B O   1 
HETATM 6640 O  O   . HOH H 7 .   ? 26.262  132.596 26.137  1.00 41.29 ? 788 HOH B O   1 
HETATM 6641 O  O   . HOH H 7 .   ? 2.580   117.396 25.340  1.00 45.82 ? 789 HOH B O   1 
HETATM 6642 O  O   . HOH H 7 .   ? -6.414  130.145 -23.396 1.00 42.89 ? 790 HOH B O   1 
HETATM 6643 O  O   . HOH H 7 .   ? 5.101   113.121 -0.113  1.00 51.84 ? 791 HOH B O   1 
HETATM 6644 O  O   . HOH H 7 .   ? 12.366  142.632 4.561   1.00 53.22 ? 792 HOH B O   1 
HETATM 6645 O  O   . HOH H 7 .   ? 4.987   114.978 -7.351  1.00 44.60 ? 793 HOH B O   1 
HETATM 6646 O  O   . HOH H 7 .   ? 16.140  119.173 29.363  1.00 47.07 ? 794 HOH B O   1 
HETATM 6647 O  O   . HOH H 7 .   ? 33.263  119.270 24.968  1.00 53.18 ? 795 HOH B O   1 
HETATM 6648 O  O   . HOH H 7 .   ? -6.114  144.586 4.965   1.00 57.01 ? 796 HOH B O   1 
HETATM 6649 O  O   . HOH H 7 .   ? 24.031  104.129 -4.709  1.00 58.53 ? 797 HOH B O   1 
HETATM 6650 O  O   . HOH H 7 .   ? -14.197 137.385 2.810   1.00 51.84 ? 798 HOH B O   1 
HETATM 6651 O  O   . HOH H 7 .   ? -0.187  118.957 21.206  1.00 53.87 ? 799 HOH B O   1 
HETATM 6652 O  O   . HOH H 7 .   ? -1.846  142.587 -18.677 1.00 52.32 ? 800 HOH B O   1 
HETATM 6653 O  O   . HOH H 7 .   ? -0.543  112.891 -20.575 1.00 50.41 ? 801 HOH B O   1 
HETATM 6654 O  O   . HOH H 7 .   ? 0.724   114.789 8.417   1.00 49.19 ? 802 HOH B O   1 
HETATM 6655 O  O   . HOH H 7 .   ? 17.260  118.872 31.880  1.00 53.56 ? 803 HOH B O   1 
HETATM 6656 O  O   . HOH H 7 .   ? 28.301  130.719 26.597  1.00 48.40 ? 804 HOH B O   1 
HETATM 6657 O  O   . HOH H 7 .   ? -11.103 118.623 -6.084  1.00 53.37 ? 805 HOH B O   1 
HETATM 6658 O  O   . HOH H 7 .   ? 1.256   111.571 4.939   1.00 58.50 ? 806 HOH B O   1 
HETATM 6659 O  O   . HOH H 7 .   ? 30.466  132.878 7.375   1.00 49.43 ? 807 HOH B O   1 
HETATM 6660 O  O   . HOH H 7 .   ? 18.818  134.136 31.184  1.00 52.98 ? 808 HOH B O   1 
HETATM 6661 O  O   . HOH H 7 .   ? 19.744  125.276 37.224  1.00 47.36 ? 809 HOH B O   1 
HETATM 6662 O  O   . HOH H 7 .   ? 7.640   137.546 21.937  1.00 57.99 ? 810 HOH B O   1 
HETATM 6663 O  O   . HOH H 7 .   ? 13.469  117.361 33.425  1.00 48.89 ? 811 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   ALA 2   2   ?   ?   ?   A . n 
A 1 3   ALA 3   3   ?   ?   ?   A . n 
A 1 4   THR 4   4   ?   ?   ?   A . n 
A 1 5   GLU 5   5   ?   ?   ?   A . n 
A 1 6   GLY 6   6   ?   ?   ?   A . n 
A 1 7   VAL 7   7   ?   ?   ?   A . n 
A 1 8   GLY 8   8   ?   ?   ?   A . n 
A 1 9   GLU 9   9   ?   ?   ?   A . n 
A 1 10  ALA 10  10  ?   ?   ?   A . n 
A 1 11  ALA 11  11  ?   ?   ?   A . n 
A 1 12  GLN 12  12  ?   ?   ?   A . n 
A 1 13  GLY 13  13  ?   ?   ?   A . n 
A 1 14  GLY 14  14  ?   ?   ?   A . n 
A 1 15  GLU 15  15  ?   ?   ?   A . n 
A 1 16  PRO 16  16  ?   ?   ?   A . n 
A 1 17  GLY 17  17  ?   ?   ?   A . n 
A 1 18  GLN 18  18  ?   ?   ?   A . n 
A 1 19  PRO 19  19  ?   ?   ?   A . n 
A 1 20  ALA 20  20  ?   ?   ?   A . n 
A 1 21  GLN 21  21  ?   ?   ?   A . n 
A 1 22  PRO 22  22  ?   ?   ?   A . n 
A 1 23  PRO 23  23  ?   ?   ?   A . n 
A 1 24  PRO 24  24  ?   ?   ?   A . n 
A 1 25  GLN 25  25  ?   ?   ?   A . n 
A 1 26  PRO 26  26  ?   ?   ?   A . n 
A 1 27  HIS 27  27  ?   ?   ?   A . n 
A 1 28  PRO 28  28  ?   ?   ?   A . n 
A 1 29  PRO 29  29  ?   ?   ?   A . n 
A 1 30  PRO 30  30  ?   ?   ?   A . n 
A 1 31  PRO 31  31  ?   ?   ?   A . n 
A 1 32  GLN 32  32  ?   ?   ?   A . n 
A 1 33  GLN 33  33  ?   ?   ?   A . n 
A 1 34  GLN 34  34  ?   ?   ?   A . n 
A 1 35  HIS 35  35  ?   ?   ?   A . n 
A 1 36  LYS 36  36  ?   ?   ?   A . n 
A 1 37  GLU 37  37  ?   ?   ?   A . n 
A 1 38  GLU 38  38  ?   ?   ?   A . n 
A 1 39  MET 39  39  ?   ?   ?   A . n 
A 1 40  ALA 40  40  ?   ?   ?   A . n 
A 1 41  ALA 41  41  ?   ?   ?   A . n 
A 1 42  GLU 42  42  ?   ?   ?   A . n 
A 1 43  ALA 43  43  ?   ?   ?   A . n 
A 1 44  GLY 44  44  ?   ?   ?   A . n 
A 1 45  GLU 45  45  ?   ?   ?   A . n 
A 1 46  ALA 46  46  ?   ?   ?   A . n 
A 1 47  VAL 47  47  ?   ?   ?   A . n 
A 1 48  ALA 48  48  ?   ?   ?   A . n 
A 1 49  SER 49  49  ?   ?   ?   A . n 
A 1 50  PRO 50  50  ?   ?   ?   A . n 
A 1 51  MET 51  51  ?   ?   ?   A . n 
A 1 52  ASP 52  52  ?   ?   ?   A . n 
A 1 53  ASP 53  53  ?   ?   ?   A . n 
A 1 54  GLY 54  54  ?   ?   ?   A . n 
A 1 55  PHE 55  55  55  PHE PHE A . n 
A 1 56  VAL 56  56  56  VAL VAL A . n 
A 1 57  SER 57  57  57  SER SER A . n 
A 1 58  LEU 58  58  58  LEU LEU A . n 
A 1 59  ASP 59  59  59  ASP ASP A . n 
A 1 60  SER 60  60  60  SER SER A . n 
A 1 61  PRO 61  61  61  PRO PRO A . n 
A 1 62  SER 62  62  62  SER SER A . n 
A 1 63  TYR 63  63  63  TYR TYR A . n 
A 1 64  VAL 64  64  64  VAL VAL A . n 
A 1 65  LEU 65  65  65  LEU LEU A . n 
A 1 66  TYR 66  66  66  TYR TYR A . n 
A 1 67  ARG 67  67  67  ARG ARG A . n 
A 1 68  ASP 68  68  68  ASP ASP A . n 
A 1 69  ARG 69  69  69  ARG ARG A . n 
A 1 70  ALA 70  70  70  ALA ALA A . n 
A 1 71  GLU 71  71  71  GLU GLU A . n 
A 1 72  TRP 72  72  72  TRP TRP A . n 
A 1 73  ALA 73  73  73  ALA ALA A . n 
A 1 74  ASP 74  74  74  ASP ASP A . n 
A 1 75  ILE 75  75  75  ILE ILE A . n 
A 1 76  ASP 76  76  76  ASP ASP A . n 
A 1 77  PRO 77  77  77  PRO PRO A . n 
A 1 78  VAL 78  78  78  VAL VAL A . n 
A 1 79  PRO 79  79  79  PRO PRO A . n 
A 1 80  GLN 80  80  80  GLN GLN A . n 
A 1 81  ASN 81  81  81  ASN ASN A . n 
A 1 82  ASP 82  82  82  ASP ASP A . n 
A 1 83  GLY 83  83  83  GLY GLY A . n 
A 1 84  PRO 84  84  84  PRO PRO A . n 
A 1 85  ASN 85  85  85  ASN ASN A . n 
A 1 86  PRO 86  86  86  PRO PRO A . n 
A 1 87  VAL 87  87  87  VAL VAL A . n 
A 1 88  VAL 88  88  88  VAL VAL A . n 
A 1 89  GLN 89  89  89  GLN GLN A . n 
A 1 90  ILE 90  90  90  ILE ILE A . n 
A 1 91  ILE 91  91  91  ILE ILE A . n 
A 1 92  TYR 92  92  92  TYR TYR A . n 
A 1 93  SER 93  93  93  SER SER A . n 
A 1 94  ASP 94  94  94  ASP ASP A . n 
A 1 95  LYS 95  95  95  LYS LYS A . n 
A 1 96  PHE 96  96  96  PHE PHE A . n 
A 1 97  ARG 97  97  97  ARG ARG A . n 
A 1 98  ASP 98  98  98  ASP ASP A . n 
A 1 99  VAL 99  99  99  VAL VAL A . n 
A 1 100 TYR 100 100 100 TYR TYR A . n 
A 1 101 ASP 101 101 101 ASP ASP A . n 
A 1 102 TYR 102 102 102 TYR TYR A . n 
A 1 103 PHE 103 103 103 PHE PHE A . n 
A 1 104 ARG 104 104 104 ARG ARG A . n 
A 1 105 ALA 105 105 105 ALA ALA A . n 
A 1 106 VAL 106 106 106 VAL VAL A . n 
A 1 107 LEU 107 107 107 LEU LEU A . n 
A 1 108 GLN 108 108 108 GLN GLN A . n 
A 1 109 ARG 109 109 109 ARG ARG A . n 
A 1 110 ASP 110 110 110 ASP ASP A . n 
A 1 111 GLU 111 111 111 GLU GLU A . n 
A 1 112 ARG 112 112 112 ARG ARG A . n 
A 1 113 SER 113 113 113 SER SER A . n 
A 1 114 GLU 114 114 114 GLU GLU A . n 
A 1 115 ARG 115 115 115 ARG ARG A . n 
A 1 116 ALA 116 116 116 ALA ALA A . n 
A 1 117 PHE 117 117 117 PHE PHE A . n 
A 1 118 LYS 118 118 118 LYS LYS A . n 
A 1 119 LEU 119 119 119 LEU LEU A . n 
A 1 120 THR 120 120 120 THR THR A . n 
A 1 121 ARG 121 121 121 ARG ARG A . n 
A 1 122 ASP 122 122 122 ASP ASP A . n 
A 1 123 ALA 123 123 123 ALA ALA A . n 
A 1 124 ILE 124 124 124 ILE ILE A . n 
A 1 125 GLU 125 125 125 GLU GLU A . n 
A 1 126 LEU 126 126 126 LEU LEU A . n 
A 1 127 ASN 127 127 127 ASN ASN A . n 
A 1 128 ALA 128 128 128 ALA ALA A . n 
A 1 129 ALA 129 129 129 ALA ALA A . n 
A 1 130 ASN 130 130 130 ASN ASN A . n 
A 1 131 TYR 131 131 131 TYR TYR A . n 
A 1 132 THR 132 132 132 THR THR A . n 
A 1 133 VAL 133 133 133 VAL VAL A . n 
A 1 134 TRP 134 134 134 TRP TRP A . n 
A 1 135 HIS 135 135 135 HIS HIS A . n 
A 1 136 PHE 136 136 136 PHE PHE A . n 
A 1 137 ARG 137 137 137 ARG ARG A . n 
A 1 138 ARG 138 138 138 ARG ARG A . n 
A 1 139 VAL 139 139 139 VAL VAL A . n 
A 1 140 LEU 140 140 140 LEU LEU A . n 
A 1 141 LEU 141 141 141 LEU LEU A . n 
A 1 142 LYS 142 142 142 LYS LYS A . n 
A 1 143 SER 143 143 143 SER SER A . n 
A 1 144 LEU 144 144 144 LEU LEU A . n 
A 1 145 GLN 145 145 145 GLN GLN A . n 
A 1 146 LYS 146 146 146 LYS LYS A . n 
A 1 147 ASP 147 147 147 ASP ASP A . n 
A 1 148 LEU 148 148 148 LEU LEU A . n 
A 1 149 HIS 149 149 149 HIS HIS A . n 
A 1 150 GLU 150 150 150 GLU GLU A . n 
A 1 151 GLU 151 151 151 GLU GLU A . n 
A 1 152 MET 152 152 152 MET MET A . n 
A 1 153 ASN 153 153 153 ASN ASN A . n 
A 1 154 TYR 154 154 154 TYR TYR A . n 
A 1 155 ILE 155 155 155 ILE ILE A . n 
A 1 156 THR 156 156 156 THR THR A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 ILE 158 158 158 ILE ILE A . n 
A 1 159 ILE 159 159 159 ILE ILE A . n 
A 1 160 GLU 160 160 160 GLU GLU A . n 
A 1 161 GLU 161 161 161 GLU GLU A . n 
A 1 162 GLN 162 162 162 GLN GLN A . n 
A 1 163 PRO 163 163 163 PRO PRO A . n 
A 1 164 LYS 164 164 164 LYS LYS A . n 
A 1 165 ASN 165 165 165 ASN ASN A . n 
A 1 166 TYR 166 166 166 TYR TYR A . n 
A 1 167 GLN 167 167 167 GLN GLN A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 TRP 169 169 169 TRP TRP A . n 
A 1 170 HIS 170 170 170 HIS HIS A . n 
A 1 171 HIS 171 171 171 HIS HIS A . n 
A 1 172 ARG 172 172 172 ARG ARG A . n 
A 1 173 ARG 173 173 173 ARG ARG A . n 
A 1 174 VAL 174 174 174 VAL VAL A . n 
A 1 175 LEU 175 175 175 LEU LEU A . n 
A 1 176 VAL 176 176 176 VAL VAL A . n 
A 1 177 GLU 177 177 177 GLU GLU A . n 
A 1 178 TRP 178 178 178 TRP TRP A . n 
A 1 179 LEU 179 179 179 LEU LEU A . n 
A 1 180 ARG 180 180 180 ARG ARG A . n 
A 1 181 ASP 181 181 181 ASP ASP A . n 
A 1 182 PRO 182 182 182 PRO PRO A . n 
A 1 183 SER 183 183 183 SER SER A . n 
A 1 184 GLN 184 184 184 GLN GLN A . n 
A 1 185 GLU 185 185 185 GLU GLU A . n 
A 1 186 LEU 186 186 186 LEU LEU A . n 
A 1 187 GLU 187 187 187 GLU GLU A . n 
A 1 188 PHE 188 188 188 PHE PHE A . n 
A 1 189 ILE 189 189 189 ILE ILE A . n 
A 1 190 ALA 190 190 190 ALA ALA A . n 
A 1 191 ASP 191 191 191 ASP ASP A . n 
A 1 192 ILE 192 192 192 ILE ILE A . n 
A 1 193 LEU 193 193 193 LEU LEU A . n 
A 1 194 ASN 194 194 194 ASN ASN A . n 
A 1 195 GLN 195 195 195 GLN GLN A . n 
A 1 196 ASP 196 196 196 ASP ASP A . n 
A 1 197 ALA 197 197 197 ALA ALA A . n 
A 1 198 LYS 198 198 198 LYS LYS A . n 
A 1 199 ASN 199 199 199 ASN ASN A . n 
A 1 200 TYR 200 200 200 TYR TYR A . n 
A 1 201 HIS 201 201 201 HIS HIS A . n 
A 1 202 ALA 202 202 202 ALA ALA A . n 
A 1 203 TRP 203 203 203 TRP TRP A . n 
A 1 204 GLN 204 204 204 GLN GLN A . n 
A 1 205 HIS 205 205 205 HIS HIS A . n 
A 1 206 ARG 206 206 206 ARG ARG A . n 
A 1 207 GLN 207 207 207 GLN GLN A . n 
A 1 208 TRP 208 208 208 TRP TRP A . n 
A 1 209 VAL 209 209 209 VAL VAL A . n 
A 1 210 ILE 210 210 210 ILE ILE A . n 
A 1 211 GLN 211 211 211 GLN GLN A . n 
A 1 212 GLU 212 212 212 GLU GLU A . n 
A 1 213 PHE 213 213 213 PHE PHE A . n 
A 1 214 LYS 214 214 214 LYS LYS A . n 
A 1 215 LEU 215 215 215 LEU LEU A . n 
A 1 216 TRP 216 216 216 TRP TRP A . n 
A 1 217 ASP 217 217 217 ASP ASP A . n 
A 1 218 ASN 218 218 218 ASN ASN A . n 
A 1 219 GLU 219 219 219 GLU GLU A . n 
A 1 220 LEU 220 220 220 LEU LEU A . n 
A 1 221 GLN 221 221 221 GLN GLN A . n 
A 1 222 TYR 222 222 222 TYR TYR A . n 
A 1 223 VAL 223 223 223 VAL VAL A . n 
A 1 224 ASP 224 224 224 ASP ASP A . n 
A 1 225 GLN 225 225 225 GLN GLN A . n 
A 1 226 LEU 226 226 226 LEU LEU A . n 
A 1 227 LEU 227 227 227 LEU LEU A . n 
A 1 228 LYS 228 228 228 LYS LYS A . n 
A 1 229 GLU 229 229 229 GLU GLU A . n 
A 1 230 ASP 230 230 230 ASP ASP A . n 
A 1 231 VAL 231 231 231 VAL VAL A . n 
A 1 232 ARG 232 232 232 ARG ARG A . n 
A 1 233 ASN 233 233 233 ASN ASN A . n 
A 1 234 ASN 234 234 234 ASN ASN A . n 
A 1 235 SER 235 235 235 SER SER A . n 
A 1 236 VAL 236 236 236 VAL VAL A . n 
A 1 237 TRP 237 237 237 TRP TRP A . n 
A 1 238 ASN 238 238 238 ASN ASN A . n 
A 1 239 GLN 239 239 239 GLN GLN A . n 
A 1 240 ARG 240 240 240 ARG ARG A . n 
A 1 241 TYR 241 241 241 TYR TYR A . n 
A 1 242 PHE 242 242 242 PHE PHE A . n 
A 1 243 VAL 243 243 243 VAL VAL A . n 
A 1 244 ILE 244 244 244 ILE ILE A . n 
A 1 245 SER 245 245 245 SER SER A . n 
A 1 246 ASN 246 246 246 ASN ASN A . n 
A 1 247 THR 247 247 247 THR THR A . n 
A 1 248 THR 248 248 248 THR THR A . n 
A 1 249 GLY 249 249 249 GLY GLY A . n 
A 1 250 TYR 250 250 250 TYR TYR A . n 
A 1 251 ASN 251 251 251 ASN ASN A . n 
A 1 252 ASP 252 252 252 ASP ASP A . n 
A 1 253 ARG 253 253 253 ARG ARG A . n 
A 1 254 ALA 254 254 254 ALA ALA A . n 
A 1 255 VAL 255 255 255 VAL VAL A . n 
A 1 256 LEU 256 256 256 LEU LEU A . n 
A 1 257 GLU 257 257 257 GLU GLU A . n 
A 1 258 ARG 258 258 258 ARG ARG A . n 
A 1 259 GLU 259 259 259 GLU GLU A . n 
A 1 260 VAL 260 260 260 VAL VAL A . n 
A 1 261 GLN 261 261 261 GLN GLN A . n 
A 1 262 TYR 262 262 262 TYR TYR A . n 
A 1 263 THR 263 263 263 THR THR A . n 
A 1 264 LEU 264 264 264 LEU LEU A . n 
A 1 265 GLU 265 265 265 GLU GLU A . n 
A 1 266 MET 266 266 266 MET MET A . n 
A 1 267 ILE 267 267 267 ILE ILE A . n 
A 1 268 LYS 268 268 268 LYS LYS A . n 
A 1 269 LEU 269 269 269 LEU LEU A . n 
A 1 270 VAL 270 270 270 VAL VAL A . n 
A 1 271 PRO 271 271 271 PRO PRO A . n 
A 1 272 HIS 272 272 272 HIS HIS A . n 
A 1 273 ASN 273 273 273 ASN ASN A . n 
A 1 274 GLU 274 274 274 GLU GLU A . n 
A 1 275 SER 275 275 275 SER SER A . n 
A 1 276 ALA 276 276 276 ALA ALA A . n 
A 1 277 TRP 277 277 277 TRP TRP A . n 
A 1 278 ASN 278 278 278 ASN ASN A . n 
A 1 279 TYR 279 279 279 TYR TYR A . n 
A 1 280 LEU 280 280 280 LEU LEU A . n 
A 1 281 LYS 281 281 281 LYS LYS A . n 
A 1 282 GLY 282 282 282 GLY GLY A . n 
A 1 283 ILE 283 283 283 ILE ILE A . n 
A 1 284 LEU 284 284 284 LEU LEU A . n 
A 1 285 GLN 285 285 285 GLN GLN A . n 
A 1 286 ASP 286 286 286 ASP ASP A . n 
A 1 287 ARG 287 287 287 ARG ARG A . n 
A 1 288 GLY 288 288 288 GLY GLY A . n 
A 1 289 LEU 289 289 289 LEU LEU A . n 
A 1 290 SER 290 290 290 SER SER A . n 
A 1 291 LYS 291 291 291 LYS LYS A . n 
A 1 292 TYR 292 292 292 TYR TYR A . n 
A 1 293 PRO 293 293 293 PRO PRO A . n 
A 1 294 ASN 294 294 294 ASN ASN A . n 
A 1 295 LEU 295 295 295 LEU LEU A . n 
A 1 296 LEU 296 296 296 LEU LEU A . n 
A 1 297 ASN 297 297 297 ASN ASN A . n 
A 1 298 GLN 298 298 298 GLN GLN A . n 
A 1 299 LEU 299 299 299 LEU LEU A . n 
A 1 300 LEU 300 300 300 LEU LEU A . n 
A 1 301 ASP 301 301 301 ASP ASP A . n 
A 1 302 LEU 302 302 302 LEU LEU A . n 
A 1 303 GLN 303 303 303 GLN GLN A . n 
A 1 304 PRO 304 304 304 PRO PRO A . n 
A 1 305 SER 305 305 305 SER SER A . n 
A 1 306 HIS 306 306 306 HIS HIS A . n 
A 1 307 SER 307 307 307 SER SER A . n 
A 1 308 SER 308 308 308 SER SER A . n 
A 1 309 PRO 309 309 309 PRO PRO A . n 
A 1 310 TYR 310 310 310 TYR TYR A . n 
A 1 311 LEU 311 311 311 LEU LEU A . n 
A 1 312 ILE 312 312 312 ILE ILE A . n 
A 1 313 ALA 313 313 313 ALA ALA A . n 
A 1 314 PHE 314 314 314 PHE PHE A . n 
A 1 315 LEU 315 315 315 LEU LEU A . n 
A 1 316 VAL 316 316 316 VAL VAL A . n 
A 1 317 ASP 317 317 317 ASP ASP A . n 
A 1 318 ILE 318 318 318 ILE ILE A . n 
A 1 319 TYR 319 319 319 TYR TYR A . n 
A 1 320 GLU 320 320 320 GLU GLU A . n 
A 1 321 ASP 321 321 321 ASP ASP A . n 
A 1 322 MET 322 322 322 MET MET A . n 
A 1 323 LEU 323 323 323 LEU LEU A . n 
A 1 324 GLU 324 324 324 GLU GLU A . n 
A 1 325 ASN 325 325 325 ASN ASN A . n 
A 1 326 GLN 326 326 326 GLN GLN A . n 
A 1 327 CYS 327 327 327 CYS CYS A . n 
A 1 328 ASP 328 328 328 ASP ASP A . n 
A 1 329 ASN 329 329 329 ASN ASN A . n 
A 1 330 LYS 330 330 330 LYS LYS A . n 
A 1 331 GLU 331 331 331 GLU GLU A . n 
A 1 332 ASP 332 332 332 ASP ASP A . n 
A 1 333 ILE 333 333 333 ILE ILE A . n 
A 1 334 LEU 334 334 334 LEU LEU A . n 
A 1 335 ASN 335 335 335 ASN ASN A . n 
A 1 336 LYS 336 336 336 LYS LYS A . n 
A 1 337 ALA 337 337 337 ALA ALA A . n 
A 1 338 LEU 338 338 338 LEU LEU A . n 
A 1 339 GLU 339 339 339 GLU GLU A . n 
A 1 340 LEU 340 340 340 LEU LEU A . n 
A 1 341 CYS 341 341 341 CYS CYS A . n 
A 1 342 GLU 342 342 342 GLU GLU A . n 
A 1 343 ILE 343 343 343 ILE ILE A . n 
A 1 344 LEU 344 344 344 LEU LEU A . n 
A 1 345 ALA 345 345 345 ALA ALA A . n 
A 1 346 LYS 346 346 346 LYS LYS A . n 
A 1 347 GLU 347 347 347 GLU GLU A . n 
A 1 348 LYS 348 348 348 LYS LYS A . n 
A 1 349 ASP 349 349 349 ASP ASP A . n 
A 1 350 THR 350 350 350 THR THR A . n 
A 1 351 ILE 351 351 351 ILE ILE A . n 
A 1 352 ARG 352 352 352 ARG ARG A . n 
A 1 353 LYS 353 353 353 LYS LYS A . n 
A 1 354 GLU 354 354 354 GLU GLU A . n 
A 1 355 TYR 355 355 355 TYR TYR A . n 
A 1 356 TRP 356 356 356 TRP TRP A . n 
A 1 357 ARG 357 357 357 ARG ARG A . n 
A 1 358 TYR 358 358 358 TYR TYR A . n 
A 1 359 ILE 359 359 359 ILE ILE A . n 
A 1 360 GLY 360 360 360 GLY GLY A . n 
A 1 361 ARG 361 361 361 ARG ARG A . n 
A 1 362 SER 362 362 362 SER SER A . n 
A 1 363 LEU 363 363 363 LEU LEU A . n 
A 1 364 GLN 364 364 364 GLN GLN A . n 
A 1 365 SER 365 365 365 SER SER A . n 
A 1 366 LYS 366 366 366 LYS LYS A . n 
A 1 367 HIS 367 367 367 HIS HIS A . n 
A 1 368 SER 368 368 368 SER SER A . n 
A 1 369 THR 369 369 369 THR THR A . n 
A 1 370 GLU 370 370 ?   ?   ?   A . n 
A 1 371 ASN 371 371 ?   ?   ?   A . n 
A 1 372 ASP 372 372 ?   ?   ?   A . n 
A 1 373 SER 373 373 ?   ?   ?   A . n 
A 1 374 PRO 374 374 ?   ?   ?   A . n 
A 1 375 THR 375 375 ?   ?   ?   A . n 
A 1 376 ASN 376 376 ?   ?   ?   A . n 
A 1 377 VAL 377 377 ?   ?   ?   A . n 
A 1 378 GLN 378 378 ?   ?   ?   A . n 
A 1 379 GLN 379 379 ?   ?   ?   A . n 
A 1 380 GLU 380 380 ?   ?   ?   A . n 
A 1 381 GLU 381 381 ?   ?   ?   A . n 
A 1 382 PHE 382 382 ?   ?   ?   A . n 
B 2 1   MET 1   1   ?   ?   ?   B . n 
B 2 2   ALA 2   2   ?   ?   ?   B . n 
B 2 3   SER 3   3   ?   ?   ?   B . n 
B 2 4   PRO 4   4   ?   ?   ?   B . n 
B 2 5   SER 5   5   ?   ?   ?   B . n 
B 2 6   SER 6   6   ?   ?   ?   B . n 
B 2 7   PHE 7   7   ?   ?   ?   B . n 
B 2 8   THR 8   8   ?   ?   ?   B . n 
B 2 9   TYR 9   9   ?   ?   ?   B . n 
B 2 10  TYR 10  10  ?   ?   ?   B . n 
B 2 11  CYS 11  11  ?   ?   ?   B . n 
B 2 12  PRO 12  12  ?   ?   ?   B . n 
B 2 13  PRO 13  13  ?   ?   ?   B . n 
B 2 14  SER 14  14  ?   ?   ?   B . n 
B 2 15  SER 15  15  15  SER SER B . n 
B 2 16  SER 16  16  16  SER SER B . n 
B 2 17  PRO 17  17  17  PRO PRO B . n 
B 2 18  VAL 18  18  18  VAL VAL B . n 
B 2 19  TRP 19  19  19  TRP TRP B . n 
B 2 20  SER 20  20  20  SER SER B . n 
B 2 21  GLU 21  21  21  GLU GLU B . n 
B 2 22  PRO 22  22  22  PRO PRO B . n 
B 2 23  LEU 23  23  23  LEU LEU B . n 
B 2 24  TYR 24  24  24  TYR TYR B . n 
B 2 25  SER 25  25  25  SER SER B . n 
B 2 26  LEU 26  26  26  LEU LEU B . n 
B 2 27  ARG 27  27  27  ARG ARG B . n 
B 2 28  PRO 28  28  28  PRO PRO B . n 
B 2 29  GLU 29  29  29  GLU GLU B . n 
B 2 30  HIS 30  30  30  HIS HIS B . n 
B 2 31  ALA 31  31  31  ALA ALA B . n 
B 2 32  ARG 32  32  32  ARG ARG B . n 
B 2 33  GLU 33  33  33  GLU GLU B . n 
B 2 34  ARG 34  34  34  ARG ARG B . n 
B 2 35  LEU 35  35  35  LEU LEU B . n 
B 2 36  GLN 36  36  36  GLN GLN B . n 
B 2 37  ASP 37  37  37  ASP ASP B . n 
B 2 38  ASP 38  38  38  ASP ASP B . n 
B 2 39  SER 39  39  39  SER SER B . n 
B 2 40  VAL 40  40  40  VAL VAL B . n 
B 2 41  GLU 41  41  41  GLU GLU B . n 
B 2 42  THR 42  42  42  THR THR B . n 
B 2 43  VAL 43  43  43  VAL VAL B . n 
B 2 44  THR 44  44  44  THR THR B . n 
B 2 45  SER 45  45  45  SER SER B . n 
B 2 46  ILE 46  46  46  ILE ILE B . n 
B 2 47  GLU 47  47  47  GLU GLU B . n 
B 2 48  GLN 48  48  48  GLN GLN B . n 
B 2 49  ALA 49  49  49  ALA ALA B . n 
B 2 50  LYS 50  50  50  LYS LYS B . n 
B 2 51  VAL 51  51  51  VAL VAL B . n 
B 2 52  GLU 52  52  52  GLU GLU B . n 
B 2 53  GLU 53  53  53  GLU GLU B . n 
B 2 54  LYS 54  54  54  LYS LYS B . n 
B 2 55  ILE 55  55  55  ILE ILE B . n 
B 2 56  GLN 56  56  56  GLN GLN B . n 
B 2 57  GLU 57  57  57  GLU GLU B . n 
B 2 58  VAL 58  58  58  VAL VAL B . n 
B 2 59  PHE 59  59  59  PHE PHE B . n 
B 2 60  SER 60  60  60  SER SER B . n 
B 2 61  SER 61  61  61  SER SER B . n 
B 2 62  TYR 62  62  62  TYR TYR B . n 
B 2 63  LYS 63  63  63  LYS LYS B . n 
B 2 64  PHE 64  64  64  PHE PHE B . n 
B 2 65  ASN 65  65  65  ASN ASN B . n 
B 2 66  HIS 66  66  66  HIS HIS B . n 
B 2 67  LEU 67  67  67  LEU LEU B . n 
B 2 68  VAL 68  68  68  VAL VAL B . n 
B 2 69  PRO 69  69  69  PRO PRO B . n 
B 2 70  ARG 70  70  70  ARG ARG B . n 
B 2 71  LEU 71  71  71  LEU LEU B . n 
B 2 72  VAL 72  72  72  VAL VAL B . n 
B 2 73  LEU 73  73  73  LEU LEU B . n 
B 2 74  GLN 74  74  74  GLN GLN B . n 
B 2 75  ARG 75  75  75  ARG ARG B . n 
B 2 76  GLU 76  76  76  GLU GLU B . n 
B 2 77  LYS 77  77  77  LYS LYS B . n 
B 2 78  HIS 78  78  78  HIS HIS B . n 
B 2 79  PHE 79  79  79  PHE PHE B . n 
B 2 80  HIS 80  80  80  HIS HIS B . n 
B 2 81  TYR 81  81  81  TYR TYR B . n 
B 2 82  LEU 82  82  82  LEU LEU B . n 
B 2 83  LYS 83  83  83  LYS LYS B . n 
B 2 84  ARG 84  84  84  ARG ARG B . n 
B 2 85  GLY 85  85  85  GLY GLY B . n 
B 2 86  LEU 86  86  86  LEU LEU B . n 
B 2 87  ARG 87  87  87  ARG ARG B . n 
B 2 88  GLN 88  88  88  GLN GLN B . n 
B 2 89  LEU 89  89  89  LEU LEU B . n 
B 2 90  THR 90  90  90  THR THR B . n 
B 2 91  ASP 91  91  91  ASP ASP B . n 
B 2 92  ALA 92  92  92  ALA ALA B . n 
B 2 93  TYR 93  93  93  TYR TYR B . n 
B 2 94  GLU 94  94  94  GLU GLU B . n 
B 2 95  CYS 95  95  95  CYS CYS B . n 
B 2 96  LEU 96  96  96  LEU LEU B . n 
B 2 97  ASP 97  97  97  ASP ASP B . n 
B 2 98  ALA 98  98  98  ALA ALA B . n 
B 2 99  SER 99  99  99  SER SER B . n 
B 2 100 ARG 100 100 100 ARG ARG B . n 
B 2 101 PRO 101 101 101 PRO PRO B . n 
B 2 102 TRP 102 102 102 TRP TRP B . n 
B 2 103 LEU 103 103 103 LEU LEU B . n 
B 2 104 CYS 104 104 104 CYS CYS B . n 
B 2 105 TYR 105 105 105 TYR TYR B . n 
B 2 106 TRP 106 106 106 TRP TRP B . n 
B 2 107 ILE 107 107 107 ILE ILE B . n 
B 2 108 LEU 108 108 108 LEU LEU B . n 
B 2 109 HIS 109 109 109 HIS HIS B . n 
B 2 110 SER 110 110 110 SER SER B . n 
B 2 111 LEU 111 111 111 LEU LEU B . n 
B 2 112 GLU 112 112 112 GLU GLU B . n 
B 2 113 LEU 113 113 113 LEU LEU B . n 
B 2 114 LEU 114 114 114 LEU LEU B . n 
B 2 115 ASP 115 115 115 ASP ASP B . n 
B 2 116 GLU 116 116 116 GLU GLU B . n 
B 2 117 PRO 117 117 117 PRO PRO B . n 
B 2 118 ILE 118 118 118 ILE ILE B . n 
B 2 119 PRO 119 119 119 PRO PRO B . n 
B 2 120 GLN 120 120 120 GLN GLN B . n 
B 2 121 ILE 121 121 121 ILE ILE B . n 
B 2 122 VAL 122 122 122 VAL VAL B . n 
B 2 123 ALA 123 123 123 ALA ALA B . n 
B 2 124 THR 124 124 124 THR THR B . n 
B 2 125 ASP 125 125 125 ASP ASP B . n 
B 2 126 VAL 126 126 126 VAL VAL B . n 
B 2 127 CYS 127 127 127 CYS CYS B . n 
B 2 128 GLN 128 128 128 GLN GLN B . n 
B 2 129 PHE 129 129 129 PHE PHE B . n 
B 2 130 LEU 130 130 130 LEU LEU B . n 
B 2 131 GLU 131 131 131 GLU GLU B . n 
B 2 132 LEU 132 132 132 LEU LEU B . n 
B 2 133 CYS 133 133 133 CYS CYS B . n 
B 2 134 GLN 134 134 134 GLN GLN B . n 
B 2 135 SER 135 135 135 SER SER B . n 
B 2 136 PRO 136 136 136 PRO PRO B . n 
B 2 137 GLU 137 137 137 GLU GLU B . n 
B 2 138 GLY 138 138 138 GLY GLY B . n 
B 2 139 GLY 139 139 139 GLY GLY B . n 
B 2 140 PHE 140 140 140 PHE PHE B . n 
B 2 141 GLY 141 141 141 GLY GLY B . n 
B 2 142 GLY 142 142 142 GLY GLY B . n 
B 2 143 GLY 143 143 143 GLY GLY B . n 
B 2 144 PRO 144 144 144 PRO PRO B . n 
B 2 145 GLY 145 145 145 GLY GLY B . n 
B 2 146 GLN 146 146 146 GLN GLN B . n 
B 2 147 TYR 147 147 147 TYR TYR B . n 
B 2 148 PRO 148 148 148 PRO PRO B . n 
B 2 149 HIS 149 149 149 HIS HIS B . n 
B 2 150 LEU 150 150 150 LEU LEU B . n 
B 2 151 ALA 151 151 151 ALA ALA B . n 
B 2 152 PRO 152 152 152 PRO PRO B . n 
B 2 153 THR 153 153 153 THR THR B . n 
B 2 154 TYR 154 154 154 TYR TYR B . n 
B 2 155 ALA 155 155 155 ALA ALA B . n 
B 2 156 ALA 156 156 156 ALA ALA B . n 
B 2 157 VAL 157 157 157 VAL VAL B . n 
B 2 158 ASN 158 158 158 ASN ASN B . n 
B 2 159 ALA 159 159 159 ALA ALA B . n 
B 2 160 LEU 160 160 160 LEU LEU B . n 
B 2 161 CYS 161 161 161 CYS CYS B . n 
B 2 162 ILE 162 162 162 ILE ILE B . n 
B 2 163 ILE 163 163 163 ILE ILE B . n 
B 2 164 GLY 164 164 164 GLY GLY B . n 
B 2 165 THR 165 165 165 THR THR B . n 
B 2 166 GLU 166 166 166 GLU GLU B . n 
B 2 167 GLU 167 167 167 GLU GLU B . n 
B 2 168 ALA 168 168 168 ALA ALA B . n 
B 2 169 TYR 169 169 169 TYR TYR B . n 
B 2 170 ASP 170 170 170 ASP ASP B . n 
B 2 171 ILE 171 171 171 ILE ILE B . n 
B 2 172 ILE 172 172 172 ILE ILE B . n 
B 2 173 ASN 173 173 173 ASN ASN B . n 
B 2 174 ARG 174 174 174 ARG ARG B . n 
B 2 175 GLU 175 175 175 GLU GLU B . n 
B 2 176 LYS 176 176 176 LYS LYS B . n 
B 2 177 LEU 177 177 177 LEU LEU B . n 
B 2 178 LEU 178 178 178 LEU LEU B . n 
B 2 179 GLN 179 179 179 GLN GLN B . n 
B 2 180 TYR 180 180 180 TYR TYR B . n 
B 2 181 LEU 181 181 181 LEU LEU B . n 
B 2 182 TYR 182 182 182 TYR TYR B . n 
B 2 183 SER 183 183 183 SER SER B . n 
B 2 184 LEU 184 184 184 LEU LEU B . n 
B 2 185 LYS 185 185 185 LYS LYS B . n 
B 2 186 GLN 186 186 186 GLN GLN B . n 
B 2 187 PRO 187 187 187 PRO PRO B . n 
B 2 188 ASP 188 188 188 ASP ASP B . n 
B 2 189 GLY 189 189 189 GLY GLY B . n 
B 2 190 SER 190 190 190 SER SER B . n 
B 2 191 PHE 191 191 191 PHE PHE B . n 
B 2 192 LEU 192 192 192 LEU LEU B . n 
B 2 193 MET 193 193 193 MET MET B . n 
B 2 194 HIS 194 194 194 HIS HIS B . n 
B 2 195 VAL 195 195 195 VAL VAL B . n 
B 2 196 GLY 196 196 196 GLY GLY B . n 
B 2 197 GLY 197 197 197 GLY GLY B . n 
B 2 198 GLU 198 198 198 GLU GLU B . n 
B 2 199 VAL 199 199 199 VAL VAL B . n 
B 2 200 ASP 200 200 200 ASP ASP B . n 
B 2 201 VAL 201 201 201 VAL VAL B . n 
B 2 202 ARG 202 202 202 ARG ARG B . n 
B 2 203 SER 203 203 203 SER SER B . n 
B 2 204 ALA 204 204 204 ALA ALA B . n 
B 2 205 TYR 205 205 205 TYR TYR B . n 
B 2 206 CYS 206 206 206 CYS CYS B . n 
B 2 207 ALA 207 207 207 ALA ALA B . n 
B 2 208 ALA 208 208 208 ALA ALA B . n 
B 2 209 SER 209 209 209 SER SER B . n 
B 2 210 VAL 210 210 210 VAL VAL B . n 
B 2 211 ALA 211 211 211 ALA ALA B . n 
B 2 212 SER 212 212 212 SER SER B . n 
B 2 213 LEU 213 213 213 LEU LEU B . n 
B 2 214 THR 214 214 214 THR THR B . n 
B 2 215 ASN 215 215 215 ASN ASN B . n 
B 2 216 ILE 216 216 216 ILE ILE B . n 
B 2 217 ILE 217 217 217 ILE ILE B . n 
B 2 218 THR 218 218 218 THR THR B . n 
B 2 219 PRO 219 219 219 PRO PRO B . n 
B 2 220 ASP 220 220 220 ASP ASP B . n 
B 2 221 LEU 221 221 221 LEU LEU B . n 
B 2 222 PHE 222 222 222 PHE PHE B . n 
B 2 223 GLU 223 223 223 GLU GLU B . n 
B 2 224 GLY 224 224 224 GLY GLY B . n 
B 2 225 THR 225 225 225 THR THR B . n 
B 2 226 ALA 226 226 226 ALA ALA B . n 
B 2 227 GLU 227 227 227 GLU GLU B . n 
B 2 228 TRP 228 228 228 TRP TRP B . n 
B 2 229 ILE 229 229 229 ILE ILE B . n 
B 2 230 ALA 230 230 230 ALA ALA B . n 
B 2 231 ARG 231 231 231 ARG ARG B . n 
B 2 232 CYS 232 232 232 CYS CYS B . n 
B 2 233 GLN 233 233 233 GLN GLN B . n 
B 2 234 ASN 234 234 234 ASN ASN B . n 
B 2 235 TRP 235 235 235 TRP TRP B . n 
B 2 236 GLU 236 236 236 GLU GLU B . n 
B 2 237 GLY 237 237 237 GLY GLY B . n 
B 2 238 GLY 238 238 238 GLY GLY B . n 
B 2 239 ILE 239 239 239 ILE ILE B . n 
B 2 240 GLY 240 240 240 GLY GLY B . n 
B 2 241 GLY 241 241 241 GLY GLY B . n 
B 2 242 VAL 242 242 242 VAL VAL B . n 
B 2 243 PRO 243 243 243 PRO PRO B . n 
B 2 244 GLY 244 244 244 GLY GLY B . n 
B 2 245 MET 245 245 245 MET MET B . n 
B 2 246 GLU 246 246 246 GLU GLU B . n 
B 2 247 ALA 247 247 247 ALA ALA B . n 
B 2 248 HIS 248 248 248 HIS HIS B . n 
B 2 249 GLY 249 249 249 GLY GLY B . n 
B 2 250 GLY 250 250 250 GLY GLY B . n 
B 2 251 TYR 251 251 251 TYR TYR B . n 
B 2 252 THR 252 252 252 THR THR B . n 
B 2 253 PHE 253 253 253 PHE PHE B . n 
B 2 254 CYS 254 254 254 CYS CYS B . n 
B 2 255 GLY 255 255 255 GLY GLY B . n 
B 2 256 LEU 256 256 256 LEU LEU B . n 
B 2 257 ALA 257 257 257 ALA ALA B . n 
B 2 258 ALA 258 258 258 ALA ALA B . n 
B 2 259 LEU 259 259 259 LEU LEU B . n 
B 2 260 VAL 260 260 260 VAL VAL B . n 
B 2 261 ILE 261 261 261 ILE ILE B . n 
B 2 262 LEU 262 262 262 LEU LEU B . n 
B 2 263 LYS 263 263 263 LYS LYS B . n 
B 2 264 ARG 264 264 264 ARG ARG B . n 
B 2 265 GLU 265 265 265 GLU GLU B . n 
B 2 266 ARG 266 266 266 ARG ARG B . n 
B 2 267 SER 267 267 267 SER SER B . n 
B 2 268 LEU 268 268 268 LEU LEU B . n 
B 2 269 ASN 269 269 269 ASN ASN B . n 
B 2 270 LEU 270 270 270 LEU LEU B . n 
B 2 271 LYS 271 271 271 LYS LYS B . n 
B 2 272 SER 272 272 272 SER SER B . n 
B 2 273 LEU 273 273 273 LEU LEU B . n 
B 2 274 LEU 274 274 274 LEU LEU B . n 
B 2 275 GLN 275 275 275 GLN GLN B . n 
B 2 276 TRP 276 276 276 TRP TRP B . n 
B 2 277 VAL 277 277 277 VAL VAL B . n 
B 2 278 THR 278 278 278 THR THR B . n 
B 2 279 SER 279 279 279 SER SER B . n 
B 2 280 ARG 280 280 280 ARG ARG B . n 
B 2 281 GLN 281 281 281 GLN GLN B . n 
B 2 282 MET 282 282 282 MET MET B . n 
B 2 283 ARG 283 283 283 ARG ARG B . n 
B 2 284 PHE 284 284 284 PHE PHE B . n 
B 2 285 GLU 285 285 285 GLU GLU B . n 
B 2 286 GLY 286 286 286 GLY GLY B . n 
B 2 287 GLY 287 287 287 GLY GLY B . n 
B 2 288 PHE 288 288 288 PHE PHE B . n 
B 2 289 GLN 289 289 289 GLN GLN B . n 
B 2 290 GLY 290 290 290 GLY GLY B . n 
B 2 291 ARG 291 291 291 ARG ARG B . n 
B 2 292 CYS 292 292 292 CYS CYS B . n 
B 2 293 ASN 293 293 293 ASN ASN B . n 
B 2 294 LYS 294 294 294 LYS LYS B . n 
B 2 295 LEU 295 295 295 LEU LEU B . n 
B 2 296 VAL 296 296 296 VAL VAL B . n 
B 2 297 ASP 297 297 297 ASP ASP B . n 
B 2 298 GLY 298 298 298 GLY GLY B . n 
B 2 299 CYS 299 299 299 CYS CYS B . n 
B 2 300 TYR 300 300 300 TYR TYR B . n 
B 2 301 SER 301 301 301 SER SER B . n 
B 2 302 PHE 302 302 302 PHE PHE B . n 
B 2 303 TRP 303 303 303 TRP TRP B . n 
B 2 304 GLN 304 304 304 GLN GLN B . n 
B 2 305 ALA 305 305 305 ALA ALA B . n 
B 2 306 GLY 306 306 306 GLY GLY B . n 
B 2 307 LEU 307 307 307 LEU LEU B . n 
B 2 308 LEU 308 308 308 LEU LEU B . n 
B 2 309 PRO 309 309 309 PRO PRO B . n 
B 2 310 LEU 310 310 310 LEU LEU B . n 
B 2 311 LEU 311 311 311 LEU LEU B . n 
B 2 312 HIS 312 312 312 HIS HIS B . n 
B 2 313 ARG 313 313 313 ARG ARG B . n 
B 2 314 ALA 314 314 314 ALA ALA B . n 
B 2 315 LEU 315 315 315 LEU LEU B . n 
B 2 316 HIS 316 316 316 HIS HIS B . n 
B 2 317 ALA 317 317 317 ALA ALA B . n 
B 2 318 GLN 318 318 318 GLN GLN B . n 
B 2 319 GLY 319 319 319 GLY GLY B . n 
B 2 320 ASP 320 320 320 ASP ASP B . n 
B 2 321 PRO 321 321 321 PRO PRO B . n 
B 2 322 ALA 322 322 322 ALA ALA B . n 
B 2 323 LEU 323 323 323 LEU LEU B . n 
B 2 324 SER 324 324 324 SER SER B . n 
B 2 325 MET 325 325 325 MET MET B . n 
B 2 326 SER 326 326 326 SER SER B . n 
B 2 327 HIS 327 327 327 HIS HIS B . n 
B 2 328 TRP 328 328 328 TRP TRP B . n 
B 2 329 MET 329 329 329 MET MET B . n 
B 2 330 PHE 330 330 330 PHE PHE B . n 
B 2 331 HIS 331 331 331 HIS HIS B . n 
B 2 332 GLN 332 332 332 GLN GLN B . n 
B 2 333 GLN 333 333 333 GLN GLN B . n 
B 2 334 ALA 334 334 334 ALA ALA B . n 
B 2 335 LEU 335 335 335 LEU LEU B . n 
B 2 336 GLN 336 336 336 GLN GLN B . n 
B 2 337 GLU 337 337 337 GLU GLU B . n 
B 2 338 TYR 338 338 338 TYR TYR B . n 
B 2 339 ILE 339 339 339 ILE ILE B . n 
B 2 340 LEU 340 340 340 LEU LEU B . n 
B 2 341 MET 341 341 341 MET MET B . n 
B 2 342 CYS 342 342 342 CYS CYS B . n 
B 2 343 CYS 343 343 343 CYS CYS B . n 
B 2 344 GLN 344 344 344 GLN GLN B . n 
B 2 345 CYS 345 345 345 CYS CYS B . n 
B 2 346 PRO 346 346 346 PRO PRO B . n 
B 2 347 ALA 347 347 347 ALA ALA B . n 
B 2 348 GLY 348 348 348 GLY GLY B . n 
B 2 349 GLY 349 349 349 GLY GLY B . n 
B 2 350 LEU 350 350 350 LEU LEU B . n 
B 2 351 LEU 351 351 351 LEU LEU B . n 
B 2 352 ASP 352 352 352 ASP ASP B . n 
B 2 353 LYS 353 353 353 LYS LYS B . n 
B 2 354 PRO 354 354 354 PRO PRO B . n 
B 2 355 GLY 355 355 355 GLY GLY B . n 
B 2 356 LYS 356 356 356 LYS LYS B . n 
B 2 357 SER 357 357 357 SER SER B . n 
B 2 358 ARG 358 358 358 ARG ARG B . n 
B 2 359 ASP 359 359 359 ASP ASP B . n 
B 2 360 PHE 360 360 360 PHE PHE B . n 
B 2 361 TYR 361 361 361 TYR TYR B . n 
B 2 362 HIS 362 362 362 HIS HIS B . n 
B 2 363 THR 363 363 363 THR THR B . n 
B 2 364 CYS 364 364 364 CYS CYS B . n 
B 2 365 TYR 365 365 365 TYR TYR B . n 
B 2 366 CYS 366 366 366 CYS CYS B . n 
B 2 367 LEU 367 367 367 LEU LEU B . n 
B 2 368 SER 368 368 368 SER SER B . n 
B 2 369 GLY 369 369 369 GLY GLY B . n 
B 2 370 LEU 370 370 370 LEU LEU B . n 
B 2 371 SER 371 371 371 SER SER B . n 
B 2 372 ILE 372 372 372 ILE ILE B . n 
B 2 373 ALA 373 373 373 ALA ALA B . n 
B 2 374 GLN 374 374 374 GLN GLN B . n 
B 2 375 HIS 375 375 375 HIS HIS B . n 
B 2 376 PHE 376 376 376 PHE PHE B . n 
B 2 377 GLY 377 377 377 GLY GLY B . n 
B 2 378 SER 378 378 378 SER SER B . n 
B 2 379 GLY 379 379 379 GLY GLY B . n 
B 2 380 ALA 380 380 380 ALA ALA B . n 
B 2 381 MET 381 381 381 MET MET B . n 
B 2 382 LEU 382 382 382 LEU LEU B . n 
B 2 383 HIS 383 383 383 HIS HIS B . n 
B 2 384 ASP 384 384 384 ASP ASP B . n 
B 2 385 VAL 385 385 385 VAL VAL B . n 
B 2 386 VAL 386 386 386 VAL VAL B . n 
B 2 387 LEU 387 387 387 LEU LEU B . n 
B 2 388 GLY 388 388 388 GLY GLY B . n 
B 2 389 VAL 389 389 389 VAL VAL B . n 
B 2 390 PRO 390 390 390 PRO PRO B . n 
B 2 391 GLU 391 391 391 GLU GLU B . n 
B 2 392 ASN 392 392 392 ASN ASN B . n 
B 2 393 ALA 393 393 393 ALA ALA B . n 
B 2 394 LEU 394 394 394 LEU LEU B . n 
B 2 395 GLN 395 395 395 GLN GLN B . n 
B 2 396 PRO 396 396 396 PRO PRO B . n 
B 2 397 THR 397 397 397 THR THR B . n 
B 2 398 HIS 398 398 398 HIS HIS B . n 
B 2 399 PRO 399 399 399 PRO PRO B . n 
B 2 400 VAL 400 400 400 VAL VAL B . n 
B 2 401 TYR 401 401 401 TYR TYR B . n 
B 2 402 ASN 402 402 402 ASN ASN B . n 
B 2 403 ILE 403 403 403 ILE ILE B . n 
B 2 404 GLY 404 404 404 GLY GLY B . n 
B 2 405 PRO 405 405 405 PRO PRO B . n 
B 2 406 ASP 406 406 406 ASP ASP B . n 
B 2 407 LYS 407 407 407 LYS LYS B . n 
B 2 408 VAL 408 408 408 VAL VAL B . n 
B 2 409 ILE 409 409 409 ILE ILE B . n 
B 2 410 GLN 410 410 410 GLN GLN B . n 
B 2 411 ALA 411 411 411 ALA ALA B . n 
B 2 412 THR 412 412 412 THR THR B . n 
B 2 413 THR 413 413 413 THR THR B . n 
B 2 414 TYR 414 414 414 TYR TYR B . n 
B 2 415 PHE 415 415 415 PHE PHE B . n 
B 2 416 LEU 416 416 416 LEU LEU B . n 
B 2 417 GLN 417 417 417 GLN GLN B . n 
B 2 418 LYS 418 418 418 LYS LYS B . n 
B 2 419 PRO 419 419 419 PRO PRO B . n 
B 2 420 VAL 420 420 420 VAL VAL B . n 
B 2 421 PRO 421 421 421 PRO PRO B . n 
B 2 422 GLY 422 422 422 GLY GLY B . n 
B 2 423 PHE 423 423 423 PHE PHE B . n 
B 2 424 GLU 424 424 424 GLU GLU B . n 
B 2 425 GLU 425 425 ?   ?   ?   B . n 
B 2 426 LEU 426 426 ?   ?   ?   B . n 
B 2 427 LYS 427 427 ?   ?   ?   B . n 
B 2 428 ASP 428 428 ?   ?   ?   B . n 
B 2 429 GLU 429 429 ?   ?   ?   B . n 
B 2 430 THR 430 430 ?   ?   ?   B . n 
B 2 431 SER 431 431 ?   ?   ?   B . n 
B 2 432 ALA 432 432 ?   ?   ?   B . n 
B 2 433 GLU 433 433 ?   ?   ?   B . n 
B 2 434 PRO 434 434 ?   ?   ?   B . n 
B 2 435 ALA 435 435 ?   ?   ?   B . n 
B 2 436 THR 436 436 ?   ?   ?   B . n 
B 2 437 ASP 437 437 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 ZN  1   439 1   ZN  ZN2 B . 
E 5 FPP 1   440 2   FPP FPP B . 
F 6 JAN 1   441 3   JAN JAN B . 
G 7 HOH 1   383 104 HOH WAT A . 
G 7 HOH 2   384 105 HOH WAT A . 
G 7 HOH 3   385 107 HOH WAT A . 
G 7 HOH 4   386 111 HOH WAT A . 
G 7 HOH 5   387 115 HOH WAT A . 
G 7 HOH 6   388 116 HOH WAT A . 
G 7 HOH 7   389 119 HOH WAT A . 
G 7 HOH 8   390 121 HOH WAT A . 
G 7 HOH 9   391 122 HOH WAT A . 
G 7 HOH 10  392 125 HOH WAT A . 
G 7 HOH 11  393 126 HOH WAT A . 
G 7 HOH 12  394 127 HOH WAT A . 
G 7 HOH 13  395 128 HOH WAT A . 
G 7 HOH 14  396 129 HOH WAT A . 
G 7 HOH 15  397 130 HOH WAT A . 
G 7 HOH 16  398 131 HOH WAT A . 
G 7 HOH 17  399 132 HOH WAT A . 
G 7 HOH 18  400 135 HOH WAT A . 
G 7 HOH 19  401 136 HOH WAT A . 
G 7 HOH 20  402 137 HOH WAT A . 
G 7 HOH 21  403 138 HOH WAT A . 
G 7 HOH 22  404 141 HOH WAT A . 
G 7 HOH 23  405 144 HOH WAT A . 
G 7 HOH 24  406 148 HOH WAT A . 
G 7 HOH 25  407 150 HOH WAT A . 
G 7 HOH 26  408 151 HOH WAT A . 
G 7 HOH 27  409 153 HOH WAT A . 
G 7 HOH 28  410 154 HOH WAT A . 
G 7 HOH 29  411 158 HOH WAT A . 
G 7 HOH 30  412 162 HOH WAT A . 
G 7 HOH 31  413 163 HOH WAT A . 
G 7 HOH 32  414 165 HOH WAT A . 
G 7 HOH 33  415 168 HOH WAT A . 
G 7 HOH 34  416 170 HOH WAT A . 
G 7 HOH 35  417 172 HOH WAT A . 
G 7 HOH 36  418 175 HOH WAT A . 
G 7 HOH 37  419 177 HOH WAT A . 
G 7 HOH 38  420 180 HOH WAT A . 
G 7 HOH 39  421 181 HOH WAT A . 
G 7 HOH 40  422 184 HOH WAT A . 
G 7 HOH 41  423 185 HOH WAT A . 
G 7 HOH 42  424 187 HOH WAT A . 
G 7 HOH 43  425 189 HOH WAT A . 
G 7 HOH 44  426 191 HOH WAT A . 
G 7 HOH 45  427 194 HOH WAT A . 
G 7 HOH 46  428 195 HOH WAT A . 
G 7 HOH 47  429 199 HOH WAT A . 
G 7 HOH 48  430 204 HOH WAT A . 
G 7 HOH 49  431 206 HOH WAT A . 
G 7 HOH 50  432 207 HOH WAT A . 
G 7 HOH 51  433 209 HOH WAT A . 
G 7 HOH 52  434 210 HOH WAT A . 
G 7 HOH 53  435 213 HOH WAT A . 
G 7 HOH 54  436 215 HOH WAT A . 
G 7 HOH 55  437 216 HOH WAT A . 
G 7 HOH 56  438 221 HOH WAT A . 
G 7 HOH 57  439 224 HOH WAT A . 
G 7 HOH 58  440 225 HOH WAT A . 
G 7 HOH 59  441 227 HOH WAT A . 
G 7 HOH 60  442 228 HOH WAT A . 
G 7 HOH 61  443 229 HOH WAT A . 
G 7 HOH 62  444 230 HOH WAT A . 
G 7 HOH 63  445 233 HOH WAT A . 
G 7 HOH 64  446 235 HOH WAT A . 
G 7 HOH 65  447 236 HOH WAT A . 
G 7 HOH 66  448 237 HOH WAT A . 
G 7 HOH 67  449 240 HOH WAT A . 
G 7 HOH 68  450 241 HOH WAT A . 
G 7 HOH 69  451 242 HOH WAT A . 
G 7 HOH 70  452 244 HOH WAT A . 
G 7 HOH 71  453 247 HOH WAT A . 
G 7 HOH 72  454 250 HOH WAT A . 
G 7 HOH 73  455 257 HOH WAT A . 
G 7 HOH 74  456 258 HOH WAT A . 
G 7 HOH 75  457 262 HOH WAT A . 
G 7 HOH 76  458 263 HOH WAT A . 
G 7 HOH 77  459 264 HOH WAT A . 
G 7 HOH 78  460 266 HOH WAT A . 
G 7 HOH 79  461 267 HOH WAT A . 
G 7 HOH 80  462 269 HOH WAT A . 
G 7 HOH 81  463 271 HOH WAT A . 
G 7 HOH 82  464 274 HOH WAT A . 
G 7 HOH 83  465 275 HOH WAT A . 
G 7 HOH 84  466 279 HOH WAT A . 
G 7 HOH 85  467 281 HOH WAT A . 
G 7 HOH 86  468 282 HOH WAT A . 
G 7 HOH 87  469 284 HOH WAT A . 
G 7 HOH 88  470 285 HOH WAT A . 
G 7 HOH 89  471 286 HOH WAT A . 
G 7 HOH 90  472 287 HOH WAT A . 
G 7 HOH 91  473 288 HOH WAT A . 
G 7 HOH 92  474 291 HOH WAT A . 
G 7 HOH 93  475 293 HOH WAT A . 
G 7 HOH 94  476 297 HOH WAT A . 
G 7 HOH 95  477 301 HOH WAT A . 
G 7 HOH 96  478 303 HOH WAT A . 
G 7 HOH 97  479 304 HOH WAT A . 
G 7 HOH 98  480 306 HOH WAT A . 
G 7 HOH 99  481 307 HOH WAT A . 
G 7 HOH 100 482 308 HOH WAT A . 
G 7 HOH 101 483 309 HOH WAT A . 
G 7 HOH 102 484 311 HOH WAT A . 
G 7 HOH 103 485 312 HOH WAT A . 
G 7 HOH 104 486 314 HOH WAT A . 
G 7 HOH 105 487 316 HOH WAT A . 
G 7 HOH 106 488 319 HOH WAT A . 
G 7 HOH 107 489 321 HOH WAT A . 
G 7 HOH 108 490 324 HOH WAT A . 
G 7 HOH 109 491 325 HOH WAT A . 
G 7 HOH 110 492 326 HOH WAT A . 
G 7 HOH 111 493 331 HOH WAT A . 
G 7 HOH 112 494 333 HOH WAT A . 
G 7 HOH 113 495 334 HOH WAT A . 
G 7 HOH 114 496 335 HOH WAT A . 
G 7 HOH 115 497 336 HOH WAT A . 
G 7 HOH 116 498 337 HOH WAT A . 
G 7 HOH 117 499 341 HOH WAT A . 
G 7 HOH 118 500 343 HOH WAT A . 
G 7 HOH 119 501 344 HOH WAT A . 
G 7 HOH 120 502 345 HOH WAT A . 
G 7 HOH 121 503 348 HOH WAT A . 
G 7 HOH 122 504 351 HOH WAT A . 
G 7 HOH 123 505 355 HOH WAT A . 
G 7 HOH 124 506 359 HOH WAT A . 
G 7 HOH 125 507 365 HOH WAT A . 
G 7 HOH 126 508 366 HOH WAT A . 
G 7 HOH 127 509 372 HOH WAT A . 
G 7 HOH 128 510 374 HOH WAT A . 
G 7 HOH 129 511 377 HOH WAT A . 
G 7 HOH 130 512 381 HOH WAT A . 
G 7 HOH 131 513 383 HOH WAT A . 
G 7 HOH 132 514 388 HOH WAT A . 
G 7 HOH 133 515 398 HOH WAT A . 
G 7 HOH 134 516 400 HOH WAT A . 
G 7 HOH 135 517 404 HOH WAT A . 
G 7 HOH 136 518 407 HOH WAT A . 
G 7 HOH 137 519 408 HOH WAT A . 
G 7 HOH 138 520 409 HOH WAT A . 
G 7 HOH 139 521 411 HOH WAT A . 
G 7 HOH 140 522 412 HOH WAT A . 
G 7 HOH 141 523 413 HOH WAT A . 
G 7 HOH 142 524 414 HOH WAT A . 
G 7 HOH 143 525 420 HOH WAT A . 
G 7 HOH 144 526 421 HOH WAT A . 
G 7 HOH 145 527 424 HOH WAT A . 
G 7 HOH 146 528 426 HOH WAT A . 
G 7 HOH 147 529 427 HOH WAT A . 
G 7 HOH 148 530 433 HOH WAT A . 
G 7 HOH 149 531 435 HOH WAT A . 
G 7 HOH 150 532 440 HOH WAT A . 
G 7 HOH 151 533 441 HOH WAT A . 
G 7 HOH 152 534 444 HOH WAT A . 
G 7 HOH 153 535 448 HOH WAT A . 
G 7 HOH 154 536 454 HOH WAT A . 
G 7 HOH 155 537 456 HOH WAT A . 
G 7 HOH 156 538 457 HOH WAT A . 
G 7 HOH 157 539 461 HOH WAT A . 
G 7 HOH 158 540 464 HOH WAT A . 
G 7 HOH 159 541 467 HOH WAT A . 
G 7 HOH 160 542 472 HOH WAT A . 
G 7 HOH 161 543 473 HOH WAT A . 
G 7 HOH 162 544 476 HOH WAT A . 
G 7 HOH 163 545 479 HOH WAT A . 
G 7 HOH 164 546 481 HOH WAT A . 
G 7 HOH 165 547 484 HOH WAT A . 
G 7 HOH 166 548 486 HOH WAT A . 
G 7 HOH 167 549 489 HOH WAT A . 
G 7 HOH 168 550 490 HOH WAT A . 
G 7 HOH 169 551 492 HOH WAT A . 
G 7 HOH 170 552 493 HOH WAT A . 
G 7 HOH 171 553 494 HOH WAT A . 
G 7 HOH 172 554 495 HOH WAT A . 
G 7 HOH 173 555 496 HOH WAT A . 
G 7 HOH 174 556 498 HOH WAT A . 
G 7 HOH 175 557 500 HOH WAT A . 
G 7 HOH 176 558 504 HOH WAT A . 
G 7 HOH 177 559 505 HOH WAT A . 
G 7 HOH 178 560 506 HOH WAT A . 
G 7 HOH 179 561 507 HOH WAT A . 
G 7 HOH 180 562 508 HOH WAT A . 
G 7 HOH 181 563 509 HOH WAT A . 
G 7 HOH 182 564 510 HOH WAT A . 
G 7 HOH 183 565 516 HOH WAT A . 
G 7 HOH 184 566 520 HOH WAT A . 
G 7 HOH 185 567 521 HOH WAT A . 
G 7 HOH 186 568 524 HOH WAT A . 
G 7 HOH 187 569 525 HOH WAT A . 
G 7 HOH 188 570 526 HOH WAT A . 
G 7 HOH 189 571 528 HOH WAT A . 
G 7 HOH 190 572 529 HOH WAT A . 
G 7 HOH 191 573 534 HOH WAT A . 
G 7 HOH 192 574 535 HOH WAT A . 
G 7 HOH 193 575 542 HOH WAT A . 
G 7 HOH 194 576 543 HOH WAT A . 
G 7 HOH 195 577 549 HOH WAT A . 
G 7 HOH 196 578 550 HOH WAT A . 
G 7 HOH 197 579 553 HOH WAT A . 
G 7 HOH 198 580 556 HOH WAT A . 
G 7 HOH 199 581 559 HOH WAT A . 
G 7 HOH 200 582 562 HOH WAT A . 
G 7 HOH 201 583 565 HOH WAT A . 
G 7 HOH 202 584 573 HOH WAT A . 
G 7 HOH 203 585 575 HOH WAT A . 
G 7 HOH 204 586 579 HOH WAT A . 
G 7 HOH 205 587 580 HOH WAT A . 
G 7 HOH 206 588 582 HOH WAT A . 
G 7 HOH 207 589 583 HOH WAT A . 
G 7 HOH 208 590 585 HOH WAT A . 
G 7 HOH 209 591 589 HOH WAT A . 
G 7 HOH 210 592 590 HOH WAT A . 
G 7 HOH 211 593 591 HOH WAT A . 
G 7 HOH 212 594 592 HOH WAT A . 
G 7 HOH 213 595 593 HOH WAT A . 
G 7 HOH 214 596 594 HOH WAT A . 
G 7 HOH 215 597 599 HOH WAT A . 
G 7 HOH 216 598 601 HOH WAT A . 
G 7 HOH 217 599 602 HOH WAT A . 
G 7 HOH 218 600 603 HOH WAT A . 
G 7 HOH 219 601 604 HOH WAT A . 
G 7 HOH 220 602 609 HOH WAT A . 
G 7 HOH 221 603 610 HOH WAT A . 
G 7 HOH 222 604 611 HOH WAT A . 
G 7 HOH 223 605 612 HOH WAT A . 
G 7 HOH 224 606 613 HOH WAT A . 
G 7 HOH 225 607 621 HOH WAT A . 
G 7 HOH 226 608 622 HOH WAT A . 
G 7 HOH 227 609 623 HOH WAT A . 
G 7 HOH 228 610 625 HOH WAT A . 
G 7 HOH 229 611 626 HOH WAT A . 
G 7 HOH 230 612 627 HOH WAT A . 
G 7 HOH 231 613 628 HOH WAT A . 
G 7 HOH 232 614 631 HOH WAT A . 
G 7 HOH 233 615 636 HOH WAT A . 
G 7 HOH 234 616 637 HOH WAT A . 
G 7 HOH 235 617 639 HOH WAT A . 
G 7 HOH 236 618 640 HOH WAT A . 
G 7 HOH 237 619 641 HOH WAT A . 
G 7 HOH 238 620 648 HOH WAT A . 
G 7 HOH 239 621 649 HOH WAT A . 
G 7 HOH 240 622 652 HOH WAT A . 
G 7 HOH 241 623 653 HOH WAT A . 
G 7 HOH 242 624 658 HOH WAT A . 
G 7 HOH 243 625 660 HOH WAT A . 
G 7 HOH 244 626 666 HOH WAT A . 
G 7 HOH 245 627 667 HOH WAT A . 
G 7 HOH 246 628 668 HOH WAT A . 
G 7 HOH 247 629 673 HOH WAT A . 
G 7 HOH 248 630 674 HOH WAT A . 
G 7 HOH 249 631 678 HOH WAT A . 
G 7 HOH 250 632 680 HOH WAT A . 
G 7 HOH 251 633 684 HOH WAT A . 
G 7 HOH 252 634 685 HOH WAT A . 
G 7 HOH 253 635 686 HOH WAT A . 
G 7 HOH 254 636 688 HOH WAT A . 
G 7 HOH 255 637 689 HOH WAT A . 
G 7 HOH 256 638 690 HOH WAT A . 
G 7 HOH 257 639 695 HOH WAT A . 
G 7 HOH 258 640 697 HOH WAT A . 
G 7 HOH 259 641 698 HOH WAT A . 
G 7 HOH 260 642 701 HOH WAT A . 
G 7 HOH 261 643 702 HOH WAT A . 
G 7 HOH 262 644 703 HOH WAT A . 
G 7 HOH 263 645 706 HOH WAT A . 
G 7 HOH 264 646 708 HOH WAT A . 
G 7 HOH 265 647 709 HOH WAT A . 
G 7 HOH 266 648 711 HOH WAT A . 
G 7 HOH 267 649 713 HOH WAT A . 
G 7 HOH 268 650 714 HOH WAT A . 
G 7 HOH 269 651 718 HOH WAT A . 
G 7 HOH 270 652 720 HOH WAT A . 
G 7 HOH 271 653 721 HOH WAT A . 
G 7 HOH 272 654 722 HOH WAT A . 
G 7 HOH 273 655 725 HOH WAT A . 
G 7 HOH 274 656 727 HOH WAT A . 
G 7 HOH 275 657 728 HOH WAT A . 
G 7 HOH 276 658 729 HOH WAT A . 
G 7 HOH 277 659 730 HOH WAT A . 
G 7 HOH 278 660 731 HOH WAT A . 
G 7 HOH 279 661 733 HOH WAT A . 
G 7 HOH 280 662 734 HOH WAT A . 
G 7 HOH 281 663 736 HOH WAT A . 
G 7 HOH 282 664 738 HOH WAT A . 
G 7 HOH 283 665 743 HOH WAT A . 
G 7 HOH 284 666 744 HOH WAT A . 
G 7 HOH 285 667 745 HOH WAT A . 
G 7 HOH 286 668 746 HOH WAT A . 
G 7 HOH 287 669 747 HOH WAT A . 
G 7 HOH 288 670 748 HOH WAT A . 
G 7 HOH 289 671 750 HOH WAT A . 
G 7 HOH 290 672 751 HOH WAT A . 
G 7 HOH 291 673 752 HOH WAT A . 
G 7 HOH 292 674 753 HOH WAT A . 
G 7 HOH 293 675 755 HOH WAT A . 
G 7 HOH 294 676 757 HOH WAT A . 
G 7 HOH 295 677 761 HOH WAT A . 
G 7 HOH 296 678 763 HOH WAT A . 
G 7 HOH 297 679 764 HOH WAT A . 
G 7 HOH 298 680 765 HOH WAT A . 
G 7 HOH 299 681 766 HOH WAT A . 
G 7 HOH 300 682 767 HOH WAT A . 
G 7 HOH 301 683 768 HOH WAT A . 
G 7 HOH 302 684 771 HOH WAT A . 
H 7 HOH 1   442 100 HOH WAT B . 
H 7 HOH 2   443 101 HOH WAT B . 
H 7 HOH 3   444 102 HOH WAT B . 
H 7 HOH 4   445 103 HOH WAT B . 
H 7 HOH 5   446 106 HOH WAT B . 
H 7 HOH 6   447 108 HOH WAT B . 
H 7 HOH 7   448 109 HOH WAT B . 
H 7 HOH 8   449 110 HOH WAT B . 
H 7 HOH 9   450 112 HOH WAT B . 
H 7 HOH 10  451 113 HOH WAT B . 
H 7 HOH 11  452 114 HOH WAT B . 
H 7 HOH 12  453 117 HOH WAT B . 
H 7 HOH 13  454 118 HOH WAT B . 
H 7 HOH 14  455 120 HOH WAT B . 
H 7 HOH 15  456 123 HOH WAT B . 
H 7 HOH 16  457 124 HOH WAT B . 
H 7 HOH 17  458 133 HOH WAT B . 
H 7 HOH 18  459 134 HOH WAT B . 
H 7 HOH 19  460 139 HOH WAT B . 
H 7 HOH 20  461 140 HOH WAT B . 
H 7 HOH 21  462 142 HOH WAT B . 
H 7 HOH 22  463 143 HOH WAT B . 
H 7 HOH 23  464 145 HOH WAT B . 
H 7 HOH 24  465 146 HOH WAT B . 
H 7 HOH 25  466 147 HOH WAT B . 
H 7 HOH 26  467 149 HOH WAT B . 
H 7 HOH 27  468 152 HOH WAT B . 
H 7 HOH 28  469 155 HOH WAT B . 
H 7 HOH 29  470 156 HOH WAT B . 
H 7 HOH 30  471 157 HOH WAT B . 
H 7 HOH 31  472 159 HOH WAT B . 
H 7 HOH 32  473 160 HOH WAT B . 
H 7 HOH 33  474 161 HOH WAT B . 
H 7 HOH 34  475 164 HOH WAT B . 
H 7 HOH 35  476 166 HOH WAT B . 
H 7 HOH 36  477 167 HOH WAT B . 
H 7 HOH 37  478 169 HOH WAT B . 
H 7 HOH 38  479 171 HOH WAT B . 
H 7 HOH 39  480 173 HOH WAT B . 
H 7 HOH 40  481 174 HOH WAT B . 
H 7 HOH 41  482 176 HOH WAT B . 
H 7 HOH 42  483 178 HOH WAT B . 
H 7 HOH 43  484 179 HOH WAT B . 
H 7 HOH 44  485 182 HOH WAT B . 
H 7 HOH 45  486 183 HOH WAT B . 
H 7 HOH 46  487 186 HOH WAT B . 
H 7 HOH 47  488 188 HOH WAT B . 
H 7 HOH 48  489 190 HOH WAT B . 
H 7 HOH 49  490 192 HOH WAT B . 
H 7 HOH 50  491 193 HOH WAT B . 
H 7 HOH 51  492 196 HOH WAT B . 
H 7 HOH 52  493 197 HOH WAT B . 
H 7 HOH 53  494 198 HOH WAT B . 
H 7 HOH 54  495 200 HOH WAT B . 
H 7 HOH 55  496 201 HOH WAT B . 
H 7 HOH 56  497 202 HOH WAT B . 
H 7 HOH 57  498 203 HOH WAT B . 
H 7 HOH 58  499 205 HOH WAT B . 
H 7 HOH 59  500 208 HOH WAT B . 
H 7 HOH 60  501 211 HOH WAT B . 
H 7 HOH 61  502 212 HOH WAT B . 
H 7 HOH 62  503 214 HOH WAT B . 
H 7 HOH 63  504 217 HOH WAT B . 
H 7 HOH 64  505 218 HOH WAT B . 
H 7 HOH 65  506 219 HOH WAT B . 
H 7 HOH 66  507 220 HOH WAT B . 
H 7 HOH 67  508 222 HOH WAT B . 
H 7 HOH 68  509 223 HOH WAT B . 
H 7 HOH 69  510 226 HOH WAT B . 
H 7 HOH 70  511 231 HOH WAT B . 
H 7 HOH 71  512 232 HOH WAT B . 
H 7 HOH 72  513 234 HOH WAT B . 
H 7 HOH 73  514 238 HOH WAT B . 
H 7 HOH 74  515 239 HOH WAT B . 
H 7 HOH 75  516 243 HOH WAT B . 
H 7 HOH 76  517 245 HOH WAT B . 
H 7 HOH 77  518 246 HOH WAT B . 
H 7 HOH 78  519 248 HOH WAT B . 
H 7 HOH 79  520 249 HOH WAT B . 
H 7 HOH 80  521 251 HOH WAT B . 
H 7 HOH 81  522 252 HOH WAT B . 
H 7 HOH 82  523 253 HOH WAT B . 
H 7 HOH 83  524 254 HOH WAT B . 
H 7 HOH 84  525 255 HOH WAT B . 
H 7 HOH 85  526 256 HOH WAT B . 
H 7 HOH 86  527 259 HOH WAT B . 
H 7 HOH 87  528 260 HOH WAT B . 
H 7 HOH 88  529 261 HOH WAT B . 
H 7 HOH 89  530 265 HOH WAT B . 
H 7 HOH 90  531 268 HOH WAT B . 
H 7 HOH 91  532 270 HOH WAT B . 
H 7 HOH 92  533 272 HOH WAT B . 
H 7 HOH 93  534 273 HOH WAT B . 
H 7 HOH 94  535 276 HOH WAT B . 
H 7 HOH 95  536 277 HOH WAT B . 
H 7 HOH 96  537 278 HOH WAT B . 
H 7 HOH 97  538 280 HOH WAT B . 
H 7 HOH 98  539 283 HOH WAT B . 
H 7 HOH 99  540 289 HOH WAT B . 
H 7 HOH 100 541 290 HOH WAT B . 
H 7 HOH 101 542 292 HOH WAT B . 
H 7 HOH 102 543 294 HOH WAT B . 
H 7 HOH 103 544 295 HOH WAT B . 
H 7 HOH 104 545 296 HOH WAT B . 
H 7 HOH 105 546 298 HOH WAT B . 
H 7 HOH 106 547 299 HOH WAT B . 
H 7 HOH 107 548 300 HOH WAT B . 
H 7 HOH 108 549 302 HOH WAT B . 
H 7 HOH 109 550 305 HOH WAT B . 
H 7 HOH 110 551 310 HOH WAT B . 
H 7 HOH 111 552 313 HOH WAT B . 
H 7 HOH 112 553 315 HOH WAT B . 
H 7 HOH 113 554 317 HOH WAT B . 
H 7 HOH 114 555 318 HOH WAT B . 
H 7 HOH 115 556 320 HOH WAT B . 
H 7 HOH 116 557 322 HOH WAT B . 
H 7 HOH 117 558 323 HOH WAT B . 
H 7 HOH 118 559 327 HOH WAT B . 
H 7 HOH 119 560 328 HOH WAT B . 
H 7 HOH 120 561 329 HOH WAT B . 
H 7 HOH 121 562 330 HOH WAT B . 
H 7 HOH 122 563 332 HOH WAT B . 
H 7 HOH 123 564 338 HOH WAT B . 
H 7 HOH 124 565 339 HOH WAT B . 
H 7 HOH 125 566 340 HOH WAT B . 
H 7 HOH 126 567 342 HOH WAT B . 
H 7 HOH 127 568 346 HOH WAT B . 
H 7 HOH 128 569 347 HOH WAT B . 
H 7 HOH 129 570 349 HOH WAT B . 
H 7 HOH 130 571 350 HOH WAT B . 
H 7 HOH 131 572 352 HOH WAT B . 
H 7 HOH 132 573 353 HOH WAT B . 
H 7 HOH 133 574 354 HOH WAT B . 
H 7 HOH 134 575 356 HOH WAT B . 
H 7 HOH 135 576 357 HOH WAT B . 
H 7 HOH 136 577 358 HOH WAT B . 
H 7 HOH 137 578 360 HOH WAT B . 
H 7 HOH 138 579 361 HOH WAT B . 
H 7 HOH 139 580 362 HOH WAT B . 
H 7 HOH 140 581 363 HOH WAT B . 
H 7 HOH 141 582 364 HOH WAT B . 
H 7 HOH 142 583 367 HOH WAT B . 
H 7 HOH 143 584 368 HOH WAT B . 
H 7 HOH 144 585 369 HOH WAT B . 
H 7 HOH 145 586 370 HOH WAT B . 
H 7 HOH 146 587 371 HOH WAT B . 
H 7 HOH 147 588 373 HOH WAT B . 
H 7 HOH 148 589 375 HOH WAT B . 
H 7 HOH 149 590 376 HOH WAT B . 
H 7 HOH 150 591 378 HOH WAT B . 
H 7 HOH 151 592 379 HOH WAT B . 
H 7 HOH 152 593 380 HOH WAT B . 
H 7 HOH 153 594 382 HOH WAT B . 
H 7 HOH 154 595 384 HOH WAT B . 
H 7 HOH 155 596 385 HOH WAT B . 
H 7 HOH 156 597 386 HOH WAT B . 
H 7 HOH 157 598 387 HOH WAT B . 
H 7 HOH 158 599 389 HOH WAT B . 
H 7 HOH 159 600 390 HOH WAT B . 
H 7 HOH 160 601 391 HOH WAT B . 
H 7 HOH 161 602 392 HOH WAT B . 
H 7 HOH 162 603 393 HOH WAT B . 
H 7 HOH 163 604 394 HOH WAT B . 
H 7 HOH 164 605 395 HOH WAT B . 
H 7 HOH 165 606 396 HOH WAT B . 
H 7 HOH 166 607 397 HOH WAT B . 
H 7 HOH 167 608 399 HOH WAT B . 
H 7 HOH 168 609 401 HOH WAT B . 
H 7 HOH 169 610 402 HOH WAT B . 
H 7 HOH 170 611 403 HOH WAT B . 
H 7 HOH 171 612 405 HOH WAT B . 
H 7 HOH 172 613 406 HOH WAT B . 
H 7 HOH 173 614 410 HOH WAT B . 
H 7 HOH 174 615 415 HOH WAT B . 
H 7 HOH 175 616 416 HOH WAT B . 
H 7 HOH 176 617 417 HOH WAT B . 
H 7 HOH 177 618 418 HOH WAT B . 
H 7 HOH 178 619 419 HOH WAT B . 
H 7 HOH 179 620 422 HOH WAT B . 
H 7 HOH 180 621 423 HOH WAT B . 
H 7 HOH 181 622 425 HOH WAT B . 
H 7 HOH 182 623 428 HOH WAT B . 
H 7 HOH 183 624 429 HOH WAT B . 
H 7 HOH 184 625 430 HOH WAT B . 
H 7 HOH 185 626 431 HOH WAT B . 
H 7 HOH 186 627 432 HOH WAT B . 
H 7 HOH 187 628 434 HOH WAT B . 
H 7 HOH 188 629 436 HOH WAT B . 
H 7 HOH 189 630 437 HOH WAT B . 
H 7 HOH 190 631 438 HOH WAT B . 
H 7 HOH 191 632 439 HOH WAT B . 
H 7 HOH 192 633 442 HOH WAT B . 
H 7 HOH 193 634 443 HOH WAT B . 
H 7 HOH 194 635 445 HOH WAT B . 
H 7 HOH 195 636 446 HOH WAT B . 
H 7 HOH 196 637 447 HOH WAT B . 
H 7 HOH 197 638 449 HOH WAT B . 
H 7 HOH 198 639 450 HOH WAT B . 
H 7 HOH 199 640 451 HOH WAT B . 
H 7 HOH 200 641 452 HOH WAT B . 
H 7 HOH 201 642 453 HOH WAT B . 
H 7 HOH 202 643 455 HOH WAT B . 
H 7 HOH 203 644 458 HOH WAT B . 
H 7 HOH 204 645 459 HOH WAT B . 
H 7 HOH 205 646 460 HOH WAT B . 
H 7 HOH 206 647 462 HOH WAT B . 
H 7 HOH 207 648 463 HOH WAT B . 
H 7 HOH 208 649 465 HOH WAT B . 
H 7 HOH 209 650 466 HOH WAT B . 
H 7 HOH 210 651 468 HOH WAT B . 
H 7 HOH 211 652 469 HOH WAT B . 
H 7 HOH 212 653 470 HOH WAT B . 
H 7 HOH 213 654 471 HOH WAT B . 
H 7 HOH 214 655 474 HOH WAT B . 
H 7 HOH 215 656 475 HOH WAT B . 
H 7 HOH 216 657 477 HOH WAT B . 
H 7 HOH 217 658 478 HOH WAT B . 
H 7 HOH 218 659 480 HOH WAT B . 
H 7 HOH 219 660 482 HOH WAT B . 
H 7 HOH 220 661 483 HOH WAT B . 
H 7 HOH 221 662 485 HOH WAT B . 
H 7 HOH 222 663 487 HOH WAT B . 
H 7 HOH 223 664 488 HOH WAT B . 
H 7 HOH 224 665 491 HOH WAT B . 
H 7 HOH 225 666 497 HOH WAT B . 
H 7 HOH 226 667 499 HOH WAT B . 
H 7 HOH 227 668 501 HOH WAT B . 
H 7 HOH 228 669 502 HOH WAT B . 
H 7 HOH 229 670 503 HOH WAT B . 
H 7 HOH 230 671 511 HOH WAT B . 
H 7 HOH 231 672 512 HOH WAT B . 
H 7 HOH 232 673 513 HOH WAT B . 
H 7 HOH 233 674 514 HOH WAT B . 
H 7 HOH 234 675 515 HOH WAT B . 
H 7 HOH 235 676 517 HOH WAT B . 
H 7 HOH 236 677 518 HOH WAT B . 
H 7 HOH 237 678 519 HOH WAT B . 
H 7 HOH 238 679 522 HOH WAT B . 
H 7 HOH 239 680 523 HOH WAT B . 
H 7 HOH 240 681 527 HOH WAT B . 
H 7 HOH 241 682 530 HOH WAT B . 
H 7 HOH 242 683 531 HOH WAT B . 
H 7 HOH 243 684 532 HOH WAT B . 
H 7 HOH 244 685 533 HOH WAT B . 
H 7 HOH 245 686 536 HOH WAT B . 
H 7 HOH 246 687 537 HOH WAT B . 
H 7 HOH 247 688 538 HOH WAT B . 
H 7 HOH 248 689 539 HOH WAT B . 
H 7 HOH 249 690 540 HOH WAT B . 
H 7 HOH 250 691 541 HOH WAT B . 
H 7 HOH 251 692 544 HOH WAT B . 
H 7 HOH 252 693 545 HOH WAT B . 
H 7 HOH 253 694 546 HOH WAT B . 
H 7 HOH 254 695 547 HOH WAT B . 
H 7 HOH 255 696 548 HOH WAT B . 
H 7 HOH 256 697 551 HOH WAT B . 
H 7 HOH 257 698 552 HOH WAT B . 
H 7 HOH 258 699 554 HOH WAT B . 
H 7 HOH 259 700 555 HOH WAT B . 
H 7 HOH 260 701 557 HOH WAT B . 
H 7 HOH 261 702 558 HOH WAT B . 
H 7 HOH 262 703 560 HOH WAT B . 
H 7 HOH 263 704 561 HOH WAT B . 
H 7 HOH 264 705 563 HOH WAT B . 
H 7 HOH 265 706 564 HOH WAT B . 
H 7 HOH 266 707 566 HOH WAT B . 
H 7 HOH 267 708 567 HOH WAT B . 
H 7 HOH 268 709 568 HOH WAT B . 
H 7 HOH 269 710 569 HOH WAT B . 
H 7 HOH 270 711 570 HOH WAT B . 
H 7 HOH 271 712 571 HOH WAT B . 
H 7 HOH 272 713 572 HOH WAT B . 
H 7 HOH 273 714 574 HOH WAT B . 
H 7 HOH 274 715 576 HOH WAT B . 
H 7 HOH 275 716 577 HOH WAT B . 
H 7 HOH 276 717 578 HOH WAT B . 
H 7 HOH 277 718 581 HOH WAT B . 
H 7 HOH 278 719 584 HOH WAT B . 
H 7 HOH 279 720 586 HOH WAT B . 
H 7 HOH 280 721 587 HOH WAT B . 
H 7 HOH 281 722 588 HOH WAT B . 
H 7 HOH 282 723 595 HOH WAT B . 
H 7 HOH 283 724 596 HOH WAT B . 
H 7 HOH 284 725 597 HOH WAT B . 
H 7 HOH 285 726 598 HOH WAT B . 
H 7 HOH 286 727 600 HOH WAT B . 
H 7 HOH 287 728 605 HOH WAT B . 
H 7 HOH 288 729 606 HOH WAT B . 
H 7 HOH 289 730 607 HOH WAT B . 
H 7 HOH 290 731 608 HOH WAT B . 
H 7 HOH 291 732 614 HOH WAT B . 
H 7 HOH 292 733 615 HOH WAT B . 
H 7 HOH 293 734 616 HOH WAT B . 
H 7 HOH 294 735 617 HOH WAT B . 
H 7 HOH 295 736 618 HOH WAT B . 
H 7 HOH 296 737 619 HOH WAT B . 
H 7 HOH 297 738 620 HOH WAT B . 
H 7 HOH 298 739 624 HOH WAT B . 
H 7 HOH 299 740 629 HOH WAT B . 
H 7 HOH 300 741 630 HOH WAT B . 
H 7 HOH 301 742 632 HOH WAT B . 
H 7 HOH 302 743 633 HOH WAT B . 
H 7 HOH 303 744 634 HOH WAT B . 
H 7 HOH 304 745 635 HOH WAT B . 
H 7 HOH 305 746 638 HOH WAT B . 
H 7 HOH 306 747 642 HOH WAT B . 
H 7 HOH 307 748 643 HOH WAT B . 
H 7 HOH 308 749 644 HOH WAT B . 
H 7 HOH 309 750 645 HOH WAT B . 
H 7 HOH 310 751 646 HOH WAT B . 
H 7 HOH 311 752 647 HOH WAT B . 
H 7 HOH 312 753 650 HOH WAT B . 
H 7 HOH 313 754 651 HOH WAT B . 
H 7 HOH 314 755 654 HOH WAT B . 
H 7 HOH 315 756 655 HOH WAT B . 
H 7 HOH 316 757 656 HOH WAT B . 
H 7 HOH 317 758 657 HOH WAT B . 
H 7 HOH 318 759 659 HOH WAT B . 
H 7 HOH 319 760 661 HOH WAT B . 
H 7 HOH 320 761 662 HOH WAT B . 
H 7 HOH 321 762 663 HOH WAT B . 
H 7 HOH 322 763 664 HOH WAT B . 
H 7 HOH 323 764 665 HOH WAT B . 
H 7 HOH 324 765 669 HOH WAT B . 
H 7 HOH 325 766 670 HOH WAT B . 
H 7 HOH 326 767 671 HOH WAT B . 
H 7 HOH 327 768 672 HOH WAT B . 
H 7 HOH 328 769 675 HOH WAT B . 
H 7 HOH 329 770 676 HOH WAT B . 
H 7 HOH 330 771 677 HOH WAT B . 
H 7 HOH 331 772 679 HOH WAT B . 
H 7 HOH 332 773 681 HOH WAT B . 
H 7 HOH 333 774 682 HOH WAT B . 
H 7 HOH 334 775 683 HOH WAT B . 
H 7 HOH 335 776 687 HOH WAT B . 
H 7 HOH 336 777 691 HOH WAT B . 
H 7 HOH 337 778 692 HOH WAT B . 
H 7 HOH 338 779 693 HOH WAT B . 
H 7 HOH 339 780 694 HOH WAT B . 
H 7 HOH 340 781 696 HOH WAT B . 
H 7 HOH 341 782 699 HOH WAT B . 
H 7 HOH 342 783 700 HOH WAT B . 
H 7 HOH 343 784 704 HOH WAT B . 
H 7 HOH 344 785 705 HOH WAT B . 
H 7 HOH 345 786 707 HOH WAT B . 
H 7 HOH 346 787 710 HOH WAT B . 
H 7 HOH 347 788 712 HOH WAT B . 
H 7 HOH 348 789 715 HOH WAT B . 
H 7 HOH 349 790 716 HOH WAT B . 
H 7 HOH 350 791 717 HOH WAT B . 
H 7 HOH 351 792 719 HOH WAT B . 
H 7 HOH 352 793 723 HOH WAT B . 
H 7 HOH 353 794 724 HOH WAT B . 
H 7 HOH 354 795 726 HOH WAT B . 
H 7 HOH 355 796 732 HOH WAT B . 
H 7 HOH 356 797 735 HOH WAT B . 
H 7 HOH 357 798 737 HOH WAT B . 
H 7 HOH 358 799 739 HOH WAT B . 
H 7 HOH 359 800 740 HOH WAT B . 
H 7 HOH 360 801 741 HOH WAT B . 
H 7 HOH 361 802 742 HOH WAT B . 
H 7 HOH 362 803 749 HOH WAT B . 
H 7 HOH 363 804 754 HOH WAT B . 
H 7 HOH 364 805 756 HOH WAT B . 
H 7 HOH 365 806 758 HOH WAT B . 
H 7 HOH 366 807 759 HOH WAT B . 
H 7 HOH 367 808 760 HOH WAT B . 
H 7 HOH 368 809 762 HOH WAT B . 
H 7 HOH 369 810 769 HOH WAT B . 
H 7 HOH 370 811 770 HOH WAT B . 
# 
_pdbx_molecule_features.prd_id    PRD_900003 
_pdbx_molecule_features.name      sucrose 
_pdbx_molecule_features.type      Oligosaccharide 
_pdbx_molecule_features.class     Nutrient 
_pdbx_molecule_features.details   'oligosaccharide with reducing-end-to-reducing-end glycosidic bond' 
# 
_pdbx_molecule.instance_id   1 
_pdbx_molecule.prd_id        PRD_900003 
_pdbx_molecule.asym_id       C 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 9260  ? 
1 MORE         -68   ? 
1 'SSA (A^2)'  28360 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1 ? B ASP 297 ? B ASP 297 ? 1_555 ZN ? D ZN . ? B ZN 439 ? 1_555 OD2 ? B ASP 297 ? B ASP 297 ? 1_555 56.8  ? 
2  OD1 ? B ASP 297 ? B ASP 297 ? 1_555 ZN ? D ZN . ? B ZN 439 ? 1_555 SG  ? B CYS 299 ? B CYS 299 ? 1_555 91.7  ? 
3  OD2 ? B ASP 297 ? B ASP 297 ? 1_555 ZN ? D ZN . ? B ZN 439 ? 1_555 SG  ? B CYS 299 ? B CYS 299 ? 1_555 106.1 ? 
4  OD1 ? B ASP 297 ? B ASP 297 ? 1_555 ZN ? D ZN . ? B ZN 439 ? 1_555 NE2 ? B HIS 362 ? B HIS 362 ? 1_555 89.5  ? 
5  OD2 ? B ASP 297 ? B ASP 297 ? 1_555 ZN ? D ZN . ? B ZN 439 ? 1_555 NE2 ? B HIS 362 ? B HIS 362 ? 1_555 122.8 ? 
6  SG  ? B CYS 299 ? B CYS 299 ? 1_555 ZN ? D ZN . ? B ZN 439 ? 1_555 NE2 ? B HIS 362 ? B HIS 362 ? 1_555 121.0 ? 
7  OD1 ? B ASP 297 ? B ASP 297 ? 1_555 ZN ? D ZN . ? B ZN 439 ? 1_555 N2  ? F JAN .   ? B JAN 441 ? 1_555 151.1 ? 
8  OD2 ? B ASP 297 ? B ASP 297 ? 1_555 ZN ? D ZN . ? B ZN 439 ? 1_555 N2  ? F JAN .   ? B JAN 441 ? 1_555 94.3  ? 
9  SG  ? B CYS 299 ? B CYS 299 ? 1_555 ZN ? D ZN . ? B ZN 439 ? 1_555 N2  ? F JAN .   ? B JAN 441 ? 1_555 98.5  ? 
10 NE2 ? B HIS 362 ? B HIS 362 ? 1_555 ZN ? D ZN . ? B ZN 439 ? 1_555 N2  ? F JAN .   ? B JAN 441 ? 1_555 107.8 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-06-08 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 2 0 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 4 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Atomic model'              
4 4 'Structure model' 'Data collection'           
5 4 'Structure model' 'Database references'       
6 4 'Structure model' 'Derived calculations'      
7 4 'Structure model' 'Non-polymer description'   
8 4 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' atom_site                     
2  4 'Structure model' chem_comp                     
3  4 'Structure model' entity                        
4  4 'Structure model' entity_name_com               
5  4 'Structure model' pdbx_branch_scheme            
6  4 'Structure model' pdbx_chem_comp_identifier     
7  4 'Structure model' pdbx_entity_branch            
8  4 'Structure model' pdbx_entity_branch_descriptor 
9  4 'Structure model' pdbx_entity_branch_link       
10 4 'Structure model' pdbx_entity_branch_list       
11 4 'Structure model' pdbx_entity_nonpoly           
12 4 'Structure model' pdbx_molecule_features        
13 4 'Structure model' pdbx_nonpoly_scheme           
14 4 'Structure model' pdbx_struct_conn_angle        
15 4 'Structure model' struct_conn                   
16 4 'Structure model' struct_conn_type              
17 4 'Structure model' struct_ref_seq_dif            
18 4 'Structure model' struct_site                   
19 4 'Structure model' struct_site_gen               
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_atom_site.B_iso_or_equiv'                   
2  4 'Structure model' '_atom_site.Cartn_x'                          
3  4 'Structure model' '_atom_site.Cartn_y'                          
4  4 'Structure model' '_atom_site.Cartn_z'                          
5  4 'Structure model' '_atom_site.auth_asym_id'                     
6  4 'Structure model' '_atom_site.auth_atom_id'                     
7  4 'Structure model' '_atom_site.auth_comp_id'                     
8  4 'Structure model' '_atom_site.auth_seq_id'                      
9  4 'Structure model' '_atom_site.label_atom_id'                    
10 4 'Structure model' '_atom_site.label_comp_id'                    
11 4 'Structure model' '_atom_site.type_symbol'                      
12 4 'Structure model' '_chem_comp.formula'                          
13 4 'Structure model' '_chem_comp.formula_weight'                   
14 4 'Structure model' '_chem_comp.id'                               
15 4 'Structure model' '_chem_comp.mon_nstd_flag'                    
16 4 'Structure model' '_chem_comp.name'                             
17 4 'Structure model' '_chem_comp.pdbx_synonyms'                    
18 4 'Structure model' '_chem_comp.type'                             
19 4 'Structure model' '_entity.formula_weight'                      
20 4 'Structure model' '_entity.pdbx_description'                    
21 4 'Structure model' '_entity.type'                                
22 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
23 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
24 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
25 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
26 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id'  
27 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
28 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
29 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
30 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
31 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id'  
32 4 'Structure model' '_pdbx_struct_conn_angle.value'               
33 4 'Structure model' '_struct_ref_seq_dif.details'                 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS      refinement       1.0 ? 1 
HKL-2000 'data reduction' .   ? 2 
HKL-2000 'data scaling'   .   ? 3 
CNS      phasing          .   ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 VAL A 88  ? ? 37.45   42.87   
2  1 ASN A 127 ? ? -161.14 92.79   
3  1 LYS A 164 ? ? -106.62 62.97   
4  1 LEU A 215 ? ? -107.36 57.33   
5  1 THR A 247 ? ? -108.54 -85.98  
6  1 HIS A 306 ? ? -141.78 46.65   
7  1 GLU A 347 ? ? -130.46 -55.00  
8  1 ASP A 349 ? ? -149.81 52.80   
9  1 ASN B 65  ? ? 58.69   -121.40 
10 1 SER B 99  ? ? -142.81 32.56   
11 1 ASN B 234 ? ? -114.47 -169.26 
12 1 SER B 326 ? ? -141.98 -17.44  
13 1 PRO B 421 ? ? -39.44  105.00  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A THR 369 ? O ? A THR 369 O 
2 1 Y 1 B GLU 424 ? O ? B GLU 424 O 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A ALA 2   ? A ALA 2   
3  1 Y 1 A ALA 3   ? A ALA 3   
4  1 Y 1 A THR 4   ? A THR 4   
5  1 Y 1 A GLU 5   ? A GLU 5   
6  1 Y 1 A GLY 6   ? A GLY 6   
7  1 Y 1 A VAL 7   ? A VAL 7   
8  1 Y 1 A GLY 8   ? A GLY 8   
9  1 Y 1 A GLU 9   ? A GLU 9   
10 1 Y 1 A ALA 10  ? A ALA 10  
11 1 Y 1 A ALA 11  ? A ALA 11  
12 1 Y 1 A GLN 12  ? A GLN 12  
13 1 Y 1 A GLY 13  ? A GLY 13  
14 1 Y 1 A GLY 14  ? A GLY 14  
15 1 Y 1 A GLU 15  ? A GLU 15  
16 1 Y 1 A PRO 16  ? A PRO 16  
17 1 Y 1 A GLY 17  ? A GLY 17  
18 1 Y 1 A GLN 18  ? A GLN 18  
19 1 Y 1 A PRO 19  ? A PRO 19  
20 1 Y 1 A ALA 20  ? A ALA 20  
21 1 Y 1 A GLN 21  ? A GLN 21  
22 1 Y 1 A PRO 22  ? A PRO 22  
23 1 Y 1 A PRO 23  ? A PRO 23  
24 1 Y 1 A PRO 24  ? A PRO 24  
25 1 Y 1 A GLN 25  ? A GLN 25  
26 1 Y 1 A PRO 26  ? A PRO 26  
27 1 Y 1 A HIS 27  ? A HIS 27  
28 1 Y 1 A PRO 28  ? A PRO 28  
29 1 Y 1 A PRO 29  ? A PRO 29  
30 1 Y 1 A PRO 30  ? A PRO 30  
31 1 Y 1 A PRO 31  ? A PRO 31  
32 1 Y 1 A GLN 32  ? A GLN 32  
33 1 Y 1 A GLN 33  ? A GLN 33  
34 1 Y 1 A GLN 34  ? A GLN 34  
35 1 Y 1 A HIS 35  ? A HIS 35  
36 1 Y 1 A LYS 36  ? A LYS 36  
37 1 Y 1 A GLU 37  ? A GLU 37  
38 1 Y 1 A GLU 38  ? A GLU 38  
39 1 Y 1 A MET 39  ? A MET 39  
40 1 Y 1 A ALA 40  ? A ALA 40  
41 1 Y 1 A ALA 41  ? A ALA 41  
42 1 Y 1 A GLU 42  ? A GLU 42  
43 1 Y 1 A ALA 43  ? A ALA 43  
44 1 Y 1 A GLY 44  ? A GLY 44  
45 1 Y 1 A GLU 45  ? A GLU 45  
46 1 Y 1 A ALA 46  ? A ALA 46  
47 1 Y 1 A VAL 47  ? A VAL 47  
48 1 Y 1 A ALA 48  ? A ALA 48  
49 1 Y 1 A SER 49  ? A SER 49  
50 1 Y 1 A PRO 50  ? A PRO 50  
51 1 Y 1 A MET 51  ? A MET 51  
52 1 Y 1 A ASP 52  ? A ASP 52  
53 1 Y 1 A ASP 53  ? A ASP 53  
54 1 Y 1 A GLY 54  ? A GLY 54  
55 1 Y 1 A GLU 370 ? A GLU 370 
56 1 Y 1 A ASN 371 ? A ASN 371 
57 1 Y 1 A ASP 372 ? A ASP 372 
58 1 Y 1 A SER 373 ? A SER 373 
59 1 Y 1 A PRO 374 ? A PRO 374 
60 1 Y 1 A THR 375 ? A THR 375 
61 1 Y 1 A ASN 376 ? A ASN 376 
62 1 Y 1 A VAL 377 ? A VAL 377 
63 1 Y 1 A GLN 378 ? A GLN 378 
64 1 Y 1 A GLN 379 ? A GLN 379 
65 1 Y 1 A GLU 380 ? A GLU 380 
66 1 Y 1 A GLU 381 ? A GLU 381 
67 1 Y 1 A PHE 382 ? A PHE 382 
68 1 Y 1 B MET 1   ? B MET 1   
69 1 Y 1 B ALA 2   ? B ALA 2   
70 1 Y 1 B SER 3   ? B SER 3   
71 1 Y 1 B PRO 4   ? B PRO 4   
72 1 Y 1 B SER 5   ? B SER 5   
73 1 Y 1 B SER 6   ? B SER 6   
74 1 Y 1 B PHE 7   ? B PHE 7   
75 1 Y 1 B THR 8   ? B THR 8   
76 1 Y 1 B TYR 9   ? B TYR 9   
77 1 Y 1 B TYR 10  ? B TYR 10  
78 1 Y 1 B CYS 11  ? B CYS 11  
79 1 Y 1 B PRO 12  ? B PRO 12  
80 1 Y 1 B PRO 13  ? B PRO 13  
81 1 Y 1 B SER 14  ? B SER 14  
82 1 Y 1 B GLU 425 ? B GLU 425 
83 1 Y 1 B LEU 426 ? B LEU 426 
84 1 Y 1 B LYS 427 ? B LYS 427 
85 1 Y 1 B ASP 428 ? B ASP 428 
86 1 Y 1 B GLU 429 ? B GLU 429 
87 1 Y 1 B THR 430 ? B THR 430 
88 1 Y 1 B SER 431 ? B SER 431 
89 1 Y 1 B ALA 432 ? B ALA 432 
90 1 Y 1 B GLU 433 ? B GLU 433 
91 1 Y 1 B PRO 434 ? B PRO 434 
92 1 Y 1 B ALA 435 ? B ALA 435 
93 1 Y 1 B THR 436 ? B THR 436 
94 1 Y 1 B ASP 437 ? B ASP 437 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
C 3 GLC 1 C GLC 1 ? SUC 4 n 
C 3 FRU 2 C FRU 2 ? SUC 4 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
FRU 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DFrufb             
FRU 'COMMON NAME'                         GMML     1.0 b-D-fructofuranose 
FRU 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-Fruf           
FRU 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Fru                
GLC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpa             
GLC 'COMMON NAME'                         GMML     1.0 a-D-glucopyranose  
GLC 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 a-D-Glcp           
GLC 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Glc                
# 
_pdbx_entity_branch.entity_id   3 
_pdbx_entity_branch.type        oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 3 DFrufb2-1DGlcpa                                            'Glycam Condensed Sequence' GMML       1.0   
2 3 'WURCS=2.0/2,2,1/[ha122h-2b_2-5][a2122h-1a_1-5]/1-2/a2-b1' WURCS                       PDB2Glycan 1.1.0 
3 3 '[][b-D-Fruf]{[(2+1)][a-D-Glcp]{}}'                        LINUCS                      PDB-CARE   ?     
# 
_pdbx_entity_branch_link.link_id                    1 
_pdbx_entity_branch_link.entity_id                  3 
_pdbx_entity_branch_link.entity_branch_list_num_1   1 
_pdbx_entity_branch_link.comp_id_1                  GLC 
_pdbx_entity_branch_link.atom_id_1                  C1 
_pdbx_entity_branch_link.leaving_atom_id_1          O1 
_pdbx_entity_branch_link.entity_branch_list_num_2   2 
_pdbx_entity_branch_link.comp_id_2                  FRU 
_pdbx_entity_branch_link.atom_id_2                  O2 
_pdbx_entity_branch_link.leaving_atom_id_2          HO2 
_pdbx_entity_branch_link.value_order                sing 
_pdbx_entity_branch_link.details                    ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
3 GLC 1 n 
3 FRU 2 n 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'ZINC ION'                                                                                                     ZN  
5 'FARNESYL DIPHOSPHATE'                                                                                         FPP 
6 '6-[(S)-AMINO(4-CHLOROPHENYL)(1-METHYL-1H-IMIDAZOL-5-YL)METHYL]-4-(3-CHLOROPHENYL)-1-METHYLQUINOLIN-2(1H)-ONE' JAN 
7 water                                                                                                          HOH 
#