data_1SCF
# 
_entry.id   1SCF 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1SCF         
WWPDB D_1000176314 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1SCF 
_pdbx_database_status.recvd_initial_deposition_date   1998-06-04 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Jiang, X.'         1 
'Gurel, O.'         2 
'Langley, K.E.'     3 
'Hendrickson, W.A.' 4 
# 
_citation.id                        primary 
_citation.title                     
'Structure of the active core of human stem cell factor and analysis of binding to its receptor kit.' 
_citation.journal_abbrev            'EMBO J.' 
_citation.journal_volume            19 
_citation.page_first                3192 
_citation.page_last                 3203 
_citation.year                      2000 
_citation.journal_id_ASTM           EMJODG 
_citation.country                   UK 
_citation.journal_id_ISSN           0261-4189 
_citation.journal_id_CSD            0897 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10880433 
_citation.pdbx_database_id_DOI      10.1093/emboj/19.13.3192 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Jiang, X.'         1  
primary 'Gurel, O.'         2  
primary 'Mendiaz, E.A.'     3  
primary 'Stearns, G.W.'     4  
primary 'Clogston, C.L.'    5  
primary 'Lu, H.S.'          6  
primary 'Osslund, T.D.'     7  
primary 'Syed, R.S.'        8  
primary 'Langley, K.E.'     9  
primary 'Hendrickson, W.A.' 10 
# 
_cell.entry_id           1SCF 
_cell.length_a           71.820 
_cell.length_b           82.550 
_cell.length_c           88.190 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1SCF 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'STEM CELL FACTOR'     31074.225 4   ? ? ? ? 
2 non-polymer syn 'PENTAETHYLENE GLYCOL' 238.278   1   ? ? ? ? 
3 non-polymer syn 'CALCIUM ION'          40.078    3   ? ? ? ? 
4 water       nat water                  18.015    264 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'SCF, SL, MGF, MAST CELL GROWTH FACTOR' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;MKKTQTWILTCIYLQLLLFNPLVKTEGICRNRVTNNVKDVTKLVANLPKDY(MSE)ITLKYVPG(MSE)DVLPSHCWISE
(MSE)VVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSI
DAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLHWAAMALPALFSLII
GFAFGALYWKKRQPSLTRAVENIQINEEDNEISMLQEKEREFQEV
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MKKTQTWILTCIYLQLLLFNPLVKTEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDS
LTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASET
SDCVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLHWAAMALPALFSLIIGFAFGALYWKKR
QPSLTRAVENIQINEEDNEISMLQEKEREFQEV
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LYS n 
1 3   LYS n 
1 4   THR n 
1 5   GLN n 
1 6   THR n 
1 7   TRP n 
1 8   ILE n 
1 9   LEU n 
1 10  THR n 
1 11  CYS n 
1 12  ILE n 
1 13  TYR n 
1 14  LEU n 
1 15  GLN n 
1 16  LEU n 
1 17  LEU n 
1 18  LEU n 
1 19  PHE n 
1 20  ASN n 
1 21  PRO n 
1 22  LEU n 
1 23  VAL n 
1 24  LYS n 
1 25  THR n 
1 26  GLU n 
1 27  GLY n 
1 28  ILE n 
1 29  CYS n 
1 30  ARG n 
1 31  ASN n 
1 32  ARG n 
1 33  VAL n 
1 34  THR n 
1 35  ASN n 
1 36  ASN n 
1 37  VAL n 
1 38  LYS n 
1 39  ASP n 
1 40  VAL n 
1 41  THR n 
1 42  LYS n 
1 43  LEU n 
1 44  VAL n 
1 45  ALA n 
1 46  ASN n 
1 47  LEU n 
1 48  PRO n 
1 49  LYS n 
1 50  ASP n 
1 51  TYR n 
1 52  MSE n 
1 53  ILE n 
1 54  THR n 
1 55  LEU n 
1 56  LYS n 
1 57  TYR n 
1 58  VAL n 
1 59  PRO n 
1 60  GLY n 
1 61  MSE n 
1 62  ASP n 
1 63  VAL n 
1 64  LEU n 
1 65  PRO n 
1 66  SER n 
1 67  HIS n 
1 68  CYS n 
1 69  TRP n 
1 70  ILE n 
1 71  SER n 
1 72  GLU n 
1 73  MSE n 
1 74  VAL n 
1 75  VAL n 
1 76  GLN n 
1 77  LEU n 
1 78  SER n 
1 79  ASP n 
1 80  SER n 
1 81  LEU n 
1 82  THR n 
1 83  ASP n 
1 84  LEU n 
1 85  LEU n 
1 86  ASP n 
1 87  LYS n 
1 88  PHE n 
1 89  SER n 
1 90  ASN n 
1 91  ILE n 
1 92  SER n 
1 93  GLU n 
1 94  GLY n 
1 95  LEU n 
1 96  SER n 
1 97  ASN n 
1 98  TYR n 
1 99  SER n 
1 100 ILE n 
1 101 ILE n 
1 102 ASP n 
1 103 LYS n 
1 104 LEU n 
1 105 VAL n 
1 106 ASN n 
1 107 ILE n 
1 108 VAL n 
1 109 ASP n 
1 110 ASP n 
1 111 LEU n 
1 112 VAL n 
1 113 GLU n 
1 114 CYS n 
1 115 VAL n 
1 116 LYS n 
1 117 GLU n 
1 118 ASN n 
1 119 SER n 
1 120 SER n 
1 121 LYS n 
1 122 ASP n 
1 123 LEU n 
1 124 LYS n 
1 125 LYS n 
1 126 SER n 
1 127 PHE n 
1 128 LYS n 
1 129 SER n 
1 130 PRO n 
1 131 GLU n 
1 132 PRO n 
1 133 ARG n 
1 134 LEU n 
1 135 PHE n 
1 136 THR n 
1 137 PRO n 
1 138 GLU n 
1 139 GLU n 
1 140 PHE n 
1 141 PHE n 
1 142 ARG n 
1 143 ILE n 
1 144 PHE n 
1 145 ASN n 
1 146 ARG n 
1 147 SER n 
1 148 ILE n 
1 149 ASP n 
1 150 ALA n 
1 151 PHE n 
1 152 LYS n 
1 153 ASP n 
1 154 PHE n 
1 155 VAL n 
1 156 VAL n 
1 157 ALA n 
1 158 SER n 
1 159 GLU n 
1 160 THR n 
1 161 SER n 
1 162 ASP n 
1 163 CYS n 
1 164 VAL n 
1 165 VAL n 
1 166 SER n 
1 167 SER n 
1 168 THR n 
1 169 LEU n 
1 170 SER n 
1 171 PRO n 
1 172 GLU n 
1 173 LYS n 
1 174 ASP n 
1 175 SER n 
1 176 ARG n 
1 177 VAL n 
1 178 SER n 
1 179 VAL n 
1 180 THR n 
1 181 LYS n 
1 182 PRO n 
1 183 PHE n 
1 184 MET n 
1 185 LEU n 
1 186 PRO n 
1 187 PRO n 
1 188 VAL n 
1 189 ALA n 
1 190 ALA n 
1 191 SER n 
1 192 SER n 
1 193 LEU n 
1 194 ARG n 
1 195 ASN n 
1 196 ASP n 
1 197 SER n 
1 198 SER n 
1 199 SER n 
1 200 SER n 
1 201 ASN n 
1 202 ARG n 
1 203 LYS n 
1 204 ALA n 
1 205 LYS n 
1 206 ASN n 
1 207 PRO n 
1 208 PRO n 
1 209 GLY n 
1 210 ASP n 
1 211 SER n 
1 212 SER n 
1 213 LEU n 
1 214 HIS n 
1 215 TRP n 
1 216 ALA n 
1 217 ALA n 
1 218 MET n 
1 219 ALA n 
1 220 LEU n 
1 221 PRO n 
1 222 ALA n 
1 223 LEU n 
1 224 PHE n 
1 225 SER n 
1 226 LEU n 
1 227 ILE n 
1 228 ILE n 
1 229 GLY n 
1 230 PHE n 
1 231 ALA n 
1 232 PHE n 
1 233 GLY n 
1 234 ALA n 
1 235 LEU n 
1 236 TYR n 
1 237 TRP n 
1 238 LYS n 
1 239 LYS n 
1 240 ARG n 
1 241 GLN n 
1 242 PRO n 
1 243 SER n 
1 244 LEU n 
1 245 THR n 
1 246 ARG n 
1 247 ALA n 
1 248 VAL n 
1 249 GLU n 
1 250 ASN n 
1 251 ILE n 
1 252 GLN n 
1 253 ILE n 
1 254 ASN n 
1 255 GLU n 
1 256 GLU n 
1 257 ASP n 
1 258 ASN n 
1 259 GLU n 
1 260 ILE n 
1 261 SER n 
1 262 MET n 
1 263 LEU n 
1 264 GLN n 
1 265 GLU n 
1 266 LYS n 
1 267 GLU n 
1 268 ARG n 
1 269 GLU n 
1 270 PHE n 
1 271 GLN n 
1 272 GLU n 
1 273 VAL n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SCF_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P21583 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MKKTQTWILTCIYLQLLLFNPLVKTEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDS
LTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASET
SDCVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLHWAAMALPALFSLIIGFAFGALYWKKR
QPSLTRAVENIQINEEDNEISMLQEKEREFQEV
;
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1SCF A 1 ? 273 ? P21583 1 ? 273 ? -24 248 
2 1 1SCF B 1 ? 273 ? P21583 1 ? 273 ? -24 248 
3 1 1SCF C 1 ? 273 ? P21583 1 ? 273 ? -24 248 
4 1 1SCF D 1 ? 273 ? P21583 1 ? 273 ? -24 248 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1SCF MSE A 52 ? UNP P21583 MET 52 MODIFIED 27 1  
1 1SCF MSE A 61 ? UNP P21583 MET 61 MODIFIED 36 2  
1 1SCF MSE A 73 ? UNP P21583 MET 73 MODIFIED 48 3  
2 1SCF MSE B 52 ? UNP P21583 MET 52 MODIFIED 27 4  
2 1SCF MSE B 61 ? UNP P21583 MET 61 MODIFIED 36 5  
2 1SCF MSE B 73 ? UNP P21583 MET 73 MODIFIED 48 6  
3 1SCF MSE C 52 ? UNP P21583 MET 52 MODIFIED 27 7  
3 1SCF MSE C 61 ? UNP P21583 MET 61 MODIFIED 36 8  
3 1SCF MSE C 73 ? UNP P21583 MET 73 MODIFIED 48 9  
4 1SCF MSE D 52 ? UNP P21583 MET 52 MODIFIED 27 10 
4 1SCF MSE D 61 ? UNP P21583 MET 61 MODIFIED 36 11 
4 1SCF MSE D 73 ? UNP P21583 MET 73 MODIFIED 48 12 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
1PE non-polymer         . 'PENTAETHYLENE GLYCOL' PEG400 'C10 H22 O6'     238.278 
ALA 'L-peptide linking' y ALANINE                ?      'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE               ?      'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE             ?      'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'        ?      'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'          ?      'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE               ?      'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE              ?      'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'        ?      'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                ?      'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE              ?      'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                  ?      'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE             ?      'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                ?      'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                 ?      'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE             ?      'C5 H11 N O2 S'  149.211 
MSE 'L-peptide linking' n SELENOMETHIONINE       ?      'C5 H11 N O2 Se' 196.106 
PHE 'L-peptide linking' y PHENYLALANINE          ?      'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                ?      'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                 ?      'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE              ?      'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN             ?      'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE               ?      'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                 ?      'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1SCF 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.40 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 7.40' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           110.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   FUJI 
_diffrn_detector.pdbx_collection_date   1995-07 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             MAD 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.986 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X4A' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X4A 
_diffrn_source.pdbx_wavelength             0.986 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1SCF 
_reflns.observed_criterion_sigma_I   -3.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             25.000 
_reflns.d_resolution_high            2.000 
_reflns.number_obs                   65689 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         94.9 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.056 
_reflns.pdbx_netI_over_sigmaI        15.3000 
_reflns.B_iso_Wilson_estimate        38.50 
_reflns.pdbx_redundancy              2.750 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.00 
_reflns_shell.d_res_low              2.07 
_reflns_shell.percent_possible_all   72.0 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.581 
_reflns_shell.meanI_over_sigI_obs    1.600 
_reflns_shell.pdbx_redundancy        2.23 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1SCF 
_refine.ls_number_reflns_obs                     49851 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.000 
_refine.pdbx_data_cutoff_high_absF               100000.000 
_refine.pdbx_data_cutoff_low_absF                0.1000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            2.20 
_refine.ls_percent_reflns_obs                    96.6 
_refine.ls_R_factor_obs                          0.199 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.199 
_refine.ls_R_factor_R_free                       0.242 
_refine.ls_R_factor_R_free_error                 0.004 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 6.000 
_refine.ls_number_reflns_R_free                  3016 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               32.10 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;REFINEMENT WAS PERFORMED WITH ANOMALOUS ON; PARAM19_MOD.PRO AND TOPH19_MOD.PRO ARE MODIFIED PARAMETER AND TOPOLOGY FILES OF PARAM19.PRO AND TOPH19.PRO, RESPECTIVELY, FOR SELENOMETHIONYL PROTEINS. NCS RESTRAINTS WERE APPLIED ONLY DURING THE INITIAL REFINEMENT.
;
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3517 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         19 
_refine_hist.number_atoms_solvent             264 
_refine_hist.number_atoms_total               3800 
_refine_hist.d_res_high                       2.20 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.016 ?     ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             2.50  ?     ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      22.80 ?     ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      2.05  ?     ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             1.20  1.500 ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            1.60  2.000 ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             2.10  2.000 ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            2.40  2.500 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_restr_ncs.dom_id              1 
_refine_ls_restr_ncs.ncs_model_details   RESTRAINTS 
_refine_ls_restr_ncs.rms_dev_position    ? 
_refine_ls_restr_ncs.weight_position     ? 
_refine_ls_restr_ncs.rms_dev_B_iso       ? 
_refine_ls_restr_ncs.weight_B_iso        ? 
_refine_ls_restr_ncs.pdbx_type           . 
_refine_ls_restr_ncs.pdbx_auth_asym_id   . 
_refine_ls_restr_ncs.pdbx_ens_id         1 
_refine_ls_restr_ncs.pdbx_refine_id      'X-RAY DIFFRACTION' 
_refine_ls_restr_ncs.pdbx_ordinal        1 
_refine_ls_restr_ncs.pdbx_number         ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   10 
_refine_ls_shell.d_res_high                       2.00 
_refine_ls_shell.d_res_low                        2.28 
_refine_ls_shell.number_reflns_R_work             4349 
_refine_ls_shell.R_factor_R_work                  0.3159 
_refine_ls_shell.percent_reflns_obs               97.00 
_refine_ls_shell.R_factor_R_free                  0.345 
_refine_ls_shell.R_factor_R_free_error            0.019 
_refine_ls_shell.percent_reflns_R_free            6.40 
_refine_ls_shell.number_reflns_R_free             302 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PARAM19_MOD.PRO   TOPH19_MOD.PRO 'X-RAY DIFFRACTION' 
2 PARAM19.SOL       TOPH19.SOL     'X-RAY DIFFRACTION' 
3 HETEROPARAM19.PAR HETERO.TOP     'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.details 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
1 given ? 0.915300  0.368400  0.162800  0.357100  -0.929200 0.095000  0.186300  -0.028800 -0.982100 -10.34380 35.55670 43.17570  
2 given ? -0.935658 -0.315827 -0.157471 -0.265278 0.923709  -0.276386 0.232747  -0.216829 -0.948058 63.79985  17.94411 63.68074  
3 given ? -0.994700 0.088300  -0.051700 -0.094000 -0.988400 0.119100  -0.040600 0.123400  0.991500  54.54720  48.88150 -20.54390 
4 given ? -0.991100 0.100500  -0.087800 -0.117800 -0.968000 0.221700  -0.062700 0.230100  0.971100  55.16840  45.07210 -21.92400 
5 given ? -0.951900 -0.248300 0.179700  -0.277100 0.947600  -0.158800 -0.130900 -0.200900 -0.970800 52.26270  13.33780 74.41510  
6 given ? 0.984200  0.147100  -0.098100 0.142600  -0.988400 -0.052100 -0.104600 0.037300  -0.993800 0.55340   52.60730 86.74100  
7 given ? -0.955400 -0.244200 0.166100  -0.269500 0.950900  -0.152200 -0.120800 -0.190100 -0.974300 52.84290  12.52990 73.76110  
# 
_struct_ncs_dom.id            1 
_struct_ncs_dom.pdbx_ens_id   1 
_struct_ncs_dom.details       ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  1SCF 
_struct.title                     'HUMAN RECOMBINANT STEM CELL FACTOR' 
_struct.pdbx_descriptor           'STEM CELL FACTOR, PENTAETHYLENE GLYCOL' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1SCF 
_struct_keywords.pdbx_keywords   'HORMONE/GROWTH FACTOR' 
_struct_keywords.text            
'HUMAN STEM CELL FACTOR, STEEL FACTOR, KIT LIGAND, MAST CELL GROWTH FACTOR, HORMONE-GROWTH FACTOR COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
I N N 4 ? 
J N N 4 ? 
K N N 4 ? 
L N N 4 ? 
# 
loop_
_struct_biol.id 
1 
2 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  VAL A 37  ? ASN A 46  ? VAL A 12  ASN A 21  1 ? 10 
HELX_P HELX_P2  2  SER A 66  ? CYS A 68  ? SER A 41  CYS A 43  5 ? 3  
HELX_P HELX_P3  3  SER A 71  ? LYS A 87  ? SER A 46  LYS A 62  5 ? 17 
HELX_P HELX_P4  4  ASN A 97  ? CYS A 114 ? ASN A 72  CYS A 89  1 ? 18 
HELX_P HELX_P5  5  PRO A 137 ? LYS A 152 ? PRO A 112 LYS A 127 1 ? 16 
HELX_P HELX_P6  6  VAL B 37  ? ASN B 46  ? VAL B 12  ASN B 21  1 ? 10 
HELX_P HELX_P7  7  SER B 66  ? CYS B 68  ? SER B 41  CYS B 43  5 ? 3  
HELX_P HELX_P8  8  SER B 71  ? LYS B 87  ? SER B 46  LYS B 62  5 ? 17 
HELX_P HELX_P9  9  ASN B 97  ? GLU B 117 ? ASN B 72  GLU B 92  1 ? 21 
HELX_P HELX_P10 10 PRO B 137 ? LYS B 152 ? PRO B 112 LYS B 127 1 ? 16 
HELX_P HELX_P11 11 VAL C 37  ? ASN C 46  ? VAL C 12  ASN C 21  1 ? 10 
HELX_P HELX_P12 12 SER C 66  ? LYS C 87  ? SER C 41  LYS C 62  1 ? 22 
HELX_P HELX_P13 13 ASN C 97  ? VAL C 115 ? ASN C 72  VAL C 90  1 ? 19 
HELX_P HELX_P14 14 PRO C 137 ? ASP C 149 ? PRO C 112 ASP C 124 1 ? 13 
HELX_P HELX_P15 15 VAL D 37  ? ASN D 46  ? VAL D 12  ASN D 21  1 ? 10 
HELX_P HELX_P16 16 SER D 66  ? CYS D 68  ? SER D 41  CYS D 43  5 ? 3  
HELX_P HELX_P17 17 SER D 71  ? LYS D 87  ? SER D 46  LYS D 62  5 ? 17 
HELX_P HELX_P18 18 ASN D 97  ? CYS D 114 ? ASN D 72  CYS D 89  1 ? 18 
HELX_P HELX_P19 19 PRO D 137 ? ALA D 150 ? PRO D 112 ALA D 125 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 68 SG ? ? ? 1_555 A CYS 163 SG  ? ? A CYS 43   A CYS 138  1_555 ? ? ? ? ? ? ? 2.061 ? 
disulf2  disulf ? ? B CYS 68 SG ? ? ? 1_555 B CYS 163 SG  ? ? B CYS 43   B CYS 138  1_555 ? ? ? ? ? ? ? 2.043 ? 
covale1  covale ? ? A MSE 52 N  ? ? ? 1_555 A TYR 51  C   ? ? A MSE 27   A TYR 26   1_555 ? ? ? ? ? ? ? 1.310 ? 
covale2  covale ? ? A MSE 52 C  ? ? ? 1_555 A ILE 53  N   ? ? A MSE 27   A ILE 28   1_555 ? ? ? ? ? ? ? 1.339 ? 
covale3  covale ? ? A MSE 61 N  ? ? ? 1_555 A GLY 60  C   ? ? A MSE 36   A GLY 35   1_555 ? ? ? ? ? ? ? 1.332 ? 
covale4  covale ? ? A MSE 61 C  ? ? ? 1_555 A ASP 62  N   ? ? A MSE 36   A ASP 37   1_555 ? ? ? ? ? ? ? 1.341 ? 
covale5  covale ? ? A MSE 73 N  ? ? ? 1_555 A GLU 72  C   ? ? A MSE 48   A GLU 47   1_555 ? ? ? ? ? ? ? 1.324 ? 
covale6  covale ? ? A MSE 73 C  ? ? ? 1_555 A VAL 74  N   ? ? A MSE 48   A VAL 49   1_555 ? ? ? ? ? ? ? 1.334 ? 
covale7  covale ? ? B MSE 52 N  ? ? ? 1_555 B TYR 51  C   ? ? B MSE 27   B TYR 26   1_555 ? ? ? ? ? ? ? 1.325 ? 
covale8  covale ? ? B MSE 52 C  ? ? ? 1_555 B ILE 53  N   ? ? B MSE 27   B ILE 28   1_555 ? ? ? ? ? ? ? 1.330 ? 
covale9  covale ? ? B MSE 61 N  ? ? ? 1_555 B GLY 60  C   ? ? B MSE 36   B GLY 35   1_555 ? ? ? ? ? ? ? 1.317 ? 
covale10 covale ? ? B MSE 61 C  ? ? ? 1_555 B ASP 62  N   ? ? B MSE 36   B ASP 37   1_555 ? ? ? ? ? ? ? 1.340 ? 
covale11 covale ? ? B MSE 73 N  ? ? ? 1_555 B GLU 72  C   ? ? B MSE 48   B GLU 47   1_555 ? ? ? ? ? ? ? 1.332 ? 
covale12 covale ? ? B MSE 73 C  ? ? ? 1_555 B VAL 74  N   ? ? B MSE 48   B VAL 49   1_555 ? ? ? ? ? ? ? 1.348 ? 
covale13 covale ? ? C MSE 52 N  ? ? ? 1_555 C TYR 51  C   ? ? C MSE 27   C TYR 26   1_555 ? ? ? ? ? ? ? 1.319 ? 
covale14 covale ? ? C MSE 52 C  ? ? ? 1_555 C ILE 53  N   ? ? C MSE 27   C ILE 28   1_555 ? ? ? ? ? ? ? 1.347 ? 
covale15 covale ? ? C MSE 61 N  ? ? ? 1_555 C GLY 60  C   ? ? C MSE 36   C GLY 35   1_555 ? ? ? ? ? ? ? 1.328 ? 
covale16 covale ? ? C MSE 61 C  ? ? ? 1_555 C ASP 62  N   ? ? C MSE 36   C ASP 37   1_555 ? ? ? ? ? ? ? 1.334 ? 
covale17 covale ? ? C MSE 73 N  ? ? ? 1_555 C GLU 72  C   ? ? C MSE 48   C GLU 47   1_555 ? ? ? ? ? ? ? 1.339 ? 
covale18 covale ? ? C MSE 73 C  ? ? ? 1_555 C VAL 74  N   ? ? C MSE 48   C VAL 49   1_555 ? ? ? ? ? ? ? 1.338 ? 
covale19 covale ? ? D MSE 52 N  ? ? ? 1_555 D TYR 51  C   ? ? D MSE 27   D TYR 26   1_555 ? ? ? ? ? ? ? 1.334 ? 
covale20 covale ? ? D MSE 52 C  ? ? ? 1_555 D ILE 53  N   ? ? D MSE 27   D ILE 28   1_555 ? ? ? ? ? ? ? 1.320 ? 
covale21 covale ? ? D MSE 61 N  ? ? ? 1_555 D GLY 60  C   ? ? D MSE 36   D GLY 35   1_555 ? ? ? ? ? ? ? 1.316 ? 
covale22 covale ? ? D MSE 61 C  ? ? ? 1_555 D ASP 62  N   ? ? D MSE 36   D ASP 37   1_555 ? ? ? ? ? ? ? 1.334 ? 
covale23 covale ? ? D MSE 73 N  ? ? ? 1_555 D GLU 72  C   ? ? D MSE 48   D GLU 47   1_555 ? ? ? ? ? ? ? 1.328 ? 
covale24 covale ? ? D MSE 73 C  ? ? ? 1_555 D VAL 74  N   ? ? D MSE 48   D VAL 49   1_555 ? ? ? ? ? ? ? 1.331 ? 
metalc1  metalc ? ? G CA  .  CA ? ? ? 1_555 L HOH .   O   ? ? D CA  1021 D HOH 1024 1_555 ? ? ? ? ? ? ? 2.365 ? 
metalc2  metalc ? ? G CA  .  CA ? ? ? 1_555 L HOH .   O   ? ? D CA  1021 D HOH 1025 1_555 ? ? ? ? ? ? ? 2.377 ? 
metalc3  metalc ? ? F CA  .  CA ? ? ? 1_555 K HOH .   O   ? ? C CA  1023 C HOH 1027 1_555 ? ? ? ? ? ? ? 2.389 ? 
metalc4  metalc ? ? F CA  .  CA ? ? ? 1_555 K HOH .   O   ? ? C CA  1023 C HOH 1028 1_555 ? ? ? ? ? ? ? 2.406 ? 
metalc5  metalc ? ? F CA  .  CA ? ? ? 1_555 K HOH .   O   ? ? C CA  1023 C HOH 1029 1_555 ? ? ? ? ? ? ? 2.372 ? 
metalc6  metalc ? ? F CA  .  CA ? ? ? 1_555 C ASN 106 OD1 ? ? C CA  1023 C ASN 81   1_555 ? ? ? ? ? ? ? 2.806 ? 
metalc7  metalc ? ? G CA  .  CA ? ? ? 1_555 D GLU 138 OE1 ? ? D CA  1021 D GLU 113  1_555 ? ? ? ? ? ? ? 2.695 ? 
metalc8  metalc ? ? G CA  .  CA ? ? ? 1_555 D GLU 138 OE2 ? ? D CA  1021 D GLU 113  1_555 ? ? ? ? ? ? ? 2.522 ? 
metalc9  metalc ? ? H CA  .  CA ? ? ? 1_555 D ASP 79  OD1 ? ? D CA  1022 D ASP 54   1_555 ? ? ? ? ? ? ? 2.577 ? 
metalc10 metalc ? ? H CA  .  CA ? ? ? 1_555 L HOH .   O   ? ? D CA  1022 D HOH 1157 1_555 ? ? ? ? ? ? ? 2.607 ? 
metalc11 metalc ? ? H CA  .  CA ? ? ? 1_555 D ASP 83  OD1 ? ? D CA  1022 D ASP 58   1_555 ? ? ? ? ? ? ? 3.028 ? 
metalc12 metalc ? ? H CA  .  CA ? ? ? 1_555 D ASP 83  OD2 ? ? D CA  1022 D ASP 58   1_555 ? ? ? ? ? ? ? 2.778 ? 
metalc13 metalc ? ? H CA  .  CA ? ? ? 1_555 L HOH .   O   ? ? D CA  1022 D HOH 1026 1_555 ? ? ? ? ? ? ? 2.416 ? 
metalc14 metalc ? ? F CA  .  CA ? ? ? 1_555 J HOH .   O   ? ? C CA  1023 B HOH 1161 3_645 ? ? ? ? ? ? ? 2.660 ? 
metalc15 metalc ? ? F CA  .  CA ? ? ? 1_555 B PHE 127 O   ? ? C CA  1023 B PHE 102  3_645 ? ? ? ? ? ? ? 2.248 ? 
metalc16 metalc ? ? G CA  .  CA ? ? ? 1_555 A VAL 164 O   ? ? D CA  1021 A VAL 139  3_655 ? ? ? ? ? ? ? 2.180 ? 
metalc17 metalc ? ? G CA  .  CA ? ? ? 1_555 I HOH .   O   ? ? D CA  1021 A HOH 1507 3_655 ? ? ? ? ? ? ? 2.638 ? 
metalc18 metalc ? ? G CA  .  CA ? ? ? 1_555 A ASP 162 OD1 ? ? D CA  1021 A ASP 137  3_655 ? ? ? ? ? ? ? 2.677 ? 
metalc19 metalc ? ? H CA  .  CA ? ? ? 1_555 B ASP 110 OD1 ? ? D CA  1022 B ASP 85   2_565 ? ? ? ? ? ? ? 2.387 ? 
metalc20 metalc ? ? H CA  .  CA ? ? ? 1_555 B GLU 113 OE1 ? ? D CA  1022 B GLU 88   2_565 ? ? ? ? ? ? ? 3.008 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
metalc ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          SER 
_struct_mon_prot_cis.label_seq_id           129 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           SER 
_struct_mon_prot_cis.auth_seq_id            104 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    130 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     105 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -0.10 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 54  ? LYS A 56  ? THR A 29  LYS A 31  
A 2 PRO A 132 ? LEU A 134 ? PRO A 107 LEU A 109 
B 1 THR B 54  ? LYS B 56  ? THR B 29  LYS B 31  
B 2 PRO B 132 ? LEU B 134 ? PRO B 107 LEU B 109 
C 1 THR C 54  ? LYS C 56  ? THR C 29  LYS C 31  
C 2 PRO C 132 ? LEU C 134 ? PRO C 107 LEU C 109 
D 1 THR D 54  ? LYS D 56  ? THR D 29  LYS D 31  
D 2 PRO D 132 ? LEU D 134 ? PRO D 107 LEU D 109 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LEU A 55 ? O LEU A 30 N ARG A 133 ? N ARG A 108 
B 1 2 O LEU B 55 ? O LEU B 30 N ARG B 133 ? N ARG B 108 
C 1 2 O LEU C 55 ? O LEU C 30 N ARG C 133 ? N ARG C 108 
D 1 2 O LEU D 55 ? O LEU D 30 N ARG D 133 ? N ARG D 108 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA D 1021' 
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA D 1022' 
AC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA C 1023' 
AC4 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE 1PE B 249' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 ASP A 162 ? ASP A 137  . ? 3_655 ? 
2  AC1 6 VAL A 164 ? VAL A 139  . ? 3_655 ? 
3  AC1 6 HOH I .   ? HOH A 1507 . ? 3_655 ? 
4  AC1 6 GLU D 138 ? GLU D 113  . ? 1_555 ? 
5  AC1 6 HOH L .   ? HOH D 1024 . ? 1_555 ? 
6  AC1 6 HOH L .   ? HOH D 1025 . ? 1_555 ? 
7  AC2 6 ASP B 110 ? ASP B 85   . ? 2_565 ? 
8  AC2 6 GLU B 113 ? GLU B 88   . ? 2_565 ? 
9  AC2 6 ASP D 79  ? ASP D 54   . ? 1_555 ? 
10 AC2 6 ASP D 83  ? ASP D 58   . ? 1_555 ? 
11 AC2 6 HOH L .   ? HOH D 1026 . ? 1_555 ? 
12 AC2 6 HOH L .   ? HOH D 1157 . ? 1_555 ? 
13 AC3 6 PHE B 127 ? PHE B 102  . ? 3_645 ? 
14 AC3 6 HOH J .   ? HOH B 1161 . ? 3_645 ? 
15 AC3 6 ASN C 106 ? ASN C 81   . ? 1_555 ? 
16 AC3 6 HOH K .   ? HOH C 1027 . ? 1_555 ? 
17 AC3 6 HOH K .   ? HOH C 1028 . ? 1_555 ? 
18 AC3 6 HOH K .   ? HOH C 1029 . ? 1_555 ? 
19 AC4 7 SER A 166 ? SER A 141  . ? 3_655 ? 
20 AC4 7 ARG B 133 ? ARG B 108  . ? 1_555 ? 
21 AC4 7 ARG B 142 ? ARG B 117  . ? 1_555 ? 
22 AC4 7 TYR D 57  ? TYR D 32   . ? 1_555 ? 
23 AC4 7 ARG D 133 ? ARG D 108  . ? 1_555 ? 
24 AC4 7 PHE D 135 ? PHE D 110  . ? 1_555 ? 
25 AC4 7 GLU D 139 ? GLU D 114  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1SCF 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1SCF 
_atom_sites.fract_transf_matrix[1][1]   0.013924 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012114 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011339 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
S  
SE 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ASN A 1 36  ? 10.232 3.110   20.636 1.00 60.07 ? 11   ASN A N   1 
ATOM   2    C  CA  . ASN A 1 36  ? 9.176  3.892   19.994 1.00 59.79 ? 11   ASN A CA  1 
ATOM   3    C  C   . ASN A 1 36  ? 9.647  5.204   19.309 1.00 59.52 ? 11   ASN A C   1 
ATOM   4    O  O   . ASN A 1 36  ? 9.661  6.288   19.910 1.00 59.97 ? 11   ASN A O   1 
ATOM   5    C  CB  . ASN A 1 36  ? 8.113  4.228   21.038 1.00 60.46 ? 11   ASN A CB  1 
ATOM   6    N  N   . VAL A 1 37  ? 10.013 5.143   18.009 1.00 57.40 ? 12   VAL A N   1 
ATOM   7    C  CA  . VAL A 1 37  ? 10.715 6.225   17.309 1.00 53.71 ? 12   VAL A CA  1 
ATOM   8    C  C   . VAL A 1 37  ? 9.844  7.387   16.820 1.00 50.84 ? 12   VAL A C   1 
ATOM   9    O  O   . VAL A 1 37  ? 10.343 8.268   16.130 1.00 51.46 ? 12   VAL A O   1 
ATOM   10   C  CB  . VAL A 1 37  ? 11.541 5.657   16.126 1.00 53.25 ? 12   VAL A CB  1 
ATOM   11   N  N   . LYS A 1 38  ? 8.543  7.490   17.147 1.00 49.07 ? 13   LYS A N   1 
ATOM   12   C  CA  . LYS A 1 38  ? 7.721  8.640   16.756 1.00 44.35 ? 13   LYS A CA  1 
ATOM   13   C  C   . LYS A 1 38  ? 8.114  9.879   17.542 1.00 42.88 ? 13   LYS A C   1 
ATOM   14   O  O   . LYS A 1 38  ? 8.271  10.995  17.007 1.00 41.79 ? 13   LYS A O   1 
ATOM   15   C  CB  . LYS A 1 38  ? 6.258  8.378   17.093 1.00 44.76 ? 13   LYS A CB  1 
ATOM   16   N  N   . ASP A 1 39  ? 8.283  9.557   18.839 1.00 38.29 ? 14   ASP A N   1 
ATOM   17   C  CA  . ASP A 1 39  ? 8.609  10.545  19.818 1.00 35.56 ? 14   ASP A CA  1 
ATOM   18   C  C   . ASP A 1 39  ? 10.068 10.894  19.718 1.00 32.01 ? 14   ASP A C   1 
ATOM   19   O  O   . ASP A 1 39  ? 10.389 12.060  19.896 1.00 30.80 ? 14   ASP A O   1 
ATOM   20   C  CB  . ASP A 1 39  ? 8.151  10.072  21.200 1.00 38.77 ? 14   ASP A CB  1 
ATOM   21   C  CG  . ASP A 1 39  ? 6.725  10.518  21.630 1.00 43.77 ? 14   ASP A CG  1 
ATOM   22   O  OD1 . ASP A 1 39  ? 6.046  11.324  20.969 1.00 45.53 ? 14   ASP A OD1 1 
ATOM   23   O  OD2 . ASP A 1 39  ? 6.269  10.057  22.680 1.00 47.33 ? 14   ASP A OD2 1 
ATOM   24   N  N   . VAL A 1 40  ? 10.939 9.938   19.360 1.00 28.31 ? 15   VAL A N   1 
ATOM   25   C  CA  . VAL A 1 40  ? 12.335 10.224  19.089 1.00 27.35 ? 15   VAL A CA  1 
ATOM   26   C  C   . VAL A 1 40  ? 12.510 11.219  17.959 1.00 29.06 ? 15   VAL A C   1 
ATOM   27   O  O   . VAL A 1 40  ? 13.265 12.166  18.138 1.00 32.49 ? 15   VAL A O   1 
ATOM   28   C  CB  . VAL A 1 40  ? 13.191 8.976   18.792 1.00 26.33 ? 15   VAL A CB  1 
ATOM   29   C  CG1 . VAL A 1 40  ? 14.623 9.347   18.405 1.00 20.32 ? 15   VAL A CG1 1 
ATOM   30   C  CG2 . VAL A 1 40  ? 13.215 8.064   20.008 1.00 24.37 ? 15   VAL A CG2 1 
ATOM   31   N  N   . THR A 1 41  ? 11.858 11.085  16.807 1.00 28.42 ? 16   THR A N   1 
ATOM   32   C  CA  . THR A 1 41  ? 11.968 12.085  15.758 1.00 27.97 ? 16   THR A CA  1 
ATOM   33   C  C   . THR A 1 41  ? 11.386 13.413  16.208 1.00 25.43 ? 16   THR A C   1 
ATOM   34   O  O   . THR A 1 41  ? 12.020 14.418  15.905 1.00 25.82 ? 16   THR A O   1 
ATOM   35   C  CB  . THR A 1 41  ? 11.357 11.646  14.385 1.00 27.70 ? 16   THR A CB  1 
ATOM   36   O  OG1 . THR A 1 41  ? 9.959  11.529  14.588 1.00 32.27 ? 16   THR A OG1 1 
ATOM   37   C  CG2 . THR A 1 41  ? 11.931 10.335  13.912 1.00 25.71 ? 16   THR A CG2 1 
ATOM   38   N  N   . LYS A 1 42  ? 10.243 13.459  16.928 1.00 24.83 ? 17   LYS A N   1 
ATOM   39   C  CA  . LYS A 1 42  ? 9.701  14.698  17.482 1.00 23.60 ? 17   LYS A CA  1 
ATOM   40   C  C   . LYS A 1 42  ? 10.659 15.401  18.410 1.00 21.54 ? 17   LYS A C   1 
ATOM   41   O  O   . LYS A 1 42  ? 10.756 16.624  18.373 1.00 23.88 ? 17   LYS A O   1 
ATOM   42   C  CB  . LYS A 1 42  ? 8.365  14.488  18.206 1.00 27.08 ? 17   LYS A CB  1 
ATOM   43   C  CG  . LYS A 1 42  ? 7.291  14.120  17.198 1.00 34.84 ? 17   LYS A CG  1 
ATOM   44   C  CD  . LYS A 1 42  ? 5.881  14.040  17.781 1.00 40.64 ? 17   LYS A CD  1 
ATOM   45   C  CE  . LYS A 1 42  ? 4.800  13.911  16.665 1.00 45.98 ? 17   LYS A CE  1 
ATOM   46   N  NZ  . LYS A 1 42  ? 4.607  12.559  16.140 1.00 48.58 ? 17   LYS A NZ  1 
ATOM   47   N  N   . LEU A 1 43  ? 11.417 14.646  19.212 1.00 19.73 ? 18   LEU A N   1 
ATOM   48   C  CA  . LEU A 1 43  ? 12.377 15.207  20.151 1.00 17.98 ? 18   LEU A CA  1 
ATOM   49   C  C   . LEU A 1 43  ? 13.544 15.778  19.401 1.00 17.55 ? 18   LEU A C   1 
ATOM   50   O  O   . LEU A 1 43  ? 13.813 16.959  19.523 1.00 17.68 ? 18   LEU A O   1 
ATOM   51   C  CB  . LEU A 1 43  ? 12.875 14.144  21.121 1.00 17.63 ? 18   LEU A CB  1 
ATOM   52   C  CG  . LEU A 1 43  ? 13.850 14.582  22.216 1.00 15.34 ? 18   LEU A CG  1 
ATOM   53   C  CD1 . LEU A 1 43  ? 13.278 15.668  23.080 1.00 15.28 ? 18   LEU A CD1 1 
ATOM   54   C  CD2 . LEU A 1 43  ? 14.253 13.389  23.032 1.00 14.40 ? 18   LEU A CD2 1 
ATOM   55   N  N   . VAL A 1 44  ? 14.189 14.952  18.577 1.00 18.35 ? 19   VAL A N   1 
ATOM   56   C  CA  . VAL A 1 44  ? 15.187 15.421  17.628 1.00 19.40 ? 19   VAL A CA  1 
ATOM   57   C  C   . VAL A 1 44  ? 14.757 16.628  16.824 1.00 18.97 ? 19   VAL A C   1 
ATOM   58   O  O   . VAL A 1 44  ? 15.533 17.562  16.711 1.00 22.36 ? 19   VAL A O   1 
ATOM   59   C  CB  . VAL A 1 44  ? 15.668 14.325  16.729 1.00 18.19 ? 19   VAL A CB  1 
ATOM   60   C  CG1 . VAL A 1 44  ? 16.675 14.817  15.708 1.00 20.68 ? 19   VAL A CG1 1 
ATOM   61   C  CG2 . VAL A 1 44  ? 16.422 13.390  17.612 1.00 19.91 ? 19   VAL A CG2 1 
ATOM   62   N  N   . ALA A 1 45  ? 13.530 16.732  16.366 1.00 18.27 ? 20   ALA A N   1 
ATOM   63   C  CA  . ALA A 1 45  ? 13.105 17.946  15.719 1.00 17.82 ? 20   ALA A CA  1 
ATOM   64   C  C   . ALA A 1 45  ? 12.923 19.074  16.711 1.00 18.90 ? 20   ALA A C   1 
ATOM   65   O  O   . ALA A 1 45  ? 12.977 20.244  16.352 1.00 20.70 ? 20   ALA A O   1 
ATOM   66   C  CB  . ALA A 1 45  ? 11.777 17.661  15.059 1.00 17.70 ? 20   ALA A CB  1 
ATOM   67   N  N   . ASN A 1 46  ? 12.677 18.787  17.979 1.00 20.04 ? 21   ASN A N   1 
ATOM   68   C  CA  . ASN A 1 46  ? 12.450 19.852  18.933 1.00 20.73 ? 21   ASN A CA  1 
ATOM   69   C  C   . ASN A 1 46  ? 13.695 20.161  19.771 1.00 20.34 ? 21   ASN A C   1 
ATOM   70   O  O   . ASN A 1 46  ? 13.627 20.909  20.741 1.00 21.05 ? 21   ASN A O   1 
ATOM   71   C  CB  . ASN A 1 46  ? 11.235 19.456  19.751 1.00 20.84 ? 21   ASN A CB  1 
ATOM   72   C  CG  . ASN A 1 46  ? 10.409 20.664  20.103 1.00 21.87 ? 21   ASN A CG  1 
ATOM   73   O  OD1 . ASN A 1 46  ? 10.157 21.501  19.250 1.00 20.51 ? 21   ASN A OD1 1 
ATOM   74   N  ND2 . ASN A 1 46  ? 9.983  20.853  21.359 1.00 25.03 ? 21   ASN A ND2 1 
ATOM   75   N  N   . LEU A 1 47  ? 14.851 19.615  19.399 1.00 18.22 ? 22   LEU A N   1 
ATOM   76   C  CA  . LEU A 1 47  ? 16.129 19.924  20.000 1.00 17.27 ? 22   LEU A CA  1 
ATOM   77   C  C   . LEU A 1 47  ? 17.023 20.733  19.051 1.00 19.37 ? 22   LEU A C   1 
ATOM   78   O  O   . LEU A 1 47  ? 17.001 20.468  17.851 1.00 19.69 ? 22   LEU A O   1 
ATOM   79   C  CB  . LEU A 1 47  ? 16.856 18.631  20.432 1.00 16.17 ? 22   LEU A CB  1 
ATOM   80   C  CG  . LEU A 1 47  ? 16.342 17.790  21.598 1.00 14.77 ? 22   LEU A CG  1 
ATOM   81   C  CD1 . LEU A 1 47  ? 17.058 16.447  21.768 1.00 14.07 ? 22   LEU A CD1 1 
ATOM   82   C  CD2 . LEU A 1 47  ? 16.463 18.606  22.862 1.00 11.82 ? 22   LEU A CD2 1 
ATOM   83   N  N   . PRO A 1 48  ? 17.833 21.728  19.457 1.00 19.42 ? 23   PRO A N   1 
ATOM   84   C  CA  . PRO A 1 48  ? 18.655 22.511  18.537 1.00 19.17 ? 23   PRO A CA  1 
ATOM   85   C  C   . PRO A 1 48  ? 19.694 21.621  17.878 1.00 20.53 ? 23   PRO A C   1 
ATOM   86   O  O   . PRO A 1 48  ? 20.318 20.832  18.575 1.00 21.23 ? 23   PRO A O   1 
ATOM   87   C  CB  . PRO A 1 48  ? 19.341 23.488  19.459 1.00 18.21 ? 23   PRO A CB  1 
ATOM   88   C  CG  . PRO A 1 48  ? 18.549 23.480  20.755 1.00 16.10 ? 23   PRO A CG  1 
ATOM   89   C  CD  . PRO A 1 48  ? 18.206 22.015  20.846 1.00 17.73 ? 23   PRO A CD  1 
ATOM   90   N  N   . LYS A 1 49  ? 19.959 21.716  16.571 1.00 23.65 ? 24   LYS A N   1 
ATOM   91   C  CA  . LYS A 1 49  ? 20.937 20.852  15.866 1.00 27.23 ? 24   LYS A CA  1 
ATOM   92   C  C   . LYS A 1 49  ? 22.388 20.847  16.370 1.00 25.36 ? 24   LYS A C   1 
ATOM   93   O  O   . LYS A 1 49  ? 23.179 19.918  16.149 1.00 25.16 ? 24   LYS A O   1 
ATOM   94   C  CB  . LYS A 1 49  ? 20.931 21.150  14.332 1.00 29.02 ? 24   LYS A CB  1 
ATOM   95   C  CG  . LYS A 1 49  ? 19.550 20.939  13.680 1.00 36.19 ? 24   LYS A CG  1 
ATOM   96   C  CD  . LYS A 1 49  ? 19.557 21.512  12.245 1.00 43.22 ? 24   LYS A CD  1 
ATOM   97   C  CE  . LYS A 1 49  ? 18.207 21.800  11.585 1.00 42.88 ? 24   LYS A CE  1 
ATOM   98   N  NZ  . LYS A 1 49  ? 18.433 22.694  10.448 1.00 48.02 ? 24   LYS A NZ  1 
ATOM   99   N  N   . ASP A 1 50  ? 22.712 21.900  17.110 1.00 26.32 ? 25   ASP A N   1 
ATOM   100  C  CA  . ASP A 1 50  ? 24.060 22.087  17.653 1.00 28.70 ? 25   ASP A CA  1 
ATOM   101  C  C   . ASP A 1 50  ? 24.209 22.024  19.180 1.00 26.91 ? 25   ASP A C   1 
ATOM   102  O  O   . ASP A 1 50  ? 25.225 22.386  19.785 1.00 27.43 ? 25   ASP A O   1 
ATOM   103  C  CB  . ASP A 1 50  ? 24.551 23.433  17.144 1.00 30.59 ? 25   ASP A CB  1 
ATOM   104  C  CG  . ASP A 1 50  ? 23.780 24.615  17.684 1.00 33.09 ? 25   ASP A CG  1 
ATOM   105  O  OD1 . ASP A 1 50  ? 22.556 24.529  17.847 1.00 34.74 ? 25   ASP A OD1 1 
ATOM   106  O  OD2 . ASP A 1 50  ? 24.421 25.638  17.933 1.00 37.53 ? 25   ASP A OD2 1 
ATOM   107  N  N   . TYR A 1 51  ? 23.122 21.605  19.808 1.00 24.09 ? 26   TYR A N   1 
ATOM   108  C  CA  . TYR A 1 51  ? 23.165 21.289  21.189 1.00 20.96 ? 26   TYR A CA  1 
ATOM   109  C  C   . TYR A 1 51  ? 23.821 19.937  21.246 1.00 20.04 ? 26   TYR A C   1 
ATOM   110  O  O   . TYR A 1 51  ? 23.282 18.951  20.780 1.00 22.61 ? 26   TYR A O   1 
ATOM   111  C  CB  . TYR A 1 51  ? 21.759 21.239  21.710 1.00 20.00 ? 26   TYR A CB  1 
ATOM   112  C  CG  . TYR A 1 51  ? 21.728 20.927  23.199 1.00 23.05 ? 26   TYR A CG  1 
ATOM   113  C  CD1 . TYR A 1 51  ? 22.430 21.764  24.039 1.00 20.56 ? 26   TYR A CD1 1 
ATOM   114  C  CD2 . TYR A 1 51  ? 21.015 19.843  23.683 1.00 22.87 ? 26   TYR A CD2 1 
ATOM   115  C  CE1 . TYR A 1 51  ? 22.421 21.541  25.376 1.00 23.76 ? 26   TYR A CE1 1 
ATOM   116  C  CE2 . TYR A 1 51  ? 20.993 19.629  25.047 1.00 22.41 ? 26   TYR A CE2 1 
ATOM   117  C  CZ  . TYR A 1 51  ? 21.693 20.493  25.877 1.00 23.68 ? 26   TYR A CZ  1 
ATOM   118  O  OH  . TYR A 1 51  ? 21.661 20.353  27.259 1.00 22.67 ? 26   TYR A OH  1 
HETATM 119  N  N   . MSE A 1 52  ? 25.003 19.890  21.809 1.00 21.07 ? 27   MSE A N   1 
HETATM 120  C  CA  . MSE A 1 52  ? 25.716 18.643  22.008 1.00 21.95 ? 27   MSE A CA  1 
HETATM 121  C  C   . MSE A 1 52  ? 25.325 17.906  23.296 1.00 23.63 ? 27   MSE A C   1 
HETATM 122  O  O   . MSE A 1 52  ? 25.089 18.481  24.371 1.00 22.77 ? 27   MSE A O   1 
HETATM 123  C  CB  . MSE A 1 52  ? 27.201 18.955  22.055 1.00 27.32 ? 27   MSE A CB  1 
HETATM 124  C  CG  . MSE A 1 52  ? 27.695 19.788  20.866 1.00 28.96 ? 27   MSE A CG  1 
HETATM 125  SE SE  . MSE A 1 52  ? 27.207 18.877  19.234 1.00 37.24 ? 27   MSE A SE  1 
HETATM 126  C  CE  . MSE A 1 52  ? 28.489 17.511  19.371 1.00 26.83 ? 27   MSE A CE  1 
ATOM   127  N  N   . ILE A 1 53  ? 25.250 16.576  23.165 1.00 22.91 ? 28   ILE A N   1 
ATOM   128  C  CA  . ILE A 1 53  ? 24.860 15.666  24.240 1.00 21.29 ? 28   ILE A CA  1 
ATOM   129  C  C   . ILE A 1 53  ? 26.030 14.713  24.494 1.00 21.02 ? 28   ILE A C   1 
ATOM   130  O  O   . ILE A 1 53  ? 26.530 14.075  23.571 1.00 20.97 ? 28   ILE A O   1 
ATOM   131  C  CB  . ILE A 1 53  ? 23.550 14.901  23.870 1.00 19.78 ? 28   ILE A CB  1 
ATOM   132  C  CG1 . ILE A 1 53  ? 22.372 15.818  23.534 1.00 17.37 ? 28   ILE A CG1 1 
ATOM   133  C  CG2 . ILE A 1 53  ? 23.147 14.006  25.006 1.00 18.93 ? 28   ILE A CG2 1 
ATOM   134  C  CD1 . ILE A 1 53  ? 21.207 15.120  22.805 1.00 16.08 ? 28   ILE A CD1 1 
ATOM   135  N  N   . THR A 1 54  ? 26.492 14.597  25.744 1.00 20.17 ? 29   THR A N   1 
ATOM   136  C  CA  . THR A 1 54  ? 27.592 13.727  26.087 1.00 20.16 ? 29   THR A CA  1 
ATOM   137  C  C   . THR A 1 54  ? 27.065 12.315  26.319 1.00 20.21 ? 29   THR A C   1 
ATOM   138  O  O   . THR A 1 54  ? 26.051 12.081  26.988 1.00 19.29 ? 29   THR A O   1 
ATOM   139  C  CB  . THR A 1 54  ? 28.269 14.295  27.333 1.00 21.22 ? 29   THR A CB  1 
ATOM   140  O  OG1 . THR A 1 54  ? 28.515 15.655  27.048 1.00 24.08 ? 29   THR A OG1 1 
ATOM   141  C  CG2 . THR A 1 54  ? 29.593 13.644  27.634 1.00 23.19 ? 29   THR A CG2 1 
ATOM   142  N  N   . LEU A 1 55  ? 27.767 11.369  25.708 1.00 18.56 ? 30   LEU A N   1 
ATOM   143  C  CA  . LEU A 1 55  ? 27.462 9.976   25.862 1.00 17.76 ? 30   LEU A CA  1 
ATOM   144  C  C   . LEU A 1 55  ? 28.824 9.351   25.959 1.00 18.41 ? 30   LEU A C   1 
ATOM   145  O  O   . LEU A 1 55  ? 29.738 9.774   25.283 1.00 20.72 ? 30   LEU A O   1 
ATOM   146  C  CB  . LEU A 1 55  ? 26.649 9.396   24.642 1.00 19.78 ? 30   LEU A CB  1 
ATOM   147  C  CG  . LEU A 1 55  ? 26.350 7.884   24.473 1.00 14.53 ? 30   LEU A CG  1 
ATOM   148  C  CD1 . LEU A 1 55  ? 25.475 7.478   25.601 1.00 18.04 ? 30   LEU A CD1 1 
ATOM   149  C  CD2 . LEU A 1 55  ? 25.629 7.525   23.205 1.00 14.92 ? 30   LEU A CD2 1 
ATOM   150  N  N   . LYS A 1 56  ? 28.984 8.378   26.833 1.00 18.64 ? 31   LYS A N   1 
ATOM   151  C  CA  . LYS A 1 56  ? 30.176 7.575   26.918 1.00 20.71 ? 31   LYS A CA  1 
ATOM   152  C  C   . LYS A 1 56  ? 29.940 6.417   25.999 1.00 21.51 ? 31   LYS A C   1 
ATOM   153  O  O   . LYS A 1 56  ? 28.966 5.701   26.170 1.00 23.02 ? 31   LYS A O   1 
ATOM   154  C  CB  . LYS A 1 56  ? 30.411 7.009   28.295 1.00 19.63 ? 31   LYS A CB  1 
ATOM   155  C  CG  . LYS A 1 56  ? 30.788 8.066   29.309 1.00 25.85 ? 31   LYS A CG  1 
ATOM   156  C  CD  . LYS A 1 56  ? 31.154 7.355   30.605 1.00 29.83 ? 31   LYS A CD  1 
ATOM   157  C  CE  . LYS A 1 56  ? 31.652 8.305   31.675 1.00 32.89 ? 31   LYS A CE  1 
ATOM   158  N  NZ  . LYS A 1 56  ? 32.116 7.506   32.799 1.00 39.63 ? 31   LYS A NZ  1 
ATOM   159  N  N   . TYR A 1 57  ? 30.845 6.219   25.034 1.00 24.83 ? 32   TYR A N   1 
ATOM   160  C  CA  . TYR A 1 57  ? 30.565 5.424   23.844 1.00 22.31 ? 32   TYR A CA  1 
ATOM   161  C  C   . TYR A 1 57  ? 31.607 4.359   23.767 1.00 19.55 ? 32   TYR A C   1 
ATOM   162  O  O   . TYR A 1 57  ? 32.759 4.667   23.946 1.00 22.18 ? 32   TYR A O   1 
ATOM   163  C  CB  . TYR A 1 57  ? 30.569 6.367   22.640 1.00 25.12 ? 32   TYR A CB  1 
ATOM   164  C  CG  . TYR A 1 57  ? 30.557 5.725   21.262 1.00 27.46 ? 32   TYR A CG  1 
ATOM   165  C  CD1 . TYR A 1 57  ? 31.790 5.449   20.689 1.00 26.41 ? 32   TYR A CD1 1 
ATOM   166  C  CD2 . TYR A 1 57  ? 29.369 5.437   20.613 1.00 26.10 ? 32   TYR A CD2 1 
ATOM   167  C  CE1 . TYR A 1 57  ? 31.871 4.860   19.452 1.00 27.56 ? 32   TYR A CE1 1 
ATOM   168  C  CE2 . TYR A 1 57  ? 29.462 4.854   19.356 1.00 29.60 ? 32   TYR A CE2 1 
ATOM   169  C  CZ  . TYR A 1 57  ? 30.710 4.589   18.787 1.00 28.41 ? 32   TYR A CZ  1 
ATOM   170  O  OH  . TYR A 1 57  ? 30.844 4.087   17.501 1.00 32.61 ? 32   TYR A OH  1 
ATOM   171  N  N   . VAL A 1 58  ? 31.217 3.108   23.604 1.00 20.21 ? 33   VAL A N   1 
ATOM   172  C  CA  . VAL A 1 58  ? 32.138 2.022   23.453 1.00 22.23 ? 33   VAL A CA  1 
ATOM   173  C  C   . VAL A 1 58  ? 32.829 2.212   22.110 1.00 24.20 ? 33   VAL A C   1 
ATOM   174  O  O   . VAL A 1 58  ? 32.156 2.231   21.078 1.00 24.76 ? 33   VAL A O   1 
ATOM   175  C  CB  . VAL A 1 58  ? 31.400 0.676   23.549 1.00 23.11 ? 33   VAL A CB  1 
ATOM   176  C  CG1 . VAL A 1 58  ? 32.297 -0.537  23.309 1.00 22.36 ? 33   VAL A CG1 1 
ATOM   177  C  CG2 . VAL A 1 58  ? 30.857 0.535   24.951 1.00 25.26 ? 33   VAL A CG2 1 
ATOM   178  N  N   . PRO A 1 59  ? 34.158 2.380   22.078 1.00 25.19 ? 34   PRO A N   1 
ATOM   179  C  CA  . PRO A 1 59  ? 34.921 2.477   20.834 1.00 27.43 ? 34   PRO A CA  1 
ATOM   180  C  C   . PRO A 1 59  ? 34.727 1.263   19.907 1.00 27.77 ? 34   PRO A C   1 
ATOM   181  O  O   . PRO A 1 59  ? 34.907 0.101   20.291 1.00 27.65 ? 34   PRO A O   1 
ATOM   182  C  CB  . PRO A 1 59  ? 36.381 2.586   21.335 1.00 29.54 ? 34   PRO A CB  1 
ATOM   183  C  CG  . PRO A 1 59  ? 36.224 3.056   22.773 1.00 26.93 ? 34   PRO A CG  1 
ATOM   184  C  CD  . PRO A 1 59  ? 35.043 2.269   23.245 1.00 23.54 ? 34   PRO A CD  1 
ATOM   185  N  N   . GLY A 1 60  ? 34.312 1.550   18.666 1.00 28.92 ? 35   GLY A N   1 
ATOM   186  C  CA  . GLY A 1 60  ? 34.175 0.517   17.650 1.00 28.59 ? 35   GLY A CA  1 
ATOM   187  C  C   . GLY A 1 60  ? 32.886 -0.277  17.715 1.00 28.76 ? 35   GLY A C   1 
ATOM   188  O  O   . GLY A 1 60  ? 32.743 -1.224  16.957 1.00 29.41 ? 35   GLY A O   1 
HETATM 189  N  N   . MSE A 1 61  ? 31.923 0.064   18.569 1.00 27.95 ? 36   MSE A N   1 
HETATM 190  C  CA  . MSE A 1 61  ? 30.612 -0.561  18.587 1.00 28.65 ? 36   MSE A CA  1 
HETATM 191  C  C   . MSE A 1 61  ? 29.809 -0.477  17.276 1.00 28.45 ? 36   MSE A C   1 
HETATM 192  O  O   . MSE A 1 61  ? 28.824 -1.189  17.098 1.00 26.26 ? 36   MSE A O   1 
HETATM 193  C  CB  . MSE A 1 61  ? 29.774 0.036   19.739 1.00 32.71 ? 36   MSE A CB  1 
HETATM 194  C  CG  . MSE A 1 61  ? 29.232 1.427   19.485 1.00 34.05 ? 36   MSE A CG  1 
HETATM 195  SE SE  . MSE A 1 61  ? 27.946 2.252   20.676 1.00 36.59 ? 36   MSE A SE  1 
HETATM 196  C  CE  . MSE A 1 61  ? 26.309 1.728   19.841 1.00 26.94 ? 36   MSE A CE  1 
ATOM   197  N  N   . ASP A 1 62  ? 30.212 0.393   16.338 1.00 30.42 ? 37   ASP A N   1 
ATOM   198  C  CA  . ASP A 1 62  ? 29.736 0.418   14.935 1.00 30.74 ? 37   ASP A CA  1 
ATOM   199  C  C   . ASP A 1 62  ? 30.051 -0.794  14.038 1.00 27.32 ? 37   ASP A C   1 
ATOM   200  O  O   . ASP A 1 62  ? 29.344 -1.054  13.064 1.00 28.97 ? 37   ASP A O   1 
ATOM   201  C  CB  . ASP A 1 62  ? 30.200 1.716   14.234 1.00 33.15 ? 37   ASP A CB  1 
ATOM   202  C  CG  . ASP A 1 62  ? 31.706 1.960   14.294 1.00 35.22 ? 37   ASP A CG  1 
ATOM   203  O  OD1 . ASP A 1 62  ? 32.230 2.247   15.374 1.00 42.04 ? 37   ASP A OD1 1 
ATOM   204  O  OD2 . ASP A 1 62  ? 32.369 1.875   13.275 1.00 34.84 ? 37   ASP A OD2 1 
ATOM   205  N  N   . VAL A 1 63  ? 31.054 -1.584  14.381 1.00 23.11 ? 38   VAL A N   1 
ATOM   206  C  CA  . VAL A 1 63  ? 31.471 -2.713  13.566 1.00 23.69 ? 38   VAL A CA  1 
ATOM   207  C  C   . VAL A 1 63  ? 31.568 -4.045  14.389 1.00 26.12 ? 38   VAL A C   1 
ATOM   208  O  O   . VAL A 1 63  ? 31.649 -5.172  13.882 1.00 27.25 ? 38   VAL A O   1 
ATOM   209  C  CB  . VAL A 1 63  ? 32.741 -2.089  12.936 1.00 19.85 ? 38   VAL A CB  1 
ATOM   210  C  CG1 . VAL A 1 63  ? 34.023 -2.366  13.647 1.00 16.55 ? 38   VAL A CG1 1 
ATOM   211  C  CG2 . VAL A 1 63  ? 32.825 -2.379  11.512 1.00 19.54 ? 38   VAL A CG2 1 
ATOM   212  N  N   . LEU A 1 64  ? 31.464 -3.968  15.728 1.00 26.26 ? 39   LEU A N   1 
ATOM   213  C  CA  . LEU A 1 64  ? 31.505 -5.113  16.640 1.00 26.07 ? 39   LEU A CA  1 
ATOM   214  C  C   . LEU A 1 64  ? 30.149 -5.788  16.888 1.00 25.48 ? 39   LEU A C   1 
ATOM   215  O  O   . LEU A 1 64  ? 29.130 -5.109  16.842 1.00 23.47 ? 39   LEU A O   1 
ATOM   216  C  CB  . LEU A 1 64  ? 32.061 -4.671  18.014 1.00 25.49 ? 39   LEU A CB  1 
ATOM   217  C  CG  . LEU A 1 64  ? 33.515 -4.307  18.156 1.00 27.97 ? 39   LEU A CG  1 
ATOM   218  C  CD1 . LEU A 1 64  ? 33.729 -3.645  19.510 1.00 30.79 ? 39   LEU A CD1 1 
ATOM   219  C  CD2 . LEU A 1 64  ? 34.399 -5.522  17.940 1.00 23.69 ? 39   LEU A CD2 1 
ATOM   220  N  N   . PRO A 1 65  ? 30.017 -7.086  17.192 1.00 25.65 ? 40   PRO A N   1 
ATOM   221  C  CA  . PRO A 1 65  ? 28.734 -7.665  17.563 1.00 27.77 ? 40   PRO A CA  1 
ATOM   222  C  C   . PRO A 1 65  ? 28.061 -7.004  18.792 1.00 27.59 ? 40   PRO A C   1 
ATOM   223  O  O   . PRO A 1 65  ? 28.710 -6.411  19.658 1.00 26.55 ? 40   PRO A O   1 
ATOM   224  C  CB  . PRO A 1 65  ? 29.102 -9.122  17.683 1.00 27.41 ? 40   PRO A CB  1 
ATOM   225  C  CG  . PRO A 1 65  ? 30.584 -9.150  18.015 1.00 26.93 ? 40   PRO A CG  1 
ATOM   226  C  CD  . PRO A 1 65  ? 31.076 -8.082  17.099 1.00 26.35 ? 40   PRO A CD  1 
ATOM   227  N  N   . SER A 1 66  ? 26.724 -7.026  18.830 1.00 27.40 ? 41   SER A N   1 
ATOM   228  C  CA  . SER A 1 66  ? 26.003 -6.235  19.806 1.00 26.79 ? 41   SER A CA  1 
ATOM   229  C  C   . SER A 1 66  ? 26.288 -6.707  21.202 1.00 27.70 ? 41   SER A C   1 
ATOM   230  O  O   . SER A 1 66  ? 26.451 -5.903  22.097 1.00 29.20 ? 41   SER A O   1 
ATOM   231  C  CB  . SER A 1 66  ? 24.540 -6.240  19.558 1.00 23.46 ? 41   SER A CB  1 
ATOM   232  O  OG  . SER A 1 66  ? 24.074 -7.559  19.691 1.00 25.42 ? 41   SER A OG  1 
ATOM   233  N  N   . HIS A 1 67  ? 26.526 -8.007  21.355 1.00 29.95 ? 42   HIS A N   1 
ATOM   234  C  CA  . HIS A 1 67  ? 26.853 -8.594  22.636 1.00 30.32 ? 42   HIS A CA  1 
ATOM   235  C  C   . HIS A 1 67  ? 28.076 -7.971  23.312 1.00 29.42 ? 42   HIS A C   1 
ATOM   236  O  O   . HIS A 1 67  ? 28.270 -8.138  24.524 1.00 28.56 ? 42   HIS A O   1 
ATOM   237  C  CB  . HIS A 1 67  ? 27.008 -10.109 22.451 1.00 35.10 ? 42   HIS A CB  1 
ATOM   238  C  CG  . HIS A 1 67  ? 28.387 -10.616 21.997 1.00 39.36 ? 42   HIS A CG  1 
ATOM   239  N  ND1 . HIS A 1 67  ? 29.424 -10.993 22.752 1.00 43.05 ? 42   HIS A ND1 1 
ATOM   240  C  CD2 . HIS A 1 67  ? 28.829 -10.644 20.694 1.00 42.30 ? 42   HIS A CD2 1 
ATOM   241  C  CE1 . HIS A 1 67  ? 30.472 -11.198 21.971 1.00 42.05 ? 42   HIS A CE1 1 
ATOM   242  N  NE2 . HIS A 1 67  ? 30.103 -10.969 20.735 1.00 41.31 ? 42   HIS A NE2 1 
ATOM   243  N  N   . CYS A 1 68  ? 28.888 -7.246  22.533 1.00 26.69 ? 43   CYS A N   1 
ATOM   244  C  CA  . CYS A 1 68  ? 30.112 -6.657  23.037 1.00 29.55 ? 43   CYS A CA  1 
ATOM   245  C  C   . CYS A 1 68  ? 29.916 -5.341  23.766 1.00 29.31 ? 43   CYS A C   1 
ATOM   246  O  O   . CYS A 1 68  ? 30.779 -4.912  24.512 1.00 31.36 ? 43   CYS A O   1 
ATOM   247  C  CB  . CYS A 1 68  ? 31.140 -6.395  21.915 1.00 31.15 ? 43   CYS A CB  1 
ATOM   248  S  SG  . CYS A 1 68  ? 31.674 -7.929  21.120 1.00 35.60 ? 43   CYS A SG  1 
ATOM   249  N  N   . TRP A 1 69  ? 28.813 -4.637  23.555 1.00 28.24 ? 44   TRP A N   1 
ATOM   250  C  CA  . TRP A 1 69  ? 28.704 -3.240  23.952 1.00 25.54 ? 44   TRP A CA  1 
ATOM   251  C  C   . TRP A 1 69  ? 27.331 -2.947  24.498 1.00 25.35 ? 44   TRP A C   1 
ATOM   252  O  O   . TRP A 1 69  ? 27.173 -1.924  25.113 1.00 28.50 ? 44   TRP A O   1 
ATOM   253  C  CB  . TRP A 1 69  ? 28.965 -2.299  22.746 1.00 22.52 ? 44   TRP A CB  1 
ATOM   254  C  CG  . TRP A 1 69  ? 28.207 -2.626  21.450 1.00 20.09 ? 44   TRP A CG  1 
ATOM   255  C  CD1 . TRP A 1 69  ? 28.851 -3.316  20.455 1.00 19.03 ? 44   TRP A CD1 1 
ATOM   256  C  CD2 . TRP A 1 69  ? 26.890 -2.326  21.142 1.00 20.02 ? 44   TRP A CD2 1 
ATOM   257  N  NE1 . TRP A 1 69  ? 27.948 -3.464  19.527 1.00 20.48 ? 44   TRP A NE1 1 
ATOM   258  C  CE2 . TRP A 1 69  ? 26.791 -2.877  19.882 1.00 19.41 ? 44   TRP A CE2 1 
ATOM   259  C  CE3 . TRP A 1 69  ? 25.841 -1.609  21.652 1.00 18.83 ? 44   TRP A CE3 1 
ATOM   260  C  CZ2 . TRP A 1 69  ? 25.665 -2.678  19.127 1.00 16.33 ? 44   TRP A CZ2 1 
ATOM   261  C  CZ3 . TRP A 1 69  ? 24.711 -1.431  20.910 1.00 16.81 ? 44   TRP A CZ3 1 
ATOM   262  C  CH2 . TRP A 1 69  ? 24.617 -1.962  19.653 1.00 17.88 ? 44   TRP A CH2 1 
ATOM   263  N  N   . ILE A 1 70  ? 26.328 -3.786  24.275 1.00 27.39 ? 45   ILE A N   1 
ATOM   264  C  CA  . ILE A 1 70  ? 24.934 -3.500  24.540 1.00 28.48 ? 45   ILE A CA  1 
ATOM   265  C  C   . ILE A 1 70  ? 24.666 -3.370  26.025 1.00 29.97 ? 45   ILE A C   1 
ATOM   266  O  O   . ILE A 1 70  ? 23.770 -2.622  26.389 1.00 31.30 ? 45   ILE A O   1 
ATOM   267  C  CB  . ILE A 1 70  ? 24.055 -4.601  23.904 1.00 28.39 ? 45   ILE A CB  1 
ATOM   268  C  CG1 . ILE A 1 70  ? 22.603 -4.220  23.795 1.00 28.24 ? 45   ILE A CG1 1 
ATOM   269  C  CG2 . ILE A 1 70  ? 24.152 -5.926  24.668 1.00 28.54 ? 45   ILE A CG2 1 
ATOM   270  C  CD1 . ILE A 1 70  ? 22.371 -2.868  23.098 1.00 30.38 ? 45   ILE A CD1 1 
ATOM   271  N  N   . SER A 1 71  ? 25.408 -4.044  26.900 1.00 30.95 ? 46   SER A N   1 
ATOM   272  C  CA  . SER A 1 71  ? 25.200 -3.897  28.337 1.00 32.47 ? 46   SER A CA  1 
ATOM   273  C  C   . SER A 1 71  ? 25.677 -2.546  28.844 1.00 30.61 ? 46   SER A C   1 
ATOM   274  O  O   . SER A 1 71  ? 24.974 -1.880  29.597 1.00 30.88 ? 46   SER A O   1 
ATOM   275  C  CB  . SER A 1 71  ? 25.899 -5.016  29.106 1.00 35.61 ? 46   SER A CB  1 
ATOM   276  O  OG  . SER A 1 71  ? 25.387 -6.311  28.746 1.00 43.59 ? 46   SER A OG  1 
ATOM   277  N  N   . GLU A 1 72  ? 26.840 -2.123  28.370 1.00 28.57 ? 47   GLU A N   1 
ATOM   278  C  CA  . GLU A 1 72  ? 27.355 -0.823  28.680 1.00 28.90 ? 47   GLU A CA  1 
ATOM   279  C  C   . GLU A 1 72  ? 26.567 0.306   28.090 1.00 27.44 ? 47   GLU A C   1 
ATOM   280  O  O   . GLU A 1 72  ? 26.383 1.323   28.735 1.00 28.17 ? 47   GLU A O   1 
ATOM   281  C  CB  . GLU A 1 72  ? 28.791 -0.702  28.244 1.00 30.74 ? 47   GLU A CB  1 
ATOM   282  C  CG  . GLU A 1 72  ? 29.439 0.554   28.818 1.00 34.60 ? 47   GLU A CG  1 
ATOM   283  C  CD  . GLU A 1 72  ? 29.550 0.665   30.351 1.00 37.52 ? 47   GLU A CD  1 
ATOM   284  O  OE1 . GLU A 1 72  ? 28.998 -0.153  31.107 1.00 37.54 ? 47   GLU A OE1 1 
ATOM   285  O  OE2 . GLU A 1 72  ? 30.208 1.607   30.800 1.00 38.33 ? 47   GLU A OE2 1 
HETATM 286  N  N   . MSE A 1 73  ? 26.073 0.098   26.879 1.00 27.89 ? 48   MSE A N   1 
HETATM 287  C  CA  . MSE A 1 73  ? 25.327 1.113   26.154 1.00 28.18 ? 48   MSE A CA  1 
HETATM 288  C  C   . MSE A 1 73  ? 23.945 1.421   26.667 1.00 26.21 ? 48   MSE A C   1 
HETATM 289  O  O   . MSE A 1 73  ? 23.580 2.578   26.606 1.00 27.02 ? 48   MSE A O   1 
HETATM 290  C  CB  . MSE A 1 73  ? 25.309 0.882   24.637 1.00 29.23 ? 48   MSE A CB  1 
HETATM 291  C  CG  . MSE A 1 73  ? 26.739 1.048   24.095 1.00 28.12 ? 48   MSE A CG  1 
HETATM 292  SE SE  . MSE A 1 73  ? 27.685 2.655   24.690 1.00 35.61 ? 48   MSE A SE  1 
HETATM 293  C  CE  . MSE A 1 73  ? 26.476 3.857   23.743 1.00 22.58 ? 48   MSE A CE  1 
ATOM   294  N  N   . VAL A 1 74  ? 23.147 0.491   27.195 1.00 27.65 ? 49   VAL A N   1 
ATOM   295  C  CA  . VAL A 1 74  ? 21.882 0.875   27.814 1.00 27.43 ? 49   VAL A CA  1 
ATOM   296  C  C   . VAL A 1 74  ? 22.017 1.680   29.115 1.00 27.42 ? 49   VAL A C   1 
ATOM   297  O  O   . VAL A 1 74  ? 21.224 2.595   29.394 1.00 27.48 ? 49   VAL A O   1 
ATOM   298  C  CB  . VAL A 1 74  ? 20.884 -0.284  27.907 1.00 27.18 ? 49   VAL A CB  1 
ATOM   299  C  CG1 . VAL A 1 74  ? 20.438 -0.478  26.452 1.00 27.08 ? 49   VAL A CG1 1 
ATOM   300  C  CG2 . VAL A 1 74  ? 21.421 -1.534  28.610 1.00 23.66 ? 49   VAL A CG2 1 
ATOM   301  N  N   . VAL A 1 75  ? 23.100 1.370   29.847 1.00 26.26 ? 50   VAL A N   1 
ATOM   302  C  CA  . VAL A 1 75  ? 23.469 2.060   31.068 1.00 24.75 ? 50   VAL A CA  1 
ATOM   303  C  C   . VAL A 1 75  ? 23.964 3.431   30.716 1.00 25.57 ? 50   VAL A C   1 
ATOM   304  O  O   . VAL A 1 75  ? 23.485 4.384   31.320 1.00 28.77 ? 50   VAL A O   1 
ATOM   305  C  CB  . VAL A 1 75  ? 24.545 1.307   31.812 1.00 24.44 ? 50   VAL A CB  1 
ATOM   306  C  CG1 . VAL A 1 75  ? 25.062 2.106   32.969 1.00 23.79 ? 50   VAL A CG1 1 
ATOM   307  C  CG2 . VAL A 1 75  ? 23.952 0.040   32.382 1.00 24.17 ? 50   VAL A CG2 1 
ATOM   308  N  N   . GLN A 1 76  ? 24.888 3.551   29.758 1.00 22.88 ? 51   GLN A N   1 
ATOM   309  C  CA  . GLN A 1 76  ? 25.315 4.841   29.294 1.00 18.59 ? 51   GLN A CA  1 
ATOM   310  C  C   . GLN A 1 76  ? 24.226 5.698   28.700 1.00 18.17 ? 51   GLN A C   1 
ATOM   311  O  O   . GLN A 1 76  ? 24.223 6.904   28.948 1.00 20.05 ? 51   GLN A O   1 
ATOM   312  C  CB  . GLN A 1 76  ? 26.474 4.707   28.320 1.00 21.19 ? 51   GLN A CB  1 
ATOM   313  C  CG  . GLN A 1 76  ? 27.676 4.059   28.934 1.00 17.37 ? 51   GLN A CG  1 
ATOM   314  C  CD  . GLN A 1 76  ? 28.072 4.720   30.240 1.00 21.56 ? 51   GLN A CD  1 
ATOM   315  O  OE1 . GLN A 1 76  ? 27.879 5.913   30.476 1.00 23.67 ? 51   GLN A OE1 1 
ATOM   316  N  NE2 . GLN A 1 76  ? 28.662 3.969   31.152 1.00 22.77 ? 51   GLN A NE2 1 
ATOM   317  N  N   . LEU A 1 77  ? 23.291 5.106   27.959 1.00 15.38 ? 52   LEU A N   1 
ATOM   318  C  CA  . LEU A 1 77  ? 22.210 5.850   27.374 1.00 16.72 ? 52   LEU A CA  1 
ATOM   319  C  C   . LEU A 1 77  ? 21.199 6.284   28.411 1.00 18.34 ? 52   LEU A C   1 
ATOM   320  O  O   . LEU A 1 77  ? 20.676 7.387   28.382 1.00 18.73 ? 52   LEU A O   1 
ATOM   321  C  CB  . LEU A 1 77  ? 21.533 5.006   26.309 1.00 15.91 ? 52   LEU A CB  1 
ATOM   322  C  CG  . LEU A 1 77  ? 22.207 5.059   24.928 1.00 17.11 ? 52   LEU A CG  1 
ATOM   323  C  CD1 . LEU A 1 77  ? 21.807 3.849   24.155 1.00 14.42 ? 52   LEU A CD1 1 
ATOM   324  C  CD2 . LEU A 1 77  ? 21.886 6.330   24.184 1.00 12.26 ? 52   LEU A CD2 1 
ATOM   325  N  N   . SER A 1 78  ? 20.932 5.433   29.378 1.00 20.83 ? 53   SER A N   1 
ATOM   326  C  CA  . SER A 1 78  ? 20.098 5.806   30.505 1.00 23.79 ? 53   SER A CA  1 
ATOM   327  C  C   . SER A 1 78  ? 20.716 6.966   31.295 1.00 24.20 ? 53   SER A C   1 
ATOM   328  O  O   . SER A 1 78  ? 19.977 7.897   31.624 1.00 26.42 ? 53   SER A O   1 
ATOM   329  C  CB  . SER A 1 78  ? 19.917 4.605   31.403 1.00 23.71 ? 53   SER A CB  1 
ATOM   330  O  OG  . SER A 1 78  ? 19.285 5.024   32.601 1.00 30.23 ? 53   SER A OG  1 
ATOM   331  N  N   . ASP A 1 79  ? 22.043 6.977   31.559 1.00 23.25 ? 54   ASP A N   1 
ATOM   332  C  CA  . ASP A 1 79  ? 22.687 8.036   32.308 1.00 20.61 ? 54   ASP A CA  1 
ATOM   333  C  C   . ASP A 1 79  ? 22.659 9.325   31.572 1.00 19.02 ? 54   ASP A C   1 
ATOM   334  O  O   . ASP A 1 79  ? 22.303 10.358  32.142 1.00 20.41 ? 54   ASP A O   1 
ATOM   335  C  CB  . ASP A 1 79  ? 24.114 7.682   32.740 1.00 25.54 ? 54   ASP A CB  1 
ATOM   336  C  CG  . ASP A 1 79  ? 24.207 6.579   33.815 1.00 31.33 ? 54   ASP A CG  1 
ATOM   337  O  OD1 . ASP A 1 79  ? 23.185 5.965   34.178 1.00 36.02 ? 54   ASP A OD1 1 
ATOM   338  O  OD2 . ASP A 1 79  ? 25.318 6.318   34.307 1.00 32.62 ? 54   ASP A OD2 1 
ATOM   339  N  N   . SER A 1 80  ? 22.962 9.286   30.291 1.00 16.79 ? 55   SER A N   1 
ATOM   340  C  CA  . SER A 1 80  ? 22.857 10.514  29.541 1.00 17.42 ? 55   SER A CA  1 
ATOM   341  C  C   . SER A 1 80  ? 21.454 11.096  29.425 1.00 16.81 ? 55   SER A C   1 
ATOM   342  O  O   . SER A 1 80  ? 21.293 12.318  29.474 1.00 17.95 ? 55   SER A O   1 
ATOM   343  C  CB  . SER A 1 80  ? 23.511 10.378  28.150 1.00 18.91 ? 55   SER A CB  1 
ATOM   344  O  OG  . SER A 1 80  ? 24.863 9.936   28.237 1.00 22.06 ? 55   SER A OG  1 
ATOM   345  N  N   . LEU A 1 81  ? 20.439 10.249  29.243 1.00 17.01 ? 56   LEU A N   1 
ATOM   346  C  CA  . LEU A 1 81  ? 19.073 10.726  29.162 1.00 17.99 ? 56   LEU A CA  1 
ATOM   347  C  C   . LEU A 1 81  ? 18.518 11.188  30.514 1.00 18.27 ? 56   LEU A C   1 
ATOM   348  O  O   . LEU A 1 81  ? 17.800 12.186  30.575 1.00 18.82 ? 56   LEU A O   1 
ATOM   349  C  CB  . LEU A 1 81  ? 18.130 9.712   28.505 1.00 17.68 ? 56   LEU A CB  1 
ATOM   350  C  CG  . LEU A 1 81  ? 18.061 9.584   26.983 1.00 18.44 ? 56   LEU A CG  1 
ATOM   351  C  CD1 . LEU A 1 81  ? 17.381 8.280   26.613 1.00 19.03 ? 56   LEU A CD1 1 
ATOM   352  C  CD2 . LEU A 1 81  ? 17.392 10.764  26.321 1.00 16.39 ? 56   LEU A CD2 1 
ATOM   353  N  N   . THR A 1 82  ? 18.835 10.532  31.616 1.00 18.45 ? 57   THR A N   1 
ATOM   354  C  CA  . THR A 1 82  ? 18.376 11.005  32.911 1.00 21.42 ? 57   THR A CA  1 
ATOM   355  C  C   . THR A 1 82  ? 18.975 12.383  33.205 1.00 21.42 ? 57   THR A C   1 
ATOM   356  O  O   . THR A 1 82  ? 18.263 13.287  33.640 1.00 21.53 ? 57   THR A O   1 
ATOM   357  C  CB  . THR A 1 82  ? 18.680 9.942   33.948 1.00 18.39 ? 57   THR A CB  1 
ATOM   358  O  OG1 . THR A 1 82  ? 18.055 8.791   33.418 1.00 20.01 ? 57   THR A OG1 1 
ATOM   359  C  CG2 . THR A 1 82  ? 17.980 10.190  35.253 1.00 23.58 ? 57   THR A CG2 1 
ATOM   360  N  N   . ASP A 1 83  ? 20.245 12.587  32.819 1.00 23.66 ? 58   ASP A N   1 
ATOM   361  C  CA  . ASP A 1 83  ? 20.908 13.867  32.971 1.00 24.99 ? 58   ASP A CA  1 
ATOM   362  C  C   . ASP A 1 83  ? 20.269 14.969  32.162 1.00 23.11 ? 58   ASP A C   1 
ATOM   363  O  O   . ASP A 1 83  ? 20.243 16.133  32.567 1.00 22.89 ? 58   ASP A O   1 
ATOM   364  C  CB  . ASP A 1 83  ? 22.410 13.766  32.646 1.00 33.60 ? 58   ASP A CB  1 
ATOM   365  C  CG  . ASP A 1 83  ? 23.101 15.151  32.595 1.00 41.66 ? 58   ASP A CG  1 
ATOM   366  O  OD1 . ASP A 1 83  ? 23.500 15.636  33.666 1.00 45.37 ? 58   ASP A OD1 1 
ATOM   367  O  OD2 . ASP A 1 83  ? 23.204 15.764  31.502 1.00 43.30 ? 58   ASP A OD2 1 
ATOM   368  N  N   . LEU A 1 84  ? 19.762 14.614  30.994 1.00 21.38 ? 59   LEU A N   1 
ATOM   369  C  CA  . LEU A 1 84  ? 19.106 15.568  30.124 1.00 19.63 ? 59   LEU A CA  1 
ATOM   370  C  C   . LEU A 1 84  ? 17.857 16.179  30.719 1.00 20.35 ? 59   LEU A C   1 
ATOM   371  O  O   . LEU A 1 84  ? 17.522 17.321  30.413 1.00 19.57 ? 59   LEU A O   1 
ATOM   372  C  CB  . LEU A 1 84  ? 18.751 14.826  28.859 1.00 19.31 ? 59   LEU A CB  1 
ATOM   373  C  CG  . LEU A 1 84  ? 19.006 15.498  27.551 1.00 18.41 ? 59   LEU A CG  1 
ATOM   374  C  CD1 . LEU A 1 84  ? 20.161 16.496  27.615 1.00 16.32 ? 59   LEU A CD1 1 
ATOM   375  C  CD2 . LEU A 1 84  ? 19.225 14.401  26.555 1.00 17.59 ? 59   LEU A CD2 1 
ATOM   376  N  N   . LEU A 1 85  ? 17.163 15.410  31.587 1.00 21.63 ? 60   LEU A N   1 
ATOM   377  C  CA  . LEU A 1 85  ? 15.930 15.857  32.216 1.00 20.55 ? 60   LEU A CA  1 
ATOM   378  C  C   . LEU A 1 85  ? 16.133 17.147  32.974 1.00 22.32 ? 60   LEU A C   1 
ATOM   379  O  O   . LEU A 1 85  ? 15.264 18.016  32.929 1.00 23.28 ? 60   LEU A O   1 
ATOM   380  C  CB  . LEU A 1 85  ? 15.389 14.796  33.145 1.00 17.67 ? 60   LEU A CB  1 
ATOM   381  C  CG  . LEU A 1 85  ? 14.680 13.601  32.538 1.00 14.57 ? 60   LEU A CG  1 
ATOM   382  C  CD1 . LEU A 1 85  ? 14.293 12.641  33.643 1.00 12.83 ? 60   LEU A CD1 1 
ATOM   383  C  CD2 . LEU A 1 85  ? 13.462 14.048  31.847 1.00 8.22  ? 60   LEU A CD2 1 
ATOM   384  N  N   . ASP A 1 86  ? 17.338 17.285  33.558 1.00 22.42 ? 61   ASP A N   1 
ATOM   385  C  CA  . ASP A 1 86  ? 17.805 18.483  34.247 1.00 22.10 ? 61   ASP A CA  1 
ATOM   386  C  C   . ASP A 1 86  ? 17.810 19.768  33.433 1.00 20.08 ? 61   ASP A C   1 
ATOM   387  O  O   . ASP A 1 86  ? 17.841 20.870  33.974 1.00 20.02 ? 61   ASP A O   1 
ATOM   388  C  CB  . ASP A 1 86  ? 19.203 18.169  34.753 1.00 28.60 ? 61   ASP A CB  1 
ATOM   389  C  CG  . ASP A 1 86  ? 19.803 19.159  35.750 1.00 34.29 ? 61   ASP A CG  1 
ATOM   390  O  OD1 . ASP A 1 86  ? 19.459 19.073  36.931 1.00 40.97 ? 61   ASP A OD1 1 
ATOM   391  O  OD2 . ASP A 1 86  ? 20.616 20.006  35.356 1.00 37.85 ? 61   ASP A OD2 1 
ATOM   392  N  N   . LYS A 1 87  ? 17.721 19.693  32.105 1.00 19.76 ? 62   LYS A N   1 
ATOM   393  C  CA  . LYS A 1 87  ? 17.839 20.862  31.245 1.00 16.53 ? 62   LYS A CA  1 
ATOM   394  C  C   . LYS A 1 87  ? 16.485 21.335  30.770 1.00 16.75 ? 62   LYS A C   1 
ATOM   395  O  O   . LYS A 1 87  ? 16.388 22.383  30.130 1.00 17.62 ? 62   LYS A O   1 
ATOM   396  C  CB  . LYS A 1 87  ? 18.684 20.529  30.020 1.00 18.65 ? 62   LYS A CB  1 
ATOM   397  C  CG  . LYS A 1 87  ? 19.986 19.755  30.233 1.00 16.80 ? 62   LYS A CG  1 
ATOM   398  C  CD  . LYS A 1 87  ? 20.808 20.483  31.276 1.00 18.07 ? 62   LYS A CD  1 
ATOM   399  C  CE  . LYS A 1 87  ? 22.135 19.776  31.535 1.00 23.34 ? 62   LYS A CE  1 
ATOM   400  N  NZ  . LYS A 1 87  ? 22.088 18.331  31.330 1.00 28.06 ? 62   LYS A NZ  1 
ATOM   401  N  N   . PHE A 1 88  ? 15.400 20.605  31.068 1.00 16.40 ? 63   PHE A N   1 
ATOM   402  C  CA  . PHE A 1 88  ? 14.086 20.979  30.586 1.00 16.93 ? 63   PHE A CA  1 
ATOM   403  C  C   . PHE A 1 88  ? 13.110 21.140  31.730 1.00 17.40 ? 63   PHE A C   1 
ATOM   404  O  O   . PHE A 1 88  ? 13.294 20.626  32.826 1.00 17.50 ? 63   PHE A O   1 
ATOM   405  C  CB  . PHE A 1 88  ? 13.576 19.942  29.574 1.00 15.08 ? 63   PHE A CB  1 
ATOM   406  C  CG  . PHE A 1 88  ? 14.424 19.850  28.325 1.00 13.39 ? 63   PHE A CG  1 
ATOM   407  C  CD1 . PHE A 1 88  ? 14.261 20.767  27.317 1.00 13.60 ? 63   PHE A CD1 1 
ATOM   408  C  CD2 . PHE A 1 88  ? 15.410 18.888  28.252 1.00 14.95 ? 63   PHE A CD2 1 
ATOM   409  C  CE1 . PHE A 1 88  ? 15.126 20.740  26.266 1.00 10.99 ? 63   PHE A CE1 1 
ATOM   410  C  CE2 . PHE A 1 88  ? 16.305 18.889  27.207 1.00 14.45 ? 63   PHE A CE2 1 
ATOM   411  C  CZ  . PHE A 1 88  ? 16.150 19.832  26.229 1.00 10.95 ? 63   PHE A CZ  1 
ATOM   412  N  N   . SER A 1 89  ? 12.031 21.843  31.444 1.00 19.14 ? 64   SER A N   1 
ATOM   413  C  CA  . SER A 1 89  ? 10.993 22.080  32.407 1.00 21.71 ? 64   SER A CA  1 
ATOM   414  C  C   . SER A 1 89  ? 9.832  21.125  32.198 1.00 22.87 ? 64   SER A C   1 
ATOM   415  O  O   . SER A 1 89  ? 9.431  20.758  31.098 1.00 24.09 ? 64   SER A O   1 
ATOM   416  C  CB  . SER A 1 89  ? 10.533 23.508  32.261 1.00 22.47 ? 64   SER A CB  1 
ATOM   417  O  OG  . SER A 1 89  ? 9.408  23.881  33.049 1.00 29.46 ? 64   SER A OG  1 
ATOM   418  N  N   . ASN A 1 90  ? 9.298  20.809  33.363 1.00 23.97 ? 65   ASN A N   1 
ATOM   419  C  CA  . ASN A 1 90  ? 8.233  19.855  33.608 1.00 29.13 ? 65   ASN A CA  1 
ATOM   420  C  C   . ASN A 1 90  ? 6.899  20.530  33.390 1.00 31.34 ? 65   ASN A C   1 
ATOM   421  O  O   . ASN A 1 90  ? 5.883  19.858  33.203 1.00 35.27 ? 65   ASN A O   1 
ATOM   422  C  CB  . ASN A 1 90  ? 8.309  19.551  35.119 1.00 30.43 ? 65   ASN A CB  1 
ATOM   423  C  CG  . ASN A 1 90  ? 8.097  18.117  35.514 1.00 33.16 ? 65   ASN A CG  1 
ATOM   424  O  OD1 . ASN A 1 90  ? 7.488  17.258  34.873 1.00 41.60 ? 65   ASN A OD1 1 
ATOM   425  N  ND2 . ASN A 1 90  ? 8.641  17.823  36.656 1.00 34.77 ? 65   ASN A ND2 1 
ATOM   426  N  N   . ILE A 1 91  ? 6.892  21.862  33.561 1.00 32.62 ? 66   ILE A N   1 
ATOM   427  C  CA  . ILE A 1 91  ? 5.708  22.691  33.384 1.00 33.83 ? 66   ILE A CA  1 
ATOM   428  C  C   . ILE A 1 91  ? 5.681  23.071  31.918 1.00 35.58 ? 66   ILE A C   1 
ATOM   429  O  O   . ILE A 1 91  ? 6.450  23.910  31.431 1.00 36.08 ? 66   ILE A O   1 
ATOM   430  C  CB  . ILE A 1 91  ? 5.752  24.000  34.223 1.00 33.21 ? 66   ILE A CB  1 
ATOM   431  C  CG1 . ILE A 1 91  ? 6.162  23.831  35.672 1.00 33.50 ? 66   ILE A CG1 1 
ATOM   432  C  CG2 . ILE A 1 91  ? 4.416  24.708  34.158 1.00 31.21 ? 66   ILE A CG2 1 
ATOM   433  C  CD1 . ILE A 1 91  ? 5.330  22.784  36.415 1.00 32.37 ? 66   ILE A CD1 1 
ATOM   434  N  N   . SER A 1 92  ? 4.782  22.424  31.201 1.00 37.23 ? 67   SER A N   1 
ATOM   435  C  CA  . SER A 1 92  ? 4.669  22.650  29.771 1.00 40.50 ? 67   SER A CA  1 
ATOM   436  C  C   . SER A 1 92  ? 3.358  22.008  29.327 1.00 42.07 ? 67   SER A C   1 
ATOM   437  O  O   . SER A 1 92  ? 3.073  20.841  29.622 1.00 43.86 ? 67   SER A O   1 
ATOM   438  C  CB  . SER A 1 92  ? 5.892  21.985  29.075 1.00 40.62 ? 67   SER A CB  1 
ATOM   439  O  OG  . SER A 1 92  ? 6.244  22.539  27.815 1.00 36.76 ? 67   SER A OG  1 
ATOM   440  N  N   . GLU A 1 93  ? 2.502  22.765  28.648 1.00 44.40 ? 68   GLU A N   1 
ATOM   441  C  CA  . GLU A 1 93  ? 1.317  22.183  28.023 1.00 46.43 ? 68   GLU A CA  1 
ATOM   442  C  C   . GLU A 1 93  ? 1.777  21.448  26.758 1.00 46.20 ? 68   GLU A C   1 
ATOM   443  O  O   . GLU A 1 93  ? 2.874  21.690  26.234 1.00 47.39 ? 68   GLU A O   1 
ATOM   444  C  CB  . GLU A 1 93  ? 0.364  23.301  27.637 1.00 49.01 ? 68   GLU A CB  1 
ATOM   445  C  CG  . GLU A 1 93  ? -1.051 22.858  27.256 1.00 53.42 ? 68   GLU A CG  1 
ATOM   446  C  CD  . GLU A 1 93  ? -2.066 23.229  28.324 1.00 56.12 ? 68   GLU A CD  1 
ATOM   447  O  OE1 . GLU A 1 93  ? -2.255 22.391  29.223 1.00 58.37 ? 68   GLU A OE1 1 
ATOM   448  O  OE2 . GLU A 1 93  ? -2.634 24.342  28.250 1.00 56.09 ? 68   GLU A OE2 1 
ATOM   449  N  N   . GLY A 1 94  ? 0.957  20.523  26.262 1.00 45.44 ? 69   GLY A N   1 
ATOM   450  C  CA  . GLY A 1 94  ? 1.228  19.834  25.021 1.00 43.62 ? 69   GLY A CA  1 
ATOM   451  C  C   . GLY A 1 94  ? 2.561  19.130  25.029 1.00 42.33 ? 69   GLY A C   1 
ATOM   452  O  O   . GLY A 1 94  ? 2.944  18.429  25.963 1.00 43.42 ? 69   GLY A O   1 
ATOM   453  N  N   . LEU A 1 95  ? 3.245  19.412  23.927 1.00 42.01 ? 70   LEU A N   1 
ATOM   454  C  CA  . LEU A 1 95  ? 4.567  18.856  23.634 1.00 40.66 ? 70   LEU A CA  1 
ATOM   455  C  C   . LEU A 1 95  ? 5.570  19.283  24.688 1.00 37.48 ? 70   LEU A C   1 
ATOM   456  O  O   . LEU A 1 95  ? 5.769  20.477  24.916 1.00 39.56 ? 70   LEU A O   1 
ATOM   457  C  CB  . LEU A 1 95  ? 5.069  19.339  22.221 1.00 42.73 ? 70   LEU A CB  1 
ATOM   458  C  CG  . LEU A 1 95  ? 6.365  18.753  21.553 1.00 43.68 ? 70   LEU A CG  1 
ATOM   459  C  CD1 . LEU A 1 95  ? 6.429  17.212  21.539 1.00 40.99 ? 70   LEU A CD1 1 
ATOM   460  C  CD2 . LEU A 1 95  ? 6.506  19.318  20.134 1.00 42.81 ? 70   LEU A CD2 1 
ATOM   461  N  N   . SER A 1 96  ? 6.203  18.289  25.301 1.00 32.14 ? 71   SER A N   1 
ATOM   462  C  CA  . SER A 1 96  ? 7.187  18.514  26.330 1.00 24.30 ? 71   SER A CA  1 
ATOM   463  C  C   . SER A 1 96  ? 8.394  17.653  26.032 1.00 20.06 ? 71   SER A C   1 
ATOM   464  O  O   . SER A 1 96  ? 8.282  16.449  25.900 1.00 21.51 ? 71   SER A O   1 
ATOM   465  C  CB  . SER A 1 96  ? 6.519  18.160  27.653 1.00 21.80 ? 71   SER A CB  1 
ATOM   466  O  OG  . SER A 1 96  ? 7.393  18.171  28.756 1.00 17.14 ? 71   SER A OG  1 
ATOM   467  N  N   . ASN A 1 97  ? 9.573  18.208  25.883 1.00 18.83 ? 72   ASN A N   1 
ATOM   468  C  CA  . ASN A 1 97  ? 10.787 17.419  25.827 1.00 16.99 ? 72   ASN A CA  1 
ATOM   469  C  C   . ASN A 1 97  ? 11.079 16.692  27.083 1.00 15.54 ? 72   ASN A C   1 
ATOM   470  O  O   . ASN A 1 97  ? 11.566 15.578  26.997 1.00 16.64 ? 72   ASN A O   1 
ATOM   471  C  CB  . ASN A 1 97  ? 11.982 18.277  25.558 1.00 20.15 ? 72   ASN A CB  1 
ATOM   472  C  CG  . ASN A 1 97  ? 11.916 18.839  24.158 1.00 23.44 ? 72   ASN A CG  1 
ATOM   473  O  OD1 . ASN A 1 97  ? 11.109 18.421  23.317 1.00 25.67 ? 72   ASN A OD1 1 
ATOM   474  N  ND2 . ASN A 1 97  ? 12.780 19.812  23.894 1.00 24.59 ? 72   ASN A ND2 1 
ATOM   475  N  N   . TYR A 1 98  ? 10.823 17.309  28.239 1.00 15.06 ? 73   TYR A N   1 
ATOM   476  C  CA  . TYR A 1 98  ? 10.835 16.579  29.507 1.00 15.26 ? 73   TYR A CA  1 
ATOM   477  C  C   . TYR A 1 98  ? 9.986  15.319  29.443 1.00 15.85 ? 73   TYR A C   1 
ATOM   478  O  O   . TYR A 1 98  ? 10.538 14.262  29.740 1.00 18.32 ? 73   TYR A O   1 
ATOM   479  C  CB  . TYR A 1 98  ? 10.315 17.410  30.733 1.00 12.75 ? 73   TYR A CB  1 
ATOM   480  C  CG  . TYR A 1 98  ? 10.760 16.862  32.082 1.00 10.27 ? 73   TYR A CG  1 
ATOM   481  C  CD1 . TYR A 1 98  ? 11.940 17.306  32.624 1.00 11.84 ? 73   TYR A CD1 1 
ATOM   482  C  CD2 . TYR A 1 98  ? 9.993  15.928  32.769 1.00 14.03 ? 73   TYR A CD2 1 
ATOM   483  C  CE1 . TYR A 1 98  ? 12.364 16.827  33.839 1.00 12.67 ? 73   TYR A CE1 1 
ATOM   484  C  CE2 . TYR A 1 98  ? 10.412 15.419  33.979 1.00 10.24 ? 73   TYR A CE2 1 
ATOM   485  C  CZ  . TYR A 1 98  ? 11.592 15.891  34.491 1.00 14.02 ? 73   TYR A CZ  1 
ATOM   486  O  OH  . TYR A 1 98  ? 12.042 15.429  35.703 1.00 14.54 ? 73   TYR A OH  1 
ATOM   487  N  N   . SER A 1 99  ? 8.682  15.323  29.087 1.00 18.48 ? 74   SER A N   1 
ATOM   488  C  CA  . SER A 1 99  ? 7.947  14.076  29.034 1.00 18.74 ? 74   SER A CA  1 
ATOM   489  C  C   . SER A 1 99  ? 8.429  13.074  28.017 1.00 18.80 ? 74   SER A C   1 
ATOM   490  O  O   . SER A 1 99  ? 8.430  11.882  28.327 1.00 18.69 ? 74   SER A O   1 
ATOM   491  C  CB  . SER A 1 99  ? 6.434  14.228  29.002 1.00 21.96 ? 74   SER A CB  1 
ATOM   492  O  OG  . SER A 1 99  ? 5.847  15.278  28.253 1.00 30.65 ? 74   SER A OG  1 
ATOM   493  N  N   . ILE A 1 100 ? 8.928  13.522  26.849 1.00 18.95 ? 75   ILE A N   1 
ATOM   494  C  CA  . ILE A 1 100 ? 9.481  12.602  25.855 1.00 17.82 ? 75   ILE A CA  1 
ATOM   495  C  C   . ILE A 1 100 ? 10.689 11.896  26.422 1.00 17.12 ? 75   ILE A C   1 
ATOM   496  O  O   . ILE A 1 100 ? 10.679 10.688  26.557 1.00 18.03 ? 75   ILE A O   1 
ATOM   497  C  CB  . ILE A 1 100 ? 9.750  13.298  24.460 1.00 20.42 ? 75   ILE A CB  1 
ATOM   498  C  CG1 . ILE A 1 100 ? 8.440  13.885  23.860 1.00 19.63 ? 75   ILE A CG1 1 
ATOM   499  C  CG2 . ILE A 1 100 ? 10.327 12.283  23.471 1.00 17.30 ? 75   ILE A CG2 1 
ATOM   500  C  CD1 . ILE A 1 100 ? 8.582  14.604  22.508 1.00 23.08 ? 75   ILE A CD1 1 
ATOM   501  N  N   . ILE A 1 101 ? 11.698 12.625  26.857 1.00 18.46 ? 76   ILE A N   1 
ATOM   502  C  CA  . ILE A 1 101 ? 12.916 12.070  27.436 1.00 19.33 ? 76   ILE A CA  1 
ATOM   503  C  C   . ILE A 1 101 ? 12.622 11.116  28.592 1.00 19.01 ? 76   ILE A C   1 
ATOM   504  O  O   . ILE A 1 101 ? 13.199 10.040  28.714 1.00 20.65 ? 76   ILE A O   1 
ATOM   505  C  CB  . ILE A 1 101 ? 13.816 13.253  27.900 1.00 18.88 ? 76   ILE A CB  1 
ATOM   506  C  CG1 . ILE A 1 101 ? 14.239 14.216  26.789 1.00 17.98 ? 76   ILE A CG1 1 
ATOM   507  C  CG2 . ILE A 1 101 ? 15.057 12.732  28.600 1.00 20.53 ? 76   ILE A CG2 1 
ATOM   508  C  CD1 . ILE A 1 101 ? 14.950 15.500  27.300 1.00 15.54 ? 76   ILE A CD1 1 
ATOM   509  N  N   . ASP A 1 102 ? 11.643 11.474  29.412 1.00 19.90 ? 77   ASP A N   1 
ATOM   510  C  CA  . ASP A 1 102 ? 11.226 10.682  30.562 1.00 19.93 ? 77   ASP A CA  1 
ATOM   511  C  C   . ASP A 1 102 ? 10.627 9.341   30.177 1.00 21.32 ? 77   ASP A C   1 
ATOM   512  O  O   . ASP A 1 102 ? 10.832 8.318   30.830 1.00 21.41 ? 77   ASP A O   1 
ATOM   513  C  CB  . ASP A 1 102 ? 10.189 11.524  31.263 1.00 21.00 ? 77   ASP A CB  1 
ATOM   514  C  CG  . ASP A 1 102 ? 9.506  10.808  32.390 1.00 23.32 ? 77   ASP A CG  1 
ATOM   515  O  OD1 . ASP A 1 102 ? 10.211 10.249  33.204 1.00 26.02 ? 77   ASP A OD1 1 
ATOM   516  O  OD2 . ASP A 1 102 ? 8.283  10.750  32.419 1.00 24.74 ? 77   ASP A OD2 1 
ATOM   517  N  N   . LYS A 1 103 ? 9.835  9.312   29.101 1.00 23.41 ? 78   LYS A N   1 
ATOM   518  C  CA  . LYS A 1 103 ? 9.385  8.038   28.606 1.00 23.09 ? 78   LYS A CA  1 
ATOM   519  C  C   . LYS A 1 103 ? 10.529 7.247   27.975 1.00 24.61 ? 78   LYS A C   1 
ATOM   520  O  O   . LYS A 1 103 ? 10.518 6.000   28.021 1.00 26.85 ? 78   LYS A O   1 
ATOM   521  C  CB  . LYS A 1 103 ? 8.267  8.237   27.656 1.00 25.84 ? 78   LYS A CB  1 
ATOM   522  C  CG  . LYS A 1 103 ? 7.024  8.643   28.403 1.00 29.26 ? 78   LYS A CG  1 
ATOM   523  C  CD  . LYS A 1 103 ? 5.882  8.766   27.362 1.00 40.97 ? 78   LYS A CD  1 
ATOM   524  C  CE  . LYS A 1 103 ? 6.119  9.815   26.221 1.00 43.91 ? 78   LYS A CE  1 
ATOM   525  N  NZ  . LYS A 1 103 ? 5.056  9.792   25.229 1.00 48.24 ? 78   LYS A NZ  1 
ATOM   526  N  N   . LEU A 1 104 ? 11.559 7.936   27.437 1.00 22.19 ? 79   LEU A N   1 
ATOM   527  C  CA  . LEU A 1 104 ? 12.718 7.253   26.865 1.00 18.09 ? 79   LEU A CA  1 
ATOM   528  C  C   . LEU A 1 104 ? 13.577 6.757   27.968 1.00 16.82 ? 79   LEU A C   1 
ATOM   529  O  O   . LEU A 1 104 ? 14.146 5.692   27.806 1.00 17.74 ? 79   LEU A O   1 
ATOM   530  C  CB  . LEU A 1 104 ? 13.580 8.147   25.986 1.00 16.97 ? 79   LEU A CB  1 
ATOM   531  C  CG  . LEU A 1 104 ? 12.928 8.748   24.768 1.00 15.98 ? 79   LEU A CG  1 
ATOM   532  C  CD1 . LEU A 1 104 ? 13.984 9.540   24.058 1.00 16.93 ? 79   LEU A CD1 1 
ATOM   533  C  CD2 . LEU A 1 104 ? 12.264 7.721   23.857 1.00 14.76 ? 79   LEU A CD2 1 
ATOM   534  N  N   . VAL A 1 105 ? 13.609 7.460   29.101 1.00 16.48 ? 80   VAL A N   1 
ATOM   535  C  CA  . VAL A 1 105 ? 14.352 6.994   30.249 1.00 13.79 ? 80   VAL A CA  1 
ATOM   536  C  C   . VAL A 1 105 ? 13.697 5.725   30.731 1.00 14.44 ? 80   VAL A C   1 
ATOM   537  O  O   . VAL A 1 105 ? 14.385 4.763   31.022 1.00 14.81 ? 80   VAL A O   1 
ATOM   538  C  CB  . VAL A 1 105 ? 14.382 8.054   31.331 1.00 17.12 ? 80   VAL A CB  1 
ATOM   539  C  CG1 . VAL A 1 105 ? 14.937 7.490   32.631 1.00 17.65 ? 80   VAL A CG1 1 
ATOM   540  C  CG2 . VAL A 1 105 ? 15.307 9.189   30.910 1.00 13.43 ? 80   VAL A CG2 1 
ATOM   541  N  N   . ASN A 1 106 ? 12.383 5.633   30.743 1.00 16.27 ? 81   ASN A N   1 
ATOM   542  C  CA  . ASN A 1 106 ? 11.696 4.398   31.081 1.00 18.71 ? 81   ASN A CA  1 
ATOM   543  C  C   . ASN A 1 106 ? 11.852 3.174   30.176 1.00 21.49 ? 81   ASN A C   1 
ATOM   544  O  O   . ASN A 1 106 ? 11.945 2.060   30.691 1.00 22.57 ? 81   ASN A O   1 
ATOM   545  C  CB  . ASN A 1 106 ? 10.244 4.707   31.191 1.00 20.64 ? 81   ASN A CB  1 
ATOM   546  C  CG  . ASN A 1 106 ? 9.968  5.574   32.402 1.00 22.06 ? 81   ASN A CG  1 
ATOM   547  O  OD1 . ASN A 1 106 ? 10.652 5.475   33.422 1.00 22.22 ? 81   ASN A OD1 1 
ATOM   548  N  ND2 . ASN A 1 106 ? 8.941  6.409   32.322 1.00 21.76 ? 81   ASN A ND2 1 
ATOM   549  N  N   . ILE A 1 107 ? 11.898 3.339   28.846 1.00 21.86 ? 82   ILE A N   1 
ATOM   550  C  CA  . ILE A 1 107 ? 12.226 2.270   27.917 1.00 23.02 ? 82   ILE A CA  1 
ATOM   551  C  C   . ILE A 1 107 ? 13.602 1.742   28.112 1.00 23.67 ? 82   ILE A C   1 
ATOM   552  O  O   . ILE A 1 107 ? 13.728 0.536   28.067 1.00 26.85 ? 82   ILE A O   1 
ATOM   553  C  CB  . ILE A 1 107 ? 12.089 2.768   26.497 1.00 22.79 ? 82   ILE A CB  1 
ATOM   554  C  CG1 . ILE A 1 107 ? 10.613 2.757   26.220 1.00 23.80 ? 82   ILE A CG1 1 
ATOM   555  C  CG2 . ILE A 1 107 ? 12.854 1.951   25.474 1.00 21.98 ? 82   ILE A CG2 1 
ATOM   556  C  CD1 . ILE A 1 107 ? 10.321 3.659   25.020 1.00 27.18 ? 82   ILE A CD1 1 
ATOM   557  N  N   . VAL A 1 108 ? 14.619 2.586   28.254 1.00 25.82 ? 83   VAL A N   1 
ATOM   558  C  CA  . VAL A 1 108 ? 15.996 2.104   28.338 1.00 27.82 ? 83   VAL A CA  1 
ATOM   559  C  C   . VAL A 1 108 ? 16.212 1.471   29.706 1.00 30.01 ? 83   VAL A C   1 
ATOM   560  O  O   . VAL A 1 108 ? 16.995 0.522   29.796 1.00 32.08 ? 83   VAL A O   1 
ATOM   561  C  CB  . VAL A 1 108 ? 17.139 3.137   28.252 1.00 26.25 ? 83   VAL A CB  1 
ATOM   562  C  CG1 . VAL A 1 108 ? 18.343 2.445   27.683 1.00 28.68 ? 83   VAL A CG1 1 
ATOM   563  C  CG2 . VAL A 1 108 ? 16.883 4.437   27.569 1.00 28.99 ? 83   VAL A CG2 1 
ATOM   564  N  N   . ASP A 1 109 ? 15.602 1.983   30.789 1.00 30.99 ? 84   ASP A N   1 
ATOM   565  C  CA  . ASP A 1 109 ? 15.711 1.384   32.123 1.00 34.08 ? 84   ASP A CA  1 
ATOM   566  C  C   . ASP A 1 109 ? 15.125 -0.013  32.275 1.00 34.30 ? 84   ASP A C   1 
ATOM   567  O  O   . ASP A 1 109 ? 15.666 -0.816  33.035 1.00 35.01 ? 84   ASP A O   1 
ATOM   568  C  CB  . ASP A 1 109 ? 15.148 2.331   33.189 1.00 37.32 ? 84   ASP A CB  1 
ATOM   569  C  CG  . ASP A 1 109 ? 15.909 3.664   33.316 1.00 42.03 ? 84   ASP A CG  1 
ATOM   570  O  OD1 . ASP A 1 109 ? 16.907 3.865   32.621 1.00 43.39 ? 84   ASP A OD1 1 
ATOM   571  O  OD2 . ASP A 1 109 ? 15.496 4.523   34.107 1.00 44.86 ? 84   ASP A OD2 1 
ATOM   572  N  N   . ASP A 1 110 ? 14.055 -0.335  31.524 1.00 35.79 ? 85   ASP A N   1 
ATOM   573  C  CA  . ASP A 1 110 ? 13.554 -1.707  31.332 1.00 37.15 ? 85   ASP A CA  1 
ATOM   574  C  C   . ASP A 1 110 ? 14.655 -2.665  30.860 1.00 34.71 ? 85   ASP A C   1 
ATOM   575  O  O   . ASP A 1 110 ? 14.777 -3.800  31.308 1.00 33.69 ? 85   ASP A O   1 
ATOM   576  C  CB  . ASP A 1 110 ? 12.434 -1.780  30.233 1.00 42.27 ? 85   ASP A CB  1 
ATOM   577  C  CG  . ASP A 1 110 ? 11.023 -1.216  30.474 1.00 46.16 ? 85   ASP A CG  1 
ATOM   578  O  OD1 . ASP A 1 110 ? 10.747 -0.756  31.587 1.00 46.14 ? 85   ASP A OD1 1 
ATOM   579  O  OD2 . ASP A 1 110 ? 10.197 -1.234  29.539 1.00 50.79 ? 85   ASP A OD2 1 
ATOM   580  N  N   . LEU A 1 111 ? 15.437 -2.164  29.904 1.00 33.83 ? 86   LEU A N   1 
ATOM   581  C  CA  . LEU A 1 111 ? 16.527 -2.886  29.288 1.00 33.71 ? 86   LEU A CA  1 
ATOM   582  C  C   . LEU A 1 111 ? 17.747 -2.959  30.177 1.00 34.12 ? 86   LEU A C   1 
ATOM   583  O  O   . LEU A 1 111 ? 18.440 -3.965  30.083 1.00 34.86 ? 86   LEU A O   1 
ATOM   584  C  CB  . LEU A 1 111 ? 16.907 -2.260  27.948 1.00 31.87 ? 86   LEU A CB  1 
ATOM   585  C  CG  . LEU A 1 111 ? 15.878 -2.198  26.829 1.00 30.75 ? 86   LEU A CG  1 
ATOM   586  C  CD1 . LEU A 1 111 ? 16.383 -1.351  25.699 1.00 30.54 ? 86   LEU A CD1 1 
ATOM   587  C  CD2 . LEU A 1 111 ? 15.521 -3.581  26.349 1.00 29.51 ? 86   LEU A CD2 1 
ATOM   588  N  N   . VAL A 1 112 ? 18.033 -1.973  31.039 1.00 33.89 ? 87   VAL A N   1 
ATOM   589  C  CA  . VAL A 1 112 ? 19.121 -2.074  32.009 1.00 35.56 ? 87   VAL A CA  1 
ATOM   590  C  C   . VAL A 1 112 ? 18.933 -3.223  33.039 1.00 40.73 ? 87   VAL A C   1 
ATOM   591  O  O   . VAL A 1 112 ? 19.889 -3.890  33.493 1.00 42.23 ? 87   VAL A O   1 
ATOM   592  C  CB  . VAL A 1 112 ? 19.239 -0.695  32.614 1.00 31.60 ? 87   VAL A CB  1 
ATOM   593  C  CG1 . VAL A 1 112 ? 20.272 -0.634  33.703 1.00 33.57 ? 87   VAL A CG1 1 
ATOM   594  C  CG2 . VAL A 1 112 ? 19.680 0.253   31.537 1.00 29.91 ? 87   VAL A CG2 1 
ATOM   595  N  N   . GLU A 1 113 ? 17.645 -3.484  33.340 1.00 44.00 ? 88   GLU A N   1 
ATOM   596  C  CA  . GLU A 1 113 ? 17.191 -4.563  34.217 1.00 47.21 ? 88   GLU A CA  1 
ATOM   597  C  C   . GLU A 1 113 ? 17.016 -5.918  33.542 1.00 48.21 ? 88   GLU A C   1 
ATOM   598  O  O   . GLU A 1 113 ? 17.359 -6.909  34.169 1.00 47.84 ? 88   GLU A O   1 
ATOM   599  C  CB  . GLU A 1 113 ? 15.868 -4.200  34.886 1.00 49.05 ? 88   GLU A CB  1 
ATOM   600  C  CG  . GLU A 1 113 ? 15.877 -2.952  35.772 1.00 52.09 ? 88   GLU A CG  1 
ATOM   601  C  CD  . GLU A 1 113 ? 16.809 -3.020  36.976 1.00 53.70 ? 88   GLU A CD  1 
ATOM   602  O  OE1 . GLU A 1 113 ? 16.608 -3.858  37.861 1.00 55.01 ? 88   GLU A OE1 1 
ATOM   603  O  OE2 . GLU A 1 113 ? 17.744 -2.221  37.020 1.00 54.23 ? 88   GLU A OE2 1 
ATOM   604  N  N   . CYS A 1 114 ? 16.475 -6.018  32.311 1.00 50.79 ? 89   CYS A N   1 
ATOM   605  C  CA  . CYS A 1 114 ? 16.489 -7.244  31.503 1.00 54.51 ? 89   CYS A CA  1 
ATOM   606  C  C   . CYS A 1 114 ? 17.952 -7.703  31.459 1.00 55.09 ? 89   CYS A C   1 
ATOM   607  O  O   . CYS A 1 114 ? 18.231 -8.791  31.961 1.00 57.42 ? 89   CYS A O   1 
ATOM   608  C  CB  . CYS A 1 114 ? 15.903 -6.972  30.078 1.00 57.17 ? 89   CYS A CB  1 
ATOM   609  S  SG  . CYS A 1 114 ? 15.060 -8.280  29.096 1.00 64.80 ? 89   CYS A SG  1 
ATOM   610  N  N   . VAL A 1 115 ? 18.890 -6.838  31.002 1.00 55.69 ? 90   VAL A N   1 
ATOM   611  C  CA  . VAL A 1 115 ? 20.357 -7.027  31.060 1.00 55.91 ? 90   VAL A CA  1 
ATOM   612  C  C   . VAL A 1 115 ? 20.906 -7.397  32.450 1.00 57.84 ? 90   VAL A C   1 
ATOM   613  O  O   . VAL A 1 115 ? 22.014 -7.924  32.546 1.00 58.27 ? 90   VAL A O   1 
ATOM   614  C  CB  . VAL A 1 115 ? 21.074 -5.738  30.480 1.00 53.45 ? 90   VAL A CB  1 
ATOM   615  C  CG1 . VAL A 1 115 ? 22.542 -5.564  30.824 1.00 52.76 ? 90   VAL A CG1 1 
ATOM   616  C  CG2 . VAL A 1 115 ? 20.965 -5.689  28.978 1.00 50.05 ? 90   VAL A CG2 1 
ATOM   617  N  N   . LYS A 1 116 ? 20.212 -7.128  33.558 1.00 59.29 ? 91   LYS A N   1 
ATOM   618  C  CA  . LYS A 1 116 ? 20.556 -7.785  34.810 1.00 62.11 ? 91   LYS A CA  1 
ATOM   619  C  C   . LYS A 1 116 ? 19.865 -9.163  34.996 1.00 63.85 ? 91   LYS A C   1 
ATOM   620  O  O   . LYS A 1 116 ? 20.517 -10.061 35.533 1.00 66.48 ? 91   LYS A O   1 
ATOM   621  C  CB  . LYS A 1 116 ? 20.305 -6.837  35.993 1.00 61.39 ? 91   LYS A CB  1 
ATOM   622  N  N   . SER A 1 129 ? 36.757 4.074   31.300 1.00 64.71 ? 104  SER A N   1 
ATOM   623  C  CA  . SER A 1 129 ? 36.147 4.043   29.974 1.00 64.00 ? 104  SER A CA  1 
ATOM   624  C  C   . SER A 1 129 ? 34.723 3.416   29.904 1.00 61.57 ? 104  SER A C   1 
ATOM   625  O  O   . SER A 1 129 ? 34.321 2.749   30.871 1.00 62.78 ? 104  SER A O   1 
ATOM   626  C  CB  . SER A 1 129 ? 37.147 3.441   28.919 1.00 65.90 ? 104  SER A CB  1 
ATOM   627  O  OG  . SER A 1 129 ? 38.150 4.399   28.533 1.00 67.30 ? 104  SER A OG  1 
ATOM   628  N  N   . PRO A 1 130 ? 33.891 3.576   28.842 1.00 57.26 ? 105  PRO A N   1 
ATOM   629  C  CA  . PRO A 1 130 ? 34.173 4.332   27.635 1.00 53.19 ? 105  PRO A CA  1 
ATOM   630  C  C   . PRO A 1 130 ? 34.452 5.801   27.827 1.00 51.76 ? 105  PRO A C   1 
ATOM   631  O  O   . PRO A 1 130 ? 34.107 6.397   28.848 1.00 53.30 ? 105  PRO A O   1 
ATOM   632  C  CB  . PRO A 1 130 ? 32.968 4.091   26.813 1.00 51.85 ? 105  PRO A CB  1 
ATOM   633  C  CG  . PRO A 1 130 ? 31.869 3.765   27.755 1.00 53.45 ? 105  PRO A CG  1 
ATOM   634  C  CD  . PRO A 1 130 ? 32.618 2.880   28.698 1.00 55.74 ? 105  PRO A CD  1 
ATOM   635  N  N   . GLU A 1 131 ? 35.242 6.296   26.875 1.00 50.80 ? 106  GLU A N   1 
ATOM   636  C  CA  . GLU A 1 131 ? 35.584 7.700   26.790 1.00 47.97 ? 106  GLU A CA  1 
ATOM   637  C  C   . GLU A 1 131 ? 34.332 8.435   26.350 1.00 44.14 ? 106  GLU A C   1 
ATOM   638  O  O   . GLU A 1 131 ? 33.684 8.006   25.400 1.00 42.91 ? 106  GLU A O   1 
ATOM   639  C  CB  . GLU A 1 131 ? 36.796 7.970   25.858 1.00 51.71 ? 106  GLU A CB  1 
ATOM   640  C  CG  . GLU A 1 131 ? 36.873 7.196   24.509 1.00 57.13 ? 106  GLU A CG  1 
ATOM   641  C  CD  . GLU A 1 131 ? 38.045 6.192   24.389 1.00 60.78 ? 106  GLU A CD  1 
ATOM   642  O  OE1 . GLU A 1 131 ? 38.141 5.251   25.189 1.00 61.59 ? 106  GLU A OE1 1 
ATOM   643  O  OE2 . GLU A 1 131 ? 38.874 6.338   23.482 1.00 63.52 ? 106  GLU A OE2 1 
ATOM   644  N  N   . PRO A 1 132 ? 33.936 9.481   27.092 1.00 41.02 ? 107  PRO A N   1 
ATOM   645  C  CA  . PRO A 1 132 ? 32.846 10.386  26.770 1.00 38.74 ? 107  PRO A CA  1 
ATOM   646  C  C   . PRO A 1 132 ? 33.069 11.190  25.517 1.00 37.93 ? 107  PRO A C   1 
ATOM   647  O  O   . PRO A 1 132 ? 34.148 11.749  25.271 1.00 40.00 ? 107  PRO A O   1 
ATOM   648  C  CB  . PRO A 1 132 ? 32.764 11.292  27.970 1.00 39.85 ? 107  PRO A CB  1 
ATOM   649  C  CG  . PRO A 1 132 ? 34.162 11.290  28.542 1.00 40.91 ? 107  PRO A CG  1 
ATOM   650  C  CD  . PRO A 1 132 ? 34.522 9.832   28.384 1.00 41.30 ? 107  PRO A CD  1 
ATOM   651  N  N   . ARG A 1 133 ? 32.000 11.208  24.724 1.00 35.40 ? 108  ARG A N   1 
ATOM   652  C  CA  . ARG A 1 133 ? 32.006 11.864  23.436 1.00 33.34 ? 108  ARG A CA  1 
ATOM   653  C  C   . ARG A 1 133 ? 30.766 12.722  23.318 1.00 29.75 ? 108  ARG A C   1 
ATOM   654  O  O   . ARG A 1 133 ? 29.727 12.347  23.867 1.00 29.55 ? 108  ARG A O   1 
ATOM   655  C  CB  . ARG A 1 133 ? 32.102 10.859  22.297 1.00 35.14 ? 108  ARG A CB  1 
ATOM   656  C  CG  . ARG A 1 133 ? 33.480 10.219  22.313 1.00 39.55 ? 108  ARG A CG  1 
ATOM   657  C  CD  . ARG A 1 133 ? 33.734 9.386   21.057 1.00 44.05 ? 108  ARG A CD  1 
ATOM   658  N  NE  . ARG A 1 133 ? 34.715 8.324   21.284 1.00 45.36 ? 108  ARG A NE  1 
ATOM   659  C  CZ  . ARG A 1 133 ? 34.965 7.376   20.373 1.00 45.18 ? 108  ARG A CZ  1 
ATOM   660  N  NH1 . ARG A 1 133 ? 34.481 7.446   19.142 1.00 46.89 ? 108  ARG A NH1 1 
ATOM   661  N  NH2 . ARG A 1 133 ? 35.679 6.306   20.712 1.00 46.89 ? 108  ARG A NH2 1 
ATOM   662  N  N   . LEU A 1 134 ? 30.932 13.877  22.650 1.00 26.42 ? 109  LEU A N   1 
ATOM   663  C  CA  . LEU A 1 134 ? 29.833 14.770  22.334 1.00 25.17 ? 109  LEU A CA  1 
ATOM   664  C  C   . LEU A 1 134 ? 29.126 14.453  21.020 1.00 25.96 ? 109  LEU A C   1 
ATOM   665  O  O   . LEU A 1 134 ? 29.774 14.229  20.002 1.00 26.43 ? 109  LEU A O   1 
ATOM   666  C  CB  . LEU A 1 134 ? 30.316 16.182  22.280 1.00 24.30 ? 109  LEU A CB  1 
ATOM   667  C  CG  . LEU A 1 134 ? 31.003 16.770  23.483 1.00 25.72 ? 109  LEU A CG  1 
ATOM   668  C  CD1 . LEU A 1 134 ? 31.426 18.185  23.137 1.00 26.28 ? 109  LEU A CD1 1 
ATOM   669  C  CD2 . LEU A 1 134 ? 30.097 16.820  24.677 1.00 25.67 ? 109  LEU A CD2 1 
ATOM   670  N  N   . PHE A 1 135 ? 27.794 14.427  20.988 1.00 24.52 ? 110  PHE A N   1 
ATOM   671  C  CA  . PHE A 1 135 ? 27.019 14.004  19.822 1.00 22.36 ? 110  PHE A CA  1 
ATOM   672  C  C   . PHE A 1 135 ? 25.996 15.079  19.586 1.00 21.47 ? 110  PHE A C   1 
ATOM   673  O  O   . PHE A 1 135 ? 25.618 15.777  20.525 1.00 21.05 ? 110  PHE A O   1 
ATOM   674  C  CB  . PHE A 1 135 ? 26.227 12.725  20.075 1.00 21.69 ? 110  PHE A CB  1 
ATOM   675  C  CG  . PHE A 1 135 ? 27.133 11.561  20.318 1.00 23.01 ? 110  PHE A CG  1 
ATOM   676  C  CD1 . PHE A 1 135 ? 27.676 10.892  19.238 1.00 24.43 ? 110  PHE A CD1 1 
ATOM   677  C  CD2 . PHE A 1 135 ? 27.506 11.243  21.597 1.00 21.68 ? 110  PHE A CD2 1 
ATOM   678  C  CE1 . PHE A 1 135 ? 28.614 9.897   19.463 1.00 24.92 ? 110  PHE A CE1 1 
ATOM   679  C  CE2 . PHE A 1 135 ? 28.460 10.282  21.798 1.00 22.08 ? 110  PHE A CE2 1 
ATOM   680  C  CZ  . PHE A 1 135 ? 29.017 9.597   20.746 1.00 23.51 ? 110  PHE A CZ  1 
ATOM   681  N  N   . THR A 1 136 ? 25.557 15.239  18.339 1.00 20.40 ? 111  THR A N   1 
ATOM   682  C  CA  . THR A 1 136 ? 24.422 16.102  18.047 1.00 19.58 ? 111  THR A CA  1 
ATOM   683  C  C   . THR A 1 136 ? 23.175 15.367  18.473 1.00 15.81 ? 111  THR A C   1 
ATOM   684  O  O   . THR A 1 136 ? 23.239 14.150  18.603 1.00 18.63 ? 111  THR A O   1 
ATOM   685  C  CB  . THR A 1 136 ? 24.305 16.421  16.578 1.00 19.96 ? 111  THR A CB  1 
ATOM   686  O  OG1 . THR A 1 136 ? 24.145 15.178  15.907 1.00 21.91 ? 111  THR A OG1 1 
ATOM   687  C  CG2 . THR A 1 136 ? 25.487 17.252  16.118 1.00 23.08 ? 111  THR A CG2 1 
ATOM   688  N  N   . PRO A 1 137 ? 22.030 15.982  18.688 1.00 15.89 ? 112  PRO A N   1 
ATOM   689  C  CA  . PRO A 1 137 ? 20.783 15.254  18.984 1.00 16.41 ? 112  PRO A CA  1 
ATOM   690  C  C   . PRO A 1 137 ? 20.500 14.089  18.025 1.00 17.10 ? 112  PRO A C   1 
ATOM   691  O  O   . PRO A 1 137 ? 20.329 12.954  18.431 1.00 18.32 ? 112  PRO A O   1 
ATOM   692  C  CB  . PRO A 1 137 ? 19.794 16.375  18.870 1.00 13.89 ? 112  PRO A CB  1 
ATOM   693  C  CG  . PRO A 1 137 ? 20.581 17.559  19.386 1.00 14.36 ? 112  PRO A CG  1 
ATOM   694  C  CD  . PRO A 1 137 ? 21.876 17.424  18.685 1.00 12.46 ? 112  PRO A CD  1 
ATOM   695  N  N   . GLU A 1 138 ? 20.564 14.321  16.728 1.00 20.22 ? 113  GLU A N   1 
ATOM   696  C  CA  . GLU A 1 138 ? 20.393 13.303  15.737 1.00 24.11 ? 113  GLU A CA  1 
ATOM   697  C  C   . GLU A 1 138 ? 21.371 12.143  15.864 1.00 24.55 ? 113  GLU A C   1 
ATOM   698  O  O   . GLU A 1 138 ? 20.963 10.982  15.866 1.00 25.38 ? 113  GLU A O   1 
ATOM   699  C  CB  . GLU A 1 138 ? 20.539 13.991  14.420 1.00 29.66 ? 113  GLU A CB  1 
ATOM   700  C  CG  . GLU A 1 138 ? 20.432 13.029  13.250 1.00 41.26 ? 113  GLU A CG  1 
ATOM   701  C  CD  . GLU A 1 138 ? 21.253 13.476  12.042 1.00 49.84 ? 113  GLU A CD  1 
ATOM   702  O  OE1 . GLU A 1 138 ? 22.475 13.694  12.197 1.00 52.84 ? 113  GLU A OE1 1 
ATOM   703  O  OE2 . GLU A 1 138 ? 20.662 13.586  10.949 1.00 55.78 ? 113  GLU A OE2 1 
ATOM   704  N  N   . GLU A 1 139 ? 22.663 12.384  16.033 1.00 24.48 ? 114  GLU A N   1 
ATOM   705  C  CA  . GLU A 1 139 ? 23.594 11.291  16.198 1.00 22.26 ? 114  GLU A CA  1 
ATOM   706  C  C   . GLU A 1 139 ? 23.398 10.486  17.471 1.00 22.80 ? 114  GLU A C   1 
ATOM   707  O  O   . GLU A 1 139 ? 23.564 9.256   17.494 1.00 23.87 ? 114  GLU A O   1 
ATOM   708  C  CB  . GLU A 1 139 ? 24.979 11.857  16.198 1.00 26.15 ? 114  GLU A CB  1 
ATOM   709  C  CG  . GLU A 1 139 ? 25.362 12.534  14.897 1.00 32.62 ? 114  GLU A CG  1 
ATOM   710  C  CD  . GLU A 1 139 ? 26.719 13.225  15.002 1.00 38.61 ? 114  GLU A CD  1 
ATOM   711  O  OE1 . GLU A 1 139 ? 26.860 14.093  15.867 1.00 41.67 ? 114  GLU A OE1 1 
ATOM   712  O  OE2 . GLU A 1 139 ? 27.646 12.893  14.242 1.00 42.28 ? 114  GLU A OE2 1 
ATOM   713  N  N   . PHE A 1 140 ? 23.035 11.181  18.558 1.00 21.59 ? 115  PHE A N   1 
ATOM   714  C  CA  . PHE A 1 140 ? 22.812 10.544  19.850 1.00 19.30 ? 115  PHE A CA  1 
ATOM   715  C  C   . PHE A 1 140 ? 21.601 9.645   19.667 1.00 17.06 ? 115  PHE A C   1 
ATOM   716  O  O   . PHE A 1 140 ? 21.555 8.527   20.165 1.00 17.46 ? 115  PHE A O   1 
ATOM   717  C  CB  . PHE A 1 140 ? 22.586 11.623  20.972 1.00 16.68 ? 115  PHE A CB  1 
ATOM   718  C  CG  . PHE A 1 140 ? 22.148 11.018  22.298 1.00 13.67 ? 115  PHE A CG  1 
ATOM   719  C  CD1 . PHE A 1 140 ? 20.820 10.679  22.520 1.00 15.42 ? 115  PHE A CD1 1 
ATOM   720  C  CD2 . PHE A 1 140 ? 23.081 10.752  23.261 1.00 15.56 ? 115  PHE A CD2 1 
ATOM   721  C  CE1 . PHE A 1 140 ? 20.412 10.003  23.650 1.00 16.48 ? 115  PHE A CE1 1 
ATOM   722  C  CE2 . PHE A 1 140 ? 22.674 10.136  24.429 1.00 17.36 ? 115  PHE A CE2 1 
ATOM   723  C  CZ  . PHE A 1 140 ? 21.351 9.750   24.617 1.00 18.29 ? 115  PHE A CZ  1 
ATOM   724  N  N   . PHE A 1 141 ? 20.581 10.135  18.981 1.00 18.67 ? 116  PHE A N   1 
ATOM   725  C  CA  . PHE A 1 141 ? 19.401 9.327   18.860 1.00 18.51 ? 116  PHE A CA  1 
ATOM   726  C  C   . PHE A 1 141 ? 19.510 8.196   17.854 1.00 22.03 ? 116  PHE A C   1 
ATOM   727  O  O   . PHE A 1 141 ? 18.768 7.213   17.892 1.00 22.83 ? 116  PHE A O   1 
ATOM   728  C  CB  . PHE A 1 141 ? 18.204 10.195  18.687 1.00 19.13 ? 116  PHE A CB  1 
ATOM   729  C  CG  . PHE A 1 141 ? 17.735 10.764  20.021 1.00 19.41 ? 116  PHE A CG  1 
ATOM   730  C  CD1 . PHE A 1 141 ? 17.159 9.924   20.952 1.00 19.08 ? 116  PHE A CD1 1 
ATOM   731  C  CD2 . PHE A 1 141 ? 17.991 12.079  20.343 1.00 19.60 ? 116  PHE A CD2 1 
ATOM   732  C  CE1 . PHE A 1 141 ? 16.911 10.381  22.214 1.00 18.67 ? 116  PHE A CE1 1 
ATOM   733  C  CE2 . PHE A 1 141 ? 17.747 12.528  21.619 1.00 21.95 ? 116  PHE A CE2 1 
ATOM   734  C  CZ  . PHE A 1 141 ? 17.218 11.674  22.550 1.00 19.99 ? 116  PHE A CZ  1 
ATOM   735  N  N   . ARG A 1 142 ? 20.510 8.249   16.986 1.00 22.43 ? 117  ARG A N   1 
ATOM   736  C  CA  . ARG A 1 142 ? 20.822 7.134   16.123 1.00 21.98 ? 117  ARG A CA  1 
ATOM   737  C  C   . ARG A 1 142 ? 21.453 6.076   16.971 1.00 19.70 ? 117  ARG A C   1 
ATOM   738  O  O   . ARG A 1 142 ? 21.039 4.946   16.841 1.00 22.56 ? 117  ARG A O   1 
ATOM   739  C  CB  . ARG A 1 142 ? 21.769 7.623   15.052 1.00 27.63 ? 117  ARG A CB  1 
ATOM   740  C  CG  . ARG A 1 142 ? 22.329 6.596   14.082 1.00 36.33 ? 117  ARG A CG  1 
ATOM   741  C  CD  . ARG A 1 142 ? 23.135 7.255   12.971 1.00 43.02 ? 117  ARG A CD  1 
ATOM   742  N  NE  . ARG A 1 142 ? 22.296 8.207   12.239 1.00 49.61 ? 117  ARG A NE  1 
ATOM   743  C  CZ  . ARG A 1 142 ? 22.704 9.468   12.008 1.00 54.02 ? 117  ARG A CZ  1 
ATOM   744  N  NH1 . ARG A 1 142 ? 23.915 9.867   12.474 1.00 53.58 ? 117  ARG A NH1 1 
ATOM   745  N  NH2 . ARG A 1 142 ? 21.899 10.314  11.313 1.00 53.56 ? 117  ARG A NH2 1 
ATOM   746  N  N   . ILE A 1 143 ? 22.394 6.348   17.874 1.00 19.56 ? 118  ILE A N   1 
ATOM   747  C  CA  . ILE A 1 143 ? 22.944 5.328   18.746 1.00 18.66 ? 118  ILE A CA  1 
ATOM   748  C  C   . ILE A 1 143 ? 21.888 4.776   19.673 1.00 19.62 ? 118  ILE A C   1 
ATOM   749  O  O   . ILE A 1 143 ? 21.887 3.579   19.933 1.00 21.23 ? 118  ILE A O   1 
ATOM   750  C  CB  . ILE A 1 143 ? 24.054 5.970   19.533 1.00 21.60 ? 118  ILE A CB  1 
ATOM   751  C  CG1 . ILE A 1 143 ? 25.121 6.479   18.593 1.00 22.63 ? 118  ILE A CG1 1 
ATOM   752  C  CG2 . ILE A 1 143 ? 24.665 5.002   20.534 1.00 22.20 ? 118  ILE A CG2 1 
ATOM   753  C  CD1 . ILE A 1 143 ? 26.178 7.330   19.285 1.00 23.90 ? 118  ILE A CD1 1 
ATOM   754  N  N   . PHE A 1 144 ? 20.971 5.619   20.180 1.00 20.06 ? 119  PHE A N   1 
ATOM   755  C  CA  . PHE A 1 144 ? 19.827 5.124   20.943 1.00 21.07 ? 119  PHE A CA  1 
ATOM   756  C  C   . PHE A 1 144 ? 18.940 4.182   20.141 1.00 21.06 ? 119  PHE A C   1 
ATOM   757  O  O   . PHE A 1 144 ? 18.720 3.075   20.600 1.00 22.31 ? 119  PHE A O   1 
ATOM   758  C  CB  . PHE A 1 144 ? 19.001 6.253   21.590 1.00 18.55 ? 119  PHE A CB  1 
ATOM   759  C  CG  . PHE A 1 144 ? 17.726 5.856   22.342 1.00 18.55 ? 119  PHE A CG  1 
ATOM   760  C  CD1 . PHE A 1 144 ? 16.517 5.708   21.673 1.00 17.37 ? 119  PHE A CD1 1 
ATOM   761  C  CD2 . PHE A 1 144 ? 17.736 5.715   23.718 1.00 21.09 ? 119  PHE A CD2 1 
ATOM   762  C  CE1 . PHE A 1 144 ? 15.348 5.439   22.351 1.00 16.37 ? 119  PHE A CE1 1 
ATOM   763  C  CE2 . PHE A 1 144 ? 16.555 5.448   24.404 1.00 19.97 ? 119  PHE A CE2 1 
ATOM   764  C  CZ  . PHE A 1 144 ? 15.369 5.311   23.721 1.00 19.81 ? 119  PHE A CZ  1 
ATOM   765  N  N   . ASN A 1 145 ? 18.426 4.507   18.957 1.00 22.51 ? 120  ASN A N   1 
ATOM   766  C  CA  . ASN A 1 145 ? 17.567 3.577   18.222 1.00 23.92 ? 120  ASN A CA  1 
ATOM   767  C  C   . ASN A 1 145 ? 18.284 2.316   17.841 1.00 25.82 ? 120  ASN A C   1 
ATOM   768  O  O   . ASN A 1 145 ? 17.653 1.274   17.841 1.00 26.73 ? 120  ASN A O   1 
ATOM   769  C  CB  . ASN A 1 145 ? 16.912 4.179   16.996 1.00 20.96 ? 120  ASN A CB  1 
ATOM   770  C  CG  . ASN A 1 145 ? 15.857 5.195   17.377 1.00 24.90 ? 120  ASN A CG  1 
ATOM   771  O  OD1 . ASN A 1 145 ? 14.852 4.877   18.020 1.00 30.44 ? 120  ASN A OD1 1 
ATOM   772  N  ND2 . ASN A 1 145 ? 16.044 6.458   17.023 1.00 26.09 ? 120  ASN A ND2 1 
ATOM   773  N  N   . ARG A 1 146 ? 19.605 2.390   17.632 1.00 29.29 ? 121  ARG A N   1 
ATOM   774  C  CA  . ARG A 1 146 ? 20.447 1.234   17.314 1.00 32.15 ? 121  ARG A CA  1 
ATOM   775  C  C   . ARG A 1 146 ? 20.686 0.283   18.503 1.00 32.13 ? 121  ARG A C   1 
ATOM   776  O  O   . ARG A 1 146 ? 20.652 -0.949  18.369 1.00 32.27 ? 121  ARG A O   1 
ATOM   777  C  CB  . ARG A 1 146 ? 21.752 1.846   16.891 1.00 36.26 ? 121  ARG A CB  1 
ATOM   778  C  CG  . ARG A 1 146 ? 22.606 0.988   16.001 1.00 42.80 ? 121  ARG A CG  1 
ATOM   779  C  CD  . ARG A 1 146 ? 24.066 1.304   16.288 1.00 45.46 ? 121  ARG A CD  1 
ATOM   780  N  NE  . ARG A 1 146 ? 24.730 0.026   16.469 1.00 49.59 ? 121  ARG A NE  1 
ATOM   781  C  CZ  . ARG A 1 146 ? 25.603 -0.473  15.599 1.00 47.62 ? 121  ARG A CZ  1 
ATOM   782  N  NH1 . ARG A 1 146 ? 26.106 0.291   14.622 1.00 50.56 ? 121  ARG A NH1 1 
ATOM   783  N  NH2 . ARG A 1 146 ? 25.907 -1.764  15.692 1.00 41.39 ? 121  ARG A NH2 1 
ATOM   784  N  N   . SER A 1 147 ? 20.925 0.856   19.695 1.00 29.65 ? 122  SER A N   1 
ATOM   785  C  CA  . SER A 1 147 ? 20.981 0.077   20.908 1.00 27.73 ? 122  SER A CA  1 
ATOM   786  C  C   . SER A 1 147 ? 19.643 -0.555  21.201 1.00 27.23 ? 122  SER A C   1 
ATOM   787  O  O   . SER A 1 147 ? 19.603 -1.652  21.716 1.00 28.27 ? 122  SER A O   1 
ATOM   788  C  CB  . SER A 1 147 ? 21.388 0.942   22.071 1.00 25.31 ? 122  SER A CB  1 
ATOM   789  O  OG  . SER A 1 147 ? 22.619 1.543   21.726 1.00 25.19 ? 122  SER A OG  1 
ATOM   790  N  N   . ILE A 1 148 ? 18.530 0.087   20.884 1.00 29.27 ? 123  ILE A N   1 
ATOM   791  C  CA  . ILE A 1 148 ? 17.210 -0.453  21.140 1.00 31.25 ? 123  ILE A CA  1 
ATOM   792  C  C   . ILE A 1 148 ? 16.972 -1.618  20.207 1.00 32.43 ? 123  ILE A C   1 
ATOM   793  O  O   . ILE A 1 148 ? 16.522 -2.672  20.637 1.00 32.75 ? 123  ILE A O   1 
ATOM   794  C  CB  . ILE A 1 148 ? 16.129 0.661   20.973 1.00 33.20 ? 123  ILE A CB  1 
ATOM   795  C  CG1 . ILE A 1 148 ? 16.103 1.685   22.130 1.00 35.29 ? 123  ILE A CG1 1 
ATOM   796  C  CG2 . ILE A 1 148 ? 14.739 0.181   20.629 1.00 33.87 ? 123  ILE A CG2 1 
ATOM   797  C  CD1 . ILE A 1 148 ? 16.243 1.313   23.627 1.00 32.91 ? 123  ILE A CD1 1 
ATOM   798  N  N   . ASP A 1 149 ? 17.325 -1.466  18.937 1.00 35.41 ? 124  ASP A N   1 
ATOM   799  C  CA  . ASP A 1 149 ? 17.064 -2.502  17.973 1.00 38.41 ? 124  ASP A CA  1 
ATOM   800  C  C   . ASP A 1 149 ? 17.902 -3.728  18.170 1.00 38.55 ? 124  ASP A C   1 
ATOM   801  O  O   . ASP A 1 149 ? 17.386 -4.820  17.960 1.00 39.71 ? 124  ASP A O   1 
ATOM   802  C  CB  . ASP A 1 149 ? 17.074 -1.951  16.562 1.00 43.19 ? 124  ASP A CB  1 
ATOM   803  C  CG  . ASP A 1 149 ? 15.763 -1.179  16.387 1.00 51.27 ? 124  ASP A CG  1 
ATOM   804  O  OD1 . ASP A 1 149 ? 14.700 -1.790  16.620 1.00 56.07 ? 124  ASP A OD1 1 
ATOM   805  O  OD2 . ASP A 1 149 ? 15.784 0.020   16.039 1.00 54.65 ? 124  ASP A OD2 1 
ATOM   806  N  N   . ALA A 1 150 ? 19.102 -3.546  18.739 1.00 37.63 ? 125  ALA A N   1 
ATOM   807  C  CA  . ALA A 1 150 ? 20.039 -4.621  18.983 1.00 37.10 ? 125  ALA A CA  1 
ATOM   808  C  C   . ALA A 1 150 ? 19.555 -5.682  19.944 1.00 39.02 ? 125  ALA A C   1 
ATOM   809  O  O   . ALA A 1 150 ? 20.250 -6.667  20.151 1.00 40.94 ? 125  ALA A O   1 
ATOM   810  C  CB  . ALA A 1 150 ? 21.321 -4.035  19.500 1.00 35.16 ? 125  ALA A CB  1 
ATOM   811  N  N   . PHE A 1 151 ? 18.374 -5.538  20.549 1.00 41.54 ? 126  PHE A N   1 
ATOM   812  C  CA  . PHE A 1 151 ? 17.774 -6.599  21.363 1.00 45.13 ? 126  PHE A CA  1 
ATOM   813  C  C   . PHE A 1 151 ? 16.837 -7.482  20.578 1.00 47.39 ? 126  PHE A C   1 
ATOM   814  O  O   . PHE A 1 151 ? 16.711 -8.660  20.900 1.00 48.19 ? 126  PHE A O   1 
ATOM   815  C  CB  . PHE A 1 151 ? 16.971 -6.099  22.571 1.00 45.19 ? 126  PHE A CB  1 
ATOM   816  C  CG  . PHE A 1 151 ? 17.791 -5.456  23.683 1.00 44.53 ? 126  PHE A CG  1 
ATOM   817  C  CD1 . PHE A 1 151 ? 18.239 -4.150  23.568 1.00 43.63 ? 126  PHE A CD1 1 
ATOM   818  C  CD2 . PHE A 1 151 ? 18.073 -6.184  24.815 1.00 44.69 ? 126  PHE A CD2 1 
ATOM   819  C  CE1 . PHE A 1 151 ? 18.960 -3.565  24.576 1.00 41.80 ? 126  PHE A CE1 1 
ATOM   820  C  CE2 . PHE A 1 151 ? 18.800 -5.597  25.822 1.00 43.70 ? 126  PHE A CE2 1 
ATOM   821  C  CZ  . PHE A 1 151 ? 19.238 -4.295  25.700 1.00 43.96 ? 126  PHE A CZ  1 
ATOM   822  N  N   . LYS A 1 152 ? 16.128 -6.898  19.600 1.00 50.61 ? 127  LYS A N   1 
ATOM   823  C  CA  . LYS A 1 152 ? 15.283 -7.656  18.679 1.00 53.56 ? 127  LYS A CA  1 
ATOM   824  C  C   . LYS A 1 152 ? 16.149 -8.640  17.856 1.00 55.43 ? 127  LYS A C   1 
ATOM   825  O  O   . LYS A 1 152 ? 16.038 -9.876  17.922 1.00 57.14 ? 127  LYS A O   1 
ATOM   826  C  CB  . LYS A 1 152 ? 14.546 -6.638  17.764 1.00 51.56 ? 127  LYS A CB  1 
ATOM   827  N  N   . ASP A 1 153 ? 17.077 -8.036  17.105 1.00 57.96 ? 128  ASP A N   1 
ATOM   828  C  CA  . ASP A 1 153 ? 18.105 -8.734  16.356 1.00 59.25 ? 128  ASP A CA  1 
ATOM   829  C  C   . ASP A 1 153 ? 19.292 -9.249  17.190 1.00 59.16 ? 128  ASP A C   1 
ATOM   830  O  O   . ASP A 1 153 ? 20.461 -8.894  17.008 1.00 58.89 ? 128  ASP A O   1 
ATOM   831  C  CB  . ASP A 1 153 ? 18.492 -7.915  15.062 1.00 61.00 ? 128  ASP A CB  1 
ATOM   832  C  CG  . ASP A 1 153 ? 18.868 -6.421  15.036 1.00 61.70 ? 128  ASP A CG  1 
ATOM   833  O  OD1 . ASP A 1 153 ? 20.024 -6.078  15.330 1.00 63.63 ? 128  ASP A OD1 1 
ATOM   834  O  OD2 . ASP A 1 153 ? 18.015 -5.603  14.667 1.00 61.66 ? 128  ASP A OD2 1 
ATOM   835  N  N   . PHE A 1 154 ? 18.967 -10.151 18.118 1.00 59.49 ? 129  PHE A N   1 
ATOM   836  C  CA  . PHE A 1 154 ? 19.969 -10.719 19.002 1.00 61.20 ? 129  PHE A CA  1 
ATOM   837  C  C   . PHE A 1 154 ? 20.411 -12.103 18.503 1.00 61.55 ? 129  PHE A C   1 
ATOM   838  O  O   . PHE A 1 154 ? 19.596 -12.979 18.179 1.00 61.67 ? 129  PHE A O   1 
ATOM   839  C  CB  . PHE A 1 154 ? 19.410 -10.801 20.440 1.00 64.40 ? 129  PHE A CB  1 
ATOM   840  C  CG  . PHE A 1 154 ? 20.326 -10.282 21.561 1.00 67.62 ? 129  PHE A CG  1 
ATOM   841  C  CD1 . PHE A 1 154 ? 21.642 -10.721 21.686 1.00 68.55 ? 129  PHE A CD1 1 
ATOM   842  C  CD2 . PHE A 1 154 ? 19.847 -9.338  22.473 1.00 69.51 ? 129  PHE A CD2 1 
ATOM   843  C  CE1 . PHE A 1 154 ? 22.464 -10.192 22.672 1.00 68.84 ? 129  PHE A CE1 1 
ATOM   844  C  CE2 . PHE A 1 154 ? 20.665 -8.823  23.472 1.00 68.79 ? 129  PHE A CE2 1 
ATOM   845  C  CZ  . PHE A 1 154 ? 21.976 -9.245  23.561 1.00 69.80 ? 129  PHE A CZ  1 
ATOM   846  N  N   . VAL A 1 155 ? 21.737 -12.294 18.417 1.00 60.68 ? 130  VAL A N   1 
ATOM   847  C  CA  . VAL A 1 155 ? 22.337 -13.577 18.041 1.00 60.72 ? 130  VAL A CA  1 
ATOM   848  C  C   . VAL A 1 155 ? 23.459 -13.949 19.040 1.00 59.57 ? 130  VAL A C   1 
ATOM   849  O  O   . VAL A 1 155 ? 24.157 -13.076 19.597 1.00 58.08 ? 130  VAL A O   1 
ATOM   850  C  CB  . VAL A 1 155 ? 22.937 -13.560 16.582 1.00 60.98 ? 130  VAL A CB  1 
ATOM   851  C  CG1 . VAL A 1 155 ? 23.051 -15.001 16.068 1.00 60.93 ? 130  VAL A CG1 1 
ATOM   852  C  CG2 . VAL A 1 155 ? 22.229 -12.635 15.579 1.00 58.32 ? 130  VAL A CG2 1 
ATOM   853  N  N   . VAL A 1 156 ? 23.635 -15.277 19.213 1.00 57.03 ? 131  VAL A N   1 
ATOM   854  C  CA  . VAL A 1 156 ? 24.634 -15.872 20.101 1.00 54.98 ? 131  VAL A CA  1 
ATOM   855  C  C   . VAL A 1 156 ? 26.059 -15.336 19.950 1.00 53.17 ? 131  VAL A C   1 
ATOM   856  O  O   . VAL A 1 156 ? 26.547 -15.173 18.839 1.00 51.72 ? 131  VAL A O   1 
ATOM   857  C  CB  . VAL A 1 156 ? 24.563 -17.411 19.950 1.00 55.34 ? 131  VAL A CB  1 
ATOM   858  C  CG1 . VAL A 1 156 ? 25.611 -18.162 20.780 1.00 55.30 ? 131  VAL A CG1 1 
ATOM   859  C  CG2 . VAL A 1 156 ? 23.145 -17.893 20.297 1.00 54.41 ? 131  VAL A CG2 1 
ATOM   860  N  N   . ALA A 1 157 ? 26.660 -15.027 21.117 1.00 52.91 ? 132  ALA A N   1 
ATOM   861  C  CA  . ALA A 1 157 ? 28.022 -14.512 21.293 1.00 52.69 ? 132  ALA A CA  1 
ATOM   862  C  C   . ALA A 1 157 ? 29.161 -15.433 20.860 1.00 53.47 ? 132  ALA A C   1 
ATOM   863  O  O   . ALA A 1 157 ? 30.250 -15.019 20.445 1.00 52.96 ? 132  ALA A O   1 
ATOM   864  C  CB  . ALA A 1 157 ? 28.268 -14.176 22.771 1.00 48.84 ? 132  ALA A CB  1 
ATOM   865  N  N   . SER A 1 158 ? 28.899 -16.725 21.000 1.00 55.81 ? 133  SER A N   1 
ATOM   866  C  CA  . SER A 1 158 ? 29.812 -17.748 20.533 1.00 58.09 ? 133  SER A CA  1 
ATOM   867  C  C   . SER A 1 158 ? 29.744 -17.881 19.005 1.00 59.46 ? 133  SER A C   1 
ATOM   868  O  O   . SER A 1 158 ? 30.726 -18.259 18.343 1.00 61.98 ? 133  SER A O   1 
ATOM   869  C  CB  . SER A 1 158 ? 29.348 -19.047 21.161 1.00 59.31 ? 133  SER A CB  1 
ATOM   870  N  N   . GLU A 1 159 ? 28.556 -17.536 18.469 1.00 58.84 ? 134  GLU A N   1 
ATOM   871  C  CA  . GLU A 1 159 ? 28.251 -17.530 17.031 1.00 57.10 ? 134  GLU A CA  1 
ATOM   872  C  C   . GLU A 1 159 ? 28.550 -16.218 16.298 1.00 54.08 ? 134  GLU A C   1 
ATOM   873  O  O   . GLU A 1 159 ? 28.319 -16.114 15.094 1.00 50.66 ? 134  GLU A O   1 
ATOM   874  C  CB  . GLU A 1 159 ? 26.768 -17.808 16.761 1.00 58.33 ? 134  GLU A CB  1 
ATOM   875  C  CG  . GLU A 1 159 ? 26.269 -19.189 17.121 1.00 61.93 ? 134  GLU A CG  1 
ATOM   876  C  CD  . GLU A 1 159 ? 24.955 -19.558 16.436 1.00 65.28 ? 134  GLU A CD  1 
ATOM   877  O  OE1 . GLU A 1 159 ? 24.056 -18.711 16.294 1.00 64.83 ? 134  GLU A OE1 1 
ATOM   878  O  OE2 . GLU A 1 159 ? 24.853 -20.726 16.034 1.00 68.18 ? 134  GLU A OE2 1 
ATOM   879  N  N   . THR A 1 160 ? 28.999 -15.169 16.988 1.00 52.70 ? 135  THR A N   1 
ATOM   880  C  CA  . THR A 1 160 ? 29.366 -13.953 16.291 1.00 51.61 ? 135  THR A CA  1 
ATOM   881  C  C   . THR A 1 160 ? 30.896 -13.856 16.192 1.00 51.35 ? 135  THR A C   1 
ATOM   882  O  O   . THR A 1 160 ? 31.549 -14.721 15.580 1.00 52.93 ? 135  THR A O   1 
ATOM   883  C  CB  . THR A 1 160 ? 28.621 -12.683 16.830 1.00 49.31 ? 135  THR A CB  1 
ATOM   884  O  OG1 . THR A 1 160 ? 29.039 -12.514 18.171 1.00 49.65 ? 135  THR A OG1 1 
ATOM   885  C  CG2 . THR A 1 160 ? 27.108 -12.772 16.767 1.00 48.16 ? 135  THR A CG2 1 
ATOM   886  N  N   . SER A 1 161 ? 31.473 -12.828 16.825 1.00 50.88 ? 136  SER A N   1 
ATOM   887  C  CA  . SER A 1 161 ? 32.885 -12.502 16.714 1.00 49.48 ? 136  SER A CA  1 
ATOM   888  C  C   . SER A 1 161 ? 33.422 -12.163 18.121 1.00 47.44 ? 136  SER A C   1 
ATOM   889  O  O   . SER A 1 161 ? 32.624 -12.000 19.056 1.00 46.14 ? 136  SER A O   1 
ATOM   890  C  CB  . SER A 1 161 ? 32.966 -11.306 15.767 1.00 50.00 ? 136  SER A CB  1 
ATOM   891  O  OG  . SER A 1 161 ? 32.146 -11.504 14.615 1.00 52.41 ? 136  SER A OG  1 
ATOM   892  N  N   . ASP A 1 162 ? 34.760 -12.051 18.314 1.00 44.90 ? 137  ASP A N   1 
ATOM   893  C  CA  . ASP A 1 162 ? 35.366 -11.578 19.566 1.00 40.01 ? 137  ASP A CA  1 
ATOM   894  C  C   . ASP A 1 162 ? 35.037 -10.093 19.850 1.00 36.45 ? 137  ASP A C   1 
ATOM   895  O  O   . ASP A 1 162 ? 34.105 -9.570  19.228 1.00 35.34 ? 137  ASP A O   1 
ATOM   896  C  CB  . ASP A 1 162 ? 36.879 -11.949 19.641 1.00 40.10 ? 137  ASP A CB  1 
ATOM   897  C  CG  . ASP A 1 162 ? 37.915 -11.197 18.783 1.00 44.69 ? 137  ASP A CG  1 
ATOM   898  O  OD1 . ASP A 1 162 ? 37.617 -10.121 18.252 1.00 46.41 ? 137  ASP A OD1 1 
ATOM   899  O  OD2 . ASP A 1 162 ? 39.056 -11.661 18.648 1.00 46.87 ? 137  ASP A OD2 1 
ATOM   900  N  N   . CYS A 1 163 ? 35.702 -9.337  20.741 1.00 32.95 ? 138  CYS A N   1 
ATOM   901  C  CA  . CYS A 1 163 ? 35.263 -7.982  21.014 1.00 31.28 ? 138  CYS A CA  1 
ATOM   902  C  C   . CYS A 1 163 ? 36.311 -6.919  20.838 1.00 30.73 ? 138  CYS A C   1 
ATOM   903  O  O   . CYS A 1 163 ? 36.233 -5.825  21.414 1.00 31.32 ? 138  CYS A O   1 
ATOM   904  C  CB  . CYS A 1 163 ? 34.557 -7.854  22.361 1.00 32.08 ? 138  CYS A CB  1 
ATOM   905  S  SG  . CYS A 1 163 ? 32.988 -8.777  22.463 1.00 37.40 ? 138  CYS A SG  1 
ATOM   906  N  N   . VAL A 1 164 ? 37.258 -7.242  19.954 1.00 30.63 ? 139  VAL A N   1 
ATOM   907  C  CA  . VAL A 1 164 ? 38.333 -6.318  19.599 1.00 29.74 ? 139  VAL A CA  1 
ATOM   908  C  C   . VAL A 1 164 ? 38.151 -5.898  18.168 1.00 28.81 ? 139  VAL A C   1 
ATOM   909  O  O   . VAL A 1 164 ? 37.830 -6.734  17.342 1.00 27.95 ? 139  VAL A O   1 
ATOM   910  C  CB  . VAL A 1 164 ? 39.769 -6.915  19.600 1.00 28.99 ? 139  VAL A CB  1 
ATOM   911  C  CG1 . VAL A 1 164 ? 40.717 -5.884  20.195 1.00 29.64 ? 139  VAL A CG1 1 
ATOM   912  C  CG2 . VAL A 1 164 ? 39.889 -8.307  20.143 1.00 26.32 ? 139  VAL A CG2 1 
ATOM   913  N  N   . VAL A 1 165 ? 38.424 -4.646  17.840 1.00 31.00 ? 140  VAL A N   1 
ATOM   914  C  CA  . VAL A 1 165 ? 38.442 -4.247  16.459 1.00 34.50 ? 140  VAL A CA  1 
ATOM   915  C  C   . VAL A 1 165 ? 39.899 -4.167  16.020 1.00 36.64 ? 140  VAL A C   1 
ATOM   916  O  O   . VAL A 1 165 ? 40.406 -5.059  15.323 1.00 39.48 ? 140  VAL A O   1 
ATOM   917  C  CB  . VAL A 1 165 ? 37.758 -2.914  16.217 1.00 36.55 ? 140  VAL A CB  1 
ATOM   918  C  CG1 . VAL A 1 165 ? 37.417 -2.900  14.747 1.00 36.42 ? 140  VAL A CG1 1 
ATOM   919  C  CG2 . VAL A 1 165 ? 36.594 -2.569  17.119 1.00 34.81 ? 140  VAL A CG2 1 
ATOM   920  N  N   . SER A 1 166 ? 40.566 -3.136  16.529 1.00 37.83 ? 141  SER A N   1 
ATOM   921  C  CA  . SER A 1 166 ? 41.905 -2.682  16.123 1.00 41.81 ? 141  SER A CA  1 
ATOM   922  C  C   . SER A 1 166 ? 41.936 -1.563  15.056 1.00 42.37 ? 141  SER A C   1 
ATOM   923  O  O   . SER A 1 166 ? 43.035 -1.174  14.685 1.00 43.60 ? 141  SER A O   1 
ATOM   924  C  CB  . SER A 1 166 ? 42.986 -3.811  15.889 1.00 42.08 ? 141  SER A CB  1 
ATOM   925  O  OG  . SER A 1 166 ? 43.175 -4.693  17.008 1.00 38.01 ? 141  SER A OG  1 
ATOM   926  N  N   . ASN B 1 36  ? 2.666  37.382  21.946 1.00 65.93 ? 11   ASN B N   1 
ATOM   927  C  CA  . ASN B 1 36  ? 1.945  36.256  22.556 1.00 66.50 ? 11   ASN B CA  1 
ATOM   928  C  C   . ASN B 1 36  ? 2.726  35.510  23.658 1.00 66.17 ? 11   ASN B C   1 
ATOM   929  O  O   . ASN B 1 36  ? 3.559  34.641  23.372 1.00 66.24 ? 11   ASN B O   1 
ATOM   930  C  CB  . ASN B 1 36  ? 1.488  35.204  21.515 1.00 66.50 ? 11   ASN B CB  1 
ATOM   931  N  N   . VAL B 1 37  ? 2.404  35.814  24.934 1.00 65.43 ? 12   VAL B N   1 
ATOM   932  C  CA  . VAL B 1 37  ? 3.197  35.450  26.131 1.00 62.92 ? 12   VAL B CA  1 
ATOM   933  C  C   . VAL B 1 37  ? 3.195  33.985  26.631 1.00 60.27 ? 12   VAL B C   1 
ATOM   934  O  O   . VAL B 1 37  ? 4.143  33.547  27.294 1.00 59.00 ? 12   VAL B O   1 
ATOM   935  C  CB  . VAL B 1 37  ? 2.780  36.430  27.299 1.00 64.35 ? 12   VAL B CB  1 
ATOM   936  C  CG1 . VAL B 1 37  ? 1.408  36.086  27.935 1.00 63.94 ? 12   VAL B CG1 1 
ATOM   937  C  CG2 . VAL B 1 37  ? 3.908  36.621  28.318 1.00 63.41 ? 12   VAL B CG2 1 
ATOM   938  N  N   . LYS B 1 38  ? 2.125  33.208  26.374 1.00 56.82 ? 13   LYS B N   1 
ATOM   939  C  CA  . LYS B 1 38  ? 2.071  31.821  26.800 1.00 51.85 ? 13   LYS B CA  1 
ATOM   940  C  C   . LYS B 1 38  ? 3.021  31.001  25.927 1.00 48.88 ? 13   LYS B C   1 
ATOM   941  O  O   . LYS B 1 38  ? 3.595  30.003  26.380 1.00 49.33 ? 13   LYS B O   1 
ATOM   942  C  CB  . LYS B 1 38  ? 0.640  31.283  26.675 1.00 52.25 ? 13   LYS B CB  1 
ATOM   943  N  N   . ASP B 1 39  ? 3.258  31.456  24.684 1.00 44.12 ? 14   ASP B N   1 
ATOM   944  C  CA  . ASP B 1 39  ? 4.169  30.783  23.770 1.00 37.71 ? 14   ASP B CA  1 
ATOM   945  C  C   . ASP B 1 39  ? 5.662  30.978  24.040 1.00 31.42 ? 14   ASP B C   1 
ATOM   946  O  O   . ASP B 1 39  ? 6.413  30.026  23.895 1.00 30.29 ? 14   ASP B O   1 
ATOM   947  C  CB  . ASP B 1 39  ? 3.763  31.113  22.326 1.00 40.87 ? 14   ASP B CB  1 
ATOM   948  C  CG  . ASP B 1 39  ? 2.497  30.409  21.803 1.00 44.08 ? 14   ASP B CG  1 
ATOM   949  O  OD1 . ASP B 1 39  ? 1.832  29.636  22.531 1.00 44.87 ? 14   ASP B OD1 1 
ATOM   950  O  OD2 . ASP B 1 39  ? 2.192  30.662  20.631 1.00 45.27 ? 14   ASP B OD2 1 
ATOM   951  N  N   . VAL B 1 40  ? 6.165  32.130  24.468 1.00 25.72 ? 15   VAL B N   1 
ATOM   952  C  CA  . VAL B 1 40  ? 7.545  32.234  24.906 1.00 24.93 ? 15   VAL B CA  1 
ATOM   953  C  C   . VAL B 1 40  ? 7.872  31.357  26.112 1.00 26.84 ? 15   VAL B C   1 
ATOM   954  O  O   . VAL B 1 40  ? 8.935  30.739  26.124 1.00 29.81 ? 15   VAL B O   1 
ATOM   955  C  CB  . VAL B 1 40  ? 7.914  33.670  25.178 1.00 22.45 ? 15   VAL B CB  1 
ATOM   956  C  CG1 . VAL B 1 40  ? 9.335  33.803  25.722 1.00 18.01 ? 15   VAL B CG1 1 
ATOM   957  C  CG2 . VAL B 1 40  ? 7.730  34.435  23.895 1.00 21.89 ? 15   VAL B CG2 1 
ATOM   958  N  N   . THR B 1 41  ? 6.962  31.275  27.104 1.00 27.60 ? 16   THR B N   1 
ATOM   959  C  CA  . THR B 1 41  ? 7.040  30.393  28.276 1.00 28.70 ? 16   THR B CA  1 
ATOM   960  C  C   . THR B 1 41  ? 7.191  28.905  27.903 1.00 27.24 ? 16   THR B C   1 
ATOM   961  O  O   . THR B 1 41  ? 8.063  28.227  28.442 1.00 29.07 ? 16   THR B O   1 
ATOM   962  C  CB  . THR B 1 41  ? 5.797  30.649  29.237 1.00 30.92 ? 16   THR B CB  1 
ATOM   963  O  OG1 . THR B 1 41  ? 5.967  31.920  29.887 1.00 30.85 ? 16   THR B OG1 1 
ATOM   964  C  CG2 . THR B 1 41  ? 5.605  29.577  30.304 1.00 29.47 ? 16   THR B CG2 1 
ATOM   965  N  N   . LYS B 1 42  ? 6.385  28.387  26.979 1.00 24.02 ? 17   LYS B N   1 
ATOM   966  C  CA  . LYS B 1 42  ? 6.508  27.042  26.455 1.00 25.48 ? 17   LYS B CA  1 
ATOM   967  C  C   . LYS B 1 42  ? 7.776  26.845  25.607 1.00 22.72 ? 17   LYS B C   1 
ATOM   968  O  O   . LYS B 1 42  ? 8.397  25.806  25.690 1.00 22.89 ? 17   LYS B O   1 
ATOM   969  C  CB  . LYS B 1 42  ? 5.235  26.851  25.662 1.00 29.47 ? 17   LYS B CB  1 
ATOM   970  C  CG  . LYS B 1 42  ? 5.047  25.479  25.076 1.00 36.80 ? 17   LYS B CG  1 
ATOM   971  C  CD  . LYS B 1 42  ? 3.820  25.460  24.129 1.00 40.47 ? 17   LYS B CD  1 
ATOM   972  C  CE  . LYS B 1 42  ? 3.432  24.008  23.742 1.00 42.23 ? 17   LYS B CE  1 
ATOM   973  N  NZ  . LYS B 1 42  ? 4.518  23.260  23.099 1.00 40.28 ? 17   LYS B NZ  1 
ATOM   974  N  N   . LEU B 1 43  ? 8.223  27.840  24.836 1.00 21.80 ? 18   LEU B N   1 
ATOM   975  C  CA  . LEU B 1 43  ? 9.489  27.797  24.148 1.00 19.84 ? 18   LEU B CA  1 
ATOM   976  C  C   . LEU B 1 43  ? 10.608 27.757  25.151 1.00 19.53 ? 18   LEU B C   1 
ATOM   977  O  O   . LEU B 1 43  ? 11.425 26.868  24.985 1.00 22.71 ? 18   LEU B O   1 
ATOM   978  C  CB  . LEU B 1 43  ? 9.660  28.989  23.206 1.00 17.63 ? 18   LEU B CB  1 
ATOM   979  C  CG  . LEU B 1 43  ? 10.954 29.148  22.479 1.00 13.25 ? 18   LEU B CG  1 
ATOM   980  C  CD1 . LEU B 1 43  ? 11.216 27.956  21.627 1.00 16.15 ? 18   LEU B CD1 1 
ATOM   981  C  CD2 . LEU B 1 43  ? 10.895 30.338  21.606 1.00 13.19 ? 18   LEU B CD2 1 
ATOM   982  N  N   . VAL B 1 44  ? 10.670 28.606  26.187 1.00 17.49 ? 19   VAL B N   1 
ATOM   983  C  CA  . VAL B 1 44  ? 11.713 28.547  27.193 1.00 15.59 ? 19   VAL B CA  1 
ATOM   984  C  C   . VAL B 1 44  ? 11.708 27.199  27.912 1.00 16.76 ? 19   VAL B C   1 
ATOM   985  O  O   . VAL B 1 44  ? 12.763 26.598  28.121 1.00 18.54 ? 19   VAL B O   1 
ATOM   986  C  CB  . VAL B 1 44  ? 11.587 29.741  28.170 1.00 15.79 ? 19   VAL B CB  1 
ATOM   987  C  CG1 . VAL B 1 44  ? 12.566 29.662  29.308 1.00 13.19 ? 19   VAL B CG1 1 
ATOM   988  C  CG2 . VAL B 1 44  ? 11.922 31.014  27.489 1.00 12.62 ? 19   VAL B CG2 1 
ATOM   989  N  N   . ALA B 1 45  ? 10.533 26.655  28.232 1.00 17.26 ? 20   ALA B N   1 
ATOM   990  C  CA  . ALA B 1 45  ? 10.415 25.384  28.918 1.00 17.20 ? 20   ALA B CA  1 
ATOM   991  C  C   . ALA B 1 45  ? 10.866 24.235  28.075 1.00 20.20 ? 20   ALA B C   1 
ATOM   992  O  O   . ALA B 1 45  ? 11.185 23.166  28.578 1.00 22.02 ? 20   ALA B O   1 
ATOM   993  C  CB  . ALA B 1 45  ? 8.972  25.064  29.185 1.00 18.25 ? 20   ALA B CB  1 
ATOM   994  N  N   . ASN B 1 46  ? 10.854 24.390  26.763 1.00 22.32 ? 21   ASN B N   1 
ATOM   995  C  CA  . ASN B 1 46  ? 11.373 23.351  25.920 1.00 21.93 ? 21   ASN B CA  1 
ATOM   996  C  C   . ASN B 1 46  ? 12.711 23.661  25.314 1.00 21.34 ? 21   ASN B C   1 
ATOM   997  O  O   . ASN B 1 46  ? 13.114 22.930  24.441 1.00 23.28 ? 21   ASN B O   1 
ATOM   998  C  CB  . ASN B 1 46  ? 10.378 23.022  24.873 1.00 26.17 ? 21   ASN B CB  1 
ATOM   999  C  CG  . ASN B 1 46  ? 9.256  22.250  25.531 1.00 31.77 ? 21   ASN B CG  1 
ATOM   1000 O  OD1 . ASN B 1 46  ? 9.352  21.054  25.813 1.00 30.41 ? 21   ASN B OD1 1 
ATOM   1001 N  ND2 . ASN B 1 46  ? 8.168  22.955  25.820 1.00 34.22 ? 21   ASN B ND2 1 
ATOM   1002 N  N   . LEU B 1 47  ? 13.455 24.675  25.727 1.00 20.84 ? 22   LEU B N   1 
ATOM   1003 C  CA  . LEU B 1 47  ? 14.825 24.880  25.285 1.00 18.95 ? 22   LEU B CA  1 
ATOM   1004 C  C   . LEU B 1 47  ? 15.754 24.358  26.359 1.00 19.14 ? 22   LEU B C   1 
ATOM   1005 O  O   . LEU B 1 47  ? 15.428 24.560  27.526 1.00 19.71 ? 22   LEU B O   1 
ATOM   1006 C  CB  . LEU B 1 47  ? 15.097 26.380  25.022 1.00 17.41 ? 22   LEU B CB  1 
ATOM   1007 C  CG  . LEU B 1 47  ? 14.510 27.035  23.750 1.00 15.79 ? 22   LEU B CG  1 
ATOM   1008 C  CD1 . LEU B 1 47  ? 14.718 28.544  23.724 1.00 13.61 ? 22   LEU B CD1 1 
ATOM   1009 C  CD2 . LEU B 1 47  ? 15.120 26.381  22.517 1.00 14.80 ? 22   LEU B CD2 1 
ATOM   1010 N  N   . PRO B 1 48  ? 16.903 23.701  26.091 1.00 18.35 ? 23   PRO B N   1 
ATOM   1011 C  CA  . PRO B 1 48  ? 17.831 23.260  27.130 1.00 17.51 ? 23   PRO B CA  1 
ATOM   1012 C  C   . PRO B 1 48  ? 18.329 24.418  28.008 1.00 17.87 ? 23   PRO B C   1 
ATOM   1013 O  O   . PRO B 1 48  ? 18.703 25.449  27.473 1.00 18.03 ? 23   PRO B O   1 
ATOM   1014 C  CB  . PRO B 1 48  ? 18.908 22.619  26.307 1.00 13.87 ? 23   PRO B CB  1 
ATOM   1015 C  CG  . PRO B 1 48  ? 18.299 22.223  25.002 1.00 12.84 ? 23   PRO B CG  1 
ATOM   1016 C  CD  . PRO B 1 48  ? 17.457 23.421  24.762 1.00 14.01 ? 23   PRO B CD  1 
ATOM   1017 N  N   . LYS B 1 49  ? 18.327 24.340  29.347 1.00 18.87 ? 24   LYS B N   1 
ATOM   1018 C  CA  . LYS B 1 49  ? 18.756 25.441  30.226 1.00 21.96 ? 24   LYS B CA  1 
ATOM   1019 C  C   . LYS B 1 49  ? 20.207 25.930  30.039 1.00 21.00 ? 24   LYS B C   1 
ATOM   1020 O  O   . LYS B 1 49  ? 20.567 27.081  30.304 1.00 21.61 ? 24   LYS B O   1 
ATOM   1021 C  CB  . LYS B 1 49  ? 18.456 25.044  31.703 1.00 23.68 ? 24   LYS B CB  1 
ATOM   1022 C  CG  . LYS B 1 49  ? 16.956 25.097  32.077 1.00 29.69 ? 24   LYS B CG  1 
ATOM   1023 C  CD  . LYS B 1 49  ? 16.544 24.407  33.429 1.00 34.88 ? 24   LYS B CD  1 
ATOM   1024 C  CE  . LYS B 1 49  ? 15.010 24.526  33.777 1.00 39.45 ? 24   LYS B CE  1 
ATOM   1025 N  NZ  . LYS B 1 49  ? 14.493 23.773  34.927 1.00 41.87 ? 24   LYS B NZ  1 
ATOM   1026 N  N   . ASP B 1 50  ? 21.040 25.044  29.503 1.00 19.08 ? 25   ASP B N   1 
ATOM   1027 C  CA  . ASP B 1 50  ? 22.440 25.350  29.263 1.00 20.79 ? 25   ASP B CA  1 
ATOM   1028 C  C   . ASP B 1 50  ? 22.758 25.601  27.789 1.00 19.77 ? 25   ASP B C   1 
ATOM   1029 O  O   . ASP B 1 50  ? 23.907 25.469  27.373 1.00 20.06 ? 25   ASP B O   1 
ATOM   1030 C  CB  . ASP B 1 50  ? 23.305 24.190  29.796 1.00 17.87 ? 25   ASP B CB  1 
ATOM   1031 C  CG  . ASP B 1 50  ? 23.063 22.836  29.175 1.00 20.81 ? 25   ASP B CG  1 
ATOM   1032 O  OD1 . ASP B 1 50  ? 21.975 22.598  28.651 1.00 22.64 ? 25   ASP B OD1 1 
ATOM   1033 O  OD2 . ASP B 1 50  ? 23.964 21.991  29.214 1.00 24.79 ? 25   ASP B OD2 1 
ATOM   1034 N  N   . TYR B 1 51  ? 21.753 25.866  26.950 1.00 19.06 ? 26   TYR B N   1 
ATOM   1035 C  CA  . TYR B 1 51  ? 21.990 26.130  25.542 1.00 18.77 ? 26   TYR B CA  1 
ATOM   1036 C  C   . TYR B 1 51  ? 22.027 27.652  25.358 1.00 18.82 ? 26   TYR B C   1 
ATOM   1037 O  O   . TYR B 1 51  ? 21.066 28.358  25.655 1.00 19.57 ? 26   TYR B O   1 
ATOM   1038 C  CB  . TYR B 1 51  ? 20.900 25.477  24.712 1.00 16.23 ? 26   TYR B CB  1 
ATOM   1039 C  CG  . TYR B 1 51  ? 21.007 25.766  23.228 1.00 19.16 ? 26   TYR B CG  1 
ATOM   1040 C  CD1 . TYR B 1 51  ? 22.034 25.216  22.492 1.00 20.33 ? 26   TYR B CD1 1 
ATOM   1041 C  CD2 . TYR B 1 51  ? 20.097 26.629  22.632 1.00 19.21 ? 26   TYR B CD2 1 
ATOM   1042 C  CE1 . TYR B 1 51  ? 22.125 25.531  21.150 1.00 19.71 ? 26   TYR B CE1 1 
ATOM   1043 C  CE2 . TYR B 1 51  ? 20.180 26.936  21.294 1.00 18.86 ? 26   TYR B CE2 1 
ATOM   1044 C  CZ  . TYR B 1 51  ? 21.184 26.356  20.565 1.00 21.21 ? 26   TYR B CZ  1 
ATOM   1045 O  OH  . TYR B 1 51  ? 21.209 26.560  19.204 1.00 23.57 ? 26   TYR B OH  1 
HETATM 1046 N  N   . MSE B 1 52  ? 23.136 28.207  24.891 1.00 18.02 ? 27   MSE B N   1 
HETATM 1047 C  CA  . MSE B 1 52  ? 23.249 29.645  24.886 1.00 20.01 ? 27   MSE B CA  1 
HETATM 1048 C  C   . MSE B 1 52  ? 22.894 30.253  23.553 1.00 20.43 ? 27   MSE B C   1 
HETATM 1049 O  O   . MSE B 1 52  ? 23.319 29.791  22.493 1.00 22.74 ? 27   MSE B O   1 
HETATM 1050 C  CB  . MSE B 1 52  ? 24.648 30.070  25.309 1.00 21.80 ? 27   MSE B CB  1 
HETATM 1051 C  CG  . MSE B 1 52  ? 25.179 29.494  26.646 1.00 24.25 ? 27   MSE B CG  1 
HETATM 1052 SE SE  . MSE B 1 52  ? 24.219 29.995  28.260 1.00 30.76 ? 27   MSE B SE  1 
HETATM 1053 C  CE  . MSE B 1 52  ? 24.936 31.691  28.317 1.00 17.91 ? 27   MSE B CE  1 
ATOM   1054 N  N   . ILE B 1 53  ? 22.071 31.294  23.642 1.00 21.17 ? 28   ILE B N   1 
ATOM   1055 C  CA  . ILE B 1 53  ? 21.690 32.092  22.507 1.00 20.03 ? 28   ILE B CA  1 
ATOM   1056 C  C   . ILE B 1 53  ? 22.501 33.383  22.470 1.00 20.64 ? 28   ILE B C   1 
ATOM   1057 O  O   . ILE B 1 53  ? 22.545 34.162  23.403 1.00 19.83 ? 28   ILE B O   1 
ATOM   1058 C  CB  . ILE B 1 53  ? 20.168 32.289  22.522 1.00 19.56 ? 28   ILE B CB  1 
ATOM   1059 C  CG1 . ILE B 1 53  ? 19.489 30.935  22.719 1.00 14.81 ? 28   ILE B CG1 1 
ATOM   1060 C  CG2 . ILE B 1 53  ? 19.653 32.893  21.195 1.00 17.30 ? 28   ILE B CG2 1 
ATOM   1061 C  CD1 . ILE B 1 53  ? 17.993 31.054  22.978 1.00 14.38 ? 28   ILE B CD1 1 
ATOM   1062 N  N   . THR B 1 54  ? 23.235 33.585  21.364 1.00 22.56 ? 29   THR B N   1 
ATOM   1063 C  CA  . THR B 1 54  ? 24.048 34.777  21.117 1.00 21.92 ? 29   THR B CA  1 
ATOM   1064 C  C   . THR B 1 54  ? 23.167 35.926  20.723 1.00 21.18 ? 29   THR B C   1 
ATOM   1065 O  O   . THR B 1 54  ? 22.235 35.744  19.926 1.00 24.05 ? 29   THR B O   1 
ATOM   1066 C  CB  . THR B 1 54  ? 25.003 34.540  19.949 1.00 24.32 ? 29   THR B CB  1 
ATOM   1067 O  OG1 . THR B 1 54  ? 25.751 33.393  20.310 1.00 26.19 ? 29   THR B OG1 1 
ATOM   1068 C  CG2 . THR B 1 54  ? 25.901 35.743  19.657 1.00 23.45 ? 29   THR B CG2 1 
ATOM   1069 N  N   . LEU B 1 55  ? 23.485 37.110  21.229 1.00 19.18 ? 30   LEU B N   1 
ATOM   1070 C  CA  . LEU B 1 55  ? 22.694 38.278  20.928 1.00 19.42 ? 30   LEU B CA  1 
ATOM   1071 C  C   . LEU B 1 55  ? 23.612 39.444  21.123 1.00 20.84 ? 30   LEU B C   1 
ATOM   1072 O  O   . LEU B 1 55  ? 24.251 39.604  22.155 1.00 22.59 ? 30   LEU B O   1 
ATOM   1073 C  CB  . LEU B 1 55  ? 21.486 38.458  21.822 1.00 16.57 ? 30   LEU B CB  1 
ATOM   1074 C  CG  . LEU B 1 55  ? 20.712 39.739  21.692 1.00 17.65 ? 30   LEU B CG  1 
ATOM   1075 C  CD1 . LEU B 1 55  ? 19.907 39.690  20.405 1.00 15.54 ? 30   LEU B CD1 1 
ATOM   1076 C  CD2 . LEU B 1 55  ? 19.875 40.004  22.946 1.00 14.12 ? 30   LEU B CD2 1 
ATOM   1077 N  N   . LYS B 1 56  ? 23.641 40.271  20.085 1.00 21.41 ? 31   LYS B N   1 
ATOM   1078 C  CA  . LYS B 1 56  ? 24.340 41.533  20.142 1.00 22.33 ? 31   LYS B CA  1 
ATOM   1079 C  C   . LYS B 1 56  ? 23.462 42.478  20.918 1.00 21.90 ? 31   LYS B C   1 
ATOM   1080 O  O   . LYS B 1 56  ? 22.714 43.295  20.370 1.00 24.57 ? 31   LYS B O   1 
ATOM   1081 C  CB  . LYS B 1 56  ? 24.642 42.093  18.754 1.00 21.18 ? 31   LYS B CB  1 
ATOM   1082 C  CG  . LYS B 1 56  ? 25.844 41.479  18.111 1.00 21.89 ? 31   LYS B CG  1 
ATOM   1083 C  CD  . LYS B 1 56  ? 25.551 41.360  16.647 1.00 29.30 ? 31   LYS B CD  1 
ATOM   1084 C  CE  . LYS B 1 56  ? 26.741 40.957  15.808 1.00 31.29 ? 31   LYS B CE  1 
ATOM   1085 N  NZ  . LYS B 1 56  ? 27.628 42.105  15.688 1.00 39.41 ? 31   LYS B NZ  1 
ATOM   1086 N  N   . TYR B 1 57  ? 23.572 42.299  22.227 1.00 21.32 ? 32   TYR B N   1 
ATOM   1087 C  CA  . TYR B 1 57  ? 22.800 43.101  23.138 1.00 19.60 ? 32   TYR B CA  1 
ATOM   1088 C  C   . TYR B 1 57  ? 23.198 44.586  22.981 1.00 19.96 ? 32   TYR B C   1 
ATOM   1089 O  O   . TYR B 1 57  ? 24.384 44.940  22.977 1.00 20.37 ? 32   TYR B O   1 
ATOM   1090 C  CB  . TYR B 1 57  ? 23.094 42.513  24.532 1.00 17.35 ? 32   TYR B CB  1 
ATOM   1091 C  CG  . TYR B 1 57  ? 22.621 43.373  25.710 1.00 17.26 ? 32   TYR B CG  1 
ATOM   1092 C  CD1 . TYR B 1 57  ? 21.298 43.297  26.107 1.00 15.20 ? 32   TYR B CD1 1 
ATOM   1093 C  CD2 . TYR B 1 57  ? 23.490 44.280  26.299 1.00 14.00 ? 32   TYR B CD2 1 
ATOM   1094 C  CE1 . TYR B 1 57  ? 20.851 44.149  27.086 1.00 13.12 ? 32   TYR B CE1 1 
ATOM   1095 C  CE2 . TYR B 1 57  ? 23.013 45.166  27.227 1.00 14.39 ? 32   TYR B CE2 1 
ATOM   1096 C  CZ  . TYR B 1 57  ? 21.702 45.070  27.606 1.00 13.82 ? 32   TYR B CZ  1 
ATOM   1097 O  OH  . TYR B 1 57  ? 21.213 45.916  28.560 1.00 18.31 ? 32   TYR B OH  1 
ATOM   1098 N  N   . VAL B 1 58  ? 22.179 45.455  22.873 1.00 19.13 ? 33   VAL B N   1 
ATOM   1099 C  CA  . VAL B 1 58  ? 22.376 46.889  22.818 1.00 19.34 ? 33   VAL B CA  1 
ATOM   1100 C  C   . VAL B 1 58  ? 22.478 47.489  24.223 1.00 22.86 ? 33   VAL B C   1 
ATOM   1101 O  O   . VAL B 1 58  ? 21.487 47.535  24.979 1.00 23.26 ? 33   VAL B O   1 
ATOM   1102 C  CB  . VAL B 1 58  ? 21.220 47.609  22.071 1.00 18.33 ? 33   VAL B CB  1 
ATOM   1103 C  CG1 . VAL B 1 58  ? 21.607 49.014  21.732 1.00 17.72 ? 33   VAL B CG1 1 
ATOM   1104 C  CG2 . VAL B 1 58  ? 20.868 46.933  20.772 1.00 18.88 ? 33   VAL B CG2 1 
ATOM   1105 N  N   . PRO B 1 59  ? 23.669 48.022  24.556 1.00 23.14 ? 34   PRO B N   1 
ATOM   1106 C  CA  . PRO B 1 59  ? 23.950 48.685  25.814 1.00 25.98 ? 34   PRO B CA  1 
ATOM   1107 C  C   . PRO B 1 59  ? 22.991 49.844  26.052 1.00 27.87 ? 34   PRO B C   1 
ATOM   1108 O  O   . PRO B 1 59  ? 22.782 50.697  25.173 1.00 28.20 ? 34   PRO B O   1 
ATOM   1109 C  CB  . PRO B 1 59  ? 25.355 49.247  25.629 1.00 24.52 ? 34   PRO B CB  1 
ATOM   1110 C  CG  . PRO B 1 59  ? 25.947 48.454  24.514 1.00 23.81 ? 34   PRO B CG  1 
ATOM   1111 C  CD  . PRO B 1 59  ? 24.761 48.256  23.617 1.00 23.96 ? 34   PRO B CD  1 
ATOM   1112 N  N   . GLY B 1 60  ? 22.428 49.854  27.265 1.00 27.60 ? 35   GLY B N   1 
ATOM   1113 C  CA  . GLY B 1 60  ? 21.544 50.919  27.694 1.00 26.85 ? 35   GLY B CA  1 
ATOM   1114 C  C   . GLY B 1 60  ? 20.103 50.509  27.809 1.00 26.95 ? 35   GLY B C   1 
ATOM   1115 O  O   . GLY B 1 60  ? 19.314 51.234  28.392 1.00 27.06 ? 35   GLY B O   1 
HETATM 1116 N  N   . MSE B 1 61  ? 19.736 49.361  27.277 1.00 27.66 ? 36   MSE B N   1 
HETATM 1117 C  CA  . MSE B 1 61  ? 18.444 48.762  27.502 1.00 31.16 ? 36   MSE B CA  1 
HETATM 1118 C  C   . MSE B 1 61  ? 17.873 48.948  28.920 1.00 33.96 ? 36   MSE B C   1 
HETATM 1119 O  O   . MSE B 1 61  ? 16.708 49.315  29.138 1.00 34.27 ? 36   MSE B O   1 
HETATM 1120 C  CB  . MSE B 1 61  ? 18.679 47.299  27.225 1.00 34.63 ? 36   MSE B CB  1 
HETATM 1121 C  CG  . MSE B 1 61  ? 17.921 46.622  26.126 1.00 37.69 ? 36   MSE B CG  1 
HETATM 1122 SE SE  . MSE B 1 61  ? 16.954 45.030  26.682 1.00 48.87 ? 36   MSE B SE  1 
HETATM 1123 C  CE  . MSE B 1 61  ? 16.692 45.161  28.580 1.00 40.22 ? 36   MSE B CE  1 
ATOM   1124 N  N   . ASP B 1 62  ? 18.753 48.712  29.902 1.00 35.95 ? 37   ASP B N   1 
ATOM   1125 C  CA  . ASP B 1 62  ? 18.421 48.828  31.303 1.00 37.28 ? 37   ASP B CA  1 
ATOM   1126 C  C   . ASP B 1 62  ? 18.228 50.272  31.758 1.00 38.57 ? 37   ASP B C   1 
ATOM   1127 O  O   . ASP B 1 62  ? 17.189 50.545  32.368 1.00 42.23 ? 37   ASP B O   1 
ATOM   1128 C  CB  . ASP B 1 62  ? 19.407 48.058  32.203 1.00 38.21 ? 37   ASP B CB  1 
ATOM   1129 C  CG  . ASP B 1 62  ? 20.907 48.280  32.005 1.00 42.18 ? 37   ASP B CG  1 
ATOM   1130 O  OD1 . ASP B 1 62  ? 21.288 49.092  31.150 1.00 44.69 ? 37   ASP B OD1 1 
ATOM   1131 O  OD2 . ASP B 1 62  ? 21.709 47.641  32.708 1.00 43.60 ? 37   ASP B OD2 1 
ATOM   1132 N  N   . VAL B 1 63  ? 19.111 51.237  31.458 1.00 36.46 ? 38   VAL B N   1 
ATOM   1133 C  CA  . VAL B 1 63  ? 18.974 52.585  32.008 1.00 34.42 ? 38   VAL B CA  1 
ATOM   1134 C  C   . VAL B 1 63  ? 18.360 53.701  31.150 1.00 35.48 ? 38   VAL B C   1 
ATOM   1135 O  O   . VAL B 1 63  ? 17.844 54.706  31.662 1.00 35.46 ? 38   VAL B O   1 
ATOM   1136 C  CB  . VAL B 1 63  ? 20.314 53.047  32.623 1.00 33.96 ? 38   VAL B CB  1 
ATOM   1137 C  CG1 . VAL B 1 63  ? 20.656 52.110  33.757 1.00 33.39 ? 38   VAL B CG1 1 
ATOM   1138 C  CG2 . VAL B 1 63  ? 21.452 53.127  31.638 1.00 30.40 ? 38   VAL B CG2 1 
ATOM   1139 N  N   . LEU B 1 64  ? 18.466 53.536  29.826 1.00 34.58 ? 39   LEU B N   1 
ATOM   1140 C  CA  . LEU B 1 64  ? 18.173 54.590  28.859 1.00 33.84 ? 39   LEU B CA  1 
ATOM   1141 C  C   . LEU B 1 64  ? 16.770 54.521  28.304 1.00 34.39 ? 39   LEU B C   1 
ATOM   1142 O  O   . LEU B 1 64  ? 16.234 53.407  28.274 1.00 37.21 ? 39   LEU B O   1 
ATOM   1143 C  CB  . LEU B 1 64  ? 19.106 54.513  27.672 1.00 31.59 ? 39   LEU B CB  1 
ATOM   1144 C  CG  . LEU B 1 64  ? 20.516 54.934  27.836 1.00 30.49 ? 39   LEU B CG  1 
ATOM   1145 C  CD1 . LEU B 1 64  ? 21.233 54.571  26.544 1.00 30.11 ? 39   LEU B CD1 1 
ATOM   1146 C  CD2 . LEU B 1 64  ? 20.556 56.416  28.187 1.00 28.81 ? 39   LEU B CD2 1 
ATOM   1147 N  N   . PRO B 1 65  ? 16.124 55.613  27.821 1.00 33.22 ? 40   PRO B N   1 
ATOM   1148 C  CA  . PRO B 1 65  ? 14.743 55.564  27.336 1.00 32.18 ? 40   PRO B CA  1 
ATOM   1149 C  C   . PRO B 1 65  ? 14.595 54.656  26.104 1.00 31.61 ? 40   PRO B C   1 
ATOM   1150 O  O   . PRO B 1 65  ? 15.515 54.575  25.295 1.00 32.07 ? 40   PRO B O   1 
ATOM   1151 C  CB  . PRO B 1 65  ? 14.498 57.028  27.054 1.00 31.41 ? 40   PRO B CB  1 
ATOM   1152 C  CG  . PRO B 1 65  ? 15.395 57.749  28.027 1.00 32.72 ? 40   PRO B CG  1 
ATOM   1153 C  CD  . PRO B 1 65  ? 16.655 56.977  27.813 1.00 33.34 ? 40   PRO B CD  1 
ATOM   1154 N  N   . SER B 1 66  ? 13.487 53.949  25.885 1.00 31.04 ? 41   SER B N   1 
ATOM   1155 C  CA  . SER B 1 66  ? 13.422 52.973  24.819 1.00 32.48 ? 41   SER B CA  1 
ATOM   1156 C  C   . SER B 1 66  ? 13.785 53.436  23.428 1.00 32.31 ? 41   SER B C   1 
ATOM   1157 O  O   . SER B 1 66  ? 14.301 52.651  22.638 1.00 30.86 ? 41   SER B O   1 
ATOM   1158 C  CB  . SER B 1 66  ? 12.119 52.197  24.820 1.00 34.06 ? 41   SER B CB  1 
ATOM   1159 O  OG  . SER B 1 66  ? 10.984 53.037  24.872 1.00 39.11 ? 41   SER B OG  1 
ATOM   1160 N  N   . HIS B 1 67  ? 13.622 54.747  23.191 1.00 34.63 ? 42   HIS B N   1 
ATOM   1161 C  CA  . HIS B 1 67  ? 13.911 55.363  21.888 1.00 36.02 ? 42   HIS B CA  1 
ATOM   1162 C  C   . HIS B 1 67  ? 15.396 55.300  21.511 1.00 36.52 ? 42   HIS B C   1 
ATOM   1163 O  O   . HIS B 1 67  ? 15.780 55.228  20.327 1.00 34.40 ? 42   HIS B O   1 
ATOM   1164 C  CB  . HIS B 1 67  ? 13.316 56.805  21.755 1.00 34.27 ? 42   HIS B CB  1 
ATOM   1165 C  CG  . HIS B 1 67  ? 13.946 57.935  22.576 1.00 34.59 ? 42   HIS B CG  1 
ATOM   1166 N  ND1 . HIS B 1 67  ? 13.588 58.408  23.772 1.00 36.14 ? 42   HIS B ND1 1 
ATOM   1167 C  CD2 . HIS B 1 67  ? 15.013 58.687  22.154 1.00 32.00 ? 42   HIS B CD2 1 
ATOM   1168 C  CE1 . HIS B 1 67  ? 14.381 59.396  24.117 1.00 32.43 ? 42   HIS B CE1 1 
ATOM   1169 N  NE2 . HIS B 1 67  ? 15.227 59.539  23.124 1.00 35.02 ? 42   HIS B NE2 1 
ATOM   1170 N  N   . CYS B 1 68  ? 16.177 55.249  22.615 1.00 35.96 ? 43   CYS B N   1 
ATOM   1171 C  CA  . CYS B 1 68  ? 17.627 55.122  22.565 1.00 35.90 ? 43   CYS B CA  1 
ATOM   1172 C  C   . CYS B 1 68  ? 18.176 53.799  22.054 1.00 32.86 ? 43   CYS B C   1 
ATOM   1173 O  O   . CYS B 1 68  ? 19.347 53.782  21.649 1.00 33.40 ? 43   CYS B O   1 
ATOM   1174 C  CB  . CYS B 1 68  ? 18.339 55.448  23.910 1.00 40.38 ? 43   CYS B CB  1 
ATOM   1175 S  SG  . CYS B 1 68  ? 18.099 57.127  24.542 1.00 45.68 ? 43   CYS B SG  1 
ATOM   1176 N  N   . TRP B 1 69  ? 17.380 52.707  22.075 1.00 29.25 ? 44   TRP B N   1 
ATOM   1177 C  CA  . TRP B 1 69  ? 17.913 51.374  21.831 1.00 25.51 ? 44   TRP B CA  1 
ATOM   1178 C  C   . TRP B 1 69  ? 17.009 50.463  21.066 1.00 24.22 ? 44   TRP B C   1 
ATOM   1179 O  O   . TRP B 1 69  ? 17.544 49.594  20.406 1.00 26.02 ? 44   TRP B O   1 
ATOM   1180 C  CB  . TRP B 1 69  ? 18.375 50.661  23.113 1.00 21.99 ? 44   TRP B CB  1 
ATOM   1181 C  CG  . TRP B 1 69  ? 17.351 50.644  24.234 1.00 20.34 ? 44   TRP B CG  1 
ATOM   1182 C  CD1 . TRP B 1 69  ? 17.361 51.632  25.183 1.00 18.11 ? 44   TRP B CD1 1 
ATOM   1183 C  CD2 . TRP B 1 69  ? 16.297 49.745  24.363 1.00 19.23 ? 44   TRP B CD2 1 
ATOM   1184 N  NE1 . TRP B 1 69  ? 16.293 51.390  25.908 1.00 19.12 ? 44   TRP B NE1 1 
ATOM   1185 C  CE2 . TRP B 1 69  ? 15.635 50.281  25.471 1.00 18.20 ? 44   TRP B CE2 1 
ATOM   1186 C  CE3 . TRP B 1 69  ? 15.892 48.551  23.795 1.00 15.22 ? 44   TRP B CE3 1 
ATOM   1187 C  CZ2 . TRP B 1 69  ? 14.532 49.622  26.000 1.00 14.99 ? 44   TRP B CZ2 1 
ATOM   1188 C  CZ3 . TRP B 1 69  ? 14.805 47.897  24.324 1.00 13.45 ? 44   TRP B CZ3 1 
ATOM   1189 C  CH2 . TRP B 1 69  ? 14.130 48.434  25.405 1.00 15.50 ? 44   TRP B CH2 1 
ATOM   1190 N  N   . ILE B 1 70  ? 15.680 50.626  21.096 1.00 24.85 ? 45   ILE B N   1 
ATOM   1191 C  CA  . ILE B 1 70  ? 14.726 49.656  20.539 1.00 25.50 ? 45   ILE B CA  1 
ATOM   1192 C  C   . ILE B 1 70  ? 14.926 49.254  19.094 1.00 26.34 ? 45   ILE B C   1 
ATOM   1193 O  O   . ILE B 1 70  ? 14.724 48.086  18.762 1.00 28.11 ? 45   ILE B O   1 
ATOM   1194 C  CB  . ILE B 1 70  ? 13.231 50.055  20.773 1.00 26.28 ? 45   ILE B CB  1 
ATOM   1195 C  CG1 . ILE B 1 70  ? 12.358 48.838  20.592 1.00 24.31 ? 45   ILE B CG1 1 
ATOM   1196 C  CG2 . ILE B 1 70  ? 12.716 51.206  19.885 1.00 25.51 ? 45   ILE B CG2 1 
ATOM   1197 C  CD1 . ILE B 1 70  ? 12.688 47.633  21.486 1.00 19.41 ? 45   ILE B CD1 1 
ATOM   1198 N  N   . SER B 1 71  ? 15.336 50.233  18.274 1.00 28.06 ? 46   SER B N   1 
ATOM   1199 C  CA  . SER B 1 71  ? 15.623 50.071  16.851 1.00 28.67 ? 46   SER B CA  1 
ATOM   1200 C  C   . SER B 1 71  ? 16.739 49.059  16.553 1.00 27.51 ? 46   SER B C   1 
ATOM   1201 O  O   . SER B 1 71  ? 16.558 48.113  15.773 1.00 26.90 ? 46   SER B O   1 
ATOM   1202 C  CB  . SER B 1 71  ? 15.933 51.472  16.250 1.00 28.71 ? 46   SER B CB  1 
ATOM   1203 O  OG  . SER B 1 71  ? 16.259 51.414  14.871 1.00 31.35 ? 46   SER B OG  1 
ATOM   1204 N  N   . GLU B 1 72  ? 17.902 49.210  17.203 1.00 26.77 ? 47   GLU B N   1 
ATOM   1205 C  CA  . GLU B 1 72  ? 18.910 48.173  17.142 1.00 27.22 ? 47   GLU B CA  1 
ATOM   1206 C  C   . GLU B 1 72  ? 18.555 46.912  17.906 1.00 23.80 ? 47   GLU B C   1 
ATOM   1207 O  O   . GLU B 1 72  ? 19.011 45.850  17.513 1.00 24.85 ? 47   GLU B O   1 
ATOM   1208 C  CB  . GLU B 1 72  ? 20.209 48.703  17.683 1.00 30.36 ? 47   GLU B CB  1 
ATOM   1209 C  CG  . GLU B 1 72  ? 21.460 47.909  17.269 1.00 31.64 ? 47   GLU B CG  1 
ATOM   1210 C  CD  . GLU B 1 72  ? 21.718 47.840  15.774 1.00 31.93 ? 47   GLU B CD  1 
ATOM   1211 O  OE1 . GLU B 1 72  ? 21.267 48.726  15.034 1.00 32.82 ? 47   GLU B OE1 1 
ATOM   1212 O  OE2 . GLU B 1 72  ? 22.391 46.892  15.366 1.00 31.60 ? 47   GLU B OE2 1 
HETATM 1213 N  N   . MSE B 1 73  ? 17.739 46.958  18.958 1.00 23.65 ? 48   MSE B N   1 
HETATM 1214 C  CA  . MSE B 1 73  ? 17.401 45.755  19.709 1.00 21.94 ? 48   MSE B CA  1 
HETATM 1215 C  C   . MSE B 1 73  ? 16.511 44.916  18.837 1.00 22.24 ? 48   MSE B C   1 
HETATM 1216 O  O   . MSE B 1 73  ? 16.819 43.732  18.731 1.00 24.91 ? 48   MSE B O   1 
HETATM 1217 C  CB  . MSE B 1 73  ? 16.783 46.061  21.080 1.00 22.86 ? 48   MSE B CB  1 
HETATM 1218 C  CG  . MSE B 1 73  ? 16.875 44.981  22.173 1.00 24.51 ? 48   MSE B CG  1 
HETATM 1219 SE SE  . MSE B 1 73  ? 18.597 44.203  22.615 1.00 30.61 ? 48   MSE B SE  1 
HETATM 1220 C  CE  . MSE B 1 73  ? 17.982 42.661  21.922 1.00 26.74 ? 48   MSE B CE  1 
ATOM   1221 N  N   . VAL B 1 74  ? 15.506 45.445  18.110 1.00 21.88 ? 49   VAL B N   1 
ATOM   1222 C  CA  . VAL B 1 74  ? 14.661 44.597  17.276 1.00 20.25 ? 49   VAL B CA  1 
ATOM   1223 C  C   . VAL B 1 74  ? 15.387 43.973  16.098 1.00 20.18 ? 49   VAL B C   1 
ATOM   1224 O  O   . VAL B 1 74  ? 15.120 42.815  15.780 1.00 22.62 ? 49   VAL B O   1 
ATOM   1225 C  CB  . VAL B 1 74  ? 13.351 45.252  16.813 1.00 23.22 ? 49   VAL B CB  1 
ATOM   1226 C  CG1 . VAL B 1 74  ? 12.455 45.562  17.992 1.00 24.62 ? 49   VAL B CG1 1 
ATOM   1227 C  CG2 . VAL B 1 74  ? 13.551 46.527  16.025 1.00 23.30 ? 49   VAL B CG2 1 
ATOM   1228 N  N   . VAL B 1 75  ? 16.363 44.655  15.484 1.00 19.52 ? 50   VAL B N   1 
ATOM   1229 C  CA  . VAL B 1 75  ? 17.179 44.087  14.408 1.00 19.02 ? 50   VAL B CA  1 
ATOM   1230 C  C   . VAL B 1 75  ? 18.005 42.916  14.897 1.00 19.73 ? 50   VAL B C   1 
ATOM   1231 O  O   . VAL B 1 75  ? 18.091 41.872  14.232 1.00 19.76 ? 50   VAL B O   1 
ATOM   1232 C  CB  . VAL B 1 75  ? 18.110 45.171  13.808 1.00 18.29 ? 50   VAL B CB  1 
ATOM   1233 C  CG1 . VAL B 1 75  ? 19.181 44.607  12.925 1.00 16.52 ? 50   VAL B CG1 1 
ATOM   1234 C  CG2 . VAL B 1 75  ? 17.290 46.136  13.024 1.00 18.74 ? 50   VAL B CG2 1 
ATOM   1235 N  N   . GLN B 1 76  ? 18.617 43.151  16.064 1.00 17.95 ? 51   GLN B N   1 
ATOM   1236 C  CA  . GLN B 1 76  ? 19.447 42.130  16.677 1.00 18.39 ? 51   GLN B CA  1 
ATOM   1237 C  C   . GLN B 1 76  ? 18.645 40.938  17.084 1.00 16.66 ? 51   GLN B C   1 
ATOM   1238 O  O   . GLN B 1 76  ? 19.056 39.827  16.830 1.00 18.39 ? 51   GLN B O   1 
ATOM   1239 C  CB  . GLN B 1 76  ? 20.264 42.655  17.851 1.00 18.87 ? 51   GLN B CB  1 
ATOM   1240 C  CG  . GLN B 1 76  ? 21.265 43.713  17.440 1.00 18.55 ? 51   GLN B CG  1 
ATOM   1241 C  CD  . GLN B 1 76  ? 22.253 43.283  16.370 1.00 23.83 ? 51   GLN B CD  1 
ATOM   1242 O  OE1 . GLN B 1 76  ? 22.400 42.141  15.918 1.00 23.92 ? 51   GLN B OE1 1 
ATOM   1243 N  NE2 . GLN B 1 76  ? 23.019 44.265  15.958 1.00 27.04 ? 51   GLN B NE2 1 
ATOM   1244 N  N   . LEU B 1 77  ? 17.481 41.149  17.652 1.00 16.16 ? 52   LEU B N   1 
ATOM   1245 C  CA  . LEU B 1 77  ? 16.615 40.053  18.010 1.00 17.66 ? 52   LEU B CA  1 
ATOM   1246 C  C   . LEU B 1 77  ? 16.106 39.302  16.810 1.00 18.23 ? 52   LEU B C   1 
ATOM   1247 O  O   . LEU B 1 77  ? 16.012 38.080  16.844 1.00 18.09 ? 52   LEU B O   1 
ATOM   1248 C  CB  . LEU B 1 77  ? 15.412 40.576  18.771 1.00 19.12 ? 52   LEU B CB  1 
ATOM   1249 C  CG  . LEU B 1 77  ? 15.665 40.840  20.232 1.00 20.87 ? 52   LEU B CG  1 
ATOM   1250 C  CD1 . LEU B 1 77  ? 14.609 41.767  20.734 1.00 20.47 ? 52   LEU B CD1 1 
ATOM   1251 C  CD2 . LEU B 1 77  ? 15.692 39.553  21.037 1.00 21.69 ? 52   LEU B CD2 1 
ATOM   1252 N  N   . SER B 1 78  ? 15.797 40.014  15.717 1.00 20.42 ? 53   SER B N   1 
ATOM   1253 C  CA  . SER B 1 78  ? 15.410 39.376  14.469 1.00 18.47 ? 53   SER B CA  1 
ATOM   1254 C  C   . SER B 1 78  ? 16.491 38.428  13.973 1.00 18.27 ? 53   SER B C   1 
ATOM   1255 O  O   . SER B 1 78  ? 16.259 37.257  13.692 1.00 17.53 ? 53   SER B O   1 
ATOM   1256 C  CB  . SER B 1 78  ? 15.188 40.496  13.523 1.00 21.19 ? 53   SER B CB  1 
ATOM   1257 O  OG  . SER B 1 78  ? 14.858 39.866  12.317 1.00 22.45 ? 53   SER B OG  1 
ATOM   1258 N  N   . ASP B 1 79  ? 17.729 38.892  13.962 1.00 21.01 ? 54   ASP B N   1 
ATOM   1259 C  CA  . ASP B 1 79  ? 18.811 38.060  13.483 1.00 25.15 ? 54   ASP B CA  1 
ATOM   1260 C  C   . ASP B 1 79  ? 19.040 36.841  14.339 1.00 24.43 ? 54   ASP B C   1 
ATOM   1261 O  O   . ASP B 1 79  ? 19.279 35.764  13.782 1.00 24.72 ? 54   ASP B O   1 
ATOM   1262 C  CB  . ASP B 1 79  ? 20.170 38.731  13.462 1.00 32.20 ? 54   ASP B CB  1 
ATOM   1263 C  CG  . ASP B 1 79  ? 20.366 40.017  12.671 1.00 44.10 ? 54   ASP B CG  1 
ATOM   1264 O  OD1 . ASP B 1 79  ? 19.508 40.411  11.838 1.00 48.06 ? 54   ASP B OD1 1 
ATOM   1265 O  OD2 . ASP B 1 79  ? 21.429 40.630  12.924 1.00 50.40 ? 54   ASP B OD2 1 
ATOM   1266 N  N   . SER B 1 80  ? 19.025 37.009  15.674 1.00 21.94 ? 55   SER B N   1 
ATOM   1267 C  CA  . SER B 1 80  ? 19.197 35.872  16.589 1.00 21.29 ? 55   SER B CA  1 
ATOM   1268 C  C   . SER B 1 80  ? 18.036 34.884  16.516 1.00 19.86 ? 55   SER B C   1 
ATOM   1269 O  O   . SER B 1 80  ? 18.259 33.675  16.567 1.00 20.94 ? 55   SER B O   1 
ATOM   1270 C  CB  . SER B 1 80  ? 19.356 36.295  18.052 1.00 18.68 ? 55   SER B CB  1 
ATOM   1271 O  OG  . SER B 1 80  ? 20.384 37.208  18.406 1.00 18.26 ? 55   SER B OG  1 
ATOM   1272 N  N   . LEU B 1 81  ? 16.789 35.362  16.374 1.00 20.32 ? 56   LEU B N   1 
ATOM   1273 C  CA  . LEU B 1 81  ? 15.647 34.453  16.343 1.00 20.44 ? 56   LEU B CA  1 
ATOM   1274 C  C   . LEU B 1 81  ? 15.628 33.735  15.025 1.00 21.16 ? 56   LEU B C   1 
ATOM   1275 O  O   . LEU B 1 81  ? 15.299 32.552  14.968 1.00 20.64 ? 56   LEU B O   1 
ATOM   1276 C  CB  . LEU B 1 81  ? 14.335 35.169  16.568 1.00 19.08 ? 56   LEU B CB  1 
ATOM   1277 C  CG  . LEU B 1 81  ? 13.967 35.545  17.993 1.00 19.76 ? 56   LEU B CG  1 
ATOM   1278 C  CD1 . LEU B 1 81  ? 12.809 36.497  18.033 1.00 18.12 ? 56   LEU B CD1 1 
ATOM   1279 C  CD2 . LEU B 1 81  ? 13.621 34.308  18.773 1.00 17.63 ? 56   LEU B CD2 1 
ATOM   1280 N  N   . THR B 1 82  ? 16.081 34.451  13.984 1.00 22.55 ? 57   THR B N   1 
ATOM   1281 C  CA  . THR B 1 82  ? 16.144 33.901  12.624 1.00 23.77 ? 57   THR B CA  1 
ATOM   1282 C  C   . THR B 1 82  ? 17.169 32.775  12.599 1.00 25.31 ? 57   THR B C   1 
ATOM   1283 O  O   . THR B 1 82  ? 16.904 31.674  12.109 1.00 28.36 ? 57   THR B O   1 
ATOM   1284 C  CB  . THR B 1 82  ? 16.420 35.019  11.581 1.00 22.83 ? 57   THR B CB  1 
ATOM   1285 O  OG1 . THR B 1 82  ? 15.245 35.800  11.520 1.00 20.28 ? 57   THR B OG1 1 
ATOM   1286 C  CG2 . THR B 1 82  ? 16.608 34.496  10.209 1.00 22.98 ? 57   THR B CG2 1 
ATOM   1287 N  N   . ASP B 1 83  ? 18.331 32.975  13.229 1.00 27.29 ? 58   ASP B N   1 
ATOM   1288 C  CA  . ASP B 1 83  ? 19.328 31.934  13.394 1.00 25.16 ? 58   ASP B CA  1 
ATOM   1289 C  C   . ASP B 1 83  ? 18.874 30.781  14.238 1.00 22.74 ? 58   ASP B C   1 
ATOM   1290 O  O   . ASP B 1 83  ? 19.128 29.640  13.909 1.00 20.50 ? 58   ASP B O   1 
ATOM   1291 C  CB  . ASP B 1 83  ? 20.510 32.549  14.059 1.00 32.90 ? 58   ASP B CB  1 
ATOM   1292 C  CG  . ASP B 1 83  ? 21.367 33.343  13.098 1.00 40.22 ? 58   ASP B CG  1 
ATOM   1293 O  OD1 . ASP B 1 83  ? 21.635 32.807  11.999 1.00 47.28 ? 58   ASP B OD1 1 
ATOM   1294 O  OD2 . ASP B 1 83  ? 21.780 34.468  13.458 1.00 42.79 ? 58   ASP B OD2 1 
ATOM   1295 N  N   . LEU B 1 84  ? 18.174 31.090  15.328 1.00 22.88 ? 59   LEU B N   1 
ATOM   1296 C  CA  . LEU B 1 84  ? 17.597 30.066  16.166 1.00 22.01 ? 59   LEU B CA  1 
ATOM   1297 C  C   . LEU B 1 84  ? 16.596 29.206  15.391 1.00 22.75 ? 59   LEU B C   1 
ATOM   1298 O  O   . LEU B 1 84  ? 16.642 27.981  15.498 1.00 24.25 ? 59   LEU B O   1 
ATOM   1299 C  CB  . LEU B 1 84  ? 16.984 30.711  17.389 1.00 21.26 ? 59   LEU B CB  1 
ATOM   1300 C  CG  . LEU B 1 84  ? 16.544 29.703  18.408 1.00 21.05 ? 59   LEU B CG  1 
ATOM   1301 C  CD1 . LEU B 1 84  ? 17.733 28.955  19.020 1.00 20.13 ? 59   LEU B CD1 1 
ATOM   1302 C  CD2 . LEU B 1 84  ? 15.718 30.419  19.413 1.00 20.68 ? 59   LEU B CD2 1 
ATOM   1303 N  N   . LEU B 1 85  ? 15.729 29.754  14.537 1.00 22.30 ? 60   LEU B N   1 
ATOM   1304 C  CA  . LEU B 1 85  ? 14.838 28.912  13.776 1.00 21.18 ? 60   LEU B CA  1 
ATOM   1305 C  C   . LEU B 1 85  ? 15.559 27.884  12.897 1.00 24.69 ? 60   LEU B C   1 
ATOM   1306 O  O   . LEU B 1 85  ? 15.084 26.761  12.702 1.00 27.59 ? 60   LEU B O   1 
ATOM   1307 C  CB  . LEU B 1 85  ? 13.949 29.829  12.982 1.00 20.34 ? 60   LEU B CB  1 
ATOM   1308 C  CG  . LEU B 1 85  ? 12.805 29.256  12.208 1.00 15.11 ? 60   LEU B CG  1 
ATOM   1309 C  CD1 . LEU B 1 85  ? 11.775 28.689  13.124 1.00 14.00 ? 60   LEU B CD1 1 
ATOM   1310 C  CD2 . LEU B 1 85  ? 12.216 30.351  11.405 1.00 15.62 ? 60   LEU B CD2 1 
ATOM   1311 N  N   . ASP B 1 86  ? 16.768 28.142  12.405 1.00 28.19 ? 61   ASP B N   1 
ATOM   1312 C  CA  . ASP B 1 86  ? 17.425 27.134  11.587 1.00 31.01 ? 61   ASP B CA  1 
ATOM   1313 C  C   . ASP B 1 86  ? 17.898 25.925  12.380 1.00 30.42 ? 61   ASP B C   1 
ATOM   1314 O  O   . ASP B 1 86  ? 18.293 24.903  11.836 1.00 30.78 ? 61   ASP B O   1 
ATOM   1315 C  CB  . ASP B 1 86  ? 18.486 27.766  10.638 1.00 40.38 ? 61   ASP B CB  1 
ATOM   1316 C  CG  . ASP B 1 86  ? 20.011 27.910  10.913 1.00 49.60 ? 61   ASP B CG  1 
ATOM   1317 O  OD1 . ASP B 1 86  ? 20.632 27.086  11.630 1.00 52.10 ? 61   ASP B OD1 1 
ATOM   1318 O  OD2 . ASP B 1 86  ? 20.602 28.852  10.340 1.00 54.11 ? 61   ASP B OD2 1 
ATOM   1319 N  N   . LYS B 1 87  ? 17.841 26.023  13.706 1.00 29.72 ? 62   LYS B N   1 
ATOM   1320 C  CA  . LYS B 1 87  ? 18.282 24.972  14.586 1.00 26.53 ? 62   LYS B CA  1 
ATOM   1321 C  C   . LYS B 1 87  ? 17.227 23.920  14.754 1.00 26.40 ? 62   LYS B C   1 
ATOM   1322 O  O   . LYS B 1 87  ? 17.553 22.835  15.224 1.00 28.09 ? 62   LYS B O   1 
ATOM   1323 C  CB  . LYS B 1 87  ? 18.655 25.534  15.953 1.00 25.89 ? 62   LYS B CB  1 
ATOM   1324 C  CG  . LYS B 1 87  ? 19.865 26.451  15.996 1.00 24.99 ? 62   LYS B CG  1 
ATOM   1325 C  CD  . LYS B 1 87  ? 21.053 25.810  15.308 1.00 26.66 ? 62   LYS B CD  1 
ATOM   1326 C  CE  . LYS B 1 87  ? 22.198 26.806  15.251 1.00 28.58 ? 62   LYS B CE  1 
ATOM   1327 N  NZ  . LYS B 1 87  ? 21.868 27.957  14.431 1.00 34.52 ? 62   LYS B NZ  1 
ATOM   1328 N  N   . PHE B 1 88  ? 15.986 24.225  14.389 1.00 26.48 ? 63   PHE B N   1 
ATOM   1329 C  CA  . PHE B 1 88  ? 14.862 23.316  14.568 1.00 29.27 ? 63   PHE B CA  1 
ATOM   1330 C  C   . PHE B 1 88  ? 14.293 22.916  13.220 1.00 31.78 ? 63   PHE B C   1 
ATOM   1331 O  O   . PHE B 1 88  ? 14.573 23.581  12.227 1.00 34.39 ? 63   PHE B O   1 
ATOM   1332 C  CB  . PHE B 1 88  ? 13.744 23.920  15.427 1.00 24.13 ? 63   PHE B CB  1 
ATOM   1333 C  CG  . PHE B 1 88  ? 14.261 24.236  16.809 1.00 23.83 ? 63   PHE B CG  1 
ATOM   1334 C  CD1 . PHE B 1 88  ? 14.269 23.261  17.761 1.00 20.94 ? 63   PHE B CD1 1 
ATOM   1335 C  CD2 . PHE B 1 88  ? 14.811 25.488  17.066 1.00 25.00 ? 63   PHE B CD2 1 
ATOM   1336 C  CE1 . PHE B 1 88  ? 14.872 23.535  18.964 1.00 23.54 ? 63   PHE B CE1 1 
ATOM   1337 C  CE2 . PHE B 1 88  ? 15.444 25.741  18.263 1.00 22.33 ? 63   PHE B CE2 1 
ATOM   1338 C  CZ  . PHE B 1 88  ? 15.467 24.752  19.211 1.00 21.46 ? 63   PHE B CZ  1 
ATOM   1339 N  N   . SER B 1 89  ? 13.565 21.791  13.203 1.00 35.96 ? 64   SER B N   1 
ATOM   1340 C  CA  . SER B 1 89  ? 12.847 21.251  12.047 1.00 41.24 ? 64   SER B CA  1 
ATOM   1341 C  C   . SER B 1 89  ? 11.362 21.237  12.401 1.00 44.87 ? 64   SER B C   1 
ATOM   1342 O  O   . SER B 1 89  ? 11.045 21.210  13.593 1.00 45.47 ? 64   SER B O   1 
ATOM   1343 C  CB  . SER B 1 89  ? 13.299 19.810  11.723 1.00 39.81 ? 64   SER B CB  1 
ATOM   1344 O  OG  . SER B 1 89  ? 14.690 19.659  11.441 1.00 41.15 ? 64   SER B OG  1 
ATOM   1345 N  N   . ASN B 1 90  ? 10.393 21.257  11.464 1.00 50.28 ? 65   ASN B N   1 
ATOM   1346 C  CA  . ASN B 1 90  ? 8.980  21.293  11.878 1.00 53.31 ? 65   ASN B CA  1 
ATOM   1347 C  C   . ASN B 1 90  ? 8.304  19.970  12.291 1.00 53.88 ? 65   ASN B C   1 
ATOM   1348 O  O   . ASN B 1 90  ? 8.619  18.877  11.815 1.00 53.27 ? 65   ASN B O   1 
ATOM   1349 C  CB  . ASN B 1 90  ? 8.137  22.121  10.899 1.00 55.21 ? 65   ASN B CB  1 
ATOM   1350 C  CG  . ASN B 1 90  ? 6.847  22.674  11.525 1.00 58.28 ? 65   ASN B CG  1 
ATOM   1351 O  OD1 . ASN B 1 90  ? 5.829  22.845  10.846 1.00 62.80 ? 65   ASN B OD1 1 
ATOM   1352 N  ND2 . ASN B 1 90  ? 6.802  22.997  12.821 1.00 58.83 ? 65   ASN B ND2 1 
ATOM   1353 N  N   . ILE B 1 91  ? 7.402  20.111  13.274 1.00 55.78 ? 66   ILE B N   1 
ATOM   1354 C  CA  . ILE B 1 91  ? 6.604  19.028  13.857 1.00 58.20 ? 66   ILE B CA  1 
ATOM   1355 C  C   . ILE B 1 91  ? 5.128  19.413  13.732 1.00 59.99 ? 66   ILE B C   1 
ATOM   1356 O  O   . ILE B 1 91  ? 4.679  20.439  14.266 1.00 59.98 ? 66   ILE B O   1 
ATOM   1357 C  CB  . ILE B 1 91  ? 6.916  18.864  15.373 1.00 58.00 ? 66   ILE B CB  1 
ATOM   1358 C  CG1 . ILE B 1 91  ? 8.393  18.635  15.673 1.00 56.77 ? 66   ILE B CG1 1 
ATOM   1359 C  CG2 . ILE B 1 91  ? 6.119  17.713  15.950 1.00 58.43 ? 66   ILE B CG2 1 
ATOM   1360 C  CD1 . ILE B 1 91  ? 8.729  18.733  17.169 1.00 53.61 ? 66   ILE B CD1 1 
ATOM   1361 N  N   . SER B 1 92  ? 4.387  18.545  13.027 1.00 62.59 ? 67   SER B N   1 
ATOM   1362 C  CA  . SER B 1 92  ? 2.945  18.687  12.803 1.00 65.18 ? 67   SER B CA  1 
ATOM   1363 C  C   . SER B 1 92  ? 2.049  18.114  13.935 1.00 66.39 ? 67   SER B C   1 
ATOM   1364 O  O   . SER B 1 92  ? 1.110  17.339  13.725 1.00 68.18 ? 67   SER B O   1 
ATOM   1365 C  CB  . SER B 1 92  ? 2.632  18.133  11.385 1.00 65.71 ? 67   SER B CB  1 
ATOM   1366 O  OG  . SER B 1 92  ? 3.288  16.912  10.995 1.00 67.79 ? 67   SER B OG  1 
ATOM   1367 N  N   . GLU B 1 93  ? 2.307  18.549  15.184 1.00 66.59 ? 68   GLU B N   1 
ATOM   1368 C  CA  . GLU B 1 93  ? 1.793  17.929  16.415 1.00 65.52 ? 68   GLU B CA  1 
ATOM   1369 C  C   . GLU B 1 93  ? 0.895  18.865  17.238 1.00 66.78 ? 68   GLU B C   1 
ATOM   1370 O  O   . GLU B 1 93  ? -0.333 18.715  17.307 1.00 67.15 ? 68   GLU B O   1 
ATOM   1371 C  CB  . GLU B 1 93  ? 2.977  17.471  17.301 1.00 66.40 ? 68   GLU B CB  1 
ATOM   1372 C  CG  . GLU B 1 93  ? 2.568  17.163  18.743 1.00 67.84 ? 68   GLU B CG  1 
ATOM   1373 C  CD  . GLU B 1 93  ? 3.745  16.736  19.622 1.00 69.12 ? 68   GLU B CD  1 
ATOM   1374 O  OE1 . GLU B 1 93  ? 4.931  16.661  19.119 1.00 70.46 ? 68   GLU B OE1 1 
ATOM   1375 O  OE2 . GLU B 1 93  ? 3.552  16.451  20.865 1.00 71.34 ? 68   GLU B OE2 1 
ATOM   1376 N  N   . GLY B 1 94  ? 1.582  19.807  17.897 1.00 65.16 ? 69   GLY B N   1 
ATOM   1377 C  CA  . GLY B 1 94  ? 1.015  20.935  18.626 1.00 63.26 ? 69   GLY B CA  1 
ATOM   1378 C  C   . GLY B 1 94  ? 2.019  22.049  18.382 1.00 60.63 ? 69   GLY B C   1 
ATOM   1379 O  O   . GLY B 1 94  ? 2.666  22.081  17.308 1.00 60.82 ? 69   GLY B O   1 
ATOM   1380 N  N   . LEU B 1 95  ? 2.179  22.963  19.355 1.00 57.50 ? 70   LEU B N   1 
ATOM   1381 C  CA  . LEU B 1 95  ? 3.254  23.950  19.225 1.00 53.07 ? 70   LEU B CA  1 
ATOM   1382 C  C   . LEU B 1 95  ? 4.610  23.233  19.244 1.00 50.38 ? 70   LEU B C   1 
ATOM   1383 O  O   . LEU B 1 95  ? 4.879  22.324  20.040 1.00 53.95 ? 70   LEU B O   1 
ATOM   1384 C  CB  . LEU B 1 95  ? 3.243  25.033  20.295 1.00 52.74 ? 70   LEU B CB  1 
ATOM   1385 C  CG  . LEU B 1 95  ? 2.243  26.184  20.332 1.00 54.01 ? 70   LEU B CG  1 
ATOM   1386 C  CD1 . LEU B 1 95  ? 2.326  26.991  19.014 1.00 54.05 ? 70   LEU B CD1 1 
ATOM   1387 C  CD2 . LEU B 1 95  ? 0.834  25.683  20.698 1.00 55.75 ? 70   LEU B CD2 1 
ATOM   1388 N  N   . SER B 1 96  ? 5.437  23.543  18.271 1.00 43.22 ? 71   SER B N   1 
ATOM   1389 C  CA  . SER B 1 96  ? 6.788  23.107  18.347 1.00 37.10 ? 71   SER B CA  1 
ATOM   1390 C  C   . SER B 1 96  ? 7.676  24.348  18.452 1.00 35.41 ? 71   SER B C   1 
ATOM   1391 O  O   . SER B 1 96  ? 7.223  25.469  18.195 1.00 34.32 ? 71   SER B O   1 
ATOM   1392 C  CB  . SER B 1 96  ? 7.030  22.242  17.147 1.00 36.36 ? 71   SER B CB  1 
ATOM   1393 O  OG  . SER B 1 96  ? 6.753  22.899  15.934 1.00 36.82 ? 71   SER B OG  1 
ATOM   1394 N  N   . ASN B 1 97  ? 8.946  24.206  18.876 1.00 33.26 ? 72   ASN B N   1 
ATOM   1395 C  CA  . ASN B 1 97  ? 9.888  25.327  18.974 1.00 28.70 ? 72   ASN B CA  1 
ATOM   1396 C  C   . ASN B 1 97  ? 10.013 26.017  17.631 1.00 25.92 ? 72   ASN B C   1 
ATOM   1397 O  O   . ASN B 1 97  ? 10.086 27.234  17.591 1.00 25.46 ? 72   ASN B O   1 
ATOM   1398 C  CB  . ASN B 1 97  ? 11.281 24.862  19.462 1.00 28.21 ? 72   ASN B CB  1 
ATOM   1399 C  CG  . ASN B 1 97  ? 11.365 24.292  20.880 1.00 26.47 ? 72   ASN B CG  1 
ATOM   1400 O  OD1 . ASN B 1 97  ? 10.592 24.638  21.764 1.00 25.38 ? 72   ASN B OD1 1 
ATOM   1401 N  ND2 . ASN B 1 97  ? 12.284 23.373  21.160 1.00 26.66 ? 72   ASN B ND2 1 
ATOM   1402 N  N   . TYR B 1 98  ? 9.968  25.221  16.547 1.00 26.29 ? 73   TYR B N   1 
ATOM   1403 C  CA  . TYR B 1 98  ? 9.940  25.723  15.179 1.00 26.54 ? 73   TYR B CA  1 
ATOM   1404 C  C   . TYR B 1 98  ? 8.760  26.639  14.993 1.00 23.80 ? 73   TYR B C   1 
ATOM   1405 O  O   . TYR B 1 98  ? 8.967  27.809  14.726 1.00 27.19 ? 73   TYR B O   1 
ATOM   1406 C  CB  . TYR B 1 98  ? 9.881  24.631  14.075 1.00 28.15 ? 73   TYR B CB  1 
ATOM   1407 C  CG  . TYR B 1 98  ? 10.162 25.129  12.647 1.00 28.60 ? 73   TYR B CG  1 
ATOM   1408 C  CD1 . TYR B 1 98  ? 9.210  25.828  11.901 1.00 29.58 ? 73   TYR B CD1 1 
ATOM   1409 C  CD2 . TYR B 1 98  ? 11.426 24.929  12.122 1.00 30.26 ? 73   TYR B CD2 1 
ATOM   1410 C  CE1 . TYR B 1 98  ? 9.566  26.391  10.690 1.00 29.50 ? 73   TYR B CE1 1 
ATOM   1411 C  CE2 . TYR B 1 98  ? 11.783 25.467  10.898 1.00 31.02 ? 73   TYR B CE2 1 
ATOM   1412 C  CZ  . TYR B 1 98  ? 10.855 26.215  10.209 1.00 32.38 ? 73   TYR B CZ  1 
ATOM   1413 O  OH  . TYR B 1 98  ? 11.245 26.802  9.014  1.00 36.91 ? 73   TYR B OH  1 
ATOM   1414 N  N   . SER B 1 99  ? 7.535  26.185  15.145 1.00 23.20 ? 74   SER B N   1 
ATOM   1415 C  CA  . SER B 1 99  ? 6.402  27.077  15.028 1.00 24.27 ? 74   SER B CA  1 
ATOM   1416 C  C   . SER B 1 99  ? 6.449  28.270  15.935 1.00 23.26 ? 74   SER B C   1 
ATOM   1417 O  O   . SER B 1 99  ? 6.039  29.360  15.572 1.00 25.85 ? 74   SER B O   1 
ATOM   1418 C  CB  . SER B 1 99  ? 5.156  26.342  15.357 1.00 25.27 ? 74   SER B CB  1 
ATOM   1419 O  OG  . SER B 1 99  ? 5.173  25.254  14.460 1.00 32.42 ? 74   SER B OG  1 
ATOM   1420 N  N   . ILE B 1 100 ? 6.958  28.120  17.146 1.00 25.08 ? 75   ILE B N   1 
ATOM   1421 C  CA  . ILE B 1 100 ? 6.913  29.248  18.057 1.00 23.59 ? 75   ILE B CA  1 
ATOM   1422 C  C   . ILE B 1 100 ? 7.908  30.294  17.620 1.00 21.89 ? 75   ILE B C   1 
ATOM   1423 O  O   . ILE B 1 100 ? 7.509  31.437  17.519 1.00 21.19 ? 75   ILE B O   1 
ATOM   1424 C  CB  . ILE B 1 100 ? 7.150  28.785  19.482 1.00 23.07 ? 75   ILE B CB  1 
ATOM   1425 C  CG1 . ILE B 1 100 ? 5.984  27.956  19.962 1.00 23.49 ? 75   ILE B CG1 1 
ATOM   1426 C  CG2 . ILE B 1 100 ? 7.272  29.985  20.397 1.00 22.81 ? 75   ILE B CG2 1 
ATOM   1427 C  CD1 . ILE B 1 100 ? 6.254  27.309  21.343 1.00 21.59 ? 75   ILE B CD1 1 
ATOM   1428 N  N   . ILE B 1 101 ? 9.149  29.881  17.347 1.00 21.79 ? 76   ILE B N   1 
ATOM   1429 C  CA  . ILE B 1 101 ? 10.226 30.789  16.994 1.00 22.16 ? 76   ILE B CA  1 
ATOM   1430 C  C   . ILE B 1 101 ? 9.830  31.465  15.705 1.00 23.36 ? 76   ILE B C   1 
ATOM   1431 O  O   . ILE B 1 101 ? 9.898  32.679  15.673 1.00 26.09 ? 76   ILE B O   1 
ATOM   1432 C  CB  . ILE B 1 101 ? 11.611 30.123  16.831 1.00 21.17 ? 76   ILE B CB  1 
ATOM   1433 C  CG1 . ILE B 1 101 ? 12.075 29.444  18.092 1.00 19.74 ? 76   ILE B CG1 1 
ATOM   1434 C  CG2 . ILE B 1 101 ? 12.661 31.169  16.489 1.00 18.62 ? 76   ILE B CG2 1 
ATOM   1435 C  CD1 . ILE B 1 101 ? 13.143 28.388  17.846 1.00 17.66 ? 76   ILE B CD1 1 
ATOM   1436 N  N   . ASP B 1 102 ? 9.353  30.734  14.702 1.00 23.97 ? 77   ASP B N   1 
ATOM   1437 C  CA  . ASP B 1 102 ? 8.866  31.293  13.456 1.00 25.97 ? 77   ASP B CA  1 
ATOM   1438 C  C   . ASP B 1 102 ? 7.856  32.411  13.657 1.00 26.70 ? 77   ASP B C   1 
ATOM   1439 O  O   . ASP B 1 102 ? 8.065  33.525  13.187 1.00 28.84 ? 77   ASP B O   1 
ATOM   1440 C  CB  . ASP B 1 102 ? 8.223  30.179  12.680 1.00 28.57 ? 77   ASP B CB  1 
ATOM   1441 C  CG  . ASP B 1 102 ? 8.018  30.507  11.212 1.00 32.25 ? 77   ASP B CG  1 
ATOM   1442 O  OD1 . ASP B 1 102 ? 8.957  31.036  10.598 1.00 34.07 ? 77   ASP B OD1 1 
ATOM   1443 O  OD2 . ASP B 1 102 ? 6.927  30.224  10.704 1.00 32.50 ? 77   ASP B OD2 1 
ATOM   1444 N  N   . LYS B 1 103 ? 6.797  32.211  14.443 1.00 28.77 ? 78   LYS B N   1 
ATOM   1445 C  CA  . LYS B 1 103 ? 5.891  33.285  14.868 1.00 28.31 ? 78   LYS B CA  1 
ATOM   1446 C  C   . LYS B 1 103 ? 6.596  34.463  15.571 1.00 26.90 ? 78   LYS B C   1 
ATOM   1447 O  O   . LYS B 1 103 ? 6.221  35.629  15.449 1.00 26.22 ? 78   LYS B O   1 
ATOM   1448 C  CB  . LYS B 1 103 ? 4.861  32.589  15.762 1.00 32.30 ? 78   LYS B CB  1 
ATOM   1449 C  CG  . LYS B 1 103 ? 3.767  33.491  16.290 1.00 41.29 ? 78   LYS B CG  1 
ATOM   1450 C  CD  . LYS B 1 103 ? 2.746  32.676  17.100 1.00 49.72 ? 78   LYS B CD  1 
ATOM   1451 C  CE  . LYS B 1 103 ? 1.564  33.546  17.666 1.00 53.37 ? 78   LYS B CE  1 
ATOM   1452 N  NZ  . LYS B 1 103 ? 0.551  32.773  18.406 1.00 54.23 ? 78   LYS B NZ  1 
ATOM   1453 N  N   . LEU B 1 104 ? 7.663  34.218  16.330 1.00 25.35 ? 79   LEU B N   1 
ATOM   1454 C  CA  . LEU B 1 104 ? 8.352  35.299  17.007 1.00 23.52 ? 79   LEU B CA  1 
ATOM   1455 C  C   . LEU B 1 104 ? 9.151  36.141  16.063 1.00 22.42 ? 79   LEU B C   1 
ATOM   1456 O  O   . LEU B 1 104 ? 9.249  37.348  16.219 1.00 20.72 ? 79   LEU B O   1 
ATOM   1457 C  CB  . LEU B 1 104 ? 9.292  34.752  18.074 1.00 23.66 ? 79   LEU B CB  1 
ATOM   1458 C  CG  . LEU B 1 104 ? 8.739  33.917  19.241 1.00 21.39 ? 79   LEU B CG  1 
ATOM   1459 C  CD1 . LEU B 1 104 ? 9.823  33.698  20.260 1.00 17.54 ? 79   LEU B CD1 1 
ATOM   1460 C  CD2 . LEU B 1 104 ? 7.579  34.608  19.911 1.00 21.67 ? 79   LEU B CD2 1 
ATOM   1461 N  N   . VAL B 1 105 ? 9.727  35.426  15.094 1.00 25.43 ? 80   VAL B N   1 
ATOM   1462 C  CA  . VAL B 1 105 ? 10.474 35.983  13.952 1.00 25.77 ? 80   VAL B CA  1 
ATOM   1463 C  C   . VAL B 1 105 ? 9.566  36.918  13.200 1.00 25.42 ? 80   VAL B C   1 
ATOM   1464 O  O   . VAL B 1 105 ? 9.948  38.052  12.971 1.00 26.43 ? 80   VAL B O   1 
ATOM   1465 C  CB  . VAL B 1 105 ? 10.989 34.920  12.949 1.00 24.61 ? 80   VAL B CB  1 
ATOM   1466 C  CG1 . VAL B 1 105 ? 11.693 35.588  11.801 1.00 26.74 ? 80   VAL B CG1 1 
ATOM   1467 C  CG2 . VAL B 1 105 ? 12.018 33.999  13.521 1.00 24.19 ? 80   VAL B CG2 1 
ATOM   1468 N  N   . ASN B 1 106 ? 8.352  36.466  12.893 1.00 27.82 ? 81   ASN B N   1 
ATOM   1469 C  CA  . ASN B 1 106 ? 7.420  37.299  12.163 1.00 29.77 ? 81   ASN B CA  1 
ATOM   1470 C  C   . ASN B 1 106 ? 6.999  38.527  12.964 1.00 29.38 ? 81   ASN B C   1 
ATOM   1471 O  O   . ASN B 1 106 ? 6.937  39.593  12.377 1.00 32.14 ? 81   ASN B O   1 
ATOM   1472 C  CB  . ASN B 1 106 ? 6.221  36.505  11.562 1.00 31.24 ? 81   ASN B CB  1 
ATOM   1473 C  CG  . ASN B 1 106 ? 6.543  35.379  10.564 1.00 33.72 ? 81   ASN B CG  1 
ATOM   1474 O  OD1 . ASN B 1 106 ? 7.608  35.271  9.962  1.00 34.16 ? 81   ASN B OD1 1 
ATOM   1475 N  ND2 . ASN B 1 106 ? 5.614  34.454  10.332 1.00 37.55 ? 81   ASN B ND2 1 
ATOM   1476 N  N   . ILE B 1 107 ? 6.761  38.515  14.283 1.00 30.06 ? 82   ILE B N   1 
ATOM   1477 C  CA  . ILE B 1 107 ? 6.418  39.713  15.057 1.00 27.77 ? 82   ILE B CA  1 
ATOM   1478 C  C   . ILE B 1 107 ? 7.591  40.672  15.019 1.00 28.50 ? 82   ILE B C   1 
ATOM   1479 O  O   . ILE B 1 107 ? 7.388  41.866  14.826 1.00 30.63 ? 82   ILE B O   1 
ATOM   1480 C  CB  . ILE B 1 107 ? 6.164  39.318  16.534 1.00 27.91 ? 82   ILE B CB  1 
ATOM   1481 C  CG1 . ILE B 1 107 ? 4.880  38.557  16.625 1.00 29.24 ? 82   ILE B CG1 1 
ATOM   1482 C  CG2 . ILE B 1 107 ? 6.192  40.458  17.555 1.00 23.22 ? 82   ILE B CG2 1 
ATOM   1483 C  CD1 . ILE B 1 107 ? 4.796  37.771  17.958 1.00 33.77 ? 82   ILE B CD1 1 
ATOM   1484 N  N   . VAL B 1 108 ? 8.833  40.218  15.222 1.00 28.54 ? 83   VAL B N   1 
ATOM   1485 C  CA  . VAL B 1 108 ? 9.884  41.192  15.413 1.00 28.60 ? 83   VAL B CA  1 
ATOM   1486 C  C   . VAL B 1 108 ? 10.348 41.752  14.061 1.00 32.57 ? 83   VAL B C   1 
ATOM   1487 O  O   . VAL B 1 108 ? 10.849 42.878  13.989 1.00 32.81 ? 83   VAL B O   1 
ATOM   1488 C  CB  . VAL B 1 108 ? 10.975 40.632  16.338 1.00 26.41 ? 83   VAL B CB  1 
ATOM   1489 C  CG1 . VAL B 1 108 ? 11.972 39.760  15.644 1.00 26.53 ? 83   VAL B CG1 1 
ATOM   1490 C  CG2 . VAL B 1 108 ? 11.609 41.742  17.144 1.00 25.82 ? 83   VAL B CG2 1 
ATOM   1491 N  N   . ASP B 1 109 ? 10.153 40.975  12.980 1.00 33.06 ? 84   ASP B N   1 
ATOM   1492 C  CA  . ASP B 1 109 ? 10.383 41.446  11.632 1.00 34.79 ? 84   ASP B CA  1 
ATOM   1493 C  C   . ASP B 1 109 ? 9.332  42.450  11.205 1.00 34.82 ? 84   ASP B C   1 
ATOM   1494 O  O   . ASP B 1 109 ? 9.665  43.271  10.357 1.00 36.49 ? 84   ASP B O   1 
ATOM   1495 C  CB  . ASP B 1 109 ? 10.391 40.329  10.601 1.00 37.40 ? 84   ASP B CB  1 
ATOM   1496 C  CG  . ASP B 1 109 ? 11.732 39.649  10.403 1.00 41.65 ? 84   ASP B CG  1 
ATOM   1497 O  OD1 . ASP B 1 109 ? 12.767 40.242  10.726 1.00 45.61 ? 84   ASP B OD1 1 
ATOM   1498 O  OD2 . ASP B 1 109 ? 11.746 38.524  9.895  1.00 45.89 ? 84   ASP B OD2 1 
ATOM   1499 N  N   . ASP B 1 110 ? 8.101  42.430  11.753 1.00 33.73 ? 85   ASP B N   1 
ATOM   1500 C  CA  . ASP B 1 110 ? 7.134  43.501  11.551 1.00 32.67 ? 85   ASP B CA  1 
ATOM   1501 C  C   . ASP B 1 110 ? 7.527  44.753  12.304 1.00 31.61 ? 85   ASP B C   1 
ATOM   1502 O  O   . ASP B 1 110 ? 7.290  45.876  11.852 1.00 30.78 ? 85   ASP B O   1 
ATOM   1503 C  CB  . ASP B 1 110 ? 5.689  43.092  11.967 1.00 36.31 ? 85   ASP B CB  1 
ATOM   1504 C  CG  . ASP B 1 110 ? 4.984  42.012  11.146 1.00 36.50 ? 85   ASP B CG  1 
ATOM   1505 O  OD1 . ASP B 1 110 ? 5.491  41.708  10.065 1.00 34.52 ? 85   ASP B OD1 1 
ATOM   1506 O  OD2 . ASP B 1 110 ? 3.945  41.485  11.574 1.00 37.36 ? 85   ASP B OD2 1 
ATOM   1507 N  N   . LEU B 1 111 ? 8.151  44.567  13.473 1.00 31.94 ? 86   LEU B N   1 
ATOM   1508 C  CA  . LEU B 1 111 ? 8.695  45.686  14.241 1.00 29.00 ? 86   LEU B CA  1 
ATOM   1509 C  C   . LEU B 1 111 ? 9.945  46.335  13.646 1.00 27.01 ? 86   LEU B C   1 
ATOM   1510 O  O   . LEU B 1 111 ? 10.158 47.536  13.788 1.00 25.07 ? 86   LEU B O   1 
ATOM   1511 C  CB  . LEU B 1 111 ? 8.888  45.242  15.703 1.00 29.72 ? 86   LEU B CB  1 
ATOM   1512 C  CG  . LEU B 1 111 ? 7.630  44.973  16.544 1.00 29.69 ? 86   LEU B CG  1 
ATOM   1513 C  CD1 . LEU B 1 111 ? 7.934  44.246  17.825 1.00 29.68 ? 86   LEU B CD1 1 
ATOM   1514 C  CD2 . LEU B 1 111 ? 6.938  46.265  16.914 1.00 29.39 ? 86   LEU B CD2 1 
ATOM   1515 N  N   . VAL B 1 112 ? 10.774 45.550  12.962 1.00 26.28 ? 87   VAL B N   1 
ATOM   1516 C  CA  . VAL B 1 112 ? 11.895 46.068  12.214 1.00 29.27 ? 87   VAL B CA  1 
ATOM   1517 C  C   . VAL B 1 112 ? 11.333 47.009  11.163 1.00 32.65 ? 87   VAL B C   1 
ATOM   1518 O  O   . VAL B 1 112 ? 11.721 48.175  11.164 1.00 35.43 ? 87   VAL B O   1 
ATOM   1519 C  CB  . VAL B 1 112 ? 12.725 44.966  11.523 1.00 28.93 ? 87   VAL B CB  1 
ATOM   1520 C  CG1 . VAL B 1 112 ? 13.789 45.570  10.630 1.00 25.59 ? 87   VAL B CG1 1 
ATOM   1521 C  CG2 . VAL B 1 112 ? 13.417 44.036  12.521 1.00 30.50 ? 87   VAL B CG2 1 
ATOM   1522 N  N   . GLU B 1 113 ? 10.392 46.534  10.325 1.00 34.28 ? 88   GLU B N   1 
ATOM   1523 C  CA  . GLU B 1 113 ? 9.820  47.291  9.217  1.00 34.18 ? 88   GLU B CA  1 
ATOM   1524 C  C   . GLU B 1 113 ? 9.201  48.582  9.702  1.00 34.90 ? 88   GLU B C   1 
ATOM   1525 O  O   . GLU B 1 113 ? 9.505  49.640  9.178  1.00 35.08 ? 88   GLU B O   1 
ATOM   1526 C  CB  . GLU B 1 113 ? 8.789  46.446  8.468  1.00 34.62 ? 88   GLU B CB  1 
ATOM   1527 C  CG  . GLU B 1 113 ? 9.361  45.233  7.725  1.00 35.13 ? 88   GLU B CG  1 
ATOM   1528 C  CD  . GLU B 1 113 ? 8.360  44.218  7.145  1.00 37.81 ? 88   GLU B CD  1 
ATOM   1529 O  OE1 . GLU B 1 113 ? 7.241  44.088  7.653  1.00 39.42 ? 88   GLU B OE1 1 
ATOM   1530 O  OE2 . GLU B 1 113 ? 8.696  43.539  6.176  1.00 38.59 ? 88   GLU B OE2 1 
ATOM   1531 N  N   . CYS B 1 114 ? 8.402  48.520  10.754 1.00 37.74 ? 89   CYS B N   1 
ATOM   1532 C  CA  . CYS B 1 114 ? 7.803  49.680  11.378 1.00 41.43 ? 89   CYS B CA  1 
ATOM   1533 C  C   . CYS B 1 114 ? 8.798  50.685  11.934 1.00 43.62 ? 89   CYS B C   1 
ATOM   1534 O  O   . CYS B 1 114 ? 8.578  51.896  11.896 1.00 44.63 ? 89   CYS B O   1 
ATOM   1535 C  CB  . CYS B 1 114 ? 6.875  49.166  12.472 1.00 43.51 ? 89   CYS B CB  1 
ATOM   1536 S  SG  . CYS B 1 114 ? 6.538  50.326  13.821 1.00 52.54 ? 89   CYS B SG  1 
ATOM   1537 N  N   . VAL B 1 115 ? 9.907  50.205  12.473 1.00 45.45 ? 90   VAL B N   1 
ATOM   1538 C  CA  . VAL B 1 115 ? 10.919 51.096  13.007 1.00 48.36 ? 90   VAL B CA  1 
ATOM   1539 C  C   . VAL B 1 115 ? 11.787 51.723  11.909 1.00 49.57 ? 90   VAL B C   1 
ATOM   1540 O  O   . VAL B 1 115 ? 12.399 52.768  12.121 1.00 50.61 ? 90   VAL B O   1 
ATOM   1541 C  CB  . VAL B 1 115 ? 11.681 50.331  14.107 1.00 48.77 ? 90   VAL B CB  1 
ATOM   1542 C  CG1 . VAL B 1 115 ? 12.903 51.039  14.582 1.00 51.24 ? 90   VAL B CG1 1 
ATOM   1543 C  CG2 . VAL B 1 115 ? 10.793 50.256  15.316 1.00 48.76 ? 90   VAL B CG2 1 
ATOM   1544 N  N   . LYS B 1 116 ? 11.834 51.181  10.695 1.00 50.84 ? 91   LYS B N   1 
ATOM   1545 C  CA  . LYS B 1 116 ? 12.492 51.870  9.600  1.00 52.46 ? 91   LYS B CA  1 
ATOM   1546 C  C   . LYS B 1 116 ? 11.615 52.881  8.847  1.00 53.71 ? 91   LYS B C   1 
ATOM   1547 O  O   . LYS B 1 116 ? 12.139 53.730  8.127  1.00 52.07 ? 91   LYS B O   1 
ATOM   1548 C  CB  . LYS B 1 116 ? 13.135 50.840  8.721  1.00 54.00 ? 91   LYS B CB  1 
ATOM   1549 C  CG  . LYS B 1 116 ? 14.290 50.209  9.508  1.00 59.12 ? 91   LYS B CG  1 
ATOM   1550 C  CD  . LYS B 1 116 ? 14.955 49.089  8.690  1.00 63.16 ? 91   LYS B CD  1 
ATOM   1551 C  CE  . LYS B 1 116 ? 16.176 48.420  9.367  1.00 66.55 ? 91   LYS B CE  1 
ATOM   1552 N  NZ  . LYS B 1 116 ? 16.631 47.252  8.605  1.00 68.43 ? 91   LYS B NZ  1 
ATOM   1553 N  N   . GLU B 1 117 ? 10.283 52.858  9.066  1.00 56.63 ? 92   GLU B N   1 
ATOM   1554 C  CA  . GLU B 1 117 ? 9.333  53.861  8.565  1.00 59.16 ? 92   GLU B CA  1 
ATOM   1555 C  C   . GLU B 1 117 ? 9.366  55.130  9.381  1.00 60.82 ? 92   GLU B C   1 
ATOM   1556 O  O   . GLU B 1 117 ? 9.635  56.189  8.802  1.00 61.59 ? 92   GLU B O   1 
ATOM   1557 C  CB  . GLU B 1 117 ? 7.852  53.434  8.599  1.00 60.60 ? 92   GLU B CB  1 
ATOM   1558 C  CG  . GLU B 1 117 ? 7.388  52.228  7.784  1.00 63.20 ? 92   GLU B CG  1 
ATOM   1559 C  CD  . GLU B 1 117 ? 7.621  52.275  6.273  1.00 66.00 ? 92   GLU B CD  1 
ATOM   1560 O  OE1 . GLU B 1 117 ? 7.843  53.369  5.709  1.00 65.65 ? 92   GLU B OE1 1 
ATOM   1561 O  OE2 . GLU B 1 117 ? 7.564  51.187  5.667  1.00 67.41 ? 92   GLU B OE2 1 
ATOM   1562 N  N   . ASN B 1 118 ? 9.061  54.977  10.698 1.00 62.57 ? 93   ASN B N   1 
ATOM   1563 C  CA  . ASN B 1 118 ? 9.063  56.041  11.714 1.00 64.84 ? 93   ASN B CA  1 
ATOM   1564 C  C   . ASN B 1 118 ? 10.247 56.971  11.593 1.00 65.46 ? 93   ASN B C   1 
ATOM   1565 O  O   . ASN B 1 118 ? 11.368 56.721  12.018 1.00 65.03 ? 93   ASN B O   1 
ATOM   1566 C  CB  . ASN B 1 118 ? 9.069  55.511  13.153 1.00 63.55 ? 93   ASN B CB  1 
ATOM   1567 N  N   . SER B 1 119 ? 9.868  58.041  10.904 1.00 68.52 ? 94   SER B N   1 
ATOM   1568 C  CA  . SER B 1 119 ? 10.773 58.985  10.254 1.00 70.87 ? 94   SER B CA  1 
ATOM   1569 C  C   . SER B 1 119 ? 11.391 60.076  11.141 1.00 71.17 ? 94   SER B C   1 
ATOM   1570 O  O   . SER B 1 119 ? 12.292 60.821  10.689 1.00 72.46 ? 94   SER B O   1 
ATOM   1571 C  CB  . SER B 1 119 ? 10.028 59.573  9.039  1.00 71.38 ? 94   SER B CB  1 
ATOM   1572 O  OG  . SER B 1 119 ? 8.711  60.001  9.407  1.00 73.36 ? 94   SER B OG  1 
ATOM   1573 N  N   . SER B 1 120 ? 10.923 60.135  12.415 1.00 68.97 ? 95   SER B N   1 
ATOM   1574 C  CA  . SER B 1 120 ? 11.564 60.953  13.424 1.00 68.06 ? 95   SER B CA  1 
ATOM   1575 C  C   . SER B 1 120 ? 13.040 60.572  13.473 1.00 67.28 ? 95   SER B C   1 
ATOM   1576 O  O   . SER B 1 120 ? 13.457 59.458  13.839 1.00 64.89 ? 95   SER B O   1 
ATOM   1577 C  CB  . SER B 1 120 ? 10.932 60.795  14.794 1.00 68.06 ? 95   SER B CB  1 
ATOM   1578 O  OG  . SER B 1 120 ? 11.441 61.800  15.670 1.00 69.36 ? 95   SER B OG  1 
ATOM   1579 N  N   . LYS B 1 121 ? 13.755 61.565  12.916 1.00 66.92 ? 96   LYS B N   1 
ATOM   1580 C  CA  . LYS B 1 121 ? 15.199 61.518  12.771 1.00 67.27 ? 96   LYS B CA  1 
ATOM   1581 C  C   . LYS B 1 121 ? 15.848 60.974  14.056 1.00 66.10 ? 96   LYS B C   1 
ATOM   1582 O  O   . LYS B 1 121 ? 16.615 59.996  14.014 1.00 64.46 ? 96   LYS B O   1 
ATOM   1583 C  CB  . LYS B 1 121 ? 15.699 62.948  12.478 1.00 67.07 ? 96   LYS B CB  1 
ATOM   1584 N  N   . ASP B 1 122 ? 15.289 61.560  15.147 1.00 64.54 ? 97   ASP B N   1 
ATOM   1585 C  CA  . ASP B 1 122 ? 15.657 61.369  16.562 1.00 62.82 ? 97   ASP B CA  1 
ATOM   1586 C  C   . ASP B 1 122 ? 15.739 59.968  17.239 1.00 60.00 ? 97   ASP B C   1 
ATOM   1587 O  O   . ASP B 1 122 ? 16.792 59.674  17.852 1.00 59.90 ? 97   ASP B O   1 
ATOM   1588 C  CB  . ASP B 1 122 ? 14.689 62.230  17.394 1.00 63.85 ? 97   ASP B CB  1 
ATOM   1589 N  N   . LEU B 1 123 ? 14.638 59.137  17.174 1.00 53.67 ? 98   LEU B N   1 
ATOM   1590 C  CA  . LEU B 1 123 ? 14.641 57.690  17.447 1.00 44.35 ? 98   LEU B CA  1 
ATOM   1591 C  C   . LEU B 1 123 ? 15.837 57.135  16.728 1.00 40.32 ? 98   LEU B C   1 
ATOM   1592 O  O   . LEU B 1 123 ? 15.868 57.109  15.497 1.00 40.10 ? 98   LEU B O   1 
ATOM   1593 C  CB  . LEU B 1 123 ? 13.389 56.996  16.916 1.00 41.21 ? 98   LEU B CB  1 
ATOM   1594 C  CG  . LEU B 1 123 ? 13.251 55.479  17.095 1.00 40.48 ? 98   LEU B CG  1 
ATOM   1595 C  CD1 . LEU B 1 123 ? 11.904 55.030  17.695 1.00 39.61 ? 98   LEU B CD1 1 
ATOM   1596 C  CD2 . LEU B 1 123 ? 13.519 54.787  15.784 1.00 37.90 ? 98   LEU B CD2 1 
ATOM   1597 N  N   . LYS B 1 124 ? 16.815 56.840  17.593 1.00 36.84 ? 99   LYS B N   1 
ATOM   1598 C  CA  . LYS B 1 124 ? 18.171 56.457  17.229 1.00 35.08 ? 99   LYS B CA  1 
ATOM   1599 C  C   . LYS B 1 124 ? 18.141 55.218  16.365 1.00 34.40 ? 99   LYS B C   1 
ATOM   1600 O  O   . LYS B 1 124 ? 17.600 54.164  16.712 1.00 34.91 ? 99   LYS B O   1 
ATOM   1601 C  CB  . LYS B 1 124 ? 19.028 56.193  18.485 1.00 35.16 ? 99   LYS B CB  1 
ATOM   1602 C  CG  . LYS B 1 124 ? 20.550 56.058  18.286 1.00 37.24 ? 99   LYS B CG  1 
ATOM   1603 C  CD  . LYS B 1 124 ? 21.314 55.641  19.556 1.00 36.33 ? 99   LYS B CD  1 
ATOM   1604 C  CE  . LYS B 1 124 ? 22.817 55.994  19.594 1.00 38.98 ? 99   LYS B CE  1 
ATOM   1605 N  NZ  . LYS B 1 124 ? 23.617 55.657  18.428 1.00 38.67 ? 99   LYS B NZ  1 
ATOM   1606 N  N   . LYS B 1 125 ? 18.689 55.387  15.174 1.00 34.28 ? 100  LYS B N   1 
ATOM   1607 C  CA  . LYS B 1 125 ? 18.726 54.285  14.232 1.00 34.35 ? 100  LYS B CA  1 
ATOM   1608 C  C   . LYS B 1 125 ? 20.147 53.964  13.811 1.00 31.26 ? 100  LYS B C   1 
ATOM   1609 O  O   . LYS B 1 125 ? 20.368 52.917  13.224 1.00 32.09 ? 100  LYS B O   1 
ATOM   1610 C  CB  . LYS B 1 125 ? 17.832 54.592  13.044 1.00 36.01 ? 100  LYS B CB  1 
ATOM   1611 C  CG  . LYS B 1 125 ? 16.335 54.635  13.349 1.00 38.72 ? 100  LYS B CG  1 
ATOM   1612 C  CD  . LYS B 1 125 ? 15.782 55.851  12.617 1.00 43.22 ? 100  LYS B CD  1 
ATOM   1613 C  CE  . LYS B 1 125 ? 14.290 55.723  12.370 1.00 43.50 ? 100  LYS B CE  1 
ATOM   1614 N  NZ  . LYS B 1 125 ? 13.982 55.990  10.969 1.00 43.57 ? 100  LYS B NZ  1 
ATOM   1615 N  N   . SER B 1 126 ? 21.120 54.814  14.159 1.00 29.00 ? 101  SER B N   1 
ATOM   1616 C  CA  . SER B 1 126 ? 22.529 54.614  13.871 1.00 28.55 ? 101  SER B CA  1 
ATOM   1617 C  C   . SER B 1 126 ? 23.351 54.047  15.032 1.00 28.24 ? 101  SER B C   1 
ATOM   1618 O  O   . SER B 1 126 ? 23.732 54.783  15.943 1.00 31.98 ? 101  SER B O   1 
ATOM   1619 C  CB  . SER B 1 126 ? 23.049 55.977  13.473 1.00 27.88 ? 101  SER B CB  1 
ATOM   1620 O  OG  . SER B 1 126 ? 24.459 55.979  13.457 1.00 27.09 ? 101  SER B OG  1 
ATOM   1621 N  N   . PHE B 1 127 ? 23.680 52.766  15.077 1.00 27.56 ? 102  PHE B N   1 
ATOM   1622 C  CA  . PHE B 1 127 ? 24.364 52.184  16.230 1.00 27.12 ? 102  PHE B CA  1 
ATOM   1623 C  C   . PHE B 1 127 ? 25.620 51.495  15.755 1.00 28.99 ? 102  PHE B C   1 
ATOM   1624 O  O   . PHE B 1 127 ? 25.613 51.001  14.627 1.00 28.31 ? 102  PHE B O   1 
ATOM   1625 C  CB  . PHE B 1 127 ? 23.538 51.127  16.945 1.00 22.35 ? 102  PHE B CB  1 
ATOM   1626 C  CG  . PHE B 1 127 ? 22.247 51.672  17.462 1.00 20.73 ? 102  PHE B CG  1 
ATOM   1627 C  CD1 . PHE B 1 127 ? 21.206 51.877  16.608 1.00 22.70 ? 102  PHE B CD1 1 
ATOM   1628 C  CD2 . PHE B 1 127 ? 22.105 51.932  18.801 1.00 24.01 ? 102  PHE B CD2 1 
ATOM   1629 C  CE1 . PHE B 1 127 ? 20.007 52.325  17.098 1.00 23.86 ? 102  PHE B CE1 1 
ATOM   1630 C  CE2 . PHE B 1 127 ? 20.892 52.343  19.295 1.00 23.54 ? 102  PHE B CE2 1 
ATOM   1631 C  CZ  . PHE B 1 127 ? 19.837 52.536  18.435 1.00 23.17 ? 102  PHE B CZ  1 
ATOM   1632 N  N   . LYS B 1 128 ? 26.691 51.459  16.575 1.00 30.21 ? 103  LYS B N   1 
ATOM   1633 C  CA  . LYS B 1 128 ? 27.823 50.595  16.284 1.00 30.86 ? 103  LYS B CA  1 
ATOM   1634 C  C   . LYS B 1 128 ? 27.374 49.171  16.550 1.00 32.14 ? 103  LYS B C   1 
ATOM   1635 O  O   . LYS B 1 128 ? 26.583 48.957  17.472 1.00 33.74 ? 103  LYS B O   1 
ATOM   1636 C  CB  . LYS B 1 128 ? 28.965 50.952  17.200 1.00 32.77 ? 103  LYS B CB  1 
ATOM   1637 N  N   . SER B 1 129 ? 27.788 48.202  15.720 1.00 32.95 ? 104  SER B N   1 
ATOM   1638 C  CA  . SER B 1 129 ? 27.284 46.825  15.805 1.00 33.85 ? 104  SER B CA  1 
ATOM   1639 C  C   . SER B 1 129 ? 27.695 46.249  17.145 1.00 31.14 ? 104  SER B C   1 
ATOM   1640 O  O   . SER B 1 129 ? 28.891 46.121  17.418 1.00 32.16 ? 104  SER B O   1 
ATOM   1641 C  CB  . SER B 1 129 ? 27.812 45.908  14.692 1.00 36.29 ? 104  SER B CB  1 
ATOM   1642 O  OG  . SER B 1 129 ? 28.690 46.589  13.784 1.00 44.97 ? 104  SER B OG  1 
ATOM   1643 N  N   . PRO B 1 130 ? 26.737 45.950  18.023 1.00 28.62 ? 105  PRO B N   1 
ATOM   1644 C  CA  . PRO B 1 130 ? 27.026 45.601  19.393 1.00 27.39 ? 105  PRO B CA  1 
ATOM   1645 C  C   . PRO B 1 130 ? 27.816 44.315  19.472 1.00 26.85 ? 105  PRO B C   1 
ATOM   1646 O  O   . PRO B 1 130 ? 27.947 43.532  18.527 1.00 29.04 ? 105  PRO B O   1 
ATOM   1647 C  CB  . PRO B 1 130 ? 25.668 45.476  19.982 1.00 26.67 ? 105  PRO B CB  1 
ATOM   1648 C  CG  . PRO B 1 130 ? 24.803 46.313  19.104 1.00 26.85 ? 105  PRO B CG  1 
ATOM   1649 C  CD  . PRO B 1 130 ? 25.308 45.910  17.747 1.00 26.48 ? 105  PRO B CD  1 
ATOM   1650 N  N   . GLU B 1 131 ? 28.426 44.160  20.628 1.00 27.12 ? 106  GLU B N   1 
ATOM   1651 C  CA  . GLU B 1 131 ? 29.240 42.982  20.897 1.00 27.97 ? 106  GLU B CA  1 
ATOM   1652 C  C   . GLU B 1 131 ? 28.299 41.806  21.172 1.00 25.13 ? 106  GLU B C   1 
ATOM   1653 O  O   . GLU B 1 131 ? 27.294 41.966  21.870 1.00 21.99 ? 106  GLU B O   1 
ATOM   1654 C  CB  . GLU B 1 131 ? 30.140 43.258  22.105 1.00 30.05 ? 106  GLU B CB  1 
ATOM   1655 C  CG  . GLU B 1 131 ? 31.418 42.451  22.220 1.00 35.47 ? 106  GLU B CG  1 
ATOM   1656 C  CD  . GLU B 1 131 ? 32.045 42.483  23.613 1.00 40.01 ? 106  GLU B CD  1 
ATOM   1657 O  OE1 . GLU B 1 131 ? 32.162 43.570  24.198 1.00 41.10 ? 106  GLU B OE1 1 
ATOM   1658 O  OE2 . GLU B 1 131 ? 32.431 41.409  24.102 1.00 42.35 ? 106  GLU B OE2 1 
ATOM   1659 N  N   . PRO B 1 132 ? 28.564 40.640  20.578 1.00 23.74 ? 107  PRO B N   1 
ATOM   1660 C  CA  . PRO B 1 132 ? 27.806 39.423  20.817 1.00 24.07 ? 107  PRO B CA  1 
ATOM   1661 C  C   . PRO B 1 132 ? 27.906 38.967  22.264 1.00 22.95 ? 107  PRO B C   1 
ATOM   1662 O  O   . PRO B 1 132 ? 28.989 38.920  22.832 1.00 24.47 ? 107  PRO B O   1 
ATOM   1663 C  CB  . PRO B 1 132 ? 28.437 38.439  19.837 1.00 24.75 ? 107  PRO B CB  1 
ATOM   1664 C  CG  . PRO B 1 132 ? 28.949 39.309  18.715 1.00 25.17 ? 107  PRO B CG  1 
ATOM   1665 C  CD  . PRO B 1 132 ? 29.556 40.448  19.512 1.00 24.46 ? 107  PRO B CD  1 
ATOM   1666 N  N   . ARG B 1 133 ? 26.765 38.677  22.884 1.00 22.39 ? 108  ARG B N   1 
ATOM   1667 C  CA  . ARG B 1 133 ? 26.684 38.164  24.239 1.00 20.57 ? 108  ARG B CA  1 
ATOM   1668 C  C   . ARG B 1 133 ? 25.904 36.865  24.227 1.00 17.43 ? 108  ARG B C   1 
ATOM   1669 O  O   . ARG B 1 133 ? 24.954 36.685  23.488 1.00 17.22 ? 108  ARG B O   1 
ATOM   1670 C  CB  . ARG B 1 133 ? 26.064 39.155  25.256 1.00 20.10 ? 108  ARG B CB  1 
ATOM   1671 C  CG  . ARG B 1 133 ? 27.007 40.157  25.848 1.00 21.68 ? 108  ARG B CG  1 
ATOM   1672 C  CD  . ARG B 1 133 ? 26.321 41.144  26.778 1.00 25.69 ? 108  ARG B CD  1 
ATOM   1673 N  NE  . ARG B 1 133 ? 25.859 40.576  28.047 1.00 27.65 ? 108  ARG B NE  1 
ATOM   1674 C  CZ  . ARG B 1 133 ? 25.517 41.345  29.084 1.00 26.15 ? 108  ARG B CZ  1 
ATOM   1675 N  NH1 . ARG B 1 133 ? 25.637 42.653  29.004 1.00 26.98 ? 108  ARG B NH1 1 
ATOM   1676 N  NH2 . ARG B 1 133 ? 25.031 40.819  30.217 1.00 27.28 ? 108  ARG B NH2 1 
ATOM   1677 N  N   . LEU B 1 134 ? 26.320 35.964  25.078 1.00 16.44 ? 109  LEU B N   1 
ATOM   1678 C  CA  . LEU B 1 134 ? 25.649 34.700  25.242 1.00 19.58 ? 109  LEU B CA  1 
ATOM   1679 C  C   . LEU B 1 134 ? 24.667 34.827  26.384 1.00 19.57 ? 109  LEU B C   1 
ATOM   1680 O  O   . LEU B 1 134 ? 24.963 35.423  27.418 1.00 21.90 ? 109  LEU B O   1 
ATOM   1681 C  CB  . LEU B 1 134 ? 26.626 33.555  25.533 1.00 18.89 ? 109  LEU B CB  1 
ATOM   1682 C  CG  . LEU B 1 134 ? 27.661 33.129  24.491 1.00 20.14 ? 109  LEU B CG  1 
ATOM   1683 C  CD1 . LEU B 1 134 ? 28.673 32.188  25.119 1.00 18.71 ? 109  LEU B CD1 1 
ATOM   1684 C  CD2 . LEU B 1 134 ? 26.985 32.436  23.316 1.00 22.74 ? 109  LEU B CD2 1 
ATOM   1685 N  N   . PHE B 1 135 ? 23.477 34.293  26.119 1.00 19.30 ? 110  PHE B N   1 
ATOM   1686 C  CA  . PHE B 1 135 ? 22.372 34.322  27.050 1.00 18.85 ? 110  PHE B CA  1 
ATOM   1687 C  C   . PHE B 1 135 ? 21.748 32.939  27.188 1.00 19.38 ? 110  PHE B C   1 
ATOM   1688 O  O   . PHE B 1 135 ? 21.676 32.205  26.207 1.00 18.43 ? 110  PHE B O   1 
ATOM   1689 C  CB  . PHE B 1 135 ? 21.312 35.298  26.553 1.00 17.38 ? 110  PHE B CB  1 
ATOM   1690 C  CG  . PHE B 1 135 ? 21.743 36.756  26.567 1.00 19.20 ? 110  PHE B CG  1 
ATOM   1691 C  CD1 . PHE B 1 135 ? 21.733 37.487  27.744 1.00 20.10 ? 110  PHE B CD1 1 
ATOM   1692 C  CD2 . PHE B 1 135 ? 22.198 37.350  25.408 1.00 19.07 ? 110  PHE B CD2 1 
ATOM   1693 C  CE1 . PHE B 1 135 ? 22.211 38.788  27.755 1.00 19.86 ? 110  PHE B CE1 1 
ATOM   1694 C  CE2 . PHE B 1 135 ? 22.643 38.650  25.436 1.00 15.79 ? 110  PHE B CE2 1 
ATOM   1695 C  CZ  . PHE B 1 135 ? 22.659 39.367  26.596 1.00 17.86 ? 110  PHE B CZ  1 
ATOM   1696 N  N   . THR B 1 136 ? 21.246 32.547  28.376 1.00 18.40 ? 111  THR B N   1 
ATOM   1697 C  CA  . THR B 1 136 ? 20.431 31.336  28.505 1.00 14.95 ? 111  THR B CA  1 
ATOM   1698 C  C   . THR B 1 136 ? 19.077 31.537  27.823 1.00 14.86 ? 111  THR B C   1 
ATOM   1699 O  O   . THR B 1 136 ? 18.720 32.705  27.696 1.00 18.62 ? 111  THR B O   1 
ATOM   1700 C  CB  . THR B 1 136 ? 20.254 30.986  30.016 1.00 10.83 ? 111  THR B CB  1 
ATOM   1701 O  OG1 . THR B 1 136 ? 19.440 32.008  30.536 1.00 14.68 ? 111  THR B OG1 1 
ATOM   1702 C  CG2 . THR B 1 136 ? 21.520 31.006  30.845 1.00 11.33 ? 111  THR B CG2 1 
ATOM   1703 N  N   . PRO B 1 137 ? 18.205 30.602  27.418 1.00 14.14 ? 112  PRO B N   1 
ATOM   1704 C  CA  . PRO B 1 137 ? 16.903 30.899  26.832 1.00 12.85 ? 112  PRO B CA  1 
ATOM   1705 C  C   . PRO B 1 137 ? 16.055 31.789  27.714 1.00 15.00 ? 112  PRO B C   1 
ATOM   1706 O  O   . PRO B 1 137 ? 15.351 32.679  27.268 1.00 16.67 ? 112  PRO B O   1 
ATOM   1707 C  CB  . PRO B 1 137 ? 16.297 29.536  26.730 1.00 13.18 ? 112  PRO B CB  1 
ATOM   1708 C  CG  . PRO B 1 137 ? 17.459 28.689  26.406 1.00 11.71 ? 112  PRO B CG  1 
ATOM   1709 C  CD  . PRO B 1 137 ? 18.482 29.179  27.402 1.00 12.63 ? 112  PRO B CD  1 
ATOM   1710 N  N   . GLU B 1 138 ? 16.103 31.597  29.015 1.00 17.42 ? 113  GLU B N   1 
ATOM   1711 C  CA  . GLU B 1 138 ? 15.375 32.431  29.945 1.00 19.68 ? 113  GLU B CA  1 
ATOM   1712 C  C   . GLU B 1 138 ? 15.802 33.888  29.901 1.00 18.59 ? 113  GLU B C   1 
ATOM   1713 O  O   . GLU B 1 138 ? 14.931 34.751  29.885 1.00 21.48 ? 113  GLU B O   1 
ATOM   1714 C  CB  . GLU B 1 138 ? 15.546 31.841  31.328 1.00 22.92 ? 113  GLU B CB  1 
ATOM   1715 C  CG  . GLU B 1 138 ? 14.984 32.707  32.439 1.00 32.95 ? 113  GLU B CG  1 
ATOM   1716 C  CD  . GLU B 1 138 ? 15.763 32.704  33.770 1.00 39.93 ? 113  GLU B CD  1 
ATOM   1717 O  OE1 . GLU B 1 138 ? 16.869 33.281  33.900 1.00 41.39 ? 113  GLU B OE1 1 
ATOM   1718 O  OE2 . GLU B 1 138 ? 15.193 32.144  34.712 1.00 44.90 ? 113  GLU B OE2 1 
ATOM   1719 N  N   . GLU B 1 139 ? 17.096 34.210  29.885 1.00 18.49 ? 114  GLU B N   1 
ATOM   1720 C  CA  . GLU B 1 139 ? 17.601 35.576  29.760 1.00 17.43 ? 114  GLU B CA  1 
ATOM   1721 C  C   . GLU B 1 139 ? 17.321 36.289  28.451 1.00 16.60 ? 114  GLU B C   1 
ATOM   1722 O  O   . GLU B 1 139 ? 16.910 37.449  28.404 1.00 19.48 ? 114  GLU B O   1 
ATOM   1723 C  CB  . GLU B 1 139 ? 19.090 35.543  29.980 1.00 19.55 ? 114  GLU B CB  1 
ATOM   1724 C  CG  . GLU B 1 139 ? 19.486 35.319  31.442 1.00 23.40 ? 114  GLU B CG  1 
ATOM   1725 C  CD  . GLU B 1 139 ? 20.962 35.034  31.718 1.00 25.98 ? 114  GLU B CD  1 
ATOM   1726 O  OE1 . GLU B 1 139 ? 21.730 34.826  30.765 1.00 25.41 ? 114  GLU B OE1 1 
ATOM   1727 O  OE2 . GLU B 1 139 ? 21.322 34.982  32.906 1.00 28.77 ? 114  GLU B OE2 1 
ATOM   1728 N  N   . PHE B 1 140 ? 17.507 35.551  27.379 1.00 14.86 ? 115  PHE B N   1 
ATOM   1729 C  CA  . PHE B 1 140 ? 17.212 35.998  26.023 1.00 15.76 ? 115  PHE B CA  1 
ATOM   1730 C  C   . PHE B 1 140 ? 15.776 36.422  25.843 1.00 14.74 ? 115  PHE B C   1 
ATOM   1731 O  O   . PHE B 1 140 ? 15.474 37.469  25.295 1.00 16.04 ? 115  PHE B O   1 
ATOM   1732 C  CB  . PHE B 1 140 ? 17.513 34.865  25.012 1.00 14.37 ? 115  PHE B CB  1 
ATOM   1733 C  CG  . PHE B 1 140 ? 17.384 35.323  23.572 1.00 16.76 ? 115  PHE B CG  1 
ATOM   1734 C  CD1 . PHE B 1 140 ? 18.400 36.062  22.990 1.00 15.08 ? 115  PHE B CD1 1 
ATOM   1735 C  CD2 . PHE B 1 140 ? 16.217 35.063  22.881 1.00 16.51 ? 115  PHE B CD2 1 
ATOM   1736 C  CE1 . PHE B 1 140 ? 18.169 36.611  21.755 1.00 15.92 ? 115  PHE B CE1 1 
ATOM   1737 C  CE2 . PHE B 1 140 ? 16.024 35.579  21.619 1.00 13.36 ? 115  PHE B CE2 1 
ATOM   1738 C  CZ  . PHE B 1 140 ? 16.994 36.364  21.079 1.00 14.28 ? 115  PHE B CZ  1 
ATOM   1739 N  N   . PHE B 1 141 ? 14.897 35.549  26.284 1.00 15.61 ? 116  PHE B N   1 
ATOM   1740 C  CA  . PHE B 1 141 ? 13.497 35.810  26.150 1.00 15.94 ? 116  PHE B CA  1 
ATOM   1741 C  C   . PHE B 1 141 ? 12.918 36.798  27.125 1.00 16.92 ? 116  PHE B C   1 
ATOM   1742 O  O   . PHE B 1 141 ? 11.842 37.326  26.862 1.00 18.97 ? 116  PHE B O   1 
ATOM   1743 C  CB  . PHE B 1 141 ? 12.759 34.499  26.111 1.00 16.90 ? 116  PHE B CB  1 
ATOM   1744 C  CG  . PHE B 1 141 ? 12.962 33.796  24.776 1.00 16.87 ? 116  PHE B CG  1 
ATOM   1745 C  CD1 . PHE B 1 141 ? 12.315 34.278  23.639 1.00 16.00 ? 116  PHE B CD1 1 
ATOM   1746 C  CD2 . PHE B 1 141 ? 13.830 32.714  24.689 1.00 17.13 ? 116  PHE B CD2 1 
ATOM   1747 C  CE1 . PHE B 1 141 ? 12.558 33.654  22.429 1.00 17.64 ? 116  PHE B CE1 1 
ATOM   1748 C  CE2 . PHE B 1 141 ? 14.079 32.114  23.482 1.00 16.31 ? 116  PHE B CE2 1 
ATOM   1749 C  CZ  . PHE B 1 141 ? 13.427 32.582  22.349 1.00 17.77 ? 116  PHE B CZ  1 
ATOM   1750 N  N   . ARG B 1 142 ? 13.629 37.094  28.208 1.00 17.01 ? 117  ARG B N   1 
ATOM   1751 C  CA  . ARG B 1 142 ? 13.292 38.189  29.085 1.00 18.94 ? 117  ARG B CA  1 
ATOM   1752 C  C   . ARG B 1 142 ? 13.636 39.492  28.388 1.00 20.76 ? 117  ARG B C   1 
ATOM   1753 O  O   . ARG B 1 142 ? 12.988 40.526  28.561 1.00 21.80 ? 117  ARG B O   1 
ATOM   1754 C  CB  . ARG B 1 142 ? 14.124 38.043  30.361 1.00 22.28 ? 117  ARG B CB  1 
ATOM   1755 C  CG  . ARG B 1 142 ? 13.889 39.003  31.538 1.00 29.21 ? 117  ARG B CG  1 
ATOM   1756 C  CD  . ARG B 1 142 ? 13.292 38.359  32.834 1.00 35.23 ? 117  ARG B CD  1 
ATOM   1757 N  NE  . ARG B 1 142 ? 14.094 37.253  33.357 1.00 37.19 ? 117  ARG B NE  1 
ATOM   1758 C  CZ  . ARG B 1 142 ? 15.408 37.373  33.616 1.00 42.10 ? 117  ARG B CZ  1 
ATOM   1759 N  NH1 . ARG B 1 142 ? 16.023 38.568  33.647 1.00 45.58 ? 117  ARG B NH1 1 
ATOM   1760 N  NH2 . ARG B 1 142 ? 16.151 36.268  33.794 1.00 43.18 ? 117  ARG B NH2 1 
ATOM   1761 N  N   . ILE B 1 143 ? 14.709 39.453  27.596 1.00 20.97 ? 118  ILE B N   1 
ATOM   1762 C  CA  . ILE B 1 143 ? 15.078 40.588  26.807 1.00 18.77 ? 118  ILE B CA  1 
ATOM   1763 C  C   . ILE B 1 143 ? 14.103 40.799  25.662 1.00 20.54 ? 118  ILE B C   1 
ATOM   1764 O  O   . ILE B 1 143 ? 13.592 41.896  25.487 1.00 20.49 ? 118  ILE B O   1 
ATOM   1765 C  CB  . ILE B 1 143 ? 16.498 40.364  26.385 1.00 16.96 ? 118  ILE B CB  1 
ATOM   1766 C  CG1 . ILE B 1 143 ? 17.377 40.504  27.587 1.00 12.82 ? 118  ILE B CG1 1 
ATOM   1767 C  CG2 . ILE B 1 143 ? 16.892 41.347  25.310 1.00 15.77 ? 118  ILE B CG2 1 
ATOM   1768 C  CD1 . ILE B 1 143 ? 18.851 40.271  27.253 1.00 14.00 ? 118  ILE B CD1 1 
ATOM   1769 N  N   . PHE B 1 144 ? 13.817 39.736  24.922 1.00 22.16 ? 119  PHE B N   1 
ATOM   1770 C  CA  . PHE B 1 144 ? 12.840 39.717  23.864 1.00 23.96 ? 119  PHE B CA  1 
ATOM   1771 C  C   . PHE B 1 144 ? 11.528 40.271  24.356 1.00 26.51 ? 119  PHE B C   1 
ATOM   1772 O  O   . PHE B 1 144 ? 10.934 41.093  23.674 1.00 29.24 ? 119  PHE B O   1 
ATOM   1773 C  CB  . PHE B 1 144 ? 12.660 38.299  23.364 1.00 22.84 ? 119  PHE B CB  1 
ATOM   1774 C  CG  . PHE B 1 144 ? 11.555 38.173  22.327 1.00 24.88 ? 119  PHE B CG  1 
ATOM   1775 C  CD1 . PHE B 1 144 ? 11.811 38.512  21.006 1.00 25.69 ? 119  PHE B CD1 1 
ATOM   1776 C  CD2 . PHE B 1 144 ? 10.271 37.803  22.727 1.00 24.94 ? 119  PHE B CD2 1 
ATOM   1777 C  CE1 . PHE B 1 144 ? 10.748 38.539  20.122 1.00 25.07 ? 119  PHE B CE1 1 
ATOM   1778 C  CE2 . PHE B 1 144 ? 9.216  37.831  21.844 1.00 24.69 ? 119  PHE B CE2 1 
ATOM   1779 C  CZ  . PHE B 1 144 ? 9.465  38.212  20.539 1.00 25.22 ? 119  PHE B CZ  1 
ATOM   1780 N  N   . ASN B 1 145 ? 11.076 39.898  25.540 1.00 29.22 ? 120  ASN B N   1 
ATOM   1781 C  CA  . ASN B 1 145 ? 9.863  40.470  26.094 1.00 31.04 ? 120  ASN B CA  1 
ATOM   1782 C  C   . ASN B 1 145 ? 9.953  41.939  26.499 1.00 32.79 ? 120  ASN B C   1 
ATOM   1783 O  O   . ASN B 1 145 ? 9.018  42.684  26.204 1.00 34.41 ? 120  ASN B O   1 
ATOM   1784 C  CB  . ASN B 1 145 ? 9.343  39.640  27.253 1.00 29.44 ? 120  ASN B CB  1 
ATOM   1785 C  CG  . ASN B 1 145 ? 8.856  38.301  26.738 1.00 33.04 ? 120  ASN B CG  1 
ATOM   1786 O  OD1 . ASN B 1 145 ? 8.264  38.216  25.651 1.00 32.93 ? 120  ASN B OD1 1 
ATOM   1787 N  ND2 . ASN B 1 145 ? 9.110  37.237  27.508 1.00 31.91 ? 120  ASN B ND2 1 
ATOM   1788 N  N   . ARG B 1 146 ? 11.018 42.436  27.140 1.00 32.47 ? 121  ARG B N   1 
ATOM   1789 C  CA  . ARG B 1 146 ? 11.117 43.849  27.465 1.00 30.92 ? 121  ARG B CA  1 
ATOM   1790 C  C   . ARG B 1 146 ? 11.067 44.709  26.204 1.00 29.78 ? 121  ARG B C   1 
ATOM   1791 O  O   . ARG B 1 146 ? 10.444 45.760  26.207 1.00 28.95 ? 121  ARG B O   1 
ATOM   1792 C  CB  . ARG B 1 146 ? 12.391 44.075  28.271 1.00 33.61 ? 121  ARG B CB  1 
ATOM   1793 C  CG  . ARG B 1 146 ? 12.655 45.523  28.664 1.00 41.90 ? 121  ARG B CG  1 
ATOM   1794 C  CD  . ARG B 1 146 ? 11.463 46.261  29.336 1.00 48.78 ? 121  ARG B CD  1 
ATOM   1795 N  NE  . ARG B 1 146 ? 11.048 47.453  28.567 1.00 55.93 ? 121  ARG B NE  1 
ATOM   1796 C  CZ  . ARG B 1 146 ? 11.568 48.694  28.762 1.00 59.13 ? 121  ARG B CZ  1 
ATOM   1797 N  NH1 . ARG B 1 146 ? 12.543 48.894  29.659 1.00 60.86 ? 121  ARG B NH1 1 
ATOM   1798 N  NH2 . ARG B 1 146 ? 11.124 49.767  28.074 1.00 60.62 ? 121  ARG B NH2 1 
ATOM   1799 N  N   . SER B 1 147 ? 11.680 44.225  25.121 1.00 29.04 ? 122  SER B N   1 
ATOM   1800 C  CA  . SER B 1 147 ? 11.818 44.920  23.854 1.00 27.66 ? 122  SER B CA  1 
ATOM   1801 C  C   . SER B 1 147 ? 10.512 45.006  23.126 1.00 29.01 ? 122  SER B C   1 
ATOM   1802 O  O   . SER B 1 147 ? 10.198 46.085  22.634 1.00 30.77 ? 122  SER B O   1 
ATOM   1803 C  CB  . SER B 1 147 ? 12.808 44.195  22.954 1.00 24.91 ? 122  SER B CB  1 
ATOM   1804 O  OG  . SER B 1 147 ? 14.125 44.237  23.464 1.00 21.03 ? 122  SER B OG  1 
ATOM   1805 N  N   . ILE B 1 148 ? 9.765  43.896  23.061 1.00 30.73 ? 123  ILE B N   1 
ATOM   1806 C  CA  . ILE B 1 148 ? 8.427  43.886  22.488 1.00 33.96 ? 123  ILE B CA  1 
ATOM   1807 C  C   . ILE B 1 148 ? 7.513  44.857  23.232 1.00 38.09 ? 123  ILE B C   1 
ATOM   1808 O  O   . ILE B 1 148 ? 6.743  45.579  22.610 1.00 38.61 ? 123  ILE B O   1 
ATOM   1809 C  CB  . ILE B 1 148 ? 7.863  42.445  22.513 1.00 33.36 ? 123  ILE B CB  1 
ATOM   1810 C  CG1 . ILE B 1 148 ? 8.567  41.492  21.559 1.00 33.77 ? 123  ILE B CG1 1 
ATOM   1811 C  CG2 . ILE B 1 148 ? 6.385  42.334  22.276 1.00 35.01 ? 123  ILE B CG2 1 
ATOM   1812 C  CD1 . ILE B 1 148 ? 8.539  41.729  20.058 1.00 31.14 ? 123  ILE B CD1 1 
ATOM   1813 N  N   . ASP B 1 149 ? 7.638  44.925  24.562 1.00 42.48 ? 124  ASP B N   1 
ATOM   1814 C  CA  . ASP B 1 149 ? 6.868  45.809  25.424 1.00 45.69 ? 124  ASP B CA  1 
ATOM   1815 C  C   . ASP B 1 149 ? 7.347  47.237  25.404 1.00 45.68 ? 124  ASP B C   1 
ATOM   1816 O  O   . ASP B 1 149 ? 6.592  48.118  25.836 1.00 46.88 ? 124  ASP B O   1 
ATOM   1817 C  CB  . ASP B 1 149 ? 6.915  45.381  26.912 1.00 50.45 ? 124  ASP B CB  1 
ATOM   1818 C  CG  . ASP B 1 149 ? 6.483  43.950  27.274 1.00 56.00 ? 124  ASP B CG  1 
ATOM   1819 O  OD1 . ASP B 1 149 ? 5.766  43.310  26.481 1.00 61.21 ? 124  ASP B OD1 1 
ATOM   1820 O  OD2 . ASP B 1 149 ? 6.883  43.461  28.344 1.00 56.72 ? 124  ASP B OD2 1 
ATOM   1821 N  N   . ALA B 1 150 ? 8.599  47.461  24.970 1.00 46.60 ? 125  ALA B N   1 
ATOM   1822 C  CA  . ALA B 1 150 ? 9.190  48.801  24.903 1.00 47.64 ? 125  ALA B CA  1 
ATOM   1823 C  C   . ALA B 1 150 ? 8.420  49.664  23.926 1.00 48.60 ? 125  ALA B C   1 
ATOM   1824 O  O   . ALA B 1 150 ? 8.412  50.882  24.081 1.00 48.65 ? 125  ALA B O   1 
ATOM   1825 C  CB  . ALA B 1 150 ? 10.643 48.781  24.422 1.00 46.01 ? 125  ALA B CB  1 
ATOM   1826 N  N   . PHE B 1 151 ? 7.752  49.014  22.960 1.00 50.56 ? 126  PHE B N   1 
ATOM   1827 C  CA  . PHE B 1 151 ? 6.834  49.695  22.055 1.00 54.13 ? 126  PHE B CA  1 
ATOM   1828 C  C   . PHE B 1 151 ? 5.525  50.182  22.688 1.00 57.79 ? 126  PHE B C   1 
ATOM   1829 O  O   . PHE B 1 151 ? 5.141  51.334  22.460 1.00 59.99 ? 126  PHE B O   1 
ATOM   1830 C  CB  . PHE B 1 151 ? 6.538  48.850  20.810 1.00 51.52 ? 126  PHE B CB  1 
ATOM   1831 C  CG  . PHE B 1 151 ? 7.721  48.691  19.873 1.00 49.43 ? 126  PHE B CG  1 
ATOM   1832 C  CD1 . PHE B 1 151 ? 8.650  47.685  20.086 1.00 48.93 ? 126  PHE B CD1 1 
ATOM   1833 C  CD2 . PHE B 1 151 ? 7.872  49.550  18.804 1.00 48.24 ? 126  PHE B CD2 1 
ATOM   1834 C  CE1 . PHE B 1 151 ? 9.721  47.531  19.226 1.00 47.28 ? 126  PHE B CE1 1 
ATOM   1835 C  CE2 . PHE B 1 151 ? 8.960  49.402  17.969 1.00 46.11 ? 126  PHE B CE2 1 
ATOM   1836 C  CZ  . PHE B 1 151 ? 9.882  48.401  18.174 1.00 45.91 ? 126  PHE B CZ  1 
ATOM   1837 N  N   . LYS B 1 152 ? 4.843  49.346  23.505 1.00 61.28 ? 127  LYS B N   1 
ATOM   1838 C  CA  . LYS B 1 152 ? 3.558  49.636  24.178 1.00 62.20 ? 127  LYS B CA  1 
ATOM   1839 C  C   . LYS B 1 152 ? 3.454  50.906  25.026 1.00 62.03 ? 127  LYS B C   1 
ATOM   1840 O  O   . LYS B 1 152 ? 2.394  51.539  25.092 1.00 61.71 ? 127  LYS B O   1 
ATOM   1841 C  CB  . LYS B 1 152 ? 3.115  48.458  25.090 1.00 64.81 ? 127  LYS B CB  1 
ATOM   1842 C  CG  . LYS B 1 152 ? 2.463  47.185  24.502 1.00 65.92 ? 127  LYS B CG  1 
ATOM   1843 C  CD  . LYS B 1 152 ? 2.082  46.311  25.702 1.00 67.81 ? 127  LYS B CD  1 
ATOM   1844 C  CE  . LYS B 1 152 ? 2.369  44.834  25.433 1.00 69.44 ? 127  LYS B CE  1 
ATOM   1845 N  NZ  . LYS B 1 152 ? 2.594  44.129  26.691 1.00 68.14 ? 127  LYS B NZ  1 
ATOM   1846 N  N   . ASP B 1 153 ? 4.561  51.200  25.719 1.00 62.76 ? 128  ASP B N   1 
ATOM   1847 C  CA  . ASP B 1 153 ? 4.736  52.380  26.554 1.00 62.70 ? 128  ASP B CA  1 
ATOM   1848 C  C   . ASP B 1 153 ? 5.573  53.412  25.794 1.00 63.56 ? 128  ASP B C   1 
ATOM   1849 O  O   . ASP B 1 153 ? 6.638  53.838  26.251 1.00 64.23 ? 128  ASP B O   1 
ATOM   1850 C  CB  . ASP B 1 153 ? 5.480  51.925  27.833 1.00 62.32 ? 128  ASP B CB  1 
ATOM   1851 N  N   . PHE B 1 154 ? 5.128  53.802  24.587 1.00 64.47 ? 129  PHE B N   1 
ATOM   1852 C  CA  . PHE B 1 154 ? 5.813  54.828  23.801 1.00 65.58 ? 129  PHE B CA  1 
ATOM   1853 C  C   . PHE B 1 154 ? 5.172  56.224  23.900 1.00 66.25 ? 129  PHE B C   1 
ATOM   1854 O  O   . PHE B 1 154 ? 4.145  56.473  23.258 1.00 67.17 ? 129  PHE B O   1 
ATOM   1855 C  CB  . PHE B 1 154 ? 5.971  54.368  22.338 1.00 64.56 ? 129  PHE B CB  1 
ATOM   1856 C  CG  . PHE B 1 154 ? 7.424  54.230  21.907 1.00 63.61 ? 129  PHE B CG  1 
ATOM   1857 C  CD1 . PHE B 1 154 ? 8.187  55.356  21.634 1.00 64.45 ? 129  PHE B CD1 1 
ATOM   1858 C  CD2 . PHE B 1 154 ? 7.979  52.977  21.775 1.00 62.93 ? 129  PHE B CD2 1 
ATOM   1859 C  CE1 . PHE B 1 154 ? 9.503  55.219  21.235 1.00 64.07 ? 129  PHE B CE1 1 
ATOM   1860 C  CE2 . PHE B 1 154 ? 9.291  52.837  21.378 1.00 63.56 ? 129  PHE B CE2 1 
ATOM   1861 C  CZ  . PHE B 1 154 ? 10.048 53.959  21.111 1.00 64.70 ? 129  PHE B CZ  1 
ATOM   1862 N  N   . ASP B 1 162 ? 17.272 62.584  24.623 1.00 55.18 ? 137  ASP B N   1 
ATOM   1863 C  CA  . ASP B 1 162 ? 18.560 63.025  24.106 1.00 54.96 ? 137  ASP B CA  1 
ATOM   1864 C  C   . ASP B 1 162 ? 19.597 61.931  23.769 1.00 55.95 ? 137  ASP B C   1 
ATOM   1865 O  O   . ASP B 1 162 ? 20.291 62.026  22.743 1.00 55.11 ? 137  ASP B O   1 
ATOM   1866 C  CB  . ASP B 1 162 ? 19.180 63.952  25.136 1.00 53.99 ? 137  ASP B CB  1 
ATOM   1867 N  N   . CYS B 1 163 ? 19.669 60.900  24.656 1.00 55.99 ? 138  CYS B N   1 
ATOM   1868 C  CA  . CYS B 1 163 ? 20.594 59.741  24.665 1.00 55.50 ? 138  CYS B CA  1 
ATOM   1869 C  C   . CYS B 1 163 ? 22.065 59.964  25.031 1.00 55.10 ? 138  CYS B C   1 
ATOM   1870 O  O   . CYS B 1 163 ? 22.723 58.973  25.357 1.00 55.77 ? 138  CYS B O   1 
ATOM   1871 C  CB  . CYS B 1 163 ? 20.486 58.822  23.416 1.00 53.55 ? 138  CYS B CB  1 
ATOM   1872 S  SG  . CYS B 1 163 ? 18.766 58.362  23.058 1.00 53.01 ? 138  CYS B SG  1 
ATOM   1873 N  N   . ASN C 1 36  ? 51.574 13.978  45.345 1.00 51.40 ? 11   ASN C N   1 
ATOM   1874 C  CA  . ASN C 1 36  ? 50.150 14.075  45.169 1.00 50.61 ? 11   ASN C CA  1 
ATOM   1875 C  C   . ASN C 1 36  ? 49.636 15.080  46.231 1.00 51.75 ? 11   ASN C C   1 
ATOM   1876 O  O   . ASN C 1 36  ? 49.446 16.244  45.828 1.00 52.28 ? 11   ASN C O   1 
ATOM   1877 C  CB  . ASN C 1 36  ? 49.486 12.671  45.271 1.00 48.14 ? 11   ASN C CB  1 
ATOM   1878 N  N   . VAL C 1 37  ? 49.577 14.664  47.548 1.00 49.74 ? 12   VAL C N   1 
ATOM   1879 C  CA  . VAL C 1 37  ? 48.941 15.269  48.771 1.00 46.17 ? 12   VAL C CA  1 
ATOM   1880 C  C   . VAL C 1 37  ? 49.317 16.681  49.255 1.00 43.47 ? 12   VAL C C   1 
ATOM   1881 O  O   . VAL C 1 37  ? 48.526 17.397  49.868 1.00 42.02 ? 12   VAL C O   1 
ATOM   1882 C  CB  . VAL C 1 37  ? 49.032 14.271  50.044 1.00 47.02 ? 12   VAL C CB  1 
ATOM   1883 C  CG1 . VAL C 1 37  ? 50.479 14.042  50.561 1.00 46.01 ? 12   VAL C CG1 1 
ATOM   1884 C  CG2 . VAL C 1 37  ? 48.129 14.662  51.233 1.00 44.78 ? 12   VAL C CG2 1 
ATOM   1885 N  N   . LYS C 1 38  ? 50.588 17.052  49.054 1.00 43.09 ? 13   LYS C N   1 
ATOM   1886 C  CA  . LYS C 1 38  ? 51.082 18.424  49.218 1.00 39.49 ? 13   LYS C CA  1 
ATOM   1887 C  C   . LYS C 1 38  ? 50.370 19.321  48.180 1.00 36.49 ? 13   LYS C C   1 
ATOM   1888 O  O   . LYS C 1 38  ? 49.910 20.435  48.472 1.00 35.14 ? 13   LYS C O   1 
ATOM   1889 C  CB  . LYS C 1 38  ? 52.643 18.424  48.986 1.00 37.77 ? 13   LYS C CB  1 
ATOM   1890 N  N   . ASP C 1 39  ? 50.231 18.776  46.951 1.00 33.25 ? 14   ASP C N   1 
ATOM   1891 C  CA  . ASP C 1 39  ? 49.522 19.456  45.898 1.00 27.29 ? 14   ASP C CA  1 
ATOM   1892 C  C   . ASP C 1 39  ? 48.042 19.262  45.991 1.00 21.51 ? 14   ASP C C   1 
ATOM   1893 O  O   . ASP C 1 39  ? 47.408 20.205  45.602 1.00 20.53 ? 14   ASP C O   1 
ATOM   1894 C  CB  . ASP C 1 39  ? 50.101 19.142  44.565 1.00 31.10 ? 14   ASP C CB  1 
ATOM   1895 C  CG  . ASP C 1 39  ? 51.439 19.856  44.288 1.00 35.88 ? 14   ASP C CG  1 
ATOM   1896 O  OD1 . ASP C 1 39  ? 52.043 20.514  45.155 1.00 37.80 ? 14   ASP C OD1 1 
ATOM   1897 O  OD2 . ASP C 1 39  ? 51.890 19.755  43.143 1.00 37.19 ? 14   ASP C OD2 1 
ATOM   1898 N  N   . VAL C 1 40  ? 47.447 18.202  46.526 1.00 15.89 ? 15   VAL C N   1 
ATOM   1899 C  CA  . VAL C 1 40  ? 46.073 18.270  46.962 1.00 16.75 ? 15   VAL C CA  1 
ATOM   1900 C  C   . VAL C 1 40  ? 45.796 19.433  47.938 1.00 17.73 ? 15   VAL C C   1 
ATOM   1901 O  O   . VAL C 1 40  ? 44.821 20.167  47.775 1.00 18.15 ? 15   VAL C O   1 
ATOM   1902 C  CB  . VAL C 1 40  ? 45.653 16.905  47.548 1.00 17.03 ? 15   VAL C CB  1 
ATOM   1903 C  CG1 . VAL C 1 40  ? 44.266 16.920  48.161 1.00 15.16 ? 15   VAL C CG1 1 
ATOM   1904 C  CG2 . VAL C 1 40  ? 45.656 15.889  46.430 1.00 17.49 ? 15   VAL C CG2 1 
ATOM   1905 N  N   . THR C 1 41  ? 46.659 19.692  48.910 1.00 17.16 ? 16   THR C N   1 
ATOM   1906 C  CA  . THR C 1 41  ? 46.513 20.824  49.806 1.00 16.51 ? 16   THR C CA  1 
ATOM   1907 C  C   . THR C 1 41  ? 46.660 22.151  49.096 1.00 15.07 ? 16   THR C C   1 
ATOM   1908 O  O   . THR C 1 41  ? 45.901 23.049  49.418 1.00 16.99 ? 16   THR C O   1 
ATOM   1909 C  CB  . THR C 1 41  ? 47.533 20.674  51.000 1.00 17.35 ? 16   THR C CB  1 
ATOM   1910 O  OG1 . THR C 1 41  ? 47.059 19.546  51.734 1.00 19.10 ? 16   THR C OG1 1 
ATOM   1911 C  CG2 . THR C 1 41  ? 47.615 21.868  51.934 1.00 11.74 ? 16   THR C CG2 1 
ATOM   1912 N  N   . LYS C 1 42  ? 47.562 22.381  48.160 1.00 13.81 ? 17   LYS C N   1 
ATOM   1913 C  CA  . LYS C 1 42  ? 47.496 23.602  47.390 1.00 15.88 ? 17   LYS C CA  1 
ATOM   1914 C  C   . LYS C 1 42  ? 46.197 23.789  46.541 1.00 16.97 ? 17   LYS C C   1 
ATOM   1915 O  O   . LYS C 1 42  ? 45.608 24.877  46.465 1.00 17.88 ? 17   LYS C O   1 
ATOM   1916 C  CB  . LYS C 1 42  ? 48.702 23.598  46.505 1.00 18.13 ? 17   LYS C CB  1 
ATOM   1917 C  CG  . LYS C 1 42  ? 50.006 23.615  47.257 1.00 21.24 ? 17   LYS C CG  1 
ATOM   1918 C  CD  . LYS C 1 42  ? 51.103 23.441  46.198 1.00 24.88 ? 17   LYS C CD  1 
ATOM   1919 C  CE  . LYS C 1 42  ? 52.486 23.537  46.798 1.00 28.59 ? 17   LYS C CE  1 
ATOM   1920 N  NZ  . LYS C 1 42  ? 52.730 24.883  47.284 1.00 31.31 ? 17   LYS C NZ  1 
ATOM   1921 N  N   . LEU C 1 43  ? 45.682 22.736  45.880 1.00 14.39 ? 18   LEU C N   1 
ATOM   1922 C  CA  . LEU C 1 43  ? 44.454 22.764  45.149 1.00 11.22 ? 18   LEU C CA  1 
ATOM   1923 C  C   . LEU C 1 43  ? 43.333 23.111  46.047 1.00 10.78 ? 18   LEU C C   1 
ATOM   1924 O  O   . LEU C 1 43  ? 42.612 24.032  45.691 1.00 16.08 ? 18   LEU C O   1 
ATOM   1925 C  CB  . LEU C 1 43  ? 44.129 21.412  44.609 1.00 12.69 ? 18   LEU C CB  1 
ATOM   1926 C  CG  . LEU C 1 43  ? 42.973 21.312  43.632 1.00 15.70 ? 18   LEU C CG  1 
ATOM   1927 C  CD1 . LEU C 1 43  ? 43.151 22.220  42.429 1.00 9.04  ? 18   LEU C CD1 1 
ATOM   1928 C  CD2 . LEU C 1 43  ? 42.864 19.875  43.248 1.00 15.11 ? 18   LEU C CD2 1 
ATOM   1929 N  N   . VAL C 1 44  ? 43.155 22.484  47.210 1.00 11.81 ? 19   VAL C N   1 
ATOM   1930 C  CA  . VAL C 1 44  ? 42.092 22.868  48.138 1.00 12.12 ? 19   VAL C CA  1 
ATOM   1931 C  C   . VAL C 1 44  ? 42.159 24.359  48.569 1.00 13.12 ? 19   VAL C C   1 
ATOM   1932 O  O   . VAL C 1 44  ? 41.144 25.056  48.607 1.00 14.59 ? 19   VAL C O   1 
ATOM   1933 C  CB  . VAL C 1 44  ? 42.041 21.868  49.328 1.00 12.63 ? 19   VAL C CB  1 
ATOM   1934 C  CG1 . VAL C 1 44  ? 40.984 22.267  50.328 1.00 11.49 ? 19   VAL C CG1 1 
ATOM   1935 C  CG2 . VAL C 1 44  ? 41.661 20.496  48.835 1.00 12.48 ? 19   VAL C CG2 1 
ATOM   1936 N  N   . ALA C 1 45  ? 43.362 24.909  48.821 1.00 13.02 ? 20   ALA C N   1 
ATOM   1937 C  CA  . ALA C 1 45  ? 43.532 26.278  49.252 1.00 11.77 ? 20   ALA C CA  1 
ATOM   1938 C  C   . ALA C 1 45  ? 43.254 27.224  48.126 1.00 11.25 ? 20   ALA C C   1 
ATOM   1939 O  O   . ALA C 1 45  ? 42.888 28.357  48.344 1.00 14.74 ? 20   ALA C O   1 
ATOM   1940 C  CB  . ALA C 1 45  ? 44.975 26.452  49.635 1.00 10.68 ? 20   ALA C CB  1 
ATOM   1941 N  N   . ASN C 1 46  ? 43.461 26.757  46.895 1.00 15.11 ? 21   ASN C N   1 
ATOM   1942 C  CA  . ASN C 1 46  ? 43.197 27.471  45.648 1.00 13.34 ? 21   ASN C CA  1 
ATOM   1943 C  C   . ASN C 1 46  ? 41.898 27.107  44.949 1.00 13.09 ? 21   ASN C C   1 
ATOM   1944 O  O   . ASN C 1 46  ? 41.663 27.533  43.815 1.00 18.62 ? 21   ASN C O   1 
ATOM   1945 C  CB  . ASN C 1 46  ? 44.318 27.149  44.717 1.00 12.84 ? 21   ASN C CB  1 
ATOM   1946 C  CG  . ASN C 1 46  ? 45.401 28.151  44.755 1.00 12.42 ? 21   ASN C CG  1 
ATOM   1947 O  OD1 . ASN C 1 46  ? 45.277 29.229  45.315 1.00 14.66 ? 21   ASN C OD1 1 
ATOM   1948 N  ND2 . ASN C 1 46  ? 46.503 27.827  44.131 1.00 12.99 ? 21   ASN C ND2 1 
ATOM   1949 N  N   . LEU C 1 47  ? 41.041 26.311  45.536 1.00 12.25 ? 22   LEU C N   1 
ATOM   1950 C  CA  . LEU C 1 47  ? 39.691 26.194  45.063 1.00 12.28 ? 22   LEU C CA  1 
ATOM   1951 C  C   . LEU C 1 47  ? 38.831 27.012  45.972 1.00 12.85 ? 22   LEU C C   1 
ATOM   1952 O  O   . LEU C 1 47  ? 39.216 27.109  47.126 1.00 17.11 ? 22   LEU C O   1 
ATOM   1953 C  CB  . LEU C 1 47  ? 39.202 24.755  45.039 1.00 10.06 ? 22   LEU C CB  1 
ATOM   1954 C  CG  . LEU C 1 47  ? 39.745 23.906  43.936 1.00 9.08  ? 22   LEU C CG  1 
ATOM   1955 C  CD1 . LEU C 1 47  ? 39.380 22.464  44.120 1.00 8.06  ? 22   LEU C CD1 1 
ATOM   1956 C  CD2 . LEU C 1 47  ? 39.124 24.394  42.666 1.00 11.26 ? 22   LEU C CD2 1 
ATOM   1957 N  N   . PRO C 1 48  ? 37.706 27.649  45.629 1.00 12.49 ? 23   PRO C N   1 
ATOM   1958 C  CA  . PRO C 1 48  ? 36.902 28.384  46.592 1.00 12.26 ? 23   PRO C CA  1 
ATOM   1959 C  C   . PRO C 1 48  ? 36.214 27.457  47.604 1.00 13.42 ? 23   PRO C C   1 
ATOM   1960 O  O   . PRO C 1 48  ? 35.695 26.416  47.220 1.00 13.22 ? 23   PRO C O   1 
ATOM   1961 C  CB  . PRO C 1 48  ? 35.923 29.108  45.681 1.00 13.14 ? 23   PRO C CB  1 
ATOM   1962 C  CG  . PRO C 1 48  ? 36.407 29.009  44.237 1.00 9.94  ? 23   PRO C CG  1 
ATOM   1963 C  CD  . PRO C 1 48  ? 37.094 27.667  44.292 1.00 12.73 ? 23   PRO C CD  1 
ATOM   1964 N  N   . LYS C 1 49  ? 36.216 27.796  48.898 1.00 13.54 ? 24   LYS C N   1 
ATOM   1965 C  CA  . LYS C 1 49  ? 35.515 27.039  49.919 1.00 17.03 ? 24   LYS C CA  1 
ATOM   1966 C  C   . LYS C 1 49  ? 34.053 26.703  49.596 1.00 17.41 ? 24   LYS C C   1 
ATOM   1967 O  O   . LYS C 1 49  ? 33.500 25.693  50.011 1.00 15.96 ? 24   LYS C O   1 
ATOM   1968 C  CB  . LYS C 1 49  ? 35.591 27.845  51.228 1.00 17.76 ? 24   LYS C CB  1 
ATOM   1969 C  CG  . LYS C 1 49  ? 36.918 27.585  51.896 1.00 22.90 ? 24   LYS C CG  1 
ATOM   1970 C  CD  . LYS C 1 49  ? 37.423 28.782  52.700 1.00 24.73 ? 24   LYS C CD  1 
ATOM   1971 C  CE  . LYS C 1 49  ? 38.893 28.608  53.191 1.00 25.32 ? 24   LYS C CE  1 
ATOM   1972 N  NZ  . LYS C 1 49  ? 39.427 29.914  53.578 1.00 27.67 ? 24   LYS C NZ  1 
ATOM   1973 N  N   . ASP C 1 50  ? 33.380 27.526  48.807 1.00 20.45 ? 25   ASP C N   1 
ATOM   1974 C  CA  . ASP C 1 50  ? 31.969 27.349  48.579 1.00 20.93 ? 25   ASP C CA  1 
ATOM   1975 C  C   . ASP C 1 50  ? 31.690 26.924  47.164 1.00 19.35 ? 25   ASP C C   1 
ATOM   1976 O  O   . ASP C 1 50  ? 30.617 27.146  46.603 1.00 21.38 ? 25   ASP C O   1 
ATOM   1977 C  CB  . ASP C 1 50  ? 31.316 28.665  48.909 1.00 23.07 ? 25   ASP C CB  1 
ATOM   1978 C  CG  . ASP C 1 50  ? 31.726 29.820  48.014 1.00 28.48 ? 25   ASP C CG  1 
ATOM   1979 O  OD1 . ASP C 1 50  ? 32.736 29.755  47.329 1.00 29.48 ? 25   ASP C OD1 1 
ATOM   1980 O  OD2 . ASP C 1 50  ? 31.018 30.829  48.006 1.00 35.37 ? 25   ASP C OD2 1 
ATOM   1981 N  N   . TYR C 1 51  ? 32.684 26.330  46.570 1.00 17.08 ? 26   TYR C N   1 
ATOM   1982 C  CA  . TYR C 1 51  ? 32.486 25.784  45.270 1.00 18.09 ? 26   TYR C CA  1 
ATOM   1983 C  C   . TYR C 1 51  ? 32.066 24.352  45.473 1.00 20.16 ? 26   TYR C C   1 
ATOM   1984 O  O   . TYR C 1 51  ? 32.672 23.586  46.210 1.00 20.74 ? 26   TYR C O   1 
ATOM   1985 C  CB  . TYR C 1 51  ? 33.787 25.925  44.505 1.00 18.65 ? 26   TYR C CB  1 
ATOM   1986 C  CG  . TYR C 1 51  ? 33.779 25.389  43.087 1.00 15.43 ? 26   TYR C CG  1 
ATOM   1987 C  CD1 . TYR C 1 51  ? 32.863 25.870  42.180 1.00 14.28 ? 26   TYR C CD1 1 
ATOM   1988 C  CD2 . TYR C 1 51  ? 34.687 24.394  42.740 1.00 18.66 ? 26   TYR C CD2 1 
ATOM   1989 C  CE1 . TYR C 1 51  ? 32.828 25.305  40.916 1.00 18.89 ? 26   TYR C CE1 1 
ATOM   1990 C  CE2 . TYR C 1 51  ? 34.680 23.853  41.457 1.00 18.57 ? 26   TYR C CE2 1 
ATOM   1991 C  CZ  . TYR C 1 51  ? 33.736 24.325  40.567 1.00 17.94 ? 26   TYR C CZ  1 
ATOM   1992 O  OH  . TYR C 1 51  ? 33.702 23.844  39.293 1.00 20.05 ? 26   TYR C OH  1 
HETATM 1993 N  N   . MSE C 1 52  ? 30.992 23.977  44.806 1.00 22.38 ? 27   MSE C N   1 
HETATM 1994 C  CA  . MSE C 1 52  ? 30.472 22.643  44.960 1.00 23.82 ? 27   MSE C CA  1 
HETATM 1995 C  C   . MSE C 1 52  ? 30.902 21.790  43.796 1.00 23.07 ? 27   MSE C C   1 
HETATM 1996 O  O   . MSE C 1 52  ? 30.675 22.180  42.659 1.00 22.78 ? 27   MSE C O   1 
HETATM 1997 C  CB  . MSE C 1 52  ? 28.966 22.685  45.023 1.00 27.76 ? 27   MSE C CB  1 
HETATM 1998 C  CG  . MSE C 1 52  ? 28.476 23.440  46.222 1.00 33.28 ? 27   MSE C CG  1 
HETATM 1999 SE SE  . MSE C 1 52  ? 29.250 22.864  47.919 1.00 47.63 ? 27   MSE C SE  1 
HETATM 2000 C  CE  . MSE C 1 52  ? 28.807 24.413  48.975 1.00 42.81 ? 27   MSE C CE  1 
ATOM   2001 N  N   . ILE C 1 53  ? 31.514 20.637  44.127 1.00 23.36 ? 28   ILE C N   1 
ATOM   2002 C  CA  . ILE C 1 53  ? 31.890 19.552  43.196 1.00 24.49 ? 28   ILE C CA  1 
ATOM   2003 C  C   . ILE C 1 53  ? 30.924 18.334  43.195 1.00 25.21 ? 28   ILE C C   1 
ATOM   2004 O  O   . ILE C 1 53  ? 30.568 17.795  44.237 1.00 24.49 ? 28   ILE C O   1 
ATOM   2005 C  CB  . ILE C 1 53  ? 33.364 19.075  43.497 1.00 21.68 ? 28   ILE C CB  1 
ATOM   2006 C  CG1 . ILE C 1 53  ? 34.379 20.215  43.453 1.00 19.99 ? 28   ILE C CG1 1 
ATOM   2007 C  CG2 . ILE C 1 53  ? 33.796 18.049  42.485 1.00 19.57 ? 28   ILE C CG2 1 
ATOM   2008 C  CD1 . ILE C 1 53  ? 35.761 19.859  43.991 1.00 18.85 ? 28   ILE C CD1 1 
ATOM   2009 N  N   . THR C 1 54  ? 30.508 17.846  42.017 1.00 26.46 ? 29   THR C N   1 
ATOM   2010 C  CA  . THR C 1 54  ? 29.637 16.688  41.888 1.00 26.80 ? 29   THR C CA  1 
ATOM   2011 C  C   . THR C 1 54  ? 30.388 15.361  41.957 1.00 27.21 ? 29   THR C C   1 
ATOM   2012 O  O   . THR C 1 54  ? 31.299 15.084  41.182 1.00 26.27 ? 29   THR C O   1 
ATOM   2013 C  CB  . THR C 1 54  ? 28.824 16.736  40.580 1.00 25.22 ? 29   THR C CB  1 
ATOM   2014 O  OG1 . THR C 1 54  ? 28.137 17.962  40.566 1.00 28.05 ? 29   THR C OG1 1 
ATOM   2015 C  CG2 . THR C 1 54  ? 27.773 15.659  40.545 1.00 26.26 ? 29   THR C CG2 1 
ATOM   2016 N  N   . LEU C 1 55  ? 29.980 14.498  42.878 1.00 27.91 ? 30   LEU C N   1 
ATOM   2017 C  CA  . LEU C 1 55  ? 30.519 13.157  42.943 1.00 29.69 ? 30   LEU C CA  1 
ATOM   2018 C  C   . LEU C 1 55  ? 29.354 12.189  43.168 1.00 31.34 ? 30   LEU C C   1 
ATOM   2019 O  O   . LEU C 1 55  ? 28.542 12.362  44.080 1.00 30.99 ? 30   LEU C O   1 
ATOM   2020 C  CB  . LEU C 1 55  ? 31.578 13.070  44.051 1.00 25.27 ? 30   LEU C CB  1 
ATOM   2021 C  CG  . LEU C 1 55  ? 32.157 11.727  44.434 1.00 23.15 ? 30   LEU C CG  1 
ATOM   2022 C  CD1 . LEU C 1 55  ? 32.879 11.106  43.274 1.00 22.85 ? 30   LEU C CD1 1 
ATOM   2023 C  CD2 . LEU C 1 55  ? 33.110 11.943  45.570 1.00 25.04 ? 30   LEU C CD2 1 
ATOM   2024 N  N   . LYS C 1 56  ? 29.246 11.172  42.300 1.00 34.65 ? 31   LYS C N   1 
ATOM   2025 C  CA  . LYS C 1 56  ? 28.335 10.045  42.513 1.00 36.49 ? 31   LYS C CA  1 
ATOM   2026 C  C   . LYS C 1 56  ? 28.910 9.150   43.620 1.00 36.03 ? 31   LYS C C   1 
ATOM   2027 O  O   . LYS C 1 56  ? 29.741 8.287   43.370 1.00 36.42 ? 31   LYS C O   1 
ATOM   2028 C  CB  . LYS C 1 56  ? 28.121 9.241   41.218 1.00 36.56 ? 31   LYS C CB  1 
ATOM   2029 C  CG  . LYS C 1 56  ? 27.475 9.966   40.056 1.00 39.42 ? 31   LYS C CG  1 
ATOM   2030 C  CD  . LYS C 1 56  ? 26.867 8.902   39.121 1.00 47.68 ? 31   LYS C CD  1 
ATOM   2031 C  CE  . LYS C 1 56  ? 25.930 9.427   37.990 1.00 51.31 ? 31   LYS C CE  1 
ATOM   2032 N  NZ  . LYS C 1 56  ? 24.859 8.496   37.602 1.00 51.86 ? 31   LYS C NZ  1 
ATOM   2033 N  N   . TYR C 1 57  ? 28.514 9.411   44.868 1.00 38.89 ? 32   TYR C N   1 
ATOM   2034 C  CA  . TYR C 1 57  ? 29.122 8.846   46.081 1.00 40.86 ? 32   TYR C CA  1 
ATOM   2035 C  C   . TYR C 1 57  ? 28.594 7.437   46.265 1.00 43.51 ? 32   TYR C C   1 
ATOM   2036 O  O   . TYR C 1 57  ? 27.425 7.204   45.953 1.00 45.02 ? 32   TYR C O   1 
ATOM   2037 C  CB  . TYR C 1 57  ? 28.707 9.747   47.229 1.00 37.67 ? 32   TYR C CB  1 
ATOM   2038 C  CG  . TYR C 1 57  ? 29.138 9.317   48.610 1.00 41.48 ? 32   TYR C CG  1 
ATOM   2039 C  CD1 . TYR C 1 57  ? 30.459 9.438   48.984 1.00 43.11 ? 32   TYR C CD1 1 
ATOM   2040 C  CD2 . TYR C 1 57  ? 28.190 8.877   49.536 1.00 43.18 ? 32   TYR C CD2 1 
ATOM   2041 C  CE1 . TYR C 1 57  ? 30.812 9.172   50.302 1.00 44.55 ? 32   TYR C CE1 1 
ATOM   2042 C  CE2 . TYR C 1 57  ? 28.542 8.584   50.847 1.00 44.09 ? 32   TYR C CE2 1 
ATOM   2043 C  CZ  . TYR C 1 57  ? 29.862 8.758   51.230 1.00 45.88 ? 32   TYR C CZ  1 
ATOM   2044 O  OH  . TYR C 1 57  ? 30.238 8.549   52.557 1.00 49.38 ? 32   TYR C OH  1 
ATOM   2045 N  N   . VAL C 1 58  ? 29.391 6.459   46.718 1.00 46.10 ? 33   VAL C N   1 
ATOM   2046 C  CA  . VAL C 1 58  ? 28.866 5.097   46.885 1.00 48.63 ? 33   VAL C CA  1 
ATOM   2047 C  C   . VAL C 1 58  ? 28.323 4.935   48.307 1.00 50.48 ? 33   VAL C C   1 
ATOM   2048 O  O   . VAL C 1 58  ? 29.088 5.086   49.265 1.00 49.75 ? 33   VAL C O   1 
ATOM   2049 C  CB  . VAL C 1 58  ? 29.900 4.000   46.501 1.00 49.02 ? 33   VAL C CB  1 
ATOM   2050 C  CG1 . VAL C 1 58  ? 29.390 2.594   46.823 1.00 50.53 ? 33   VAL C CG1 1 
ATOM   2051 C  CG2 . VAL C 1 58  ? 30.216 4.072   45.014 1.00 47.63 ? 33   VAL C CG2 1 
ATOM   2052 N  N   . PRO C 1 59  ? 27.006 4.682   48.505 1.00 53.28 ? 34   PRO C N   1 
ATOM   2053 C  CA  . PRO C 1 59  ? 26.385 4.695   49.834 1.00 55.66 ? 34   PRO C CA  1 
ATOM   2054 C  C   . PRO C 1 59  ? 27.121 3.734   50.767 1.00 58.89 ? 34   PRO C C   1 
ATOM   2055 O  O   . PRO C 1 59  ? 27.426 2.568   50.448 1.00 59.22 ? 34   PRO C O   1 
ATOM   2056 C  CB  . PRO C 1 59  ? 24.936 4.297   49.549 1.00 54.96 ? 34   PRO C CB  1 
ATOM   2057 C  CG  . PRO C 1 59  ? 24.701 4.825   48.139 1.00 51.80 ? 34   PRO C CG  1 
ATOM   2058 C  CD  . PRO C 1 59  ? 26.002 4.428   47.456 1.00 51.86 ? 34   PRO C CD  1 
ATOM   2059 N  N   . GLY C 1 60  ? 27.545 4.399   51.850 1.00 60.51 ? 35   GLY C N   1 
ATOM   2060 C  CA  . GLY C 1 60  ? 28.272 3.744   52.925 1.00 62.88 ? 35   GLY C CA  1 
ATOM   2061 C  C   . GLY C 1 60  ? 29.632 3.266   52.457 1.00 63.14 ? 35   GLY C C   1 
ATOM   2062 O  O   . GLY C 1 60  ? 29.852 2.077   52.214 1.00 64.01 ? 35   GLY C O   1 
HETATM 2063 N  N   . MSE C 1 61  ? 30.521 4.240   52.301 1.00 62.92 ? 36   MSE C N   1 
HETATM 2064 C  CA  . MSE C 1 61  ? 31.881 3.970   51.881 1.00 63.09 ? 36   MSE C CA  1 
HETATM 2065 C  C   . MSE C 1 61  ? 32.945 4.485   52.836 1.00 64.77 ? 36   MSE C C   1 
HETATM 2066 O  O   . MSE C 1 61  ? 34.148 4.357   52.599 1.00 65.03 ? 36   MSE C O   1 
HETATM 2067 C  CB  . MSE C 1 61  ? 32.115 4.582   50.531 1.00 62.61 ? 36   MSE C CB  1 
HETATM 2068 C  CG  . MSE C 1 61  ? 31.973 6.068   50.551 1.00 60.55 ? 36   MSE C CG  1 
HETATM 2069 SE SE  . MSE C 1 61  ? 33.277 6.879   49.401 1.00 61.18 ? 36   MSE C SE  1 
HETATM 2070 C  CE  . MSE C 1 61  ? 34.541 7.346   50.777 1.00 55.15 ? 36   MSE C CE  1 
ATOM   2071 N  N   . ASP C 1 62  ? 32.430 5.163   53.863 1.00 66.73 ? 37   ASP C N   1 
ATOM   2072 C  CA  . ASP C 1 62  ? 33.149 5.583   55.061 1.00 67.41 ? 37   ASP C CA  1 
ATOM   2073 C  C   . ASP C 1 62  ? 33.215 4.481   56.132 1.00 66.85 ? 37   ASP C C   1 
ATOM   2074 O  O   . ASP C 1 62  ? 34.130 4.393   56.957 1.00 67.21 ? 37   ASP C O   1 
ATOM   2075 C  CB  . ASP C 1 62  ? 32.478 6.867   55.589 1.00 69.00 ? 37   ASP C CB  1 
ATOM   2076 C  CG  . ASP C 1 62  ? 30.982 6.808   55.935 1.00 70.25 ? 37   ASP C CG  1 
ATOM   2077 O  OD1 . ASP C 1 62  ? 30.143 6.538   55.061 1.00 69.81 ? 37   ASP C OD1 1 
ATOM   2078 O  OD2 . ASP C 1 62  ? 30.657 7.058   57.097 1.00 71.69 ? 37   ASP C OD2 1 
ATOM   2079 N  N   . VAL C 1 63  ? 32.224 3.593   56.068 1.00 65.94 ? 38   VAL C N   1 
ATOM   2080 C  CA  . VAL C 1 63  ? 32.091 2.461   56.960 1.00 64.55 ? 38   VAL C CA  1 
ATOM   2081 C  C   . VAL C 1 63  ? 32.395 1.200   56.170 1.00 65.94 ? 38   VAL C C   1 
ATOM   2082 O  O   . VAL C 1 63  ? 33.340 0.521   56.584 1.00 68.33 ? 38   VAL C O   1 
ATOM   2083 C  CB  . VAL C 1 63  ? 30.694 2.475   57.631 1.00 63.05 ? 38   VAL C CB  1 
ATOM   2084 C  CG1 . VAL C 1 63  ? 29.960 1.135   57.787 1.00 62.73 ? 38   VAL C CG1 1 
ATOM   2085 C  CG2 . VAL C 1 63  ? 30.915 3.097   58.990 1.00 61.39 ? 38   VAL C CG2 1 
ATOM   2086 N  N   . LEU C 1 64  ? 31.700 0.861   55.059 1.00 64.32 ? 39   LEU C N   1 
ATOM   2087 C  CA  . LEU C 1 64  ? 31.997 -0.365  54.328 1.00 63.23 ? 39   LEU C CA  1 
ATOM   2088 C  C   . LEU C 1 64  ? 33.487 -0.412  53.952 1.00 62.57 ? 39   LEU C C   1 
ATOM   2089 O  O   . LEU C 1 64  ? 34.084 0.647   53.713 1.00 63.24 ? 39   LEU C O   1 
ATOM   2090 C  CB  . LEU C 1 64  ? 31.130 -0.449  53.078 1.00 62.74 ? 39   LEU C CB  1 
ATOM   2091 N  N   . PRO C 1 65  ? 34.161 -1.578  54.006 1.00 61.57 ? 40   PRO C N   1 
ATOM   2092 C  CA  . PRO C 1 65  ? 35.608 -1.719  53.761 1.00 59.74 ? 40   PRO C CA  1 
ATOM   2093 C  C   . PRO C 1 65  ? 36.009 -1.462  52.318 1.00 57.52 ? 40   PRO C C   1 
ATOM   2094 O  O   . PRO C 1 65  ? 35.183 -1.629  51.418 1.00 54.10 ? 40   PRO C O   1 
ATOM   2095 C  CB  . PRO C 1 65  ? 35.861 -3.170  54.123 1.00 60.55 ? 40   PRO C CB  1 
ATOM   2096 C  CG  . PRO C 1 65  ? 34.550 -3.863  53.762 1.00 60.74 ? 40   PRO C CG  1 
ATOM   2097 C  CD  . PRO C 1 65  ? 33.546 -2.868  54.329 1.00 61.16 ? 40   PRO C CD  1 
ATOM   2098 N  N   . SER C 1 66  ? 37.282 -1.110  52.111 1.00 56.39 ? 41   SER C N   1 
ATOM   2099 C  CA  . SER C 1 66  ? 37.779 -0.735  50.798 1.00 56.77 ? 41   SER C CA  1 
ATOM   2100 C  C   . SER C 1 66  ? 37.271 -1.553  49.602 1.00 56.41 ? 41   SER C C   1 
ATOM   2101 O  O   . SER C 1 66  ? 36.627 -0.992  48.727 1.00 56.58 ? 41   SER C O   1 
ATOM   2102 C  CB  . SER C 1 66  ? 39.292 -0.643  50.831 1.00 57.36 ? 41   SER C CB  1 
ATOM   2103 O  OG  . SER C 1 66  ? 39.964 -1.877  50.695 1.00 60.69 ? 41   SER C OG  1 
ATOM   2104 N  N   . HIS C 1 67  ? 37.404 -2.882  49.580 1.00 56.11 ? 42   HIS C N   1 
ATOM   2105 C  CA  . HIS C 1 67  ? 36.947 -3.739  48.482 1.00 56.80 ? 42   HIS C CA  1 
ATOM   2106 C  C   . HIS C 1 67  ? 35.473 -3.664  48.079 1.00 56.34 ? 42   HIS C C   1 
ATOM   2107 O  O   . HIS C 1 67  ? 35.062 -4.139  47.007 1.00 55.64 ? 42   HIS C O   1 
ATOM   2108 C  CB  . HIS C 1 67  ? 37.301 -5.217  48.795 1.00 60.78 ? 42   HIS C CB  1 
ATOM   2109 C  CG  . HIS C 1 67  ? 36.205 -6.095  49.445 1.00 63.24 ? 42   HIS C CG  1 
ATOM   2110 N  ND1 . HIS C 1 67  ? 35.894 -6.211  50.736 1.00 63.50 ? 42   HIS C ND1 1 
ATOM   2111 C  CD2 . HIS C 1 67  ? 35.244 -6.788  48.711 1.00 63.78 ? 42   HIS C CD2 1 
ATOM   2112 C  CE1 . HIS C 1 67  ? 34.762 -6.882  50.802 1.00 64.65 ? 42   HIS C CE1 1 
ATOM   2113 N  NE2 . HIS C 1 67  ? 34.371 -7.201  49.584 1.00 64.49 ? 42   HIS C NE2 1 
ATOM   2114 N  N   . CYS C 1 68  ? 34.669 -3.175  49.027 1.00 56.27 ? 43   CYS C N   1 
ATOM   2115 C  CA  . CYS C 1 68  ? 33.239 -3.012  48.806 1.00 56.25 ? 43   CYS C CA  1 
ATOM   2116 C  C   . CYS C 1 68  ? 32.953 -1.871  47.844 1.00 54.69 ? 43   CYS C C   1 
ATOM   2117 O  O   . CYS C 1 68  ? 32.104 -2.006  46.959 1.00 56.17 ? 43   CYS C O   1 
ATOM   2118 C  CB  . CYS C 1 68  ? 32.488 -2.787  50.120 1.00 57.47 ? 43   CYS C CB  1 
ATOM   2119 S  SG  . CYS C 1 68  ? 31.647 -4.253  50.786 1.00 60.51 ? 43   CYS C SG  1 
ATOM   2120 N  N   . TRP C 1 69  ? 33.695 -0.766  47.973 1.00 51.41 ? 44   TRP C N   1 
ATOM   2121 C  CA  . TRP C 1 69  ? 33.338 0.464   47.287 1.00 47.58 ? 44   TRP C CA  1 
ATOM   2122 C  C   . TRP C 1 69  ? 34.349 0.946   46.300 1.00 46.08 ? 44   TRP C C   1 
ATOM   2123 O  O   . TRP C 1 69  ? 33.969 1.593   45.341 1.00 46.29 ? 44   TRP C O   1 
ATOM   2124 C  CB  . TRP C 1 69  ? 33.089 1.587   48.271 1.00 47.09 ? 44   TRP C CB  1 
ATOM   2125 C  CG  . TRP C 1 69  ? 34.199 1.801   49.301 1.00 46.63 ? 44   TRP C CG  1 
ATOM   2126 C  CD1 . TRP C 1 69  ? 34.221 1.046   50.444 1.00 47.77 ? 44   TRP C CD1 1 
ATOM   2127 C  CD2 . TRP C 1 69  ? 35.261 2.660   49.225 1.00 45.55 ? 44   TRP C CD2 1 
ATOM   2128 N  NE1 . TRP C 1 69  ? 35.307 1.419   51.078 1.00 47.46 ? 44   TRP C NE1 1 
ATOM   2129 C  CE2 . TRP C 1 69  ? 35.948 2.361   50.389 1.00 44.86 ? 44   TRP C CE2 1 
ATOM   2130 C  CE3 . TRP C 1 69  ? 35.723 3.640   48.403 1.00 42.70 ? 44   TRP C CE3 1 
ATOM   2131 C  CZ2 . TRP C 1 69  ? 37.122 2.956   50.754 1.00 43.79 ? 44   TRP C CZ2 1 
ATOM   2132 C  CZ3 . TRP C 1 69  ? 36.886 4.263   48.782 1.00 43.82 ? 44   TRP C CZ3 1 
ATOM   2133 C  CH2 . TRP C 1 69  ? 37.597 3.925   49.920 1.00 42.91 ? 44   TRP C CH2 1 
ATOM   2134 N  N   . ILE C 1 70  ? 35.615 0.635   46.539 1.00 45.14 ? 45   ILE C N   1 
ATOM   2135 C  CA  . ILE C 1 70  ? 36.735 1.252   45.851 1.00 47.08 ? 45   ILE C CA  1 
ATOM   2136 C  C   . ILE C 1 70  ? 36.657 1.198   44.329 1.00 47.61 ? 45   ILE C C   1 
ATOM   2137 O  O   . ILE C 1 70  ? 36.955 2.157   43.619 1.00 48.87 ? 45   ILE C O   1 
ATOM   2138 C  CB  . ILE C 1 70  ? 38.085 0.681   46.427 1.00 47.91 ? 45   ILE C CB  1 
ATOM   2139 C  CG1 . ILE C 1 70  ? 39.316 1.515   46.123 1.00 46.35 ? 45   ILE C CG1 1 
ATOM   2140 C  CG2 . ILE C 1 70  ? 38.420 -0.723  45.905 1.00 50.05 ? 45   ILE C CG2 1 
ATOM   2141 C  CD1 . ILE C 1 70  ? 39.180 2.995   46.462 1.00 43.72 ? 45   ILE C CD1 1 
ATOM   2142 N  N   . SER C 1 71  ? 36.158 0.077   43.850 1.00 47.61 ? 46   SER C N   1 
ATOM   2143 C  CA  . SER C 1 71  ? 36.069 -0.245  42.437 1.00 48.09 ? 46   SER C CA  1 
ATOM   2144 C  C   . SER C 1 71  ? 35.166 0.685   41.595 1.00 47.26 ? 46   SER C C   1 
ATOM   2145 O  O   . SER C 1 71  ? 35.598 1.186   40.555 1.00 46.49 ? 46   SER C O   1 
ATOM   2146 C  CB  . SER C 1 71  ? 35.688 -1.728  42.427 1.00 50.90 ? 46   SER C CB  1 
ATOM   2147 O  OG  . SER C 1 71  ? 35.093 -2.219  43.664 1.00 54.24 ? 46   SER C OG  1 
ATOM   2148 N  N   . GLU C 1 72  ? 33.932 0.997   42.039 1.00 46.80 ? 47   GLU C N   1 
ATOM   2149 C  CA  . GLU C 1 72  ? 33.095 2.037   41.430 1.00 45.94 ? 47   GLU C CA  1 
ATOM   2150 C  C   . GLU C 1 72  ? 33.599 3.449   41.776 1.00 43.82 ? 47   GLU C C   1 
ATOM   2151 O  O   . GLU C 1 72  ? 33.532 4.348   40.947 1.00 43.16 ? 47   GLU C O   1 
ATOM   2152 C  CB  . GLU C 1 72  ? 31.602 1.843   41.831 1.00 47.29 ? 47   GLU C CB  1 
ATOM   2153 C  CG  . GLU C 1 72  ? 30.478 2.752   41.246 1.00 52.00 ? 47   GLU C CG  1 
ATOM   2154 C  CD  . GLU C 1 72  ? 29.748 2.394   39.936 1.00 54.16 ? 47   GLU C CD  1 
ATOM   2155 O  OE1 . GLU C 1 72  ? 28.894 1.494   39.926 1.00 57.21 ? 47   GLU C OE1 1 
ATOM   2156 O  OE2 . GLU C 1 72  ? 29.989 3.052   38.922 1.00 54.36 ? 47   GLU C OE2 1 
HETATM 2157 N  N   . MSE C 1 73  ? 34.170 3.670   42.967 1.00 43.01 ? 48   MSE C N   1 
HETATM 2158 C  CA  . MSE C 1 73  ? 34.601 4.979   43.448 1.00 40.77 ? 48   MSE C CA  1 
HETATM 2159 C  C   . MSE C 1 73  ? 35.795 5.538   42.724 1.00 37.10 ? 48   MSE C C   1 
HETATM 2160 O  O   . MSE C 1 73  ? 35.799 6.739   42.563 1.00 39.16 ? 48   MSE C O   1 
HETATM 2161 C  CB  . MSE C 1 73  ? 34.926 4.968   44.927 1.00 43.83 ? 48   MSE C CB  1 
HETATM 2162 C  CG  . MSE C 1 73  ? 34.667 6.334   45.551 1.00 49.60 ? 48   MSE C CG  1 
HETATM 2163 SE SE  . MSE C 1 73  ? 32.809 6.850   45.340 1.00 57.46 ? 48   MSE C SE  1 
HETATM 2164 C  CE  . MSE C 1 73  ? 32.917 8.464   46.266 1.00 52.90 ? 48   MSE C CE  1 
ATOM   2165 N  N   . VAL C 1 74  ? 36.793 4.773   42.266 1.00 34.29 ? 49   VAL C N   1 
ATOM   2166 C  CA  . VAL C 1 74  ? 37.855 5.271   41.388 1.00 30.22 ? 49   VAL C CA  1 
ATOM   2167 C  C   . VAL C 1 74  ? 37.372 5.680   39.997 1.00 31.03 ? 49   VAL C C   1 
ATOM   2168 O  O   . VAL C 1 74  ? 37.936 6.572   39.365 1.00 30.17 ? 49   VAL C O   1 
ATOM   2169 C  CB  . VAL C 1 74  ? 39.021 4.288   41.268 1.00 27.65 ? 49   VAL C CB  1 
ATOM   2170 C  CG1 . VAL C 1 74  ? 39.719 4.131   42.581 1.00 27.80 ? 49   VAL C CG1 1 
ATOM   2171 C  CG2 . VAL C 1 74  ? 38.591 2.924   40.828 1.00 27.38 ? 49   VAL C CG2 1 
ATOM   2172 N  N   . VAL C 1 75  ? 36.319 5.056   39.478 1.00 29.68 ? 50   VAL C N   1 
ATOM   2173 C  CA  . VAL C 1 75  ? 35.727 5.548   38.255 1.00 29.53 ? 50   VAL C CA  1 
ATOM   2174 C  C   . VAL C 1 75  ? 34.932 6.806   38.559 1.00 28.57 ? 50   VAL C C   1 
ATOM   2175 O  O   . VAL C 1 75  ? 35.069 7.755   37.800 1.00 30.41 ? 50   VAL C O   1 
ATOM   2176 C  CB  . VAL C 1 75  ? 34.904 4.446   37.554 1.00 30.06 ? 50   VAL C CB  1 
ATOM   2177 C  CG1 . VAL C 1 75  ? 34.026 4.900   36.371 1.00 28.50 ? 50   VAL C CG1 1 
ATOM   2178 C  CG2 . VAL C 1 75  ? 35.916 3.457   37.070 1.00 29.52 ? 50   VAL C CG2 1 
ATOM   2179 N  N   . GLN C 1 76  ? 34.147 6.917   39.639 1.00 28.05 ? 51   GLN C N   1 
ATOM   2180 C  CA  . GLN C 1 76  ? 33.421 8.148   39.945 1.00 27.55 ? 51   GLN C CA  1 
ATOM   2181 C  C   . GLN C 1 76  ? 34.267 9.336   40.379 1.00 26.77 ? 51   GLN C C   1 
ATOM   2182 O  O   . GLN C 1 76  ? 33.957 10.480  40.061 1.00 27.78 ? 51   GLN C O   1 
ATOM   2183 C  CB  . GLN C 1 76  ? 32.276 7.962   40.944 1.00 27.95 ? 51   GLN C CB  1 
ATOM   2184 C  CG  . GLN C 1 76  ? 31.142 7.029   40.503 1.00 31.66 ? 51   GLN C CG  1 
ATOM   2185 C  CD  . GLN C 1 76  ? 30.518 7.274   39.121 1.00 35.14 ? 51   GLN C CD  1 
ATOM   2186 O  OE1 . GLN C 1 76  ? 30.531 8.353   38.510 1.00 34.94 ? 51   GLN C OE1 1 
ATOM   2187 N  NE2 . GLN C 1 76  ? 29.945 6.214   38.566 1.00 36.11 ? 51   GLN C NE2 1 
ATOM   2188 N  N   . LEU C 1 77  ? 35.349 9.130   41.113 1.00 24.84 ? 52   LEU C N   1 
ATOM   2189 C  CA  . LEU C 1 77  ? 36.290 10.188  41.316 1.00 24.73 ? 52   LEU C CA  1 
ATOM   2190 C  C   . LEU C 1 77  ? 36.914 10.560  40.004 1.00 25.82 ? 52   LEU C C   1 
ATOM   2191 O  O   . LEU C 1 77  ? 37.061 11.752  39.750 1.00 26.91 ? 52   LEU C O   1 
ATOM   2192 C  CB  . LEU C 1 77  ? 37.349 9.754   42.251 1.00 25.92 ? 52   LEU C CB  1 
ATOM   2193 C  CG  . LEU C 1 77  ? 36.831 9.701   43.653 1.00 27.26 ? 52   LEU C CG  1 
ATOM   2194 C  CD1 . LEU C 1 77  ? 37.880 9.090   44.510 1.00 27.86 ? 52   LEU C CD1 1 
ATOM   2195 C  CD2 . LEU C 1 77  ? 36.473 11.078  44.141 1.00 27.93 ? 52   LEU C CD2 1 
ATOM   2196 N  N   . SER C 1 78  ? 37.211 9.566   39.148 1.00 27.18 ? 53   SER C N   1 
ATOM   2197 C  CA  . SER C 1 78  ? 37.788 9.790   37.838 1.00 24.69 ? 53   SER C CA  1 
ATOM   2198 C  C   . SER C 1 78  ? 36.859 10.558  36.918 1.00 26.00 ? 53   SER C C   1 
ATOM   2199 O  O   . SER C 1 78  ? 37.336 11.388  36.166 1.00 26.97 ? 53   SER C O   1 
ATOM   2200 C  CB  . SER C 1 78  ? 38.172 8.499   37.198 1.00 25.64 ? 53   SER C CB  1 
ATOM   2201 O  OG  . SER C 1 78  ? 38.902 8.772   36.019 1.00 24.45 ? 53   SER C OG  1 
ATOM   2202 N  N   . ASP C 1 79  ? 35.544 10.421  36.932 1.00 27.50 ? 54   ASP C N   1 
ATOM   2203 C  CA  . ASP C 1 79  ? 34.743 11.292  36.113 1.00 29.13 ? 54   ASP C CA  1 
ATOM   2204 C  C   . ASP C 1 79  ? 34.719 12.679  36.663 1.00 27.20 ? 54   ASP C C   1 
ATOM   2205 O  O   . ASP C 1 79  ? 34.826 13.616  35.906 1.00 30.75 ? 54   ASP C O   1 
ATOM   2206 C  CB  . ASP C 1 79  ? 33.314 10.874  36.099 1.00 35.74 ? 54   ASP C CB  1 
ATOM   2207 C  CG  . ASP C 1 79  ? 33.056 9.521   35.502 1.00 43.27 ? 54   ASP C CG  1 
ATOM   2208 O  OD1 . ASP C 1 79  ? 33.871 9.016   34.694 1.00 44.80 ? 54   ASP C OD1 1 
ATOM   2209 O  OD2 . ASP C 1 79  ? 31.996 8.988   35.876 1.00 47.24 ? 54   ASP C OD2 1 
ATOM   2210 N  N   . SER C 1 80  ? 34.554 12.829  37.966 1.00 26.41 ? 55   SER C N   1 
ATOM   2211 C  CA  . SER C 1 80  ? 34.470 14.119  38.610 1.00 23.34 ? 55   SER C CA  1 
ATOM   2212 C  C   . SER C 1 80  ? 35.676 14.964  38.382 1.00 19.99 ? 55   SER C C   1 
ATOM   2213 O  O   . SER C 1 80  ? 35.544 16.157  38.175 1.00 20.42 ? 55   SER C O   1 
ATOM   2214 C  CB  . SER C 1 80  ? 34.306 13.948  40.105 1.00 24.40 ? 55   SER C CB  1 
ATOM   2215 O  OG  . SER C 1 80  ? 33.079 13.321  40.431 1.00 24.29 ? 55   SER C OG  1 
ATOM   2216 N  N   . LEU C 1 81  ? 36.837 14.338  38.432 1.00 19.40 ? 56   LEU C N   1 
ATOM   2217 C  CA  . LEU C 1 81  ? 38.082 15.062  38.245 1.00 21.98 ? 56   LEU C CA  1 
ATOM   2218 C  C   . LEU C 1 81  ? 38.333 15.488  36.797 1.00 23.22 ? 56   LEU C C   1 
ATOM   2219 O  O   . LEU C 1 81  ? 38.922 16.543  36.512 1.00 21.76 ? 56   LEU C O   1 
ATOM   2220 C  CB  . LEU C 1 81  ? 39.301 14.271  38.793 1.00 21.06 ? 56   LEU C CB  1 
ATOM   2221 C  CG  . LEU C 1 81  ? 39.614 14.342  40.291 1.00 19.56 ? 56   LEU C CG  1 
ATOM   2222 C  CD1 . LEU C 1 81  ? 40.647 13.313  40.678 1.00 18.16 ? 56   LEU C CD1 1 
ATOM   2223 C  CD2 . LEU C 1 81  ? 40.132 15.717  40.651 1.00 16.61 ? 56   LEU C CD2 1 
ATOM   2224 N  N   . THR C 1 82  ? 37.873 14.624  35.881 1.00 25.77 ? 57   THR C N   1 
ATOM   2225 C  CA  . THR C 1 82  ? 37.991 14.906  34.462 1.00 28.23 ? 57   THR C CA  1 
ATOM   2226 C  C   . THR C 1 82  ? 37.020 16.004  34.104 1.00 28.03 ? 57   THR C C   1 
ATOM   2227 O  O   . THR C 1 82  ? 37.390 16.908  33.364 1.00 31.55 ? 57   THR C O   1 
ATOM   2228 C  CB  . THR C 1 82  ? 37.813 13.669  33.596 1.00 30.08 ? 57   THR C CB  1 
ATOM   2229 O  OG1 . THR C 1 82  ? 38.904 12.849  33.972 1.00 32.28 ? 57   THR C OG1 1 
ATOM   2230 C  CG2 . THR C 1 82  ? 38.044 13.945  32.109 1.00 33.98 ? 57   THR C CG2 1 
ATOM   2231 N  N   . ASP C 1 83  ? 35.831 16.009  34.675 1.00 26.77 ? 58   ASP C N   1 
ATOM   2232 C  CA  . ASP C 1 83  ? 34.940 17.120  34.486 1.00 29.31 ? 58   ASP C CA  1 
ATOM   2233 C  C   . ASP C 1 83  ? 35.387 18.422  35.173 1.00 28.49 ? 58   ASP C C   1 
ATOM   2234 O  O   . ASP C 1 83  ? 35.241 19.515  34.614 1.00 29.44 ? 58   ASP C O   1 
ATOM   2235 C  CB  . ASP C 1 83  ? 33.489 16.679  34.870 1.00 36.00 ? 58   ASP C CB  1 
ATOM   2236 C  CG  . ASP C 1 83  ? 32.849 15.532  34.032 1.00 40.53 ? 58   ASP C CG  1 
ATOM   2237 O  OD1 . ASP C 1 83  ? 33.503 14.924  33.151 1.00 41.90 ? 58   ASP C OD1 1 
ATOM   2238 O  OD2 . ASP C 1 83  ? 31.673 15.229  34.294 1.00 42.29 ? 58   ASP C OD2 1 
ATOM   2239 N  N   . LEU C 1 84  ? 35.964 18.350  36.383 1.00 26.07 ? 59   LEU C N   1 
ATOM   2240 C  CA  . LEU C 1 84  ? 36.486 19.508  37.074 1.00 21.52 ? 59   LEU C CA  1 
ATOM   2241 C  C   . LEU C 1 84  ? 37.611 20.115  36.285 1.00 19.04 ? 59   LEU C C   1 
ATOM   2242 O  O   . LEU C 1 84  ? 37.748 21.317  36.312 1.00 20.31 ? 59   LEU C O   1 
ATOM   2243 C  CB  . LEU C 1 84  ? 37.028 19.118  38.444 1.00 19.27 ? 59   LEU C CB  1 
ATOM   2244 C  CG  . LEU C 1 84  ? 37.519 20.223  39.377 1.00 18.52 ? 59   LEU C CG  1 
ATOM   2245 C  CD1 . LEU C 1 84  ? 36.411 21.181  39.805 1.00 14.85 ? 59   LEU C CD1 1 
ATOM   2246 C  CD2 . LEU C 1 84  ? 38.147 19.538  40.574 1.00 18.90 ? 59   LEU C CD2 1 
ATOM   2247 N  N   . LEU C 1 85  ? 38.399 19.348  35.553 1.00 19.17 ? 60   LEU C N   1 
ATOM   2248 C  CA  . LEU C 1 85  ? 39.549 19.854  34.840 1.00 20.10 ? 60   LEU C CA  1 
ATOM   2249 C  C   . LEU C 1 85  ? 39.173 20.833  33.766 1.00 22.23 ? 60   LEU C C   1 
ATOM   2250 O  O   . LEU C 1 85  ? 39.912 21.768  33.474 1.00 24.00 ? 60   LEU C O   1 
ATOM   2251 C  CB  . LEU C 1 85  ? 40.290 18.718  34.206 1.00 18.56 ? 60   LEU C CB  1 
ATOM   2252 C  CG  . LEU C 1 85  ? 41.582 19.115  33.520 1.00 19.76 ? 60   LEU C CG  1 
ATOM   2253 C  CD1 . LEU C 1 85  ? 42.638 19.404  34.561 1.00 17.43 ? 60   LEU C CD1 1 
ATOM   2254 C  CD2 . LEU C 1 85  ? 42.018 18.002  32.555 1.00 20.53 ? 60   LEU C CD2 1 
ATOM   2255 N  N   . ASP C 1 86  ? 37.984 20.629  33.214 1.00 25.53 ? 61   ASP C N   1 
ATOM   2256 C  CA  . ASP C 1 86  ? 37.471 21.478  32.157 1.00 27.32 ? 61   ASP C CA  1 
ATOM   2257 C  C   . ASP C 1 86  ? 36.950 22.809  32.666 1.00 24.92 ? 61   ASP C C   1 
ATOM   2258 O  O   . ASP C 1 86  ? 36.768 23.738  31.883 1.00 26.04 ? 61   ASP C O   1 
ATOM   2259 C  CB  . ASP C 1 86  ? 36.365 20.729  31.389 1.00 35.92 ? 61   ASP C CB  1 
ATOM   2260 C  CG  . ASP C 1 86  ? 36.753 19.367  30.759 1.00 45.09 ? 61   ASP C CG  1 
ATOM   2261 O  OD1 . ASP C 1 86  ? 37.808 19.241  30.086 1.00 48.21 ? 61   ASP C OD1 1 
ATOM   2262 O  OD2 . ASP C 1 86  ? 35.970 18.414  30.956 1.00 49.47 ? 61   ASP C OD2 1 
ATOM   2263 N  N   . LYS C 1 87  ? 36.733 22.956  33.979 1.00 22.12 ? 62   LYS C N   1 
ATOM   2264 C  CA  . LYS C 1 87  ? 36.379 24.234  34.559 1.00 18.62 ? 62   LYS C CA  1 
ATOM   2265 C  C   . LYS C 1 87  ? 37.603 25.082  34.727 1.00 17.52 ? 62   LYS C C   1 
ATOM   2266 O  O   . LYS C 1 87  ? 37.491 26.205  35.176 1.00 19.68 ? 62   LYS C O   1 
ATOM   2267 C  CB  . LYS C 1 87  ? 35.718 24.064  35.888 1.00 17.21 ? 62   LYS C CB  1 
ATOM   2268 C  CG  . LYS C 1 87  ? 34.590 23.048  35.893 1.00 20.59 ? 62   LYS C CG  1 
ATOM   2269 C  CD  . LYS C 1 87  ? 33.552 23.302  34.802 1.00 23.94 ? 62   LYS C CD  1 
ATOM   2270 C  CE  . LYS C 1 87  ? 32.302 22.398  34.907 1.00 27.69 ? 62   LYS C CE  1 
ATOM   2271 N  NZ  . LYS C 1 87  ? 32.621 20.990  35.112 1.00 33.53 ? 62   LYS C NZ  1 
ATOM   2272 N  N   . PHE C 1 88  ? 38.792 24.629  34.385 1.00 16.95 ? 63   PHE C N   1 
ATOM   2273 C  CA  . PHE C 1 88  ? 39.980 25.398  34.650 1.00 18.75 ? 63   PHE C CA  1 
ATOM   2274 C  C   . PHE C 1 88  ? 40.714 25.584  33.363 1.00 20.52 ? 63   PHE C C   1 
ATOM   2275 O  O   . PHE C 1 88  ? 40.491 24.894  32.375 1.00 22.83 ? 63   PHE C O   1 
ATOM   2276 C  CB  . PHE C 1 88  ? 40.890 24.728  35.712 1.00 16.49 ? 63   PHE C CB  1 
ATOM   2277 C  CG  . PHE C 1 88  ? 40.280 24.790  37.109 1.00 15.86 ? 63   PHE C CG  1 
ATOM   2278 C  CD1 . PHE C 1 88  ? 40.413 25.931  37.893 1.00 15.21 ? 63   PHE C CD1 1 
ATOM   2279 C  CD2 . PHE C 1 88  ? 39.475 23.764  37.555 1.00 16.14 ? 63   PHE C CD2 1 
ATOM   2280 C  CE1 . PHE C 1 88  ? 39.717 26.070  39.078 1.00 11.64 ? 63   PHE C CE1 1 
ATOM   2281 C  CE2 . PHE C 1 88  ? 38.742 23.932  38.732 1.00 17.01 ? 63   PHE C CE2 1 
ATOM   2282 C  CZ  . PHE C 1 88  ? 38.864 25.086  39.487 1.00 11.68 ? 63   PHE C CZ  1 
ATOM   2283 N  N   . SER C 1 89  ? 41.606 26.540  33.393 1.00 22.26 ? 64   SER C N   1 
ATOM   2284 C  CA  . SER C 1 89  ? 42.458 26.748  32.268 1.00 25.03 ? 64   SER C CA  1 
ATOM   2285 C  C   . SER C 1 89  ? 43.928 26.724  32.651 1.00 27.32 ? 64   SER C C   1 
ATOM   2286 O  O   . SER C 1 89  ? 44.339 27.274  33.668 1.00 29.54 ? 64   SER C O   1 
ATOM   2287 C  CB  . SER C 1 89  ? 41.951 28.036  31.682 1.00 27.42 ? 64   SER C CB  1 
ATOM   2288 O  OG  . SER C 1 89  ? 42.936 28.782  30.987 1.00 33.90 ? 64   SER C OG  1 
ATOM   2289 N  N   . ASN C 1 90  ? 44.750 26.056  31.838 1.00 29.09 ? 65   ASN C N   1 
ATOM   2290 C  CA  . ASN C 1 90  ? 46.183 25.967  32.048 1.00 29.94 ? 65   ASN C CA  1 
ATOM   2291 C  C   . ASN C 1 90  ? 46.912 27.280  31.894 1.00 31.16 ? 65   ASN C C   1 
ATOM   2292 O  O   . ASN C 1 90  ? 46.482 28.228  31.252 1.00 32.15 ? 65   ASN C O   1 
ATOM   2293 C  CB  . ASN C 1 90  ? 46.770 24.950  31.088 1.00 31.52 ? 65   ASN C CB  1 
ATOM   2294 C  CG  . ASN C 1 90  ? 48.076 24.325  31.558 1.00 31.71 ? 65   ASN C CG  1 
ATOM   2295 O  OD1 . ASN C 1 90  ? 48.626 24.591  32.636 1.00 30.12 ? 65   ASN C OD1 1 
ATOM   2296 N  ND2 . ASN C 1 90  ? 48.554 23.457  30.676 1.00 32.43 ? 65   ASN C ND2 1 
ATOM   2297 N  N   . ILE C 1 91  ? 48.053 27.328  32.558 1.00 34.70 ? 66   ILE C N   1 
ATOM   2298 C  CA  . ILE C 1 91  ? 48.822 28.549  32.743 1.00 38.02 ? 66   ILE C CA  1 
ATOM   2299 C  C   . ILE C 1 91  ? 50.279 28.139  32.567 1.00 39.89 ? 66   ILE C C   1 
ATOM   2300 O  O   . ILE C 1 91  ? 50.733 27.095  33.077 1.00 40.56 ? 66   ILE C O   1 
ATOM   2301 C  CB  . ILE C 1 91  ? 48.560 29.130  34.181 1.00 37.96 ? 66   ILE C CB  1 
ATOM   2302 C  CG1 . ILE C 1 91  ? 47.097 29.513  34.381 1.00 37.79 ? 66   ILE C CG1 1 
ATOM   2303 C  CG2 . ILE C 1 91  ? 49.443 30.334  34.443 1.00 37.53 ? 66   ILE C CG2 1 
ATOM   2304 C  CD1 . ILE C 1 91  ? 46.677 29.759  35.833 1.00 39.98 ? 66   ILE C CD1 1 
ATOM   2305 N  N   . SER C 1 92  ? 50.960 29.038  31.828 1.00 41.75 ? 67   SER C N   1 
ATOM   2306 C  CA  . SER C 1 92  ? 52.349 28.856  31.397 1.00 44.33 ? 67   SER C CA  1 
ATOM   2307 C  C   . SER C 1 92  ? 53.320 28.647  32.536 1.00 44.00 ? 67   SER C C   1 
ATOM   2308 O  O   . SER C 1 92  ? 54.160 27.762  32.527 1.00 44.13 ? 67   SER C O   1 
ATOM   2309 C  CB  . SER C 1 92  ? 52.833 30.063  30.588 1.00 45.04 ? 67   SER C CB  1 
ATOM   2310 O  OG  . SER C 1 92  ? 52.984 31.250  31.372 1.00 50.12 ? 67   SER C OG  1 
ATOM   2311 N  N   . GLU C 1 93  ? 53.150 29.510  33.517 1.00 46.29 ? 68   GLU C N   1 
ATOM   2312 C  CA  . GLU C 1 93  ? 53.969 29.520  34.702 1.00 49.75 ? 68   GLU C CA  1 
ATOM   2313 C  C   . GLU C 1 93  ? 53.215 29.731  36.043 1.00 48.90 ? 68   GLU C C   1 
ATOM   2314 O  O   . GLU C 1 93  ? 52.374 30.624  36.267 1.00 49.09 ? 68   GLU C O   1 
ATOM   2315 C  CB  . GLU C 1 93  ? 55.066 30.581  34.479 1.00 53.81 ? 68   GLU C CB  1 
ATOM   2316 C  CG  . GLU C 1 93  ? 56.220 30.174  33.547 1.00 59.46 ? 68   GLU C CG  1 
ATOM   2317 C  CD  . GLU C 1 93  ? 57.364 29.378  34.192 1.00 63.46 ? 68   GLU C CD  1 
ATOM   2318 O  OE1 . GLU C 1 93  ? 57.165 28.736  35.239 1.00 65.40 ? 68   GLU C OE1 1 
ATOM   2319 O  OE2 . GLU C 1 93  ? 58.477 29.413  33.642 1.00 65.78 ? 68   GLU C OE2 1 
ATOM   2320 N  N   . GLY C 1 94  ? 53.643 28.896  36.995 1.00 46.18 ? 69   GLY C N   1 
ATOM   2321 C  CA  . GLY C 1 94  ? 52.938 28.734  38.244 1.00 41.09 ? 69   GLY C CA  1 
ATOM   2322 C  C   . GLY C 1 94  ? 52.252 27.398  38.142 1.00 37.69 ? 69   GLY C C   1 
ATOM   2323 O  O   . GLY C 1 94  ? 51.845 26.975  37.057 1.00 38.22 ? 69   GLY C O   1 
ATOM   2324 N  N   . LEU C 1 95  ? 52.181 26.712  39.279 1.00 34.58 ? 70   LEU C N   1 
ATOM   2325 C  CA  . LEU C 1 95  ? 51.394 25.484  39.399 1.00 30.54 ? 70   LEU C CA  1 
ATOM   2326 C  C   . LEU C 1 95  ? 49.895 25.821  39.513 1.00 28.30 ? 70   LEU C C   1 
ATOM   2327 O  O   . LEU C 1 95  ? 49.411 26.367  40.513 1.00 29.19 ? 70   LEU C O   1 
ATOM   2328 C  CB  . LEU C 1 95  ? 51.895 24.714  40.615 1.00 28.69 ? 70   LEU C CB  1 
ATOM   2329 C  CG  . LEU C 1 95  ? 51.380 23.328  40.950 1.00 27.08 ? 70   LEU C CG  1 
ATOM   2330 C  CD1 . LEU C 1 95  ? 51.749 22.340  39.816 1.00 26.63 ? 70   LEU C CD1 1 
ATOM   2331 C  CD2 . LEU C 1 95  ? 51.914 22.939  42.329 1.00 22.67 ? 70   LEU C CD2 1 
ATOM   2332 N  N   . SER C 1 96  ? 49.173 25.536  38.430 1.00 23.37 ? 71   SER C N   1 
ATOM   2333 C  CA  . SER C 1 96  ? 47.795 25.909  38.342 1.00 18.79 ? 71   SER C CA  1 
ATOM   2334 C  C   . SER C 1 96  ? 46.961 24.732  38.737 1.00 14.59 ? 71   SER C C   1 
ATOM   2335 O  O   . SER C 1 96  ? 47.420 23.616  38.830 1.00 13.92 ? 71   SER C O   1 
ATOM   2336 C  CB  . SER C 1 96  ? 47.499 26.362  36.929 1.00 19.04 ? 71   SER C CB  1 
ATOM   2337 O  OG  . SER C 1 96  ? 47.794 25.282  36.073 1.00 21.34 ? 71   SER C OG  1 
ATOM   2338 N  N   . ASN C 1 97  ? 45.691 25.004  38.938 1.00 15.21 ? 72   ASN C N   1 
ATOM   2339 C  CA  . ASN C 1 97  ? 44.712 24.002  39.262 1.00 16.38 ? 72   ASN C CA  1 
ATOM   2340 C  C   . ASN C 1 97  ? 44.530 23.023  38.120 1.00 17.89 ? 72   ASN C C   1 
ATOM   2341 O  O   . ASN C 1 97  ? 44.330 21.836  38.358 1.00 19.68 ? 72   ASN C O   1 
ATOM   2342 C  CB  . ASN C 1 97  ? 43.395 24.668  39.627 1.00 14.20 ? 72   ASN C CB  1 
ATOM   2343 C  CG  . ASN C 1 97  ? 43.443 25.398  40.958 1.00 16.98 ? 72   ASN C CG  1 
ATOM   2344 O  OD1 . ASN C 1 97  ? 44.439 25.399  41.698 1.00 15.50 ? 72   ASN C OD1 1 
ATOM   2345 N  ND2 . ASN C 1 97  ? 42.348 26.051  41.315 1.00 16.58 ? 72   ASN C ND2 1 
ATOM   2346 N  N   . TYR C 1 98  ? 44.626 23.493  36.878 1.00 17.45 ? 73   TYR C N   1 
ATOM   2347 C  CA  . TYR C 1 98  ? 44.546 22.649  35.715 1.00 16.35 ? 73   TYR C CA  1 
ATOM   2348 C  C   . TYR C 1 98  ? 45.628 21.603  35.846 1.00 16.88 ? 73   TYR C C   1 
ATOM   2349 O  O   . TYR C 1 98  ? 45.388 20.407  35.803 1.00 18.90 ? 73   TYR C O   1 
ATOM   2350 C  CB  . TYR C 1 98  ? 44.797 23.540  34.503 1.00 14.79 ? 73   TYR C CB  1 
ATOM   2351 C  CG  . TYR C 1 98  ? 44.618 22.779  33.215 1.00 18.01 ? 73   TYR C CG  1 
ATOM   2352 C  CD1 . TYR C 1 98  ? 45.649 22.000  32.745 1.00 18.75 ? 73   TYR C CD1 1 
ATOM   2353 C  CD2 . TYR C 1 98  ? 43.428 22.809  32.544 1.00 17.80 ? 73   TYR C CD2 1 
ATOM   2354 C  CE1 . TYR C 1 98  ? 45.507 21.189  31.632 1.00 23.12 ? 73   TYR C CE1 1 
ATOM   2355 C  CE2 . TYR C 1 98  ? 43.282 22.000  31.424 1.00 23.77 ? 73   TYR C CE2 1 
ATOM   2356 C  CZ  . TYR C 1 98  ? 44.300 21.160  30.987 1.00 22.85 ? 73   TYR C CZ  1 
ATOM   2357 O  OH  . TYR C 1 98  ? 44.105 20.242  29.959 1.00 27.47 ? 73   TYR C OH  1 
ATOM   2358 N  N   . SER C 1 99  ? 46.846 22.071  36.054 1.00 19.27 ? 74   SER C N   1 
ATOM   2359 C  CA  . SER C 1 99  ? 48.037 21.234  36.196 1.00 18.80 ? 74   SER C CA  1 
ATOM   2360 C  C   . SER C 1 99  ? 47.939 20.205  37.316 1.00 18.49 ? 74   SER C C   1 
ATOM   2361 O  O   . SER C 1 99  ? 48.192 19.026  37.062 1.00 18.14 ? 74   SER C O   1 
ATOM   2362 C  CB  . SER C 1 99  ? 49.160 22.197  36.410 1.00 19.97 ? 74   SER C CB  1 
ATOM   2363 O  OG  . SER C 1 99  ? 50.345 21.552  36.749 1.00 27.05 ? 74   SER C OG  1 
ATOM   2364 N  N   . ILE C 1 100 ? 47.536 20.603  38.532 1.00 17.15 ? 75   ILE C N   1 
ATOM   2365 C  CA  . ILE C 1 100 ? 47.360 19.670  39.640 1.00 15.78 ? 75   ILE C CA  1 
ATOM   2366 C  C   . ILE C 1 100 ? 46.266 18.688  39.303 1.00 15.56 ? 75   ILE C C   1 
ATOM   2367 O  O   . ILE C 1 100 ? 46.392 17.487  39.540 1.00 15.90 ? 75   ILE C O   1 
ATOM   2368 C  CB  . ILE C 1 100 ? 47.004 20.373  40.994 1.00 14.47 ? 75   ILE C CB  1 
ATOM   2369 C  CG1 . ILE C 1 100 ? 48.069 21.396  41.311 1.00 15.08 ? 75   ILE C CG1 1 
ATOM   2370 C  CG2 . ILE C 1 100 ? 46.847 19.406  42.151 1.00 9.44  ? 75   ILE C CG2 1 
ATOM   2371 C  CD1 . ILE C 1 100 ? 47.662 22.494  42.334 1.00 16.06 ? 75   ILE C CD1 1 
ATOM   2372 N  N   . ILE C 1 101 ? 45.174 19.165  38.739 1.00 15.87 ? 76   ILE C N   1 
ATOM   2373 C  CA  . ILE C 1 101 ? 44.072 18.254  38.540 1.00 16.45 ? 76   ILE C CA  1 
ATOM   2374 C  C   . ILE C 1 101 ? 44.423 17.278  37.416 1.00 18.42 ? 76   ILE C C   1 
ATOM   2375 O  O   . ILE C 1 101 ? 44.047 16.107  37.479 1.00 21.96 ? 76   ILE C O   1 
ATOM   2376 C  CB  . ILE C 1 101 ? 42.777 19.029  38.276 1.00 16.99 ? 76   ILE C CB  1 
ATOM   2377 C  CG1 . ILE C 1 101 ? 42.407 20.014  39.366 1.00 18.36 ? 76   ILE C CG1 1 
ATOM   2378 C  CG2 . ILE C 1 101 ? 41.661 18.026  38.294 1.00 18.72 ? 76   ILE C CG2 1 
ATOM   2379 C  CD1 . ILE C 1 101 ? 41.376 21.090  38.981 1.00 13.71 ? 76   ILE C CD1 1 
ATOM   2380 N  N   . ASP C 1 102 ? 45.169 17.686  36.395 1.00 19.28 ? 77   ASP C N   1 
ATOM   2381 C  CA  . ASP C 1 102 ? 45.673 16.806  35.340 1.00 20.35 ? 77   ASP C CA  1 
ATOM   2382 C  C   . ASP C 1 102 ? 46.477 15.616  35.867 1.00 18.75 ? 77   ASP C C   1 
ATOM   2383 O  O   . ASP C 1 102 ? 46.259 14.474  35.483 1.00 20.55 ? 77   ASP C O   1 
ATOM   2384 C  CB  . ASP C 1 102 ? 46.528 17.679  34.388 1.00 23.72 ? 77   ASP C CB  1 
ATOM   2385 C  CG  . ASP C 1 102 ? 46.796 17.143  32.984 1.00 27.17 ? 77   ASP C CG  1 
ATOM   2386 O  OD1 . ASP C 1 102 ? 46.195 16.148  32.611 1.00 29.11 ? 77   ASP C OD1 1 
ATOM   2387 O  OD2 . ASP C 1 102 ? 47.586 17.723  32.239 1.00 31.91 ? 77   ASP C OD2 1 
ATOM   2388 N  N   . LYS C 1 103 ? 47.401 15.826  36.791 1.00 18.00 ? 78   LYS C N   1 
ATOM   2389 C  CA  . LYS C 1 103 ? 48.064 14.729  37.494 1.00 19.18 ? 78   LYS C CA  1 
ATOM   2390 C  C   . LYS C 1 103 ? 47.114 13.802  38.229 1.00 16.84 ? 78   LYS C C   1 
ATOM   2391 O  O   . LYS C 1 103 ? 47.200 12.586  38.170 1.00 18.34 ? 78   LYS C O   1 
ATOM   2392 C  CB  . LYS C 1 103 ? 49.017 15.288  38.533 1.00 21.80 ? 78   LYS C CB  1 
ATOM   2393 C  CG  . LYS C 1 103 ? 50.492 15.453  38.249 1.00 26.26 ? 78   LYS C CG  1 
ATOM   2394 C  CD  . LYS C 1 103 ? 50.799 16.212  36.977 1.00 33.33 ? 78   LYS C CD  1 
ATOM   2395 C  CE  . LYS C 1 103 ? 51.977 17.190  37.154 1.00 36.36 ? 78   LYS C CE  1 
ATOM   2396 N  NZ  . LYS C 1 103 ? 51.538 18.516  37.592 1.00 40.57 ? 78   LYS C NZ  1 
ATOM   2397 N  N   . LEU C 1 104 ? 46.160 14.358  38.937 1.00 17.71 ? 79   LEU C N   1 
ATOM   2398 C  CA  . LEU C 1 104 ? 45.282 13.528  39.739 1.00 19.39 ? 79   LEU C CA  1 
ATOM   2399 C  C   . LEU C 1 104 ? 44.465 12.641  38.836 1.00 19.34 ? 79   LEU C C   1 
ATOM   2400 O  O   . LEU C 1 104 ? 44.358 11.479  39.161 1.00 22.92 ? 79   LEU C O   1 
ATOM   2401 C  CB  . LEU C 1 104 ? 44.412 14.342  40.708 1.00 15.20 ? 79   LEU C CB  1 
ATOM   2402 C  CG  . LEU C 1 104 ? 45.179 15.238  41.695 1.00 14.54 ? 79   LEU C CG  1 
ATOM   2403 C  CD1 . LEU C 1 104 ? 44.276 15.934  42.683 1.00 15.95 ? 79   LEU C CD1 1 
ATOM   2404 C  CD2 . LEU C 1 104 ? 46.119 14.401  42.497 1.00 14.50 ? 79   LEU C CD2 1 
ATOM   2405 N  N   . VAL C 1 105 ? 43.974 13.115  37.694 1.00 20.79 ? 80   VAL C N   1 
ATOM   2406 C  CA  . VAL C 1 105 ? 43.210 12.349  36.719 1.00 19.75 ? 80   VAL C CA  1 
ATOM   2407 C  C   . VAL C 1 105 ? 44.068 11.231  36.229 1.00 20.92 ? 80   VAL C C   1 
ATOM   2408 O  O   . VAL C 1 105 ? 43.583 10.133  36.160 1.00 19.45 ? 80   VAL C O   1 
ATOM   2409 C  CB  . VAL C 1 105 ? 42.850 13.201  35.502 1.00 20.41 ? 80   VAL C CB  1 
ATOM   2410 C  CG1 . VAL C 1 105 ? 42.103 12.364  34.477 1.00 22.80 ? 80   VAL C CG1 1 
ATOM   2411 C  CG2 . VAL C 1 105 ? 41.915 14.311  35.902 1.00 19.35 ? 80   VAL C CG2 1 
ATOM   2412 N  N   . ASN C 1 106 ? 45.344 11.472  35.936 1.00 24.00 ? 81   ASN C N   1 
ATOM   2413 C  CA  . ASN C 1 106 ? 46.215 10.435  35.447 1.00 24.32 ? 81   ASN C CA  1 
ATOM   2414 C  C   . ASN C 1 106 ? 46.460 9.366   36.474 1.00 25.83 ? 81   ASN C C   1 
ATOM   2415 O  O   . ASN C 1 106 ? 46.405 8.188   36.168 1.00 27.41 ? 81   ASN C O   1 
ATOM   2416 C  CB  . ASN C 1 106 ? 47.505 11.049  35.027 1.00 25.29 ? 81   ASN C CB  1 
ATOM   2417 C  CG  . ASN C 1 106 ? 47.389 11.689  33.658 1.00 27.98 ? 81   ASN C CG  1 
ATOM   2418 O  OD1 . ASN C 1 106 ? 47.347 10.977  32.667 1.00 30.37 ? 81   ASN C OD1 1 
ATOM   2419 N  ND2 . ASN C 1 106 ? 47.387 13.000  33.477 1.00 27.47 ? 81   ASN C ND2 1 
ATOM   2420 N  N   . ILE C 1 107 ? 46.690 9.750   37.714 1.00 27.31 ? 82   ILE C N   1 
ATOM   2421 C  CA  . ILE C 1 107 ? 46.839 8.819   38.814 1.00 27.48 ? 82   ILE C CA  1 
ATOM   2422 C  C   . ILE C 1 107 ? 45.586 7.971   39.042 1.00 29.22 ? 82   ILE C C   1 
ATOM   2423 O  O   . ILE C 1 107 ? 45.705 6.766   39.266 1.00 32.26 ? 82   ILE C O   1 
ATOM   2424 C  CB  . ILE C 1 107 ? 47.228 9.685   40.022 1.00 26.77 ? 82   ILE C CB  1 
ATOM   2425 C  CG1 . ILE C 1 107 ? 48.662 10.131  39.852 1.00 24.85 ? 82   ILE C CG1 1 
ATOM   2426 C  CG2 . ILE C 1 107 ? 47.046 8.977   41.344 1.00 26.49 ? 82   ILE C CG2 1 
ATOM   2427 C  CD1 . ILE C 1 107 ? 49.159 11.193  40.833 1.00 24.34 ? 82   ILE C CD1 1 
ATOM   2428 N  N   . VAL C 1 108 ? 44.371 8.547   38.968 1.00 30.80 ? 83   VAL C N   1 
ATOM   2429 C  CA  . VAL C 1 108 ? 43.099 7.834   39.209 1.00 29.90 ? 83   VAL C CA  1 
ATOM   2430 C  C   . VAL C 1 108 ? 42.793 6.906   38.019 1.00 30.67 ? 83   VAL C C   1 
ATOM   2431 O  O   . VAL C 1 108 ? 42.229 5.824   38.195 1.00 29.90 ? 83   VAL C O   1 
ATOM   2432 C  CB  . VAL C 1 108 ? 41.888 8.816   39.455 1.00 27.23 ? 83   VAL C CB  1 
ATOM   2433 C  CG1 . VAL C 1 108 ? 40.651 8.141   39.973 1.00 28.89 ? 83   VAL C CG1 1 
ATOM   2434 C  CG2 . VAL C 1 108 ? 42.154 9.759   40.558 1.00 28.33 ? 83   VAL C CG2 1 
ATOM   2435 N  N   . ASP C 1 109 ? 43.174 7.298   36.797 1.00 31.05 ? 84   ASP C N   1 
ATOM   2436 C  CA  . ASP C 1 109 ? 42.971 6.473   35.629 1.00 31.24 ? 84   ASP C CA  1 
ATOM   2437 C  C   . ASP C 1 109 ? 43.761 5.196   35.686 1.00 32.41 ? 84   ASP C C   1 
ATOM   2438 O  O   . ASP C 1 109 ? 43.233 4.156   35.291 1.00 32.47 ? 84   ASP C O   1 
ATOM   2439 C  CB  . ASP C 1 109 ? 43.296 7.192   34.350 1.00 31.90 ? 84   ASP C CB  1 
ATOM   2440 C  CG  . ASP C 1 109 ? 42.233 8.181   33.899 1.00 36.65 ? 84   ASP C CG  1 
ATOM   2441 O  OD1 . ASP C 1 109 ? 41.105 8.177   34.417 1.00 37.73 ? 84   ASP C OD1 1 
ATOM   2442 O  OD2 . ASP C 1 109 ? 42.537 8.969   33.000 1.00 40.83 ? 84   ASP C OD2 1 
ATOM   2443 N  N   . ASP C 1 110 ? 44.988 5.287   36.202 1.00 31.95 ? 85   ASP C N   1 
ATOM   2444 C  CA  . ASP C 1 110 ? 45.770 4.128   36.589 1.00 34.69 ? 85   ASP C CA  1 
ATOM   2445 C  C   . ASP C 1 110 ? 45.189 3.114   37.564 1.00 34.70 ? 85   ASP C C   1 
ATOM   2446 O  O   . ASP C 1 110 ? 45.464 1.921   37.471 1.00 34.86 ? 85   ASP C O   1 
ATOM   2447 C  CB  . ASP C 1 110 ? 47.030 4.593   37.248 1.00 37.43 ? 85   ASP C CB  1 
ATOM   2448 C  CG  . ASP C 1 110 ? 48.101 5.028   36.290 1.00 41.26 ? 85   ASP C CG  1 
ATOM   2449 O  OD1 . ASP C 1 110 ? 47.860 4.978   35.077 1.00 45.93 ? 85   ASP C OD1 1 
ATOM   2450 O  OD2 . ASP C 1 110 ? 49.169 5.423   36.776 1.00 43.39 ? 85   ASP C OD2 1 
ATOM   2451 N  N   . LEU C 1 111 ? 44.445 3.587   38.552 1.00 34.35 ? 86   LEU C N   1 
ATOM   2452 C  CA  . LEU C 1 111 ? 43.783 2.717   39.498 1.00 34.80 ? 86   LEU C CA  1 
ATOM   2453 C  C   . LEU C 1 111 ? 42.525 2.164   38.889 1.00 34.98 ? 86   LEU C C   1 
ATOM   2454 O  O   . LEU C 1 111 ? 42.117 1.094   39.288 1.00 36.02 ? 86   LEU C O   1 
ATOM   2455 C  CB  . LEU C 1 111 ? 43.443 3.508   40.735 1.00 35.24 ? 86   LEU C CB  1 
ATOM   2456 C  CG  . LEU C 1 111 ? 44.591 4.321   41.331 1.00 37.43 ? 86   LEU C CG  1 
ATOM   2457 C  CD1 . LEU C 1 111 ? 44.052 5.240   42.407 1.00 38.91 ? 86   LEU C CD1 1 
ATOM   2458 C  CD2 . LEU C 1 111 ? 45.728 3.422   41.825 1.00 37.75 ? 86   LEU C CD2 1 
ATOM   2459 N  N   . VAL C 1 112 ? 41.886 2.866   37.939 1.00 37.37 ? 87   VAL C N   1 
ATOM   2460 C  CA  . VAL C 1 112 ? 40.748 2.365   37.175 1.00 38.56 ? 87   VAL C CA  1 
ATOM   2461 C  C   . VAL C 1 112 ? 41.236 1.205   36.320 1.00 41.43 ? 87   VAL C C   1 
ATOM   2462 O  O   . VAL C 1 112 ? 40.621 0.154   36.337 1.00 43.44 ? 87   VAL C O   1 
ATOM   2463 C  CB  . VAL C 1 112 ? 40.167 3.478   36.302 1.00 36.61 ? 87   VAL C CB  1 
ATOM   2464 C  CG1 . VAL C 1 112 ? 39.054 2.945   35.450 1.00 37.46 ? 87   VAL C CG1 1 
ATOM   2465 C  CG2 . VAL C 1 112 ? 39.592 4.584   37.139 1.00 35.39 ? 87   VAL C CG2 1 
ATOM   2466 N  N   . GLU C 1 113 ? 42.356 1.329   35.613 1.00 45.33 ? 88   GLU C N   1 
ATOM   2467 C  CA  . GLU C 1 113 ? 42.933 0.237   34.842 1.00 50.04 ? 88   GLU C CA  1 
ATOM   2468 C  C   . GLU C 1 113 ? 43.480 -0.856  35.761 1.00 52.28 ? 88   GLU C C   1 
ATOM   2469 O  O   . GLU C 1 113 ? 43.503 -2.015  35.374 1.00 53.46 ? 88   GLU C O   1 
ATOM   2470 C  CB  . GLU C 1 113 ? 44.048 0.728   33.869 1.00 52.22 ? 88   GLU C CB  1 
ATOM   2471 C  CG  . GLU C 1 113 ? 43.776 1.785   32.749 1.00 56.99 ? 88   GLU C CG  1 
ATOM   2472 C  CD  . GLU C 1 113 ? 42.784 1.451   31.610 1.00 62.14 ? 88   GLU C CD  1 
ATOM   2473 O  OE1 . GLU C 1 113 ? 42.853 0.348   31.046 1.00 66.19 ? 88   GLU C OE1 1 
ATOM   2474 O  OE2 . GLU C 1 113 ? 41.926 2.286   31.266 1.00 62.89 ? 88   GLU C OE2 1 
ATOM   2475 N  N   . CYS C 1 114 ? 43.930 -0.535  36.982 1.00 55.77 ? 89   CYS C N   1 
ATOM   2476 C  CA  . CYS C 1 114 ? 44.471 -1.508  37.936 1.00 58.72 ? 89   CYS C CA  1 
ATOM   2477 C  C   . CYS C 1 114 ? 43.372 -2.333  38.578 1.00 60.22 ? 89   CYS C C   1 
ATOM   2478 O  O   . CYS C 1 114 ? 43.624 -3.464  39.000 1.00 61.13 ? 89   CYS C O   1 
ATOM   2479 C  CB  . CYS C 1 114 ? 45.285 -0.819  39.048 1.00 59.69 ? 89   CYS C CB  1 
ATOM   2480 S  SG  . CYS C 1 114 ? 46.103 -1.924  40.239 1.00 65.48 ? 89   CYS C SG  1 
ATOM   2481 N  N   . VAL C 1 115 ? 42.159 -1.749  38.657 1.00 61.71 ? 90   VAL C N   1 
ATOM   2482 C  CA  . VAL C 1 115 ? 40.963 -2.396  39.210 1.00 62.70 ? 90   VAL C CA  1 
ATOM   2483 C  C   . VAL C 1 115 ? 40.453 -3.516  38.278 1.00 64.64 ? 90   VAL C C   1 
ATOM   2484 O  O   . VAL C 1 115 ? 40.010 -4.562  38.779 1.00 65.07 ? 90   VAL C O   1 
ATOM   2485 C  CB  . VAL C 1 115 ? 39.934 -1.260  39.622 1.00 60.49 ? 90   VAL C CB  1 
ATOM   2486 C  CG1 . VAL C 1 115 ? 38.477 -1.428  39.231 1.00 58.30 ? 90   VAL C CG1 1 
ATOM   2487 C  CG2 . VAL C 1 115 ? 40.023 -1.060  41.125 1.00 58.40 ? 90   VAL C CG2 1 
ATOM   2488 N  N   . LYS C 1 116 ? 40.591 -3.348  36.938 1.00 66.41 ? 91   LYS C N   1 
ATOM   2489 C  CA  . LYS C 1 116 ? 40.281 -4.402  35.971 1.00 68.79 ? 91   LYS C CA  1 
ATOM   2490 C  C   . LYS C 1 116 ? 41.219 -5.638  36.092 1.00 70.22 ? 91   LYS C C   1 
ATOM   2491 O  O   . LYS C 1 116 ? 40.715 -6.728  36.404 1.00 72.46 ? 91   LYS C O   1 
ATOM   2492 C  CB  . LYS C 1 116 ? 40.233 -3.836  34.530 1.00 68.55 ? 91   LYS C CB  1 
ATOM   2493 C  CG  . LYS C 1 116 ? 39.560 -4.821  33.535 1.00 71.09 ? 91   LYS C CG  1 
ATOM   2494 C  CD  . LYS C 1 116 ? 39.779 -4.534  32.028 1.00 71.78 ? 91   LYS C CD  1 
ATOM   2495 C  CE  . LYS C 1 116 ? 39.128 -3.245  31.514 1.00 70.74 ? 91   LYS C CE  1 
ATOM   2496 N  NZ  . LYS C 1 116 ? 39.730 -2.834  30.259 1.00 70.64 ? 91   LYS C NZ  1 
ATOM   2497 N  N   . SER C 1 129 ? 25.399 2.470   38.962 1.00 56.13 ? 104  SER C N   1 
ATOM   2498 C  CA  . SER C 1 129 ? 25.444 3.921   38.739 1.00 55.65 ? 104  SER C CA  1 
ATOM   2499 C  C   . SER C 1 129 ? 24.850 4.688   39.939 1.00 52.95 ? 104  SER C C   1 
ATOM   2500 O  O   . SER C 1 129 ? 23.647 4.968   39.947 1.00 53.89 ? 104  SER C O   1 
ATOM   2501 C  CB  . SER C 1 129 ? 24.797 4.326   37.337 1.00 57.16 ? 104  SER C CB  1 
ATOM   2502 O  OG  . SER C 1 129 ? 23.517 3.792   36.940 1.00 56.67 ? 104  SER C OG  1 
ATOM   2503 N  N   . PRO C 1 130 ? 25.618 5.024   41.000 1.00 49.29 ? 105  PRO C N   1 
ATOM   2504 C  CA  . PRO C 1 130 ? 25.119 5.676   42.224 1.00 46.42 ? 105  PRO C CA  1 
ATOM   2505 C  C   . PRO C 1 130 ? 24.631 7.146   42.171 1.00 44.43 ? 105  PRO C C   1 
ATOM   2506 O  O   . PRO C 1 130 ? 24.768 7.791   41.134 1.00 42.75 ? 105  PRO C O   1 
ATOM   2507 C  CB  . PRO C 1 130 ? 26.265 5.445   43.181 1.00 45.66 ? 105  PRO C CB  1 
ATOM   2508 C  CG  . PRO C 1 130 ? 27.467 5.523   42.277 1.00 46.43 ? 105  PRO C CG  1 
ATOM   2509 C  CD  . PRO C 1 130 ? 27.036 4.706   41.089 1.00 47.56 ? 105  PRO C CD  1 
ATOM   2510 N  N   . GLU C 1 131 ? 24.023 7.707   43.240 1.00 44.38 ? 106  GLU C N   1 
ATOM   2511 C  CA  . GLU C 1 131 ? 23.436 9.055   43.238 1.00 43.85 ? 106  GLU C CA  1 
ATOM   2512 C  C   . GLU C 1 131 ? 24.414 10.202  43.420 1.00 42.61 ? 106  GLU C C   1 
ATOM   2513 O  O   . GLU C 1 131 ? 25.293 10.113  44.289 1.00 42.69 ? 106  GLU C O   1 
ATOM   2514 C  CB  . GLU C 1 131 ? 22.321 9.281   44.289 1.00 45.50 ? 106  GLU C CB  1 
ATOM   2515 C  CG  . GLU C 1 131 ? 20.936 8.664   44.035 1.00 46.22 ? 106  GLU C CG  1 
ATOM   2516 C  CD  . GLU C 1 131 ? 20.404 8.761   42.607 1.00 45.82 ? 106  GLU C CD  1 
ATOM   2517 O  OE1 . GLU C 1 131 ? 20.257 9.861   42.067 1.00 41.34 ? 106  GLU C OE1 1 
ATOM   2518 O  OE2 . GLU C 1 131 ? 20.152 7.699   42.032 1.00 48.83 ? 106  GLU C OE2 1 
ATOM   2519 N  N   . PRO C 1 132 ? 24.254 11.291  42.632 1.00 41.36 ? 107  PRO C N   1 
ATOM   2520 C  CA  . PRO C 1 132 ? 25.096 12.486  42.637 1.00 39.50 ? 107  PRO C CA  1 
ATOM   2521 C  C   . PRO C 1 132 ? 24.873 13.318  43.850 1.00 38.28 ? 107  PRO C C   1 
ATOM   2522 O  O   . PRO C 1 132 ? 23.767 13.685  44.226 1.00 39.34 ? 107  PRO C O   1 
ATOM   2523 C  CB  . PRO C 1 132 ? 24.680 13.288  41.434 1.00 40.28 ? 107  PRO C CB  1 
ATOM   2524 C  CG  . PRO C 1 132 ? 24.151 12.214  40.519 1.00 42.95 ? 107  PRO C CG  1 
ATOM   2525 C  CD  . PRO C 1 132 ? 23.353 11.358  41.490 1.00 41.93 ? 107  PRO C CD  1 
ATOM   2526 N  N   . ARG C 1 133 ? 26.012 13.570  44.436 1.00 35.97 ? 108  ARG C N   1 
ATOM   2527 C  CA  . ARG C 1 133 ? 26.055 14.439  45.561 1.00 35.65 ? 108  ARG C CA  1 
ATOM   2528 C  C   . ARG C 1 133 ? 26.953 15.609  45.219 1.00 34.88 ? 108  ARG C C   1 
ATOM   2529 O  O   . ARG C 1 133 ? 27.707 15.585  44.244 1.00 35.60 ? 108  ARG C O   1 
ATOM   2530 C  CB  . ARG C 1 133 ? 26.617 13.701  46.756 1.00 39.40 ? 108  ARG C CB  1 
ATOM   2531 C  CG  . ARG C 1 133 ? 25.710 12.742  47.530 1.00 44.75 ? 108  ARG C CG  1 
ATOM   2532 C  CD  . ARG C 1 133 ? 25.959 12.906  49.053 1.00 48.86 ? 108  ARG C CD  1 
ATOM   2533 N  NE  . ARG C 1 133 ? 25.401 11.801  49.824 1.00 52.47 ? 108  ARG C NE  1 
ATOM   2534 C  CZ  . ARG C 1 133 ? 25.920 11.400  50.988 1.00 54.55 ? 108  ARG C CZ  1 
ATOM   2535 N  NH1 . ARG C 1 133 ? 26.919 12.095  51.582 1.00 55.13 ? 108  ARG C NH1 1 
ATOM   2536 N  NH2 . ARG C 1 133 ? 25.427 10.267  51.532 1.00 54.84 ? 108  ARG C NH2 1 
ATOM   2537 N  N   . LEU C 1 134 ? 26.850 16.651  46.046 1.00 32.80 ? 109  LEU C N   1 
ATOM   2538 C  CA  . LEU C 1 134 ? 27.686 17.851  45.949 1.00 31.31 ? 109  LEU C CA  1 
ATOM   2539 C  C   . LEU C 1 134 ? 28.544 17.984  47.198 1.00 27.53 ? 109  LEU C C   1 
ATOM   2540 O  O   . LEU C 1 134 ? 28.058 17.849  48.335 1.00 29.28 ? 109  LEU C O   1 
ATOM   2541 C  CB  . LEU C 1 134 ? 26.876 19.173  45.813 1.00 30.72 ? 109  LEU C CB  1 
ATOM   2542 C  CG  . LEU C 1 134 ? 25.837 19.411  44.752 1.00 29.60 ? 109  LEU C CG  1 
ATOM   2543 C  CD1 . LEU C 1 134 ? 25.143 20.697  45.150 1.00 31.86 ? 109  LEU C CD1 1 
ATOM   2544 C  CD2 . LEU C 1 134 ? 26.433 19.432  43.347 1.00 30.24 ? 109  LEU C CD2 1 
ATOM   2545 N  N   . PHE C 1 135 ? 29.841 18.247  46.995 1.00 24.61 ? 110  PHE C N   1 
ATOM   2546 C  CA  . PHE C 1 135 ? 30.784 18.289  48.116 1.00 20.67 ? 110  PHE C CA  1 
ATOM   2547 C  C   . PHE C 1 135 ? 31.579 19.548  48.013 1.00 17.66 ? 110  PHE C C   1 
ATOM   2548 O  O   . PHE C 1 135 ? 31.746 20.049  46.924 1.00 19.14 ? 110  PHE C O   1 
ATOM   2549 C  CB  . PHE C 1 135 ? 31.721 17.098  48.021 1.00 23.08 ? 110  PHE C CB  1 
ATOM   2550 C  CG  . PHE C 1 135 ? 31.049 15.733  48.163 1.00 22.91 ? 110  PHE C CG  1 
ATOM   2551 C  CD1 . PHE C 1 135 ? 30.793 15.226  49.426 1.00 20.89 ? 110  PHE C CD1 1 
ATOM   2552 C  CD2 . PHE C 1 135 ? 30.737 15.008  47.024 1.00 23.49 ? 110  PHE C CD2 1 
ATOM   2553 C  CE1 . PHE C 1 135 ? 30.269 13.969  49.565 1.00 21.28 ? 110  PHE C CE1 1 
ATOM   2554 C  CE2 . PHE C 1 135 ? 30.186 13.751  47.178 1.00 24.67 ? 110  PHE C CE2 1 
ATOM   2555 C  CZ  . PHE C 1 135 ? 29.974 13.233  48.444 1.00 24.36 ? 110  PHE C CZ  1 
ATOM   2556 N  N   . THR C 1 136 ? 32.071 20.116  49.084 1.00 17.78 ? 111  THR C N   1 
ATOM   2557 C  CA  . THR C 1 136 ? 32.961 21.249  48.978 1.00 18.25 ? 111  THR C CA  1 
ATOM   2558 C  C   . THR C 1 136 ? 34.337 20.763  48.509 1.00 21.30 ? 111  THR C C   1 
ATOM   2559 O  O   . THR C 1 136 ? 34.518 19.547  48.617 1.00 26.22 ? 111  THR C O   1 
ATOM   2560 C  CB  . THR C 1 136 ? 33.057 21.895  50.359 1.00 19.78 ? 111  THR C CB  1 
ATOM   2561 O  OG1 . THR C 1 136 ? 33.780 20.989  51.199 1.00 19.58 ? 111  THR C OG1 1 
ATOM   2562 C  CG2 . THR C 1 136 ? 31.663 22.215  50.913 1.00 18.93 ? 111  THR C CG2 1 
ATOM   2563 N  N   . PRO C 1 137 ? 35.360 21.512  48.024 1.00 19.29 ? 112  PRO C N   1 
ATOM   2564 C  CA  . PRO C 1 137 ? 36.675 20.962  47.729 1.00 18.39 ? 112  PRO C CA  1 
ATOM   2565 C  C   . PRO C 1 137 ? 37.225 20.086  48.855 1.00 21.30 ? 112  PRO C C   1 
ATOM   2566 O  O   . PRO C 1 137 ? 37.605 18.953  48.611 1.00 22.05 ? 112  PRO C O   1 
ATOM   2567 C  CB  . PRO C 1 137 ? 37.455 22.226  47.520 1.00 18.00 ? 112  PRO C CB  1 
ATOM   2568 C  CG  . PRO C 1 137 ? 36.455 23.100  46.801 1.00 16.59 ? 112  PRO C CG  1 
ATOM   2569 C  CD  . PRO C 1 137 ? 35.265 22.919  47.660 1.00 14.34 ? 112  PRO C CD  1 
ATOM   2570 N  N   . GLU C 1 138 ? 37.221 20.521  50.119 1.00 22.83 ? 113  GLU C N   1 
ATOM   2571 C  CA  . GLU C 1 138 ? 37.717 19.735  51.235 1.00 24.32 ? 113  GLU C CA  1 
ATOM   2572 C  C   . GLU C 1 138 ? 37.046 18.394  51.408 1.00 23.52 ? 113  GLU C C   1 
ATOM   2573 O  O   . GLU C 1 138 ? 37.729 17.385  51.549 1.00 23.92 ? 113  GLU C O   1 
ATOM   2574 C  CB  . GLU C 1 138 ? 37.496 20.463  52.524 1.00 27.24 ? 113  GLU C CB  1 
ATOM   2575 C  CG  . GLU C 1 138 ? 38.700 20.955  53.281 1.00 35.37 ? 113  GLU C CG  1 
ATOM   2576 C  CD  . GLU C 1 138 ? 38.282 21.200  54.724 1.00 39.80 ? 113  GLU C CD  1 
ATOM   2577 O  OE1 . GLU C 1 138 ? 37.915 20.230  55.387 1.00 41.11 ? 113  GLU C OE1 1 
ATOM   2578 O  OE2 . GLU C 1 138 ? 38.296 22.339  55.182 1.00 41.53 ? 113  GLU C OE2 1 
ATOM   2579 N  N   . GLU C 1 139 ? 35.712 18.350  51.386 1.00 23.35 ? 114  GLU C N   1 
ATOM   2580 C  CA  . GLU C 1 139 ? 34.968 17.107  51.535 1.00 23.29 ? 114  GLU C CA  1 
ATOM   2581 C  C   . GLU C 1 139 ? 35.168 16.200  50.344 1.00 22.72 ? 114  GLU C C   1 
ATOM   2582 O  O   . GLU C 1 139 ? 35.160 14.981  50.518 1.00 23.79 ? 114  GLU C O   1 
ATOM   2583 C  CB  . GLU C 1 139 ? 33.470 17.344  51.622 1.00 26.84 ? 114  GLU C CB  1 
ATOM   2584 C  CG  . GLU C 1 139 ? 32.974 18.114  52.849 1.00 31.67 ? 114  GLU C CG  1 
ATOM   2585 C  CD  . GLU C 1 139 ? 31.578 18.736  52.701 1.00 37.47 ? 114  GLU C CD  1 
ATOM   2586 O  OE1 . GLU C 1 139 ? 30.884 18.533  51.681 1.00 35.31 ? 114  GLU C OE1 1 
ATOM   2587 O  OE2 . GLU C 1 139 ? 31.202 19.468  53.633 1.00 40.13 ? 114  GLU C OE2 1 
ATOM   2588 N  N   . PHE C 1 140 ? 35.320 16.775  49.143 1.00 20.03 ? 115  PHE C N   1 
ATOM   2589 C  CA  . PHE C 1 140 ? 35.606 15.979  47.971 1.00 18.15 ? 115  PHE C CA  1 
ATOM   2590 C  C   . PHE C 1 140 ? 36.997 15.397  48.157 1.00 17.33 ? 115  PHE C C   1 
ATOM   2591 O  O   . PHE C 1 140 ? 37.214 14.205  48.013 1.00 18.05 ? 115  PHE C O   1 
ATOM   2592 C  CB  . PHE C 1 140 ? 35.524 16.833  46.705 1.00 15.90 ? 115  PHE C CB  1 
ATOM   2593 C  CG  . PHE C 1 140 ? 35.825 16.063  45.429 1.00 17.09 ? 115  PHE C CG  1 
ATOM   2594 C  CD1 . PHE C 1 140 ? 34.861 15.299  44.845 1.00 16.21 ? 115  PHE C CD1 1 
ATOM   2595 C  CD2 . PHE C 1 140 ? 37.094 16.093  44.890 1.00 18.64 ? 115  PHE C CD2 1 
ATOM   2596 C  CE1 . PHE C 1 140 ? 35.193 14.558  43.744 1.00 19.14 ? 115  PHE C CE1 1 
ATOM   2597 C  CE2 . PHE C 1 140 ? 37.425 15.336  43.795 1.00 18.76 ? 115  PHE C CE2 1 
ATOM   2598 C  CZ  . PHE C 1 140 ? 36.463 14.570  43.217 1.00 19.41 ? 115  PHE C CZ  1 
ATOM   2599 N  N   . PHE C 1 141 ? 38.010 16.167  48.509 1.00 19.36 ? 116  PHE C N   1 
ATOM   2600 C  CA  . PHE C 1 141 ? 39.361 15.618  48.454 1.00 17.90 ? 116  PHE C CA  1 
ATOM   2601 C  C   . PHE C 1 141 ? 39.621 14.678  49.623 1.00 18.24 ? 116  PHE C C   1 
ATOM   2602 O  O   . PHE C 1 141 ? 40.505 13.855  49.549 1.00 19.98 ? 116  PHE C O   1 
ATOM   2603 C  CB  . PHE C 1 141 ? 40.376 16.744  48.162 1.00 16.33 ? 116  PHE C CB  1 
ATOM   2604 C  CG  . PHE C 1 141 ? 40.442 17.170  46.679 1.00 15.27 ? 116  PHE C CG  1 
ATOM   2605 C  CD1 . PHE C 1 141 ? 41.052 16.328  45.753 1.00 14.80 ? 116  PHE C CD1 1 
ATOM   2606 C  CD2 . PHE C 1 141 ? 39.806 18.324  46.240 1.00 12.85 ? 116  PHE C CD2 1 
ATOM   2607 C  CE1 . PHE C 1 141 ? 40.967 16.602  44.409 1.00 12.34 ? 116  PHE C CE1 1 
ATOM   2608 C  CE2 . PHE C 1 141 ? 39.715 18.569  44.885 1.00 14.12 ? 116  PHE C CE2 1 
ATOM   2609 C  CZ  . PHE C 1 141 ? 40.289 17.711  43.980 1.00 10.60 ? 116  PHE C CZ  1 
ATOM   2610 N  N   . ARG C 1 142 ? 38.755 14.664  50.641 1.00 20.78 ? 117  ARG C N   1 
ATOM   2611 C  CA  . ARG C 1 142 ? 38.796 13.751  51.770 1.00 21.33 ? 117  ARG C CA  1 
ATOM   2612 C  C   . ARG C 1 142 ? 38.412 12.368  51.308 1.00 20.46 ? 117  ARG C C   1 
ATOM   2613 O  O   . ARG C 1 142 ? 39.076 11.405  51.639 1.00 21.70 ? 117  ARG C O   1 
ATOM   2614 C  CB  . ARG C 1 142 ? 37.823 14.244  52.840 1.00 21.70 ? 117  ARG C CB  1 
ATOM   2615 C  CG  . ARG C 1 142 ? 37.838 13.513  54.177 1.00 27.63 ? 117  ARG C CG  1 
ATOM   2616 C  CD  . ARG C 1 142 ? 36.826 14.115  55.165 1.00 29.36 ? 117  ARG C CD  1 
ATOM   2617 N  NE  . ARG C 1 142 ? 37.230 15.464  55.616 1.00 32.11 ? 117  ARG C NE  1 
ATOM   2618 C  CZ  . ARG C 1 142 ? 36.411 16.535  55.565 1.00 32.37 ? 117  ARG C CZ  1 
ATOM   2619 N  NH1 . ARG C 1 142 ? 35.179 16.464  55.047 1.00 32.61 ? 117  ARG C NH1 1 
ATOM   2620 N  NH2 . ARG C 1 142 ? 36.836 17.701  56.025 1.00 30.98 ? 117  ARG C NH2 1 
ATOM   2621 N  N   . ILE C 1 143 ? 37.342 12.263  50.540 1.00 21.91 ? 118  ILE C N   1 
ATOM   2622 C  CA  . ILE C 1 143 ? 36.897 11.031  49.882 1.00 22.55 ? 118  ILE C CA  1 
ATOM   2623 C  C   . ILE C 1 143 ? 37.944 10.504  48.890 1.00 23.60 ? 118  ILE C C   1 
ATOM   2624 O  O   . ILE C 1 143 ? 38.254 9.316   48.853 1.00 24.72 ? 118  ILE C O   1 
ATOM   2625 C  CB  . ILE C 1 143 ? 35.527 11.358  49.213 1.00 22.47 ? 118  ILE C CB  1 
ATOM   2626 C  CG1 . ILE C 1 143 ? 34.467 11.506  50.293 1.00 21.67 ? 118  ILE C CG1 1 
ATOM   2627 C  CG2 . ILE C 1 143 ? 35.117 10.338  48.161 1.00 21.48 ? 118  ILE C CG2 1 
ATOM   2628 C  CD1 . ILE C 1 143 ? 33.164 12.169  49.825 1.00 21.12 ? 118  ILE C CD1 1 
ATOM   2629 N  N   . PHE C 1 144 ? 38.544 11.402  48.103 1.00 23.86 ? 119  PHE C N   1 
ATOM   2630 C  CA  . PHE C 1 144 ? 39.633 11.098  47.186 1.00 22.73 ? 119  PHE C CA  1 
ATOM   2631 C  C   . PHE C 1 144 ? 40.816 10.488  47.916 1.00 24.24 ? 119  PHE C C   1 
ATOM   2632 O  O   . PHE C 1 144 ? 41.233 9.416   47.511 1.00 24.28 ? 119  PHE C O   1 
ATOM   2633 C  CB  . PHE C 1 144 ? 40.038 12.357  46.426 1.00 15.88 ? 119  PHE C CB  1 
ATOM   2634 C  CG  . PHE C 1 144 ? 41.297 12.224  45.624 1.00 15.30 ? 119  PHE C CG  1 
ATOM   2635 C  CD1 . PHE C 1 144 ? 41.231 11.724  44.354 1.00 15.03 ? 119  PHE C CD1 1 
ATOM   2636 C  CD2 . PHE C 1 144 ? 42.495 12.639  46.172 1.00 12.85 ? 119  PHE C CD2 1 
ATOM   2637 C  CE1 . PHE C 1 144 ? 42.412 11.623  43.653 1.00 15.97 ? 119  PHE C CE1 1 
ATOM   2638 C  CE2 . PHE C 1 144 ? 43.675 12.526  45.473 1.00 15.16 ? 119  PHE C CE2 1 
ATOM   2639 C  CZ  . PHE C 1 144 ? 43.630 12.003  44.206 1.00 16.33 ? 119  PHE C CZ  1 
ATOM   2640 N  N   . ASN C 1 145 ? 41.396 11.145  48.936 1.00 26.61 ? 120  ASN C N   1 
ATOM   2641 C  CA  . ASN C 1 145 ? 42.511 10.621  49.728 1.00 27.10 ? 120  ASN C CA  1 
ATOM   2642 C  C   . ASN C 1 145 ? 42.225 9.301   50.400 1.00 28.31 ? 120  ASN C C   1 
ATOM   2643 O  O   . ASN C 1 145 ? 43.081 8.433   50.376 1.00 28.63 ? 120  ASN C O   1 
ATOM   2644 C  CB  . ASN C 1 145 ? 42.959 11.590  50.783 1.00 24.50 ? 120  ASN C CB  1 
ATOM   2645 C  CG  . ASN C 1 145 ? 43.837 12.659  50.215 1.00 27.34 ? 120  ASN C CG  1 
ATOM   2646 O  OD1 . ASN C 1 145 ? 43.864 13.757  50.761 1.00 32.26 ? 120  ASN C OD1 1 
ATOM   2647 N  ND2 . ASN C 1 145 ? 44.628 12.420  49.169 1.00 29.64 ? 120  ASN C ND2 1 
ATOM   2648 N  N   . ARG C 1 146 ? 41.017 9.136   50.947 1.00 30.80 ? 121  ARG C N   1 
ATOM   2649 C  CA  . ARG C 1 146 ? 40.549 7.862   51.441 1.00 35.49 ? 121  ARG C CA  1 
ATOM   2650 C  C   . ARG C 1 146 ? 40.514 6.767   50.357 1.00 36.43 ? 121  ARG C C   1 
ATOM   2651 O  O   . ARG C 1 146 ? 40.859 5.616   50.628 1.00 38.58 ? 121  ARG C O   1 
ATOM   2652 C  CB  . ARG C 1 146 ? 39.202 8.108   52.138 1.00 37.63 ? 121  ARG C CB  1 
ATOM   2653 C  CG  . ARG C 1 146 ? 38.534 6.865   52.651 1.00 42.24 ? 121  ARG C CG  1 
ATOM   2654 C  CD  . ARG C 1 146 ? 37.240 7.194   53.373 1.00 47.82 ? 121  ARG C CD  1 
ATOM   2655 N  NE  . ARG C 1 146 ? 36.399 6.001   53.529 1.00 51.79 ? 121  ARG C NE  1 
ATOM   2656 C  CZ  . ARG C 1 146 ? 36.788 4.912   54.233 1.00 55.38 ? 121  ARG C CZ  1 
ATOM   2657 N  NH1 . ARG C 1 146 ? 38.016 4.799   54.783 1.00 57.12 ? 121  ARG C NH1 1 
ATOM   2658 N  NH2 . ARG C 1 146 ? 35.928 3.904   54.446 1.00 55.34 ? 121  ARG C NH2 1 
ATOM   2659 N  N   . SER C 1 147 ? 40.171 7.089   49.106 1.00 36.49 ? 122  SER C N   1 
ATOM   2660 C  CA  . SER C 1 147 ? 40.274 6.177   47.974 1.00 36.44 ? 122  SER C CA  1 
ATOM   2661 C  C   . SER C 1 147 ? 41.660 5.723   47.529 1.00 37.85 ? 122  SER C C   1 
ATOM   2662 O  O   . SER C 1 147 ? 41.874 4.556   47.235 1.00 39.23 ? 122  SER C O   1 
ATOM   2663 C  CB  . SER C 1 147 ? 39.613 6.814   46.788 1.00 34.58 ? 122  SER C CB  1 
ATOM   2664 O  OG  . SER C 1 147 ? 38.286 7.132   47.155 1.00 34.47 ? 122  SER C OG  1 
ATOM   2665 N  N   . ILE C 1 148 ? 42.638 6.599   47.409 1.00 38.85 ? 123  ILE C N   1 
ATOM   2666 C  CA  . ILE C 1 148 ? 43.949 6.180   46.985 1.00 43.11 ? 123  ILE C CA  1 
ATOM   2667 C  C   . ILE C 1 148 ? 44.589 5.456   48.157 1.00 46.18 ? 123  ILE C C   1 
ATOM   2668 O  O   . ILE C 1 148 ? 45.449 4.614   47.937 1.00 47.69 ? 123  ILE C O   1 
ATOM   2669 C  CB  . ILE C 1 148 ? 44.843 7.378   46.505 1.00 42.65 ? 123  ILE C CB  1 
ATOM   2670 C  CG1 . ILE C 1 148 ? 44.147 8.410   45.599 1.00 38.38 ? 123  ILE C CG1 1 
ATOM   2671 C  CG2 . ILE C 1 148 ? 46.146 6.866   45.872 1.00 43.09 ? 123  ILE C CG2 1 
ATOM   2672 C  CD1 . ILE C 1 148 ? 43.242 7.872   44.489 1.00 35.80 ? 123  ILE C CD1 1 
ATOM   2673 N  N   . ASP C 1 149 ? 44.206 5.755   49.402 1.00 50.61 ? 124  ASP C N   1 
ATOM   2674 C  CA  . ASP C 1 149 ? 44.805 5.095   50.564 1.00 54.85 ? 124  ASP C CA  1 
ATOM   2675 C  C   . ASP C 1 149 ? 44.197 3.730   50.882 1.00 54.20 ? 124  ASP C C   1 
ATOM   2676 O  O   . ASP C 1 149 ? 44.774 2.898   51.586 1.00 54.57 ? 124  ASP C O   1 
ATOM   2677 C  CB  . ASP C 1 149 ? 44.788 5.989   51.823 1.00 59.47 ? 124  ASP C CB  1 
ATOM   2678 C  CG  . ASP C 1 149 ? 45.794 7.151   51.915 1.00 63.36 ? 124  ASP C CG  1 
ATOM   2679 O  OD1 . ASP C 1 149 ? 45.935 7.919   50.949 1.00 63.45 ? 124  ASP C OD1 1 
ATOM   2680 O  OD2 . ASP C 1 149 ? 46.414 7.295   52.988 1.00 66.94 ? 124  ASP C OD2 1 
ATOM   2681 N  N   . ALA C 1 150 ? 43.039 3.460   50.281 1.00 54.57 ? 125  ALA C N   1 
ATOM   2682 C  CA  . ALA C 1 150 ? 42.427 2.137   50.314 1.00 56.99 ? 125  ALA C CA  1 
ATOM   2683 C  C   . ALA C 1 150 ? 43.150 1.108   49.440 1.00 58.85 ? 125  ALA C C   1 
ATOM   2684 O  O   . ALA C 1 150 ? 42.617 0.022   49.161 1.00 59.46 ? 125  ALA C O   1 
ATOM   2685 C  CB  . ALA C 1 150 ? 40.982 2.263   49.824 1.00 56.08 ? 125  ALA C CB  1 
ATOM   2686 N  N   . PHE C 1 151 ? 44.343 1.552   48.975 1.00 60.81 ? 126  PHE C N   1 
ATOM   2687 C  CA  . PHE C 1 151 ? 45.408 0.793   48.316 1.00 62.82 ? 126  PHE C CA  1 
ATOM   2688 C  C   . PHE C 1 151 ? 46.675 0.603   49.241 1.00 64.91 ? 126  PHE C C   1 
ATOM   2689 O  O   . PHE C 1 151 ? 47.801 0.492   48.731 1.00 65.88 ? 126  PHE C O   1 
ATOM   2690 C  CB  . PHE C 1 151 ? 45.715 1.476   46.898 1.00 60.15 ? 126  PHE C CB  1 
ATOM   2691 C  CG  . PHE C 1 151 ? 44.638 1.419   45.778 1.00 57.55 ? 126  PHE C CG  1 
ATOM   2692 C  CD1 . PHE C 1 151 ? 43.594 2.334   45.731 1.00 56.09 ? 126  PHE C CD1 1 
ATOM   2693 C  CD2 . PHE C 1 151 ? 44.655 0.421   44.813 1.00 56.90 ? 126  PHE C CD2 1 
ATOM   2694 C  CE1 . PHE C 1 151 ? 42.568 2.227   44.807 1.00 52.24 ? 126  PHE C CE1 1 
ATOM   2695 C  CE2 . PHE C 1 151 ? 43.627 0.319   43.884 1.00 54.42 ? 126  PHE C CE2 1 
ATOM   2696 C  CZ  . PHE C 1 151 ? 42.573 1.208   43.889 1.00 52.99 ? 126  PHE C CZ  1 
ATOM   2697 N  N   . ASN D 1 36  ? 47.774 44.287  38.626 1.00 52.77 ? 11   ASN D N   1 
ATOM   2698 C  CA  . ASN D 1 36  ? 46.416 43.904  38.273 1.00 53.01 ? 11   ASN D CA  1 
ATOM   2699 C  C   . ASN D 1 36  ? 46.383 43.039  36.995 1.00 52.04 ? 11   ASN D C   1 
ATOM   2700 O  O   . ASN D 1 36  ? 46.673 41.852  37.139 1.00 53.30 ? 11   ASN D O   1 
ATOM   2701 C  CB  . ASN D 1 36  ? 45.488 45.136  38.154 1.00 52.37 ? 11   ASN D CB  1 
ATOM   2702 N  N   . VAL D 1 37  ? 46.135 43.551  35.763 1.00 49.81 ? 12   VAL D N   1 
ATOM   2703 C  CA  . VAL D 1 37  ? 45.936 42.823  34.490 1.00 45.10 ? 12   VAL D CA  1 
ATOM   2704 C  C   . VAL D 1 37  ? 46.697 41.529  34.194 1.00 40.73 ? 12   VAL D C   1 
ATOM   2705 O  O   . VAL D 1 37  ? 46.109 40.477  33.958 1.00 39.20 ? 12   VAL D O   1 
ATOM   2706 C  CB  . VAL D 1 37  ? 46.118 43.863  33.336 1.00 46.99 ? 12   VAL D CB  1 
ATOM   2707 C  CG1 . VAL D 1 37  ? 46.377 43.229  31.966 1.00 47.11 ? 12   VAL D CG1 1 
ATOM   2708 C  CG2 . VAL D 1 37  ? 44.888 44.784  33.225 1.00 46.26 ? 12   VAL D CG2 1 
ATOM   2709 N  N   . LYS D 1 38  ? 48.014 41.610  34.165 1.00 37.97 ? 13   LYS D N   1 
ATOM   2710 C  CA  . LYS D 1 38  ? 48.844 40.432  34.132 1.00 36.45 ? 13   LYS D CA  1 
ATOM   2711 C  C   . LYS D 1 38  ? 48.402 39.322  35.117 1.00 36.18 ? 13   LYS D C   1 
ATOM   2712 O  O   . LYS D 1 38  ? 48.194 38.166  34.709 1.00 37.38 ? 13   LYS D O   1 
ATOM   2713 C  CB  . LYS D 1 38  ? 50.258 40.905  34.451 1.00 35.89 ? 13   LYS D CB  1 
ATOM   2714 N  N   . ASP D 1 39  ? 48.190 39.643  36.410 1.00 33.96 ? 14   ASP D N   1 
ATOM   2715 C  CA  . ASP D 1 39  ? 47.703 38.684  37.372 1.00 29.22 ? 14   ASP D CA  1 
ATOM   2716 C  C   . ASP D 1 39  ? 46.220 38.409  37.305 1.00 25.55 ? 14   ASP D C   1 
ATOM   2717 O  O   . ASP D 1 39  ? 45.799 37.316  37.647 1.00 25.36 ? 14   ASP D O   1 
ATOM   2718 C  CB  . ASP D 1 39  ? 48.158 39.126  38.726 1.00 33.71 ? 14   ASP D CB  1 
ATOM   2719 C  CG  . ASP D 1 39  ? 49.573 38.623  39.084 1.00 41.45 ? 14   ASP D CG  1 
ATOM   2720 O  OD1 . ASP D 1 39  ? 50.178 37.858  38.316 1.00 45.64 ? 14   ASP D OD1 1 
ATOM   2721 O  OD2 . ASP D 1 39  ? 50.083 38.981  40.161 1.00 44.73 ? 14   ASP D OD2 1 
ATOM   2722 N  N   . VAL D 1 40  ? 45.421 39.347  36.809 1.00 22.15 ? 15   VAL D N   1 
ATOM   2723 C  CA  . VAL D 1 40  ? 44.000 39.173  36.672 1.00 19.73 ? 15   VAL D CA  1 
ATOM   2724 C  C   . VAL D 1 40  ? 43.683 38.044  35.731 1.00 21.56 ? 15   VAL D C   1 
ATOM   2725 O  O   . VAL D 1 40  ? 42.825 37.217  36.016 1.00 23.37 ? 15   VAL D O   1 
ATOM   2726 C  CB  . VAL D 1 40  ? 43.294 40.462  36.234 1.00 18.49 ? 15   VAL D CB  1 
ATOM   2727 C  CG1 . VAL D 1 40  ? 41.883 40.238  35.684 1.00 17.31 ? 15   VAL D CG1 1 
ATOM   2728 C  CG2 . VAL D 1 40  ? 43.093 41.327  37.450 1.00 17.77 ? 15   VAL D CG2 1 
ATOM   2729 N  N   . THR D 1 41  ? 44.387 37.974  34.623 1.00 22.81 ? 16   THR D N   1 
ATOM   2730 C  CA  . THR D 1 41  ? 44.166 36.943  33.605 1.00 24.47 ? 16   THR D CA  1 
ATOM   2731 C  C   . THR D 1 41  ? 44.517 35.513  34.082 1.00 21.91 ? 16   THR D C   1 
ATOM   2732 O  O   . THR D 1 41  ? 43.904 34.526  33.676 1.00 20.78 ? 16   THR D O   1 
ATOM   2733 C  CB  . THR D 1 41  ? 44.991 37.520  32.381 1.00 26.36 ? 16   THR D CB  1 
ATOM   2734 O  OG1 . THR D 1 41  ? 44.076 38.310  31.630 1.00 28.31 ? 16   THR D OG1 1 
ATOM   2735 C  CG2 . THR D 1 41  ? 45.721 36.529  31.530 1.00 28.93 ? 16   THR D CG2 1 
ATOM   2736 N  N   . LYS D 1 42  ? 45.470 35.415  35.016 1.00 20.72 ? 17   LYS D N   1 
ATOM   2737 C  CA  . LYS D 1 42  ? 45.958 34.179  35.596 1.00 20.21 ? 17   LYS D CA  1 
ATOM   2738 C  C   . LYS D 1 42  ? 45.019 33.719  36.683 1.00 18.63 ? 17   LYS D C   1 
ATOM   2739 O  O   . LYS D 1 42  ? 44.754 32.526  36.783 1.00 21.04 ? 17   LYS D O   1 
ATOM   2740 C  CB  . LYS D 1 42  ? 47.277 34.522  36.207 1.00 24.75 ? 17   LYS D CB  1 
ATOM   2741 C  CG  . LYS D 1 42  ? 48.163 33.373  36.590 1.00 29.44 ? 17   LYS D CG  1 
ATOM   2742 C  CD  . LYS D 1 42  ? 49.365 33.928  37.347 1.00 32.96 ? 17   LYS D CD  1 
ATOM   2743 C  CE  . LYS D 1 42  ? 50.423 34.474  36.422 1.00 36.20 ? 17   LYS D CE  1 
ATOM   2744 N  NZ  . LYS D 1 42  ? 51.313 35.272  37.230 1.00 39.87 ? 17   LYS D NZ  1 
ATOM   2745 N  N   . LEU D 1 43  ? 44.483 34.656  37.468 1.00 16.11 ? 18   LEU D N   1 
ATOM   2746 C  CA  . LEU D 1 43  ? 43.391 34.389  38.362 1.00 13.77 ? 18   LEU D CA  1 
ATOM   2747 C  C   . LEU D 1 43  ? 42.158 33.926  37.636 1.00 14.10 ? 18   LEU D C   1 
ATOM   2748 O  O   . LEU D 1 43  ? 41.662 32.898  38.072 1.00 17.61 ? 18   LEU D O   1 
ATOM   2749 C  CB  . LEU D 1 43  ? 43.070 35.599  39.180 1.00 14.87 ? 18   LEU D CB  1 
ATOM   2750 C  CG  . LEU D 1 43  ? 42.103 35.485  40.362 1.00 15.58 ? 18   LEU D CG  1 
ATOM   2751 C  CD1 . LEU D 1 43  ? 42.567 34.568  41.470 1.00 11.31 ? 18   LEU D CD1 1 
ATOM   2752 C  CD2 . LEU D 1 43  ? 41.872 36.849  40.952 1.00 15.28 ? 18   LEU D CD2 1 
ATOM   2753 N  N   . VAL D 1 44  ? 41.617 34.544  36.561 1.00 15.42 ? 19   VAL D N   1 
ATOM   2754 C  CA  . VAL D 1 44  ? 40.479 34.034  35.786 1.00 13.39 ? 19   VAL D CA  1 
ATOM   2755 C  C   . VAL D 1 44  ? 40.704 32.587  35.385 1.00 14.30 ? 19   VAL D C   1 
ATOM   2756 O  O   . VAL D 1 44  ? 39.824 31.744  35.542 1.00 13.93 ? 19   VAL D O   1 
ATOM   2757 C  CB  . VAL D 1 44  ? 40.251 34.838  34.489 1.00 14.39 ? 19   VAL D CB  1 
ATOM   2758 C  CG1 . VAL D 1 44  ? 39.059 34.330  33.694 1.00 11.41 ? 19   VAL D CG1 1 
ATOM   2759 C  CG2 . VAL D 1 44  ? 39.913 36.255  34.797 1.00 12.80 ? 19   VAL D CG2 1 
ATOM   2760 N  N   . ALA D 1 45  ? 41.911 32.288  34.876 1.00 14.50 ? 20   ALA D N   1 
ATOM   2761 C  CA  . ALA D 1 45  ? 42.319 30.924  34.543 1.00 15.90 ? 20   ALA D CA  1 
ATOM   2762 C  C   . ALA D 1 45  ? 42.340 29.894  35.680 1.00 16.27 ? 20   ALA D C   1 
ATOM   2763 O  O   . ALA D 1 45  ? 42.153 28.697  35.464 1.00 14.91 ? 20   ALA D O   1 
ATOM   2764 C  CB  . ALA D 1 45  ? 43.719 30.983  33.946 1.00 16.48 ? 20   ALA D CB  1 
ATOM   2765 N  N   . ASN D 1 46  ? 42.543 30.396  36.914 1.00 16.20 ? 21   ASN D N   1 
ATOM   2766 C  CA  . ASN D 1 46  ? 42.665 29.549  38.081 1.00 14.59 ? 21   ASN D CA  1 
ATOM   2767 C  C   . ASN D 1 46  ? 41.408 29.513  38.923 1.00 15.22 ? 21   ASN D C   1 
ATOM   2768 O  O   . ASN D 1 46  ? 41.343 28.894  39.982 1.00 14.76 ? 21   ASN D O   1 
ATOM   2769 C  CB  . ASN D 1 46  ? 43.863 30.085  38.853 1.00 15.31 ? 21   ASN D CB  1 
ATOM   2770 C  CG  . ASN D 1 46  ? 44.760 29.000  39.360 1.00 12.22 ? 21   ASN D CG  1 
ATOM   2771 O  OD1 . ASN D 1 46  ? 45.002 28.023  38.669 1.00 15.31 ? 21   ASN D OD1 1 
ATOM   2772 N  ND2 . ASN D 1 46  ? 45.313 29.122  40.545 1.00 14.81 ? 21   ASN D ND2 1 
ATOM   2773 N  N   . LEU D 1 47  ? 40.364 30.201  38.493 1.00 15.62 ? 22   LEU D N   1 
ATOM   2774 C  CA  . LEU D 1 47  ? 39.069 30.126  39.157 1.00 15.32 ? 22   LEU D CA  1 
ATOM   2775 C  C   . LEU D 1 47  ? 38.172 29.241  38.319 1.00 15.81 ? 22   LEU D C   1 
ATOM   2776 O  O   . LEU D 1 47  ? 38.337 29.289  37.109 1.00 18.22 ? 22   LEU D O   1 
ATOM   2777 C  CB  . LEU D 1 47  ? 38.470 31.498  39.326 1.00 11.04 ? 22   LEU D CB  1 
ATOM   2778 C  CG  . LEU D 1 47  ? 39.203 32.454  40.210 1.00 10.12 ? 22   LEU D CG  1 
ATOM   2779 C  CD1 . LEU D 1 47  ? 38.580 33.801  40.004 1.00 11.85 ? 22   LEU D CD1 1 
ATOM   2780 C  CD2 . LEU D 1 47  ? 39.108 32.071  41.671 1.00 10.74 ? 22   LEU D CD2 1 
ATOM   2781 N  N   . PRO D 1 48  ? 37.246 28.422  38.825 1.00 16.11 ? 23   PRO D N   1 
ATOM   2782 C  CA  . PRO D 1 48  ? 36.365 27.588  38.004 1.00 15.30 ? 23   PRO D CA  1 
ATOM   2783 C  C   . PRO D 1 48  ? 35.533 28.456  37.064 1.00 16.55 ? 23   PRO D C   1 
ATOM   2784 O  O   . PRO D 1 48  ? 35.044 29.485  37.502 1.00 18.78 ? 23   PRO D O   1 
ATOM   2785 C  CB  . PRO D 1 48  ? 35.474 26.944  39.027 1.00 14.03 ? 23   PRO D CB  1 
ATOM   2786 C  CG  . PRO D 1 48  ? 36.252 27.043  40.317 1.00 16.22 ? 23   PRO D CG  1 
ATOM   2787 C  CD  . PRO D 1 48  ? 36.854 28.409  40.228 1.00 15.04 ? 23   PRO D CD  1 
ATOM   2788 N  N   . LYS D 1 49  ? 35.319 28.105  35.785 1.00 19.22 ? 24   LYS D N   1 
ATOM   2789 C  CA  . LYS D 1 49  ? 34.492 28.864  34.822 1.00 19.57 ? 24   LYS D CA  1 
ATOM   2790 C  C   . LYS D 1 49  ? 33.027 28.975  35.241 1.00 18.94 ? 24   LYS D C   1 
ATOM   2791 O  O   . LYS D 1 49  ? 32.381 29.956  34.910 1.00 22.65 ? 24   LYS D O   1 
ATOM   2792 C  CB  . LYS D 1 49  ? 34.575 28.214  33.425 1.00 20.25 ? 24   LYS D CB  1 
ATOM   2793 C  CG  . LYS D 1 49  ? 35.853 28.425  32.655 1.00 19.83 ? 24   LYS D CG  1 
ATOM   2794 C  CD  . LYS D 1 49  ? 36.049 27.261  31.683 1.00 20.33 ? 24   LYS D CD  1 
ATOM   2795 C  CE  . LYS D 1 49  ? 37.542 27.297  31.291 1.00 25.04 ? 24   LYS D CE  1 
ATOM   2796 N  NZ  . LYS D 1 49  ? 38.019 26.084  30.623 1.00 27.36 ? 24   LYS D NZ  1 
ATOM   2797 N  N   . ASP D 1 50  ? 32.490 28.011  36.007 1.00 20.97 ? 25   ASP D N   1 
ATOM   2798 C  CA  . ASP D 1 50  ? 31.146 27.984  36.585 1.00 20.24 ? 25   ASP D CA  1 
ATOM   2799 C  C   . ASP D 1 50  ? 31.084 28.420  38.037 1.00 20.26 ? 25   ASP D C   1 
ATOM   2800 O  O   . ASP D 1 50  ? 30.092 28.177  38.714 1.00 24.64 ? 25   ASP D O   1 
ATOM   2801 C  CB  . ASP D 1 50  ? 30.557 26.555  36.502 1.00 21.95 ? 25   ASP D CB  1 
ATOM   2802 C  CG  . ASP D 1 50  ? 31.274 25.501  37.333 1.00 26.54 ? 25   ASP D CG  1 
ATOM   2803 O  OD1 . ASP D 1 50  ? 32.429 25.721  37.693 1.00 28.24 ? 25   ASP D OD1 1 
ATOM   2804 O  OD2 . ASP D 1 50  ? 30.697 24.445  37.616 1.00 29.75 ? 25   ASP D OD2 1 
ATOM   2805 N  N   . TYR D 1 51  ? 32.109 29.038  38.591 1.00 19.65 ? 26   TYR D N   1 
ATOM   2806 C  CA  . TYR D 1 51  ? 31.978 29.716  39.865 1.00 19.99 ? 26   TYR D CA  1 
ATOM   2807 C  C   . TYR D 1 51  ? 31.327 31.078  39.666 1.00 20.55 ? 26   TYR D C   1 
ATOM   2808 O  O   . TYR D 1 51  ? 31.837 31.882  38.892 1.00 23.24 ? 26   TYR D O   1 
ATOM   2809 C  CB  . TYR D 1 51  ? 33.388 29.886  40.446 1.00 18.93 ? 26   TYR D CB  1 
ATOM   2810 C  CG  . TYR D 1 51  ? 33.487 30.459  41.844 1.00 18.30 ? 26   TYR D CG  1 
ATOM   2811 C  CD1 . TYR D 1 51  ? 32.718 29.938  42.855 1.00 17.48 ? 26   TYR D CD1 1 
ATOM   2812 C  CD2 . TYR D 1 51  ? 34.309 31.538  42.057 1.00 19.75 ? 26   TYR D CD2 1 
ATOM   2813 C  CE1 . TYR D 1 51  ? 32.689 30.542  44.078 1.00 17.10 ? 26   TYR D CE1 1 
ATOM   2814 C  CE2 . TYR D 1 51  ? 34.304 32.124  43.291 1.00 21.03 ? 26   TYR D CE2 1 
ATOM   2815 C  CZ  . TYR D 1 51  ? 33.494 31.613  44.276 1.00 19.84 ? 26   TYR D CZ  1 
ATOM   2816 O  OH  . TYR D 1 51  ? 33.553 32.163  45.538 1.00 26.79 ? 26   TYR D OH  1 
HETATM 2817 N  N   . MSE D 1 52  ? 30.240 31.351  40.390 1.00 20.11 ? 27   MSE D N   1 
HETATM 2818 C  CA  . MSE D 1 52  ? 29.563 32.640  40.409 1.00 19.68 ? 27   MSE D CA  1 
HETATM 2819 C  C   . MSE D 1 52  ? 29.972 33.547  41.554 1.00 19.24 ? 27   MSE D C   1 
HETATM 2820 O  O   . MSE D 1 52  ? 29.844 33.217  42.722 1.00 18.84 ? 27   MSE D O   1 
HETATM 2821 C  CB  . MSE D 1 52  ? 28.030 32.478  40.470 1.00 25.00 ? 27   MSE D CB  1 
HETATM 2822 C  CG  . MSE D 1 52  ? 27.356 31.633  39.361 1.00 27.34 ? 27   MSE D CG  1 
HETATM 2823 SE SE  . MSE D 1 52  ? 28.005 31.953  37.549 1.00 33.76 ? 27   MSE D SE  1 
HETATM 2824 C  CE  . MSE D 1 52  ? 27.146 33.538  37.334 1.00 29.16 ? 27   MSE D CE  1 
ATOM   2825 N  N   . ILE D 1 53  ? 30.503 34.700  41.191 1.00 18.26 ? 28   ILE D N   1 
ATOM   2826 C  CA  . ILE D 1 53  ? 30.838 35.733  42.127 1.00 18.98 ? 28   ILE D CA  1 
ATOM   2827 C  C   . ILE D 1 53  ? 29.668 36.703  42.239 1.00 19.61 ? 28   ILE D C   1 
ATOM   2828 O  O   . ILE D 1 53  ? 29.151 37.088  41.196 1.00 22.18 ? 28   ILE D O   1 
ATOM   2829 C  CB  . ILE D 1 53  ? 32.136 36.421  41.662 1.00 15.61 ? 28   ILE D CB  1 
ATOM   2830 C  CG1 . ILE D 1 53  ? 33.234 35.398  41.469 1.00 12.73 ? 28   ILE D CG1 1 
ATOM   2831 C  CG2 . ILE D 1 53  ? 32.593 37.471  42.693 1.00 15.00 ? 28   ILE D CG2 1 
ATOM   2832 C  CD1 . ILE D 1 53  ? 34.487 35.969  40.818 1.00 10.07 ? 28   ILE D CD1 1 
ATOM   2833 N  N   . THR D 1 54  ? 29.199 37.105  43.433 1.00 20.30 ? 29   THR D N   1 
ATOM   2834 C  CA  . THR D 1 54  ? 28.142 38.118  43.587 1.00 18.55 ? 29   THR D CA  1 
ATOM   2835 C  C   . THR D 1 54  ? 28.720 39.514  43.593 1.00 18.51 ? 29   THR D C   1 
ATOM   2836 O  O   . THR D 1 54  ? 29.681 39.757  44.305 1.00 20.24 ? 29   THR D O   1 
ATOM   2837 C  CB  . THR D 1 54  ? 27.248 37.915  44.853 1.00 18.42 ? 29   THR D CB  1 
ATOM   2838 O  OG1 . THR D 1 54  ? 26.791 36.570  44.817 1.00 20.41 ? 29   THR D OG1 1 
ATOM   2839 C  CG2 . THR D 1 54  ? 25.982 38.747  44.836 1.00 16.39 ? 29   THR D CG2 1 
ATOM   2840 N  N   . LEU D 1 55  ? 28.205 40.455  42.785 1.00 18.52 ? 30   LEU D N   1 
ATOM   2841 C  CA  . LEU D 1 55  ? 28.610 41.845  42.783 1.00 17.78 ? 30   LEU D CA  1 
ATOM   2842 C  C   . LEU D 1 55  ? 27.305 42.598  42.724 1.00 19.35 ? 30   LEU D C   1 
ATOM   2843 O  O   . LEU D 1 55  ? 26.420 42.245  41.946 1.00 19.98 ? 30   LEU D O   1 
ATOM   2844 C  CB  . LEU D 1 55  ? 29.390 42.149  41.505 1.00 18.28 ? 30   LEU D CB  1 
ATOM   2845 C  CG  . LEU D 1 55  ? 29.905 43.557  41.154 1.00 15.52 ? 30   LEU D CG  1 
ATOM   2846 C  CD1 . LEU D 1 55  ? 30.720 44.170  42.241 1.00 15.62 ? 30   LEU D CD1 1 
ATOM   2847 C  CD2 . LEU D 1 55  ? 30.732 43.522  39.879 1.00 17.11 ? 30   LEU D CD2 1 
ATOM   2848 N  N   . LYS D 1 56  ? 27.150 43.613  43.560 1.00 20.05 ? 31   LYS D N   1 
ATOM   2849 C  CA  . LYS D 1 56  ? 26.046 44.522  43.409 1.00 21.35 ? 31   LYS D CA  1 
ATOM   2850 C  C   . LYS D 1 56  ? 26.413 45.564  42.354 1.00 23.46 ? 31   LYS D C   1 
ATOM   2851 O  O   . LYS D 1 56  ? 27.223 46.470  42.561 1.00 23.96 ? 31   LYS D O   1 
ATOM   2852 C  CB  . LYS D 1 56  ? 25.702 45.148  44.722 1.00 21.22 ? 31   LYS D CB  1 
ATOM   2853 C  CG  . LYS D 1 56  ? 25.353 44.109  45.766 1.00 23.53 ? 31   LYS D CG  1 
ATOM   2854 C  CD  . LYS D 1 56  ? 24.738 44.814  46.976 1.00 28.13 ? 31   LYS D CD  1 
ATOM   2855 C  CE  . LYS D 1 56  ? 24.583 43.890  48.182 1.00 29.07 ? 31   LYS D CE  1 
ATOM   2856 N  NZ  . LYS D 1 56  ? 23.982 44.617  49.293 1.00 34.24 ? 31   LYS D NZ  1 
ATOM   2857 N  N   . TYR D 1 57  ? 25.818 45.356  41.172 1.00 25.01 ? 32   TYR D N   1 
ATOM   2858 C  CA  . TYR D 1 57  ? 26.219 46.004  39.925 1.00 25.06 ? 32   TYR D CA  1 
ATOM   2859 C  C   . TYR D 1 57  ? 25.377 47.248  39.752 1.00 26.53 ? 32   TYR D C   1 
ATOM   2860 O  O   . TYR D 1 57  ? 24.167 47.293  40.046 1.00 27.71 ? 32   TYR D O   1 
ATOM   2861 C  CB  . TYR D 1 57  ? 26.050 44.978  38.778 1.00 25.42 ? 32   TYR D CB  1 
ATOM   2862 C  CG  . TYR D 1 57  ? 26.196 45.465  37.336 1.00 24.15 ? 32   TYR D CG  1 
ATOM   2863 C  CD1 . TYR D 1 57  ? 27.433 45.460  36.728 1.00 22.29 ? 32   TYR D CD1 1 
ATOM   2864 C  CD2 . TYR D 1 57  ? 25.071 45.915  36.672 1.00 23.90 ? 32   TYR D CD2 1 
ATOM   2865 C  CE1 . TYR D 1 57  ? 27.558 45.961  35.459 1.00 24.06 ? 32   TYR D CE1 1 
ATOM   2866 C  CE2 . TYR D 1 57  ? 25.183 46.427  35.409 1.00 25.00 ? 32   TYR D CE2 1 
ATOM   2867 C  CZ  . TYR D 1 57  ? 26.427 46.458  34.822 1.00 26.48 ? 32   TYR D CZ  1 
ATOM   2868 O  OH  . TYR D 1 57  ? 26.533 47.012  33.558 1.00 26.81 ? 32   TYR D OH  1 
ATOM   2869 N  N   . VAL D 1 58  ? 26.099 48.297  39.333 1.00 28.52 ? 33   VAL D N   1 
ATOM   2870 C  CA  . VAL D 1 58  ? 25.505 49.613  39.093 1.00 27.57 ? 33   VAL D CA  1 
ATOM   2871 C  C   . VAL D 1 58  ? 24.973 49.634  37.670 1.00 27.14 ? 33   VAL D C   1 
ATOM   2872 O  O   . VAL D 1 58  ? 25.769 49.693  36.750 1.00 28.15 ? 33   VAL D O   1 
ATOM   2873 C  CB  . VAL D 1 58  ? 26.529 50.724  39.288 1.00 26.82 ? 33   VAL D CB  1 
ATOM   2874 C  CG1 . VAL D 1 58  ? 25.931 52.066  38.921 1.00 25.83 ? 33   VAL D CG1 1 
ATOM   2875 C  CG2 . VAL D 1 58  ? 26.880 50.758  40.755 1.00 25.22 ? 33   VAL D CG2 1 
ATOM   2876 N  N   . PRO D 1 59  ? 23.674 49.548  37.434 1.00 27.51 ? 34   PRO D N   1 
ATOM   2877 C  CA  . PRO D 1 59  ? 23.085 49.608  36.105 1.00 28.26 ? 34   PRO D CA  1 
ATOM   2878 C  C   . PRO D 1 59  ? 23.491 50.909  35.413 1.00 31.20 ? 34   PRO D C   1 
ATOM   2879 O  O   . PRO D 1 59  ? 23.649 51.980  36.012 1.00 32.62 ? 34   PRO D O   1 
ATOM   2880 C  CB  . PRO D 1 59  ? 21.617 49.574  36.407 1.00 27.82 ? 34   PRO D CB  1 
ATOM   2881 C  CG  . PRO D 1 59  ? 21.523 48.866  37.750 1.00 29.77 ? 34   PRO D CG  1 
ATOM   2882 C  CD  . PRO D 1 59  ? 22.668 49.494  38.488 1.00 27.97 ? 34   PRO D CD  1 
ATOM   2883 N  N   . GLY D 1 60  ? 23.756 50.780  34.117 1.00 32.89 ? 35   GLY D N   1 
ATOM   2884 C  CA  . GLY D 1 60  ? 24.265 51.891  33.338 1.00 34.68 ? 35   GLY D CA  1 
ATOM   2885 C  C   . GLY D 1 60  ? 25.749 52.065  33.438 1.00 34.91 ? 35   GLY D C   1 
ATOM   2886 O  O   . GLY D 1 60  ? 26.271 53.066  32.991 1.00 38.32 ? 35   GLY D O   1 
HETATM 2887 N  N   . MSE D 1 61  ? 26.456 51.105  33.995 1.00 36.03 ? 36   MSE D N   1 
HETATM 2888 C  CA  . MSE D 1 61  ? 27.910 51.084  34.060 1.00 38.11 ? 36   MSE D CA  1 
HETATM 2889 C  C   . MSE D 1 61  ? 28.634 51.193  32.726 1.00 38.57 ? 36   MSE D C   1 
HETATM 2890 O  O   . MSE D 1 61  ? 29.741 51.717  32.594 1.00 39.99 ? 36   MSE D O   1 
HETATM 2891 C  CB  . MSE D 1 61  ? 28.255 49.744  34.622 1.00 41.60 ? 36   MSE D CB  1 
HETATM 2892 C  CG  . MSE D 1 61  ? 28.972 49.795  35.911 1.00 45.00 ? 36   MSE D CG  1 
HETATM 2893 SE SE  . MSE D 1 61  ? 30.412 48.532  35.745 1.00 54.90 ? 36   MSE D SE  1 
HETATM 2894 C  CE  . MSE D 1 61  ? 30.966 48.492  33.897 1.00 45.21 ? 36   MSE D CE  1 
ATOM   2895 N  N   . ASP D 1 62  ? 27.956 50.571  31.760 1.00 39.01 ? 37   ASP D N   1 
ATOM   2896 C  CA  . ASP D 1 62  ? 28.357 50.446  30.370 1.00 37.84 ? 37   ASP D CA  1 
ATOM   2897 C  C   . ASP D 1 62  ? 28.125 51.687  29.525 1.00 37.29 ? 37   ASP D C   1 
ATOM   2898 O  O   . ASP D 1 62  ? 29.067 52.169  28.896 1.00 40.17 ? 37   ASP D O   1 
ATOM   2899 C  CB  . ASP D 1 62  ? 27.725 49.194  29.760 1.00 37.35 ? 37   ASP D CB  1 
ATOM   2900 C  CG  . ASP D 1 62  ? 26.258 48.854  30.083 1.00 40.62 ? 37   ASP D CG  1 
ATOM   2901 O  OD1 . ASP D 1 62  ? 25.560 49.672  30.709 1.00 39.43 ? 37   ASP D OD1 1 
ATOM   2902 O  OD2 . ASP D 1 62  ? 25.813 47.752  29.705 1.00 41.13 ? 37   ASP D OD2 1 
ATOM   2903 N  N   . VAL D 1 63  ? 26.930 52.266  29.525 1.00 36.85 ? 38   VAL D N   1 
ATOM   2904 C  CA  . VAL D 1 63  ? 26.665 53.462  28.719 1.00 38.43 ? 38   VAL D CA  1 
ATOM   2905 C  C   . VAL D 1 63  ? 27.021 54.828  29.311 1.00 39.02 ? 38   VAL D C   1 
ATOM   2906 O  O   . VAL D 1 63  ? 27.395 55.748  28.581 1.00 39.83 ? 38   VAL D O   1 
ATOM   2907 C  CB  . VAL D 1 63  ? 25.212 53.466  28.171 1.00 36.76 ? 38   VAL D CB  1 
ATOM   2908 C  CG1 . VAL D 1 63  ? 25.086 52.227  27.356 1.00 36.24 ? 38   VAL D CG1 1 
ATOM   2909 C  CG2 . VAL D 1 63  ? 24.081 53.482  29.175 1.00 36.31 ? 38   VAL D CG2 1 
ATOM   2910 N  N   . LEU D 1 64  ? 26.886 54.965  30.641 1.00 39.92 ? 39   LEU D N   1 
ATOM   2911 C  CA  . LEU D 1 64  ? 27.031 56.231  31.341 1.00 38.96 ? 39   LEU D CA  1 
ATOM   2912 C  C   . LEU D 1 64  ? 28.495 56.624  31.625 1.00 41.40 ? 39   LEU D C   1 
ATOM   2913 O  O   . LEU D 1 64  ? 29.397 55.777  31.589 1.00 40.82 ? 39   LEU D O   1 
ATOM   2914 C  CB  . LEU D 1 64  ? 26.208 56.247  32.637 1.00 35.81 ? 39   LEU D CB  1 
ATOM   2915 C  CG  . LEU D 1 64  ? 24.706 56.030  32.689 1.00 34.18 ? 39   LEU D CG  1 
ATOM   2916 C  CD1 . LEU D 1 64  ? 24.285 56.206  34.141 1.00 33.76 ? 39   LEU D CD1 1 
ATOM   2917 C  CD2 . LEU D 1 64  ? 23.900 56.980  31.827 1.00 31.66 ? 39   LEU D CD2 1 
ATOM   2918 N  N   . PRO D 1 65  ? 28.807 57.926  31.852 1.00 44.17 ? 40   PRO D N   1 
ATOM   2919 C  CA  . PRO D 1 65  ? 30.141 58.383  32.244 1.00 44.44 ? 40   PRO D CA  1 
ATOM   2920 C  C   . PRO D 1 65  ? 30.420 58.032  33.699 1.00 42.47 ? 40   PRO D C   1 
ATOM   2921 O  O   . PRO D 1 65  ? 29.550 58.003  34.562 1.00 42.05 ? 40   PRO D O   1 
ATOM   2922 C  CB  . PRO D 1 65  ? 30.115 59.908  32.011 1.00 45.14 ? 40   PRO D CB  1 
ATOM   2923 C  CG  . PRO D 1 65  ? 28.674 60.256  32.263 1.00 45.10 ? 40   PRO D CG  1 
ATOM   2924 C  CD  . PRO D 1 65  ? 27.934 59.092  31.603 1.00 46.22 ? 40   PRO D CD  1 
ATOM   2925 N  N   . SER D 1 66  ? 31.694 57.749  33.906 1.00 42.00 ? 41   SER D N   1 
ATOM   2926 C  CA  . SER D 1 66  ? 32.266 57.360  35.166 1.00 39.50 ? 41   SER D CA  1 
ATOM   2927 C  C   . SER D 1 66  ? 31.724 58.115  36.365 1.00 38.61 ? 41   SER D C   1 
ATOM   2928 O  O   . SER D 1 66  ? 31.345 57.439  37.303 1.00 38.99 ? 41   SER D O   1 
ATOM   2929 C  CB  . SER D 1 66  ? 33.760 57.491  35.009 1.00 40.43 ? 41   SER D CB  1 
ATOM   2930 O  OG  . SER D 1 66  ? 34.204 56.814  33.824 1.00 45.16 ? 41   SER D OG  1 
ATOM   2931 N  N   . HIS D 1 67  ? 31.550 59.442  36.396 1.00 38.17 ? 42   HIS D N   1 
ATOM   2932 C  CA  . HIS D 1 67  ? 31.018 60.127  37.567 1.00 36.99 ? 42   HIS D CA  1 
ATOM   2933 C  C   . HIS D 1 67  ? 29.633 59.685  38.068 1.00 38.51 ? 42   HIS D C   1 
ATOM   2934 O  O   . HIS D 1 67  ? 29.219 59.978  39.190 1.00 39.73 ? 42   HIS D O   1 
ATOM   2935 C  CB  . HIS D 1 67  ? 31.062 61.646  37.328 1.00 36.53 ? 42   HIS D CB  1 
ATOM   2936 C  CG  . HIS D 1 67  ? 29.988 62.146  36.370 1.00 34.40 ? 42   HIS D CG  1 
ATOM   2937 N  ND1 . HIS D 1 67  ? 30.070 62.275  35.063 1.00 35.82 ? 42   HIS D ND1 1 
ATOM   2938 C  CD2 . HIS D 1 67  ? 28.694 62.443  36.749 1.00 36.22 ? 42   HIS D CD2 1 
ATOM   2939 C  CE1 . HIS D 1 67  ? 28.872 62.607  34.629 1.00 35.92 ? 42   HIS D CE1 1 
ATOM   2940 N  NE2 . HIS D 1 67  ? 28.050 62.680  35.644 1.00 37.56 ? 42   HIS D NE2 1 
ATOM   2941 N  N   . CYS D 1 68  ? 28.848 58.974  37.261 1.00 40.38 ? 43   CYS D N   1 
ATOM   2942 C  CA  . CYS D 1 68  ? 27.521 58.516  37.662 1.00 40.95 ? 43   CYS D CA  1 
ATOM   2943 C  C   . CYS D 1 68  ? 27.545 57.165  38.394 1.00 38.66 ? 43   CYS D C   1 
ATOM   2944 O  O   . CYS D 1 68  ? 26.556 56.769  39.027 1.00 38.58 ? 43   CYS D O   1 
ATOM   2945 C  CB  . CYS D 1 68  ? 26.561 58.489  36.426 1.00 43.16 ? 43   CYS D CB  1 
ATOM   2946 S  SG  . CYS D 1 68  ? 25.889 60.126  35.971 1.00 50.07 ? 43   CYS D SG  1 
ATOM   2947 N  N   . TRP D 1 69  ? 28.677 56.450  38.300 1.00 34.96 ? 44   TRP D N   1 
ATOM   2948 C  CA  . TRP D 1 69  ? 28.763 55.094  38.789 1.00 32.27 ? 44   TRP D CA  1 
ATOM   2949 C  C   . TRP D 1 69  ? 30.055 54.754  39.486 1.00 32.35 ? 44   TRP D C   1 
ATOM   2950 O  O   . TRP D 1 69  ? 30.010 53.891  40.349 1.00 34.30 ? 44   TRP D O   1 
ATOM   2951 C  CB  . TRP D 1 69  ? 28.502 54.045  37.688 1.00 29.74 ? 44   TRP D CB  1 
ATOM   2952 C  CG  . TRP D 1 69  ? 29.428 54.039  36.479 1.00 25.62 ? 44   TRP D CG  1 
ATOM   2953 C  CD1 . TRP D 1 69  ? 29.034 54.689  35.340 1.00 24.56 ? 44   TRP D CD1 1 
ATOM   2954 C  CD2 . TRP D 1 69  ? 30.636 53.392  36.360 1.00 24.29 ? 44   TRP D CD2 1 
ATOM   2955 N  NE1 . TRP D 1 69  ? 30.006 54.462  34.497 1.00 26.57 ? 44   TRP D NE1 1 
ATOM   2956 C  CE2 . TRP D 1 69  ? 30.972 53.705  35.046 1.00 25.16 ? 44   TRP D CE2 1 
ATOM   2957 C  CE3 . TRP D 1 69  ? 31.442 52.536  37.072 1.00 21.05 ? 44   TRP D CE3 1 
ATOM   2958 C  CZ2 . TRP D 1 69  ? 32.119 53.210  34.446 1.00 23.57 ? 44   TRP D CZ2 1 
ATOM   2959 C  CZ3 . TRP D 1 69  ? 32.600 52.058  36.490 1.00 21.72 ? 44   TRP D CZ3 1 
ATOM   2960 C  CH2 . TRP D 1 69  ? 32.956 52.395  35.194 1.00 23.72 ? 44   TRP D CH2 1 
ATOM   2961 N  N   . ILE D 1 70  ? 31.191 55.378  39.216 1.00 31.34 ? 45   ILE D N   1 
ATOM   2962 C  CA  . ILE D 1 70  ? 32.444 54.851  39.687 1.00 34.23 ? 45   ILE D CA  1 
ATOM   2963 C  C   . ILE D 1 70  ? 32.627 54.719  41.206 1.00 35.04 ? 45   ILE D C   1 
ATOM   2964 O  O   . ILE D 1 70  ? 33.222 53.726  41.618 1.00 36.05 ? 45   ILE D O   1 
ATOM   2965 C  CB  . ILE D 1 70  ? 33.586 55.584  38.980 1.00 35.62 ? 45   ILE D CB  1 
ATOM   2966 C  CG1 . ILE D 1 70  ? 34.959 54.917  39.068 1.00 36.05 ? 45   ILE D CG1 1 
ATOM   2967 C  CG2 . ILE D 1 70  ? 33.716 56.959  39.592 1.00 37.86 ? 45   ILE D CG2 1 
ATOM   2968 C  CD1 . ILE D 1 70  ? 35.020 53.482  38.545 1.00 36.81 ? 45   ILE D CD1 1 
ATOM   2969 N  N   . SER D 1 71  ? 32.100 55.591  42.080 1.00 35.07 ? 46   SER D N   1 
ATOM   2970 C  CA  . SER D 1 71  ? 32.421 55.538  43.500 1.00 35.85 ? 46   SER D CA  1 
ATOM   2971 C  C   . SER D 1 71  ? 31.651 54.443  44.213 1.00 35.51 ? 46   SER D C   1 
ATOM   2972 O  O   . SER D 1 71  ? 32.169 53.858  45.165 1.00 38.41 ? 46   SER D O   1 
ATOM   2973 C  CB  . SER D 1 71  ? 32.165 56.852  44.223 1.00 36.96 ? 46   SER D CB  1 
ATOM   2974 O  OG  . SER D 1 71  ? 30.786 57.005  44.534 1.00 40.12 ? 46   SER D OG  1 
ATOM   2975 N  N   . GLU D 1 72  ? 30.419 54.185  43.770 1.00 33.93 ? 47   GLU D N   1 
ATOM   2976 C  CA  . GLU D 1 72  ? 29.656 53.051  44.230 1.00 32.65 ? 47   GLU D CA  1 
ATOM   2977 C  C   . GLU D 1 72  ? 30.197 51.773  43.648 1.00 31.56 ? 47   GLU D C   1 
ATOM   2978 O  O   . GLU D 1 72  ? 30.216 50.761  44.339 1.00 31.25 ? 47   GLU D O   1 
ATOM   2979 C  CB  . GLU D 1 72  ? 28.206 53.193  43.842 1.00 36.42 ? 47   GLU D CB  1 
ATOM   2980 C  CG  . GLU D 1 72  ? 27.306 51.989  44.164 1.00 45.32 ? 47   GLU D CG  1 
ATOM   2981 C  CD  . GLU D 1 72  ? 26.964 51.716  45.628 1.00 48.90 ? 47   GLU D CD  1 
ATOM   2982 O  OE1 . GLU D 1 72  ? 27.839 51.323  46.399 1.00 52.24 ? 47   GLU D OE1 1 
ATOM   2983 O  OE2 . GLU D 1 72  ? 25.797 51.872  45.995 1.00 52.95 ? 47   GLU D OE2 1 
HETATM 2984 N  N   . MSE D 1 73  ? 30.646 51.788  42.398 1.00 30.45 ? 48   MSE D N   1 
HETATM 2985 C  CA  . MSE D 1 73  ? 31.189 50.592  41.798 1.00 31.67 ? 48   MSE D CA  1 
HETATM 2986 C  C   . MSE D 1 73  ? 32.499 50.155  42.444 1.00 30.88 ? 48   MSE D C   1 
HETATM 2987 O  O   . MSE D 1 73  ? 32.694 48.961  42.577 1.00 33.46 ? 48   MSE D O   1 
HETATM 2988 C  CB  . MSE D 1 73  ? 31.394 50.777  40.342 1.00 32.74 ? 48   MSE D CB  1 
HETATM 2989 C  CG  . MSE D 1 73  ? 31.510 49.459  39.632 1.00 36.29 ? 48   MSE D CG  1 
HETATM 2990 SE SE  . MSE D 1 73  ? 29.910 48.366  39.787 1.00 47.34 ? 48   MSE D SE  1 
HETATM 2991 C  CE  . MSE D 1 73  ? 30.895 46.927  39.264 1.00 38.75 ? 48   MSE D CE  1 
ATOM   2992 N  N   . VAL D 1 74  ? 33.433 50.984  42.904 1.00 30.60 ? 49   VAL D N   1 
ATOM   2993 C  CA  . VAL D 1 74  ? 34.605 50.504  43.671 1.00 29.47 ? 49   VAL D CA  1 
ATOM   2994 C  C   . VAL D 1 74  ? 34.285 50.012  45.074 1.00 27.89 ? 49   VAL D C   1 
ATOM   2995 O  O   . VAL D 1 74  ? 34.967 49.128  45.596 1.00 27.63 ? 49   VAL D O   1 
ATOM   2996 C  CB  . VAL D 1 74  ? 35.828 51.488  43.781 1.00 30.38 ? 49   VAL D CB  1 
ATOM   2997 C  CG1 . VAL D 1 74  ? 36.552 51.617  42.439 1.00 30.57 ? 49   VAL D CG1 1 
ATOM   2998 C  CG2 . VAL D 1 74  ? 35.440 52.863  44.340 1.00 30.43 ? 49   VAL D CG2 1 
ATOM   2999 N  N   . VAL D 1 75  ? 33.263 50.622  45.679 1.00 25.21 ? 50   VAL D N   1 
ATOM   3000 C  CA  . VAL D 1 75  ? 32.754 50.149  46.945 1.00 24.70 ? 50   VAL D CA  1 
ATOM   3001 C  C   . VAL D 1 75  ? 32.153 48.745  46.832 1.00 24.08 ? 50   VAL D C   1 
ATOM   3002 O  O   . VAL D 1 75  ? 32.438 47.921  47.699 1.00 25.08 ? 50   VAL D O   1 
ATOM   3003 C  CB  . VAL D 1 75  ? 31.757 51.172  47.504 1.00 24.15 ? 50   VAL D CB  1 
ATOM   3004 C  CG1 . VAL D 1 75  ? 30.945 50.583  48.650 1.00 24.85 ? 50   VAL D CG1 1 
ATOM   3005 C  CG2 . VAL D 1 75  ? 32.484 52.411  47.974 1.00 21.01 ? 50   VAL D CG2 1 
ATOM   3006 N  N   . GLN D 1 76  ? 31.343 48.470  45.796 1.00 22.06 ? 51   GLN D N   1 
ATOM   3007 C  CA  . GLN D 1 76  ? 30.807 47.154  45.522 1.00 22.13 ? 51   GLN D CA  1 
ATOM   3008 C  C   . GLN D 1 76  ? 31.810 46.099  45.123 1.00 20.89 ? 51   GLN D C   1 
ATOM   3009 O  O   . GLN D 1 76  ? 31.663 44.940  45.479 1.00 21.33 ? 51   GLN D O   1 
ATOM   3010 C  CB  . GLN D 1 76  ? 29.719 47.249  44.484 1.00 24.57 ? 51   GLN D CB  1 
ATOM   3011 C  CG  . GLN D 1 76  ? 28.496 47.999  45.018 1.00 26.12 ? 51   GLN D CG  1 
ATOM   3012 C  CD  . GLN D 1 76  ? 27.936 47.379  46.304 1.00 26.75 ? 51   GLN D CD  1 
ATOM   3013 O  OE1 . GLN D 1 76  ? 28.128 46.194  46.616 1.00 25.54 ? 51   GLN D OE1 1 
ATOM   3014 N  NE2 . GLN D 1 76  ? 27.234 48.198  47.088 1.00 26.23 ? 51   GLN D NE2 1 
ATOM   3015 N  N   . LEU D 1 77  ? 32.839 46.544  44.423 1.00 19.69 ? 52   LEU D N   1 
ATOM   3016 C  CA  . LEU D 1 77  ? 33.966 45.728  44.057 1.00 20.34 ? 52   LEU D CA  1 
ATOM   3017 C  C   . LEU D 1 77  ? 34.831 45.383  45.250 1.00 20.47 ? 52   LEU D C   1 
ATOM   3018 O  O   . LEU D 1 77  ? 35.199 44.215  45.356 1.00 23.75 ? 52   LEU D O   1 
ATOM   3019 C  CB  . LEU D 1 77  ? 34.866 46.398  42.976 1.00 19.72 ? 52   LEU D CB  1 
ATOM   3020 C  CG  . LEU D 1 77  ? 34.402 46.541  41.509 1.00 18.02 ? 52   LEU D CG  1 
ATOM   3021 C  CD1 . LEU D 1 77  ? 35.404 47.412  40.807 1.00 14.47 ? 52   LEU D CD1 1 
ATOM   3022 C  CD2 . LEU D 1 77  ? 34.217 45.177  40.844 1.00 14.93 ? 52   LEU D CD2 1 
ATOM   3023 N  N   . SER D 1 78  ? 35.178 46.294  46.165 1.00 21.36 ? 53   SER D N   1 
ATOM   3024 C  CA  . SER D 1 78  ? 35.913 45.942  47.377 1.00 22.45 ? 53   SER D CA  1 
ATOM   3025 C  C   . SER D 1 78  ? 35.173 44.873  48.166 1.00 22.70 ? 53   SER D C   1 
ATOM   3026 O  O   . SER D 1 78  ? 35.770 43.895  48.565 1.00 24.55 ? 53   SER D O   1 
ATOM   3027 C  CB  . SER D 1 78  ? 36.117 47.178  48.233 1.00 25.43 ? 53   SER D CB  1 
ATOM   3028 O  OG  . SER D 1 78  ? 36.882 46.917  49.410 1.00 32.17 ? 53   SER D OG  1 
ATOM   3029 N  N   . ASP D 1 79  ? 33.852 44.962  48.286 1.00 23.74 ? 54   ASP D N   1 
ATOM   3030 C  CA  . ASP D 1 79  ? 33.021 44.038  49.030 1.00 25.51 ? 54   ASP D CA  1 
ATOM   3031 C  C   . ASP D 1 79  ? 33.119 42.633  48.500 1.00 22.56 ? 54   ASP D C   1 
ATOM   3032 O  O   . ASP D 1 79  ? 33.390 41.711  49.250 1.00 22.33 ? 54   ASP D O   1 
ATOM   3033 C  CB  . ASP D 1 79  ? 31.565 44.500  48.963 1.00 32.00 ? 54   ASP D CB  1 
ATOM   3034 C  CG  . ASP D 1 79  ? 30.624 43.913  50.019 1.00 42.23 ? 54   ASP D CG  1 
ATOM   3035 O  OD1 . ASP D 1 79  ? 30.117 42.792  49.841 1.00 45.21 ? 54   ASP D OD1 1 
ATOM   3036 O  OD2 . ASP D 1 79  ? 30.364 44.607  51.018 1.00 49.94 ? 54   ASP D OD2 1 
ATOM   3037 N  N   . SER D 1 80  ? 32.943 42.520  47.192 1.00 19.99 ? 55   SER D N   1 
ATOM   3038 C  CA  . SER D 1 80  ? 32.933 41.258  46.504 1.00 16.42 ? 55   SER D CA  1 
ATOM   3039 C  C   . SER D 1 80  ? 34.279 40.596  46.521 1.00 14.71 ? 55   SER D C   1 
ATOM   3040 O  O   . SER D 1 80  ? 34.395 39.393  46.693 1.00 15.83 ? 55   SER D O   1 
ATOM   3041 C  CB  . SER D 1 80  ? 32.503 41.468  45.066 1.00 16.29 ? 55   SER D CB  1 
ATOM   3042 O  OG  . SER D 1 80  ? 31.170 41.909  44.886 1.00 19.97 ? 55   SER D OG  1 
ATOM   3043 N  N   . LEU D 1 81  ? 35.296 41.406  46.315 1.00 15.85 ? 56   LEU D N   1 
ATOM   3044 C  CA  . LEU D 1 81  ? 36.638 40.884  46.345 1.00 17.57 ? 56   LEU D CA  1 
ATOM   3045 C  C   . LEU D 1 81  ? 37.034 40.485  47.744 1.00 17.75 ? 56   LEU D C   1 
ATOM   3046 O  O   . LEU D 1 81  ? 37.782 39.527  47.863 1.00 19.01 ? 56   LEU D O   1 
ATOM   3047 C  CB  . LEU D 1 81  ? 37.619 41.904  45.848 1.00 17.61 ? 56   LEU D CB  1 
ATOM   3048 C  CG  . LEU D 1 81  ? 37.813 42.091  44.344 1.00 21.27 ? 56   LEU D CG  1 
ATOM   3049 C  CD1 . LEU D 1 81  ? 38.577 43.396  44.141 1.00 19.96 ? 56   LEU D CD1 1 
ATOM   3050 C  CD2 . LEU D 1 81  ? 38.540 40.936  43.687 1.00 16.32 ? 56   LEU D CD2 1 
ATOM   3051 N  N   . THR D 1 82  ? 36.560 41.169  48.803 1.00 19.07 ? 57   THR D N   1 
ATOM   3052 C  CA  . THR D 1 82  ? 36.864 40.818  50.189 1.00 17.97 ? 57   THR D CA  1 
ATOM   3053 C  C   . THR D 1 82  ? 36.126 39.571  50.566 1.00 18.20 ? 57   THR D C   1 
ATOM   3054 O  O   . THR D 1 82  ? 36.674 38.746  51.266 1.00 20.89 ? 57   THR D O   1 
ATOM   3055 C  CB  . THR D 1 82  ? 36.521 41.984  51.099 1.00 19.37 ? 57   THR D CB  1 
ATOM   3056 O  OG1 . THR D 1 82  ? 37.503 42.932  50.741 1.00 20.91 ? 57   THR D OG1 1 
ATOM   3057 C  CG2 . THR D 1 82  ? 36.778 41.786  52.575 1.00 26.13 ? 57   THR D CG2 1 
ATOM   3058 N  N   . ASP D 1 83  ? 34.924 39.346  50.085 1.00 18.03 ? 58   ASP D N   1 
ATOM   3059 C  CA  . ASP D 1 83  ? 34.293 38.066  50.220 1.00 18.76 ? 58   ASP D CA  1 
ATOM   3060 C  C   . ASP D 1 83  ? 34.958 37.009  49.397 1.00 20.46 ? 58   ASP D C   1 
ATOM   3061 O  O   . ASP D 1 83  ? 35.041 35.878  49.865 1.00 20.47 ? 58   ASP D O   1 
ATOM   3062 C  CB  . ASP D 1 83  ? 32.859 38.102  49.791 1.00 21.24 ? 58   ASP D CB  1 
ATOM   3063 C  CG  . ASP D 1 83  ? 32.043 39.157  50.517 1.00 26.19 ? 58   ASP D CG  1 
ATOM   3064 O  OD1 . ASP D 1 83  ? 32.458 39.665  51.572 1.00 26.83 ? 58   ASP D OD1 1 
ATOM   3065 O  OD2 . ASP D 1 83  ? 30.970 39.481  49.993 1.00 30.50 ? 58   ASP D OD2 1 
ATOM   3066 N  N   . LEU D 1 84  ? 35.449 37.324  48.197 1.00 19.65 ? 59   LEU D N   1 
ATOM   3067 C  CA  . LEU D 1 84  ? 36.099 36.331  47.383 1.00 18.09 ? 59   LEU D CA  1 
ATOM   3068 C  C   . LEU D 1 84  ? 37.345 35.878  48.090 1.00 19.12 ? 59   LEU D C   1 
ATOM   3069 O  O   . LEU D 1 84  ? 37.553 34.694  48.251 1.00 23.04 ? 59   LEU D O   1 
ATOM   3070 C  CB  . LEU D 1 84  ? 36.392 36.893  46.028 1.00 16.75 ? 59   LEU D CB  1 
ATOM   3071 C  CG  . LEU D 1 84  ? 36.808 35.864  45.048 1.00 17.14 ? 59   LEU D CG  1 
ATOM   3072 C  CD1 . LEU D 1 84  ? 35.714 34.823  44.909 1.00 16.41 ? 59   LEU D CD1 1 
ATOM   3073 C  CD2 . LEU D 1 84  ? 37.209 36.546  43.769 1.00 16.93 ? 59   LEU D CD2 1 
ATOM   3074 N  N   . LEU D 1 85  ? 38.132 36.764  48.667 1.00 21.47 ? 60   LEU D N   1 
ATOM   3075 C  CA  . LEU D 1 85  ? 39.332 36.428  49.431 1.00 22.73 ? 60   LEU D CA  1 
ATOM   3076 C  C   . LEU D 1 85  ? 39.173 35.401  50.564 1.00 24.38 ? 60   LEU D C   1 
ATOM   3077 O  O   . LEU D 1 85  ? 40.084 34.626  50.853 1.00 25.12 ? 60   LEU D O   1 
ATOM   3078 C  CB  . LEU D 1 85  ? 39.852 37.726  50.017 1.00 21.70 ? 60   LEU D CB  1 
ATOM   3079 C  CG  . LEU D 1 85  ? 41.196 37.710  50.670 1.00 23.77 ? 60   LEU D CG  1 
ATOM   3080 C  CD1 . LEU D 1 85  ? 42.256 37.514  49.598 1.00 22.63 ? 60   LEU D CD1 1 
ATOM   3081 C  CD2 . LEU D 1 85  ? 41.446 38.985  51.425 1.00 24.99 ? 60   LEU D CD2 1 
ATOM   3082 N  N   . ASP D 1 86  ? 38.005 35.386  51.224 1.00 26.63 ? 61   ASP D N   1 
ATOM   3083 C  CA  . ASP D 1 86  ? 37.705 34.524  52.363 1.00 25.59 ? 61   ASP D CA  1 
ATOM   3084 C  C   . ASP D 1 86  ? 37.428 33.112  51.872 1.00 22.43 ? 61   ASP D C   1 
ATOM   3085 O  O   . ASP D 1 86  ? 37.373 32.161  52.646 1.00 23.39 ? 61   ASP D O   1 
ATOM   3086 C  CB  . ASP D 1 86  ? 36.497 35.146  53.120 1.00 33.33 ? 61   ASP D CB  1 
ATOM   3087 C  CG  . ASP D 1 86  ? 35.889 34.390  54.325 1.00 40.36 ? 61   ASP D CG  1 
ATOM   3088 O  OD1 . ASP D 1 86  ? 36.478 34.403  55.424 1.00 44.78 ? 61   ASP D OD1 1 
ATOM   3089 O  OD2 . ASP D 1 86  ? 34.807 33.794  54.169 1.00 43.10 ? 61   ASP D OD2 1 
ATOM   3090 N  N   . LYS D 1 87  ? 37.289 32.899  50.575 1.00 17.94 ? 62   LYS D N   1 
ATOM   3091 C  CA  . LYS D 1 87  ? 37.048 31.574  50.058 1.00 13.29 ? 62   LYS D CA  1 
ATOM   3092 C  C   . LYS D 1 87  ? 38.344 30.855  49.757 1.00 12.68 ? 62   LYS D C   1 
ATOM   3093 O  O   . LYS D 1 87  ? 38.308 29.692  49.387 1.00 15.69 ? 62   LYS D O   1 
ATOM   3094 C  CB  . LYS D 1 87  ? 36.292 31.712  48.771 1.00 13.99 ? 62   LYS D CB  1 
ATOM   3095 C  CG  . LYS D 1 87  ? 35.036 32.517  48.890 1.00 16.25 ? 62   LYS D CG  1 
ATOM   3096 C  CD  . LYS D 1 87  ? 34.086 31.871  49.870 1.00 21.21 ? 62   LYS D CD  1 
ATOM   3097 C  CE  . LYS D 1 87  ? 32.997 32.898  50.166 1.00 23.50 ? 62   LYS D CE  1 
ATOM   3098 N  NZ  . LYS D 1 87  ? 32.319 33.267  48.937 1.00 30.45 ? 62   LYS D NZ  1 
ATOM   3099 N  N   . PHE D 1 88  ? 39.504 31.504  49.885 1.00 12.18 ? 63   PHE D N   1 
ATOM   3100 C  CA  . PHE D 1 88  ? 40.797 30.938  49.594 1.00 13.29 ? 63   PHE D CA  1 
ATOM   3101 C  C   . PHE D 1 88  ? 41.659 30.965  50.837 1.00 16.38 ? 63   PHE D C   1 
ATOM   3102 O  O   . PHE D 1 88  ? 41.401 31.701  51.798 1.00 16.40 ? 63   PHE D O   1 
ATOM   3103 C  CB  . PHE D 1 88  ? 41.495 31.773  48.552 1.00 11.01 ? 63   PHE D CB  1 
ATOM   3104 C  CG  . PHE D 1 88  ? 40.776 31.641  47.229 1.00 13.33 ? 63   PHE D CG  1 
ATOM   3105 C  CD1 . PHE D 1 88  ? 40.917 30.478  46.491 1.00 11.26 ? 63   PHE D CD1 1 
ATOM   3106 C  CD2 . PHE D 1 88  ? 39.904 32.635  46.823 1.00 13.18 ? 63   PHE D CD2 1 
ATOM   3107 C  CE1 . PHE D 1 88  ? 40.140 30.299  45.367 1.00 9.84  ? 63   PHE D CE1 1 
ATOM   3108 C  CE2 . PHE D 1 88  ? 39.126 32.436  45.690 1.00 13.90 ? 63   PHE D CE2 1 
ATOM   3109 C  CZ  . PHE D 1 88  ? 39.251 31.264  44.964 1.00 10.53 ? 63   PHE D CZ  1 
ATOM   3110 N  N   . SER D 1 89  ? 42.725 30.164  50.773 1.00 16.82 ? 64   SER D N   1 
ATOM   3111 C  CA  . SER D 1 89  ? 43.703 30.208  51.822 1.00 16.74 ? 64   SER D CA  1 
ATOM   3112 C  C   . SER D 1 89  ? 45.123 30.230  51.275 1.00 16.89 ? 64   SER D C   1 
ATOM   3113 O  O   . SER D 1 89  ? 45.377 29.918  50.120 1.00 16.97 ? 64   SER D O   1 
ATOM   3114 C  CB  . SER D 1 89  ? 43.430 29.068  52.849 1.00 18.93 ? 64   SER D CB  1 
ATOM   3115 O  OG  . SER D 1 89  ? 44.080 27.847  52.508 1.00 28.24 ? 64   SER D OG  1 
ATOM   3116 N  N   . ASN D 1 90  ? 46.080 30.661  52.095 1.00 16.96 ? 65   ASN D N   1 
ATOM   3117 C  CA  . ASN D 1 90  ? 47.479 30.684  51.746 1.00 15.98 ? 65   ASN D CA  1 
ATOM   3118 C  C   . ASN D 1 90  ? 48.027 29.319  51.496 1.00 15.15 ? 65   ASN D C   1 
ATOM   3119 O  O   . ASN D 1 90  ? 47.472 28.362  52.000 1.00 17.07 ? 65   ASN D O   1 
ATOM   3120 C  CB  . ASN D 1 90  ? 48.341 31.398  52.774 1.00 17.48 ? 65   ASN D CB  1 
ATOM   3121 C  CG  . ASN D 1 90  ? 48.232 32.904  52.684 1.00 19.71 ? 65   ASN D CG  1 
ATOM   3122 O  OD1 . ASN D 1 90  ? 48.695 33.551  51.752 1.00 25.73 ? 65   ASN D OD1 1 
ATOM   3123 N  ND2 . ASN D 1 90  ? 47.621 33.560  53.640 1.00 22.21 ? 65   ASN D ND2 1 
ATOM   3124 N  N   . ILE D 1 91  ? 49.077 29.253  50.672 1.00 15.61 ? 66   ILE D N   1 
ATOM   3125 C  CA  . ILE D 1 91  ? 49.778 28.029  50.363 1.00 16.53 ? 66   ILE D CA  1 
ATOM   3126 C  C   . ILE D 1 91  ? 51.232 28.235  50.711 1.00 16.49 ? 66   ILE D C   1 
ATOM   3127 O  O   . ILE D 1 91  ? 51.633 29.383  50.813 1.00 17.79 ? 66   ILE D O   1 
ATOM   3128 C  CB  . ILE D 1 91  ? 49.594 27.623  48.869 1.00 16.19 ? 66   ILE D CB  1 
ATOM   3129 C  CG1 . ILE D 1 91  ? 50.149 28.660  47.906 1.00 16.66 ? 66   ILE D CG1 1 
ATOM   3130 C  CG2 . ILE D 1 91  ? 48.115 27.329  48.611 1.00 12.63 ? 66   ILE D CG2 1 
ATOM   3131 C  CD1 . ILE D 1 91  ? 50.081 28.086  46.478 1.00 18.10 ? 66   ILE D CD1 1 
ATOM   3132 N  N   . SER D 1 92  ? 52.041 27.187  50.853 1.00 18.84 ? 67   SER D N   1 
ATOM   3133 C  CA  . SER D 1 92  ? 53.442 27.347  51.233 1.00 23.17 ? 67   SER D CA  1 
ATOM   3134 C  C   . SER D 1 92  ? 54.305 28.078  50.214 1.00 23.34 ? 67   SER D C   1 
ATOM   3135 O  O   . SER D 1 92  ? 55.250 28.779  50.552 1.00 25.92 ? 67   SER D O   1 
ATOM   3136 C  CB  . SER D 1 92  ? 54.084 26.006  51.543 1.00 23.00 ? 67   SER D CB  1 
ATOM   3137 O  OG  . SER D 1 92  ? 53.971 25.139  50.419 1.00 30.06 ? 67   SER D OG  1 
ATOM   3138 N  N   . GLU D 1 93  ? 53.981 27.968  48.942 1.00 25.32 ? 68   GLU D N   1 
ATOM   3139 C  CA  . GLU D 1 93  ? 54.755 28.626  47.914 1.00 27.08 ? 68   GLU D CA  1 
ATOM   3140 C  C   . GLU D 1 93  ? 54.045 28.401  46.597 1.00 25.08 ? 68   GLU D C   1 
ATOM   3141 O  O   . GLU D 1 93  ? 53.391 27.373  46.403 1.00 24.26 ? 68   GLU D O   1 
ATOM   3142 C  CB  . GLU D 1 93  ? 56.190 28.061  47.921 1.00 30.32 ? 68   GLU D CB  1 
ATOM   3143 C  CG  . GLU D 1 93  ? 56.711 27.081  46.883 1.00 40.98 ? 68   GLU D CG  1 
ATOM   3144 C  CD  . GLU D 1 93  ? 56.009 25.744  46.778 1.00 46.80 ? 68   GLU D CD  1 
ATOM   3145 O  OE1 . GLU D 1 93  ? 55.947 24.998  47.773 1.00 50.12 ? 68   GLU D OE1 1 
ATOM   3146 O  OE2 . GLU D 1 93  ? 55.508 25.470  45.676 1.00 52.68 ? 68   GLU D OE2 1 
ATOM   3147 N  N   . GLY D 1 94  ? 54.121 29.389  45.723 1.00 23.65 ? 69   GLY D N   1 
ATOM   3148 C  CA  . GLY D 1 94  ? 53.784 29.192  44.320 1.00 24.95 ? 69   GLY D CA  1 
ATOM   3149 C  C   . GLY D 1 94  ? 52.580 30.012  43.952 1.00 23.05 ? 69   GLY D C   1 
ATOM   3150 O  O   . GLY D 1 94  ? 52.270 30.941  44.691 1.00 24.04 ? 69   GLY D O   1 
ATOM   3151 N  N   . LEU D 1 95  ? 51.883 29.667  42.870 1.00 22.75 ? 70   LEU D N   1 
ATOM   3152 C  CA  . LEU D 1 95  ? 50.768 30.474  42.415 1.00 23.31 ? 70   LEU D CA  1 
ATOM   3153 C  C   . LEU D 1 95  ? 49.618 30.380  43.412 1.00 21.85 ? 70   LEU D C   1 
ATOM   3154 O  O   . LEU D 1 95  ? 49.170 29.262  43.689 1.00 23.27 ? 70   LEU D O   1 
ATOM   3155 C  CB  . LEU D 1 95  ? 50.307 29.902  41.114 1.00 22.88 ? 70   LEU D CB  1 
ATOM   3156 C  CG  . LEU D 1 95  ? 49.652 30.850  40.145 1.00 22.31 ? 70   LEU D CG  1 
ATOM   3157 C  CD1 . LEU D 1 95  ? 49.073 29.925  39.088 1.00 24.98 ? 70   LEU D CD1 1 
ATOM   3158 C  CD2 . LEU D 1 95  ? 48.576 31.722  40.710 1.00 21.90 ? 70   LEU D CD2 1 
ATOM   3159 N  N   . SER D 1 96  ? 49.143 31.526  43.918 1.00 19.05 ? 71   SER D N   1 
ATOM   3160 C  CA  . SER D 1 96  ? 48.132 31.561  44.977 1.00 16.36 ? 71   SER D CA  1 
ATOM   3161 C  C   . SER D 1 96  ? 47.008 32.518  44.667 1.00 15.90 ? 71   SER D C   1 
ATOM   3162 O  O   . SER D 1 96  ? 47.262 33.701  44.521 1.00 18.19 ? 71   SER D O   1 
ATOM   3163 C  CB  . SER D 1 96  ? 48.747 32.015  46.298 1.00 15.26 ? 71   SER D CB  1 
ATOM   3164 O  OG  . SER D 1 96  ? 47.822 32.217  47.360 1.00 16.34 ? 71   SER D OG  1 
ATOM   3165 N  N   . ASN D 1 97  ? 45.757 32.053  44.598 1.00 17.24 ? 72   ASN D N   1 
ATOM   3166 C  CA  . ASN D 1 97  ? 44.604 32.871  44.335 1.00 14.30 ? 72   ASN D CA  1 
ATOM   3167 C  C   . ASN D 1 97  ? 44.451 33.836  45.493 1.00 16.33 ? 72   ASN D C   1 
ATOM   3168 O  O   . ASN D 1 97  ? 44.170 35.023  45.286 1.00 16.94 ? 72   ASN D O   1 
ATOM   3169 C  CB  . ASN D 1 97  ? 43.399 31.967  44.208 1.00 14.51 ? 72   ASN D CB  1 
ATOM   3170 C  CG  . ASN D 1 97  ? 43.311 31.102  42.953 1.00 14.36 ? 72   ASN D CG  1 
ATOM   3171 O  OD1 . ASN D 1 97  ? 44.170 31.156  42.089 1.00 15.41 ? 72   ASN D OD1 1 
ATOM   3172 N  ND2 . ASN D 1 97  ? 42.291 30.261  42.779 1.00 14.10 ? 72   ASN D ND2 1 
ATOM   3173 N  N   . TYR D 1 98  ? 44.711 33.348  46.720 1.00 16.70 ? 73   TYR D N   1 
ATOM   3174 C  CA  . TYR D 1 98  ? 44.709 34.222  47.893 1.00 17.86 ? 73   TYR D CA  1 
ATOM   3175 C  C   . TYR D 1 98  ? 45.580 35.466  47.698 1.00 17.22 ? 73   TYR D C   1 
ATOM   3176 O  O   . TYR D 1 98  ? 45.047 36.559  47.813 1.00 19.51 ? 73   TYR D O   1 
ATOM   3177 C  CB  . TYR D 1 98  ? 45.171 33.479  49.182 1.00 15.83 ? 73   TYR D CB  1 
ATOM   3178 C  CG  . TYR D 1 98  ? 44.962 34.331  50.421 1.00 11.11 ? 73   TYR D CG  1 
ATOM   3179 C  CD1 . TYR D 1 98  ? 43.755 34.297  51.064 1.00 13.95 ? 73   TYR D CD1 1 
ATOM   3180 C  CD2 . TYR D 1 98  ? 45.932 35.212  50.823 1.00 14.63 ? 73   TYR D CD2 1 
ATOM   3181 C  CE1 . TYR D 1 98  ? 43.474 35.184  52.080 1.00 15.34 ? 73   TYR D CE1 1 
ATOM   3182 C  CE2 . TYR D 1 98  ? 45.663 36.140  51.814 1.00 15.34 ? 73   TYR D CE2 1 
ATOM   3183 C  CZ  . TYR D 1 98  ? 44.430 36.108  52.407 1.00 16.30 ? 73   TYR D CZ  1 
ATOM   3184 O  OH  . TYR D 1 98  ? 44.123 37.051  53.334 1.00 22.01 ? 73   TYR D OH  1 
ATOM   3185 N  N   . SER D 1 99  ? 46.888 35.357  47.402 1.00 18.57 ? 74   SER D N   1 
ATOM   3186 C  CA  . SER D 1 99  ? 47.786 36.498  47.221 1.00 17.90 ? 74   SER D CA  1 
ATOM   3187 C  C   . SER D 1 99  ? 47.420 37.417  46.121 1.00 16.44 ? 74   SER D C   1 
ATOM   3188 O  O   . SER D 1 99  ? 47.636 38.600  46.291 1.00 18.01 ? 74   SER D O   1 
ATOM   3189 C  CB  . SER D 1 99  ? 49.180 36.125  46.829 1.00 18.93 ? 74   SER D CB  1 
ATOM   3190 O  OG  . SER D 1 99  ? 49.623 35.176  47.760 1.00 25.77 ? 74   SER D OG  1 
ATOM   3191 N  N   . ILE D 1 100 ? 46.890 36.866  45.027 1.00 16.68 ? 75   ILE D N   1 
ATOM   3192 C  CA  . ILE D 1 100 ? 46.470 37.645  43.893 1.00 16.88 ? 75   ILE D CA  1 
ATOM   3193 C  C   . ILE D 1 100 ? 45.256 38.493  44.244 1.00 16.78 ? 75   ILE D C   1 
ATOM   3194 O  O   . ILE D 1 100 ? 45.237 39.693  43.968 1.00 20.42 ? 75   ILE D O   1 
ATOM   3195 C  CB  . ILE D 1 100 ? 46.184 36.709  42.711 1.00 16.41 ? 75   ILE D CB  1 
ATOM   3196 C  CG1 . ILE D 1 100 ? 47.380 35.898  42.295 1.00 16.78 ? 75   ILE D CG1 1 
ATOM   3197 C  CG2 . ILE D 1 100 ? 45.861 37.615  41.567 1.00 16.46 ? 75   ILE D CG2 1 
ATOM   3198 C  CD1 . ILE D 1 100 ? 47.146 34.967  41.097 1.00 19.66 ? 75   ILE D CD1 1 
ATOM   3199 N  N   . ILE D 1 101 ? 44.230 37.936  44.901 1.00 18.21 ? 76   ILE D N   1 
ATOM   3200 C  CA  . ILE D 1 101 ? 43.023 38.678  45.220 1.00 15.41 ? 76   ILE D CA  1 
ATOM   3201 C  C   . ILE D 1 101 ? 43.340 39.669  46.286 1.00 17.60 ? 76   ILE D C   1 
ATOM   3202 O  O   . ILE D 1 101 ? 42.870 40.796  46.215 1.00 20.17 ? 76   ILE D O   1 
ATOM   3203 C  CB  . ILE D 1 101 ? 41.941 37.743  45.711 1.00 16.42 ? 76   ILE D CB  1 
ATOM   3204 C  CG1 . ILE D 1 101 ? 41.615 36.789  44.588 1.00 14.92 ? 76   ILE D CG1 1 
ATOM   3205 C  CG2 . ILE D 1 101 ? 40.696 38.481  46.200 1.00 11.21 ? 76   ILE D CG2 1 
ATOM   3206 C  CD1 . ILE D 1 101 ? 40.745 35.613  45.055 1.00 13.69 ? 76   ILE D CD1 1 
ATOM   3207 N  N   . ASP D 1 102 ? 44.162 39.271  47.248 1.00 19.35 ? 77   ASP D N   1 
ATOM   3208 C  CA  . ASP D 1 102 ? 44.561 40.150  48.321 1.00 21.77 ? 77   ASP D CA  1 
ATOM   3209 C  C   . ASP D 1 102 ? 45.248 41.436  47.858 1.00 22.56 ? 77   ASP D C   1 
ATOM   3210 O  O   . ASP D 1 102 ? 44.924 42.515  48.376 1.00 22.07 ? 77   ASP D O   1 
ATOM   3211 C  CB  . ASP D 1 102 ? 45.433 39.385  49.282 1.00 24.17 ? 77   ASP D CB  1 
ATOM   3212 C  CG  . ASP D 1 102 ? 45.713 40.148  50.571 1.00 28.55 ? 77   ASP D CG  1 
ATOM   3213 O  OD1 . ASP D 1 102 ? 44.842 40.889  51.067 1.00 33.63 ? 77   ASP D OD1 1 
ATOM   3214 O  OD2 . ASP D 1 102 ? 46.822 39.988  51.073 1.00 28.53 ? 77   ASP D OD2 1 
ATOM   3215 N  N   . LYS D 1 103 ? 46.139 41.344  46.851 1.00 22.27 ? 78   LYS D N   1 
ATOM   3216 C  CA  . LYS D 1 103 ? 46.692 42.534  46.222 1.00 21.32 ? 78   LYS D CA  1 
ATOM   3217 C  C   . LYS D 1 103 ? 45.654 43.318  45.471 1.00 19.56 ? 78   LYS D C   1 
ATOM   3218 O  O   . LYS D 1 103 ? 45.786 44.524  45.417 1.00 22.75 ? 78   LYS D O   1 
ATOM   3219 C  CB  . LYS D 1 103 ? 47.807 42.270  45.230 1.00 23.87 ? 78   LYS D CB  1 
ATOM   3220 C  CG  . LYS D 1 103 ? 49.036 41.600  45.795 1.00 30.71 ? 78   LYS D CG  1 
ATOM   3221 C  CD  . LYS D 1 103 ? 50.269 41.917  44.947 1.00 37.30 ? 78   LYS D CD  1 
ATOM   3222 C  CE  . LYS D 1 103 ? 51.317 40.799  45.004 1.00 40.34 ? 78   LYS D CE  1 
ATOM   3223 N  NZ  . LYS D 1 103 ? 50.843 39.671  44.214 1.00 44.85 ? 78   LYS D NZ  1 
ATOM   3224 N  N   . LEU D 1 104 ? 44.634 42.714  44.882 1.00 18.00 ? 79   LEU D N   1 
ATOM   3225 C  CA  . LEU D 1 104 ? 43.570 43.462  44.247 1.00 16.42 ? 79   LEU D CA  1 
ATOM   3226 C  C   . LEU D 1 104 ? 42.696 44.124  45.273 1.00 18.98 ? 79   LEU D C   1 
ATOM   3227 O  O   . LEU D 1 104 ? 42.215 45.218  45.035 1.00 21.86 ? 79   LEU D O   1 
ATOM   3228 C  CB  . LEU D 1 104 ? 42.687 42.543  43.451 1.00 13.71 ? 79   LEU D CB  1 
ATOM   3229 C  CG  . LEU D 1 104 ? 43.383 41.746  42.358 1.00 13.81 ? 79   LEU D CG  1 
ATOM   3230 C  CD1 . LEU D 1 104 ? 42.294 41.091  41.522 1.00 14.16 ? 79   LEU D CD1 1 
ATOM   3231 C  CD2 . LEU D 1 104 ? 44.240 42.627  41.462 1.00 11.49 ? 79   LEU D CD2 1 
ATOM   3232 N  N   . VAL D 1 105 ? 42.438 43.524  46.430 1.00 19.01 ? 80   VAL D N   1 
ATOM   3233 C  CA  . VAL D 1 105 ? 41.624 44.124  47.462 1.00 20.11 ? 80   VAL D CA  1 
ATOM   3234 C  C   . VAL D 1 105 ? 42.369 45.343  47.920 1.00 21.57 ? 80   VAL D C   1 
ATOM   3235 O  O   . VAL D 1 105 ? 41.759 46.389  47.987 1.00 25.14 ? 80   VAL D O   1 
ATOM   3236 C  CB  . VAL D 1 105 ? 41.480 43.093  48.603 1.00 22.94 ? 80   VAL D CB  1 
ATOM   3237 C  CG1 . VAL D 1 105 ? 40.920 43.647  49.896 1.00 25.85 ? 80   VAL D CG1 1 
ATOM   3238 C  CG2 . VAL D 1 105 ? 40.511 42.003  48.246 1.00 20.39 ? 80   VAL D CG2 1 
ATOM   3239 N  N   . ASN D 1 106 ? 43.678 45.313  48.167 1.00 24.08 ? 81   ASN D N   1 
ATOM   3240 C  CA  . ASN D 1 106 ? 44.375 46.498  48.626 1.00 23.59 ? 81   ASN D CA  1 
ATOM   3241 C  C   . ASN D 1 106 ? 44.363 47.632  47.620 1.00 26.17 ? 81   ASN D C   1 
ATOM   3242 O  O   . ASN D 1 106 ? 44.334 48.756  48.114 1.00 28.26 ? 81   ASN D O   1 
ATOM   3243 C  CB  . ASN D 1 106 ? 45.761 46.180  49.097 1.00 21.14 ? 81   ASN D CB  1 
ATOM   3244 C  CG  . ASN D 1 106 ? 45.684 45.257  50.278 1.00 23.73 ? 81   ASN D CG  1 
ATOM   3245 O  OD1 . ASN D 1 106 ? 44.871 45.422  51.175 1.00 31.16 ? 81   ASN D OD1 1 
ATOM   3246 N  ND2 . ASN D 1 106 ? 46.490 44.231  50.357 1.00 25.26 ? 81   ASN D ND2 1 
ATOM   3247 N  N   . ILE D 1 107 ? 44.340 47.414  46.280 1.00 25.02 ? 82   ILE D N   1 
ATOM   3248 C  CA  . ILE D 1 107 ? 44.088 48.469  45.268 1.00 25.82 ? 82   ILE D CA  1 
ATOM   3249 C  C   . ILE D 1 107 ? 42.671 49.103  45.287 1.00 25.89 ? 82   ILE D C   1 
ATOM   3250 O  O   . ILE D 1 107 ? 42.512 50.323  45.196 1.00 25.87 ? 82   ILE D O   1 
ATOM   3251 C  CB  . ILE D 1 107 ? 44.444 48.002  43.847 1.00 23.39 ? 82   ILE D CB  1 
ATOM   3252 C  CG1 . ILE D 1 107 ? 45.885 47.557  43.751 1.00 25.26 ? 82   ILE D CG1 1 
ATOM   3253 C  CG2 . ILE D 1 107 ? 44.317 49.150  42.894 1.00 23.94 ? 82   ILE D CG2 1 
ATOM   3254 C  CD1 . ILE D 1 107 ? 46.185 46.717  42.500 1.00 24.24 ? 82   ILE D CD1 1 
ATOM   3255 N  N   . VAL D 1 108 ? 41.595 48.324  45.443 1.00 27.50 ? 83   VAL D N   1 
ATOM   3256 C  CA  . VAL D 1 108 ? 40.240 48.859  45.486 1.00 27.69 ? 83   VAL D CA  1 
ATOM   3257 C  C   . VAL D 1 108 ? 40.017 49.556  46.841 1.00 30.42 ? 83   VAL D C   1 
ATOM   3258 O  O   . VAL D 1 108 ? 39.190 50.454  46.938 1.00 29.44 ? 83   VAL D O   1 
ATOM   3259 C  CB  . VAL D 1 108 ? 39.230 47.758  45.201 1.00 23.07 ? 83   VAL D CB  1 
ATOM   3260 C  CG1 . VAL D 1 108 ? 37.910 48.384  44.868 1.00 24.95 ? 83   VAL D CG1 1 
ATOM   3261 C  CG2 . VAL D 1 108 ? 39.634 47.000  43.979 1.00 23.59 ? 83   VAL D CG2 1 
ATOM   3262 N  N   . ASP D 1 109 ? 40.772 49.192  47.892 1.00 32.89 ? 84   ASP D N   1 
ATOM   3263 C  CA  . ASP D 1 109 ? 40.753 49.840  49.206 1.00 35.85 ? 84   ASP D CA  1 
ATOM   3264 C  C   . ASP D 1 109 ? 41.361 51.238  49.084 1.00 35.75 ? 84   ASP D C   1 
ATOM   3265 O  O   . ASP D 1 109 ? 40.779 52.212  49.557 1.00 35.62 ? 84   ASP D O   1 
ATOM   3266 C  CB  . ASP D 1 109 ? 41.531 49.029  50.294 1.00 39.03 ? 84   ASP D CB  1 
ATOM   3267 C  CG  . ASP D 1 109 ? 40.827 48.006  51.221 1.00 41.67 ? 84   ASP D CG  1 
ATOM   3268 O  OD1 . ASP D 1 109 ? 39.593 47.858  51.172 1.00 43.23 ? 84   ASP D OD1 1 
ATOM   3269 O  OD2 . ASP D 1 109 ? 41.536 47.352  52.008 1.00 43.54 ? 84   ASP D OD2 1 
ATOM   3270 N  N   . ASP D 1 110 ? 42.500 51.382  48.417 1.00 35.24 ? 85   ASP D N   1 
ATOM   3271 C  CA  . ASP D 1 110 ? 43.039 52.689  48.095 1.00 39.54 ? 85   ASP D CA  1 
ATOM   3272 C  C   . ASP D 1 110 ? 42.055 53.620  47.372 1.00 40.48 ? 85   ASP D C   1 
ATOM   3273 O  O   . ASP D 1 110 ? 41.712 54.706  47.853 1.00 42.05 ? 85   ASP D O   1 
ATOM   3274 C  CB  . ASP D 1 110 ? 44.343 52.540  47.287 1.00 41.18 ? 85   ASP D CB  1 
ATOM   3275 C  CG  . ASP D 1 110 ? 45.534 51.871  48.001 1.00 43.42 ? 85   ASP D CG  1 
ATOM   3276 O  OD1 . ASP D 1 110 ? 45.537 51.723  49.243 1.00 41.35 ? 85   ASP D OD1 1 
ATOM   3277 O  OD2 . ASP D 1 110 ? 46.465 51.488  47.276 1.00 42.78 ? 85   ASP D OD2 1 
ATOM   3278 N  N   . LEU D 1 111 ? 41.518 53.157  46.238 1.00 41.90 ? 86   LEU D N   1 
ATOM   3279 C  CA  . LEU D 1 111 ? 40.526 53.903  45.456 1.00 39.57 ? 86   LEU D CA  1 
ATOM   3280 C  C   . LEU D 1 111 ? 39.249 54.172  46.203 1.00 38.81 ? 86   LEU D C   1 
ATOM   3281 O  O   . LEU D 1 111 ? 38.614 55.176  45.924 1.00 40.16 ? 86   LEU D O   1 
ATOM   3282 C  CB  . LEU D 1 111 ? 40.142 53.164  44.191 1.00 36.00 ? 86   LEU D CB  1 
ATOM   3283 C  CG  . LEU D 1 111 ? 41.234 52.732  43.251 1.00 34.91 ? 86   LEU D CG  1 
ATOM   3284 C  CD1 . LEU D 1 111 ? 40.618 52.075  42.047 1.00 33.95 ? 86   LEU D CD1 1 
ATOM   3285 C  CD2 . LEU D 1 111 ? 42.096 53.907  42.858 1.00 32.40 ? 86   LEU D CD2 1 
ATOM   3286 N  N   . VAL D 1 112 ? 38.840 53.303  47.125 1.00 40.82 ? 87   VAL D N   1 
ATOM   3287 C  CA  . VAL D 1 112 ? 37.680 53.589  47.958 1.00 44.87 ? 87   VAL D CA  1 
ATOM   3288 C  C   . VAL D 1 112 ? 37.965 54.754  48.933 1.00 47.95 ? 87   VAL D C   1 
ATOM   3289 O  O   . VAL D 1 112 ? 37.085 55.580  49.176 1.00 49.04 ? 87   VAL D O   1 
ATOM   3290 C  CB  . VAL D 1 112 ? 37.191 52.311  48.682 1.00 42.48 ? 87   VAL D CB  1 
ATOM   3291 C  CG1 . VAL D 1 112 ? 36.094 52.685  49.647 1.00 43.30 ? 87   VAL D CG1 1 
ATOM   3292 C  CG2 . VAL D 1 112 ? 36.572 51.285  47.749 1.00 39.59 ? 87   VAL D CG2 1 
ATOM   3293 N  N   . GLU D 1 113 ? 39.185 54.862  49.472 1.00 51.32 ? 88   GLU D N   1 
ATOM   3294 C  CA  . GLU D 1 113 ? 39.548 55.935  50.387 1.00 55.88 ? 88   GLU D CA  1 
ATOM   3295 C  C   . GLU D 1 113 ? 39.807 57.235  49.672 1.00 57.32 ? 88   GLU D C   1 
ATOM   3296 O  O   . GLU D 1 113 ? 39.717 58.303  50.291 1.00 59.78 ? 88   GLU D O   1 
ATOM   3297 C  CB  . GLU D 1 113 ? 40.786 55.627  51.225 1.00 57.84 ? 88   GLU D CB  1 
ATOM   3298 C  CG  . GLU D 1 113 ? 40.534 54.935  52.572 1.00 61.46 ? 88   GLU D CG  1 
ATOM   3299 C  CD  . GLU D 1 113 ? 41.737 54.106  53.056 1.00 65.66 ? 88   GLU D CD  1 
ATOM   3300 O  OE1 . GLU D 1 113 ? 42.872 54.610  53.000 1.00 65.91 ? 88   GLU D OE1 1 
ATOM   3301 O  OE2 . GLU D 1 113 ? 41.543 52.947  53.479 1.00 68.20 ? 88   GLU D OE2 1 
ATOM   3302 N  N   . CYS D 1 114 ? 40.147 57.130  48.382 1.00 57.61 ? 89   CYS D N   1 
ATOM   3303 C  CA  . CYS D 1 114 ? 40.273 58.307  47.528 1.00 58.46 ? 89   CYS D CA  1 
ATOM   3304 C  C   . CYS D 1 114 ? 38.895 58.970  47.344 1.00 58.39 ? 89   CYS D C   1 
ATOM   3305 O  O   . CYS D 1 114 ? 38.791 60.197  47.378 1.00 58.21 ? 89   CYS D O   1 
ATOM   3306 C  CB  . CYS D 1 114 ? 40.931 57.880  46.221 1.00 57.54 ? 89   CYS D CB  1 
ATOM   3307 S  SG  . CYS D 1 114 ? 41.341 59.181  45.038 1.00 58.90 ? 89   CYS D SG  1 
ATOM   3308 N  N   . VAL D 1 115 ? 37.809 58.179  47.271 1.00 58.70 ? 90   VAL D N   1 
ATOM   3309 C  CA  . VAL D 1 115 ? 36.453 58.684  47.150 1.00 59.63 ? 90   VAL D CA  1 
ATOM   3310 C  C   . VAL D 1 115 ? 35.871 59.210  48.484 1.00 61.73 ? 90   VAL D C   1 
ATOM   3311 O  O   . VAL D 1 115 ? 34.680 59.004  48.763 1.00 62.80 ? 90   VAL D O   1 
ATOM   3312 C  CB  . VAL D 1 115 ? 35.602 57.544  46.539 1.00 58.55 ? 90   VAL D CB  1 
ATOM   3313 N  N   . SER D 1 129 ? 20.665 52.244  45.909 1.00 56.19 ? 104  SER D N   1 
ATOM   3314 C  CA  . SER D 1 129 ? 21.629 51.156  45.958 1.00 53.75 ? 104  SER D CA  1 
ATOM   3315 C  C   . SER D 1 129 ? 21.476 50.204  44.750 1.00 51.69 ? 104  SER D C   1 
ATOM   3316 O  O   . SER D 1 129 ? 20.519 50.365  43.954 1.00 53.93 ? 104  SER D O   1 
ATOM   3317 C  CB  . SER D 1 129 ? 21.454 50.421  47.297 1.00 55.38 ? 104  SER D CB  1 
ATOM   3318 O  OG  . SER D 1 129 ? 22.506 49.503  47.610 1.00 56.37 ? 104  SER D OG  1 
ATOM   3319 N  N   . PRO D 1 130 ? 22.446 49.277  44.526 1.00 45.68 ? 105  PRO D N   1 
ATOM   3320 C  CA  . PRO D 1 130 ? 22.366 48.292  43.470 1.00 41.30 ? 105  PRO D CA  1 
ATOM   3321 C  C   . PRO D 1 130 ? 22.138 46.887  43.955 1.00 37.99 ? 105  PRO D C   1 
ATOM   3322 O  O   . PRO D 1 130 ? 22.529 46.478  45.049 1.00 38.93 ? 105  PRO D O   1 
ATOM   3323 C  CB  . PRO D 1 130 ? 23.661 48.481  42.741 1.00 40.55 ? 105  PRO D CB  1 
ATOM   3324 C  CG  . PRO D 1 130 ? 24.631 48.664  43.862 1.00 42.00 ? 105  PRO D CG  1 
ATOM   3325 C  CD  . PRO D 1 130 ? 23.856 49.476  44.863 1.00 42.72 ? 105  PRO D CD  1 
ATOM   3326 N  N   . GLU D 1 131 ? 21.459 46.177  43.075 1.00 33.70 ? 106  GLU D N   1 
ATOM   3327 C  CA  . GLU D 1 131 ? 20.971 44.880  43.417 1.00 32.02 ? 106  GLU D CA  1 
ATOM   3328 C  C   . GLU D 1 131 ? 21.976 43.812  43.085 1.00 32.36 ? 106  GLU D C   1 
ATOM   3329 O  O   . GLU D 1 131 ? 22.715 43.942  42.111 1.00 32.37 ? 106  GLU D O   1 
ATOM   3330 C  CB  . GLU D 1 131 ? 19.734 44.553  42.624 1.00 32.57 ? 106  GLU D CB  1 
ATOM   3331 N  N   . PRO D 1 132 ? 22.006 42.732  43.886 1.00 32.45 ? 107  PRO D N   1 
ATOM   3332 C  CA  . PRO D 1 132 ? 22.855 41.549  43.686 1.00 31.86 ? 107  PRO D CA  1 
ATOM   3333 C  C   . PRO D 1 132 ? 22.724 40.845  42.340 1.00 29.45 ? 107  PRO D C   1 
ATOM   3334 O  O   . PRO D 1 132 ? 21.623 40.491  41.911 1.00 29.62 ? 107  PRO D O   1 
ATOM   3335 C  CB  . PRO D 1 132 ? 22.403 40.614  44.801 1.00 32.83 ? 107  PRO D CB  1 
ATOM   3336 C  CG  . PRO D 1 132 ? 22.040 41.574  45.904 1.00 34.59 ? 107  PRO D CG  1 
ATOM   3337 C  CD  . PRO D 1 132 ? 21.299 42.658  45.165 1.00 31.98 ? 107  PRO D CD  1 
ATOM   3338 N  N   . ARG D 1 133 ? 23.893 40.580  41.745 1.00 27.04 ? 108  ARG D N   1 
ATOM   3339 C  CA  . ARG D 1 133 ? 23.966 39.882  40.479 1.00 24.37 ? 108  ARG D CA  1 
ATOM   3340 C  C   . ARG D 1 133 ? 25.090 38.834  40.442 1.00 22.83 ? 108  ARG D C   1 
ATOM   3341 O  O   . ARG D 1 133 ? 26.084 39.002  41.124 1.00 21.26 ? 108  ARG D O   1 
ATOM   3342 C  CB  . ARG D 1 133 ? 24.090 40.981  39.431 1.00 27.20 ? 108  ARG D CB  1 
ATOM   3343 C  CG  . ARG D 1 133 ? 23.924 40.490  38.015 1.00 32.52 ? 108  ARG D CG  1 
ATOM   3344 C  CD  . ARG D 1 133 ? 23.488 41.587  37.061 1.00 35.27 ? 108  ARG D CD  1 
ATOM   3345 N  NE  . ARG D 1 133 ? 23.846 41.160  35.712 1.00 38.19 ? 108  ARG D NE  1 
ATOM   3346 C  CZ  . ARG D 1 133 ? 23.536 41.872  34.627 1.00 38.97 ? 108  ARG D CZ  1 
ATOM   3347 N  NH1 . ARG D 1 133 ? 22.798 43.008  34.720 1.00 34.64 ? 108  ARG D NH1 1 
ATOM   3348 N  NH2 . ARG D 1 133 ? 23.995 41.398  33.454 1.00 39.61 ? 108  ARG D NH2 1 
ATOM   3349 N  N   . LEU D 1 134 ? 24.984 37.734  39.681 1.00 21.95 ? 109  LEU D N   1 
ATOM   3350 C  CA  . LEU D 1 134 ? 25.996 36.697  39.565 1.00 20.44 ? 109  LEU D CA  1 
ATOM   3351 C  C   . LEU D 1 134 ? 26.760 36.756  38.265 1.00 18.72 ? 109  LEU D C   1 
ATOM   3352 O  O   . LEU D 1 134 ? 26.191 36.725  37.175 1.00 19.50 ? 109  LEU D O   1 
ATOM   3353 C  CB  . LEU D 1 134 ? 25.392 35.304  39.657 1.00 21.02 ? 109  LEU D CB  1 
ATOM   3354 C  CG  . LEU D 1 134 ? 24.434 34.885  40.779 1.00 23.43 ? 109  LEU D CG  1 
ATOM   3355 C  CD1 . LEU D 1 134 ? 24.170 33.404  40.648 1.00 24.08 ? 109  LEU D CD1 1 
ATOM   3356 C  CD2 . LEU D 1 134 ? 24.939 35.187  42.193 1.00 25.25 ? 109  LEU D CD2 1 
ATOM   3357 N  N   . PHE D 1 135 ? 28.080 36.753  38.437 1.00 17.94 ? 110  PHE D N   1 
ATOM   3358 C  CA  . PHE D 1 135 ? 29.031 36.804  37.333 1.00 17.25 ? 110  PHE D CA  1 
ATOM   3359 C  C   . PHE D 1 135 ? 30.013 35.649  37.346 1.00 16.87 ? 110  PHE D C   1 
ATOM   3360 O  O   . PHE D 1 135 ? 30.417 35.198  38.404 1.00 19.49 ? 110  PHE D O   1 
ATOM   3361 C  CB  . PHE D 1 135 ? 29.848 38.070  37.366 1.00 16.08 ? 110  PHE D CB  1 
ATOM   3362 C  CG  . PHE D 1 135 ? 28.993 39.305  37.265 1.00 18.38 ? 110  PHE D CG  1 
ATOM   3363 C  CD1 . PHE D 1 135 ? 28.573 39.743  36.029 1.00 19.11 ? 110  PHE D CD1 1 
ATOM   3364 C  CD2 . PHE D 1 135 ? 28.633 39.977  38.408 1.00 16.78 ? 110  PHE D CD2 1 
ATOM   3365 C  CE1 . PHE D 1 135 ? 27.802 40.874  35.946 1.00 16.73 ? 110  PHE D CE1 1 
ATOM   3366 C  CE2 . PHE D 1 135 ? 27.850 41.103  38.321 1.00 18.17 ? 110  PHE D CE2 1 
ATOM   3367 C  CZ  . PHE D 1 135 ? 27.445 41.553  37.081 1.00 21.53 ? 110  PHE D CZ  1 
ATOM   3368 N  N   . THR D 1 136 ? 30.425 35.107  36.216 1.00 15.24 ? 111  THR D N   1 
ATOM   3369 C  CA  . THR D 1 136 ? 31.539 34.192  36.176 1.00 14.72 ? 111  THR D CA  1 
ATOM   3370 C  C   . THR D 1 136 ? 32.811 34.994  36.443 1.00 12.40 ? 111  THR D C   1 
ATOM   3371 O  O   . THR D 1 136 ? 32.752 36.218  36.400 1.00 13.27 ? 111  THR D O   1 
ATOM   3372 C  CB  . THR D 1 136 ? 31.579 33.435  34.828 1.00 17.12 ? 111  THR D CB  1 
ATOM   3373 O  OG1 . THR D 1 136 ? 31.630 34.415  33.809 1.00 17.68 ? 111  THR D OG1 1 
ATOM   3374 C  CG2 . THR D 1 136 ? 30.451 32.446  34.621 1.00 14.81 ? 111  THR D CG2 1 
ATOM   3375 N  N   . PRO D 1 137 ? 33.974 34.412  36.757 1.00 12.31 ? 112  PRO D N   1 
ATOM   3376 C  CA  . PRO D 1 137 ? 35.219 35.126  36.935 1.00 11.10 ? 112  PRO D CA  1 
ATOM   3377 C  C   . PRO D 1 137 ? 35.594 36.046  35.783 1.00 14.02 ? 112  PRO D C   1 
ATOM   3378 O  O   . PRO D 1 137 ? 35.884 37.215  36.011 1.00 13.17 ? 112  PRO D O   1 
ATOM   3379 C  CB  . PRO D 1 137 ? 36.189 33.965  37.074 1.00 9.39  ? 112  PRO D CB  1 
ATOM   3380 C  CG  . PRO D 1 137 ? 35.413 32.952  37.854 1.00 7.72  ? 112  PRO D CG  1 
ATOM   3381 C  CD  . PRO D 1 137 ? 34.151 32.972  37.061 1.00 11.01 ? 112  PRO D CD  1 
ATOM   3382 N  N   . GLU D 1 138 ? 35.611 35.572  34.517 1.00 16.22 ? 113  GLU D N   1 
ATOM   3383 C  CA  . GLU D 1 138 ? 35.905 36.456  33.395 1.00 16.17 ? 113  GLU D CA  1 
ATOM   3384 C  C   . GLU D 1 138 ? 35.026 37.679  33.272 1.00 13.99 ? 113  GLU D C   1 
ATOM   3385 O  O   . GLU D 1 138 ? 35.508 38.761  32.985 1.00 15.09 ? 113  GLU D O   1 
ATOM   3386 C  CB  . GLU D 1 138 ? 35.913 35.703  32.092 1.00 17.91 ? 113  GLU D CB  1 
ATOM   3387 C  CG  . GLU D 1 138 ? 34.636 34.985  31.713 1.00 19.43 ? 113  GLU D CG  1 
ATOM   3388 C  CD  . GLU D 1 138 ? 34.621 34.539  30.277 1.00 22.34 ? 113  GLU D CD  1 
ATOM   3389 O  OE1 . GLU D 1 138 ? 35.652 34.599  29.608 1.00 23.91 ? 113  GLU D OE1 1 
ATOM   3390 O  OE2 . GLU D 1 138 ? 33.558 34.139  29.810 1.00 24.64 ? 113  GLU D OE2 1 
ATOM   3391 N  N   . GLU D 1 139 ? 33.747 37.539  33.559 1.00 14.85 ? 114  GLU D N   1 
ATOM   3392 C  CA  . GLU D 1 139 ? 32.837 38.649  33.596 1.00 15.81 ? 114  GLU D CA  1 
ATOM   3393 C  C   . GLU D 1 139 ? 33.063 39.567  34.769 1.00 15.50 ? 114  GLU D C   1 
ATOM   3394 O  O   . GLU D 1 139 ? 33.085 40.783  34.557 1.00 15.87 ? 114  GLU D O   1 
ATOM   3395 C  CB  . GLU D 1 139 ? 31.402 38.208  33.707 1.00 19.13 ? 114  GLU D CB  1 
ATOM   3396 C  CG  . GLU D 1 139 ? 30.883 37.422  32.539 1.00 21.49 ? 114  GLU D CG  1 
ATOM   3397 C  CD  . GLU D 1 139 ? 29.605 36.642  32.816 1.00 24.09 ? 114  GLU D CD  1 
ATOM   3398 O  OE1 . GLU D 1 139 ? 29.017 36.697  33.897 1.00 26.51 ? 114  GLU D OE1 1 
ATOM   3399 O  OE2 . GLU D 1 139 ? 29.185 35.937  31.907 1.00 29.29 ? 114  GLU D OE2 1 
ATOM   3400 N  N   . PHE D 1 140 ? 33.204 39.041  35.990 1.00 13.99 ? 115  PHE D N   1 
ATOM   3401 C  CA  . PHE D 1 140 ? 33.464 39.892  37.125 1.00 12.83 ? 115  PHE D CA  1 
ATOM   3402 C  C   . PHE D 1 140 ? 34.753 40.667  36.905 1.00 13.21 ? 115  PHE D C   1 
ATOM   3403 O  O   . PHE D 1 140 ? 34.827 41.855  37.193 1.00 14.99 ? 115  PHE D O   1 
ATOM   3404 C  CB  . PHE D 1 140 ? 33.650 39.018  38.359 1.00 10.89 ? 115  PHE D CB  1 
ATOM   3405 C  CG  . PHE D 1 140 ? 33.982 39.867  39.569 1.00 11.83 ? 115  PHE D CG  1 
ATOM   3406 C  CD1 . PHE D 1 140 ? 32.951 40.361  40.344 1.00 12.60 ? 115  PHE D CD1 1 
ATOM   3407 C  CD2 . PHE D 1 140 ? 35.296 40.133  39.917 1.00 14.96 ? 115  PHE D CD2 1 
ATOM   3408 C  CE1 . PHE D 1 140 ? 33.251 41.093  41.480 1.00 12.59 ? 115  PHE D CE1 1 
ATOM   3409 C  CE2 . PHE D 1 140 ? 35.605 40.892  41.033 1.00 13.04 ? 115  PHE D CE2 1 
ATOM   3410 C  CZ  . PHE D 1 140 ? 34.560 41.373  41.810 1.00 14.57 ? 115  PHE D CZ  1 
ATOM   3411 N  N   . PHE D 1 141 ? 35.833 40.025  36.477 1.00 15.07 ? 116  PHE D N   1 
ATOM   3412 C  CA  . PHE D 1 141 ? 37.102 40.718  36.297 1.00 13.94 ? 116  PHE D CA  1 
ATOM   3413 C  C   . PHE D 1 141 ? 37.181 41.563  35.036 1.00 15.79 ? 116  PHE D C   1 
ATOM   3414 O  O   . PHE D 1 141 ? 38.014 42.455  34.965 1.00 16.79 ? 116  PHE D O   1 
ATOM   3415 C  CB  . PHE D 1 141 ? 38.273 39.775  36.373 1.00 13.55 ? 116  PHE D CB  1 
ATOM   3416 C  CG  . PHE D 1 141 ? 38.548 39.261  37.759 1.00 10.27 ? 116  PHE D CG  1 
ATOM   3417 C  CD1 . PHE D 1 141 ? 39.105 40.100  38.692 1.00 12.82 ? 116  PHE D CD1 1 
ATOM   3418 C  CD2 . PHE D 1 141 ? 38.143 37.990  38.132 1.00 11.47 ? 116  PHE D CD2 1 
ATOM   3419 C  CE1 . PHE D 1 141 ? 39.169 39.689  40.025 1.00 14.46 ? 116  PHE D CE1 1 
ATOM   3420 C  CE2 . PHE D 1 141 ? 38.216 37.584  39.457 1.00 10.67 ? 116  PHE D CE2 1 
ATOM   3421 C  CZ  . PHE D 1 141 ? 38.709 38.439  40.407 1.00 11.80 ? 116  PHE D CZ  1 
ATOM   3422 N  N   . ARG D 1 142 ? 36.361 41.405  34.011 1.00 16.57 ? 117  ARG D N   1 
ATOM   3423 C  CA  . ARG D 1 142 ? 36.293 42.421  32.990 1.00 20.64 ? 117  ARG D CA  1 
ATOM   3424 C  C   . ARG D 1 142 ? 35.668 43.700  33.548 1.00 22.51 ? 117  ARG D C   1 
ATOM   3425 O  O   . ARG D 1 142 ? 36.089 44.803  33.174 1.00 23.89 ? 117  ARG D O   1 
ATOM   3426 C  CB  . ARG D 1 142 ? 35.446 41.879  31.860 1.00 26.52 ? 117  ARG D CB  1 
ATOM   3427 C  CG  . ARG D 1 142 ? 35.518 42.709  30.598 1.00 31.58 ? 117  ARG D CG  1 
ATOM   3428 C  CD  . ARG D 1 142 ? 34.496 42.146  29.640 1.00 35.05 ? 117  ARG D CD  1 
ATOM   3429 N  NE  . ARG D 1 142 ? 34.394 43.021  28.483 1.00 38.58 ? 117  ARG D NE  1 
ATOM   3430 C  CZ  . ARG D 1 142 ? 33.828 42.656  27.326 1.00 37.56 ? 117  ARG D CZ  1 
ATOM   3431 N  NH1 . ARG D 1 142 ? 33.169 41.506  27.170 1.00 33.95 ? 117  ARG D NH1 1 
ATOM   3432 N  NH2 . ARG D 1 142 ? 34.002 43.473  26.286 1.00 37.95 ? 117  ARG D NH2 1 
ATOM   3433 N  N   . ILE D 1 143 ? 34.656 43.594  34.445 1.00 22.03 ? 118  ILE D N   1 
ATOM   3434 C  CA  . ILE D 1 143 ? 34.052 44.753  35.121 1.00 19.63 ? 118  ILE D CA  1 
ATOM   3435 C  C   . ILE D 1 143 ? 35.047 45.368  36.086 1.00 19.88 ? 118  ILE D C   1 
ATOM   3436 O  O   . ILE D 1 143 ? 35.183 46.586  36.085 1.00 23.21 ? 118  ILE D O   1 
ATOM   3437 C  CB  . ILE D 1 143 ? 32.781 44.357  35.874 1.00 20.68 ? 118  ILE D CB  1 
ATOM   3438 C  CG1 . ILE D 1 143 ? 31.691 43.843  34.951 1.00 19.48 ? 118  ILE D CG1 1 
ATOM   3439 C  CG2 . ILE D 1 143 ? 32.255 45.562  36.619 1.00 20.52 ? 118  ILE D CG2 1 
ATOM   3440 C  CD1 . ILE D 1 143 ? 30.567 43.143  35.727 1.00 18.63 ? 118  ILE D CD1 1 
ATOM   3441 N  N   . PHE D 1 144 ? 35.741 44.577  36.908 1.00 16.07 ? 119  PHE D N   1 
ATOM   3442 C  CA  . PHE D 1 144 ? 36.853 45.059  37.683 1.00 15.72 ? 119  PHE D CA  1 
ATOM   3443 C  C   . PHE D 1 144 ? 37.853 45.894  36.880 1.00 17.75 ? 119  PHE D C   1 
ATOM   3444 O  O   . PHE D 1 144 ? 38.208 47.006  37.267 1.00 20.22 ? 119  PHE D O   1 
ATOM   3445 C  CB  . PHE D 1 144 ? 37.545 43.866  38.359 1.00 12.02 ? 119  PHE D CB  1 
ATOM   3446 C  CG  . PHE D 1 144 ? 38.822 44.222  39.100 1.00 13.89 ? 119  PHE D CG  1 
ATOM   3447 C  CD1 . PHE D 1 144 ? 38.760 44.766  40.389 1.00 14.47 ? 119  PHE D CD1 1 
ATOM   3448 C  CD2 . PHE D 1 144 ? 40.057 44.030  38.492 1.00 10.48 ? 119  PHE D CD2 1 
ATOM   3449 C  CE1 . PHE D 1 144 ? 39.944 45.148  41.032 1.00 13.14 ? 119  PHE D CE1 1 
ATOM   3450 C  CE2 . PHE D 1 144 ? 41.219 44.387  39.149 1.00 10.95 ? 119  PHE D CE2 1 
ATOM   3451 C  CZ  . PHE D 1 144 ? 41.163 44.965  40.405 1.00 10.47 ? 119  PHE D CZ  1 
ATOM   3452 N  N   . ASN D 1 145 ? 38.349 45.343  35.779 1.00 18.18 ? 120  ASN D N   1 
ATOM   3453 C  CA  . ASN D 1 145 ? 39.325 45.994  34.955 1.00 18.15 ? 120  ASN D CA  1 
ATOM   3454 C  C   . ASN D 1 145 ? 38.709 47.263  34.387 1.00 20.79 ? 120  ASN D C   1 
ATOM   3455 O  O   . ASN D 1 145 ? 39.348 48.303  34.408 1.00 22.36 ? 120  ASN D O   1 
ATOM   3456 C  CB  . ASN D 1 145 ? 39.805 45.078  33.812 1.00 18.05 ? 120  ASN D CB  1 
ATOM   3457 C  CG  . ASN D 1 145 ? 40.849 44.026  34.137 1.00 17.71 ? 120  ASN D CG  1 
ATOM   3458 O  OD1 . ASN D 1 145 ? 41.770 44.210  34.918 1.00 21.36 ? 120  ASN D OD1 1 
ATOM   3459 N  ND2 . ASN D 1 145 ? 40.765 42.860  33.538 1.00 17.03 ? 120  ASN D ND2 1 
ATOM   3460 N  N   . ARG D 1 146 ? 37.463 47.256  33.941 1.00 22.71 ? 121  ARG D N   1 
ATOM   3461 C  CA  . ARG D 1 146 ? 36.824 48.438  33.431 1.00 24.59 ? 121  ARG D CA  1 
ATOM   3462 C  C   . ARG D 1 146 ? 36.703 49.523  34.494 1.00 27.41 ? 121  ARG D C   1 
ATOM   3463 O  O   . ARG D 1 146 ? 36.971 50.683  34.192 1.00 30.49 ? 121  ARG D O   1 
ATOM   3464 C  CB  . ARG D 1 146 ? 35.468 47.993  32.953 1.00 26.42 ? 121  ARG D CB  1 
ATOM   3465 C  CG  . ARG D 1 146 ? 34.608 49.156  32.549 1.00 33.46 ? 121  ARG D CG  1 
ATOM   3466 C  CD  . ARG D 1 146 ? 34.760 49.641  31.105 1.00 37.32 ? 121  ARG D CD  1 
ATOM   3467 N  NE  . ARG D 1 146 ? 34.149 50.962  30.882 1.00 39.99 ? 121  ARG D NE  1 
ATOM   3468 C  CZ  . ARG D 1 146 ? 32.836 51.217  31.020 1.00 39.01 ? 121  ARG D CZ  1 
ATOM   3469 N  NH1 . ARG D 1 146 ? 31.955 50.306  31.426 1.00 37.27 ? 121  ARG D NH1 1 
ATOM   3470 N  NH2 . ARG D 1 146 ? 32.392 52.439  30.747 1.00 40.47 ? 121  ARG D NH2 1 
ATOM   3471 N  N   . SER D 1 147 ? 36.364 49.186  35.754 1.00 28.07 ? 122  SER D N   1 
ATOM   3472 C  CA  . SER D 1 147 ? 36.147 50.153  36.820 1.00 24.66 ? 122  SER D CA  1 
ATOM   3473 C  C   . SER D 1 147 ? 37.455 50.758  37.250 1.00 25.38 ? 122  SER D C   1 
ATOM   3474 O  O   . SER D 1 147 ? 37.536 51.971  37.401 1.00 24.85 ? 122  SER D O   1 
ATOM   3475 C  CB  . SER D 1 147 ? 35.452 49.505  37.983 1.00 20.76 ? 122  SER D CB  1 
ATOM   3476 O  OG  . SER D 1 147 ? 34.236 48.886  37.591 1.00 19.10 ? 122  SER D OG  1 
ATOM   3477 N  N   . ILE D 1 148 ? 38.513 49.954  37.389 1.00 28.58 ? 123  ILE D N   1 
ATOM   3478 C  CA  . ILE D 1 148 ? 39.853 50.468  37.718 1.00 31.03 ? 123  ILE D CA  1 
ATOM   3479 C  C   . ILE D 1 148 ? 40.396 51.464  36.684 1.00 33.54 ? 123  ILE D C   1 
ATOM   3480 O  O   . ILE D 1 148 ? 40.998 52.471  37.040 1.00 33.54 ? 123  ILE D O   1 
ATOM   3481 C  CB  . ILE D 1 148 ? 40.821 49.267  38.041 1.00 31.69 ? 123  ILE D CB  1 
ATOM   3482 C  CG1 . ILE D 1 148 ? 40.899 48.877  39.544 1.00 30.91 ? 123  ILE D CG1 1 
ATOM   3483 C  CG2 . ILE D 1 148 ? 42.262 49.504  37.583 1.00 31.27 ? 123  ILE D CG2 1 
ATOM   3484 C  CD1 . ILE D 1 148 ? 39.609 48.826  40.377 1.00 31.19 ? 123  ILE D CD1 1 
ATOM   3485 N  N   . ASP D 1 149 ? 40.123 51.244  35.395 1.00 36.80 ? 124  ASP D N   1 
ATOM   3486 C  CA  . ASP D 1 149 ? 40.562 52.125  34.333 1.00 38.72 ? 124  ASP D CA  1 
ATOM   3487 C  C   . ASP D 1 149 ? 39.846 53.455  34.353 1.00 39.18 ? 124  ASP D C   1 
ATOM   3488 O  O   . ASP D 1 149 ? 40.487 54.491  34.186 1.00 39.94 ? 124  ASP D O   1 
ATOM   3489 C  CB  . ASP D 1 149 ? 40.383 51.461  32.981 1.00 42.50 ? 124  ASP D CB  1 
ATOM   3490 C  CG  . ASP D 1 149 ? 40.847 52.342  31.828 1.00 47.69 ? 124  ASP D CG  1 
ATOM   3491 O  OD1 . ASP D 1 149 ? 42.058 52.554  31.646 1.00 50.62 ? 124  ASP D OD1 1 
ATOM   3492 O  OD2 . ASP D 1 149 ? 39.972 52.837  31.116 1.00 51.18 ? 124  ASP D OD2 1 
ATOM   3493 N  N   . ALA D 1 150 ? 38.538 53.440  34.590 1.00 39.43 ? 125  ALA D N   1 
ATOM   3494 C  CA  . ALA D 1 150 ? 37.731 54.649  34.586 1.00 41.04 ? 125  ALA D CA  1 
ATOM   3495 C  C   . ALA D 1 150 ? 38.028 55.640  35.712 1.00 44.24 ? 125  ALA D C   1 
ATOM   3496 O  O   . ALA D 1 150 ? 37.580 56.792  35.729 1.00 46.63 ? 125  ALA D O   1 
ATOM   3497 C  CB  . ALA D 1 150 ? 36.289 54.232  34.688 1.00 37.89 ? 125  ALA D CB  1 
ATOM   3498 N  N   . PHE D 1 151 ? 38.795 55.189  36.693 1.00 47.55 ? 126  PHE D N   1 
ATOM   3499 C  CA  . PHE D 1 151 ? 39.342 56.063  37.709 1.00 52.08 ? 126  PHE D CA  1 
ATOM   3500 C  C   . PHE D 1 151 ? 40.409 57.058  37.208 1.00 55.06 ? 126  PHE D C   1 
ATOM   3501 O  O   . PHE D 1 151 ? 40.531 58.167  37.751 1.00 57.33 ? 126  PHE D O   1 
ATOM   3502 C  CB  . PHE D 1 151 ? 39.877 55.182  38.838 1.00 51.90 ? 126  PHE D CB  1 
ATOM   3503 C  CG  . PHE D 1 151 ? 39.154 55.489  40.124 1.00 50.92 ? 126  PHE D CG  1 
ATOM   3504 C  CD1 . PHE D 1 151 ? 39.155 56.780  40.620 1.00 52.88 ? 126  PHE D CD1 1 
ATOM   3505 C  CD2 . PHE D 1 151 ? 38.437 54.505  40.745 1.00 50.11 ? 126  PHE D CD2 1 
ATOM   3506 C  CE1 . PHE D 1 151 ? 38.390 57.105  41.721 1.00 54.34 ? 126  PHE D CE1 1 
ATOM   3507 C  CE2 . PHE D 1 151 ? 37.688 54.827  41.851 1.00 52.08 ? 126  PHE D CE2 1 
ATOM   3508 C  CZ  . PHE D 1 151 ? 37.653 56.117  42.336 1.00 53.64 ? 126  PHE D CZ  1 
ATOM   3509 N  N   . LYS D 1 152 ? 41.187 56.667  36.177 1.00 56.75 ? 127  LYS D N   1 
ATOM   3510 C  CA  . LYS D 1 152 ? 42.055 57.566  35.420 1.00 57.29 ? 127  LYS D CA  1 
ATOM   3511 C  C   . LYS D 1 152 ? 41.257 58.229  34.273 1.00 58.91 ? 127  LYS D C   1 
ATOM   3512 O  O   . LYS D 1 152 ? 41.376 57.826  33.098 1.00 60.03 ? 127  LYS D O   1 
ATOM   3513 C  CB  . LYS D 1 152 ? 43.225 56.735  34.882 1.00 56.61 ? 127  LYS D CB  1 
HETATM 3514 O  OH2 . 1PE E 2 .   ? 18.016 39.096  31.870 1.00 54.04 ? 249  1PE B OH2 1 
HETATM 3515 C  C12 . 1PE E 2 .   ? 19.233 39.467  31.241 1.00 52.50 ? 249  1PE B C12 1 
HETATM 3516 C  C22 . 1PE E 2 .   ? 20.344 39.764  32.285 1.00 52.87 ? 249  1PE B C22 1 
HETATM 3517 O  OH3 . 1PE E 2 .   ? 21.455 40.455  31.657 1.00 50.81 ? 249  1PE B OH3 1 
HETATM 3518 C  C13 . 1PE E 2 .   ? 21.887 42.392  30.182 1.00 41.29 ? 249  1PE B C13 1 
HETATM 3519 C  C23 . 1PE E 2 .   ? 20.971 41.737  31.213 1.00 45.45 ? 249  1PE B C23 1 
HETATM 3520 O  OH4 . 1PE E 2 .   ? 23.085 42.870  30.757 1.00 37.80 ? 249  1PE B OH4 1 
HETATM 3521 C  C14 . 1PE E 2 .   ? 24.265 44.731  31.534 1.00 39.00 ? 249  1PE B C14 1 
HETATM 3522 C  C24 . 1PE E 2 .   ? 22.866 44.120  31.391 1.00 35.49 ? 249  1PE B C24 1 
HETATM 3523 O  OH5 . 1PE E 2 .   ? 25.158 43.676  31.917 1.00 39.07 ? 249  1PE B OH5 1 
HETATM 3524 C  C15 . 1PE E 2 .   ? 27.396 42.942  31.976 1.00 36.51 ? 249  1PE B C15 1 
HETATM 3525 C  C25 . 1PE E 2 .   ? 26.476 44.138  32.222 1.00 37.63 ? 249  1PE B C25 1 
HETATM 3526 O  OH6 . 1PE E 2 .   ? 26.797 41.817  32.602 1.00 37.94 ? 249  1PE B OH6 1 
HETATM 3527 C  C16 . 1PE E 2 .   ? 28.795 40.537  32.878 1.00 44.86 ? 249  1PE B C16 1 
HETATM 3528 C  C26 . 1PE E 2 .   ? 27.405 40.589  32.251 1.00 38.90 ? 249  1PE B C26 1 
HETATM 3529 O  OH7 . 1PE E 2 .   ? 29.817 40.999  31.987 1.00 53.59 ? 249  1PE B OH7 1 
HETATM 3530 CA CA  . CA  F 3 .   ? 46.453 8.630   31.415 1.00 34.99 ? 1023 CA  C CA  1 
HETATM 3531 CA CA  . CA  G 3 .   ? 34.563 32.796  27.927 1.00 28.47 ? 1021 CA  D CA  1 
HETATM 3532 CA CA  . CA  H 3 .   ? 29.874 41.216  51.866 1.00 42.93 ? 1022 CA  D CA  1 
HETATM 3533 O  O   . HOH I 4 .   ? 33.704 13.935  20.986 1.00 32.21 ? 1105 HOH A O   1 
HETATM 3534 O  O   . HOH I 4 .   ? 22.707 17.800  13.006 1.00 51.74 ? 1106 HOH A O   1 
HETATM 3535 O  O   . HOH I 4 .   ? 25.589 22.952  23.068 1.00 38.86 ? 1107 HOH A O   1 
HETATM 3536 O  O   . HOH I 4 .   ? 20.410 17.104  15.299 1.00 29.07 ? 1108 HOH A O   1 
HETATM 3537 O  O   . HOH I 4 .   ? 26.763 8.355   29.315 1.00 19.21 ? 1109 HOH A O   1 
HETATM 3538 O  O   . HOH I 4 .   ? 25.744 13.365  30.461 1.00 32.06 ? 1110 HOH A O   1 
HETATM 3539 O  O   . HOH I 4 .   ? 27.532 6.721   32.848 1.00 38.65 ? 1111 HOH A O   1 
HETATM 3540 O  O   . HOH I 4 .   ? 18.245 18.266  16.629 1.00 28.39 ? 1112 HOH A O   1 
HETATM 3541 O  O   . HOH I 4 .   ? 23.260 14.366  29.164 1.00 21.00 ? 1113 HOH A O   1 
HETATM 3542 O  O   . HOH I 4 .   ? 20.651 6.306   35.427 1.00 25.08 ? 1116 HOH A O   1 
HETATM 3543 O  O   . HOH I 4 .   ? 13.693 14.872  13.312 1.00 29.91 ? 1118 HOH A O   1 
HETATM 3544 O  O   . HOH I 4 .   ? 10.257 20.310  28.411 1.00 19.75 ? 1119 HOH A O   1 
HETATM 3545 O  O   . HOH I 4 .   ? 17.034 0.246   35.599 1.00 32.81 ? 1120 HOH A O   1 
HETATM 3546 O  O   . HOH I 4 .   ? 6.051  17.933  31.202 1.00 21.61 ? 1121 HOH A O   1 
HETATM 3547 O  O   . HOH I 4 .   ? 4.997  14.576  24.993 1.00 33.94 ? 1122 HOH A O   1 
HETATM 3548 O  O   . HOH I 4 .   ? 0.916  19.643  30.618 1.00 37.91 ? 1123 HOH A O   1 
HETATM 3549 O  O   . HOH I 4 .   ? 5.906  11.136  30.408 1.00 46.39 ? 1124 HOH A O   1 
HETATM 3550 O  O   . HOH I 4 .   ? 6.559  5.604   30.508 1.00 37.39 ? 1125 HOH A O   1 
HETATM 3551 O  O   . HOH I 4 .   ? 8.033  4.439   28.006 1.00 43.67 ? 1126 HOH A O   1 
HETATM 3552 O  O   . HOH I 4 .   ? 5.753  3.756   33.445 1.00 43.48 ? 1127 HOH A O   1 
HETATM 3553 O  O   . HOH I 4 .   ? 16.374 19.854  15.198 1.00 26.92 ? 1154 HOH A O   1 
HETATM 3554 O  O   . HOH I 4 .   ? 25.519 -10.203 13.390 1.00 29.39 ? 1170 HOH A O   1 
HETATM 3555 O  O   . HOH I 4 .   ? 10.631 22.205  16.485 1.00 23.48 ? 1220 HOH A O   1 
HETATM 3556 O  O   . HOH I 4 .   ? 26.086 -7.425  31.507 1.00 39.58 ? 1269 HOH A O   1 
HETATM 3557 O  O   . HOH I 4 .   ? 9.649  26.708  34.475 1.00 36.02 ? 1277 HOH A O   1 
HETATM 3558 O  O   . HOH I 4 .   ? 6.687  28.384  34.247 1.00 45.71 ? 1300 HOH A O   1 
HETATM 3559 O  O   . HOH I 4 .   ? 24.941 16.106  28.105 1.00 27.22 ? 1309 HOH A O   1 
HETATM 3560 O  O   . HOH I 4 .   ? 31.223 4.884   34.089 1.00 30.96 ? 1360 HOH A O   1 
HETATM 3561 O  O   . HOH I 4 .   ? 19.647 3.819   14.444 1.00 26.16 ? 1361 HOH A O   1 
HETATM 3562 O  O   . HOH I 4 .   ? 12.171 -3.712  34.829 1.00 52.07 ? 1364 HOH A O   1 
HETATM 3563 O  O   . HOH I 4 .   ? 14.715 10.503  15.414 1.00 47.98 ? 1366 HOH A O   1 
HETATM 3564 O  O   . HOH I 4 .   ? 3.284  18.073  30.684 1.00 39.22 ? 1370 HOH A O   1 
HETATM 3565 O  O   . HOH I 4 .   ? 16.114 12.267  13.222 1.00 41.79 ? 1371 HOH A O   1 
HETATM 3566 O  O   . HOH I 4 .   ? 26.710 -10.158 28.570 1.00 46.72 ? 1374 HOH A O   1 
HETATM 3567 O  O   . HOH I 4 .   ? 13.842 2.095   17.391 1.00 51.23 ? 1376 HOH A O   1 
HETATM 3568 O  O   . HOH I 4 .   ? 23.624 18.176  26.993 1.00 46.55 ? 1377 HOH A O   1 
HETATM 3569 O  O   . HOH I 4 .   ? 17.679 9.897   14.906 1.00 29.42 ? 1378 HOH A O   1 
HETATM 3570 O  O   . HOH I 4 .   ? 21.173 -2.881  15.825 1.00 44.25 ? 1380 HOH A O   1 
HETATM 3571 O  O   . HOH I 4 .   ? 25.990 6.184   14.411 1.00 40.98 ? 1381 HOH A O   1 
HETATM 3572 O  O   . HOH I 4 .   ? 25.475 8.938   15.031 1.00 40.93 ? 1382 HOH A O   1 
HETATM 3573 O  O   . HOH I 4 .   ? 27.045 17.549  12.911 1.00 44.46 ? 1384 HOH A O   1 
HETATM 3574 O  O   . HOH I 4 .   ? 15.174 -5.506  13.111 1.00 43.09 ? 1387 HOH A O   1 
HETATM 3575 O  O   . HOH I 4 .   ? 3.093  25.580  28.841 1.00 47.33 ? 1388 HOH A O   1 
HETATM 3576 O  O   . HOH I 4 .   ? 27.283 3.257   16.277 1.00 28.50 ? 1390 HOH A O   1 
HETATM 3577 O  O   . HOH I 4 .   ? 31.590 8.583   17.790 1.00 31.43 ? 1391 HOH A O   1 
HETATM 3578 O  O   . HOH I 4 .   ? 28.183 8.699   15.618 1.00 37.69 ? 1392 HOH A O   1 
HETATM 3579 O  O   . HOH I 4 .   ? 24.599 3.854   15.072 1.00 40.30 ? 1393 HOH A O   1 
HETATM 3580 O  O   . HOH I 4 .   ? 7.506  9.248   13.243 1.00 51.74 ? 1430 HOH A O   1 
HETATM 3581 O  O   . HOH I 4 .   ? 5.136  2.358   29.831 1.00 44.25 ? 1441 HOH A O   1 
HETATM 3582 O  O   . HOH I 4 .   ? 28.597 17.387  31.041 1.00 40.53 ? 1447 HOH A O   1 
HETATM 3583 O  O   . HOH I 4 .   ? 34.884 -9.534  12.912 1.00 33.84 ? 1454 HOH A O   1 
HETATM 3584 O  O   . HOH I 4 .   ? 22.556 3.172   12.871 1.00 35.99 ? 1458 HOH A O   1 
HETATM 3585 O  O   . HOH I 4 .   ? 0.573  13.064  16.484 1.00 44.57 ? 1461 HOH A O   1 
HETATM 3586 O  O   . HOH I 4 .   ? 24.604 -9.866  26.249 1.00 43.72 ? 1464 HOH A O   1 
HETATM 3587 O  O   . HOH I 4 .   ? 39.709 -9.399  16.482 1.00 30.44 ? 1507 HOH A O   1 
HETATM 3588 O  O   . HOH I 4 .   ? 9.926  24.411  36.529 1.00 37.21 ? 1509 HOH A O   1 
HETATM 3589 O  O   . HOH I 4 .   ? 12.185 2.224   34.335 1.00 56.22 ? 1523 HOH A O   1 
HETATM 3590 O  O   . HOH J 4 .   ? 15.116 22.225  22.815 1.00 19.32 ? 1114 HOH B O   1 
HETATM 3591 O  O   . HOH J 4 .   ? 15.033 21.355  35.696 1.00 38.95 ? 1115 HOH B O   1 
HETATM 3592 O  O   . HOH J 4 .   ? 15.267 18.912  37.475 1.00 41.62 ? 1117 HOH B O   1 
HETATM 3593 O  O   . HOH J 4 .   ? 34.421 31.639  20.635 1.00 57.58 ? 1129 HOH B O   1 
HETATM 3594 O  O   . HOH J 4 .   ? 13.246 35.686  8.764  1.00 63.66 ? 1133 HOH B O   1 
HETATM 3595 O  O   . HOH J 4 .   ? 14.868 40.514  7.810  1.00 46.95 ? 1136 HOH B O   1 
HETATM 3596 O  O   . HOH J 4 .   ? 10.511 41.610  30.508 1.00 54.06 ? 1139 HOH B O   1 
HETATM 3597 O  O   . HOH J 4 .   ? 9.657  38.390  31.085 1.00 36.52 ? 1141 HOH B O   1 
HETATM 3598 O  O   . HOH J 4 .   ? 32.915 38.699  23.494 1.00 40.84 ? 1144 HOH B O   1 
HETATM 3599 O  O   . HOH J 4 .   ? 29.548 21.469  24.434 1.00 44.50 ? 1145 HOH B O   1 
HETATM 3600 O  O   . HOH J 4 .   ? 26.181 34.331  29.823 1.00 34.71 ? 1146 HOH B O   1 
HETATM 3601 O  O   . HOH J 4 .   ? 2.909  45.550  9.710  1.00 33.50 ? 1156 HOH B O   1 
HETATM 3602 O  O   . HOH J 4 .   ? 18.671 28.692  31.947 1.00 31.92 ? 1158 HOH B O   1 
HETATM 3603 O  O   . HOH J 4 .   ? 24.551 47.693  13.911 1.00 39.92 ? 1161 HOH B O   1 
HETATM 3604 O  O   . HOH J 4 .   ? 14.463 28.577  32.747 1.00 33.62 ? 1163 HOH B O   1 
HETATM 3605 O  O   . HOH J 4 .   ? 11.799 43.370  8.564  1.00 42.64 ? 1167 HOH B O   1 
HETATM 3606 O  O   . HOH J 4 .   ? 15.639 30.378  9.410  1.00 35.98 ? 1172 HOH B O   1 
HETATM 3607 O  O   . HOH J 4 .   ? 26.042 53.508  19.228 1.00 35.35 ? 1173 HOH B O   1 
HETATM 3608 O  O   . HOH J 4 .   ? 16.723 43.317  9.437  1.00 70.54 ? 1174 HOH B O   1 
HETATM 3609 O  O   . HOH J 4 .   ? 11.039 27.202  31.989 1.00 35.23 ? 1175 HOH B O   1 
HETATM 3610 O  O   . HOH J 4 .   ? 26.492 54.880  14.660 1.00 45.35 ? 1176 HOH B O   1 
HETATM 3611 O  O   . HOH J 4 .   ? 26.009 21.500  26.306 1.00 37.33 ? 1181 HOH B O   1 
HETATM 3612 O  O   . HOH J 4 .   ? 25.015 38.231  32.413 1.00 46.20 ? 1190 HOH B O   1 
HETATM 3613 O  O   . HOH J 4 .   ? 13.328 45.647  6.880  1.00 50.19 ? 1191 HOH B O   1 
HETATM 3614 O  O   . HOH J 4 .   ? 9.102  28.582  30.815 1.00 28.84 ? 1192 HOH B O   1 
HETATM 3615 O  O   . HOH J 4 .   ? 16.216 53.125  18.778 1.00 20.19 ? 1194 HOH B O   1 
HETATM 3616 O  O   . HOH J 4 .   ? 10.760 56.327  24.871 1.00 25.61 ? 1197 HOH B O   1 
HETATM 3617 O  O   . HOH J 4 .   ? 19.161 31.540  33.429 1.00 41.50 ? 1198 HOH B O   1 
HETATM 3618 O  O   . HOH J 4 .   ? 25.323 26.251  24.066 1.00 29.38 ? 1204 HOH B O   1 
HETATM 3619 O  O   . HOH J 4 .   ? 18.912 50.780  14.345 1.00 28.88 ? 1205 HOH B O   1 
HETATM 3620 O  O   . HOH J 4 .   ? 28.562 46.055  22.818 1.00 37.71 ? 1206 HOH B O   1 
HETATM 3621 O  O   . HOH J 4 .   ? 17.682 38.715  10.160 1.00 31.02 ? 1209 HOH B O   1 
HETATM 3622 O  O   . HOH J 4 .   ? 15.338 26.949  28.916 1.00 11.70 ? 1217 HOH B O   1 
HETATM 3623 O  O   . HOH J 4 .   ? 16.493 28.977  30.383 1.00 19.55 ? 1223 HOH B O   1 
HETATM 3624 O  O   . HOH J 4 .   ? 12.017 34.217  29.751 1.00 24.35 ? 1232 HOH B O   1 
HETATM 3625 O  O   . HOH J 4 .   ? 26.536 25.536  28.250 1.00 29.21 ? 1234 HOH B O   1 
HETATM 3626 O  O   . HOH J 4 .   ? 25.412 37.399  29.161 1.00 27.51 ? 1235 HOH B O   1 
HETATM 3627 O  O   . HOH J 4 .   ? 22.061 39.616  17.387 1.00 15.04 ? 1238 HOH B O   1 
HETATM 3628 O  O   . HOH J 4 .   ? 14.228 24.366  29.787 1.00 22.47 ? 1239 HOH B O   1 
HETATM 3629 O  O   . HOH J 4 .   ? 23.022 47.566  29.327 1.00 39.50 ? 1240 HOH B O   1 
HETATM 3630 O  O   . HOH J 4 .   ? 21.098 32.679  17.559 1.00 35.09 ? 1241 HOH B O   1 
HETATM 3631 O  O   . HOH J 4 .   ? 23.864 37.449  16.707 1.00 37.28 ? 1242 HOH B O   1 
HETATM 3632 O  O   . HOH J 4 .   ? 20.198 57.839  14.584 1.00 26.12 ? 1246 HOH B O   1 
HETATM 3633 O  O   . HOH J 4 .   ? 22.701 31.034  19.118 1.00 26.32 ? 1247 HOH B O   1 
HETATM 3634 O  O   . HOH J 4 .   ? 26.643 43.795  23.560 1.00 23.03 ? 1253 HOH B O   1 
HETATM 3635 O  O   . HOH J 4 .   ? 23.890 51.918  23.175 1.00 37.61 ? 1263 HOH B O   1 
HETATM 3636 O  O   . HOH J 4 .   ? 13.550 26.049  31.905 1.00 33.45 ? 1264 HOH B O   1 
HETATM 3637 O  O   . HOH J 4 .   ? 10.689 31.547  31.432 1.00 47.94 ? 1266 HOH B O   1 
HETATM 3638 O  O   . HOH J 4 .   ? 22.022 54.673  22.853 1.00 37.03 ? 1271 HOH B O   1 
HETATM 3639 O  O   . HOH J 4 .   ? 7.956  56.039  27.031 1.00 55.41 ? 1280 HOH B O   1 
HETATM 3640 O  O   . HOH J 4 .   ? 15.342 17.025  12.461 1.00 55.13 ? 1281 HOH B O   1 
HETATM 3641 O  O   . HOH J 4 .   ? 12.862 44.437  3.810  1.00 49.95 ? 1284 HOH B O   1 
HETATM 3642 O  O   . HOH J 4 .   ? 28.546 31.433  28.564 1.00 47.71 ? 1289 HOH B O   1 
HETATM 3643 O  O   . HOH J 4 .   ? 23.058 27.656  32.358 1.00 45.02 ? 1293 HOH B O   1 
HETATM 3644 O  O   . HOH J 4 .   ? 28.377 27.865  25.772 1.00 37.73 ? 1294 HOH B O   1 
HETATM 3645 O  O   . HOH J 4 .   ? 22.435 24.151  33.420 1.00 39.38 ? 1297 HOH B O   1 
HETATM 3646 O  O   . HOH J 4 .   ? 0.897  25.934  24.841 1.00 47.80 ? 1311 HOH B O   1 
HETATM 3647 O  O   . HOH J 4 .   ? 10.144 48.734  5.731  1.00 39.11 ? 1321 HOH B O   1 
HETATM 3648 O  O   . HOH J 4 .   ? 16.596 27.837  34.825 1.00 50.15 ? 1331 HOH B O   1 
HETATM 3649 O  O   . HOH J 4 .   ? 8.866  32.982  29.638 1.00 51.57 ? 1337 HOH B O   1 
HETATM 3650 O  O   . HOH J 4 .   ? 18.790 42.705  33.580 1.00 43.47 ? 1342 HOH B O   1 
HETATM 3651 O  O   . HOH J 4 .   ? 22.819 36.661  11.619 1.00 46.70 ? 1344 HOH B O   1 
HETATM 3652 O  O   . HOH J 4 .   ? 19.465 28.669  34.714 1.00 39.89 ? 1345 HOH B O   1 
HETATM 3653 O  O   . HOH J 4 .   ? 3.487  36.484  13.806 1.00 40.41 ? 1353 HOH B O   1 
HETATM 3654 O  O   . HOH J 4 .   ? 0.837  22.245  22.324 1.00 55.83 ? 1405 HOH B O   1 
HETATM 3655 O  O   . HOH J 4 .   ? 30.392 39.323  25.039 1.00 34.89 ? 1409 HOH B O   1 
HETATM 3656 O  O   . HOH J 4 .   ? 13.220 32.748  8.629  1.00 49.26 ? 1411 HOH B O   1 
HETATM 3657 O  O   . HOH J 4 .   ? 5.934  30.983  8.318  1.00 45.39 ? 1420 HOH B O   1 
HETATM 3658 O  O   . HOH J 4 .   ? 3.024  40.996  27.927 1.00 42.40 ? 1422 HOH B O   1 
HETATM 3659 O  O   . HOH J 4 .   ? 16.200 42.165  4.789  1.00 62.98 ? 1428 HOH B O   1 
HETATM 3660 O  O   . HOH J 4 .   ? 4.930  40.213  24.269 1.00 53.41 ? 1429 HOH B O   1 
HETATM 3661 O  O   . HOH J 4 .   ? 16.093 51.978  11.936 1.00 39.24 ? 1434 HOH B O   1 
HETATM 3662 O  O   . HOH J 4 .   ? 4.318  19.369  8.919  1.00 47.53 ? 1440 HOH B O   1 
HETATM 3663 O  O   . HOH J 4 .   ? 2.076  24.174  15.211 1.00 53.91 ? 1443 HOH B O   1 
HETATM 3664 O  O   . HOH J 4 .   ? 15.474 42.729  30.690 1.00 38.63 ? 1444 HOH B O   1 
HETATM 3665 O  O   . HOH J 4 .   ? 6.167  47.337  5.349  1.00 53.27 ? 1463 HOH B O   1 
HETATM 3666 O  O   . HOH J 4 .   ? 25.441 49.608  19.993 1.00 33.89 ? 1506 HOH B O   1 
HETATM 3667 O  O   . HOH K 4 .   ? 44.819 10.251  32.056 1.00 31.08 ? 1027 HOH C O   1 
HETATM 3668 O  O   . HOH K 4 .   ? 47.508 7.695   33.365 1.00 35.15 ? 1028 HOH C O   1 
HETATM 3669 O  O   . HOH K 4 .   ? 48.695 9.256   30.957 1.00 29.22 ? 1029 HOH C O   1 
HETATM 3670 O  O   . HOH K 4 .   ? 44.059 26.360  36.277 1.00 22.42 ? 1128 HOH C O   1 
HETATM 3671 O  O   . HOH K 4 .   ? 50.215 13.426  34.211 1.00 31.74 ? 1130 HOH C O   1 
HETATM 3672 O  O   . HOH K 4 .   ? 34.029 21.538  54.154 1.00 48.71 ? 1134 HOH C O   1 
HETATM 3673 O  O   . HOH K 4 .   ? 39.069 5.943   33.085 1.00 53.70 ? 1147 HOH C O   1 
HETATM 3674 O  O   . HOH K 4 .   ? 34.970 24.222  52.427 1.00 40.12 ? 1148 HOH C O   1 
HETATM 3675 O  O   . HOH K 4 .   ? 28.412 33.531  47.673 1.00 44.44 ? 1150 HOH C O   1 
HETATM 3676 O  O   . HOH K 4 .   ? 45.977 17.661  29.654 1.00 48.44 ? 1153 HOH C O   1 
HETATM 3677 O  O   . HOH K 4 .   ? 31.097 11.069  39.837 1.00 22.54 ? 1160 HOH C O   1 
HETATM 3678 O  O   . HOH K 4 .   ? 39.695 23.691  29.775 1.00 46.55 ? 1169 HOH C O   1 
HETATM 3679 O  O   . HOH K 4 .   ? 48.739 5.603   40.080 1.00 46.72 ? 1177 HOH C O   1 
HETATM 3680 O  O   . HOH K 4 .   ? 38.452 10.611  56.410 1.00 33.18 ? 1179 HOH C O   1 
HETATM 3681 O  O   . HOH K 4 .   ? 28.401 31.064  46.621 1.00 25.46 ? 1187 HOH C O   1 
HETATM 3682 O  O   . HOH K 4 .   ? 31.584 19.545  39.778 1.00 41.14 ? 1201 HOH C O   1 
HETATM 3683 O  O   . HOH K 4 .   ? 31.212 15.396  37.505 1.00 38.29 ? 1207 HOH C O   1 
HETATM 3684 O  O   . HOH K 4 .   ? 21.188 13.368  44.376 1.00 22.37 ? 1208 HOH C O   1 
HETATM 3685 O  O   . HOH K 4 .   ? 50.214 11.867  37.111 1.00 50.09 ? 1210 HOH C O   1 
HETATM 3686 O  O   . HOH K 4 .   ? 49.993 18.233  34.806 1.00 44.55 ? 1214 HOH C O   1 
HETATM 3687 O  O   . HOH K 4 .   ? 38.642 25.017  49.298 1.00 24.48 ? 1225 HOH C O   1 
HETATM 3688 O  O   . HOH K 4 .   ? 39.985 27.256  49.971 1.00 19.31 ? 1227 HOH C O   1 
HETATM 3689 O  O   . HOH K 4 .   ? 46.680 26.589  41.727 1.00 24.34 ? 1228 HOH C O   1 
HETATM 3690 O  O   . HOH K 4 .   ? 37.132 23.521  50.764 1.00 25.39 ? 1230 HOH C O   1 
HETATM 3691 O  O   . HOH K 4 .   ? 32.934 17.639  38.491 1.00 30.00 ? 1243 HOH C O   1 
HETATM 3692 O  O   . HOH K 4 .   ? 40.219 10.507  54.210 1.00 42.36 ? 1245 HOH C O   1 
HETATM 3693 O  O   . HOH K 4 .   ? 28.946 26.204  44.341 1.00 51.94 ? 1252 HOH C O   1 
HETATM 3694 O  O   . HOH K 4 .   ? 48.804 2.432   50.876 1.00 36.59 ? 1256 HOH C O   1 
HETATM 3695 O  O   . HOH K 4 .   ? 51.244 18.531  40.805 1.00 33.51 ? 1257 HOH C O   1 
HETATM 3696 O  O   . HOH K 4 .   ? 45.720 4.638   32.384 1.00 54.41 ? 1261 HOH C O   1 
HETATM 3697 O  O   . HOH K 4 .   ? 28.901 24.308  41.027 1.00 41.39 ? 1274 HOH C O   1 
HETATM 3698 O  O   . HOH K 4 .   ? 45.609 -2.697  31.603 1.00 49.62 ? 1276 HOH C O   1 
HETATM 3699 O  O   . HOH K 4 .   ? 21.970 8.818   36.303 1.00 45.69 ? 1279 HOH C O   1 
HETATM 3700 O  O   . HOH K 4 .   ? 41.049 11.857  30.681 1.00 29.94 ? 1287 HOH C O   1 
HETATM 3701 O  O   . HOH K 4 .   ? 34.457 19.302  55.855 1.00 47.88 ? 1288 HOH C O   1 
HETATM 3702 O  O   . HOH K 4 .   ? 17.851 13.033  47.051 1.00 31.43 ? 1295 HOH C O   1 
HETATM 3703 O  O   . HOH K 4 .   ? 41.624 1.272   27.661 1.00 61.55 ? 1303 HOH C O   1 
HETATM 3704 O  O   . HOH K 4 .   ? 32.370 19.055  31.177 1.00 43.71 ? 1315 HOH C O   1 
HETATM 3705 O  O   . HOH K 4 .   ? 19.469 15.072  45.662 1.00 48.16 ? 1316 HOH C O   1 
HETATM 3706 O  O   . HOH K 4 .   ? 42.727 8.091   54.610 1.00 56.42 ? 1326 HOH C O   1 
HETATM 3707 O  O   . HOH K 4 .   ? 41.316 20.071  29.052 1.00 39.86 ? 1330 HOH C O   1 
HETATM 3708 O  O   . HOH K 4 .   ? 40.238 -8.133  39.062 1.00 41.11 ? 1333 HOH C O   1 
HETATM 3709 O  O   . HOH K 4 .   ? 52.825 32.335  38.756 1.00 50.57 ? 1340 HOH C O   1 
HETATM 3710 O  O   . HOH K 4 .   ? 40.179 23.790  53.530 1.00 47.43 ? 1347 HOH C O   1 
HETATM 3711 O  O   . HOH K 4 .   ? 43.833 14.822  32.665 1.00 30.09 ? 1389 HOH C O   1 
HETATM 3712 O  O   . HOH K 4 .   ? 18.445 6.222   44.059 1.00 53.71 ? 1407 HOH C O   1 
HETATM 3713 O  O   . HOH K 4 .   ? 18.490 9.793   47.086 1.00 48.51 ? 1410 HOH C O   1 
HETATM 3714 O  O   . HOH K 4 .   ? 49.361 20.100  32.438 1.00 43.65 ? 1412 HOH C O   1 
HETATM 3715 O  O   . HOH K 4 .   ? 32.399 -4.433  42.259 1.00 41.31 ? 1421 HOH C O   1 
HETATM 3716 O  O   . HOH K 4 .   ? 36.321 -0.489  35.913 1.00 41.12 ? 1424 HOH C O   1 
HETATM 3717 O  O   . HOH K 4 .   ? 32.063 21.866  31.547 1.00 49.87 ? 1437 HOH C O   1 
HETATM 3718 O  O   . HOH K 4 .   ? 54.621 26.247  29.147 1.00 48.62 ? 1438 HOH C O   1 
HETATM 3719 O  O   . HOH K 4 .   ? 34.955 9.442   53.656 1.00 51.40 ? 1446 HOH C O   1 
HETATM 3720 O  O   . HOH K 4 .   ? 29.676 11.548  53.175 1.00 41.64 ? 1456 HOH C O   1 
HETATM 3721 O  O   . HOH K 4 .   ? 50.467 6.260   32.228 1.00 46.40 ? 1462 HOH C O   1 
HETATM 3722 O  O   . HOH K 4 .   ? 22.806 17.220  45.236 1.00 61.41 ? 1466 HOH C O   1 
HETATM 3723 O  O   . HOH K 4 .   ? 30.194 -0.768  45.229 1.00 40.11 ? 1519 HOH C O   1 
HETATM 3724 O  O   . HOH L 4 .   ? 36.890 32.430  27.721 1.00 24.58 ? 1024 HOH D O   1 
HETATM 3725 O  O   . HOH L 4 .   ? 35.049 30.934  29.322 1.00 27.97 ? 1025 HOH D O   1 
HETATM 3726 O  O   . HOH L 4 .   ? 31.347 42.865  52.839 1.00 31.45 ? 1026 HOH D O   1 
HETATM 3727 O  O   . HOH L 4 .   ? 22.455 45.496  39.519 1.00 46.16 ? 1132 HOH D O   1 
HETATM 3728 O  O   . HOH L 4 .   ? 46.505 41.139  53.506 1.00 25.80 ? 1135 HOH D O   1 
HETATM 3729 O  O   . HOH L 4 .   ? 37.977 45.274  53.726 1.00 41.75 ? 1138 HOH D O   1 
HETATM 3730 O  O   . HOH L 4 .   ? 21.928 44.651  36.769 1.00 27.65 ? 1140 HOH D O   1 
HETATM 3731 O  O   . HOH L 4 .   ? 35.556 55.905  31.455 1.00 33.05 ? 1142 HOH D O   1 
HETATM 3732 O  O   . HOH L 4 .   ? 52.337 31.433  47.975 1.00 42.15 ? 1143 HOH D O   1 
HETATM 3733 O  O   . HOH L 4 .   ? 59.825 24.478  48.580 1.00 40.98 ? 1149 HOH D O   1 
HETATM 3734 O  O   . HOH L 4 .   ? 25.454 33.933  32.960 1.00 35.88 ? 1151 HOH D O   1 
HETATM 3735 O  O   . HOH L 4 .   ? 41.875 59.115  53.350 1.00 51.54 ? 1152 HOH D O   1 
HETATM 3736 O  O   . HOH L 4 .   ? 27.955 42.970  52.054 1.00 42.09 ? 1157 HOH D O   1 
HETATM 3737 O  O   . HOH L 4 .   ? 19.328 46.523  39.555 1.00 49.64 ? 1162 HOH D O   1 
HETATM 3738 O  O   . HOH L 4 .   ? 42.334 34.141  31.684 1.00 25.02 ? 1164 HOH D O   1 
HETATM 3739 O  O   . HOH L 4 .   ? 26.640 35.518  34.853 1.00 25.40 ? 1165 HOH D O   1 
HETATM 3740 O  O   . HOH L 4 .   ? 41.719 26.191  52.537 1.00 54.23 ? 1166 HOH D O   1 
HETATM 3741 O  O   . HOH L 4 .   ? 25.173 41.020  50.981 1.00 37.80 ? 1180 HOH D O   1 
HETATM 3742 O  O   . HOH L 4 .   ? 32.901 61.354  32.974 1.00 47.36 ? 1185 HOH D O   1 
HETATM 3743 O  O   . HOH L 4 .   ? 49.199 44.404  48.616 1.00 55.72 ? 1186 HOH D O   1 
HETATM 3744 O  O   . HOH L 4 .   ? 50.488 34.252  43.662 1.00 27.11 ? 1189 HOH D O   1 
HETATM 3745 O  O   . HOH L 4 .   ? 48.924 37.778  50.511 1.00 41.81 ? 1195 HOH D O   1 
HETATM 3746 O  O   . HOH L 4 .   ? 29.151 29.120  42.414 1.00 25.51 ? 1196 HOH D O   1 
HETATM 3747 O  O   . HOH L 4 .   ? 31.499 33.130  31.243 1.00 30.94 ? 1202 HOH D O   1 
HETATM 3748 O  O   . HOH L 4 .   ? 33.475 31.251  32.729 1.00 30.16 ? 1203 HOH D O   1 
HETATM 3749 O  O   . HOH L 4 .   ? 28.768 41.646  47.276 1.00 22.25 ? 1212 HOH D O   1 
HETATM 3750 O  O   . HOH L 4 .   ? 32.815 34.522  46.504 1.00 35.13 ? 1215 HOH D O   1 
HETATM 3751 O  O   . HOH L 4 .   ? 39.893 28.328  41.896 1.00 12.01 ? 1216 HOH D O   1 
HETATM 3752 O  O   . HOH L 4 .   ? 35.548 32.617  33.681 1.00 18.33 ? 1218 HOH D O   1 
HETATM 3753 O  O   . HOH L 4 .   ? 39.368 28.656  34.414 1.00 16.49 ? 1219 HOH D O   1 
HETATM 3754 O  O   . HOH L 4 .   ? 38.404 33.931  29.548 1.00 20.31 ? 1221 HOH D O   1 
HETATM 3755 O  O   . HOH L 4 .   ? 29.170 43.940  45.652 1.00 17.85 ? 1222 HOH D O   1 
HETATM 3756 O  O   . HOH L 4 .   ? 50.201 26.750  43.278 1.00 23.76 ? 1224 HOH D O   1 
HETATM 3757 O  O   . HOH L 4 .   ? 22.132 37.260  38.648 1.00 21.90 ? 1226 HOH D O   1 
HETATM 3758 O  O   . HOH L 4 .   ? 45.783 30.693  47.582 1.00 25.33 ? 1229 HOH D O   1 
HETATM 3759 O  O   . HOH L 4 .   ? 37.666 45.416  31.269 1.00 22.37 ? 1231 HOH D O   1 
HETATM 3760 O  O   . HOH L 4 .   ? 26.995 45.967  27.617 1.00 23.52 ? 1233 HOH D O   1 
HETATM 3761 O  O   . HOH L 4 .   ? 37.339 31.390  35.413 1.00 25.38 ? 1236 HOH D O   1 
HETATM 3762 O  O   . HOH L 4 .   ? 49.870 32.179  49.678 1.00 25.92 ? 1237 HOH D O   1 
HETATM 3763 O  O   . HOH L 4 .   ? 30.081 39.275  47.475 1.00 27.25 ? 1244 HOH D O   1 
HETATM 3764 O  O   . HOH L 4 .   ? 50.529 25.000  51.117 1.00 16.36 ? 1248 HOH D O   1 
HETATM 3765 O  O   . HOH L 4 .   ? 27.308 27.122  38.575 1.00 29.98 ? 1249 HOH D O   1 
HETATM 3766 O  O   . HOH L 4 .   ? 41.664 46.630  31.018 1.00 29.42 ? 1250 HOH D O   1 
HETATM 3767 O  O   . HOH L 4 .   ? 27.841 34.202  44.699 1.00 37.98 ? 1251 HOH D O   1 
HETATM 3768 O  O   . HOH L 4 .   ? 52.894 25.886  44.095 1.00 33.52 ? 1254 HOH D O   1 
HETATM 3769 O  O   . HOH L 4 .   ? 42.339 26.613  55.952 1.00 36.97 ? 1255 HOH D O   1 
HETATM 3770 O  O   . HOH L 4 .   ? 49.903 39.828  48.137 1.00 44.77 ? 1260 HOH D O   1 
HETATM 3771 O  O   . HOH L 4 .   ? 32.871 29.567  30.088 1.00 39.72 ? 1262 HOH D O   1 
HETATM 3772 O  O   . HOH L 4 .   ? 34.675 64.010  47.159 1.00 47.97 ? 1286 HOH D O   1 
HETATM 3773 O  O   . HOH L 4 .   ? 33.220 60.645  39.548 1.00 52.03 ? 1291 HOH D O   1 
HETATM 3774 O  O   . HOH L 4 .   ? 30.910 54.312  27.471 1.00 48.06 ? 1292 HOH D O   1 
HETATM 3775 O  O   . HOH L 4 .   ? 29.292 20.833  37.423 1.00 52.78 ? 1298 HOH D O   1 
HETATM 3776 O  O   . HOH L 4 .   ? 26.196 40.554  47.655 1.00 52.83 ? 1299 HOH D O   1 
HETATM 3777 O  O   . HOH L 4 .   ? 24.865 48.368  49.108 1.00 53.05 ? 1306 HOH D O   1 
HETATM 3778 O  O   . HOH L 4 .   ? 43.375 33.196  54.115 1.00 34.68 ? 1308 HOH D O   1 
HETATM 3779 O  O   . HOH L 4 .   ? 48.767 36.362  53.067 1.00 39.18 ? 1310 HOH D O   1 
HETATM 3780 O  O   . HOH L 4 .   ? 41.531 54.883  30.082 1.00 37.92 ? 1312 HOH D O   1 
HETATM 3781 O  O   . HOH L 4 .   ? 29.076 56.977  42.203 1.00 46.38 ? 1322 HOH D O   1 
HETATM 3782 O  O   . HOH L 4 .   ? 19.903 45.162  47.256 1.00 52.33 ? 1332 HOH D O   1 
HETATM 3783 O  O   . HOH L 4 .   ? 32.007 37.168  46.170 1.00 43.84 ? 1335 HOH D O   1 
HETATM 3784 O  O   . HOH L 4 .   ? 35.650 46.023  29.211 1.00 40.99 ? 1339 HOH D O   1 
HETATM 3785 O  O   . HOH L 4 .   ? 36.938 51.807  31.314 1.00 45.30 ? 1341 HOH D O   1 
HETATM 3786 O  O   . HOH L 4 .   ? 39.148 30.436  32.035 1.00 17.64 ? 1404 HOH D O   1 
HETATM 3787 O  O   . HOH L 4 .   ? 29.799 34.134  27.910 1.00 28.75 ? 1406 HOH D O   1 
HETATM 3788 O  O   . HOH L 4 .   ? 51.855 33.864  41.242 1.00 64.26 ? 1414 HOH D O   1 
HETATM 3789 O  O   . HOH L 4 .   ? 47.727 41.100  41.717 1.00 35.47 ? 1418 HOH D O   1 
HETATM 3790 O  O   . HOH L 4 .   ? 24.466 54.548  43.747 1.00 53.28 ? 1419 HOH D O   1 
HETATM 3791 O  O   . HOH L 4 .   ? 56.971 31.610  49.136 1.00 44.36 ? 1455 HOH D O   1 
HETATM 3792 O  O   . HOH L 4 .   ? 46.713 47.217  35.996 1.00 51.75 ? 1457 HOH D O   1 
HETATM 3793 O  O   . HOH L 4 .   ? 42.572 42.347  52.583 1.00 55.24 ? 1459 HOH D O   1 
HETATM 3794 O  O   . HOH L 4 .   ? 34.731 28.232  28.355 1.00 37.81 ? 1515 HOH D O   1 
HETATM 3795 O  O   . HOH L 4 .   ? 44.323 37.583  28.523 1.00 44.08 ? 1518 HOH D O   1 
HETATM 3796 O  O   . HOH L 4 .   ? 42.425 48.375  34.242 1.00 50.42 ? 1521 HOH D O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -24 ?   ?   ?   A . n 
A 1 2   LYS 2   -23 ?   ?   ?   A . n 
A 1 3   LYS 3   -22 ?   ?   ?   A . n 
A 1 4   THR 4   -21 ?   ?   ?   A . n 
A 1 5   GLN 5   -20 ?   ?   ?   A . n 
A 1 6   THR 6   -19 ?   ?   ?   A . n 
A 1 7   TRP 7   -18 ?   ?   ?   A . n 
A 1 8   ILE 8   -17 ?   ?   ?   A . n 
A 1 9   LEU 9   -16 ?   ?   ?   A . n 
A 1 10  THR 10  -15 ?   ?   ?   A . n 
A 1 11  CYS 11  -14 ?   ?   ?   A . n 
A 1 12  ILE 12  -13 ?   ?   ?   A . n 
A 1 13  TYR 13  -12 ?   ?   ?   A . n 
A 1 14  LEU 14  -11 ?   ?   ?   A . n 
A 1 15  GLN 15  -10 ?   ?   ?   A . n 
A 1 16  LEU 16  -9  ?   ?   ?   A . n 
A 1 17  LEU 17  -8  ?   ?   ?   A . n 
A 1 18  LEU 18  -7  ?   ?   ?   A . n 
A 1 19  PHE 19  -6  ?   ?   ?   A . n 
A 1 20  ASN 20  -5  ?   ?   ?   A . n 
A 1 21  PRO 21  -4  ?   ?   ?   A . n 
A 1 22  LEU 22  -3  ?   ?   ?   A . n 
A 1 23  VAL 23  -2  ?   ?   ?   A . n 
A 1 24  LYS 24  -1  ?   ?   ?   A . n 
A 1 25  THR 25  0   ?   ?   ?   A . n 
A 1 26  GLU 26  1   ?   ?   ?   A . n 
A 1 27  GLY 27  2   ?   ?   ?   A . n 
A 1 28  ILE 28  3   ?   ?   ?   A . n 
A 1 29  CYS 29  4   ?   ?   ?   A . n 
A 1 30  ARG 30  5   ?   ?   ?   A . n 
A 1 31  ASN 31  6   ?   ?   ?   A . n 
A 1 32  ARG 32  7   ?   ?   ?   A . n 
A 1 33  VAL 33  8   ?   ?   ?   A . n 
A 1 34  THR 34  9   ?   ?   ?   A . n 
A 1 35  ASN 35  10  ?   ?   ?   A . n 
A 1 36  ASN 36  11  11  ASN ASN A . n 
A 1 37  VAL 37  12  12  VAL VAL A . n 
A 1 38  LYS 38  13  13  LYS LYS A . n 
A 1 39  ASP 39  14  14  ASP ASP A . n 
A 1 40  VAL 40  15  15  VAL VAL A . n 
A 1 41  THR 41  16  16  THR THR A . n 
A 1 42  LYS 42  17  17  LYS LYS A . n 
A 1 43  LEU 43  18  18  LEU LEU A . n 
A 1 44  VAL 44  19  19  VAL VAL A . n 
A 1 45  ALA 45  20  20  ALA ALA A . n 
A 1 46  ASN 46  21  21  ASN ASN A . n 
A 1 47  LEU 47  22  22  LEU LEU A . n 
A 1 48  PRO 48  23  23  PRO PRO A . n 
A 1 49  LYS 49  24  24  LYS LYS A . n 
A 1 50  ASP 50  25  25  ASP ASP A . n 
A 1 51  TYR 51  26  26  TYR TYR A . n 
A 1 52  MSE 52  27  27  MSE MSE A . n 
A 1 53  ILE 53  28  28  ILE ILE A . n 
A 1 54  THR 54  29  29  THR THR A . n 
A 1 55  LEU 55  30  30  LEU LEU A . n 
A 1 56  LYS 56  31  31  LYS LYS A . n 
A 1 57  TYR 57  32  32  TYR TYR A . n 
A 1 58  VAL 58  33  33  VAL VAL A . n 
A 1 59  PRO 59  34  34  PRO PRO A . n 
A 1 60  GLY 60  35  35  GLY GLY A . n 
A 1 61  MSE 61  36  36  MSE MSE A . n 
A 1 62  ASP 62  37  37  ASP ASP A . n 
A 1 63  VAL 63  38  38  VAL VAL A . n 
A 1 64  LEU 64  39  39  LEU LEU A . n 
A 1 65  PRO 65  40  40  PRO PRO A . n 
A 1 66  SER 66  41  41  SER SER A . n 
A 1 67  HIS 67  42  42  HIS HIS A . n 
A 1 68  CYS 68  43  43  CYS CYS A . n 
A 1 69  TRP 69  44  44  TRP TRP A . n 
A 1 70  ILE 70  45  45  ILE ILE A . n 
A 1 71  SER 71  46  46  SER SER A . n 
A 1 72  GLU 72  47  47  GLU GLU A . n 
A 1 73  MSE 73  48  48  MSE MSE A . n 
A 1 74  VAL 74  49  49  VAL VAL A . n 
A 1 75  VAL 75  50  50  VAL VAL A . n 
A 1 76  GLN 76  51  51  GLN GLN A . n 
A 1 77  LEU 77  52  52  LEU LEU A . n 
A 1 78  SER 78  53  53  SER SER A . n 
A 1 79  ASP 79  54  54  ASP ASP A . n 
A 1 80  SER 80  55  55  SER SER A . n 
A 1 81  LEU 81  56  56  LEU LEU A . n 
A 1 82  THR 82  57  57  THR THR A . n 
A 1 83  ASP 83  58  58  ASP ASP A . n 
A 1 84  LEU 84  59  59  LEU LEU A . n 
A 1 85  LEU 85  60  60  LEU LEU A . n 
A 1 86  ASP 86  61  61  ASP ASP A . n 
A 1 87  LYS 87  62  62  LYS LYS A . n 
A 1 88  PHE 88  63  63  PHE PHE A . n 
A 1 89  SER 89  64  64  SER SER A . n 
A 1 90  ASN 90  65  65  ASN ASN A . n 
A 1 91  ILE 91  66  66  ILE ILE A . n 
A 1 92  SER 92  67  67  SER SER A . n 
A 1 93  GLU 93  68  68  GLU GLU A . n 
A 1 94  GLY 94  69  69  GLY GLY A . n 
A 1 95  LEU 95  70  70  LEU LEU A . n 
A 1 96  SER 96  71  71  SER SER A . n 
A 1 97  ASN 97  72  72  ASN ASN A . n 
A 1 98  TYR 98  73  73  TYR TYR A . n 
A 1 99  SER 99  74  74  SER SER A . n 
A 1 100 ILE 100 75  75  ILE ILE A . n 
A 1 101 ILE 101 76  76  ILE ILE A . n 
A 1 102 ASP 102 77  77  ASP ASP A . n 
A 1 103 LYS 103 78  78  LYS LYS A . n 
A 1 104 LEU 104 79  79  LEU LEU A . n 
A 1 105 VAL 105 80  80  VAL VAL A . n 
A 1 106 ASN 106 81  81  ASN ASN A . n 
A 1 107 ILE 107 82  82  ILE ILE A . n 
A 1 108 VAL 108 83  83  VAL VAL A . n 
A 1 109 ASP 109 84  84  ASP ASP A . n 
A 1 110 ASP 110 85  85  ASP ASP A . n 
A 1 111 LEU 111 86  86  LEU LEU A . n 
A 1 112 VAL 112 87  87  VAL VAL A . n 
A 1 113 GLU 113 88  88  GLU GLU A . n 
A 1 114 CYS 114 89  89  CYS CYS A . n 
A 1 115 VAL 115 90  90  VAL VAL A . n 
A 1 116 LYS 116 91  91  LYS LYS A . n 
A 1 117 GLU 117 92  ?   ?   ?   A . n 
A 1 118 ASN 118 93  ?   ?   ?   A . n 
A 1 119 SER 119 94  ?   ?   ?   A . n 
A 1 120 SER 120 95  ?   ?   ?   A . n 
A 1 121 LYS 121 96  ?   ?   ?   A . n 
A 1 122 ASP 122 97  ?   ?   ?   A . n 
A 1 123 LEU 123 98  ?   ?   ?   A . n 
A 1 124 LYS 124 99  ?   ?   ?   A . n 
A 1 125 LYS 125 100 ?   ?   ?   A . n 
A 1 126 SER 126 101 ?   ?   ?   A . n 
A 1 127 PHE 127 102 ?   ?   ?   A . n 
A 1 128 LYS 128 103 ?   ?   ?   A . n 
A 1 129 SER 129 104 104 SER SER A . n 
A 1 130 PRO 130 105 105 PRO PRO A . n 
A 1 131 GLU 131 106 106 GLU GLU A . n 
A 1 132 PRO 132 107 107 PRO PRO A . n 
A 1 133 ARG 133 108 108 ARG ARG A . n 
A 1 134 LEU 134 109 109 LEU LEU A . n 
A 1 135 PHE 135 110 110 PHE PHE A . n 
A 1 136 THR 136 111 111 THR THR A . n 
A 1 137 PRO 137 112 112 PRO PRO A . n 
A 1 138 GLU 138 113 113 GLU GLU A . n 
A 1 139 GLU 139 114 114 GLU GLU A . n 
A 1 140 PHE 140 115 115 PHE PHE A . n 
A 1 141 PHE 141 116 116 PHE PHE A . n 
A 1 142 ARG 142 117 117 ARG ARG A . n 
A 1 143 ILE 143 118 118 ILE ILE A . n 
A 1 144 PHE 144 119 119 PHE PHE A . n 
A 1 145 ASN 145 120 120 ASN ASN A . n 
A 1 146 ARG 146 121 121 ARG ARG A . n 
A 1 147 SER 147 122 122 SER SER A . n 
A 1 148 ILE 148 123 123 ILE ILE A . n 
A 1 149 ASP 149 124 124 ASP ASP A . n 
A 1 150 ALA 150 125 125 ALA ALA A . n 
A 1 151 PHE 151 126 126 PHE PHE A . n 
A 1 152 LYS 152 127 127 LYS LYS A . n 
A 1 153 ASP 153 128 128 ASP ASP A . n 
A 1 154 PHE 154 129 129 PHE PHE A . n 
A 1 155 VAL 155 130 130 VAL VAL A . n 
A 1 156 VAL 156 131 131 VAL VAL A . n 
A 1 157 ALA 157 132 132 ALA ALA A . n 
A 1 158 SER 158 133 133 SER SER A . n 
A 1 159 GLU 159 134 134 GLU GLU A . n 
A 1 160 THR 160 135 135 THR THR A . n 
A 1 161 SER 161 136 136 SER SER A . n 
A 1 162 ASP 162 137 137 ASP ASP A . n 
A 1 163 CYS 163 138 138 CYS CYS A . n 
A 1 164 VAL 164 139 139 VAL VAL A . n 
A 1 165 VAL 165 140 140 VAL VAL A . n 
A 1 166 SER 166 141 141 SER SER A . n 
A 1 167 SER 167 142 ?   ?   ?   A . n 
A 1 168 THR 168 143 ?   ?   ?   A . n 
A 1 169 LEU 169 144 ?   ?   ?   A . n 
A 1 170 SER 170 145 ?   ?   ?   A . n 
A 1 171 PRO 171 146 ?   ?   ?   A . n 
A 1 172 GLU 172 147 ?   ?   ?   A . n 
A 1 173 LYS 173 148 ?   ?   ?   A . n 
A 1 174 ASP 174 149 ?   ?   ?   A . n 
A 1 175 SER 175 150 ?   ?   ?   A . n 
A 1 176 ARG 176 151 ?   ?   ?   A . n 
A 1 177 VAL 177 152 ?   ?   ?   A . n 
A 1 178 SER 178 153 ?   ?   ?   A . n 
A 1 179 VAL 179 154 ?   ?   ?   A . n 
A 1 180 THR 180 155 ?   ?   ?   A . n 
A 1 181 LYS 181 156 ?   ?   ?   A . n 
A 1 182 PRO 182 157 ?   ?   ?   A . n 
A 1 183 PHE 183 158 ?   ?   ?   A . n 
A 1 184 MET 184 159 ?   ?   ?   A . n 
A 1 185 LEU 185 160 ?   ?   ?   A . n 
A 1 186 PRO 186 161 ?   ?   ?   A . n 
A 1 187 PRO 187 162 ?   ?   ?   A . n 
A 1 188 VAL 188 163 ?   ?   ?   A . n 
A 1 189 ALA 189 164 ?   ?   ?   A . n 
A 1 190 ALA 190 165 ?   ?   ?   A . n 
A 1 191 SER 191 166 ?   ?   ?   A . n 
A 1 192 SER 192 167 ?   ?   ?   A . n 
A 1 193 LEU 193 168 ?   ?   ?   A . n 
A 1 194 ARG 194 169 ?   ?   ?   A . n 
A 1 195 ASN 195 170 ?   ?   ?   A . n 
A 1 196 ASP 196 171 ?   ?   ?   A . n 
A 1 197 SER 197 172 ?   ?   ?   A . n 
A 1 198 SER 198 173 ?   ?   ?   A . n 
A 1 199 SER 199 174 ?   ?   ?   A . n 
A 1 200 SER 200 175 ?   ?   ?   A . n 
A 1 201 ASN 201 176 ?   ?   ?   A . n 
A 1 202 ARG 202 177 ?   ?   ?   A . n 
A 1 203 LYS 203 178 ?   ?   ?   A . n 
A 1 204 ALA 204 179 ?   ?   ?   A . n 
A 1 205 LYS 205 180 ?   ?   ?   A . n 
A 1 206 ASN 206 181 ?   ?   ?   A . n 
A 1 207 PRO 207 182 ?   ?   ?   A . n 
A 1 208 PRO 208 183 ?   ?   ?   A . n 
A 1 209 GLY 209 184 ?   ?   ?   A . n 
A 1 210 ASP 210 185 ?   ?   ?   A . n 
A 1 211 SER 211 186 ?   ?   ?   A . n 
A 1 212 SER 212 187 ?   ?   ?   A . n 
A 1 213 LEU 213 188 ?   ?   ?   A . n 
A 1 214 HIS 214 189 ?   ?   ?   A . n 
A 1 215 TRP 215 190 ?   ?   ?   A . n 
A 1 216 ALA 216 191 ?   ?   ?   A . n 
A 1 217 ALA 217 192 ?   ?   ?   A . n 
A 1 218 MET 218 193 ?   ?   ?   A . n 
A 1 219 ALA 219 194 ?   ?   ?   A . n 
A 1 220 LEU 220 195 ?   ?   ?   A . n 
A 1 221 PRO 221 196 ?   ?   ?   A . n 
A 1 222 ALA 222 197 ?   ?   ?   A . n 
A 1 223 LEU 223 198 ?   ?   ?   A . n 
A 1 224 PHE 224 199 ?   ?   ?   A . n 
A 1 225 SER 225 200 ?   ?   ?   A . n 
A 1 226 LEU 226 201 ?   ?   ?   A . n 
A 1 227 ILE 227 202 ?   ?   ?   A . n 
A 1 228 ILE 228 203 ?   ?   ?   A . n 
A 1 229 GLY 229 204 ?   ?   ?   A . n 
A 1 230 PHE 230 205 ?   ?   ?   A . n 
A 1 231 ALA 231 206 ?   ?   ?   A . n 
A 1 232 PHE 232 207 ?   ?   ?   A . n 
A 1 233 GLY 233 208 ?   ?   ?   A . n 
A 1 234 ALA 234 209 ?   ?   ?   A . n 
A 1 235 LEU 235 210 ?   ?   ?   A . n 
A 1 236 TYR 236 211 ?   ?   ?   A . n 
A 1 237 TRP 237 212 ?   ?   ?   A . n 
A 1 238 LYS 238 213 ?   ?   ?   A . n 
A 1 239 LYS 239 214 ?   ?   ?   A . n 
A 1 240 ARG 240 215 ?   ?   ?   A . n 
A 1 241 GLN 241 216 ?   ?   ?   A . n 
A 1 242 PRO 242 217 ?   ?   ?   A . n 
A 1 243 SER 243 218 ?   ?   ?   A . n 
A 1 244 LEU 244 219 ?   ?   ?   A . n 
A 1 245 THR 245 220 ?   ?   ?   A . n 
A 1 246 ARG 246 221 ?   ?   ?   A . n 
A 1 247 ALA 247 222 ?   ?   ?   A . n 
A 1 248 VAL 248 223 ?   ?   ?   A . n 
A 1 249 GLU 249 224 ?   ?   ?   A . n 
A 1 250 ASN 250 225 ?   ?   ?   A . n 
A 1 251 ILE 251 226 ?   ?   ?   A . n 
A 1 252 GLN 252 227 ?   ?   ?   A . n 
A 1 253 ILE 253 228 ?   ?   ?   A . n 
A 1 254 ASN 254 229 ?   ?   ?   A . n 
A 1 255 GLU 255 230 ?   ?   ?   A . n 
A 1 256 GLU 256 231 ?   ?   ?   A . n 
A 1 257 ASP 257 232 ?   ?   ?   A . n 
A 1 258 ASN 258 233 ?   ?   ?   A . n 
A 1 259 GLU 259 234 ?   ?   ?   A . n 
A 1 260 ILE 260 235 ?   ?   ?   A . n 
A 1 261 SER 261 236 ?   ?   ?   A . n 
A 1 262 MET 262 237 ?   ?   ?   A . n 
A 1 263 LEU 263 238 ?   ?   ?   A . n 
A 1 264 GLN 264 239 ?   ?   ?   A . n 
A 1 265 GLU 265 240 ?   ?   ?   A . n 
A 1 266 LYS 266 241 ?   ?   ?   A . n 
A 1 267 GLU 267 242 ?   ?   ?   A . n 
A 1 268 ARG 268 243 ?   ?   ?   A . n 
A 1 269 GLU 269 244 ?   ?   ?   A . n 
A 1 270 PHE 270 245 ?   ?   ?   A . n 
A 1 271 GLN 271 246 ?   ?   ?   A . n 
A 1 272 GLU 272 247 ?   ?   ?   A . n 
A 1 273 VAL 273 248 ?   ?   ?   A . n 
B 1 1   MET 1   -24 ?   ?   ?   B . n 
B 1 2   LYS 2   -23 ?   ?   ?   B . n 
B 1 3   LYS 3   -22 ?   ?   ?   B . n 
B 1 4   THR 4   -21 ?   ?   ?   B . n 
B 1 5   GLN 5   -20 ?   ?   ?   B . n 
B 1 6   THR 6   -19 ?   ?   ?   B . n 
B 1 7   TRP 7   -18 ?   ?   ?   B . n 
B 1 8   ILE 8   -17 ?   ?   ?   B . n 
B 1 9   LEU 9   -16 ?   ?   ?   B . n 
B 1 10  THR 10  -15 ?   ?   ?   B . n 
B 1 11  CYS 11  -14 ?   ?   ?   B . n 
B 1 12  ILE 12  -13 ?   ?   ?   B . n 
B 1 13  TYR 13  -12 ?   ?   ?   B . n 
B 1 14  LEU 14  -11 ?   ?   ?   B . n 
B 1 15  GLN 15  -10 ?   ?   ?   B . n 
B 1 16  LEU 16  -9  ?   ?   ?   B . n 
B 1 17  LEU 17  -8  ?   ?   ?   B . n 
B 1 18  LEU 18  -7  ?   ?   ?   B . n 
B 1 19  PHE 19  -6  ?   ?   ?   B . n 
B 1 20  ASN 20  -5  ?   ?   ?   B . n 
B 1 21  PRO 21  -4  ?   ?   ?   B . n 
B 1 22  LEU 22  -3  ?   ?   ?   B . n 
B 1 23  VAL 23  -2  ?   ?   ?   B . n 
B 1 24  LYS 24  -1  ?   ?   ?   B . n 
B 1 25  THR 25  0   ?   ?   ?   B . n 
B 1 26  GLU 26  1   ?   ?   ?   B . n 
B 1 27  GLY 27  2   ?   ?   ?   B . n 
B 1 28  ILE 28  3   ?   ?   ?   B . n 
B 1 29  CYS 29  4   ?   ?   ?   B . n 
B 1 30  ARG 30  5   ?   ?   ?   B . n 
B 1 31  ASN 31  6   ?   ?   ?   B . n 
B 1 32  ARG 32  7   ?   ?   ?   B . n 
B 1 33  VAL 33  8   ?   ?   ?   B . n 
B 1 34  THR 34  9   ?   ?   ?   B . n 
B 1 35  ASN 35  10  ?   ?   ?   B . n 
B 1 36  ASN 36  11  11  ASN ASN B . n 
B 1 37  VAL 37  12  12  VAL VAL B . n 
B 1 38  LYS 38  13  13  LYS LYS B . n 
B 1 39  ASP 39  14  14  ASP ASP B . n 
B 1 40  VAL 40  15  15  VAL VAL B . n 
B 1 41  THR 41  16  16  THR THR B . n 
B 1 42  LYS 42  17  17  LYS LYS B . n 
B 1 43  LEU 43  18  18  LEU LEU B . n 
B 1 44  VAL 44  19  19  VAL VAL B . n 
B 1 45  ALA 45  20  20  ALA ALA B . n 
B 1 46  ASN 46  21  21  ASN ASN B . n 
B 1 47  LEU 47  22  22  LEU LEU B . n 
B 1 48  PRO 48  23  23  PRO PRO B . n 
B 1 49  LYS 49  24  24  LYS LYS B . n 
B 1 50  ASP 50  25  25  ASP ASP B . n 
B 1 51  TYR 51  26  26  TYR TYR B . n 
B 1 52  MSE 52  27  27  MSE MSE B . n 
B 1 53  ILE 53  28  28  ILE ILE B . n 
B 1 54  THR 54  29  29  THR THR B . n 
B 1 55  LEU 55  30  30  LEU LEU B . n 
B 1 56  LYS 56  31  31  LYS LYS B . n 
B 1 57  TYR 57  32  32  TYR TYR B . n 
B 1 58  VAL 58  33  33  VAL VAL B . n 
B 1 59  PRO 59  34  34  PRO PRO B . n 
B 1 60  GLY 60  35  35  GLY GLY B . n 
B 1 61  MSE 61  36  36  MSE MSE B . n 
B 1 62  ASP 62  37  37  ASP ASP B . n 
B 1 63  VAL 63  38  38  VAL VAL B . n 
B 1 64  LEU 64  39  39  LEU LEU B . n 
B 1 65  PRO 65  40  40  PRO PRO B . n 
B 1 66  SER 66  41  41  SER SER B . n 
B 1 67  HIS 67  42  42  HIS HIS B . n 
B 1 68  CYS 68  43  43  CYS CYS B . n 
B 1 69  TRP 69  44  44  TRP TRP B . n 
B 1 70  ILE 70  45  45  ILE ILE B . n 
B 1 71  SER 71  46  46  SER SER B . n 
B 1 72  GLU 72  47  47  GLU GLU B . n 
B 1 73  MSE 73  48  48  MSE MSE B . n 
B 1 74  VAL 74  49  49  VAL VAL B . n 
B 1 75  VAL 75  50  50  VAL VAL B . n 
B 1 76  GLN 76  51  51  GLN GLN B . n 
B 1 77  LEU 77  52  52  LEU LEU B . n 
B 1 78  SER 78  53  53  SER SER B . n 
B 1 79  ASP 79  54  54  ASP ASP B . n 
B 1 80  SER 80  55  55  SER SER B . n 
B 1 81  LEU 81  56  56  LEU LEU B . n 
B 1 82  THR 82  57  57  THR THR B . n 
B 1 83  ASP 83  58  58  ASP ASP B . n 
B 1 84  LEU 84  59  59  LEU LEU B . n 
B 1 85  LEU 85  60  60  LEU LEU B . n 
B 1 86  ASP 86  61  61  ASP ASP B . n 
B 1 87  LYS 87  62  62  LYS LYS B . n 
B 1 88  PHE 88  63  63  PHE PHE B . n 
B 1 89  SER 89  64  64  SER SER B . n 
B 1 90  ASN 90  65  65  ASN ASN B . n 
B 1 91  ILE 91  66  66  ILE ILE B . n 
B 1 92  SER 92  67  67  SER SER B . n 
B 1 93  GLU 93  68  68  GLU GLU B . n 
B 1 94  GLY 94  69  69  GLY GLY B . n 
B 1 95  LEU 95  70  70  LEU LEU B . n 
B 1 96  SER 96  71  71  SER SER B . n 
B 1 97  ASN 97  72  72  ASN ASN B . n 
B 1 98  TYR 98  73  73  TYR TYR B . n 
B 1 99  SER 99  74  74  SER SER B . n 
B 1 100 ILE 100 75  75  ILE ILE B . n 
B 1 101 ILE 101 76  76  ILE ILE B . n 
B 1 102 ASP 102 77  77  ASP ASP B . n 
B 1 103 LYS 103 78  78  LYS LYS B . n 
B 1 104 LEU 104 79  79  LEU LEU B . n 
B 1 105 VAL 105 80  80  VAL VAL B . n 
B 1 106 ASN 106 81  81  ASN ASN B . n 
B 1 107 ILE 107 82  82  ILE ILE B . n 
B 1 108 VAL 108 83  83  VAL VAL B . n 
B 1 109 ASP 109 84  84  ASP ASP B . n 
B 1 110 ASP 110 85  85  ASP ASP B . n 
B 1 111 LEU 111 86  86  LEU LEU B . n 
B 1 112 VAL 112 87  87  VAL VAL B . n 
B 1 113 GLU 113 88  88  GLU GLU B . n 
B 1 114 CYS 114 89  89  CYS CYS B . n 
B 1 115 VAL 115 90  90  VAL VAL B . n 
B 1 116 LYS 116 91  91  LYS LYS B . n 
B 1 117 GLU 117 92  92  GLU GLU B . n 
B 1 118 ASN 118 93  93  ASN ASN B . n 
B 1 119 SER 119 94  94  SER SER B . n 
B 1 120 SER 120 95  95  SER SER B . n 
B 1 121 LYS 121 96  96  LYS LYS B . n 
B 1 122 ASP 122 97  97  ASP ASP B . n 
B 1 123 LEU 123 98  98  LEU LEU B . n 
B 1 124 LYS 124 99  99  LYS LYS B . n 
B 1 125 LYS 125 100 100 LYS LYS B . n 
B 1 126 SER 126 101 101 SER SER B . n 
B 1 127 PHE 127 102 102 PHE PHE B . n 
B 1 128 LYS 128 103 103 LYS LYS B . n 
B 1 129 SER 129 104 104 SER SER B . n 
B 1 130 PRO 130 105 105 PRO PRO B . n 
B 1 131 GLU 131 106 106 GLU GLU B . n 
B 1 132 PRO 132 107 107 PRO PRO B . n 
B 1 133 ARG 133 108 108 ARG ARG B . n 
B 1 134 LEU 134 109 109 LEU LEU B . n 
B 1 135 PHE 135 110 110 PHE PHE B . n 
B 1 136 THR 136 111 111 THR THR B . n 
B 1 137 PRO 137 112 112 PRO PRO B . n 
B 1 138 GLU 138 113 113 GLU GLU B . n 
B 1 139 GLU 139 114 114 GLU GLU B . n 
B 1 140 PHE 140 115 115 PHE PHE B . n 
B 1 141 PHE 141 116 116 PHE PHE B . n 
B 1 142 ARG 142 117 117 ARG ARG B . n 
B 1 143 ILE 143 118 118 ILE ILE B . n 
B 1 144 PHE 144 119 119 PHE PHE B . n 
B 1 145 ASN 145 120 120 ASN ASN B . n 
B 1 146 ARG 146 121 121 ARG ARG B . n 
B 1 147 SER 147 122 122 SER SER B . n 
B 1 148 ILE 148 123 123 ILE ILE B . n 
B 1 149 ASP 149 124 124 ASP ASP B . n 
B 1 150 ALA 150 125 125 ALA ALA B . n 
B 1 151 PHE 151 126 126 PHE PHE B . n 
B 1 152 LYS 152 127 127 LYS LYS B . n 
B 1 153 ASP 153 128 128 ASP ASP B . n 
B 1 154 PHE 154 129 129 PHE PHE B . n 
B 1 155 VAL 155 130 ?   ?   ?   B . n 
B 1 156 VAL 156 131 ?   ?   ?   B . n 
B 1 157 ALA 157 132 ?   ?   ?   B . n 
B 1 158 SER 158 133 ?   ?   ?   B . n 
B 1 159 GLU 159 134 ?   ?   ?   B . n 
B 1 160 THR 160 135 ?   ?   ?   B . n 
B 1 161 SER 161 136 ?   ?   ?   B . n 
B 1 162 ASP 162 137 137 ASP ASP B . n 
B 1 163 CYS 163 138 138 CYS CYS B . n 
B 1 164 VAL 164 139 ?   ?   ?   B . n 
B 1 165 VAL 165 140 ?   ?   ?   B . n 
B 1 166 SER 166 141 ?   ?   ?   B . n 
B 1 167 SER 167 142 ?   ?   ?   B . n 
B 1 168 THR 168 143 ?   ?   ?   B . n 
B 1 169 LEU 169 144 ?   ?   ?   B . n 
B 1 170 SER 170 145 ?   ?   ?   B . n 
B 1 171 PRO 171 146 ?   ?   ?   B . n 
B 1 172 GLU 172 147 ?   ?   ?   B . n 
B 1 173 LYS 173 148 ?   ?   ?   B . n 
B 1 174 ASP 174 149 ?   ?   ?   B . n 
B 1 175 SER 175 150 ?   ?   ?   B . n 
B 1 176 ARG 176 151 ?   ?   ?   B . n 
B 1 177 VAL 177 152 ?   ?   ?   B . n 
B 1 178 SER 178 153 ?   ?   ?   B . n 
B 1 179 VAL 179 154 ?   ?   ?   B . n 
B 1 180 THR 180 155 ?   ?   ?   B . n 
B 1 181 LYS 181 156 ?   ?   ?   B . n 
B 1 182 PRO 182 157 ?   ?   ?   B . n 
B 1 183 PHE 183 158 ?   ?   ?   B . n 
B 1 184 MET 184 159 ?   ?   ?   B . n 
B 1 185 LEU 185 160 ?   ?   ?   B . n 
B 1 186 PRO 186 161 ?   ?   ?   B . n 
B 1 187 PRO 187 162 ?   ?   ?   B . n 
B 1 188 VAL 188 163 ?   ?   ?   B . n 
B 1 189 ALA 189 164 ?   ?   ?   B . n 
B 1 190 ALA 190 165 ?   ?   ?   B . n 
B 1 191 SER 191 166 ?   ?   ?   B . n 
B 1 192 SER 192 167 ?   ?   ?   B . n 
B 1 193 LEU 193 168 ?   ?   ?   B . n 
B 1 194 ARG 194 169 ?   ?   ?   B . n 
B 1 195 ASN 195 170 ?   ?   ?   B . n 
B 1 196 ASP 196 171 ?   ?   ?   B . n 
B 1 197 SER 197 172 ?   ?   ?   B . n 
B 1 198 SER 198 173 ?   ?   ?   B . n 
B 1 199 SER 199 174 ?   ?   ?   B . n 
B 1 200 SER 200 175 ?   ?   ?   B . n 
B 1 201 ASN 201 176 ?   ?   ?   B . n 
B 1 202 ARG 202 177 ?   ?   ?   B . n 
B 1 203 LYS 203 178 ?   ?   ?   B . n 
B 1 204 ALA 204 179 ?   ?   ?   B . n 
B 1 205 LYS 205 180 ?   ?   ?   B . n 
B 1 206 ASN 206 181 ?   ?   ?   B . n 
B 1 207 PRO 207 182 ?   ?   ?   B . n 
B 1 208 PRO 208 183 ?   ?   ?   B . n 
B 1 209 GLY 209 184 ?   ?   ?   B . n 
B 1 210 ASP 210 185 ?   ?   ?   B . n 
B 1 211 SER 211 186 ?   ?   ?   B . n 
B 1 212 SER 212 187 ?   ?   ?   B . n 
B 1 213 LEU 213 188 ?   ?   ?   B . n 
B 1 214 HIS 214 189 ?   ?   ?   B . n 
B 1 215 TRP 215 190 ?   ?   ?   B . n 
B 1 216 ALA 216 191 ?   ?   ?   B . n 
B 1 217 ALA 217 192 ?   ?   ?   B . n 
B 1 218 MET 218 193 ?   ?   ?   B . n 
B 1 219 ALA 219 194 ?   ?   ?   B . n 
B 1 220 LEU 220 195 ?   ?   ?   B . n 
B 1 221 PRO 221 196 ?   ?   ?   B . n 
B 1 222 ALA 222 197 ?   ?   ?   B . n 
B 1 223 LEU 223 198 ?   ?   ?   B . n 
B 1 224 PHE 224 199 ?   ?   ?   B . n 
B 1 225 SER 225 200 ?   ?   ?   B . n 
B 1 226 LEU 226 201 ?   ?   ?   B . n 
B 1 227 ILE 227 202 ?   ?   ?   B . n 
B 1 228 ILE 228 203 ?   ?   ?   B . n 
B 1 229 GLY 229 204 ?   ?   ?   B . n 
B 1 230 PHE 230 205 ?   ?   ?   B . n 
B 1 231 ALA 231 206 ?   ?   ?   B . n 
B 1 232 PHE 232 207 ?   ?   ?   B . n 
B 1 233 GLY 233 208 ?   ?   ?   B . n 
B 1 234 ALA 234 209 ?   ?   ?   B . n 
B 1 235 LEU 235 210 ?   ?   ?   B . n 
B 1 236 TYR 236 211 ?   ?   ?   B . n 
B 1 237 TRP 237 212 ?   ?   ?   B . n 
B 1 238 LYS 238 213 ?   ?   ?   B . n 
B 1 239 LYS 239 214 ?   ?   ?   B . n 
B 1 240 ARG 240 215 ?   ?   ?   B . n 
B 1 241 GLN 241 216 ?   ?   ?   B . n 
B 1 242 PRO 242 217 ?   ?   ?   B . n 
B 1 243 SER 243 218 ?   ?   ?   B . n 
B 1 244 LEU 244 219 ?   ?   ?   B . n 
B 1 245 THR 245 220 ?   ?   ?   B . n 
B 1 246 ARG 246 221 ?   ?   ?   B . n 
B 1 247 ALA 247 222 ?   ?   ?   B . n 
B 1 248 VAL 248 223 ?   ?   ?   B . n 
B 1 249 GLU 249 224 ?   ?   ?   B . n 
B 1 250 ASN 250 225 ?   ?   ?   B . n 
B 1 251 ILE 251 226 ?   ?   ?   B . n 
B 1 252 GLN 252 227 ?   ?   ?   B . n 
B 1 253 ILE 253 228 ?   ?   ?   B . n 
B 1 254 ASN 254 229 ?   ?   ?   B . n 
B 1 255 GLU 255 230 ?   ?   ?   B . n 
B 1 256 GLU 256 231 ?   ?   ?   B . n 
B 1 257 ASP 257 232 ?   ?   ?   B . n 
B 1 258 ASN 258 233 ?   ?   ?   B . n 
B 1 259 GLU 259 234 ?   ?   ?   B . n 
B 1 260 ILE 260 235 ?   ?   ?   B . n 
B 1 261 SER 261 236 ?   ?   ?   B . n 
B 1 262 MET 262 237 ?   ?   ?   B . n 
B 1 263 LEU 263 238 ?   ?   ?   B . n 
B 1 264 GLN 264 239 ?   ?   ?   B . n 
B 1 265 GLU 265 240 ?   ?   ?   B . n 
B 1 266 LYS 266 241 ?   ?   ?   B . n 
B 1 267 GLU 267 242 ?   ?   ?   B . n 
B 1 268 ARG 268 243 ?   ?   ?   B . n 
B 1 269 GLU 269 244 ?   ?   ?   B . n 
B 1 270 PHE 270 245 ?   ?   ?   B . n 
B 1 271 GLN 271 246 ?   ?   ?   B . n 
B 1 272 GLU 272 247 ?   ?   ?   B . n 
B 1 273 VAL 273 248 ?   ?   ?   B . n 
C 1 1   MET 1   -24 ?   ?   ?   C . n 
C 1 2   LYS 2   -23 ?   ?   ?   C . n 
C 1 3   LYS 3   -22 ?   ?   ?   C . n 
C 1 4   THR 4   -21 ?   ?   ?   C . n 
C 1 5   GLN 5   -20 ?   ?   ?   C . n 
C 1 6   THR 6   -19 ?   ?   ?   C . n 
C 1 7   TRP 7   -18 ?   ?   ?   C . n 
C 1 8   ILE 8   -17 ?   ?   ?   C . n 
C 1 9   LEU 9   -16 ?   ?   ?   C . n 
C 1 10  THR 10  -15 ?   ?   ?   C . n 
C 1 11  CYS 11  -14 ?   ?   ?   C . n 
C 1 12  ILE 12  -13 ?   ?   ?   C . n 
C 1 13  TYR 13  -12 ?   ?   ?   C . n 
C 1 14  LEU 14  -11 ?   ?   ?   C . n 
C 1 15  GLN 15  -10 ?   ?   ?   C . n 
C 1 16  LEU 16  -9  ?   ?   ?   C . n 
C 1 17  LEU 17  -8  ?   ?   ?   C . n 
C 1 18  LEU 18  -7  ?   ?   ?   C . n 
C 1 19  PHE 19  -6  ?   ?   ?   C . n 
C 1 20  ASN 20  -5  ?   ?   ?   C . n 
C 1 21  PRO 21  -4  ?   ?   ?   C . n 
C 1 22  LEU 22  -3  ?   ?   ?   C . n 
C 1 23  VAL 23  -2  ?   ?   ?   C . n 
C 1 24  LYS 24  -1  ?   ?   ?   C . n 
C 1 25  THR 25  0   ?   ?   ?   C . n 
C 1 26  GLU 26  1   ?   ?   ?   C . n 
C 1 27  GLY 27  2   ?   ?   ?   C . n 
C 1 28  ILE 28  3   ?   ?   ?   C . n 
C 1 29  CYS 29  4   ?   ?   ?   C . n 
C 1 30  ARG 30  5   ?   ?   ?   C . n 
C 1 31  ASN 31  6   ?   ?   ?   C . n 
C 1 32  ARG 32  7   ?   ?   ?   C . n 
C 1 33  VAL 33  8   ?   ?   ?   C . n 
C 1 34  THR 34  9   ?   ?   ?   C . n 
C 1 35  ASN 35  10  ?   ?   ?   C . n 
C 1 36  ASN 36  11  11  ASN ASN C . n 
C 1 37  VAL 37  12  12  VAL VAL C . n 
C 1 38  LYS 38  13  13  LYS LYS C . n 
C 1 39  ASP 39  14  14  ASP ASP C . n 
C 1 40  VAL 40  15  15  VAL VAL C . n 
C 1 41  THR 41  16  16  THR THR C . n 
C 1 42  LYS 42  17  17  LYS LYS C . n 
C 1 43  LEU 43  18  18  LEU LEU C . n 
C 1 44  VAL 44  19  19  VAL VAL C . n 
C 1 45  ALA 45  20  20  ALA ALA C . n 
C 1 46  ASN 46  21  21  ASN ASN C . n 
C 1 47  LEU 47  22  22  LEU LEU C . n 
C 1 48  PRO 48  23  23  PRO PRO C . n 
C 1 49  LYS 49  24  24  LYS LYS C . n 
C 1 50  ASP 50  25  25  ASP ASP C . n 
C 1 51  TYR 51  26  26  TYR TYR C . n 
C 1 52  MSE 52  27  27  MSE MSE C . n 
C 1 53  ILE 53  28  28  ILE ILE C . n 
C 1 54  THR 54  29  29  THR THR C . n 
C 1 55  LEU 55  30  30  LEU LEU C . n 
C 1 56  LYS 56  31  31  LYS LYS C . n 
C 1 57  TYR 57  32  32  TYR TYR C . n 
C 1 58  VAL 58  33  33  VAL VAL C . n 
C 1 59  PRO 59  34  34  PRO PRO C . n 
C 1 60  GLY 60  35  35  GLY GLY C . n 
C 1 61  MSE 61  36  36  MSE MSE C . n 
C 1 62  ASP 62  37  37  ASP ASP C . n 
C 1 63  VAL 63  38  38  VAL VAL C . n 
C 1 64  LEU 64  39  39  LEU LEU C . n 
C 1 65  PRO 65  40  40  PRO PRO C . n 
C 1 66  SER 66  41  41  SER SER C . n 
C 1 67  HIS 67  42  42  HIS HIS C . n 
C 1 68  CYS 68  43  43  CYS CYS C . n 
C 1 69  TRP 69  44  44  TRP TRP C . n 
C 1 70  ILE 70  45  45  ILE ILE C . n 
C 1 71  SER 71  46  46  SER SER C . n 
C 1 72  GLU 72  47  47  GLU GLU C . n 
C 1 73  MSE 73  48  48  MSE MSE C . n 
C 1 74  VAL 74  49  49  VAL VAL C . n 
C 1 75  VAL 75  50  50  VAL VAL C . n 
C 1 76  GLN 76  51  51  GLN GLN C . n 
C 1 77  LEU 77  52  52  LEU LEU C . n 
C 1 78  SER 78  53  53  SER SER C . n 
C 1 79  ASP 79  54  54  ASP ASP C . n 
C 1 80  SER 80  55  55  SER SER C . n 
C 1 81  LEU 81  56  56  LEU LEU C . n 
C 1 82  THR 82  57  57  THR THR C . n 
C 1 83  ASP 83  58  58  ASP ASP C . n 
C 1 84  LEU 84  59  59  LEU LEU C . n 
C 1 85  LEU 85  60  60  LEU LEU C . n 
C 1 86  ASP 86  61  61  ASP ASP C . n 
C 1 87  LYS 87  62  62  LYS LYS C . n 
C 1 88  PHE 88  63  63  PHE PHE C . n 
C 1 89  SER 89  64  64  SER SER C . n 
C 1 90  ASN 90  65  65  ASN ASN C . n 
C 1 91  ILE 91  66  66  ILE ILE C . n 
C 1 92  SER 92  67  67  SER SER C . n 
C 1 93  GLU 93  68  68  GLU GLU C . n 
C 1 94  GLY 94  69  69  GLY GLY C . n 
C 1 95  LEU 95  70  70  LEU LEU C . n 
C 1 96  SER 96  71  71  SER SER C . n 
C 1 97  ASN 97  72  72  ASN ASN C . n 
C 1 98  TYR 98  73  73  TYR TYR C . n 
C 1 99  SER 99  74  74  SER SER C . n 
C 1 100 ILE 100 75  75  ILE ILE C . n 
C 1 101 ILE 101 76  76  ILE ILE C . n 
C 1 102 ASP 102 77  77  ASP ASP C . n 
C 1 103 LYS 103 78  78  LYS LYS C . n 
C 1 104 LEU 104 79  79  LEU LEU C . n 
C 1 105 VAL 105 80  80  VAL VAL C . n 
C 1 106 ASN 106 81  81  ASN ASN C . n 
C 1 107 ILE 107 82  82  ILE ILE C . n 
C 1 108 VAL 108 83  83  VAL VAL C . n 
C 1 109 ASP 109 84  84  ASP ASP C . n 
C 1 110 ASP 110 85  85  ASP ASP C . n 
C 1 111 LEU 111 86  86  LEU LEU C . n 
C 1 112 VAL 112 87  87  VAL VAL C . n 
C 1 113 GLU 113 88  88  GLU GLU C . n 
C 1 114 CYS 114 89  89  CYS CYS C . n 
C 1 115 VAL 115 90  90  VAL VAL C . n 
C 1 116 LYS 116 91  91  LYS LYS C . n 
C 1 117 GLU 117 92  ?   ?   ?   C . n 
C 1 118 ASN 118 93  ?   ?   ?   C . n 
C 1 119 SER 119 94  ?   ?   ?   C . n 
C 1 120 SER 120 95  ?   ?   ?   C . n 
C 1 121 LYS 121 96  ?   ?   ?   C . n 
C 1 122 ASP 122 97  ?   ?   ?   C . n 
C 1 123 LEU 123 98  ?   ?   ?   C . n 
C 1 124 LYS 124 99  ?   ?   ?   C . n 
C 1 125 LYS 125 100 ?   ?   ?   C . n 
C 1 126 SER 126 101 ?   ?   ?   C . n 
C 1 127 PHE 127 102 ?   ?   ?   C . n 
C 1 128 LYS 128 103 ?   ?   ?   C . n 
C 1 129 SER 129 104 104 SER SER C . n 
C 1 130 PRO 130 105 105 PRO PRO C . n 
C 1 131 GLU 131 106 106 GLU GLU C . n 
C 1 132 PRO 132 107 107 PRO PRO C . n 
C 1 133 ARG 133 108 108 ARG ARG C . n 
C 1 134 LEU 134 109 109 LEU LEU C . n 
C 1 135 PHE 135 110 110 PHE PHE C . n 
C 1 136 THR 136 111 111 THR THR C . n 
C 1 137 PRO 137 112 112 PRO PRO C . n 
C 1 138 GLU 138 113 113 GLU GLU C . n 
C 1 139 GLU 139 114 114 GLU GLU C . n 
C 1 140 PHE 140 115 115 PHE PHE C . n 
C 1 141 PHE 141 116 116 PHE PHE C . n 
C 1 142 ARG 142 117 117 ARG ARG C . n 
C 1 143 ILE 143 118 118 ILE ILE C . n 
C 1 144 PHE 144 119 119 PHE PHE C . n 
C 1 145 ASN 145 120 120 ASN ASN C . n 
C 1 146 ARG 146 121 121 ARG ARG C . n 
C 1 147 SER 147 122 122 SER SER C . n 
C 1 148 ILE 148 123 123 ILE ILE C . n 
C 1 149 ASP 149 124 124 ASP ASP C . n 
C 1 150 ALA 150 125 125 ALA ALA C . n 
C 1 151 PHE 151 126 126 PHE PHE C . n 
C 1 152 LYS 152 127 ?   ?   ?   C . n 
C 1 153 ASP 153 128 ?   ?   ?   C . n 
C 1 154 PHE 154 129 ?   ?   ?   C . n 
C 1 155 VAL 155 130 ?   ?   ?   C . n 
C 1 156 VAL 156 131 ?   ?   ?   C . n 
C 1 157 ALA 157 132 ?   ?   ?   C . n 
C 1 158 SER 158 133 ?   ?   ?   C . n 
C 1 159 GLU 159 134 ?   ?   ?   C . n 
C 1 160 THR 160 135 ?   ?   ?   C . n 
C 1 161 SER 161 136 ?   ?   ?   C . n 
C 1 162 ASP 162 137 ?   ?   ?   C . n 
C 1 163 CYS 163 138 ?   ?   ?   C . n 
C 1 164 VAL 164 139 ?   ?   ?   C . n 
C 1 165 VAL 165 140 ?   ?   ?   C . n 
C 1 166 SER 166 141 ?   ?   ?   C . n 
C 1 167 SER 167 142 ?   ?   ?   C . n 
C 1 168 THR 168 143 ?   ?   ?   C . n 
C 1 169 LEU 169 144 ?   ?   ?   C . n 
C 1 170 SER 170 145 ?   ?   ?   C . n 
C 1 171 PRO 171 146 ?   ?   ?   C . n 
C 1 172 GLU 172 147 ?   ?   ?   C . n 
C 1 173 LYS 173 148 ?   ?   ?   C . n 
C 1 174 ASP 174 149 ?   ?   ?   C . n 
C 1 175 SER 175 150 ?   ?   ?   C . n 
C 1 176 ARG 176 151 ?   ?   ?   C . n 
C 1 177 VAL 177 152 ?   ?   ?   C . n 
C 1 178 SER 178 153 ?   ?   ?   C . n 
C 1 179 VAL 179 154 ?   ?   ?   C . n 
C 1 180 THR 180 155 ?   ?   ?   C . n 
C 1 181 LYS 181 156 ?   ?   ?   C . n 
C 1 182 PRO 182 157 ?   ?   ?   C . n 
C 1 183 PHE 183 158 ?   ?   ?   C . n 
C 1 184 MET 184 159 ?   ?   ?   C . n 
C 1 185 LEU 185 160 ?   ?   ?   C . n 
C 1 186 PRO 186 161 ?   ?   ?   C . n 
C 1 187 PRO 187 162 ?   ?   ?   C . n 
C 1 188 VAL 188 163 ?   ?   ?   C . n 
C 1 189 ALA 189 164 ?   ?   ?   C . n 
C 1 190 ALA 190 165 ?   ?   ?   C . n 
C 1 191 SER 191 166 ?   ?   ?   C . n 
C 1 192 SER 192 167 ?   ?   ?   C . n 
C 1 193 LEU 193 168 ?   ?   ?   C . n 
C 1 194 ARG 194 169 ?   ?   ?   C . n 
C 1 195 ASN 195 170 ?   ?   ?   C . n 
C 1 196 ASP 196 171 ?   ?   ?   C . n 
C 1 197 SER 197 172 ?   ?   ?   C . n 
C 1 198 SER 198 173 ?   ?   ?   C . n 
C 1 199 SER 199 174 ?   ?   ?   C . n 
C 1 200 SER 200 175 ?   ?   ?   C . n 
C 1 201 ASN 201 176 ?   ?   ?   C . n 
C 1 202 ARG 202 177 ?   ?   ?   C . n 
C 1 203 LYS 203 178 ?   ?   ?   C . n 
C 1 204 ALA 204 179 ?   ?   ?   C . n 
C 1 205 LYS 205 180 ?   ?   ?   C . n 
C 1 206 ASN 206 181 ?   ?   ?   C . n 
C 1 207 PRO 207 182 ?   ?   ?   C . n 
C 1 208 PRO 208 183 ?   ?   ?   C . n 
C 1 209 GLY 209 184 ?   ?   ?   C . n 
C 1 210 ASP 210 185 ?   ?   ?   C . n 
C 1 211 SER 211 186 ?   ?   ?   C . n 
C 1 212 SER 212 187 ?   ?   ?   C . n 
C 1 213 LEU 213 188 ?   ?   ?   C . n 
C 1 214 HIS 214 189 ?   ?   ?   C . n 
C 1 215 TRP 215 190 ?   ?   ?   C . n 
C 1 216 ALA 216 191 ?   ?   ?   C . n 
C 1 217 ALA 217 192 ?   ?   ?   C . n 
C 1 218 MET 218 193 ?   ?   ?   C . n 
C 1 219 ALA 219 194 ?   ?   ?   C . n 
C 1 220 LEU 220 195 ?   ?   ?   C . n 
C 1 221 PRO 221 196 ?   ?   ?   C . n 
C 1 222 ALA 222 197 ?   ?   ?   C . n 
C 1 223 LEU 223 198 ?   ?   ?   C . n 
C 1 224 PHE 224 199 ?   ?   ?   C . n 
C 1 225 SER 225 200 ?   ?   ?   C . n 
C 1 226 LEU 226 201 ?   ?   ?   C . n 
C 1 227 ILE 227 202 ?   ?   ?   C . n 
C 1 228 ILE 228 203 ?   ?   ?   C . n 
C 1 229 GLY 229 204 ?   ?   ?   C . n 
C 1 230 PHE 230 205 ?   ?   ?   C . n 
C 1 231 ALA 231 206 ?   ?   ?   C . n 
C 1 232 PHE 232 207 ?   ?   ?   C . n 
C 1 233 GLY 233 208 ?   ?   ?   C . n 
C 1 234 ALA 234 209 ?   ?   ?   C . n 
C 1 235 LEU 235 210 ?   ?   ?   C . n 
C 1 236 TYR 236 211 ?   ?   ?   C . n 
C 1 237 TRP 237 212 ?   ?   ?   C . n 
C 1 238 LYS 238 213 ?   ?   ?   C . n 
C 1 239 LYS 239 214 ?   ?   ?   C . n 
C 1 240 ARG 240 215 ?   ?   ?   C . n 
C 1 241 GLN 241 216 ?   ?   ?   C . n 
C 1 242 PRO 242 217 ?   ?   ?   C . n 
C 1 243 SER 243 218 ?   ?   ?   C . n 
C 1 244 LEU 244 219 ?   ?   ?   C . n 
C 1 245 THR 245 220 ?   ?   ?   C . n 
C 1 246 ARG 246 221 ?   ?   ?   C . n 
C 1 247 ALA 247 222 ?   ?   ?   C . n 
C 1 248 VAL 248 223 ?   ?   ?   C . n 
C 1 249 GLU 249 224 ?   ?   ?   C . n 
C 1 250 ASN 250 225 ?   ?   ?   C . n 
C 1 251 ILE 251 226 ?   ?   ?   C . n 
C 1 252 GLN 252 227 ?   ?   ?   C . n 
C 1 253 ILE 253 228 ?   ?   ?   C . n 
C 1 254 ASN 254 229 ?   ?   ?   C . n 
C 1 255 GLU 255 230 ?   ?   ?   C . n 
C 1 256 GLU 256 231 ?   ?   ?   C . n 
C 1 257 ASP 257 232 ?   ?   ?   C . n 
C 1 258 ASN 258 233 ?   ?   ?   C . n 
C 1 259 GLU 259 234 ?   ?   ?   C . n 
C 1 260 ILE 260 235 ?   ?   ?   C . n 
C 1 261 SER 261 236 ?   ?   ?   C . n 
C 1 262 MET 262 237 ?   ?   ?   C . n 
C 1 263 LEU 263 238 ?   ?   ?   C . n 
C 1 264 GLN 264 239 ?   ?   ?   C . n 
C 1 265 GLU 265 240 ?   ?   ?   C . n 
C 1 266 LYS 266 241 ?   ?   ?   C . n 
C 1 267 GLU 267 242 ?   ?   ?   C . n 
C 1 268 ARG 268 243 ?   ?   ?   C . n 
C 1 269 GLU 269 244 ?   ?   ?   C . n 
C 1 270 PHE 270 245 ?   ?   ?   C . n 
C 1 271 GLN 271 246 ?   ?   ?   C . n 
C 1 272 GLU 272 247 ?   ?   ?   C . n 
C 1 273 VAL 273 248 ?   ?   ?   C . n 
D 1 1   MET 1   -24 ?   ?   ?   D . n 
D 1 2   LYS 2   -23 ?   ?   ?   D . n 
D 1 3   LYS 3   -22 ?   ?   ?   D . n 
D 1 4   THR 4   -21 ?   ?   ?   D . n 
D 1 5   GLN 5   -20 ?   ?   ?   D . n 
D 1 6   THR 6   -19 ?   ?   ?   D . n 
D 1 7   TRP 7   -18 ?   ?   ?   D . n 
D 1 8   ILE 8   -17 ?   ?   ?   D . n 
D 1 9   LEU 9   -16 ?   ?   ?   D . n 
D 1 10  THR 10  -15 ?   ?   ?   D . n 
D 1 11  CYS 11  -14 ?   ?   ?   D . n 
D 1 12  ILE 12  -13 ?   ?   ?   D . n 
D 1 13  TYR 13  -12 ?   ?   ?   D . n 
D 1 14  LEU 14  -11 ?   ?   ?   D . n 
D 1 15  GLN 15  -10 ?   ?   ?   D . n 
D 1 16  LEU 16  -9  ?   ?   ?   D . n 
D 1 17  LEU 17  -8  ?   ?   ?   D . n 
D 1 18  LEU 18  -7  ?   ?   ?   D . n 
D 1 19  PHE 19  -6  ?   ?   ?   D . n 
D 1 20  ASN 20  -5  ?   ?   ?   D . n 
D 1 21  PRO 21  -4  ?   ?   ?   D . n 
D 1 22  LEU 22  -3  ?   ?   ?   D . n 
D 1 23  VAL 23  -2  ?   ?   ?   D . n 
D 1 24  LYS 24  -1  ?   ?   ?   D . n 
D 1 25  THR 25  0   ?   ?   ?   D . n 
D 1 26  GLU 26  1   ?   ?   ?   D . n 
D 1 27  GLY 27  2   ?   ?   ?   D . n 
D 1 28  ILE 28  3   ?   ?   ?   D . n 
D 1 29  CYS 29  4   ?   ?   ?   D . n 
D 1 30  ARG 30  5   ?   ?   ?   D . n 
D 1 31  ASN 31  6   ?   ?   ?   D . n 
D 1 32  ARG 32  7   ?   ?   ?   D . n 
D 1 33  VAL 33  8   ?   ?   ?   D . n 
D 1 34  THR 34  9   ?   ?   ?   D . n 
D 1 35  ASN 35  10  ?   ?   ?   D . n 
D 1 36  ASN 36  11  11  ASN ASN D . n 
D 1 37  VAL 37  12  12  VAL VAL D . n 
D 1 38  LYS 38  13  13  LYS LYS D . n 
D 1 39  ASP 39  14  14  ASP ASP D . n 
D 1 40  VAL 40  15  15  VAL VAL D . n 
D 1 41  THR 41  16  16  THR THR D . n 
D 1 42  LYS 42  17  17  LYS LYS D . n 
D 1 43  LEU 43  18  18  LEU LEU D . n 
D 1 44  VAL 44  19  19  VAL VAL D . n 
D 1 45  ALA 45  20  20  ALA ALA D . n 
D 1 46  ASN 46  21  21  ASN ASN D . n 
D 1 47  LEU 47  22  22  LEU LEU D . n 
D 1 48  PRO 48  23  23  PRO PRO D . n 
D 1 49  LYS 49  24  24  LYS LYS D . n 
D 1 50  ASP 50  25  25  ASP ASP D . n 
D 1 51  TYR 51  26  26  TYR TYR D . n 
D 1 52  MSE 52  27  27  MSE MSE D . n 
D 1 53  ILE 53  28  28  ILE ILE D . n 
D 1 54  THR 54  29  29  THR THR D . n 
D 1 55  LEU 55  30  30  LEU LEU D . n 
D 1 56  LYS 56  31  31  LYS LYS D . n 
D 1 57  TYR 57  32  32  TYR TYR D . n 
D 1 58  VAL 58  33  33  VAL VAL D . n 
D 1 59  PRO 59  34  34  PRO PRO D . n 
D 1 60  GLY 60  35  35  GLY GLY D . n 
D 1 61  MSE 61  36  36  MSE MSE D . n 
D 1 62  ASP 62  37  37  ASP ASP D . n 
D 1 63  VAL 63  38  38  VAL VAL D . n 
D 1 64  LEU 64  39  39  LEU LEU D . n 
D 1 65  PRO 65  40  40  PRO PRO D . n 
D 1 66  SER 66  41  41  SER SER D . n 
D 1 67  HIS 67  42  42  HIS HIS D . n 
D 1 68  CYS 68  43  43  CYS CYS D . n 
D 1 69  TRP 69  44  44  TRP TRP D . n 
D 1 70  ILE 70  45  45  ILE ILE D . n 
D 1 71  SER 71  46  46  SER SER D . n 
D 1 72  GLU 72  47  47  GLU GLU D . n 
D 1 73  MSE 73  48  48  MSE MSE D . n 
D 1 74  VAL 74  49  49  VAL VAL D . n 
D 1 75  VAL 75  50  50  VAL VAL D . n 
D 1 76  GLN 76  51  51  GLN GLN D . n 
D 1 77  LEU 77  52  52  LEU LEU D . n 
D 1 78  SER 78  53  53  SER SER D . n 
D 1 79  ASP 79  54  54  ASP ASP D . n 
D 1 80  SER 80  55  55  SER SER D . n 
D 1 81  LEU 81  56  56  LEU LEU D . n 
D 1 82  THR 82  57  57  THR THR D . n 
D 1 83  ASP 83  58  58  ASP ASP D . n 
D 1 84  LEU 84  59  59  LEU LEU D . n 
D 1 85  LEU 85  60  60  LEU LEU D . n 
D 1 86  ASP 86  61  61  ASP ASP D . n 
D 1 87  LYS 87  62  62  LYS LYS D . n 
D 1 88  PHE 88  63  63  PHE PHE D . n 
D 1 89  SER 89  64  64  SER SER D . n 
D 1 90  ASN 90  65  65  ASN ASN D . n 
D 1 91  ILE 91  66  66  ILE ILE D . n 
D 1 92  SER 92  67  67  SER SER D . n 
D 1 93  GLU 93  68  68  GLU GLU D . n 
D 1 94  GLY 94  69  69  GLY GLY D . n 
D 1 95  LEU 95  70  70  LEU LEU D . n 
D 1 96  SER 96  71  71  SER SER D . n 
D 1 97  ASN 97  72  72  ASN ASN D . n 
D 1 98  TYR 98  73  73  TYR TYR D . n 
D 1 99  SER 99  74  74  SER SER D . n 
D 1 100 ILE 100 75  75  ILE ILE D . n 
D 1 101 ILE 101 76  76  ILE ILE D . n 
D 1 102 ASP 102 77  77  ASP ASP D . n 
D 1 103 LYS 103 78  78  LYS LYS D . n 
D 1 104 LEU 104 79  79  LEU LEU D . n 
D 1 105 VAL 105 80  80  VAL VAL D . n 
D 1 106 ASN 106 81  81  ASN ASN D . n 
D 1 107 ILE 107 82  82  ILE ILE D . n 
D 1 108 VAL 108 83  83  VAL VAL D . n 
D 1 109 ASP 109 84  84  ASP ASP D . n 
D 1 110 ASP 110 85  85  ASP ASP D . n 
D 1 111 LEU 111 86  86  LEU LEU D . n 
D 1 112 VAL 112 87  87  VAL VAL D . n 
D 1 113 GLU 113 88  88  GLU GLU D . n 
D 1 114 CYS 114 89  89  CYS CYS D . n 
D 1 115 VAL 115 90  90  VAL VAL D . n 
D 1 116 LYS 116 91  ?   ?   ?   D . n 
D 1 117 GLU 117 92  ?   ?   ?   D . n 
D 1 118 ASN 118 93  ?   ?   ?   D . n 
D 1 119 SER 119 94  ?   ?   ?   D . n 
D 1 120 SER 120 95  ?   ?   ?   D . n 
D 1 121 LYS 121 96  ?   ?   ?   D . n 
D 1 122 ASP 122 97  ?   ?   ?   D . n 
D 1 123 LEU 123 98  ?   ?   ?   D . n 
D 1 124 LYS 124 99  ?   ?   ?   D . n 
D 1 125 LYS 125 100 ?   ?   ?   D . n 
D 1 126 SER 126 101 ?   ?   ?   D . n 
D 1 127 PHE 127 102 ?   ?   ?   D . n 
D 1 128 LYS 128 103 ?   ?   ?   D . n 
D 1 129 SER 129 104 104 SER SER D . n 
D 1 130 PRO 130 105 105 PRO PRO D . n 
D 1 131 GLU 131 106 106 GLU GLU D . n 
D 1 132 PRO 132 107 107 PRO PRO D . n 
D 1 133 ARG 133 108 108 ARG ARG D . n 
D 1 134 LEU 134 109 109 LEU LEU D . n 
D 1 135 PHE 135 110 110 PHE PHE D . n 
D 1 136 THR 136 111 111 THR THR D . n 
D 1 137 PRO 137 112 112 PRO PRO D . n 
D 1 138 GLU 138 113 113 GLU GLU D . n 
D 1 139 GLU 139 114 114 GLU GLU D . n 
D 1 140 PHE 140 115 115 PHE PHE D . n 
D 1 141 PHE 141 116 116 PHE PHE D . n 
D 1 142 ARG 142 117 117 ARG ARG D . n 
D 1 143 ILE 143 118 118 ILE ILE D . n 
D 1 144 PHE 144 119 119 PHE PHE D . n 
D 1 145 ASN 145 120 120 ASN ASN D . n 
D 1 146 ARG 146 121 121 ARG ARG D . n 
D 1 147 SER 147 122 122 SER SER D . n 
D 1 148 ILE 148 123 123 ILE ILE D . n 
D 1 149 ASP 149 124 124 ASP ASP D . n 
D 1 150 ALA 150 125 125 ALA ALA D . n 
D 1 151 PHE 151 126 126 PHE PHE D . n 
D 1 152 LYS 152 127 127 LYS LYS D . n 
D 1 153 ASP 153 128 ?   ?   ?   D . n 
D 1 154 PHE 154 129 ?   ?   ?   D . n 
D 1 155 VAL 155 130 ?   ?   ?   D . n 
D 1 156 VAL 156 131 ?   ?   ?   D . n 
D 1 157 ALA 157 132 ?   ?   ?   D . n 
D 1 158 SER 158 133 ?   ?   ?   D . n 
D 1 159 GLU 159 134 ?   ?   ?   D . n 
D 1 160 THR 160 135 ?   ?   ?   D . n 
D 1 161 SER 161 136 ?   ?   ?   D . n 
D 1 162 ASP 162 137 ?   ?   ?   D . n 
D 1 163 CYS 163 138 ?   ?   ?   D . n 
D 1 164 VAL 164 139 ?   ?   ?   D . n 
D 1 165 VAL 165 140 ?   ?   ?   D . n 
D 1 166 SER 166 141 ?   ?   ?   D . n 
D 1 167 SER 167 142 ?   ?   ?   D . n 
D 1 168 THR 168 143 ?   ?   ?   D . n 
D 1 169 LEU 169 144 ?   ?   ?   D . n 
D 1 170 SER 170 145 ?   ?   ?   D . n 
D 1 171 PRO 171 146 ?   ?   ?   D . n 
D 1 172 GLU 172 147 ?   ?   ?   D . n 
D 1 173 LYS 173 148 ?   ?   ?   D . n 
D 1 174 ASP 174 149 ?   ?   ?   D . n 
D 1 175 SER 175 150 ?   ?   ?   D . n 
D 1 176 ARG 176 151 ?   ?   ?   D . n 
D 1 177 VAL 177 152 ?   ?   ?   D . n 
D 1 178 SER 178 153 ?   ?   ?   D . n 
D 1 179 VAL 179 154 ?   ?   ?   D . n 
D 1 180 THR 180 155 ?   ?   ?   D . n 
D 1 181 LYS 181 156 ?   ?   ?   D . n 
D 1 182 PRO 182 157 ?   ?   ?   D . n 
D 1 183 PHE 183 158 ?   ?   ?   D . n 
D 1 184 MET 184 159 ?   ?   ?   D . n 
D 1 185 LEU 185 160 ?   ?   ?   D . n 
D 1 186 PRO 186 161 ?   ?   ?   D . n 
D 1 187 PRO 187 162 ?   ?   ?   D . n 
D 1 188 VAL 188 163 ?   ?   ?   D . n 
D 1 189 ALA 189 164 ?   ?   ?   D . n 
D 1 190 ALA 190 165 ?   ?   ?   D . n 
D 1 191 SER 191 166 ?   ?   ?   D . n 
D 1 192 SER 192 167 ?   ?   ?   D . n 
D 1 193 LEU 193 168 ?   ?   ?   D . n 
D 1 194 ARG 194 169 ?   ?   ?   D . n 
D 1 195 ASN 195 170 ?   ?   ?   D . n 
D 1 196 ASP 196 171 ?   ?   ?   D . n 
D 1 197 SER 197 172 ?   ?   ?   D . n 
D 1 198 SER 198 173 ?   ?   ?   D . n 
D 1 199 SER 199 174 ?   ?   ?   D . n 
D 1 200 SER 200 175 ?   ?   ?   D . n 
D 1 201 ASN 201 176 ?   ?   ?   D . n 
D 1 202 ARG 202 177 ?   ?   ?   D . n 
D 1 203 LYS 203 178 ?   ?   ?   D . n 
D 1 204 ALA 204 179 ?   ?   ?   D . n 
D 1 205 LYS 205 180 ?   ?   ?   D . n 
D 1 206 ASN 206 181 ?   ?   ?   D . n 
D 1 207 PRO 207 182 ?   ?   ?   D . n 
D 1 208 PRO 208 183 ?   ?   ?   D . n 
D 1 209 GLY 209 184 ?   ?   ?   D . n 
D 1 210 ASP 210 185 ?   ?   ?   D . n 
D 1 211 SER 211 186 ?   ?   ?   D . n 
D 1 212 SER 212 187 ?   ?   ?   D . n 
D 1 213 LEU 213 188 ?   ?   ?   D . n 
D 1 214 HIS 214 189 ?   ?   ?   D . n 
D 1 215 TRP 215 190 ?   ?   ?   D . n 
D 1 216 ALA 216 191 ?   ?   ?   D . n 
D 1 217 ALA 217 192 ?   ?   ?   D . n 
D 1 218 MET 218 193 ?   ?   ?   D . n 
D 1 219 ALA 219 194 ?   ?   ?   D . n 
D 1 220 LEU 220 195 ?   ?   ?   D . n 
D 1 221 PRO 221 196 ?   ?   ?   D . n 
D 1 222 ALA 222 197 ?   ?   ?   D . n 
D 1 223 LEU 223 198 ?   ?   ?   D . n 
D 1 224 PHE 224 199 ?   ?   ?   D . n 
D 1 225 SER 225 200 ?   ?   ?   D . n 
D 1 226 LEU 226 201 ?   ?   ?   D . n 
D 1 227 ILE 227 202 ?   ?   ?   D . n 
D 1 228 ILE 228 203 ?   ?   ?   D . n 
D 1 229 GLY 229 204 ?   ?   ?   D . n 
D 1 230 PHE 230 205 ?   ?   ?   D . n 
D 1 231 ALA 231 206 ?   ?   ?   D . n 
D 1 232 PHE 232 207 ?   ?   ?   D . n 
D 1 233 GLY 233 208 ?   ?   ?   D . n 
D 1 234 ALA 234 209 ?   ?   ?   D . n 
D 1 235 LEU 235 210 ?   ?   ?   D . n 
D 1 236 TYR 236 211 ?   ?   ?   D . n 
D 1 237 TRP 237 212 ?   ?   ?   D . n 
D 1 238 LYS 238 213 ?   ?   ?   D . n 
D 1 239 LYS 239 214 ?   ?   ?   D . n 
D 1 240 ARG 240 215 ?   ?   ?   D . n 
D 1 241 GLN 241 216 ?   ?   ?   D . n 
D 1 242 PRO 242 217 ?   ?   ?   D . n 
D 1 243 SER 243 218 ?   ?   ?   D . n 
D 1 244 LEU 244 219 ?   ?   ?   D . n 
D 1 245 THR 245 220 ?   ?   ?   D . n 
D 1 246 ARG 246 221 ?   ?   ?   D . n 
D 1 247 ALA 247 222 ?   ?   ?   D . n 
D 1 248 VAL 248 223 ?   ?   ?   D . n 
D 1 249 GLU 249 224 ?   ?   ?   D . n 
D 1 250 ASN 250 225 ?   ?   ?   D . n 
D 1 251 ILE 251 226 ?   ?   ?   D . n 
D 1 252 GLN 252 227 ?   ?   ?   D . n 
D 1 253 ILE 253 228 ?   ?   ?   D . n 
D 1 254 ASN 254 229 ?   ?   ?   D . n 
D 1 255 GLU 255 230 ?   ?   ?   D . n 
D 1 256 GLU 256 231 ?   ?   ?   D . n 
D 1 257 ASP 257 232 ?   ?   ?   D . n 
D 1 258 ASN 258 233 ?   ?   ?   D . n 
D 1 259 GLU 259 234 ?   ?   ?   D . n 
D 1 260 ILE 260 235 ?   ?   ?   D . n 
D 1 261 SER 261 236 ?   ?   ?   D . n 
D 1 262 MET 262 237 ?   ?   ?   D . n 
D 1 263 LEU 263 238 ?   ?   ?   D . n 
D 1 264 GLN 264 239 ?   ?   ?   D . n 
D 1 265 GLU 265 240 ?   ?   ?   D . n 
D 1 266 LYS 266 241 ?   ?   ?   D . n 
D 1 267 GLU 267 242 ?   ?   ?   D . n 
D 1 268 ARG 268 243 ?   ?   ?   D . n 
D 1 269 GLU 269 244 ?   ?   ?   D . n 
D 1 270 PHE 270 245 ?   ?   ?   D . n 
D 1 271 GLN 271 246 ?   ?   ?   D . n 
D 1 272 GLU 272 247 ?   ?   ?   D . n 
D 1 273 VAL 273 248 ?   ?   ?   D . n 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1  A MSE 52 A MSE 27 ? MET SELENOMETHIONINE 
2  A MSE 61 A MSE 36 ? MET SELENOMETHIONINE 
3  A MSE 73 A MSE 48 ? MET SELENOMETHIONINE 
4  B MSE 52 B MSE 27 ? MET SELENOMETHIONINE 
5  B MSE 61 B MSE 36 ? MET SELENOMETHIONINE 
6  B MSE 73 B MSE 48 ? MET SELENOMETHIONINE 
7  C MSE 52 C MSE 27 ? MET SELENOMETHIONINE 
8  C MSE 61 C MSE 36 ? MET SELENOMETHIONINE 
9  C MSE 73 C MSE 48 ? MET SELENOMETHIONINE 
10 D MSE 52 D MSE 27 ? MET SELENOMETHIONINE 
11 D MSE 61 D MSE 36 ? MET SELENOMETHIONINE 
12 D MSE 73 D MSE 48 ? MET SELENOMETHIONINE 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric    2 
2 author_and_software_defined_assembly PISA dimeric    2 
3 software_defined_assembly            PISA tetrameric 4 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,E,I,J     
2 1 C,D,F,G,H,K,L 
3 1 C,D,F,G,H,K,L 
3 2 A,B,E,I,J     
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1810  ? 
1 MORE         -22   ? 
1 'SSA (A^2)'  12440 ? 
2 'ABSA (A^2)' 2050  ? 
2 MORE         -11   ? 
2 'SSA (A^2)'  10940 ? 
3 'ABSA (A^2)' 5340  ? 
3 MORE         -40   ? 
3 'SSA (A^2)'  21900 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z             1.0000000000  0.0000000000 0.0000000000 0.0000000000  0.0000000000 
1.0000000000 0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 3_655 -x+1,y+1/2,-z+1/2 -1.0000000000 0.0000000000 0.0000000000 71.8200000000 0.0000000000 
1.0000000000 0.0000000000 41.2750000000 0.0000000000 0.0000000000 -1.0000000000 44.0950000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? L HOH .   ? D HOH 1024 ? 1_555 CA ? G CA . ? D CA 1021 ? 1_555 O   ? L HOH .   ? D HOH 1025 ? 1_555 74.3  ? 
2  O   ? L HOH .   ? D HOH 1024 ? 1_555 CA ? G CA . ? D CA 1021 ? 1_555 OE1 ? D GLU 138 ? D GLU 113  ? 1_555 76.1  ? 
3  O   ? L HOH .   ? D HOH 1025 ? 1_555 CA ? G CA . ? D CA 1021 ? 1_555 OE1 ? D GLU 138 ? D GLU 113  ? 1_555 94.3  ? 
4  O   ? L HOH .   ? D HOH 1024 ? 1_555 CA ? G CA . ? D CA 1021 ? 1_555 OE2 ? D GLU 138 ? D GLU 113  ? 1_555 122.7 ? 
5  O   ? L HOH .   ? D HOH 1025 ? 1_555 CA ? G CA . ? D CA 1021 ? 1_555 OE2 ? D GLU 138 ? D GLU 113  ? 1_555 93.5  ? 
6  OE1 ? D GLU 138 ? D GLU 113  ? 1_555 CA ? G CA . ? D CA 1021 ? 1_555 OE2 ? D GLU 138 ? D GLU 113  ? 1_555 48.6  ? 
7  O   ? L HOH .   ? D HOH 1024 ? 1_555 CA ? G CA . ? D CA 1021 ? 1_555 O   ? A VAL 164 ? A VAL 139  ? 3_655 109.6 ? 
8  O   ? L HOH .   ? D HOH 1025 ? 1_555 CA ? G CA . ? D CA 1021 ? 1_555 O   ? A VAL 164 ? A VAL 139  ? 3_655 175.5 ? 
9  OE1 ? D GLU 138 ? D GLU 113  ? 1_555 CA ? G CA . ? D CA 1021 ? 1_555 O   ? A VAL 164 ? A VAL 139  ? 3_655 84.6  ? 
10 OE2 ? D GLU 138 ? D GLU 113  ? 1_555 CA ? G CA . ? D CA 1021 ? 1_555 O   ? A VAL 164 ? A VAL 139  ? 3_655 82.6  ? 
11 O   ? L HOH .   ? D HOH 1024 ? 1_555 CA ? G CA . ? D CA 1021 ? 1_555 O   ? I HOH .   ? A HOH 1507 ? 3_655 148.3 ? 
12 O   ? L HOH .   ? D HOH 1025 ? 1_555 CA ? G CA . ? D CA 1021 ? 1_555 O   ? I HOH .   ? A HOH 1507 ? 3_655 89.2  ? 
13 OE1 ? D GLU 138 ? D GLU 113  ? 1_555 CA ? G CA . ? D CA 1021 ? 1_555 O   ? I HOH .   ? A HOH 1507 ? 3_655 133.1 ? 
14 OE2 ? D GLU 138 ? D GLU 113  ? 1_555 CA ? G CA . ? D CA 1021 ? 1_555 O   ? I HOH .   ? A HOH 1507 ? 3_655 84.5  ? 
15 O   ? A VAL 164 ? A VAL 139  ? 3_655 CA ? G CA . ? D CA 1021 ? 1_555 O   ? I HOH .   ? A HOH 1507 ? 3_655 88.3  ? 
16 O   ? L HOH .   ? D HOH 1024 ? 1_555 CA ? G CA . ? D CA 1021 ? 1_555 OD1 ? A ASP 162 ? A ASP 137  ? 3_655 88.3  ? 
17 O   ? L HOH .   ? D HOH 1025 ? 1_555 CA ? G CA . ? D CA 1021 ? 1_555 OD1 ? A ASP 162 ? A ASP 137  ? 3_655 90.2  ? 
18 OE1 ? D GLU 138 ? D GLU 113  ? 1_555 CA ? G CA . ? D CA 1021 ? 1_555 OD1 ? A ASP 162 ? A ASP 137  ? 3_655 161.8 ? 
19 OE2 ? D GLU 138 ? D GLU 113  ? 1_555 CA ? G CA . ? D CA 1021 ? 1_555 OD1 ? A ASP 162 ? A ASP 137  ? 3_655 148.7 ? 
20 O   ? A VAL 164 ? A VAL 139  ? 3_655 CA ? G CA . ? D CA 1021 ? 1_555 OD1 ? A ASP 162 ? A ASP 137  ? 3_655 92.1  ? 
21 O   ? I HOH .   ? A HOH 1507 ? 3_655 CA ? G CA . ? D CA 1021 ? 1_555 OD1 ? A ASP 162 ? A ASP 137  ? 3_655 64.4  ? 
22 O   ? K HOH .   ? C HOH 1027 ? 1_555 CA ? F CA . ? C CA 1023 ? 1_555 O   ? K HOH .   ? C HOH 1028 ? 1_555 110.2 ? 
23 O   ? K HOH .   ? C HOH 1027 ? 1_555 CA ? F CA . ? C CA 1023 ? 1_555 O   ? K HOH .   ? C HOH 1029 ? 1_555 121.3 ? 
24 O   ? K HOH .   ? C HOH 1028 ? 1_555 CA ? F CA . ? C CA 1023 ? 1_555 O   ? K HOH .   ? C HOH 1029 ? 1_555 81.1  ? 
25 O   ? K HOH .   ? C HOH 1027 ? 1_555 CA ? F CA . ? C CA 1023 ? 1_555 OD1 ? C ASN 106 ? C ASN 81   ? 1_555 62.0  ? 
26 O   ? K HOH .   ? C HOH 1028 ? 1_555 CA ? F CA . ? C CA 1023 ? 1_555 OD1 ? C ASN 106 ? C ASN 81   ? 1_555 79.8  ? 
27 O   ? K HOH .   ? C HOH 1029 ? 1_555 CA ? F CA . ? C CA 1023 ? 1_555 OD1 ? C ASN 106 ? C ASN 81   ? 1_555 64.2  ? 
28 O   ? K HOH .   ? C HOH 1027 ? 1_555 CA ? F CA . ? C CA 1023 ? 1_555 O   ? J HOH .   ? B HOH 1161 ? 3_645 153.9 ? 
29 O   ? K HOH .   ? C HOH 1028 ? 1_555 CA ? F CA . ? C CA 1023 ? 1_555 O   ? J HOH .   ? B HOH 1161 ? 3_645 85.3  ? 
30 O   ? K HOH .   ? C HOH 1029 ? 1_555 CA ? F CA . ? C CA 1023 ? 1_555 O   ? J HOH .   ? B HOH 1161 ? 3_645 80.8  ? 
31 OD1 ? C ASN 106 ? C ASN 81   ? 1_555 CA ? F CA . ? C CA 1023 ? 1_555 O   ? J HOH .   ? B HOH 1161 ? 3_645 143.5 ? 
32 O   ? K HOH .   ? C HOH 1027 ? 1_555 CA ? F CA . ? C CA 1023 ? 1_555 O   ? B PHE 127 ? B PHE 102  ? 3_645 80.0  ? 
33 O   ? K HOH .   ? C HOH 1028 ? 1_555 CA ? F CA . ? C CA 1023 ? 1_555 O   ? B PHE 127 ? B PHE 102  ? 3_645 160.0 ? 
34 O   ? K HOH .   ? C HOH 1029 ? 1_555 CA ? F CA . ? C CA 1023 ? 1_555 O   ? B PHE 127 ? B PHE 102  ? 3_645 78.9  ? 
35 OD1 ? C ASN 106 ? C ASN 81   ? 1_555 CA ? F CA . ? C CA 1023 ? 1_555 O   ? B PHE 127 ? B PHE 102  ? 3_645 90.8  ? 
36 O   ? J HOH .   ? B HOH 1161 ? 3_645 CA ? F CA . ? C CA 1023 ? 1_555 O   ? B PHE 127 ? B PHE 102  ? 3_645 92.2  ? 
37 OD1 ? D ASP 79  ? D ASP 54   ? 1_555 CA ? H CA . ? D CA 1022 ? 1_555 O   ? L HOH .   ? D HOH 1157 ? 1_555 73.4  ? 
38 OD1 ? D ASP 79  ? D ASP 54   ? 1_555 CA ? H CA . ? D CA 1022 ? 1_555 OD1 ? D ASP 83  ? D ASP 58   ? 1_555 99.0  ? 
39 O   ? L HOH .   ? D HOH 1157 ? 1_555 CA ? H CA . ? D CA 1022 ? 1_555 OD1 ? D ASP 83  ? D ASP 58   ? 1_555 168.5 ? 
40 OD1 ? D ASP 79  ? D ASP 54   ? 1_555 CA ? H CA . ? D CA 1022 ? 1_555 OD2 ? D ASP 83  ? D ASP 58   ? 1_555 79.3  ? 
41 O   ? L HOH .   ? D HOH 1157 ? 1_555 CA ? H CA . ? D CA 1022 ? 1_555 OD2 ? D ASP 83  ? D ASP 58   ? 1_555 139.4 ? 
42 OD1 ? D ASP 83  ? D ASP 58   ? 1_555 CA ? H CA . ? D CA 1022 ? 1_555 OD2 ? D ASP 83  ? D ASP 58   ? 1_555 43.8  ? 
43 OD1 ? D ASP 79  ? D ASP 54   ? 1_555 CA ? H CA . ? D CA 1022 ? 1_555 O   ? L HOH .   ? D HOH 1026 ? 1_555 80.9  ? 
44 O   ? L HOH .   ? D HOH 1157 ? 1_555 CA ? H CA . ? D CA 1022 ? 1_555 O   ? L HOH .   ? D HOH 1026 ? 1_555 87.7  ? 
45 OD1 ? D ASP 83  ? D ASP 58   ? 1_555 CA ? H CA . ? D CA 1022 ? 1_555 O   ? L HOH .   ? D HOH 1026 ? 1_555 82.4  ? 
46 OD2 ? D ASP 83  ? D ASP 58   ? 1_555 CA ? H CA . ? D CA 1022 ? 1_555 O   ? L HOH .   ? D HOH 1026 ? 1_555 117.2 ? 
47 OD1 ? D ASP 79  ? D ASP 54   ? 1_555 CA ? H CA . ? D CA 1022 ? 1_555 OD1 ? B ASP 110 ? B ASP 85   ? 2_565 146.0 ? 
48 O   ? L HOH .   ? D HOH 1157 ? 1_555 CA ? H CA . ? D CA 1022 ? 1_555 OD1 ? B ASP 110 ? B ASP 85   ? 2_565 101.8 ? 
49 OD1 ? D ASP 83  ? D ASP 58   ? 1_555 CA ? H CA . ? D CA 1022 ? 1_555 OD1 ? B ASP 110 ? B ASP 85   ? 2_565 79.5  ? 
50 OD2 ? D ASP 83  ? D ASP 58   ? 1_555 CA ? H CA . ? D CA 1022 ? 1_555 OD1 ? B ASP 110 ? B ASP 85   ? 2_565 117.4 ? 
51 O   ? L HOH .   ? D HOH 1026 ? 1_555 CA ? H CA . ? D CA 1022 ? 1_555 OD1 ? B ASP 110 ? B ASP 85   ? 2_565 65.2  ? 
52 OD1 ? D ASP 79  ? D ASP 54   ? 1_555 CA ? H CA . ? D CA 1022 ? 1_555 OE1 ? B GLU 113 ? B GLU 88   ? 2_565 124.5 ? 
53 O   ? L HOH .   ? D HOH 1157 ? 1_555 CA ? H CA . ? D CA 1022 ? 1_555 OE1 ? B GLU 113 ? B GLU 88   ? 2_565 108.9 ? 
54 OD1 ? D ASP 83  ? D ASP 58   ? 1_555 CA ? H CA . ? D CA 1022 ? 1_555 OE1 ? B GLU 113 ? B GLU 88   ? 2_565 82.5  ? 
55 OD2 ? D ASP 83  ? D ASP 58   ? 1_555 CA ? H CA . ? D CA 1022 ? 1_555 OE1 ? B GLU 113 ? B GLU 88   ? 2_565 63.9  ? 
56 O   ? L HOH .   ? D HOH 1026 ? 1_555 CA ? H CA . ? D CA 1022 ? 1_555 OE1 ? B GLU 113 ? B GLU 88   ? 2_565 152.2 ? 
57 OD1 ? B ASP 110 ? B ASP 85   ? 2_565 CA ? H CA . ? D CA 1022 ? 1_555 OE1 ? B GLU 113 ? B GLU 88   ? 2_565 89.2  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2000-07-07 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' .   ? 1 
SCALEPACK 'data scaling'   .   ? 2 
MADLSQ    'model building' .   ? 3 
X-PLOR    'model building' 3.1 ? 4 
X-PLOR    refinement       3.1 ? 5 
MADLSQ    phasing          .   ? 6 
X-PLOR    phasing          3.1 ? 7 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 NE2 C HIS 42 ? ? CD2 C HIS 42 ? ? 1.302 1.373 -0.071 0.011 N 
2 1 NE2 D HIS 42 ? ? CD2 D HIS 42 ? ? 1.301 1.373 -0.072 0.011 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CB  A TYR 32  ? ? CG  A TYR 32  ? ? CD1 A TYR 32  ? ? 116.83 121.00 -4.17  0.60 N 
2  1 CD1 A TRP 44  ? ? CG  A TRP 44  ? ? CD2 A TRP 44  ? ? 113.21 106.30 6.91   0.80 N 
3  1 CB  A TRP 44  ? ? CG  A TRP 44  ? ? CD1 A TRP 44  ? ? 119.17 127.00 -7.83  1.30 N 
4  1 CE2 A TRP 44  ? ? CD2 A TRP 44  ? ? CG  A TRP 44  ? ? 100.65 107.30 -6.65  0.80 N 
5  1 CG  A TRP 44  ? ? CD2 A TRP 44  ? ? CE3 A TRP 44  ? ? 139.37 133.90 5.47   0.90 N 
6  1 CA  A CYS 89  ? ? CB  A CYS 89  ? ? SG  A CYS 89  ? ? 122.28 114.20 8.08   1.10 N 
7  1 CD1 B TRP 44  ? ? CG  B TRP 44  ? ? CD2 B TRP 44  ? ? 114.03 106.30 7.73   0.80 N 
8  1 CG  B TRP 44  ? ? CD1 B TRP 44  ? ? NE1 B TRP 44  ? ? 104.10 110.10 -6.00  1.00 N 
9  1 CE2 B TRP 44  ? ? CD2 B TRP 44  ? ? CG  B TRP 44  ? ? 100.63 107.30 -6.67  0.80 N 
10 1 CA  B ASP 61  ? ? CB  B ASP 61  ? ? CG  B ASP 61  ? ? 126.69 113.40 13.29  2.20 N 
11 1 CD1 C TRP 44  ? ? CG  C TRP 44  ? ? CD2 C TRP 44  ? ? 112.33 106.30 6.03   0.80 N 
12 1 CE2 C TRP 44  ? ? CD2 C TRP 44  ? ? CG  C TRP 44  ? ? 101.71 107.30 -5.59  0.80 N 
13 1 CG1 C VAL 83  ? ? CB  C VAL 83  ? ? CG2 C VAL 83  ? ? 100.25 110.90 -10.65 1.60 N 
14 1 CD1 D TRP 44  ? ? CG  D TRP 44  ? ? CD2 D TRP 44  ? ? 113.83 106.30 7.53   0.80 N 
15 1 CB  D TRP 44  ? ? CG  D TRP 44  ? ? CD1 D TRP 44  ? ? 118.92 127.00 -8.08  1.30 N 
16 1 CG  D TRP 44  ? ? CD1 D TRP 44  ? ? NE1 D TRP 44  ? ? 103.90 110.10 -6.20  1.00 N 
17 1 CE2 D TRP 44  ? ? CD2 D TRP 44  ? ? CG  D TRP 44  ? ? 100.83 107.30 -6.47  0.80 N 
18 1 CG  D TRP 44  ? ? CD2 D TRP 44  ? ? CE3 D TRP 44  ? ? 139.74 133.90 5.84   0.90 N 
19 1 NE  D ARG 108 ? ? CZ  D ARG 108 ? ? NH2 D ARG 108 ? ? 116.20 120.30 -4.10  0.50 N 
20 1 NE  D ARG 117 ? ? CZ  D ARG 117 ? ? NH2 D ARG 117 ? ? 116.85 120.30 -3.45  0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 TRP A 44  ? ? -141.01 -16.36  
2  1 THR A 135 ? ? -103.06 -116.51 
3  1 ASP A 137 ? ? -65.96  -164.01 
4  1 VAL A 140 ? ? -101.62 -71.85  
5  1 TRP B 44  ? ? -143.38 -26.44  
6  1 GLU B 68  ? ? -118.11 -74.96  
7  1 ASN B 93  ? ? -42.20  96.66   
8  1 SER B 95  ? ? -53.90  107.14  
9  1 LEU B 98  ? ? -45.29  105.50  
10 1 ASP B 128 ? ? -101.58 55.90   
11 1 GLU D 68  ? ? -174.89 145.92  
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 TYR C 73 ? ? 0.070 'SIDE CHAIN' 
2 1 TYR D 73 ? ? 0.078 'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ASN 11  ? CG  ? A ASN 36  CG  
2  1 Y 1 A ASN 11  ? OD1 ? A ASN 36  OD1 
3  1 Y 1 A ASN 11  ? ND2 ? A ASN 36  ND2 
4  1 Y 1 A VAL 12  ? CG1 ? A VAL 37  CG1 
5  1 Y 1 A VAL 12  ? CG2 ? A VAL 37  CG2 
6  1 Y 1 A LYS 13  ? CG  ? A LYS 38  CG  
7  1 Y 1 A LYS 13  ? CD  ? A LYS 38  CD  
8  1 Y 1 A LYS 13  ? CE  ? A LYS 38  CE  
9  1 Y 1 A LYS 13  ? NZ  ? A LYS 38  NZ  
10 1 Y 1 A LYS 91  ? CG  ? A LYS 116 CG  
11 1 Y 1 A LYS 91  ? CD  ? A LYS 116 CD  
12 1 Y 1 A LYS 91  ? CE  ? A LYS 116 CE  
13 1 Y 1 A LYS 91  ? NZ  ? A LYS 116 NZ  
14 1 Y 1 A LYS 127 ? CG  ? A LYS 152 CG  
15 1 Y 1 A LYS 127 ? CD  ? A LYS 152 CD  
16 1 Y 1 A LYS 127 ? CE  ? A LYS 152 CE  
17 1 Y 1 A LYS 127 ? NZ  ? A LYS 152 NZ  
18 1 Y 1 A SER 133 ? OG  ? A SER 158 OG  
19 1 Y 1 B ASN 11  ? CG  ? B ASN 36  CG  
20 1 Y 1 B ASN 11  ? OD1 ? B ASN 36  OD1 
21 1 Y 1 B ASN 11  ? ND2 ? B ASN 36  ND2 
22 1 Y 1 B LYS 13  ? CG  ? B LYS 38  CG  
23 1 Y 1 B LYS 13  ? CD  ? B LYS 38  CD  
24 1 Y 1 B LYS 13  ? CE  ? B LYS 38  CE  
25 1 Y 1 B LYS 13  ? NZ  ? B LYS 38  NZ  
26 1 Y 1 B ASN 93  ? CG  ? B ASN 118 CG  
27 1 Y 1 B ASN 93  ? OD1 ? B ASN 118 OD1 
28 1 Y 1 B ASN 93  ? ND2 ? B ASN 118 ND2 
29 1 Y 1 B LYS 96  ? CG  ? B LYS 121 CG  
30 1 Y 1 B LYS 96  ? CD  ? B LYS 121 CD  
31 1 Y 1 B LYS 96  ? CE  ? B LYS 121 CE  
32 1 Y 1 B LYS 96  ? NZ  ? B LYS 121 NZ  
33 1 Y 1 B ASP 97  ? CG  ? B ASP 122 CG  
34 1 Y 1 B ASP 97  ? OD1 ? B ASP 122 OD1 
35 1 Y 1 B ASP 97  ? OD2 ? B ASP 122 OD2 
36 1 Y 1 B LYS 103 ? CG  ? B LYS 128 CG  
37 1 Y 1 B LYS 103 ? CD  ? B LYS 128 CD  
38 1 Y 1 B LYS 103 ? CE  ? B LYS 128 CE  
39 1 Y 1 B LYS 103 ? NZ  ? B LYS 128 NZ  
40 1 Y 1 B ASP 128 ? CG  ? B ASP 153 CG  
41 1 Y 1 B ASP 128 ? OD1 ? B ASP 153 OD1 
42 1 Y 1 B ASP 128 ? OD2 ? B ASP 153 OD2 
43 1 Y 1 B ASP 137 ? CG  ? B ASP 162 CG  
44 1 Y 1 B ASP 137 ? OD1 ? B ASP 162 OD1 
45 1 Y 1 B ASP 137 ? OD2 ? B ASP 162 OD2 
46 1 Y 1 C ASN 11  ? CG  ? C ASN 36  CG  
47 1 Y 1 C ASN 11  ? OD1 ? C ASN 36  OD1 
48 1 Y 1 C ASN 11  ? ND2 ? C ASN 36  ND2 
49 1 Y 1 C LYS 13  ? CG  ? C LYS 38  CG  
50 1 Y 1 C LYS 13  ? CD  ? C LYS 38  CD  
51 1 Y 1 C LYS 13  ? CE  ? C LYS 38  CE  
52 1 Y 1 C LYS 13  ? NZ  ? C LYS 38  NZ  
53 1 Y 1 C LEU 39  ? CG  ? C LEU 64  CG  
54 1 Y 1 C LEU 39  ? CD1 ? C LEU 64  CD1 
55 1 Y 1 C LEU 39  ? CD2 ? C LEU 64  CD2 
56 1 Y 1 D ASN 11  ? CG  ? D ASN 36  CG  
57 1 Y 1 D ASN 11  ? OD1 ? D ASN 36  OD1 
58 1 Y 1 D ASN 11  ? ND2 ? D ASN 36  ND2 
59 1 Y 1 D LYS 13  ? CG  ? D LYS 38  CG  
60 1 Y 1 D LYS 13  ? CD  ? D LYS 38  CD  
61 1 Y 1 D LYS 13  ? CE  ? D LYS 38  CE  
62 1 Y 1 D LYS 13  ? NZ  ? D LYS 38  NZ  
63 1 Y 1 D VAL 90  ? CG1 ? D VAL 115 CG1 
64 1 Y 1 D VAL 90  ? CG2 ? D VAL 115 CG2 
65 1 Y 1 D GLU 106 ? CG  ? D GLU 131 CG  
66 1 Y 1 D GLU 106 ? CD  ? D GLU 131 CD  
67 1 Y 1 D GLU 106 ? OE1 ? D GLU 131 OE1 
68 1 Y 1 D GLU 106 ? OE2 ? D GLU 131 OE2 
69 1 Y 1 D LYS 127 ? CG  ? D LYS 152 CG  
70 1 Y 1 D LYS 127 ? CD  ? D LYS 152 CD  
71 1 Y 1 D LYS 127 ? CE  ? D LYS 152 CE  
72 1 Y 1 D LYS 127 ? NZ  ? D LYS 152 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A MET -24 ? A MET 1   
2   1 Y 1 A LYS -23 ? A LYS 2   
3   1 Y 1 A LYS -22 ? A LYS 3   
4   1 Y 1 A THR -21 ? A THR 4   
5   1 Y 1 A GLN -20 ? A GLN 5   
6   1 Y 1 A THR -19 ? A THR 6   
7   1 Y 1 A TRP -18 ? A TRP 7   
8   1 Y 1 A ILE -17 ? A ILE 8   
9   1 Y 1 A LEU -16 ? A LEU 9   
10  1 Y 1 A THR -15 ? A THR 10  
11  1 Y 1 A CYS -14 ? A CYS 11  
12  1 Y 1 A ILE -13 ? A ILE 12  
13  1 Y 1 A TYR -12 ? A TYR 13  
14  1 Y 1 A LEU -11 ? A LEU 14  
15  1 Y 1 A GLN -10 ? A GLN 15  
16  1 Y 1 A LEU -9  ? A LEU 16  
17  1 Y 1 A LEU -8  ? A LEU 17  
18  1 Y 1 A LEU -7  ? A LEU 18  
19  1 Y 1 A PHE -6  ? A PHE 19  
20  1 Y 1 A ASN -5  ? A ASN 20  
21  1 Y 1 A PRO -4  ? A PRO 21  
22  1 Y 1 A LEU -3  ? A LEU 22  
23  1 Y 1 A VAL -2  ? A VAL 23  
24  1 Y 1 A LYS -1  ? A LYS 24  
25  1 Y 1 A THR 0   ? A THR 25  
26  1 Y 1 A GLU 1   ? A GLU 26  
27  1 Y 1 A GLY 2   ? A GLY 27  
28  1 Y 1 A ILE 3   ? A ILE 28  
29  1 Y 1 A CYS 4   ? A CYS 29  
30  1 Y 1 A ARG 5   ? A ARG 30  
31  1 Y 1 A ASN 6   ? A ASN 31  
32  1 Y 1 A ARG 7   ? A ARG 32  
33  1 Y 1 A VAL 8   ? A VAL 33  
34  1 Y 1 A THR 9   ? A THR 34  
35  1 Y 1 A ASN 10  ? A ASN 35  
36  1 Y 1 A GLU 92  ? A GLU 117 
37  1 Y 1 A ASN 93  ? A ASN 118 
38  1 Y 1 A SER 94  ? A SER 119 
39  1 Y 1 A SER 95  ? A SER 120 
40  1 Y 1 A LYS 96  ? A LYS 121 
41  1 Y 1 A ASP 97  ? A ASP 122 
42  1 Y 1 A LEU 98  ? A LEU 123 
43  1 Y 1 A LYS 99  ? A LYS 124 
44  1 Y 1 A LYS 100 ? A LYS 125 
45  1 Y 1 A SER 101 ? A SER 126 
46  1 Y 1 A PHE 102 ? A PHE 127 
47  1 Y 1 A LYS 103 ? A LYS 128 
48  1 Y 1 A SER 142 ? A SER 167 
49  1 Y 1 A THR 143 ? A THR 168 
50  1 Y 1 A LEU 144 ? A LEU 169 
51  1 Y 1 A SER 145 ? A SER 170 
52  1 Y 1 A PRO 146 ? A PRO 171 
53  1 Y 1 A GLU 147 ? A GLU 172 
54  1 Y 1 A LYS 148 ? A LYS 173 
55  1 Y 1 A ASP 149 ? A ASP 174 
56  1 Y 1 A SER 150 ? A SER 175 
57  1 Y 1 A ARG 151 ? A ARG 176 
58  1 Y 1 A VAL 152 ? A VAL 177 
59  1 Y 1 A SER 153 ? A SER 178 
60  1 Y 1 A VAL 154 ? A VAL 179 
61  1 Y 1 A THR 155 ? A THR 180 
62  1 Y 1 A LYS 156 ? A LYS 181 
63  1 Y 1 A PRO 157 ? A PRO 182 
64  1 Y 1 A PHE 158 ? A PHE 183 
65  1 Y 1 A MET 159 ? A MET 184 
66  1 Y 1 A LEU 160 ? A LEU 185 
67  1 Y 1 A PRO 161 ? A PRO 186 
68  1 Y 1 A PRO 162 ? A PRO 187 
69  1 Y 1 A VAL 163 ? A VAL 188 
70  1 Y 1 A ALA 164 ? A ALA 189 
71  1 Y 1 A ALA 165 ? A ALA 190 
72  1 Y 1 A SER 166 ? A SER 191 
73  1 Y 1 A SER 167 ? A SER 192 
74  1 Y 1 A LEU 168 ? A LEU 193 
75  1 Y 1 A ARG 169 ? A ARG 194 
76  1 Y 1 A ASN 170 ? A ASN 195 
77  1 Y 1 A ASP 171 ? A ASP 196 
78  1 Y 1 A SER 172 ? A SER 197 
79  1 Y 1 A SER 173 ? A SER 198 
80  1 Y 1 A SER 174 ? A SER 199 
81  1 Y 1 A SER 175 ? A SER 200 
82  1 Y 1 A ASN 176 ? A ASN 201 
83  1 Y 1 A ARG 177 ? A ARG 202 
84  1 Y 1 A LYS 178 ? A LYS 203 
85  1 Y 1 A ALA 179 ? A ALA 204 
86  1 Y 1 A LYS 180 ? A LYS 205 
87  1 Y 1 A ASN 181 ? A ASN 206 
88  1 Y 1 A PRO 182 ? A PRO 207 
89  1 Y 1 A PRO 183 ? A PRO 208 
90  1 Y 1 A GLY 184 ? A GLY 209 
91  1 Y 1 A ASP 185 ? A ASP 210 
92  1 Y 1 A SER 186 ? A SER 211 
93  1 Y 1 A SER 187 ? A SER 212 
94  1 Y 1 A LEU 188 ? A LEU 213 
95  1 Y 1 A HIS 189 ? A HIS 214 
96  1 Y 1 A TRP 190 ? A TRP 215 
97  1 Y 1 A ALA 191 ? A ALA 216 
98  1 Y 1 A ALA 192 ? A ALA 217 
99  1 Y 1 A MET 193 ? A MET 218 
100 1 Y 1 A ALA 194 ? A ALA 219 
101 1 Y 1 A LEU 195 ? A LEU 220 
102 1 Y 1 A PRO 196 ? A PRO 221 
103 1 Y 1 A ALA 197 ? A ALA 222 
104 1 Y 1 A LEU 198 ? A LEU 223 
105 1 Y 1 A PHE 199 ? A PHE 224 
106 1 Y 1 A SER 200 ? A SER 225 
107 1 Y 1 A LEU 201 ? A LEU 226 
108 1 Y 1 A ILE 202 ? A ILE 227 
109 1 Y 1 A ILE 203 ? A ILE 228 
110 1 Y 1 A GLY 204 ? A GLY 229 
111 1 Y 1 A PHE 205 ? A PHE 230 
112 1 Y 1 A ALA 206 ? A ALA 231 
113 1 Y 1 A PHE 207 ? A PHE 232 
114 1 Y 1 A GLY 208 ? A GLY 233 
115 1 Y 1 A ALA 209 ? A ALA 234 
116 1 Y 1 A LEU 210 ? A LEU 235 
117 1 Y 1 A TYR 211 ? A TYR 236 
118 1 Y 1 A TRP 212 ? A TRP 237 
119 1 Y 1 A LYS 213 ? A LYS 238 
120 1 Y 1 A LYS 214 ? A LYS 239 
121 1 Y 1 A ARG 215 ? A ARG 240 
122 1 Y 1 A GLN 216 ? A GLN 241 
123 1 Y 1 A PRO 217 ? A PRO 242 
124 1 Y 1 A SER 218 ? A SER 243 
125 1 Y 1 A LEU 219 ? A LEU 244 
126 1 Y 1 A THR 220 ? A THR 245 
127 1 Y 1 A ARG 221 ? A ARG 246 
128 1 Y 1 A ALA 222 ? A ALA 247 
129 1 Y 1 A VAL 223 ? A VAL 248 
130 1 Y 1 A GLU 224 ? A GLU 249 
131 1 Y 1 A ASN 225 ? A ASN 250 
132 1 Y 1 A ILE 226 ? A ILE 251 
133 1 Y 1 A GLN 227 ? A GLN 252 
134 1 Y 1 A ILE 228 ? A ILE 253 
135 1 Y 1 A ASN 229 ? A ASN 254 
136 1 Y 1 A GLU 230 ? A GLU 255 
137 1 Y 1 A GLU 231 ? A GLU 256 
138 1 Y 1 A ASP 232 ? A ASP 257 
139 1 Y 1 A ASN 233 ? A ASN 258 
140 1 Y 1 A GLU 234 ? A GLU 259 
141 1 Y 1 A ILE 235 ? A ILE 260 
142 1 Y 1 A SER 236 ? A SER 261 
143 1 Y 1 A MET 237 ? A MET 262 
144 1 Y 1 A LEU 238 ? A LEU 263 
145 1 Y 1 A GLN 239 ? A GLN 264 
146 1 Y 1 A GLU 240 ? A GLU 265 
147 1 Y 1 A LYS 241 ? A LYS 266 
148 1 Y 1 A GLU 242 ? A GLU 267 
149 1 Y 1 A ARG 243 ? A ARG 268 
150 1 Y 1 A GLU 244 ? A GLU 269 
151 1 Y 1 A PHE 245 ? A PHE 270 
152 1 Y 1 A GLN 246 ? A GLN 271 
153 1 Y 1 A GLU 247 ? A GLU 272 
154 1 Y 1 A VAL 248 ? A VAL 273 
155 1 Y 1 B MET -24 ? B MET 1   
156 1 Y 1 B LYS -23 ? B LYS 2   
157 1 Y 1 B LYS -22 ? B LYS 3   
158 1 Y 1 B THR -21 ? B THR 4   
159 1 Y 1 B GLN -20 ? B GLN 5   
160 1 Y 1 B THR -19 ? B THR 6   
161 1 Y 1 B TRP -18 ? B TRP 7   
162 1 Y 1 B ILE -17 ? B ILE 8   
163 1 Y 1 B LEU -16 ? B LEU 9   
164 1 Y 1 B THR -15 ? B THR 10  
165 1 Y 1 B CYS -14 ? B CYS 11  
166 1 Y 1 B ILE -13 ? B ILE 12  
167 1 Y 1 B TYR -12 ? B TYR 13  
168 1 Y 1 B LEU -11 ? B LEU 14  
169 1 Y 1 B GLN -10 ? B GLN 15  
170 1 Y 1 B LEU -9  ? B LEU 16  
171 1 Y 1 B LEU -8  ? B LEU 17  
172 1 Y 1 B LEU -7  ? B LEU 18  
173 1 Y 1 B PHE -6  ? B PHE 19  
174 1 Y 1 B ASN -5  ? B ASN 20  
175 1 Y 1 B PRO -4  ? B PRO 21  
176 1 Y 1 B LEU -3  ? B LEU 22  
177 1 Y 1 B VAL -2  ? B VAL 23  
178 1 Y 1 B LYS -1  ? B LYS 24  
179 1 Y 1 B THR 0   ? B THR 25  
180 1 Y 1 B GLU 1   ? B GLU 26  
181 1 Y 1 B GLY 2   ? B GLY 27  
182 1 Y 1 B ILE 3   ? B ILE 28  
183 1 Y 1 B CYS 4   ? B CYS 29  
184 1 Y 1 B ARG 5   ? B ARG 30  
185 1 Y 1 B ASN 6   ? B ASN 31  
186 1 Y 1 B ARG 7   ? B ARG 32  
187 1 Y 1 B VAL 8   ? B VAL 33  
188 1 Y 1 B THR 9   ? B THR 34  
189 1 Y 1 B ASN 10  ? B ASN 35  
190 1 Y 1 B VAL 130 ? B VAL 155 
191 1 Y 1 B VAL 131 ? B VAL 156 
192 1 Y 1 B ALA 132 ? B ALA 157 
193 1 Y 1 B SER 133 ? B SER 158 
194 1 Y 1 B GLU 134 ? B GLU 159 
195 1 Y 1 B THR 135 ? B THR 160 
196 1 Y 1 B SER 136 ? B SER 161 
197 1 Y 1 B VAL 139 ? B VAL 164 
198 1 Y 1 B VAL 140 ? B VAL 165 
199 1 Y 1 B SER 141 ? B SER 166 
200 1 Y 1 B SER 142 ? B SER 167 
201 1 Y 1 B THR 143 ? B THR 168 
202 1 Y 1 B LEU 144 ? B LEU 169 
203 1 Y 1 B SER 145 ? B SER 170 
204 1 Y 1 B PRO 146 ? B PRO 171 
205 1 Y 1 B GLU 147 ? B GLU 172 
206 1 Y 1 B LYS 148 ? B LYS 173 
207 1 Y 1 B ASP 149 ? B ASP 174 
208 1 Y 1 B SER 150 ? B SER 175 
209 1 Y 1 B ARG 151 ? B ARG 176 
210 1 Y 1 B VAL 152 ? B VAL 177 
211 1 Y 1 B SER 153 ? B SER 178 
212 1 Y 1 B VAL 154 ? B VAL 179 
213 1 Y 1 B THR 155 ? B THR 180 
214 1 Y 1 B LYS 156 ? B LYS 181 
215 1 Y 1 B PRO 157 ? B PRO 182 
216 1 Y 1 B PHE 158 ? B PHE 183 
217 1 Y 1 B MET 159 ? B MET 184 
218 1 Y 1 B LEU 160 ? B LEU 185 
219 1 Y 1 B PRO 161 ? B PRO 186 
220 1 Y 1 B PRO 162 ? B PRO 187 
221 1 Y 1 B VAL 163 ? B VAL 188 
222 1 Y 1 B ALA 164 ? B ALA 189 
223 1 Y 1 B ALA 165 ? B ALA 190 
224 1 Y 1 B SER 166 ? B SER 191 
225 1 Y 1 B SER 167 ? B SER 192 
226 1 Y 1 B LEU 168 ? B LEU 193 
227 1 Y 1 B ARG 169 ? B ARG 194 
228 1 Y 1 B ASN 170 ? B ASN 195 
229 1 Y 1 B ASP 171 ? B ASP 196 
230 1 Y 1 B SER 172 ? B SER 197 
231 1 Y 1 B SER 173 ? B SER 198 
232 1 Y 1 B SER 174 ? B SER 199 
233 1 Y 1 B SER 175 ? B SER 200 
234 1 Y 1 B ASN 176 ? B ASN 201 
235 1 Y 1 B ARG 177 ? B ARG 202 
236 1 Y 1 B LYS 178 ? B LYS 203 
237 1 Y 1 B ALA 179 ? B ALA 204 
238 1 Y 1 B LYS 180 ? B LYS 205 
239 1 Y 1 B ASN 181 ? B ASN 206 
240 1 Y 1 B PRO 182 ? B PRO 207 
241 1 Y 1 B PRO 183 ? B PRO 208 
242 1 Y 1 B GLY 184 ? B GLY 209 
243 1 Y 1 B ASP 185 ? B ASP 210 
244 1 Y 1 B SER 186 ? B SER 211 
245 1 Y 1 B SER 187 ? B SER 212 
246 1 Y 1 B LEU 188 ? B LEU 213 
247 1 Y 1 B HIS 189 ? B HIS 214 
248 1 Y 1 B TRP 190 ? B TRP 215 
249 1 Y 1 B ALA 191 ? B ALA 216 
250 1 Y 1 B ALA 192 ? B ALA 217 
251 1 Y 1 B MET 193 ? B MET 218 
252 1 Y 1 B ALA 194 ? B ALA 219 
253 1 Y 1 B LEU 195 ? B LEU 220 
254 1 Y 1 B PRO 196 ? B PRO 221 
255 1 Y 1 B ALA 197 ? B ALA 222 
256 1 Y 1 B LEU 198 ? B LEU 223 
257 1 Y 1 B PHE 199 ? B PHE 224 
258 1 Y 1 B SER 200 ? B SER 225 
259 1 Y 1 B LEU 201 ? B LEU 226 
260 1 Y 1 B ILE 202 ? B ILE 227 
261 1 Y 1 B ILE 203 ? B ILE 228 
262 1 Y 1 B GLY 204 ? B GLY 229 
263 1 Y 1 B PHE 205 ? B PHE 230 
264 1 Y 1 B ALA 206 ? B ALA 231 
265 1 Y 1 B PHE 207 ? B PHE 232 
266 1 Y 1 B GLY 208 ? B GLY 233 
267 1 Y 1 B ALA 209 ? B ALA 234 
268 1 Y 1 B LEU 210 ? B LEU 235 
269 1 Y 1 B TYR 211 ? B TYR 236 
270 1 Y 1 B TRP 212 ? B TRP 237 
271 1 Y 1 B LYS 213 ? B LYS 238 
272 1 Y 1 B LYS 214 ? B LYS 239 
273 1 Y 1 B ARG 215 ? B ARG 240 
274 1 Y 1 B GLN 216 ? B GLN 241 
275 1 Y 1 B PRO 217 ? B PRO 242 
276 1 Y 1 B SER 218 ? B SER 243 
277 1 Y 1 B LEU 219 ? B LEU 244 
278 1 Y 1 B THR 220 ? B THR 245 
279 1 Y 1 B ARG 221 ? B ARG 246 
280 1 Y 1 B ALA 222 ? B ALA 247 
281 1 Y 1 B VAL 223 ? B VAL 248 
282 1 Y 1 B GLU 224 ? B GLU 249 
283 1 Y 1 B ASN 225 ? B ASN 250 
284 1 Y 1 B ILE 226 ? B ILE 251 
285 1 Y 1 B GLN 227 ? B GLN 252 
286 1 Y 1 B ILE 228 ? B ILE 253 
287 1 Y 1 B ASN 229 ? B ASN 254 
288 1 Y 1 B GLU 230 ? B GLU 255 
289 1 Y 1 B GLU 231 ? B GLU 256 
290 1 Y 1 B ASP 232 ? B ASP 257 
291 1 Y 1 B ASN 233 ? B ASN 258 
292 1 Y 1 B GLU 234 ? B GLU 259 
293 1 Y 1 B ILE 235 ? B ILE 260 
294 1 Y 1 B SER 236 ? B SER 261 
295 1 Y 1 B MET 237 ? B MET 262 
296 1 Y 1 B LEU 238 ? B LEU 263 
297 1 Y 1 B GLN 239 ? B GLN 264 
298 1 Y 1 B GLU 240 ? B GLU 265 
299 1 Y 1 B LYS 241 ? B LYS 266 
300 1 Y 1 B GLU 242 ? B GLU 267 
301 1 Y 1 B ARG 243 ? B ARG 268 
302 1 Y 1 B GLU 244 ? B GLU 269 
303 1 Y 1 B PHE 245 ? B PHE 270 
304 1 Y 1 B GLN 246 ? B GLN 271 
305 1 Y 1 B GLU 247 ? B GLU 272 
306 1 Y 1 B VAL 248 ? B VAL 273 
307 1 Y 1 C MET -24 ? C MET 1   
308 1 Y 1 C LYS -23 ? C LYS 2   
309 1 Y 1 C LYS -22 ? C LYS 3   
310 1 Y 1 C THR -21 ? C THR 4   
311 1 Y 1 C GLN -20 ? C GLN 5   
312 1 Y 1 C THR -19 ? C THR 6   
313 1 Y 1 C TRP -18 ? C TRP 7   
314 1 Y 1 C ILE -17 ? C ILE 8   
315 1 Y 1 C LEU -16 ? C LEU 9   
316 1 Y 1 C THR -15 ? C THR 10  
317 1 Y 1 C CYS -14 ? C CYS 11  
318 1 Y 1 C ILE -13 ? C ILE 12  
319 1 Y 1 C TYR -12 ? C TYR 13  
320 1 Y 1 C LEU -11 ? C LEU 14  
321 1 Y 1 C GLN -10 ? C GLN 15  
322 1 Y 1 C LEU -9  ? C LEU 16  
323 1 Y 1 C LEU -8  ? C LEU 17  
324 1 Y 1 C LEU -7  ? C LEU 18  
325 1 Y 1 C PHE -6  ? C PHE 19  
326 1 Y 1 C ASN -5  ? C ASN 20  
327 1 Y 1 C PRO -4  ? C PRO 21  
328 1 Y 1 C LEU -3  ? C LEU 22  
329 1 Y 1 C VAL -2  ? C VAL 23  
330 1 Y 1 C LYS -1  ? C LYS 24  
331 1 Y 1 C THR 0   ? C THR 25  
332 1 Y 1 C GLU 1   ? C GLU 26  
333 1 Y 1 C GLY 2   ? C GLY 27  
334 1 Y 1 C ILE 3   ? C ILE 28  
335 1 Y 1 C CYS 4   ? C CYS 29  
336 1 Y 1 C ARG 5   ? C ARG 30  
337 1 Y 1 C ASN 6   ? C ASN 31  
338 1 Y 1 C ARG 7   ? C ARG 32  
339 1 Y 1 C VAL 8   ? C VAL 33  
340 1 Y 1 C THR 9   ? C THR 34  
341 1 Y 1 C ASN 10  ? C ASN 35  
342 1 Y 1 C GLU 92  ? C GLU 117 
343 1 Y 1 C ASN 93  ? C ASN 118 
344 1 Y 1 C SER 94  ? C SER 119 
345 1 Y 1 C SER 95  ? C SER 120 
346 1 Y 1 C LYS 96  ? C LYS 121 
347 1 Y 1 C ASP 97  ? C ASP 122 
348 1 Y 1 C LEU 98  ? C LEU 123 
349 1 Y 1 C LYS 99  ? C LYS 124 
350 1 Y 1 C LYS 100 ? C LYS 125 
351 1 Y 1 C SER 101 ? C SER 126 
352 1 Y 1 C PHE 102 ? C PHE 127 
353 1 Y 1 C LYS 103 ? C LYS 128 
354 1 Y 1 C LYS 127 ? C LYS 152 
355 1 Y 1 C ASP 128 ? C ASP 153 
356 1 Y 1 C PHE 129 ? C PHE 154 
357 1 Y 1 C VAL 130 ? C VAL 155 
358 1 Y 1 C VAL 131 ? C VAL 156 
359 1 Y 1 C ALA 132 ? C ALA 157 
360 1 Y 1 C SER 133 ? C SER 158 
361 1 Y 1 C GLU 134 ? C GLU 159 
362 1 Y 1 C THR 135 ? C THR 160 
363 1 Y 1 C SER 136 ? C SER 161 
364 1 Y 1 C ASP 137 ? C ASP 162 
365 1 Y 1 C CYS 138 ? C CYS 163 
366 1 Y 1 C VAL 139 ? C VAL 164 
367 1 Y 1 C VAL 140 ? C VAL 165 
368 1 Y 1 C SER 141 ? C SER 166 
369 1 Y 1 C SER 142 ? C SER 167 
370 1 Y 1 C THR 143 ? C THR 168 
371 1 Y 1 C LEU 144 ? C LEU 169 
372 1 Y 1 C SER 145 ? C SER 170 
373 1 Y 1 C PRO 146 ? C PRO 171 
374 1 Y 1 C GLU 147 ? C GLU 172 
375 1 Y 1 C LYS 148 ? C LYS 173 
376 1 Y 1 C ASP 149 ? C ASP 174 
377 1 Y 1 C SER 150 ? C SER 175 
378 1 Y 1 C ARG 151 ? C ARG 176 
379 1 Y 1 C VAL 152 ? C VAL 177 
380 1 Y 1 C SER 153 ? C SER 178 
381 1 Y 1 C VAL 154 ? C VAL 179 
382 1 Y 1 C THR 155 ? C THR 180 
383 1 Y 1 C LYS 156 ? C LYS 181 
384 1 Y 1 C PRO 157 ? C PRO 182 
385 1 Y 1 C PHE 158 ? C PHE 183 
386 1 Y 1 C MET 159 ? C MET 184 
387 1 Y 1 C LEU 160 ? C LEU 185 
388 1 Y 1 C PRO 161 ? C PRO 186 
389 1 Y 1 C PRO 162 ? C PRO 187 
390 1 Y 1 C VAL 163 ? C VAL 188 
391 1 Y 1 C ALA 164 ? C ALA 189 
392 1 Y 1 C ALA 165 ? C ALA 190 
393 1 Y 1 C SER 166 ? C SER 191 
394 1 Y 1 C SER 167 ? C SER 192 
395 1 Y 1 C LEU 168 ? C LEU 193 
396 1 Y 1 C ARG 169 ? C ARG 194 
397 1 Y 1 C ASN 170 ? C ASN 195 
398 1 Y 1 C ASP 171 ? C ASP 196 
399 1 Y 1 C SER 172 ? C SER 197 
400 1 Y 1 C SER 173 ? C SER 198 
401 1 Y 1 C SER 174 ? C SER 199 
402 1 Y 1 C SER 175 ? C SER 200 
403 1 Y 1 C ASN 176 ? C ASN 201 
404 1 Y 1 C ARG 177 ? C ARG 202 
405 1 Y 1 C LYS 178 ? C LYS 203 
406 1 Y 1 C ALA 179 ? C ALA 204 
407 1 Y 1 C LYS 180 ? C LYS 205 
408 1 Y 1 C ASN 181 ? C ASN 206 
409 1 Y 1 C PRO 182 ? C PRO 207 
410 1 Y 1 C PRO 183 ? C PRO 208 
411 1 Y 1 C GLY 184 ? C GLY 209 
412 1 Y 1 C ASP 185 ? C ASP 210 
413 1 Y 1 C SER 186 ? C SER 211 
414 1 Y 1 C SER 187 ? C SER 212 
415 1 Y 1 C LEU 188 ? C LEU 213 
416 1 Y 1 C HIS 189 ? C HIS 214 
417 1 Y 1 C TRP 190 ? C TRP 215 
418 1 Y 1 C ALA 191 ? C ALA 216 
419 1 Y 1 C ALA 192 ? C ALA 217 
420 1 Y 1 C MET 193 ? C MET 218 
421 1 Y 1 C ALA 194 ? C ALA 219 
422 1 Y 1 C LEU 195 ? C LEU 220 
423 1 Y 1 C PRO 196 ? C PRO 221 
424 1 Y 1 C ALA 197 ? C ALA 222 
425 1 Y 1 C LEU 198 ? C LEU 223 
426 1 Y 1 C PHE 199 ? C PHE 224 
427 1 Y 1 C SER 200 ? C SER 225 
428 1 Y 1 C LEU 201 ? C LEU 226 
429 1 Y 1 C ILE 202 ? C ILE 227 
430 1 Y 1 C ILE 203 ? C ILE 228 
431 1 Y 1 C GLY 204 ? C GLY 229 
432 1 Y 1 C PHE 205 ? C PHE 230 
433 1 Y 1 C ALA 206 ? C ALA 231 
434 1 Y 1 C PHE 207 ? C PHE 232 
435 1 Y 1 C GLY 208 ? C GLY 233 
436 1 Y 1 C ALA 209 ? C ALA 234 
437 1 Y 1 C LEU 210 ? C LEU 235 
438 1 Y 1 C TYR 211 ? C TYR 236 
439 1 Y 1 C TRP 212 ? C TRP 237 
440 1 Y 1 C LYS 213 ? C LYS 238 
441 1 Y 1 C LYS 214 ? C LYS 239 
442 1 Y 1 C ARG 215 ? C ARG 240 
443 1 Y 1 C GLN 216 ? C GLN 241 
444 1 Y 1 C PRO 217 ? C PRO 242 
445 1 Y 1 C SER 218 ? C SER 243 
446 1 Y 1 C LEU 219 ? C LEU 244 
447 1 Y 1 C THR 220 ? C THR 245 
448 1 Y 1 C ARG 221 ? C ARG 246 
449 1 Y 1 C ALA 222 ? C ALA 247 
450 1 Y 1 C VAL 223 ? C VAL 248 
451 1 Y 1 C GLU 224 ? C GLU 249 
452 1 Y 1 C ASN 225 ? C ASN 250 
453 1 Y 1 C ILE 226 ? C ILE 251 
454 1 Y 1 C GLN 227 ? C GLN 252 
455 1 Y 1 C ILE 228 ? C ILE 253 
456 1 Y 1 C ASN 229 ? C ASN 254 
457 1 Y 1 C GLU 230 ? C GLU 255 
458 1 Y 1 C GLU 231 ? C GLU 256 
459 1 Y 1 C ASP 232 ? C ASP 257 
460 1 Y 1 C ASN 233 ? C ASN 258 
461 1 Y 1 C GLU 234 ? C GLU 259 
462 1 Y 1 C ILE 235 ? C ILE 260 
463 1 Y 1 C SER 236 ? C SER 261 
464 1 Y 1 C MET 237 ? C MET 262 
465 1 Y 1 C LEU 238 ? C LEU 263 
466 1 Y 1 C GLN 239 ? C GLN 264 
467 1 Y 1 C GLU 240 ? C GLU 265 
468 1 Y 1 C LYS 241 ? C LYS 266 
469 1 Y 1 C GLU 242 ? C GLU 267 
470 1 Y 1 C ARG 243 ? C ARG 268 
471 1 Y 1 C GLU 244 ? C GLU 269 
472 1 Y 1 C PHE 245 ? C PHE 270 
473 1 Y 1 C GLN 246 ? C GLN 271 
474 1 Y 1 C GLU 247 ? C GLU 272 
475 1 Y 1 C VAL 248 ? C VAL 273 
476 1 Y 1 D MET -24 ? D MET 1   
477 1 Y 1 D LYS -23 ? D LYS 2   
478 1 Y 1 D LYS -22 ? D LYS 3   
479 1 Y 1 D THR -21 ? D THR 4   
480 1 Y 1 D GLN -20 ? D GLN 5   
481 1 Y 1 D THR -19 ? D THR 6   
482 1 Y 1 D TRP -18 ? D TRP 7   
483 1 Y 1 D ILE -17 ? D ILE 8   
484 1 Y 1 D LEU -16 ? D LEU 9   
485 1 Y 1 D THR -15 ? D THR 10  
486 1 Y 1 D CYS -14 ? D CYS 11  
487 1 Y 1 D ILE -13 ? D ILE 12  
488 1 Y 1 D TYR -12 ? D TYR 13  
489 1 Y 1 D LEU -11 ? D LEU 14  
490 1 Y 1 D GLN -10 ? D GLN 15  
491 1 Y 1 D LEU -9  ? D LEU 16  
492 1 Y 1 D LEU -8  ? D LEU 17  
493 1 Y 1 D LEU -7  ? D LEU 18  
494 1 Y 1 D PHE -6  ? D PHE 19  
495 1 Y 1 D ASN -5  ? D ASN 20  
496 1 Y 1 D PRO -4  ? D PRO 21  
497 1 Y 1 D LEU -3  ? D LEU 22  
498 1 Y 1 D VAL -2  ? D VAL 23  
499 1 Y 1 D LYS -1  ? D LYS 24  
500 1 Y 1 D THR 0   ? D THR 25  
501 1 Y 1 D GLU 1   ? D GLU 26  
502 1 Y 1 D GLY 2   ? D GLY 27  
503 1 Y 1 D ILE 3   ? D ILE 28  
504 1 Y 1 D CYS 4   ? D CYS 29  
505 1 Y 1 D ARG 5   ? D ARG 30  
506 1 Y 1 D ASN 6   ? D ASN 31  
507 1 Y 1 D ARG 7   ? D ARG 32  
508 1 Y 1 D VAL 8   ? D VAL 33  
509 1 Y 1 D THR 9   ? D THR 34  
510 1 Y 1 D ASN 10  ? D ASN 35  
511 1 Y 1 D LYS 91  ? D LYS 116 
512 1 Y 1 D GLU 92  ? D GLU 117 
513 1 Y 1 D ASN 93  ? D ASN 118 
514 1 Y 1 D SER 94  ? D SER 119 
515 1 Y 1 D SER 95  ? D SER 120 
516 1 Y 1 D LYS 96  ? D LYS 121 
517 1 Y 1 D ASP 97  ? D ASP 122 
518 1 Y 1 D LEU 98  ? D LEU 123 
519 1 Y 1 D LYS 99  ? D LYS 124 
520 1 Y 1 D LYS 100 ? D LYS 125 
521 1 Y 1 D SER 101 ? D SER 126 
522 1 Y 1 D PHE 102 ? D PHE 127 
523 1 Y 1 D LYS 103 ? D LYS 128 
524 1 Y 1 D ASP 128 ? D ASP 153 
525 1 Y 1 D PHE 129 ? D PHE 154 
526 1 Y 1 D VAL 130 ? D VAL 155 
527 1 Y 1 D VAL 131 ? D VAL 156 
528 1 Y 1 D ALA 132 ? D ALA 157 
529 1 Y 1 D SER 133 ? D SER 158 
530 1 Y 1 D GLU 134 ? D GLU 159 
531 1 Y 1 D THR 135 ? D THR 160 
532 1 Y 1 D SER 136 ? D SER 161 
533 1 Y 1 D ASP 137 ? D ASP 162 
534 1 Y 1 D CYS 138 ? D CYS 163 
535 1 Y 1 D VAL 139 ? D VAL 164 
536 1 Y 1 D VAL 140 ? D VAL 165 
537 1 Y 1 D SER 141 ? D SER 166 
538 1 Y 1 D SER 142 ? D SER 167 
539 1 Y 1 D THR 143 ? D THR 168 
540 1 Y 1 D LEU 144 ? D LEU 169 
541 1 Y 1 D SER 145 ? D SER 170 
542 1 Y 1 D PRO 146 ? D PRO 171 
543 1 Y 1 D GLU 147 ? D GLU 172 
544 1 Y 1 D LYS 148 ? D LYS 173 
545 1 Y 1 D ASP 149 ? D ASP 174 
546 1 Y 1 D SER 150 ? D SER 175 
547 1 Y 1 D ARG 151 ? D ARG 176 
548 1 Y 1 D VAL 152 ? D VAL 177 
549 1 Y 1 D SER 153 ? D SER 178 
550 1 Y 1 D VAL 154 ? D VAL 179 
551 1 Y 1 D THR 155 ? D THR 180 
552 1 Y 1 D LYS 156 ? D LYS 181 
553 1 Y 1 D PRO 157 ? D PRO 182 
554 1 Y 1 D PHE 158 ? D PHE 183 
555 1 Y 1 D MET 159 ? D MET 184 
556 1 Y 1 D LEU 160 ? D LEU 185 
557 1 Y 1 D PRO 161 ? D PRO 186 
558 1 Y 1 D PRO 162 ? D PRO 187 
559 1 Y 1 D VAL 163 ? D VAL 188 
560 1 Y 1 D ALA 164 ? D ALA 189 
561 1 Y 1 D ALA 165 ? D ALA 190 
562 1 Y 1 D SER 166 ? D SER 191 
563 1 Y 1 D SER 167 ? D SER 192 
564 1 Y 1 D LEU 168 ? D LEU 193 
565 1 Y 1 D ARG 169 ? D ARG 194 
566 1 Y 1 D ASN 170 ? D ASN 195 
567 1 Y 1 D ASP 171 ? D ASP 196 
568 1 Y 1 D SER 172 ? D SER 197 
569 1 Y 1 D SER 173 ? D SER 198 
570 1 Y 1 D SER 174 ? D SER 199 
571 1 Y 1 D SER 175 ? D SER 200 
572 1 Y 1 D ASN 176 ? D ASN 201 
573 1 Y 1 D ARG 177 ? D ARG 202 
574 1 Y 1 D LYS 178 ? D LYS 203 
575 1 Y 1 D ALA 179 ? D ALA 204 
576 1 Y 1 D LYS 180 ? D LYS 205 
577 1 Y 1 D ASN 181 ? D ASN 206 
578 1 Y 1 D PRO 182 ? D PRO 207 
579 1 Y 1 D PRO 183 ? D PRO 208 
580 1 Y 1 D GLY 184 ? D GLY 209 
581 1 Y 1 D ASP 185 ? D ASP 210 
582 1 Y 1 D SER 186 ? D SER 211 
583 1 Y 1 D SER 187 ? D SER 212 
584 1 Y 1 D LEU 188 ? D LEU 213 
585 1 Y 1 D HIS 189 ? D HIS 214 
586 1 Y 1 D TRP 190 ? D TRP 215 
587 1 Y 1 D ALA 191 ? D ALA 216 
588 1 Y 1 D ALA 192 ? D ALA 217 
589 1 Y 1 D MET 193 ? D MET 218 
590 1 Y 1 D ALA 194 ? D ALA 219 
591 1 Y 1 D LEU 195 ? D LEU 220 
592 1 Y 1 D PRO 196 ? D PRO 221 
593 1 Y 1 D ALA 197 ? D ALA 222 
594 1 Y 1 D LEU 198 ? D LEU 223 
595 1 Y 1 D PHE 199 ? D PHE 224 
596 1 Y 1 D SER 200 ? D SER 225 
597 1 Y 1 D LEU 201 ? D LEU 226 
598 1 Y 1 D ILE 202 ? D ILE 227 
599 1 Y 1 D ILE 203 ? D ILE 228 
600 1 Y 1 D GLY 204 ? D GLY 229 
601 1 Y 1 D PHE 205 ? D PHE 230 
602 1 Y 1 D ALA 206 ? D ALA 231 
603 1 Y 1 D PHE 207 ? D PHE 232 
604 1 Y 1 D GLY 208 ? D GLY 233 
605 1 Y 1 D ALA 209 ? D ALA 234 
606 1 Y 1 D LEU 210 ? D LEU 235 
607 1 Y 1 D TYR 211 ? D TYR 236 
608 1 Y 1 D TRP 212 ? D TRP 237 
609 1 Y 1 D LYS 213 ? D LYS 238 
610 1 Y 1 D LYS 214 ? D LYS 239 
611 1 Y 1 D ARG 215 ? D ARG 240 
612 1 Y 1 D GLN 216 ? D GLN 241 
613 1 Y 1 D PRO 217 ? D PRO 242 
614 1 Y 1 D SER 218 ? D SER 243 
615 1 Y 1 D LEU 219 ? D LEU 244 
616 1 Y 1 D THR 220 ? D THR 245 
617 1 Y 1 D ARG 221 ? D ARG 246 
618 1 Y 1 D ALA 222 ? D ALA 247 
619 1 Y 1 D VAL 223 ? D VAL 248 
620 1 Y 1 D GLU 224 ? D GLU 249 
621 1 Y 1 D ASN 225 ? D ASN 250 
622 1 Y 1 D ILE 226 ? D ILE 251 
623 1 Y 1 D GLN 227 ? D GLN 252 
624 1 Y 1 D ILE 228 ? D ILE 253 
625 1 Y 1 D ASN 229 ? D ASN 254 
626 1 Y 1 D GLU 230 ? D GLU 255 
627 1 Y 1 D GLU 231 ? D GLU 256 
628 1 Y 1 D ASP 232 ? D ASP 257 
629 1 Y 1 D ASN 233 ? D ASN 258 
630 1 Y 1 D GLU 234 ? D GLU 259 
631 1 Y 1 D ILE 235 ? D ILE 260 
632 1 Y 1 D SER 236 ? D SER 261 
633 1 Y 1 D MET 237 ? D MET 262 
634 1 Y 1 D LEU 238 ? D LEU 263 
635 1 Y 1 D GLN 239 ? D GLN 264 
636 1 Y 1 D GLU 240 ? D GLU 265 
637 1 Y 1 D LYS 241 ? D LYS 266 
638 1 Y 1 D GLU 242 ? D GLU 267 
639 1 Y 1 D ARG 243 ? D ARG 268 
640 1 Y 1 D GLU 244 ? D GLU 269 
641 1 Y 1 D PHE 245 ? D PHE 270 
642 1 Y 1 D GLN 246 ? D GLN 271 
643 1 Y 1 D GLU 247 ? D GLU 272 
644 1 Y 1 D VAL 248 ? D VAL 273 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'PENTAETHYLENE GLYCOL' 1PE 
3 'CALCIUM ION'          CA  
4 water                  HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 2 1PE 1  249  1    1PE 1PE B . 
F 3 CA  1  1023 1023 CA  CA  C . 
G 3 CA  1  1021 1021 CA  CA  D . 
H 3 CA  1  1022 1022 CA  CA  D . 
I 4 HOH 1  1105 1105 HOH HOH A . 
I 4 HOH 2  1106 1106 HOH HOH A . 
I 4 HOH 3  1107 1107 HOH HOH A . 
I 4 HOH 4  1108 1108 HOH HOH A . 
I 4 HOH 5  1109 1109 HOH HOH A . 
I 4 HOH 6  1110 1110 HOH HOH A . 
I 4 HOH 7  1111 1111 HOH HOH A . 
I 4 HOH 8  1112 1112 HOH HOH A . 
I 4 HOH 9  1113 1113 HOH HOH A . 
I 4 HOH 10 1116 1116 HOH HOH A . 
I 4 HOH 11 1118 1118 HOH HOH A . 
I 4 HOH 12 1119 1119 HOH HOH A . 
I 4 HOH 13 1120 1120 HOH HOH A . 
I 4 HOH 14 1121 1121 HOH HOH A . 
I 4 HOH 15 1122 1122 HOH HOH A . 
I 4 HOH 16 1123 1123 HOH HOH A . 
I 4 HOH 17 1124 1124 HOH HOH A . 
I 4 HOH 18 1125 1125 HOH HOH A . 
I 4 HOH 19 1126 1126 HOH HOH A . 
I 4 HOH 20 1127 1127 HOH HOH A . 
I 4 HOH 21 1154 1154 HOH HOH A . 
I 4 HOH 22 1170 1170 HOH HOH A . 
I 4 HOH 23 1220 1220 HOH HOH A . 
I 4 HOH 24 1269 1269 HOH HOH A . 
I 4 HOH 25 1277 1277 HOH HOH A . 
I 4 HOH 26 1300 1300 HOH HOH A . 
I 4 HOH 27 1309 1309 HOH HOH A . 
I 4 HOH 28 1360 1360 HOH HOH A . 
I 4 HOH 29 1361 1361 HOH HOH A . 
I 4 HOH 30 1364 1364 HOH HOH A . 
I 4 HOH 31 1366 1366 HOH HOH A . 
I 4 HOH 32 1370 1370 HOH HOH A . 
I 4 HOH 33 1371 1371 HOH HOH A . 
I 4 HOH 34 1374 1374 HOH HOH A . 
I 4 HOH 35 1376 1376 HOH HOH A . 
I 4 HOH 36 1377 1377 HOH HOH A . 
I 4 HOH 37 1378 1378 HOH HOH A . 
I 4 HOH 38 1380 1380 HOH HOH A . 
I 4 HOH 39 1381 1381 HOH HOH A . 
I 4 HOH 40 1382 1382 HOH HOH A . 
I 4 HOH 41 1384 1384 HOH HOH A . 
I 4 HOH 42 1387 1387 HOH HOH A . 
I 4 HOH 43 1388 1388 HOH HOH A . 
I 4 HOH 44 1390 1390 HOH HOH A . 
I 4 HOH 45 1391 1391 HOH HOH A . 
I 4 HOH 46 1392 1392 HOH HOH A . 
I 4 HOH 47 1393 1393 HOH HOH A . 
I 4 HOH 48 1430 1430 HOH HOH A . 
I 4 HOH 49 1441 1441 HOH HOH A . 
I 4 HOH 50 1447 1447 HOH HOH A . 
I 4 HOH 51 1454 1454 HOH HOH A . 
I 4 HOH 52 1458 1458 HOH HOH A . 
I 4 HOH 53 1461 1461 HOH HOH A . 
I 4 HOH 54 1464 1464 HOH HOH A . 
I 4 HOH 55 1507 1507 HOH HOH A . 
I 4 HOH 56 1509 1509 HOH HOH A . 
I 4 HOH 57 1523 1523 HOH HOH A . 
J 4 HOH 1  1114 1114 HOH HOH B . 
J 4 HOH 2  1115 1115 HOH HOH B . 
J 4 HOH 3  1117 1117 HOH HOH B . 
J 4 HOH 4  1129 1129 HOH HOH B . 
J 4 HOH 5  1133 1133 HOH HOH B . 
J 4 HOH 6  1136 1136 HOH HOH B . 
J 4 HOH 7  1139 1139 HOH HOH B . 
J 4 HOH 8  1141 1141 HOH HOH B . 
J 4 HOH 9  1144 1144 HOH HOH B . 
J 4 HOH 10 1145 1145 HOH HOH B . 
J 4 HOH 11 1146 1146 HOH HOH B . 
J 4 HOH 12 1156 1156 HOH HOH B . 
J 4 HOH 13 1158 1158 HOH HOH B . 
J 4 HOH 14 1161 1161 HOH HOH B . 
J 4 HOH 15 1163 1163 HOH HOH B . 
J 4 HOH 16 1167 1167 HOH HOH B . 
J 4 HOH 17 1172 1172 HOH HOH B . 
J 4 HOH 18 1173 1173 HOH HOH B . 
J 4 HOH 19 1174 1174 HOH HOH B . 
J 4 HOH 20 1175 1175 HOH HOH B . 
J 4 HOH 21 1176 1176 HOH HOH B . 
J 4 HOH 22 1181 1181 HOH HOH B . 
J 4 HOH 23 1190 1190 HOH HOH B . 
J 4 HOH 24 1191 1191 HOH HOH B . 
J 4 HOH 25 1192 1192 HOH HOH B . 
J 4 HOH 26 1194 1194 HOH HOH B . 
J 4 HOH 27 1197 1197 HOH HOH B . 
J 4 HOH 28 1198 1198 HOH HOH B . 
J 4 HOH 29 1204 1204 HOH HOH B . 
J 4 HOH 30 1205 1205 HOH HOH B . 
J 4 HOH 31 1206 1206 HOH HOH B . 
J 4 HOH 32 1209 1209 HOH HOH B . 
J 4 HOH 33 1217 1217 HOH HOH B . 
J 4 HOH 34 1223 1223 HOH HOH B . 
J 4 HOH 35 1232 1232 HOH HOH B . 
J 4 HOH 36 1234 1234 HOH HOH B . 
J 4 HOH 37 1235 1235 HOH HOH B . 
J 4 HOH 38 1238 1238 HOH HOH B . 
J 4 HOH 39 1239 1239 HOH HOH B . 
J 4 HOH 40 1240 1240 HOH HOH B . 
J 4 HOH 41 1241 1241 HOH HOH B . 
J 4 HOH 42 1242 1242 HOH HOH B . 
J 4 HOH 43 1246 1246 HOH HOH B . 
J 4 HOH 44 1247 1247 HOH HOH B . 
J 4 HOH 45 1253 1253 HOH HOH B . 
J 4 HOH 46 1263 1263 HOH HOH B . 
J 4 HOH 47 1264 1264 HOH HOH B . 
J 4 HOH 48 1266 1266 HOH HOH B . 
J 4 HOH 49 1271 1271 HOH HOH B . 
J 4 HOH 50 1280 1280 HOH HOH B . 
J 4 HOH 51 1281 1281 HOH HOH B . 
J 4 HOH 52 1284 1284 HOH HOH B . 
J 4 HOH 53 1289 1289 HOH HOH B . 
J 4 HOH 54 1293 1293 HOH HOH B . 
J 4 HOH 55 1294 1294 HOH HOH B . 
J 4 HOH 56 1297 1297 HOH HOH B . 
J 4 HOH 57 1311 1311 HOH HOH B . 
J 4 HOH 58 1321 1321 HOH HOH B . 
J 4 HOH 59 1331 1331 HOH HOH B . 
J 4 HOH 60 1337 1337 HOH HOH B . 
J 4 HOH 61 1342 1342 HOH HOH B . 
J 4 HOH 62 1344 1344 HOH HOH B . 
J 4 HOH 63 1345 1345 HOH HOH B . 
J 4 HOH 64 1353 1353 HOH HOH B . 
J 4 HOH 65 1405 1405 HOH HOH B . 
J 4 HOH 66 1409 1409 HOH HOH B . 
J 4 HOH 67 1411 1411 HOH HOH B . 
J 4 HOH 68 1420 1420 HOH HOH B . 
J 4 HOH 69 1422 1422 HOH HOH B . 
J 4 HOH 70 1428 1428 HOH HOH B . 
J 4 HOH 71 1429 1429 HOH HOH B . 
J 4 HOH 72 1434 1434 HOH HOH B . 
J 4 HOH 73 1440 1440 HOH HOH B . 
J 4 HOH 74 1443 1443 HOH HOH B . 
J 4 HOH 75 1444 1444 HOH HOH B . 
J 4 HOH 76 1463 1463 HOH HOH B . 
J 4 HOH 77 1506 1506 HOH HOH B . 
K 4 HOH 1  1027 1027 HOH HOH C . 
K 4 HOH 2  1028 1028 HOH HOH C . 
K 4 HOH 3  1029 1029 HOH HOH C . 
K 4 HOH 4  1128 1128 HOH HOH C . 
K 4 HOH 5  1130 1130 HOH HOH C . 
K 4 HOH 6  1134 1134 HOH HOH C . 
K 4 HOH 7  1147 1147 HOH HOH C . 
K 4 HOH 8  1148 1148 HOH HOH C . 
K 4 HOH 9  1150 1150 HOH HOH C . 
K 4 HOH 10 1153 1153 HOH HOH C . 
K 4 HOH 11 1160 1160 HOH HOH C . 
K 4 HOH 12 1169 1169 HOH HOH C . 
K 4 HOH 13 1177 1177 HOH HOH C . 
K 4 HOH 14 1179 1179 HOH HOH C . 
K 4 HOH 15 1187 1187 HOH HOH C . 
K 4 HOH 16 1201 1201 HOH HOH C . 
K 4 HOH 17 1207 1207 HOH HOH C . 
K 4 HOH 18 1208 1208 HOH HOH C . 
K 4 HOH 19 1210 1210 HOH HOH C . 
K 4 HOH 20 1214 1214 HOH HOH C . 
K 4 HOH 21 1225 1225 HOH HOH C . 
K 4 HOH 22 1227 1227 HOH HOH C . 
K 4 HOH 23 1228 1228 HOH HOH C . 
K 4 HOH 24 1230 1230 HOH HOH C . 
K 4 HOH 25 1243 1243 HOH HOH C . 
K 4 HOH 26 1245 1245 HOH HOH C . 
K 4 HOH 27 1252 1252 HOH HOH C . 
K 4 HOH 28 1256 1256 HOH HOH C . 
K 4 HOH 29 1257 1257 HOH HOH C . 
K 4 HOH 30 1261 1261 HOH HOH C . 
K 4 HOH 31 1274 1274 HOH HOH C . 
K 4 HOH 32 1276 1276 HOH HOH C . 
K 4 HOH 33 1279 1279 HOH HOH C . 
K 4 HOH 34 1287 1287 HOH HOH C . 
K 4 HOH 35 1288 1288 HOH HOH C . 
K 4 HOH 36 1295 1295 HOH HOH C . 
K 4 HOH 37 1303 1303 HOH HOH C . 
K 4 HOH 38 1315 1315 HOH HOH C . 
K 4 HOH 39 1316 1316 HOH HOH C . 
K 4 HOH 40 1326 1326 HOH HOH C . 
K 4 HOH 41 1330 1330 HOH HOH C . 
K 4 HOH 42 1333 1333 HOH HOH C . 
K 4 HOH 43 1340 1340 HOH HOH C . 
K 4 HOH 44 1347 1347 HOH HOH C . 
K 4 HOH 45 1389 1389 HOH HOH C . 
K 4 HOH 46 1407 1407 HOH HOH C . 
K 4 HOH 47 1410 1410 HOH HOH C . 
K 4 HOH 48 1412 1412 HOH HOH C . 
K 4 HOH 49 1421 1421 HOH HOH C . 
K 4 HOH 50 1424 1424 HOH HOH C . 
K 4 HOH 51 1437 1437 HOH HOH C . 
K 4 HOH 52 1438 1438 HOH HOH C . 
K 4 HOH 53 1446 1446 HOH HOH C . 
K 4 HOH 54 1456 1456 HOH HOH C . 
K 4 HOH 55 1462 1462 HOH HOH C . 
K 4 HOH 56 1466 1466 HOH HOH C . 
K 4 HOH 57 1519 1519 HOH HOH C . 
L 4 HOH 1  1024 1024 HOH HOH D . 
L 4 HOH 2  1025 1025 HOH HOH D . 
L 4 HOH 3  1026 1026 HOH HOH D . 
L 4 HOH 4  1132 1132 HOH HOH D . 
L 4 HOH 5  1135 1135 HOH HOH D . 
L 4 HOH 6  1138 1138 HOH HOH D . 
L 4 HOH 7  1140 1140 HOH HOH D . 
L 4 HOH 8  1142 1142 HOH HOH D . 
L 4 HOH 9  1143 1143 HOH HOH D . 
L 4 HOH 10 1149 1149 HOH HOH D . 
L 4 HOH 11 1151 1151 HOH HOH D . 
L 4 HOH 12 1152 1152 HOH HOH D . 
L 4 HOH 13 1157 1157 HOH HOH D . 
L 4 HOH 14 1162 1162 HOH HOH D . 
L 4 HOH 15 1164 1164 HOH HOH D . 
L 4 HOH 16 1165 1165 HOH HOH D . 
L 4 HOH 17 1166 1166 HOH HOH D . 
L 4 HOH 18 1180 1180 HOH HOH D . 
L 4 HOH 19 1185 1185 HOH HOH D . 
L 4 HOH 20 1186 1186 HOH HOH D . 
L 4 HOH 21 1189 1189 HOH HOH D . 
L 4 HOH 22 1195 1195 HOH HOH D . 
L 4 HOH 23 1196 1196 HOH HOH D . 
L 4 HOH 24 1202 1202 HOH HOH D . 
L 4 HOH 25 1203 1203 HOH HOH D . 
L 4 HOH 26 1212 1212 HOH HOH D . 
L 4 HOH 27 1215 1215 HOH HOH D . 
L 4 HOH 28 1216 1216 HOH HOH D . 
L 4 HOH 29 1218 1218 HOH HOH D . 
L 4 HOH 30 1219 1219 HOH HOH D . 
L 4 HOH 31 1221 1221 HOH HOH D . 
L 4 HOH 32 1222 1222 HOH HOH D . 
L 4 HOH 33 1224 1224 HOH HOH D . 
L 4 HOH 34 1226 1226 HOH HOH D . 
L 4 HOH 35 1229 1229 HOH HOH D . 
L 4 HOH 36 1231 1231 HOH HOH D . 
L 4 HOH 37 1233 1233 HOH HOH D . 
L 4 HOH 38 1236 1236 HOH HOH D . 
L 4 HOH 39 1237 1237 HOH HOH D . 
L 4 HOH 40 1244 1244 HOH HOH D . 
L 4 HOH 41 1248 1248 HOH HOH D . 
L 4 HOH 42 1249 1249 HOH HOH D . 
L 4 HOH 43 1250 1250 HOH HOH D . 
L 4 HOH 44 1251 1251 HOH HOH D . 
L 4 HOH 45 1254 1254 HOH HOH D . 
L 4 HOH 46 1255 1255 HOH HOH D . 
L 4 HOH 47 1260 1260 HOH HOH D . 
L 4 HOH 48 1262 1262 HOH HOH D . 
L 4 HOH 49 1286 1286 HOH HOH D . 
L 4 HOH 50 1291 1291 HOH HOH D . 
L 4 HOH 51 1292 1292 HOH HOH D . 
L 4 HOH 52 1298 1298 HOH HOH D . 
L 4 HOH 53 1299 1299 HOH HOH D . 
L 4 HOH 54 1306 1306 HOH HOH D . 
L 4 HOH 55 1308 1308 HOH HOH D . 
L 4 HOH 56 1310 1310 HOH HOH D . 
L 4 HOH 57 1312 1312 HOH HOH D . 
L 4 HOH 58 1322 1322 HOH HOH D . 
L 4 HOH 59 1332 1332 HOH HOH D . 
L 4 HOH 60 1335 1335 HOH HOH D . 
L 4 HOH 61 1339 1339 HOH HOH D . 
L 4 HOH 62 1341 1341 HOH HOH D . 
L 4 HOH 63 1404 1404 HOH HOH D . 
L 4 HOH 64 1406 1406 HOH HOH D . 
L 4 HOH 65 1414 1414 HOH HOH D . 
L 4 HOH 66 1418 1418 HOH HOH D . 
L 4 HOH 67 1419 1419 HOH HOH D . 
L 4 HOH 68 1455 1455 HOH HOH D . 
L 4 HOH 69 1457 1457 HOH HOH D . 
L 4 HOH 70 1459 1459 HOH HOH D . 
L 4 HOH 71 1515 1515 HOH HOH D . 
L 4 HOH 72 1518 1518 HOH HOH D . 
L 4 HOH 73 1521 1521 HOH HOH D . 
#