data_1SD8
# 
_entry.id   1SD8 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.313 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1SD8         
RCSB  RCSB021611   
WWPDB D_1000021611 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1S3C . unspecified 
PDB 1S3D . unspecified 
PDB 1SD9 . unspecified 
PDB 1SJZ . unspecified 
PDB 1SK0 . unspecified 
PDB 1SK1 . unspecified 
PDB 1SK2 . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1SD8 
_pdbx_database_status.recvd_initial_deposition_date   2004-02-13 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'DeMel, S.'     1 
'Edwards, B.F.' 2 
# 
_citation.id                        primary 
_citation.title                     
'Arginine 60 in the ArsC arsenate reductase of E. coli plasmid R773 determines the chemical nature of the bound As(III) product.' 
_citation.journal_abbrev            'Protein Sci.' 
_citation.journal_volume            13 
_citation.page_first                2330 
_citation.page_last                 2340 
_citation.year                      2004 
_citation.journal_id_ASTM           PRCIEI 
_citation.country                   US 
_citation.journal_id_ISSN           0961-8368 
_citation.journal_id_CSD            0795 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15295115 
_citation.pdbx_database_id_DOI      10.1110/ps.04787204 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'DeMel, S.'     1 ? 
primary 'Shi, J.'       2 ? 
primary 'Martin, P.'    3 ? 
primary 'Rosen, B.P.'   4 ? 
primary 'Edwards, B.F.' 5 ? 
# 
_cell.entry_id           1SD8 
_cell.length_a           86.600 
_cell.length_b           86.600 
_cell.length_c           116.030 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1SD8 
_symmetry.space_group_name_H-M             'P 61 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                178 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Arsenate reductase' 15821.226 1   1.20.4.1 R60K ? ? 
2 non-polymer syn 'SULFATE ION'        96.063    3   ?        ?    ? ? 
3 non-polymer syn 'CESIUM ION'         132.905   5   ?        ?    ? ? 
4 water       nat water                18.015    330 ?        ?    ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Arsenical pump modifier' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSNITIYHNPACGTSRNTLEMIRNSGTEPTIILYLENPPSRDELVKLIADMGISVRALLKKNVEPYEQLGLAEDKFTDDQ
LIDFMLQHPILINRPIVVTPLGTRLCRPSEVVLDILQDAQKGAFTKEDGEKVVDEAGKRLK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSNITIYHNPACGTSRNTLEMIRNSGTEPTIILYLENPPSRDELVKLIADMGISVRALLKKNVEPYEQLGLAEDKFTDDQ
LIDFMLQHPILINRPIVVTPLGTRLCRPSEVVLDILQDAQKGAFTKEDGEKVVDEAGKRLK
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   ASN n 
1 4   ILE n 
1 5   THR n 
1 6   ILE n 
1 7   TYR n 
1 8   HIS n 
1 9   ASN n 
1 10  PRO n 
1 11  ALA n 
1 12  CYS n 
1 13  GLY n 
1 14  THR n 
1 15  SER n 
1 16  ARG n 
1 17  ASN n 
1 18  THR n 
1 19  LEU n 
1 20  GLU n 
1 21  MET n 
1 22  ILE n 
1 23  ARG n 
1 24  ASN n 
1 25  SER n 
1 26  GLY n 
1 27  THR n 
1 28  GLU n 
1 29  PRO n 
1 30  THR n 
1 31  ILE n 
1 32  ILE n 
1 33  LEU n 
1 34  TYR n 
1 35  LEU n 
1 36  GLU n 
1 37  ASN n 
1 38  PRO n 
1 39  PRO n 
1 40  SER n 
1 41  ARG n 
1 42  ASP n 
1 43  GLU n 
1 44  LEU n 
1 45  VAL n 
1 46  LYS n 
1 47  LEU n 
1 48  ILE n 
1 49  ALA n 
1 50  ASP n 
1 51  MET n 
1 52  GLY n 
1 53  ILE n 
1 54  SER n 
1 55  VAL n 
1 56  ARG n 
1 57  ALA n 
1 58  LEU n 
1 59  LEU n 
1 60  LYS n 
1 61  LYS n 
1 62  ASN n 
1 63  VAL n 
1 64  GLU n 
1 65  PRO n 
1 66  TYR n 
1 67  GLU n 
1 68  GLN n 
1 69  LEU n 
1 70  GLY n 
1 71  LEU n 
1 72  ALA n 
1 73  GLU n 
1 74  ASP n 
1 75  LYS n 
1 76  PHE n 
1 77  THR n 
1 78  ASP n 
1 79  ASP n 
1 80  GLN n 
1 81  LEU n 
1 82  ILE n 
1 83  ASP n 
1 84  PHE n 
1 85  MET n 
1 86  LEU n 
1 87  GLN n 
1 88  HIS n 
1 89  PRO n 
1 90  ILE n 
1 91  LEU n 
1 92  ILE n 
1 93  ASN n 
1 94  ARG n 
1 95  PRO n 
1 96  ILE n 
1 97  VAL n 
1 98  VAL n 
1 99  THR n 
1 100 PRO n 
1 101 LEU n 
1 102 GLY n 
1 103 THR n 
1 104 ARG n 
1 105 LEU n 
1 106 CYS n 
1 107 ARG n 
1 108 PRO n 
1 109 SER n 
1 110 GLU n 
1 111 VAL n 
1 112 VAL n 
1 113 LEU n 
1 114 ASP n 
1 115 ILE n 
1 116 LEU n 
1 117 GLN n 
1 118 ASP n 
1 119 ALA n 
1 120 GLN n 
1 121 LYS n 
1 122 GLY n 
1 123 ALA n 
1 124 PHE n 
1 125 THR n 
1 126 LYS n 
1 127 GLU n 
1 128 ASP n 
1 129 GLY n 
1 130 GLU n 
1 131 LYS n 
1 132 VAL n 
1 133 VAL n 
1 134 ASP n 
1 135 GLU n 
1 136 ALA n 
1 137 GLY n 
1 138 LYS n 
1 139 ARG n 
1 140 LEU n 
1 141 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     562 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ARSC1_ECOLI 
_struct_ref.pdbx_db_accession          P08692 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSNITIYHNPACGTSRNTLEMIRNSGTEPTIILYLENPPSRDELVKLIADMGISVRALLRKNVEPYEQLGLAEDKFTDDQ
LIDFMLQHPILINRPIVVTPLGTRLCRPSEVVLDILQDAQKGAFTKEDGEKVVDEAGKRLK
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1SD8 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 141 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P08692 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  141 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       141 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1SD8 
_struct_ref_seq_dif.mon_id                       LYS 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      60 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P08692 
_struct_ref_seq_dif.db_mon_id                    ARG 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          60 
_struct_ref_seq_dif.details                      'ENGINEERED MUTATION' 
_struct_ref_seq_dif.pdbx_auth_seq_num            60 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CS  non-polymer         . 'CESIUM ION'    ? 'Cs 1'           132.905 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1SD8 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   57.3 
_exptl_crystal.description           ? 
_exptl_crystal.density_Matthews      2.88 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            278 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.80 
_exptl_crystal_grow.pdbx_details    
'50% saturated Cesium Sulfate, 100mM sodium acetate, 5mM DTT, pH 4.80, VAPOR DIFFUSION, HANGING DROP, temperature 278K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           93.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2001-07-24 
_diffrn_detector.details                'OSMIC MIRRORS' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'OSMIC MIRRORS' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     1SD8 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.00 
_reflns.d_resolution_high            1.580 
_reflns.number_obs                   32216 
_reflns.number_all                   33927 
_reflns.percent_possible_obs         95.0 
_reflns.pdbx_Rmerge_I_obs            0.104 
_reflns.pdbx_Rsym_value              0.104 
_reflns.pdbx_netI_over_sigmaI        25.9000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              16.9 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.58 
_reflns_shell.d_res_low              1.64 
_reflns_shell.percent_possible_all   69.2 
_reflns_shell.Rmerge_I_obs           0.2343 
_reflns_shell.pdbx_Rsym_value        0.2343 
_reflns_shell.meanI_over_sigI_obs    3.88 
_reflns_shell.pdbx_redundancy        3.08 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1SD8 
_refine.ls_number_reflns_obs                     32216 
_refine.ls_number_reflns_all                     32216 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            1.59 
_refine.ls_percent_reflns_obs                    91.6 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          0.1396 
_refine.ls_R_factor_R_work                       0.1396 
_refine.ls_R_factor_R_free                       0.1812 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.2 
_refine.ls_number_reflns_R_free                  1682 
_refine.ls_number_parameters                     13148 
_refine.ls_number_restraints                     15242 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'MOEWS & KRETSINGER, J.MOL.BIOL.91(1973)201-228' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R' 
_refine.details                                  'ANISOTROPIC REFINEMENT REDUCED FREE R (NO CUTOFF) BY ?' 
_refine.pdbx_starting_model                      'NATIVE STRUCTURE' 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1SD8 
_refine_analyze.Luzzati_coordinate_error_obs    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      7 
_refine_analyze.occupancy_sum_hydrogen          1111.00 
_refine_analyze.occupancy_sum_non_hydrogen      1415.70 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1083 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         20 
_refine_hist.number_atoms_solvent             330 
_refine_hist.number_atoms_total               1433 
_refine_hist.d_res_high                       1.59 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
s_bond_d               0.011  ? ? ? 'X-RAY DIFFRACTION' ? 
s_angle_d              0.030  ? ? ? 'X-RAY DIFFRACTION' ? 
s_similar_dist         0.000  ? ? ? 'X-RAY DIFFRACTION' ? 
s_from_restr_planes    0.0315 ? ? ? 'X-RAY DIFFRACTION' ? 
s_zero_chiral_vol      0.052  ? ? ? 'X-RAY DIFFRACTION' ? 
s_non_zero_chiral_vol  0.074  ? ? ? 'X-RAY DIFFRACTION' ? 
s_anti_bump_dis_restr  0.044  ? ? ? 'X-RAY DIFFRACTION' ? 
s_rigid_bond_adp_cmpnt 0.003  ? ? ? 'X-RAY DIFFRACTION' ? 
s_similar_adp_cmpnt    0.048  ? ? ? 'X-RAY DIFFRACTION' ? 
s_approx_iso_adps      0.074  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_pdbx_refine.entry_id                                    1SD8 
_pdbx_refine.R_factor_all_no_cutoff                      0.1396 
_pdbx_refine.R_factor_obs_no_cutoff                      0.1396 
_pdbx_refine.free_R_factor_no_cutoff                     0.1812 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     5.2 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            1682 
_pdbx_refine.R_factor_all_4sig_cutoff                    0.139 
_pdbx_refine.R_factor_obs_4sig_cutoff                    0.1488 
_pdbx_refine.free_R_factor_4sig_cutoff                   0.1917 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   5.2 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          1630 
_pdbx_refine.number_reflns_obs_4sig_cutoff               31235 
_pdbx_refine.number_reflns_obs_no_cutoff                 ? 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.free_R_error_no_cutoff                      ? 
# 
_struct.entry_id                  1SD8 
_struct.title                     'ARSENATE REDUCTASE R60K MUTANT FROM E. COLI' 
_struct.pdbx_descriptor           'Arsenate reductase (E.C.1.20.4.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1SD8 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            'ARSC, REDUCTASE, ARSENITE, ARSENATE, OXIDOREDUCTASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
I N N 3 ? 
J N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 CYS A 12  ? SER A 25  ? CYS A 12  SER A 25  1 ? 14 
HELX_P HELX_P2 2 SER A 40  ? GLY A 52  ? SER A 40  GLY A 52  1 ? 13 
HELX_P HELX_P3 3 VAL A 55  ? LEU A 59  ? VAL A 55  LEU A 59  5 ? 5  
HELX_P HELX_P4 4 VAL A 63  ? LEU A 69  ? VAL A 63  LEU A 69  1 ? 7  
HELX_P HELX_P5 5 THR A 77  ? HIS A 88  ? THR A 77  HIS A 88  1 ? 12 
HELX_P HELX_P6 6 PRO A 89  ? ILE A 92  ? PRO A 89  ILE A 92  5 ? 4  
HELX_P HELX_P7 7 PRO A 108 ? ILE A 115 ? PRO A 108 ILE A 115 5 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? F CS  .  CS  ? ? ? 1_555 A ASP 114 O   ? ? A CS  401 A ASP 114  1_555  ? ? ? ? ? ? ? 3.272 ? 
metalc2  metalc ? ? F CS  .  CS  ? ? ? 1_555 A LEU 113 O   ? ? A CS  401 A LEU 113  1_555  ? ? ? ? ? ? ? 3.109 ? 
metalc3  metalc ? ? F CS  .  CS  ? ? ? 1_555 A LEU 116 O   ? ? A CS  401 A LEU 116  1_555  ? ? ? ? ? ? ? 3.077 ? 
metalc4  metalc ? ? F CS  .  CS  ? ? ? 1_555 J HOH .   O   ? ? A CS  401 A HOH 1037 1_555  ? ? ? ? ? ? ? 3.207 ? 
metalc5  metalc ? ? G CS  .  CS  ? ? ? 1_555 A ASP 128 OD2 ? ? A CS  402 A ASP 128  1_555  ? ? ? ? ? ? ? 3.521 ? 
metalc6  metalc ? ? G CS  .  CS  ? ? ? 1_555 J HOH .   O   ? ? A CS  402 A HOH 1177 1_555  ? ? ? ? ? ? ? 3.125 ? 
metalc7  metalc ? ? G CS  .  CS  ? ? ? 1_555 J HOH .   O   ? ? A CS  402 A HOH 1036 1_555  ? ? ? ? ? ? ? 3.298 ? 
metalc8  metalc ? ? G CS  .  CS  ? ? ? 1_555 J HOH .   O   ? ? A CS  402 A HOH 1075 1_555  ? ? ? ? ? ? ? 3.091 ? 
metalc9  metalc ? ? H CS  .  CS  ? ? ? 1_555 A SER 40  N   ? ? A CS  403 A SER 40   1_555  ? ? ? ? ? ? ? 3.801 ? 
metalc10 metalc ? ? H CS  .  CS  ? ? ? 1_555 A PRO 38  O   ? ? A CS  403 A PRO 38   1_555  ? ? ? ? ? ? ? 3.205 ? 
metalc11 metalc ? ? H CS  .  CS  ? ? ? 1_555 J HOH .   O   ? ? A CS  403 A HOH 1021 1_555  ? ? ? ? ? ? ? 3.017 ? 
metalc12 metalc ? ? H CS  .  CS  ? ? ? 1_555 J HOH .   O   ? ? A CS  403 A HOH 1185 1_555  ? ? ? ? ? ? ? 2.939 ? 
metalc13 metalc ? ? H CS  .  CS  ? ? ? 1_555 J HOH .   O   ? ? A CS  403 A HOH 1120 1_555  ? ? ? ? ? ? ? 3.758 ? 
metalc14 metalc ? ? E CS  .  CS  ? ? ? 1_555 J HOH .   O   ? ? A CS  404 A HOH 1091 1_555  ? ? ? ? ? ? ? 3.161 ? 
metalc15 metalc ? ? E CS  .  CS  ? ? ? 1_555 A GLY 26  O   ? ? A CS  404 A GLY 26   1_555  ? ? ? ? ? ? ? 3.172 ? 
metalc16 metalc ? ? E CS  .  CS  ? ? ? 1_555 J HOH .   O   ? ? A CS  404 A HOH 1284 1_555  ? ? ? ? ? ? ? 3.104 ? 
metalc17 metalc ? ? I CS  .  CS  ? ? ? 1_555 J HOH .   O   ? ? A CS  405 A HOH 1072 1_555  ? ? ? ? ? ? ? 3.171 ? 
metalc18 metalc ? ? I CS  .  CS  ? ? ? 1_555 J HOH .   O   ? ? A CS  405 A HOH 1093 1_555  ? ? ? ? ? ? ? 2.977 ? 
metalc19 metalc ? ? I CS  .  CS  ? ? ? 1_555 A GLU 64  OE2 ? ? A CS  405 A GLU 64   1_555  ? ? ? ? ? ? ? 3.241 ? 
metalc20 metalc ? ? F CS  .  CS  ? ? ? 1_555 A LEU 116 O   ? ? A CS  401 A LEU 116  10_665 ? ? ? ? ? ? ? 3.076 ? 
metalc21 metalc ? ? F CS  .  CS  ? ? ? 1_555 A LEU 113 O   ? ? A CS  401 A LEU 113  10_665 ? ? ? ? ? ? ? 3.109 ? 
metalc22 metalc ? ? F CS  .  CS  ? ? ? 1_555 A ASP 114 O   ? ? A CS  401 A ASP 114  10_665 ? ? ? ? ? ? ? 3.271 ? 
metalc23 metalc ? ? F CS  .  CS  ? ? ? 1_555 J HOH .   O   ? ? A CS  401 A HOH 1037 10_665 ? ? ? ? ? ? ? 3.207 ? 
metalc24 metalc ? ? G CS  .  CS  ? ? ? 1_555 J HOH .   O   ? ? A CS  402 A HOH 1055 12_566 ? ? ? ? ? ? ? 3.782 ? 
metalc25 metalc ? ? G CS  .  CS  ? ? ? 1_555 A GLU 67  OE2 ? ? A CS  402 A GLU 67   12_566 ? ? ? ? ? ? ? 2.999 ? 
metalc26 metalc ? ? G CS  .  CS  ? ? ? 1_555 A GLU 67  OE1 ? ? A CS  402 A GLU 67   12_566 ? ? ? ? ? ? ? 3.066 ? 
metalc27 metalc ? ? G CS  .  CS  ? ? ? 1_555 J HOH .   O   ? ? A CS  402 A HOH 1238 12_566 ? ? ? ? ? ? ? 2.841 ? 
metalc28 metalc ? ? I CS  .  CS  ? ? ? 1_555 A GLN 87  NE2 ? ? A CS  405 A GLN 87   8_676  ? ? ? ? ? ? ? 3.681 ? 
metalc29 metalc ? ? I CS  .  CS  ? ? ? 1_555 J HOH .   O   ? ? A CS  405 A HOH 1251 12_566 ? ? ? ? ? ? ? 3.885 ? 
metalc30 metalc ? ? A GLU 43 OE1 B ? ? 1_555 H CS  .   CS  ? ? A GLU 43  A CS  403  1_555  ? ? ? ? ? ? ? 3.217 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ARG 94  A . ? ARG 94  A PRO 95  A ? PRO 95  A 1 -3.76 
2 ARG 107 A . ? ARG 107 A PRO 108 A ? PRO 108 A 1 3.04  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 30  ? ILE A 32  ? THR A 30  ILE A 32  
A 2 THR A 5   ? TYR A 7   ? THR A 5   TYR A 7   
A 3 ILE A 96  ? THR A 99  ? ILE A 96  THR A 99  
A 4 GLY A 102 ? LEU A 105 ? GLY A 102 LEU A 105 
B 1 PHE A 124 ? THR A 125 ? PHE A 124 THR A 125 
B 2 LYS A 131 ? VAL A 133 ? LYS A 131 VAL A 133 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ILE A 32  ? O ILE A 32  N ILE A 6   ? N ILE A 6   
A 2 3 N TYR A 7   ? N TYR A 7   O ILE A 96  ? O ILE A 96  
A 3 4 N THR A 99  ? N THR A 99  O GLY A 102 ? O GLY A 102 
B 1 2 N PHE A 124 ? N PHE A 124 O VAL A 132 ? O VAL A 132 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE SO4 A 201' 
AC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 A 202' 
AC3 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE SO4 A 203' 
AC4 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CS A 404'  
AC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CS A 401'  
AC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CS A 402'  
AC7 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CS A 403'  
AC8 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CS A 405'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 9  CYS A 12  ? CYS A 12   . ? 1_555  ? 
2  AC1 9  THR A 14  ? THR A 14   . ? 1_555  ? 
3  AC1 9  ASN A 62  ? ASN A 62   . ? 12_566 ? 
4  AC1 9  ARG A 94  ? ARG A 94   . ? 1_555  ? 
5  AC1 9  ARG A 107 ? ARG A 107  . ? 1_555  ? 
6  AC1 9  HOH J .   ? HOH A 1001 . ? 1_555  ? 
7  AC1 9  HOH J .   ? HOH A 1002 . ? 1_555  ? 
8  AC1 9  HOH J .   ? HOH A 1203 . ? 1_555  ? 
9  AC1 9  HOH J .   ? HOH A 1212 . ? 1_555  ? 
10 AC2 5  ARG A 107 ? ARG A 107  . ? 1_555  ? 
11 AC2 5  HOH J .   ? HOH A 1096 . ? 1_555  ? 
12 AC2 5  HOH J .   ? HOH A 1146 . ? 1_555  ? 
13 AC2 5  HOH J .   ? HOH A 1172 . ? 1_555  ? 
14 AC2 5  HOH J .   ? HOH A 1180 . ? 1_555  ? 
15 AC3 10 THR A 14  ? THR A 14   . ? 1_555  ? 
16 AC3 10 ASN A 17  ? ASN A 17   . ? 1_555  ? 
17 AC3 10 PRO A 108 ? PRO A 108  . ? 1_555  ? 
18 AC3 10 SER A 109 ? SER A 109  . ? 1_555  ? 
19 AC3 10 LYS A 126 ? LYS A 126  . ? 1_555  ? 
20 AC3 10 HOH J .   ? HOH A 1036 . ? 1_555  ? 
21 AC3 10 HOH J .   ? HOH A 1075 . ? 1_555  ? 
22 AC3 10 HOH J .   ? HOH A 1168 . ? 1_555  ? 
23 AC3 10 HOH J .   ? HOH A 1173 . ? 1_555  ? 
24 AC3 10 HOH J .   ? HOH A 1269 . ? 1_555  ? 
25 AC4 2  GLY A 26  ? GLY A 26   . ? 1_555  ? 
26 AC4 2  THR A 27  ? THR A 27   . ? 1_555  ? 
27 AC5 6  LEU A 113 ? LEU A 113  . ? 10_665 ? 
28 AC5 6  LEU A 113 ? LEU A 113  . ? 1_555  ? 
29 AC5 6  ASP A 114 ? ASP A 114  . ? 1_555  ? 
30 AC5 6  ASP A 114 ? ASP A 114  . ? 10_665 ? 
31 AC5 6  LEU A 116 ? LEU A 116  . ? 1_555  ? 
32 AC5 6  LEU A 116 ? LEU A 116  . ? 10_665 ? 
33 AC6 4  GLU A 67  ? GLU A 67   . ? 12_566 ? 
34 AC6 4  ASP A 128 ? ASP A 128  . ? 1_555  ? 
35 AC6 4  HOH J .   ? HOH A 1075 . ? 1_555  ? 
36 AC6 4  HOH J .   ? HOH A 1238 . ? 12_566 ? 
37 AC7 4  PRO A 38  ? PRO A 38   . ? 1_555  ? 
38 AC7 4  GLU A 43  ? GLU A 43   . ? 1_555  ? 
39 AC7 4  HOH J .   ? HOH A 1021 . ? 1_555  ? 
40 AC7 4  HOH J .   ? HOH A 1185 . ? 1_555  ? 
41 AC8 3  GLU A 64  ? GLU A 64   . ? 1_555  ? 
42 AC8 3  GLN A 87  ? GLN A 87   . ? 8_676  ? 
43 AC8 3  HOH J .   ? HOH A 1093 . ? 1_555  ? 
# 
_database_PDB_matrix.entry_id          1SD8 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.000000 
_database_PDB_matrix.origx_vector[2]   0.000000 
_database_PDB_matrix.origx_vector[3]   0.000000 
# 
_atom_sites.entry_id                    1SD8 
_atom_sites.fract_transf_matrix[1][1]   0.011547 
_atom_sites.fract_transf_matrix[1][2]   0.006667 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013334 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008618 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
CS 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ASN A 1 3   ? 32.036 45.825 45.509 1.00 38.95  ? 3    ASN A N   1 
ATOM   2    C  CA  . ASN A 1 3   ? 31.872 47.279 45.584 1.00 31.43  ? 3    ASN A CA  1 
ATOM   3    C  C   . ASN A 1 3   ? 30.585 47.637 46.295 1.00 22.95  ? 3    ASN A C   1 
ATOM   4    O  O   . ASN A 1 3   ? 29.510 47.619 45.705 1.00 25.51  ? 3    ASN A O   1 
ATOM   5    C  CB  . ASN A 1 3   ? 31.736 47.819 44.173 1.00 32.64  ? 3    ASN A CB  1 
ATOM   6    C  CG  . ASN A 1 3   ? 31.868 49.330 44.083 1.00 53.38  ? 3    ASN A CG  1 
ATOM   7    O  OD1 . ASN A 1 3   ? 31.899 49.864 42.950 1.00 98.20  ? 3    ASN A OD1 1 
ATOM   8    N  ND2 . ASN A 1 3   ? 31.950 50.046 45.202 1.00 72.72  ? 3    ASN A ND2 1 
ATOM   9    N  N   . ILE A 1 4   ? 30.687 47.984 47.560 1.00 16.79  ? 4    ILE A N   1 
ATOM   10   C  CA  . ILE A 1 4   ? 29.554 48.246 48.383 1.00 15.35  ? 4    ILE A CA  1 
ATOM   11   C  C   . ILE A 1 4   ? 29.711 49.633 49.033 1.00 14.12  ? 4    ILE A C   1 
ATOM   12   O  O   . ILE A 1 4   ? 30.827 49.911 49.482 1.00 16.66  ? 4    ILE A O   1 
ATOM   13   C  CB  . ILE A 1 4   ? 29.402 47.191 49.501 1.00 18.05  ? 4    ILE A CB  1 
ATOM   14   C  CG1 . ILE A 1 4   ? 29.306 45.779 48.934 1.00 15.43  ? 4    ILE A CG1 1 
ATOM   15   C  CG2 . ILE A 1 4   ? 28.235 47.479 50.441 1.00 14.05  ? 4    ILE A CG2 1 
ATOM   16   C  CD1 . ILE A 1 4   ? 29.197 44.686 49.956 1.00 18.86  ? 4    ILE A CD1 1 
ATOM   17   N  N   . THR A 1 5   ? 28.608 50.360 49.035 1.00 14.16  ? 5    THR A N   1 
ATOM   18   C  CA  . THR A 1 5   ? 28.523 51.668 49.704 1.00 15.86  ? 5    THR A CA  1 
ATOM   19   C  C   . THR A 1 5   ? 27.397 51.649 50.731 1.00 15.49  ? 5    THR A C   1 
ATOM   20   O  O   . THR A 1 5   ? 26.320 51.168 50.390 1.00 15.70  ? 5    THR A O   1 
ATOM   21   C  CB  . THR A 1 5   ? 28.301 52.778 48.681 1.00 17.22  ? 5    THR A CB  1 
ATOM   22   O  OG1 . THR A 1 5   ? 29.426 52.792 47.795 1.00 18.99  ? 5    THR A OG1 1 
ATOM   23   C  CG2 . THR A 1 5   ? 28.212 54.139 49.345 1.00 18.32  ? 5    THR A CG2 1 
ATOM   24   N  N   . ILE A 1 6   ? 27.721 52.167 51.939 1.00 14.79  ? 6    ILE A N   1 
ATOM   25   C  CA  . ILE A 1 6   ? 26.682 52.374 52.929 1.00 13.12  ? 6    ILE A CA  1 
ATOM   26   C  C   . ILE A 1 6   ? 26.647 53.863 53.284 1.00 14.15  ? 6    ILE A C   1 
ATOM   27   O  O   . ILE A 1 6   ? 27.691 54.464 53.614 1.00 14.37  ? 6    ILE A O   1 
ATOM   28   C  CB  . ILE A 1 6   ? 26.841 51.473 54.173 1.00 14.47  ? 6    ILE A CB  1 
ATOM   29   C  CG1 . ILE A 1 6   ? 25.762 51.698 55.197 1.00 14.34  ? 6    ILE A CG1 1 
ATOM   30   C  CG2 . ILE A 1 6   ? 28.201 51.594 54.838 1.00 14.98  ? 6    ILE A CG2 1 
ATOM   31   C  CD1 . ILE A 1 6   ? 25.734 50.798 56.409 1.00 15.70  ? 6    ILE A CD1 1 
ATOM   32   N  N   . TYR A 1 7   ? 25.436 54.421 53.218 1.00 13.61  ? 7    TYR A N   1 
ATOM   33   C  CA  . TYR A 1 7   ? 25.147 55.758 53.773 1.00 12.82  ? 7    TYR A CA  1 
ATOM   34   C  C   . TYR A 1 7   ? 24.770 55.562 55.248 1.00 13.11  ? 7    TYR A C   1 
ATOM   35   O  O   . TYR A 1 7   ? 23.679 55.087 55.533 1.00 13.76  ? 7    TYR A O   1 
ATOM   36   C  CB  . TYR A 1 7   ? 24.063 56.441 52.960 1.00 14.43  ? 7    TYR A CB  1 
ATOM   37   C  CG  . TYR A 1 7   ? 24.471 56.746 51.541 1.00 13.45  ? 7    TYR A CG  1 
ATOM   38   C  CD1 . TYR A 1 7   ? 24.409 55.802 50.542 1.00 14.19  ? 7    TYR A CD1 1 
ATOM   39   C  CD2 . TYR A 1 7   ? 24.943 58.014 51.212 1.00 14.72  ? 7    TYR A CD2 1 
ATOM   40   C  CE1 . TYR A 1 7   ? 24.793 56.091 49.250 1.00 18.64  ? 7    TYR A CE1 1 
ATOM   41   C  CE2 . TYR A 1 7   ? 25.326 58.315 49.937 1.00 16.52  ? 7    TYR A CE2 1 
ATOM   42   C  CZ  . TYR A 1 7   ? 25.248 57.351 48.948 1.00 14.63  ? 7    TYR A CZ  1 
ATOM   43   O  OH  . TYR A 1 7   ? 25.642 57.670 47.668 1.00 20.38  ? 7    TYR A OH  1 
ATOM   44   N  N   . HIS A 1 8   ? 25.703 55.881 56.127 1.00 12.94  ? 8    HIS A N   1 
ATOM   45   C  CA  . HIS A 1 8   ? 25.755 55.425 57.488 1.00 13.90  ? 8    HIS A CA  1 
ATOM   46   C  C   . HIS A 1 8   ? 25.614 56.564 58.476 1.00 14.07  ? 8    HIS A C   1 
ATOM   47   O  O   . HIS A 1 8   ? 26.199 57.614 58.307 1.00 14.80  ? 8    HIS A O   1 
ATOM   48   C  CB  . HIS A 1 8   ? 27.093 54.697 57.738 1.00 14.05  ? 8    HIS A CB  1 
ATOM   49   C  CG  . HIS A 1 8   ? 27.395 54.151 59.105 1.00 13.10  ? 8    HIS A CG  1 
ATOM   50   N  ND1 . HIS A 1 8   ? 26.556 53.322 59.803 1.00 15.69  ? 8    HIS A ND1 1 
ATOM   51   C  CD2 . HIS A 1 8   ? 28.470 54.231 59.913 1.00 12.76  ? 8    HIS A CD2 1 
ATOM   52   C  CE1 . HIS A 1 8   ? 27.041 52.949 60.955 1.00 15.04  ? 8    HIS A CE1 1 
ATOM   53   N  NE2 . HIS A 1 8   ? 28.238 53.509 61.059 1.00 15.85  ? 8    HIS A NE2 1 
ATOM   54   N  N   . ASN A 1 9   ? 24.884 56.519 59.558 1.00 14.67  ? 9    ASN A N   1 
ATOM   55   C  CA  . ASN A 1 9   ? 24.813 57.183 60.787 1.00 12.81  ? 9    ASN A CA  1 
ATOM   56   C  C   . ASN A 1 9   ? 25.257 56.291 61.944 1.00 13.21  ? 9    ASN A C   1 
ATOM   57   O  O   . ASN A 1 9   ? 24.497 55.420 62.373 1.00 15.30  ? 9    ASN A O   1 
ATOM   58   C  CB  . ASN A 1 9   ? 23.356 57.651 60.968 1.00 14.45  ? 9    ASN A CB  1 
ATOM   59   C  CG  . ASN A 1 9   ? 23.303 58.608 62.140 1.00 14.48  ? 9    ASN A CG  1 
ATOM   60   O  OD1 . ASN A 1 9   ? 24.251 58.697 62.925 1.00 17.60  ? 9    ASN A OD1 1 
ATOM   61   N  ND2 . ASN A 1 9   ? 22.188 59.299 62.252 1.00 19.88  ? 9    ASN A ND2 1 
ATOM   62   N  N   . PRO A 1 10  ? 26.478 56.503 62.416 1.00 14.42  ? 10   PRO A N   1 
ATOM   63   C  CA  . PRO A 1 10  ? 26.986 55.748 63.553 1.00 14.18  ? 10   PRO A CA  1 
ATOM   64   C  C   . PRO A 1 10  ? 26.124 55.808 64.800 1.00 15.96  ? 10   PRO A C   1 
ATOM   65   O  O   . PRO A 1 10  ? 26.254 54.927 65.666 1.00 16.61  ? 10   PRO A O   1 
ATOM   66   C  CB  . PRO A 1 10  ? 28.336 56.404 63.858 1.00 17.10  ? 10   PRO A CB  1 
ATOM   67   C  CG  . PRO A 1 10  ? 28.765 57.015 62.560 1.00 21.72  ? 10   PRO A CG  1 
ATOM   68   C  CD  . PRO A 1 10  ? 27.468 57.456 61.909 1.00 19.55  ? 10   PRO A CD  1 
ATOM   69   N  N   . ALA A 1 11  ? 25.243 56.799 64.898 1.00 15.28  ? 11   ALA A N   1 
ATOM   70   C  CA  . ALA A 1 11  ? 24.439 56.897 66.102 1.00 18.82  ? 11   ALA A CA  1 
ATOM   71   C  C   . ALA A 1 11  ? 23.136 56.118 65.970 1.00 19.25  ? 11   ALA A C   1 
ATOM   72   O  O   . ALA A 1 11  ? 22.347 56.162 66.933 1.00 27.75  ? 11   ALA A O   1 
ATOM   73   C  CB  . ALA A 1 11  ? 24.114 58.344 66.408 1.00 18.86  ? 11   ALA A CB  1 
ATOM   74   N  N   . CYS A 1 12  ? 22.899 55.464 64.849 1.00 15.18  ? 12   CYS A N   1 
ATOM   75   C  CA  . CYS A 1 12  ? 21.640 54.759 64.591 1.00 13.11  ? 12   CYS A CA  1 
ATOM   76   C  C   . CYS A 1 12  ? 21.848 53.248 64.693 1.00 13.75  ? 12   CYS A C   1 
ATOM   77   O  O   . CYS A 1 12  ? 22.728 52.750 63.973 1.00 14.17  ? 12   CYS A O   1 
ATOM   78   C  CB  . CYS A 1 12  ? 21.097 55.151 63.210 1.00 14.75  ? 12   CYS A CB  1 
ATOM   79   S  SG  . CYS A 1 12  ? 19.789 54.082 62.606 1.00 16.74  ? 12   CYS A SG  1 
ATOM   80   N  N   . GLY A 1 13  ? 21.133 52.522 65.536 1.00 13.92  ? 13   GLY A N   1 
ATOM   81   C  CA  . GLY A 1 13  ? 21.306 51.103 65.764 1.00 13.76  ? 13   GLY A CA  1 
ATOM   82   C  C   . GLY A 1 13  ? 21.144 50.292 64.487 1.00 12.21  ? 13   GLY A C   1 
ATOM   83   O  O   . GLY A 1 13  ? 21.876 49.371 64.174 1.00 14.17  ? 13   GLY A O   1 
ATOM   84   N  N   . THR A 1 14  ? 20.124 50.657 63.707 1.00 13.38  ? 14   THR A N   1 
ATOM   85   C  CA  . THR A 1 14  ? 19.840 49.963 62.475 1.00 12.79  ? 14   THR A CA  1 
ATOM   86   C  C   . THR A 1 14  ? 21.055 50.065 61.545 1.00 14.45  ? 14   THR A C   1 
ATOM   87   O  O   . THR A 1 14  ? 21.437 49.086 60.853 1.00 12.10  ? 14   THR A O   1 
ATOM   88   C  CB  . THR A 1 14  ? 18.574 50.548 61.796 1.00 14.22  ? 14   THR A CB  1 
ATOM   89   O  OG1 . THR A 1 14  ? 17.454 50.567 62.716 1.00 15.39  ? 14   THR A OG1 1 
ATOM   90   C  CG2 . THR A 1 14  ? 18.201 49.767 60.541 1.00 13.84  ? 14   THR A CG2 1 
ATOM   91   N  N   . SER A 1 15  ? 21.636 51.285 61.527 1.00 14.47  ? 15   SER A N   1 
ATOM   92   C  CA  . SER A 1 15  ? 22.751 51.554 60.663 1.00 11.83  ? 15   SER A CA  1 
ATOM   93   C  C   . SER A 1 15  ? 23.979 50.738 61.106 1.00 13.15  ? 15   SER A C   1 
ATOM   94   O  O   . SER A 1 15  ? 24.702 50.120 60.295 1.00 13.09  ? 15   SER A O   1 
ATOM   95   C  CB  . SER A 1 15  ? 23.074 53.056 60.617 1.00 14.00  ? 15   SER A CB  1 
ATOM   96   O  OG  . SER A 1 15  ? 23.795 53.255 59.408 1.00 15.10  ? 15   SER A OG  1 
ATOM   97   N  N   . ARG A 1 16  ? 24.227 50.668 62.397 1.00 14.05  ? 16   ARG A N   1 
ATOM   98   C  CA  . ARG A 1 16  ? 25.365 49.863 62.901 1.00 13.21  ? 16   ARG A CA  1 
ATOM   99   C  C   . ARG A 1 16  ? 25.167 48.379 62.595 1.00 12.47  ? 16   ARG A C   1 
ATOM   100  O  O   . ARG A 1 16  ? 26.120 47.713 62.149 1.00 14.16  ? 16   ARG A O   1 
ATOM   101  C  CB  . ARG A 1 16  ? 25.576 50.107 64.378 1.00 12.57  ? 16   ARG A CB  1 
ATOM   102  C  CG  . ARG A 1 16  ? 25.959 51.473 64.855 1.00 13.87  ? 16   ARG A CG  1 
ATOM   103  C  CD  . ARG A 1 16  ? 26.387 51.572 66.281 1.00 14.90  ? 16   ARG A CD  1 
ATOM   104  N  NE  . ARG A 1 16  ? 25.258 51.265 67.151 1.00 14.86  ? 16   ARG A NE  1 
ATOM   105  C  CZ  . ARG A 1 16  ? 24.336 52.109 67.602 1.00 16.95  ? 16   ARG A CZ  1 
ATOM   106  N  NH1 . ARG A 1 16  ? 24.390 53.394 67.263 1.00 15.89  ? 16   ARG A NH1 1 
ATOM   107  N  NH2 . ARG A 1 16  ? 23.349 51.679 68.399 1.00 16.43  ? 16   ARG A NH2 1 
ATOM   108  N  N   . ASN A 1 17  ? 23.968 47.852 62.840 1.00 12.87  ? 17   ASN A N   1 
ATOM   109  C  CA  . ASN A 1 17  ? 23.720 46.438 62.563 1.00 12.91  ? 17   ASN A CA  1 
ATOM   110  C  C   . ASN A 1 17  ? 23.946 46.118 61.082 1.00 11.86  ? 17   ASN A C   1 
ATOM   111  O  O   . ASN A 1 17  ? 24.478 45.088 60.710 1.00 14.33  ? 17   ASN A O   1 
ATOM   112  C  CB  . ASN A 1 17  ? 22.314 46.017 62.958 1.00 15.75  ? 17   ASN A CB  1 
ATOM   113  C  CG  . ASN A 1 17  ? 22.118 45.791 64.444 1.00 14.58  ? 17   ASN A CG  1 
ATOM   114  O  OD1 . ASN A 1 17  ? 22.974 45.264 65.168 1.00 14.77  ? 17   ASN A OD1 1 
ATOM   115  N  ND2 . ASN A 1 17  ? 20.926 46.169 64.893 1.00 14.86  ? 17   ASN A ND2 1 
ATOM   116  N  N   . THR A 1 18  ? 23.489 47.026 60.223 1.00 13.46  ? 18   THR A N   1 
ATOM   117  C  CA  . THR A 1 18  ? 23.624 46.855 58.785 1.00 12.46  ? 18   THR A CA  1 
ATOM   118  C  C   . THR A 1 18  ? 25.110 46.814 58.424 1.00 12.44  ? 18   THR A C   1 
ATOM   119  O  O   . THR A 1 18  ? 25.514 45.895 57.682 1.00 13.94  ? 18   THR A O   1 
ATOM   120  C  CB  . THR A 1 18  ? 22.900 47.957 57.985 1.00 12.36  ? 18   THR A CB  1 
ATOM   121  O  OG1 . THR A 1 18  ? 21.491 47.898 58.228 1.00 13.67  ? 18   THR A OG1 1 
ATOM   122  C  CG2 . THR A 1 18  ? 23.052 47.754 56.487 1.00 14.39  ? 18   THR A CG2 1 
ATOM   123  N  N   . LEU A 1 19  ? 25.857 47.776 58.936 1.00 12.05  ? 19   LEU A N   1 
ATOM   124  C  CA  . LEU A 1 19  ? 27.292 47.829 58.639 1.00 12.51  ? 19   LEU A CA  1 
ATOM   125  C  C   . LEU A 1 19  ? 27.963 46.521 59.055 1.00 12.35  ? 19   LEU A C   1 
ATOM   126  O  O   . LEU A 1 19  ? 28.784 45.942 58.331 1.00 14.13  ? 19   LEU A O   1 
ATOM   127  C  CB  . LEU A 1 19  ? 27.935 49.036 59.319 1.00 12.82  ? 19   LEU A CB  1 
ATOM   128  C  CG  . LEU A 1 19  ? 29.447 49.230 59.208 1.00 13.00  ? 19   LEU A CG  1 
ATOM   129  C  CD1 . LEU A 1 19  ? 29.925 49.185 57.764 1.00 14.23  ? 19   LEU A CD1 1 
ATOM   130  C  CD2 . LEU A 1 19  ? 29.837 50.556 59.866 1.00 14.63  ? 19   LEU A CD2 1 
ATOM   131  N  N   . GLU A 1 20  ? 27.634 46.027 60.253 1.00 13.82  ? 20   GLU A N   1 
ATOM   132  C  CA  . GLU A 1 20  ? 28.279 44.769 60.668 1.00 14.47  ? 20   GLU A CA  1 
ATOM   133  C  C   . GLU A 1 20  ? 27.816 43.585 59.839 1.00 14.45  ? 20   GLU A C   1 
ATOM   134  O  O   . GLU A 1 20  ? 28.634 42.659 59.632 1.00 14.30  ? 20   GLU A O   1 
ATOM   135  C  CB  . GLU A 1 20  ? 28.063 44.558 62.159 1.00 14.22  ? 20   GLU A CB  1 
ATOM   136  C  CG  . GLU A 1 20  ? 28.601 45.662 63.076 1.00 14.14  ? 20   GLU A CG  1 
ATOM   137  C  CD  . GLU A 1 20  ? 30.084 45.969 63.135 1.00 15.23  ? 20   GLU A CD  1 
ATOM   138  O  OE1 . GLU A 1 20  ? 30.715 45.953 62.037 1.00 16.60  ? 20   GLU A OE1 1 
ATOM   139  O  OE2 . GLU A 1 20  ? 30.623 46.283 64.251 1.00 15.22  ? 20   GLU A OE2 1 
ATOM   140  N  N   . MET A 1 21  ? 26.589 43.546 59.342 1.00 14.05  ? 21   MET A N   1 
ATOM   141  C  CA  . MET A 1 21  ? 26.189 42.403 58.501 1.00 14.19  ? 21   MET A CA  1 
ATOM   142  C  C   . MET A 1 21  ? 26.939 42.493 57.180 1.00 13.59  ? 21   MET A C   1 
ATOM   143  O  O   . MET A 1 21  ? 27.351 41.492 56.613 1.00 13.91  ? 21   MET A O   1 
ATOM   144  C  CB  . MET A 1 21  ? 24.680 42.367 58.269 1.00 14.69  ? 21   MET A CB  1 
ATOM   145  C  CG  . MET A 1 21  ? 23.924 41.540 59.293 1.00 16.12  ? 21   MET A CG  1 
ATOM   146  S  SD  . MET A 1 21  ? 22.129 41.455 58.991 1.00 16.93  ? 21   MET A SD  1 
ATOM   147  C  CE  . MET A 1 21  ? 21.640 43.052 59.655 1.00 21.56  ? 21   MET A CE  1 
ATOM   148  N  N   . ILE A 1 22  ? 27.134 43.687 56.620 1.00 13.95  ? 22   ILE A N   1 
ATOM   149  C  CA  . ILE A 1 22  ? 27.961 43.821 55.426 1.00 13.31  ? 22   ILE A CA  1 
ATOM   150  C  C   . ILE A 1 22  ? 29.344 43.213 55.684 1.00 12.86  ? 22   ILE A C   1 
ATOM   151  O  O   . ILE A 1 22  ? 29.839 42.397 54.890 1.00 14.37  ? 22   ILE A O   1 
ATOM   152  C  CB  . ILE A 1 22  ? 28.112 45.279 54.965 1.00 13.09  ? 22   ILE A CB  1 
ATOM   153  C  CG1 . ILE A 1 22  ? 26.797 45.943 54.577 1.00 13.23  ? 22   ILE A CG1 1 
ATOM   154  C  CG2 . ILE A 1 22  ? 29.079 45.378 53.798 1.00 14.86  ? 22   ILE A CG2 1 
ATOM   155  C  CD1 . ILE A 1 22  ? 26.802 47.440 54.334 1.00 16.10  ? 22   ILE A CD1 1 
ATOM   156  N  N   . ARG A 1 23  ? 29.955 43.601 56.814 1.00 14.79  ? 23   ARG A N   1 
ATOM   157  C  CA  . ARG A 1 23  ? 31.292 43.091 57.147 1.00 14.18  ? 23   ARG A CA  1 
ATOM   158  C  C   . ARG A 1 23  ? 31.287 41.586 57.315 1.00 14.66  ? 23   ARG A C   1 
ATOM   159  O  O   . ARG A 1 23  ? 32.286 40.920 56.933 1.00 16.94  ? 23   ARG A O   1 
ATOM   160  C  CB  . ARG A 1 23  ? 31.866 43.775 58.396 1.00 15.62  ? 23   ARG A CB  1 
ATOM   161  C  CG  . ARG A 1 23  ? 32.239 45.226 58.053 1.00 15.73  ? 23   ARG A CG  1 
ATOM   162  C  CD  . ARG A 1 23  ? 32.609 45.985 59.282 1.00 16.30  ? 23   ARG A CD  1 
ATOM   163  N  NE  . ARG A 1 23  ? 33.194 47.285 59.034 1.00 15.34  ? 23   ARG A NE  1 
ATOM   164  C  CZ  . ARG A 1 23  ? 33.111 48.353 59.826 1.00 14.50  ? 23   ARG A CZ  1 
ATOM   165  N  NH1 . ARG A 1 23  ? 32.415 48.348 60.967 1.00 15.93  ? 23   ARG A NH1 1 
ATOM   166  N  NH2 . ARG A 1 23  ? 33.725 49.473 59.458 1.00 15.38  ? 23   ARG A NH2 1 
ATOM   167  N  N   . ASN A 1 24  ? 30.197 41.054 57.861 1.00 14.72  ? 24   ASN A N   1 
ATOM   168  C  CA  . ASN A 1 24  ? 30.117 39.628 58.108 1.00 15.25  ? 24   ASN A CA  1 
ATOM   169  C  C   . ASN A 1 24  ? 29.956 38.823 56.819 1.00 14.26  ? 24   ASN A C   1 
ATOM   170  O  O   . ASN A 1 24  ? 30.058 37.610 56.821 1.00 16.59  ? 24   ASN A O   1 
ATOM   171  C  CB  . ASN A 1 24  ? 28.969 39.282 59.057 1.00 15.56  ? 24   ASN A CB  1 
ATOM   172  C  CG  . ASN A 1 24  ? 28.966 37.882 59.637 1.00 16.11  ? 24   ASN A CG  1 
ATOM   173  O  OD1 . ASN A 1 24  ? 27.911 37.215 59.786 1.00 19.19  ? 24   ASN A OD1 1 
ATOM   174  N  ND2 . ASN A 1 24  ? 30.120 37.375 59.998 1.00 14.43  ? 24   ASN A ND2 1 
ATOM   175  N  N   . SER A 1 25  ? 29.709 39.498 55.705 1.00 14.12  ? 25   SER A N   1 
ATOM   176  C  CA  . SER A 1 25  ? 29.693 38.849 54.398 1.00 14.20  ? 25   SER A CA  1 
ATOM   177  C  C   . SER A 1 25  ? 31.075 38.833 53.765 1.00 15.32  ? 25   SER A C   1 
ATOM   178  O  O   . SER A 1 25  ? 31.250 38.250 52.693 1.00 17.06  ? 25   SER A O   1 
ATOM   179  C  CB  . SER A 1 25  ? 28.700 39.527 53.463 1.00 14.61  ? 25   SER A CB  1 
ATOM   180  O  OG  . SER A 1 25  ? 29.206 40.699 52.857 1.00 15.67  ? 25   SER A OG  1 
ATOM   181  N  N   . GLY A 1 26  ? 32.046 39.454 54.432 1.00 15.65  ? 26   GLY A N   1 
ATOM   182  C  CA  . GLY A 1 26  ? 33.409 39.459 53.942 1.00 17.10  ? 26   GLY A CA  1 
ATOM   183  C  C   . GLY A 1 26  ? 33.826 40.702 53.205 1.00 17.41  ? 26   GLY A C   1 
ATOM   184  O  O   . GLY A 1 26  ? 34.929 40.662 52.637 1.00 20.58  ? 26   GLY A O   1 
ATOM   185  N  N   . THR A 1 27  ? 33.041 41.777 53.164 1.00 17.94  ? 27   THR A N   1 
ATOM   186  C  CA  . THR A 1 27  ? 33.637 42.957 52.570 1.00 20.37  ? 27   THR A CA  1 
ATOM   187  C  C   . THR A 1 27  ? 33.436 44.204 53.430 1.00 16.89  ? 27   THR A C   1 
ATOM   188  O  O   . THR A 1 27  ? 32.480 44.382 54.149 1.00 17.83  ? 27   THR A O   1 
ATOM   189  C  CB  . THR A 1 27  ? 33.294 43.269 51.106 1.00 28.84  ? 27   THR A CB  1 
ATOM   190  O  OG1 . THR A 1 27  ? 32.567 44.478 50.882 1.00 37.26  ? 27   THR A OG1 1 
ATOM   191  C  CG2 . THR A 1 27  ? 32.473 42.204 50.452 1.00 21.25  ? 27   THR A CG2 1 
ATOM   192  N  N   . GLU A 1 28  ? 34.454 45.042 53.313 1.00 16.41  ? 28   GLU A N   1 
ATOM   193  C  CA  . GLU A 1 28  ? 34.477 46.339 53.941 1.00 16.23  ? 28   GLU A CA  1 
ATOM   194  C  C   . GLU A 1 28  ? 33.910 47.358 52.950 1.00 17.30  ? 28   GLU A C   1 
ATOM   195  O  O   . GLU A 1 28  ? 34.527 47.541 51.889 1.00 19.51  ? 28   GLU A O   1 
ATOM   196  C  CB  . GLU A 1 28  ? 35.885 46.753 54.333 1.00 16.38  ? 28   GLU A CB  1 
ATOM   197  C  CG  . GLU A 1 28  ? 35.998 48.125 54.966 1.00 17.47  ? 28   GLU A CG  1 
ATOM   198  C  CD  . GLU A 1 28  ? 35.364 48.158 56.340 1.00 18.16  ? 28   GLU A CD  1 
ATOM   199  O  OE1 . GLU A 1 28  ? 35.211 49.251 56.907 1.00 19.67  ? 28   GLU A OE1 1 
ATOM   200  O  OE2 . GLU A 1 28  ? 35.035 47.087 56.877 1.00 18.77  ? 28   GLU A OE2 1 
ATOM   201  N  N   . PRO A 1 29  ? 32.779 47.963 53.303 1.00 16.42  ? 29   PRO A N   1 
ATOM   202  C  CA  . PRO A 1 29  ? 32.149 48.898 52.355 1.00 15.58  ? 29   PRO A CA  1 
ATOM   203  C  C   . PRO A 1 29  ? 32.817 50.258 52.394 1.00 15.30  ? 29   PRO A C   1 
ATOM   204  O  O   . PRO A 1 29  ? 33.479 50.663 53.367 1.00 16.84  ? 29   PRO A O   1 
ATOM   205  C  CB  . PRO A 1 29  ? 30.712 48.964 52.890 1.00 14.72  ? 29   PRO A CB  1 
ATOM   206  C  CG  . PRO A 1 29  ? 30.868 48.771 54.371 1.00 14.39  ? 29   PRO A CG  1 
ATOM   207  C  CD  . PRO A 1 29  ? 32.014 47.829 54.523 1.00 15.97  ? 29   PRO A CD  1 
ATOM   208  N  N   . THR A 1 30  ? 32.605 51.026 51.331 1.00 16.42  ? 30   THR A N   1 
ATOM   209  C  CA  . THR A 1 30  ? 32.831 52.472 51.422 1.00 15.65  ? 30   THR A CA  1 
ATOM   210  C  C   . THR A 1 30  ? 31.791 53.050 52.345 1.00 15.07  ? 30   THR A C   1 
ATOM   211  O  O   . THR A 1 30  ? 30.619 52.728 52.145 1.00 15.84  ? 30   THR A O   1 
ATOM   212  C  CB  . THR A 1 30  ? 32.705 53.064 50.011 1.00 20.07  ? 30   THR A CB  1 
ATOM   213  O  OG1 . THR A 1 30  ? 33.764 52.528 49.208 1.00 21.12  ? 30   THR A OG1 1 
ATOM   214  C  CG2 . THR A 1 30  ? 32.869 54.571 50.045 1.00 21.48  ? 30   THR A CG2 1 
ATOM   215  N  N   . ILE A 1 31  ? 32.191 53.852 53.331 1.00 16.89  ? 31   ILE A N   1 
ATOM   216  C  CA  . ILE A 1 31  ? 31.240 54.422 54.295 1.00 15.53  ? 31   ILE A CA  1 
ATOM   217  C  C   . ILE A 1 31  ? 31.069 55.917 54.057 1.00 14.90  ? 31   ILE A C   1 
ATOM   218  O  O   . ILE A 1 31  ? 32.045 56.673 54.141 1.00 16.96  ? 31   ILE A O   1 
ATOM   219  C  CB  . ILE A 1 31  ? 31.731 54.143 55.728 1.00 14.78  ? 31   ILE A CB  1 
ATOM   220  C  CG1 . ILE A 1 31  ? 31.893 52.629 55.992 1.00 15.55  ? 31   ILE A CG1 1 
ATOM   221  C  CG2 . ILE A 1 31  ? 30.859 54.833 56.770 1.00 17.80  ? 31   ILE A CG2 1 
ATOM   222  C  CD1 . ILE A 1 31  ? 32.560 52.343 57.325 1.00 17.84  ? 31   ILE A CD1 1 
ATOM   223  N  N   . ILE A 1 32  ? 29.842 56.326 53.718 1.00 14.22  ? 32   ILE A N   1 
ATOM   224  C  CA  . ILE A 1 32  ? 29.547 57.739 53.497 1.00 15.42  ? 32   ILE A CA  1 
ATOM   225  C  C   . ILE A 1 32  ? 28.756 58.232 54.705 1.00 14.37  ? 32   ILE A C   1 
ATOM   226  O  O   . ILE A 1 32  ? 27.652 57.715 54.989 1.00 15.05  ? 32   ILE A O   1 
ATOM   227  C  CB  . ILE A 1 32  ? 28.772 57.955 52.197 1.00 14.77  ? 32   ILE A CB  1 
ATOM   228  C  CG1 . ILE A 1 32  ? 29.610 57.506 50.983 1.00 16.09  ? 32   ILE A CG1 1 
ATOM   229  C  CG2 . ILE A 1 32  ? 28.311 59.384 52.029 1.00 16.66  ? 32   ILE A CG2 1 
ATOM   230  C  CD1 . ILE A 1 32  ? 28.879 57.585 49.675 1.00 20.35  ? 32   ILE A CD1 1 
ATOM   231  N  N   . LEU A 1 33  ? 29.332 59.182 55.431 1.00 15.70  ? 33   LEU A N   1 
ATOM   232  C  CA  . LEU A 1 33  ? 28.640 59.796 56.569 1.00 15.23  ? 33   LEU A CA  1 
ATOM   233  C  C   . LEU A 1 33  ? 27.691 60.856 56.011 1.00 16.29  ? 33   LEU A C   1 
ATOM   234  O  O   . LEU A 1 33  ? 28.075 62.023 55.937 1.00 17.94  ? 33   LEU A O   1 
ATOM   235  C  CB  . LEU A 1 33  ? 29.642 60.366 57.561 1.00 14.84  ? 33   LEU A CB  1 
ATOM   236  C  CG  . LEU A 1 33  ? 30.578 59.325 58.194 1.00 14.90  ? 33   LEU A CG  1 
ATOM   237  C  CD1 . LEU A 1 33  ? 31.655 59.999 59.029 1.00 17.43  ? 33   LEU A CD1 1 
ATOM   238  C  CD2 . LEU A 1 33  ? 29.795 58.305 59.009 1.00 18.71  ? 33   LEU A CD2 1 
ATOM   239  N  N   . TYR A 1 34  ? 26.504 60.426 55.588 1.00 16.01  ? 34   TYR A N   1 
ATOM   240  C  CA  . TYR A 1 34  ? 25.583 61.234 54.779 1.00 15.86  ? 34   TYR A CA  1 
ATOM   241  C  C   . TYR A 1 34  ? 25.190 62.512 55.508 1.00 15.43  ? 34   TYR A C   1 
ATOM   242  O  O   . TYR A 1 34  ? 24.751 63.462 54.820 1.00 18.42  ? 34   TYR A O   1 
ATOM   243  C  CB  . TYR A 1 34  ? 24.371 60.388 54.282 1.00 15.36  ? 34   TYR A CB  1 
ATOM   244  C  CG  . TYR A 1 34  ? 23.448 60.114 55.446 1.00 14.69  ? 34   TYR A CG  1 
ATOM   245  C  CD1 . TYR A 1 34  ? 22.372 60.925 55.809 1.00 15.93  ? 34   TYR A CD1 1 
ATOM   246  C  CD2 . TYR A 1 34  ? 23.706 58.975 56.223 1.00 16.07  ? 34   TYR A CD2 1 
ATOM   247  C  CE1 . TYR A 1 34  ? 21.546 60.686 56.879 1.00 15.91  ? 34   TYR A CE1 1 
ATOM   248  C  CE2 . TYR A 1 34  ? 22.865 58.762 57.307 1.00 15.10  ? 34   TYR A CE2 1 
ATOM   249  C  CZ  . TYR A 1 34  ? 21.816 59.556 57.650 1.00 15.38  ? 34   TYR A CZ  1 
ATOM   250  O  OH  . TYR A 1 34  ? 21.022 59.275 58.731 1.00 16.98  ? 34   TYR A OH  1 
ATOM   251  N  N   . LEU A 1 35  ? 25.260 62.541 56.842 1.00 15.48  ? 35   LEU A N   1 
ATOM   252  C  CA  . LEU A 1 35  ? 24.853 63.763 57.525 1.00 16.64  ? 35   LEU A CA  1 
ATOM   253  C  C   . LEU A 1 35  ? 25.795 64.911 57.192 1.00 16.76  ? 35   LEU A C   1 
ATOM   254  O  O   . LEU A 1 35  ? 25.358 66.061 57.128 1.00 20.56  ? 35   LEU A O   1 
ATOM   255  C  CB  . LEU A 1 35  ? 24.736 63.576 59.033 1.00 15.00  ? 35   LEU A CB  1 
ATOM   256  C  CG  . LEU A 1 35  ? 23.713 62.558 59.527 1.00 16.77  ? 35   LEU A CG  1 
ATOM   257  C  CD1 . LEU A 1 35  ? 23.959 62.185 60.980 1.00 25.21  ? 35   LEU A CD1 1 
ATOM   258  C  CD2 . LEU A 1 35  ? 22.278 63.081 59.378 1.00 20.04  ? 35   LEU A CD2 1 
ATOM   259  N  N   . GLU A 1 36  ? 27.052 64.583 56.972 1.00 17.47  ? 36   GLU A N   1 
ATOM   260  C  CA  . GLU A 1 36  ? 28.082 65.587 56.694 1.00 22.40  ? 36   GLU A CA  1 
ATOM   261  C  C   . GLU A 1 36  ? 28.430 65.632 55.208 1.00 21.71  ? 36   GLU A C   1 
ATOM   262  O  O   . GLU A 1 36  ? 28.885 66.676 54.734 1.00 25.38  ? 36   GLU A O   1 
ATOM   263  C  CB  A GLU A 1 36  ? 29.352 65.264 57.469 0.44 26.38  ? 36   GLU A CB  1 
ATOM   264  C  CB  B GLU A 1 36  ? 29.311 65.363 57.553 0.56 25.88  ? 36   GLU A CB  1 
ATOM   265  C  CG  A GLU A 1 36  ? 29.259 65.034 58.964 0.44 29.70  ? 36   GLU A CG  1 
ATOM   266  C  CG  B GLU A 1 36  ? 30.086 64.087 57.334 0.56 28.95  ? 36   GLU A CG  1 
ATOM   267  C  CD  A GLU A 1 36  ? 30.594 64.587 59.540 0.44 31.34  ? 36   GLU A CD  1 
ATOM   268  C  CD  B GLU A 1 36  ? 31.105 63.851 58.443 0.56 28.68  ? 36   GLU A CD  1 
ATOM   269  O  OE1 A GLU A 1 36  ? 30.692 64.207 60.728 0.44 31.91  ? 36   GLU A OE1 1 
ATOM   270  O  OE1 B GLU A 1 36  ? 30.679 63.771 59.619 0.56 33.98  ? 36   GLU A OE1 1 
ATOM   271  O  OE2 A GLU A 1 36  ? 31.595 64.612 58.784 0.44 34.21  ? 36   GLU A OE2 1 
ATOM   272  O  OE2 B GLU A 1 36  ? 32.320 63.753 58.146 0.56 32.54  ? 36   GLU A OE2 1 
ATOM   273  N  N   . ASN A 1 37  ? 28.194 64.504 54.549 1.00 19.38  ? 37   ASN A N   1 
ATOM   274  C  CA  . ASN A 1 37  ? 28.531 64.309 53.135 1.00 19.96  ? 37   ASN A CA  1 
ATOM   275  C  C   . ASN A 1 37  ? 27.369 63.735 52.341 1.00 19.96  ? 37   ASN A C   1 
ATOM   276  O  O   . ASN A 1 37  ? 27.464 62.591 51.876 1.00 16.91  ? 37   ASN A O   1 
ATOM   277  C  CB  . ASN A 1 37  ? 29.763 63.430 52.992 1.00 23.54  ? 37   ASN A CB  1 
ATOM   278  C  CG  . ASN A 1 37  ? 31.006 64.117 53.515 1.00 28.89  ? 37   ASN A CG  1 
ATOM   279  O  OD1 . ASN A 1 37  ? 31.423 65.184 53.046 1.00 36.62  ? 37   ASN A OD1 1 
ATOM   280  N  ND2 . ASN A 1 37  ? 31.621 63.508 54.517 1.00 32.57  ? 37   ASN A ND2 1 
ATOM   281  N  N   . PRO A 1 38  ? 26.259 64.466 52.216 1.00 18.92  ? 38   PRO A N   1 
ATOM   282  C  CA  . PRO A 1 38  ? 25.094 63.850 51.549 1.00 18.75  ? 38   PRO A CA  1 
ATOM   283  C  C   . PRO A 1 38  ? 25.337 63.635 50.067 1.00 16.20  ? 38   PRO A C   1 
ATOM   284  O  O   . PRO A 1 38  ? 26.161 64.292 49.441 1.00 18.97  ? 38   PRO A O   1 
ATOM   285  C  CB  . PRO A 1 38  ? 24.017 64.926 51.727 1.00 20.51  ? 38   PRO A CB  1 
ATOM   286  C  CG  . PRO A 1 38  ? 24.783 66.217 51.821 1.00 20.68  ? 38   PRO A CG  1 
ATOM   287  C  CD  . PRO A 1 38  ? 26.001 65.848 52.629 1.00 19.59  ? 38   PRO A CD  1 
ATOM   288  N  N   . PRO A 1 39  ? 24.535 62.776 49.478 1.00 17.41  ? 39   PRO A N   1 
ATOM   289  C  CA  . PRO A 1 39  ? 24.607 62.556 48.038 1.00 16.78  ? 39   PRO A CA  1 
ATOM   290  C  C   . PRO A 1 39  ? 24.223 63.845 47.321 1.00 17.18  ? 39   PRO A C   1 
ATOM   291  O  O   . PRO A 1 39  ? 23.518 64.722 47.833 1.00 18.20  ? 39   PRO A O   1 
ATOM   292  C  CB  . PRO A 1 39  ? 23.533 61.507 47.821 1.00 19.04  ? 39   PRO A CB  1 
ATOM   293  C  CG  . PRO A 1 39  ? 22.569 61.707 48.951 1.00 17.87  ? 39   PRO A CG  1 
ATOM   294  C  CD  . PRO A 1 39  ? 23.443 62.038 50.112 1.00 18.40  ? 39   PRO A CD  1 
ATOM   295  N  N   . SER A 1 40  ? 24.679 63.977 46.068 1.00 17.81  ? 40   SER A N   1 
ATOM   296  C  CA  . SER A 1 40  ? 24.206 65.097 45.261 1.00 17.50  ? 40   SER A CA  1 
ATOM   297  C  C   . SER A 1 40  ? 22.768 64.846 44.815 1.00 16.96  ? 40   SER A C   1 
ATOM   298  O  O   . SER A 1 40  ? 22.228 63.755 44.988 1.00 16.26  ? 40   SER A O   1 
ATOM   299  C  CB  . SER A 1 40  ? 25.053 65.261 44.017 1.00 20.16  ? 40   SER A CB  1 
ATOM   300  O  OG  . SER A 1 40  ? 24.899 64.119 43.207 1.00 19.29  ? 40   SER A OG  1 
ATOM   301  N  N   . ARG A 1 41  ? 22.121 65.847 44.222 1.00 16.47  ? 41   ARG A N   1 
ATOM   302  C  CA  . ARG A 1 41  ? 20.740 65.615 43.777 1.00 16.63  ? 41   ARG A CA  1 
ATOM   303  C  C   . ARG A 1 41  ? 20.630 64.480 42.787 1.00 16.74  ? 41   ARG A C   1 
ATOM   304  O  O   . ARG A 1 41  ? 19.752 63.616 42.931 1.00 17.73  ? 41   ARG A O   1 
ATOM   305  C  CB  . ARG A 1 41  ? 20.155 66.908 43.188 1.00 17.43  ? 41   ARG A CB  1 
ATOM   306  C  CG  . ARG A 1 41  ? 18.676 66.947 42.942 1.00 19.36  ? 41   ARG A CG  1 
ATOM   307  C  CD  . ARG A 1 41  ? 18.104 68.310 42.631 1.00 18.48  ? 41   ARG A CD  1 
ATOM   308  N  NE  . ARG A 1 41  ? 16.689 68.429 43.032 1.00 18.18  ? 41   ARG A NE  1 
ATOM   309  C  CZ  . ARG A 1 41  ? 15.711 67.752 42.484 1.00 16.43  ? 41   ARG A CZ  1 
ATOM   310  N  NH1 . ARG A 1 41  ? 15.890 66.876 41.496 1.00 19.32  ? 41   ARG A NH1 1 
ATOM   311  N  NH2 . ARG A 1 41  ? 14.476 67.928 42.920 1.00 17.08  ? 41   ARG A NH2 1 
ATOM   312  N  N   . ASP A 1 42  ? 21.498 64.439 41.775 1.00 18.88  ? 42   ASP A N   1 
ATOM   313  C  CA  . ASP A 1 42  ? 21.402 63.344 40.812 1.00 19.14  ? 42   ASP A CA  1 
ATOM   314  C  C   . ASP A 1 42  ? 21.544 61.977 41.453 1.00 20.14  ? 42   ASP A C   1 
ATOM   315  O  O   . ASP A 1 42  ? 20.901 60.979 41.154 1.00 20.27  ? 42   ASP A O   1 
ATOM   316  C  CB  . ASP A 1 42  ? 22.494 63.540 39.748 1.00 26.14  ? 42   ASP A CB  1 
ATOM   317  C  CG  . ASP A 1 42  ? 22.157 64.635 38.774 1.00 29.09  ? 42   ASP A CG  1 
ATOM   318  O  OD1 . ASP A 1 42  ? 21.020 65.140 38.797 1.00 34.98  ? 42   ASP A OD1 1 
ATOM   319  O  OD2 . ASP A 1 42  ? 23.064 64.969 37.984 1.00 37.12  ? 42   ASP A OD2 1 
ATOM   320  N  N   . GLU A 1 43  ? 22.425 61.812 42.414 1.00 19.65  ? 43   GLU A N   1 
ATOM   321  C  CA  . GLU A 1 43  ? 22.740 60.601 43.130 1.00 18.59  ? 43   GLU A CA  1 
ATOM   322  C  C   . GLU A 1 43  ? 21.536 60.231 44.002 1.00 17.69  ? 43   GLU A C   1 
ATOM   323  O  O   . GLU A 1 43  ? 21.183 59.060 44.029 1.00 18.77  ? 43   GLU A O   1 
ATOM   324  C  CB  A GLU A 1 43  ? 24.003 60.622 43.979 0.51 20.97  ? 43   GLU A CB  1 
ATOM   325  C  CB  B GLU A 1 43  ? 23.982 60.811 44.010 0.49 22.12  ? 43   GLU A CB  1 
ATOM   326  C  CG  A GLU A 1 43  ? 24.436 59.243 44.451 0.51 22.04  ? 43   GLU A CG  1 
ATOM   327  C  CG  B GLU A 1 43  ? 25.335 61.034 43.379 0.49 17.49  ? 43   GLU A CG  1 
ATOM   328  C  CD  A GLU A 1 43  ? 24.457 58.147 43.401 0.51 25.66  ? 43   GLU A CD  1 
ATOM   329  C  CD  B GLU A 1 43  ? 26.535 61.456 44.202 0.49 20.43  ? 43   GLU A CD  1 
ATOM   330  O  OE1 A GLU A 1 43  ? 24.942 58.335 42.261 0.51 31.64  ? 43   GLU A OE1 1 
ATOM   331  O  OE1 B GLU A 1 43  ? 26.504 61.881 45.368 0.49 12.68  ? 43   GLU A OE1 1 
ATOM   332  O  OE2 A GLU A 1 43  ? 23.979 57.049 43.725 0.51 27.27  ? 43   GLU A OE2 1 
ATOM   333  O  OE2 B GLU A 1 43  ? 27.669 61.371 43.655 0.49 25.38  ? 43   GLU A OE2 1 
ATOM   334  N  N   . LEU A 1 44  ? 20.980 61.243 44.669 1.00 17.60  ? 44   LEU A N   1 
ATOM   335  C  CA  . LEU A 1 44  ? 19.815 60.945 45.500 1.00 16.56  ? 44   LEU A CA  1 
ATOM   336  C  C   . LEU A 1 44  ? 18.639 60.495 44.641 1.00 17.75  ? 44   LEU A C   1 
ATOM   337  O  O   . LEU A 1 44  ? 17.970 59.530 45.010 1.00 17.17  ? 44   LEU A O   1 
ATOM   338  C  CB  . LEU A 1 44  ? 19.479 62.161 46.347 1.00 16.77  ? 44   LEU A CB  1 
ATOM   339  C  CG  . LEU A 1 44  ? 18.278 61.958 47.292 1.00 17.90  ? 44   LEU A CG  1 
ATOM   340  C  CD1 . LEU A 1 44  ? 18.464 60.758 48.214 1.00 18.61  ? 44   LEU A CD1 1 
ATOM   341  C  CD2 . LEU A 1 44  ? 18.065 63.241 48.064 1.00 17.39  ? 44   LEU A CD2 1 
ATOM   342  N  N   . VAL A 1 45  ? 18.400 61.133 43.496 1.00 17.31  ? 45   VAL A N   1 
ATOM   343  C  CA  . VAL A 1 45  ? 17.324 60.691 42.609 1.00 18.46  ? 45   VAL A CA  1 
ATOM   344  C  C   . VAL A 1 45  ? 17.532 59.252 42.173 1.00 18.80  ? 45   VAL A C   1 
ATOM   345  O  O   . VAL A 1 45  ? 16.618 58.421 42.142 1.00 19.11  ? 45   VAL A O   1 
ATOM   346  C  CB  . VAL A 1 45  ? 17.215 61.651 41.396 1.00 21.80  ? 45   VAL A CB  1 
ATOM   347  C  CG1 . VAL A 1 45  ? 16.326 61.064 40.310 1.00 23.75  ? 45   VAL A CG1 1 
ATOM   348  C  CG2 . VAL A 1 45  ? 16.718 63.027 41.859 1.00 23.94  ? 45   VAL A CG2 1 
ATOM   349  N  N   . LYS A 1 46  ? 18.777 58.903 41.848 1.00 19.12  ? 46   LYS A N   1 
ATOM   350  C  CA  . LYS A 1 46  ? 19.102 57.537 41.456 1.00 18.96  ? 46   LYS A CA  1 
ATOM   351  C  C   . LYS A 1 46  ? 18.907 56.519 42.574 1.00 16.72  ? 46   LYS A C   1 
ATOM   352  O  O   . LYS A 1 46  ? 18.367 55.428 42.373 1.00 19.38  ? 46   LYS A O   1 
ATOM   353  C  CB  . LYS A 1 46  ? 20.560 57.475 40.971 1.00 23.41  ? 46   LYS A CB  1 
ATOM   354  C  CG  . LYS A 1 46  ? 21.018 56.093 40.527 1.00 27.20  ? 46   LYS A CG  1 
ATOM   355  C  CD  . LYS A 1 46  ? 22.439 56.119 39.965 1.00 31.18  ? 46   LYS A CD  1 
ATOM   356  C  CE  . LYS A 1 46  ? 23.020 54.719 39.821 1.00 35.80  ? 46   LYS A CE  1 
ATOM   357  N  NZ  . LYS A 1 46  ? 22.043 53.794 39.182 1.00 48.38  ? 46   LYS A NZ  1 
ATOM   358  N  N   . LEU A 1 47  ? 19.353 56.881 43.768 1.00 17.94  ? 47   LEU A N   1 
ATOM   359  C  CA  . LEU A 1 47  ? 19.186 55.988 44.918 1.00 17.29  ? 47   LEU A CA  1 
ATOM   360  C  C   . LEU A 1 47  ? 17.703 55.681 45.136 1.00 17.43  ? 47   LEU A C   1 
ATOM   361  O  O   . LEU A 1 47  ? 17.291 54.535 45.346 1.00 17.30  ? 47   LEU A O   1 
ATOM   362  C  CB  . LEU A 1 47  ? 19.779 56.591 46.185 1.00 15.41  ? 47   LEU A CB  1 
ATOM   363  C  CG  . LEU A 1 47  ? 21.294 56.749 46.269 1.00 14.65  ? 47   LEU A CG  1 
ATOM   364  C  CD1 . LEU A 1 47  ? 21.697 57.678 47.424 1.00 17.18  ? 47   LEU A CD1 1 
ATOM   365  C  CD2 . LEU A 1 47  ? 22.009 55.408 46.393 1.00 17.39  ? 47   LEU A CD2 1 
ATOM   366  N  N   . ILE A 1 48  ? 16.878 56.733 45.077 1.00 17.56  ? 48   ILE A N   1 
ATOM   367  C  CA  . ILE A 1 48  ? 15.450 56.483 45.293 1.00 17.58  ? 48   ILE A CA  1 
ATOM   368  C  C   . ILE A 1 48  ? 14.853 55.600 44.224 1.00 17.12  ? 48   ILE A C   1 
ATOM   369  O  O   . ILE A 1 48  ? 14.078 54.658 44.492 1.00 20.26  ? 48   ILE A O   1 
ATOM   370  C  CB  . ILE A 1 48  ? 14.758 57.865 45.386 1.00 16.43  ? 48   ILE A CB  1 
ATOM   371  C  CG1 . ILE A 1 48  ? 15.131 58.631 46.653 1.00 17.16  ? 48   ILE A CG1 1 
ATOM   372  C  CG2 . ILE A 1 48  ? 13.248 57.756 45.239 1.00 18.74  ? 48   ILE A CG2 1 
ATOM   373  C  CD1 . ILE A 1 48  ? 14.800 60.095 46.589 1.00 19.11  ? 48   ILE A CD1 1 
ATOM   374  N  N   . ALA A 1 49  ? 15.189 55.865 42.960 1.00 19.57  ? 49   ALA A N   1 
ATOM   375  C  CA  . ALA A 1 49  ? 14.708 55.014 41.882 1.00 20.68  ? 49   ALA A CA  1 
ATOM   376  C  C   . ALA A 1 49  ? 15.124 53.554 42.102 1.00 20.06  ? 49   ALA A C   1 
ATOM   377  O  O   . ALA A 1 49  ? 14.310 52.634 41.998 1.00 24.87  ? 49   ALA A O   1 
ATOM   378  C  CB  . ALA A 1 49  ? 15.215 55.489 40.531 1.00 22.38  ? 49   ALA A CB  1 
ATOM   379  N  N   . ASP A 1 50  ? 16.403 53.363 42.439 1.00 19.13  ? 50   ASP A N   1 
ATOM   380  C  CA  . ASP A 1 50  ? 16.915 52.006 42.601 1.00 19.01  ? 50   ASP A CA  1 
ATOM   381  C  C   . ASP A 1 50  ? 16.303 51.307 43.813 1.00 19.14  ? 50   ASP A C   1 
ATOM   382  O  O   . ASP A 1 50  ? 16.167 50.087 43.778 1.00 22.18  ? 50   ASP A O   1 
ATOM   383  C  CB  . ASP A 1 50  ? 18.430 51.983 42.684 1.00 19.14  ? 50   ASP A CB  1 
ATOM   384  C  CG  . ASP A 1 50  ? 19.104 52.363 41.384 1.00 20.73  ? 50   ASP A CG  1 
ATOM   385  O  OD1 . ASP A 1 50  ? 20.336 52.526 41.349 1.00 23.25  ? 50   ASP A OD1 1 
ATOM   386  O  OD2 . ASP A 1 50  ? 18.404 52.498 40.367 1.00 22.84  ? 50   ASP A OD2 1 
ATOM   387  N  N   . MET A 1 51  ? 15.925 52.067 44.835 1.00 19.20  ? 51   MET A N   1 
ATOM   388  C  CA  . MET A 1 51  ? 15.374 51.497 46.048 1.00 20.61  ? 51   MET A CA  1 
ATOM   389  C  C   . MET A 1 51  ? 13.935 51.025 45.883 1.00 24.99  ? 51   MET A C   1 
ATOM   390  O  O   . MET A 1 51  ? 13.412 50.217 46.678 1.00 25.92  ? 51   MET A O   1 
ATOM   391  C  CB  . MET A 1 51  ? 15.450 52.519 47.199 1.00 20.60  ? 51   MET A CB  1 
ATOM   392  C  CG  . MET A 1 51  ? 16.862 52.560 47.780 1.00 22.39  ? 51   MET A CG  1 
ATOM   393  S  SD  . MET A 1 51  ? 16.887 53.527 49.301 1.00 22.22  ? 51   MET A SD  1 
ATOM   394  C  CE  . MET A 1 51  ? 16.790 55.188 48.704 1.00 21.17  ? 51   MET A CE  1 
ATOM   395  N  N   . GLY A 1 52  ? 13.372 51.566 44.812 1.00 23.90  ? 52   GLY A N   1 
ATOM   396  C  CA  . GLY A 1 52  ? 11.997 51.305 44.456 1.00 28.19  ? 52   GLY A CA  1 
ATOM   397  C  C   . GLY A 1 52  ? 11.004 51.682 45.535 1.00 28.98  ? 52   GLY A C   1 
ATOM   398  O  O   . GLY A 1 52  ? 9.934  51.084 45.688 1.00 35.22  ? 52   GLY A O   1 
ATOM   399  N  N   . ILE A 1 53  ? 11.285 52.702 46.327 1.00 23.15  ? 53   ILE A N   1 
ATOM   400  C  CA  . ILE A 1 53  ? 10.302 53.258 47.250 1.00 19.87  ? 53   ILE A CA  1 
ATOM   401  C  C   . ILE A 1 53  ? 9.934  54.672 46.843 1.00 17.18  ? 53   ILE A C   1 
ATOM   402  O  O   . ILE A 1 53  ? 10.563 55.295 45.992 1.00 21.61  ? 53   ILE A O   1 
ATOM   403  C  CB  . ILE A 1 53  ? 10.876 53.264 48.678 1.00 21.84  ? 53   ILE A CB  1 
ATOM   404  C  CG1 . ILE A 1 53  ? 12.099 54.181 48.789 1.00 22.81  ? 53   ILE A CG1 1 
ATOM   405  C  CG2 . ILE A 1 53  ? 11.140 51.854 49.134 1.00 21.81  ? 53   ILE A CG2 1 
ATOM   406  C  CD1 . ILE A 1 53  ? 12.735 54.184 50.171 1.00 23.66  ? 53   ILE A CD1 1 
ATOM   407  N  N   . SER A 1 54  ? 8.913  55.211 47.492 1.00 16.93  ? 54   SER A N   1 
ATOM   408  C  CA  . SER A 1 54  ? 8.548  56.584 47.205 1.00 17.96  ? 54   SER A CA  1 
ATOM   409  C  C   . SER A 1 54  ? 9.506  57.567 47.845 1.00 17.68  ? 54   SER A C   1 
ATOM   410  O  O   . SER A 1 54  ? 10.202 57.187 48.777 1.00 18.26  ? 54   SER A O   1 
ATOM   411  C  CB  . SER A 1 54  ? 7.128  56.828 47.725 1.00 18.02  ? 54   SER A CB  1 
ATOM   412  O  OG  . SER A 1 54  ? 7.117  56.884 49.137 1.00 19.41  ? 54   SER A OG  1 
ATOM   413  N  N   . VAL A 1 55  ? 9.548  58.806 47.351 1.00 16.51  ? 55   VAL A N   1 
ATOM   414  C  CA  . VAL A 1 55  ? 10.357 59.815 47.995 1.00 15.65  ? 55   VAL A CA  1 
ATOM   415  C  C   . VAL A 1 55  ? 9.910  59.965 49.444 1.00 15.42  ? 55   VAL A C   1 
ATOM   416  O  O   . VAL A 1 55  ? 10.727 60.009 50.362 1.00 17.22  ? 55   VAL A O   1 
ATOM   417  C  CB  . VAL A 1 55  ? 10.273 61.155 47.248 1.00 16.93  ? 55   VAL A CB  1 
ATOM   418  C  CG1 . VAL A 1 55  ? 11.015 62.226 48.026 1.00 18.14  ? 55   VAL A CG1 1 
ATOM   419  C  CG2 . VAL A 1 55  ? 10.824 61.079 45.825 1.00 20.52  ? 55   VAL A CG2 1 
ATOM   420  N  N   . ARG A 1 56  ? 8.609  60.033 49.715 1.00 16.55  ? 56   ARG A N   1 
ATOM   421  C  CA  . ARG A 1 56  ? 8.152  60.265 51.082 1.00 15.58  ? 56   ARG A CA  1 
ATOM   422  C  C   . ARG A 1 56  ? 8.555  59.115 51.983 1.00 16.19  ? 56   ARG A C   1 
ATOM   423  O  O   . ARG A 1 56  ? 8.819  59.366 53.162 1.00 19.01  ? 56   ARG A O   1 
ATOM   424  C  CB  . ARG A 1 56  ? 6.641  60.488 51.160 1.00 17.32  ? 56   ARG A CB  1 
ATOM   425  C  CG  . ARG A 1 56  ? 6.097  60.651 52.564 1.00 18.19  ? 56   ARG A CG  1 
ATOM   426  C  CD  . ARG A 1 56  ? 4.633  61.082 52.543 1.00 20.77  ? 56   ARG A CD  1 
ATOM   427  N  NE  . ARG A 1 56  ? 4.538  62.496 52.179 1.00 17.74  ? 56   ARG A NE  1 
ATOM   428  C  CZ  . ARG A 1 56  ? 4.741  63.439 53.099 1.00 17.68  ? 56   ARG A CZ  1 
ATOM   429  N  NH1 . ARG A 1 56  ? 4.647  64.693 52.751 1.00 17.00  ? 56   ARG A NH1 1 
ATOM   430  N  NH2 . ARG A 1 56  ? 5.034  63.200 54.372 1.00 18.15  ? 56   ARG A NH2 1 
ATOM   431  N  N   . ALA A 1 57  ? 8.592  57.905 51.444 1.00 17.72  ? 57   ALA A N   1 
ATOM   432  C  CA  . ALA A 1 57  ? 9.003  56.762 52.244 1.00 16.64  ? 57   ALA A CA  1 
ATOM   433  C  C   . ALA A 1 57  ? 10.436 56.908 52.736 1.00 18.58  ? 57   ALA A C   1 
ATOM   434  O  O   . ALA A 1 57  ? 10.844 56.295 53.740 1.00 18.90  ? 57   ALA A O   1 
ATOM   435  C  CB  . ALA A 1 57  ? 8.851  55.491 51.420 1.00 20.44  ? 57   ALA A CB  1 
ATOM   436  N  N   . LEU A 1 58  ? 11.267 57.708 52.064 1.00 17.17  ? 58   LEU A N   1 
ATOM   437  C  CA  . LEU A 1 58  ? 12.635 57.889 52.554 1.00 15.36  ? 58   LEU A CA  1 
ATOM   438  C  C   . LEU A 1 58  ? 12.760 58.944 53.634 1.00 15.89  ? 58   LEU A C   1 
ATOM   439  O  O   . LEU A 1 58  ? 13.826 59.084 54.259 1.00 17.09  ? 58   LEU A O   1 
ATOM   440  C  CB  . LEU A 1 58  ? 13.548 58.174 51.356 1.00 16.87  ? 58   LEU A CB  1 
ATOM   441  C  CG  . LEU A 1 58  ? 15.056 58.238 51.565 1.00 15.96  ? 58   LEU A CG  1 
ATOM   442  C  CD1 . LEU A 1 58  ? 15.553 56.939 52.167 1.00 17.40  ? 58   LEU A CD1 1 
ATOM   443  C  CD2 . LEU A 1 58  ? 15.777 58.554 50.270 1.00 17.33  ? 58   LEU A CD2 1 
ATOM   444  N  N   . LEU A 1 59  ? 11.698 59.709 53.901 1.00 15.30  ? 59   LEU A N   1 
ATOM   445  C  CA  . LEU A 1 59  ? 11.825 60.773 54.881 1.00 14.81  ? 59   LEU A CA  1 
ATOM   446  C  C   . LEU A 1 59  ? 11.926 60.233 56.302 1.00 16.52  ? 59   LEU A C   1 
ATOM   447  O  O   . LEU A 1 59  ? 11.101 59.442 56.739 1.00 19.81  ? 59   LEU A O   1 
ATOM   448  C  CB  . LEU A 1 59  ? 10.628 61.725 54.883 1.00 17.53  ? 59   LEU A CB  1 
ATOM   449  C  CG  . LEU A 1 59  ? 10.462 62.667 53.722 1.00 20.41  ? 59   LEU A CG  1 
ATOM   450  C  CD1 . LEU A 1 59  ? 9.111  63.371 53.818 1.00 18.91  ? 59   LEU A CD1 1 
ATOM   451  C  CD2 . LEU A 1 59  ? 11.609 63.688 53.670 1.00 23.02  ? 59   LEU A CD2 1 
ATOM   452  N  N   . LYS A 1 60  ? 12.924 60.707 57.027 1.00 15.42  ? 60   LYS A N   1 
ATOM   453  C  CA  . LYS A 1 60  ? 13.034 60.443 58.451 1.00 16.81  ? 60   LYS A CA  1 
ATOM   454  C  C   . LYS A 1 60  ? 12.137 61.384 59.250 1.00 18.73  ? 60   LYS A C   1 
ATOM   455  O  O   . LYS A 1 60  ? 12.235 62.598 59.110 1.00 16.65  ? 60   LYS A O   1 
ATOM   456  C  CB  . LYS A 1 60  ? 14.488 60.642 58.833 1.00 21.12  ? 60   LYS A CB  1 
ATOM   457  C  CG  . LYS A 1 60  ? 14.802 60.614 60.301 1.00 22.60  ? 60   LYS A CG  1 
ATOM   458  C  CD  . LYS A 1 60  ? 15.267 59.308 60.851 1.00 25.31  ? 60   LYS A CD  1 
ATOM   459  C  CE  . LYS A 1 60  ? 15.472 59.526 62.368 1.00 26.05  ? 60   LYS A CE  1 
ATOM   460  N  NZ  . LYS A 1 60  ? 14.345 58.936 63.096 1.00 25.88  ? 60   LYS A NZ  1 
ATOM   461  N  N   . LYS A 1 61  ? 11.277 60.809 60.073 1.00 18.19  ? 61   LYS A N   1 
ATOM   462  C  CA  . LYS A 1 61  ? 10.426 61.574 60.964 1.00 20.50  ? 61   LYS A CA  1 
ATOM   463  C  C   . LYS A 1 61  ? 11.157 61.902 62.247 1.00 22.54  ? 61   LYS A C   1 
ATOM   464  O  O   . LYS A 1 61  ? 12.297 61.515 62.527 1.00 22.97  ? 61   LYS A O   1 
ATOM   465  C  CB  . LYS A 1 61  ? 9.171  60.735 61.240 1.00 21.35  ? 61   LYS A CB  1 
ATOM   466  C  CG  . LYS A 1 61  ? 8.477  60.271 59.953 1.00 21.71  ? 61   LYS A CG  1 
ATOM   467  C  CD  . LYS A 1 61  ? 7.165  59.587 60.321 1.00 26.12  ? 61   LYS A CD  1 
ATOM   468  C  CE  . LYS A 1 61  ? 6.427  59.022 59.136 1.00 30.67  ? 61   LYS A CE  1 
ATOM   469  N  NZ  . LYS A 1 61  ? 5.062  58.503 59.479 1.00 46.97  ? 61   LYS A NZ  1 
ATOM   470  N  N   . ASN A 1 62  ? 10.575 62.635 63.148 1.00 20.48  ? 62   ASN A N   1 
ATOM   471  C  CA  . ASN A 1 62  ? 11.055 62.871 64.514 1.00 17.50  ? 62   ASN A CA  1 
ATOM   472  C  C   . ASN A 1 62  ? 12.444 63.512 64.532 1.00 16.77  ? 62   ASN A C   1 
ATOM   473  O  O   . ASN A 1 62  ? 13.237 63.237 65.427 1.00 17.20  ? 62   ASN A O   1 
ATOM   474  C  CB  A ASN A 1 62  ? 11.057 61.580 65.333 0.26 20.07  ? 62   ASN A CB  1 
ATOM   475  C  CB  B ASN A 1 62  ? 11.044 61.617 65.384 0.74 19.48  ? 62   ASN A CB  1 
ATOM   476  C  CG  A ASN A 1 62  ? 12.235 60.654 65.181 0.26 21.06  ? 62   ASN A CG  1 
ATOM   477  C  CG  B ASN A 1 62  ? 11.180 61.927 66.874 0.74 19.10  ? 62   ASN A CG  1 
ATOM   478  O  OD1 A ASN A 1 62  ? 12.333 59.930 64.186 0.26 28.09  ? 62   ASN A OD1 1 
ATOM   479  O  OD1 B ASN A 1 62  ? 10.760 62.957 67.406 0.74 18.17  ? 62   ASN A OD1 1 
ATOM   480  N  ND2 A ASN A 1 62  ? 13.198 60.639 66.113 0.26 38.17  ? 62   ASN A ND2 1 
ATOM   481  N  ND2 B ASN A 1 62  ? 11.789 60.977 67.595 0.74 22.19  ? 62   ASN A ND2 1 
ATOM   482  N  N   . VAL A 1 63  ? 12.652 64.381 63.551 1.00 15.67  ? 63   VAL A N   1 
ATOM   483  C  CA  . VAL A 1 63  ? 13.829 65.225 63.483 1.00 13.98  ? 63   VAL A CA  1 
ATOM   484  C  C   . VAL A 1 63  ? 13.402 66.674 63.203 1.00 14.91  ? 63   VAL A C   1 
ATOM   485  O  O   . VAL A 1 63  ? 12.341 66.940 62.647 1.00 14.99  ? 63   VAL A O   1 
ATOM   486  C  CB  . VAL A 1 63  ? 14.890 64.748 62.488 1.00 14.60  ? 63   VAL A CB  1 
ATOM   487  C  CG1 . VAL A 1 63  ? 15.414 63.358 62.869 1.00 16.75  ? 63   VAL A CG1 1 
ATOM   488  C  CG2 . VAL A 1 63  ? 14.357 64.715 61.077 1.00 15.45  ? 63   VAL A CG2 1 
ATOM   489  N  N   . GLU A 1 64  ? 14.251 67.605 63.628 1.00 14.74  ? 64   GLU A N   1 
ATOM   490  C  CA  . GLU A 1 64  ? 13.855 69.015 63.697 1.00 13.71  ? 64   GLU A CA  1 
ATOM   491  C  C   . GLU A 1 64  ? 13.311 69.559 62.387 1.00 15.26  ? 64   GLU A C   1 
ATOM   492  O  O   . GLU A 1 64  ? 12.230 70.141 62.426 1.00 15.61  ? 64   GLU A O   1 
ATOM   493  C  CB  . GLU A 1 64  ? 15.022 69.840 64.259 1.00 16.17  ? 64   GLU A CB  1 
ATOM   494  C  CG  . GLU A 1 64  ? 14.665 71.292 64.509 1.00 17.20  ? 64   GLU A CG  1 
ATOM   495  C  CD  . GLU A 1 64  ? 15.650 72.037 65.372 1.00 16.51  ? 64   GLU A CD  1 
ATOM   496  O  OE1 . GLU A 1 64  ? 15.407 73.250 65.580 1.00 20.94  ? 64   GLU A OE1 1 
ATOM   497  O  OE2 . GLU A 1 64  ? 16.653 71.467 65.834 1.00 20.89  ? 64   GLU A OE2 1 
ATOM   498  N  N   . PRO A 1 65  ? 13.974 69.423 61.250 1.00 15.07  ? 65   PRO A N   1 
ATOM   499  C  CA  . PRO A 1 65  ? 13.392 69.950 60.015 1.00 14.12  ? 65   PRO A CA  1 
ATOM   500  C  C   . PRO A 1 65  ? 12.083 69.264 59.609 1.00 13.18  ? 65   PRO A C   1 
ATOM   501  O  O   . PRO A 1 65  ? 11.201 69.903 59.022 1.00 16.06  ? 65   PRO A O   1 
ATOM   502  C  CB  . PRO A 1 65  ? 14.487 69.720 58.968 1.00 14.35  ? 65   PRO A CB  1 
ATOM   503  C  CG  . PRO A 1 65  ? 15.434 68.772 59.567 1.00 20.28  ? 65   PRO A CG  1 
ATOM   504  C  CD  . PRO A 1 65  ? 15.328 68.851 61.051 1.00 17.01  ? 65   PRO A CD  1 
ATOM   505  N  N   . TYR A 1 66  ? 11.902 67.985 59.888 1.00 14.67  ? 66   TYR A N   1 
ATOM   506  C  CA  . TYR A 1 66  ? 10.631 67.309 59.547 1.00 14.08  ? 66   TYR A CA  1 
ATOM   507  C  C   . TYR A 1 66  ? 9.471  67.979 60.256 1.00 14.30  ? 66   TYR A C   1 
ATOM   508  O  O   . TYR A 1 66  ? 8.384  68.225 59.715 1.00 14.51  ? 66   TYR A O   1 
ATOM   509  C  CB  . TYR A 1 66  ? 10.746 65.822 59.889 1.00 15.29  ? 66   TYR A CB  1 
ATOM   510  C  CG  . TYR A 1 66  ? 9.570  65.004 59.469 1.00 16.04  ? 66   TYR A CG  1 
ATOM   511  C  CD1 . TYR A 1 66  ? 8.433  64.865 60.278 1.00 17.31  ? 66   TYR A CD1 1 
ATOM   512  C  CD2 . TYR A 1 66  ? 9.569  64.353 58.254 1.00 17.06  ? 66   TYR A CD2 1 
ATOM   513  C  CE1 . TYR A 1 66  ? 7.370  64.095 59.860 1.00 20.62  ? 66   TYR A CE1 1 
ATOM   514  C  CE2 . TYR A 1 66  ? 8.497  63.585 57.833 1.00 19.89  ? 66   TYR A CE2 1 
ATOM   515  C  CZ  . TYR A 1 66  ? 7.383  63.459 58.641 1.00 22.94  ? 66   TYR A CZ  1 
ATOM   516  O  OH  . TYR A 1 66  ? 6.293  62.709 58.256 1.00 21.63  ? 66   TYR A OH  1 
ATOM   517  N  N   . GLU A 1 67  ? 9.718  68.260 61.534 1.00 15.50  ? 67   GLU A N   1 
ATOM   518  C  CA  . GLU A 1 67  ? 8.753  68.939 62.388 1.00 14.81  ? 67   GLU A CA  1 
ATOM   519  C  C   . GLU A 1 67  ? 8.504  70.363 61.899 1.00 14.37  ? 67   GLU A C   1 
ATOM   520  O  O   . GLU A 1 67  ? 7.344  70.743 61.669 1.00 15.35  ? 67   GLU A O   1 
ATOM   521  C  CB  . GLU A 1 67  ? 9.247  68.930 63.838 1.00 15.96  ? 67   GLU A CB  1 
ATOM   522  C  CG  . GLU A 1 67  ? 9.670  67.589 64.397 1.00 22.59  ? 67   GLU A CG  1 
ATOM   523  C  CD  . GLU A 1 67  ? 8.587  66.576 64.561 1.00 28.26  ? 67   GLU A CD  1 
ATOM   524  O  OE1 . GLU A 1 67  ? 7.417  66.915 64.266 1.00 27.09  ? 67   GLU A OE1 1 
ATOM   525  O  OE2 . GLU A 1 67  ? 8.914  65.444 65.003 1.00 39.03  ? 67   GLU A OE2 1 
ATOM   526  N  N   . GLN A 1 68  ? 9.555  71.150 61.783 1.00 14.69  ? 68   GLN A N   1 
ATOM   527  C  CA  . GLN A 1 68  ? 9.454  72.582 61.606 1.00 15.03  ? 68   GLN A CA  1 
ATOM   528  C  C   . GLN A 1 68  ? 9.037  72.969 60.193 1.00 16.13  ? 68   GLN A C   1 
ATOM   529  O  O   . GLN A 1 68  ? 8.394  74.013 60.024 1.00 16.41  ? 68   GLN A O   1 
ATOM   530  C  CB  . GLN A 1 68  ? 10.758 73.301 61.949 1.00 15.82  ? 68   GLN A CB  1 
ATOM   531  C  CG  . GLN A 1 68  ? 11.080 73.138 63.437 1.00 16.20  ? 68   GLN A CG  1 
ATOM   532  C  CD  . GLN A 1 68  ? 12.355 73.816 63.868 1.00 15.29  ? 68   GLN A CD  1 
ATOM   533  O  OE1 . GLN A 1 68  ? 13.187 74.132 63.024 1.00 17.35  ? 68   GLN A OE1 1 
ATOM   534  N  NE2 . GLN A 1 68  ? 12.550 74.085 65.164 1.00 18.81  ? 68   GLN A NE2 1 
ATOM   535  N  N   . LEU A 1 69  ? 9.405  72.124 59.245 1.00 14.39  ? 69   LEU A N   1 
ATOM   536  C  CA  . LEU A 1 69  ? 8.960  72.306 57.873 1.00 15.33  ? 69   LEU A CA  1 
ATOM   537  C  C   . LEU A 1 69  ? 7.579  71.717 57.603 1.00 14.69  ? 69   LEU A C   1 
ATOM   538  O  O   . LEU A 1 69  ? 7.026  71.859 56.503 1.00 16.53  ? 69   LEU A O   1 
ATOM   539  C  CB  . LEU A 1 69  ? 9.990  71.718 56.887 1.00 17.80  ? 69   LEU A CB  1 
ATOM   540  C  CG  . LEU A 1 69  ? 11.355 72.397 56.912 1.00 15.76  ? 69   LEU A CG  1 
ATOM   541  C  CD1 . LEU A 1 69  ? 12.395 71.539 56.203 1.00 17.51  ? 69   LEU A CD1 1 
ATOM   542  C  CD2 . LEU A 1 69  ? 11.211 73.808 56.334 1.00 19.28  ? 69   LEU A CD2 1 
ATOM   543  N  N   . GLY A 1 70  ? 6.969  71.038 58.562 1.00 16.18  ? 70   GLY A N   1 
ATOM   544  C  CA  . GLY A 1 70  ? 5.617  70.525 58.451 1.00 18.58  ? 70   GLY A CA  1 
ATOM   545  C  C   . GLY A 1 70  ? 5.432  69.376 57.484 1.00 16.66  ? 70   GLY A C   1 
ATOM   546  O  O   . GLY A 1 70  ? 4.349  69.224 56.894 1.00 18.08  ? 70   GLY A O   1 
ATOM   547  N  N   . LEU A 1 71  ? 6.484  68.576 57.336 1.00 15.72  ? 71   LEU A N   1 
ATOM   548  C  CA  . LEU A 1 71  ? 6.551  67.574 56.257 1.00 15.51  ? 71   LEU A CA  1 
ATOM   549  C  C   . LEU A 1 71  ? 5.594  66.417 56.483 1.00 13.23  ? 71   LEU A C   1 
ATOM   550  O  O   . LEU A 1 71  ? 5.338  65.657 55.529 1.00 17.82  ? 71   LEU A O   1 
ATOM   551  C  CB  . LEU A 1 71  ? 7.980  67.105 56.002 1.00 16.17  ? 71   LEU A CB  1 
ATOM   552  C  CG  . LEU A 1 71  ? 9.020  68.188 55.653 1.00 13.63  ? 71   LEU A CG  1 
ATOM   553  C  CD1 . LEU A 1 71  ? 10.365 67.521 55.267 1.00 17.87  ? 71   LEU A CD1 1 
ATOM   554  C  CD2 . LEU A 1 71  ? 8.581  69.143 54.558 1.00 14.99  ? 71   LEU A CD2 1 
ATOM   555  N  N   . ALA A 1 72  ? 5.023  66.281 57.669 1.00 14.59  ? 72   ALA A N   1 
ATOM   556  C  CA  . ALA A 1 72  ? 3.993  65.286 57.872 1.00 18.30  ? 72   ALA A CA  1 
ATOM   557  C  C   . ALA A 1 72  ? 2.784  65.504 56.978 1.00 16.85  ? 72   ALA A C   1 
ATOM   558  O  O   . ALA A 1 72  ? 2.100  64.537 56.609 1.00 21.20  ? 72   ALA A O   1 
ATOM   559  C  CB  . ALA A 1 72  ? 3.515  65.288 59.330 1.00 18.54  ? 72   ALA A CB  1 
ATOM   560  N  N   . GLU A 1 73  ? 2.521  66.764 56.665 1.00 18.53  ? 73   GLU A N   1 
ATOM   561  C  CA  . GLU A 1 73  ? 1.334  67.126 55.905 1.00 16.75  ? 73   GLU A CA  1 
ATOM   562  C  C   . GLU A 1 73  ? 1.572  66.809 54.424 1.00 17.68  ? 73   GLU A C   1 
ATOM   563  O  O   . GLU A 1 73  ? 2.680  66.989 53.895 1.00 16.03  ? 73   GLU A O   1 
ATOM   564  C  CB  . GLU A 1 73  ? 1.012  68.602 56.007 1.00 21.35  ? 73   GLU A CB  1 
ATOM   565  C  CG  . GLU A 1 73  ? 0.659  69.205 57.345 1.00 34.75  ? 73   GLU A CG  1 
ATOM   566  C  CD  . GLU A 1 73  ? 0.367  70.700 57.079 1.00 40.98  ? 73   GLU A CD  1 
ATOM   567  O  OE1 . GLU A 1 73  ? 1.188  71.518 57.520 1.00 64.67  ? 73   GLU A OE1 1 
ATOM   568  O  OE2 . GLU A 1 73  ? -0.627 70.922 56.373 1.00 50.70  ? 73   GLU A OE2 1 
ATOM   569  N  N   . ASP A 1 74  ? 0.514  66.366 53.763 1.00 17.08  ? 74   ASP A N   1 
ATOM   570  C  CA  . ASP A 1 74  ? 0.619  66.035 52.323 1.00 18.99  ? 74   ASP A CA  1 
ATOM   571  C  C   . ASP A 1 74  ? 0.454  67.252 51.440 1.00 17.62  ? 74   ASP A C   1 
ATOM   572  O  O   . ASP A 1 74  ? -0.576 67.443 50.773 1.00 21.94  ? 74   ASP A O   1 
ATOM   573  C  CB  . ASP A 1 74  ? -0.413 64.962 51.983 1.00 24.58  ? 74   ASP A CB  1 
ATOM   574  C  CG  . ASP A 1 74  ? -0.331 64.484 50.567 1.00 22.34  ? 74   ASP A CG  1 
ATOM   575  O  OD1 . ASP A 1 74  ? -1.330 63.913 50.093 1.00 29.81  ? 74   ASP A OD1 1 
ATOM   576  O  OD2 . ASP A 1 74  ? 0.731  64.696 49.937 1.00 25.44  ? 74   ASP A OD2 1 
ATOM   577  N  N   . LYS A 1 75  ? 1.474  68.098 51.422 1.00 15.71  ? 75   LYS A N   1 
ATOM   578  C  CA  . LYS A 1 75  ? 1.433  69.378 50.740 1.00 16.25  ? 75   LYS A CA  1 
ATOM   579  C  C   . LYS A 1 75  ? 2.710  69.591 49.933 1.00 15.26  ? 75   LYS A C   1 
ATOM   580  O  O   . LYS A 1 75  ? 2.985  70.729 49.585 1.00 15.02  ? 75   LYS A O   1 
ATOM   581  C  CB  . LYS A 1 75  ? 1.284  70.555 51.732 1.00 24.59  ? 75   LYS A CB  1 
ATOM   582  C  CG  . LYS A 1 75  ? -0.030 70.603 52.463 1.00 33.80  ? 75   LYS A CG  1 
ATOM   583  C  CD  . LYS A 1 75  ? -0.247 71.826 53.322 1.00 37.93  ? 75   LYS A CD  1 
ATOM   584  C  CE  . LYS A 1 75  ? 0.978  72.662 53.593 1.00 49.86  ? 75   LYS A CE  1 
ATOM   585  N  NZ  . LYS A 1 75  ? 0.637  73.902 54.388 1.00 60.57  ? 75   LYS A NZ  1 
ATOM   586  N  N   . PHE A 1 76  ? 3.445  68.522 49.687 1.00 14.77  ? 76   PHE A N   1 
ATOM   587  C  CA  . PHE A 1 76  ? 4.768  68.634 49.065 1.00 14.14  ? 76   PHE A CA  1 
ATOM   588  C  C   . PHE A 1 76  ? 4.911  67.712 47.891 1.00 15.23  ? 76   PHE A C   1 
ATOM   589  O  O   . PHE A 1 76  ? 4.561  66.528 47.994 1.00 16.81  ? 76   PHE A O   1 
ATOM   590  C  CB  . PHE A 1 76  ? 5.854  68.281 50.103 1.00 16.18  ? 76   PHE A CB  1 
ATOM   591  C  CG  . PHE A 1 76  ? 5.716  69.167 51.325 1.00 15.55  ? 76   PHE A CG  1 
ATOM   592  C  CD1 . PHE A 1 76  ? 5.014  68.726 52.433 1.00 14.50  ? 76   PHE A CD1 1 
ATOM   593  C  CD2 . PHE A 1 76  ? 6.289  70.413 51.382 1.00 17.02  ? 76   PHE A CD2 1 
ATOM   594  C  CE1 . PHE A 1 76  ? 4.883  69.528 53.542 1.00 17.21  ? 76   PHE A CE1 1 
ATOM   595  C  CE2 . PHE A 1 76  ? 6.144  71.256 52.462 1.00 13.98  ? 76   PHE A CE2 1 
ATOM   596  C  CZ  . PHE A 1 76  ? 5.424  70.791 53.551 1.00 16.01  ? 76   PHE A CZ  1 
ATOM   597  N  N   . THR A 1 77  ? 5.406  68.200 46.766 1.00 16.92  ? 77   THR A N   1 
ATOM   598  C  CA  . THR A 1 77  ? 5.670  67.302 45.643 1.00 15.16  ? 77   THR A CA  1 
ATOM   599  C  C   . THR A 1 77  ? 6.917  66.468 45.928 1.00 15.29  ? 77   THR A C   1 
ATOM   600  O  O   . THR A 1 77  ? 7.694  66.777 46.813 1.00 15.44  ? 77   THR A O   1 
ATOM   601  C  CB  . THR A 1 77  ? 5.902  68.030 44.317 1.00 14.64  ? 77   THR A CB  1 
ATOM   602  O  OG1 . THR A 1 77  ? 7.019  68.880 44.495 1.00 14.80  ? 77   THR A OG1 1 
ATOM   603  C  CG2 . THR A 1 77  ? 4.820  69.027 43.949 1.00 16.21  ? 77   THR A CG2 1 
ATOM   604  N  N   . ASP A 1 78  ? 7.101  65.405 45.134 1.00 15.24  ? 78   ASP A N   1 
ATOM   605  C  CA  . ASP A 1 78  ? 8.339  64.650 45.330 1.00 15.90  ? 78   ASP A CA  1 
ATOM   606  C  C   . ASP A 1 78  ? 9.585  65.488 45.203 1.00 14.14  ? 78   ASP A C   1 
ATOM   607  O  O   . ASP A 1 78  ? 10.533 65.297 46.000 1.00 16.35  ? 78   ASP A O   1 
ATOM   608  C  CB  . ASP A 1 78  ? 8.330  63.525 44.309 1.00 17.52  ? 78   ASP A CB  1 
ATOM   609  C  CG  . ASP A 1 78  ? 7.444  62.368 44.697 1.00 18.29  ? 78   ASP A CG  1 
ATOM   610  O  OD1 . ASP A 1 78  ? 7.353  61.439 43.882 1.00 21.52  ? 78   ASP A OD1 1 
ATOM   611  O  OD2 . ASP A 1 78  ? 6.865  62.392 45.801 1.00 20.64  ? 78   ASP A OD2 1 
ATOM   612  N  N   . ASP A 1 79  ? 9.640  66.409 44.241 1.00 14.36  ? 79   ASP A N   1 
ATOM   613  C  CA  . ASP A 1 79  ? 10.906 67.154 44.104 1.00 14.59  ? 79   ASP A CA  1 
ATOM   614  C  C   . ASP A 1 79  ? 11.126 68.150 45.212 1.00 12.98  ? 79   ASP A C   1 
ATOM   615  O  O   . ASP A 1 79  ? 12.227 68.460 45.623 1.00 14.63  ? 79   ASP A O   1 
ATOM   616  C  CB  . ASP A 1 79  ? 10.981 67.848 42.733 1.00 15.29  ? 79   ASP A CB  1 
ATOM   617  C  CG  . ASP A 1 79  ? 11.289 66.797 41.683 1.00 15.71  ? 79   ASP A CG  1 
ATOM   618  O  OD1 . ASP A 1 79  ? 10.375 66.366 40.949 1.00 16.06  ? 79   ASP A OD1 1 
ATOM   619  O  OD2 . ASP A 1 79  ? 12.470 66.420 41.635 1.00 18.84  ? 79   ASP A OD2 1 
ATOM   620  N  N   . GLN A 1 80  ? 10.167 68.785 45.843 1.00 12.82  ? 80   GLN A N   1 
ATOM   621  C  CA  . GLN A 1 80  ? 10.161 69.619 46.999 1.00 12.70  ? 80   GLN A CA  1 
ATOM   622  C  C   . GLN A 1 80  ? 10.770 68.748 48.099 1.00 12.95  ? 80   GLN A C   1 
ATOM   623  O  O   . GLN A 1 80  ? 11.688 69.228 48.761 1.00 13.67  ? 80   GLN A O   1 
ATOM   624  C  CB  . GLN A 1 80  ? 8.786  70.166 47.394 1.00 13.59  ? 80   GLN A CB  1 
ATOM   625  C  CG  . GLN A 1 80  ? 8.285  71.255 46.467 1.00 13.85  ? 80   GLN A CG  1 
ATOM   626  C  CD  . GLN A 1 80  ? 6.861  71.740 46.687 1.00 13.44  ? 80   GLN A CD  1 
ATOM   627  O  OE1 . GLN A 1 80  ? 5.942  71.004 47.116 1.00 14.21  ? 80   GLN A OE1 1 
ATOM   628  N  NE2 . GLN A 1 80  ? 6.649  73.041 46.433 1.00 13.81  ? 80   GLN A NE2 1 
ATOM   629  N  N   . LEU A 1 81  ? 10.293 67.509 48.241 1.00 13.70  ? 81   LEU A N   1 
ATOM   630  C  CA  . LEU A 1 81  ? 10.846 66.634 49.298 1.00 13.56  ? 81   LEU A CA  1 
ATOM   631  C  C   . LEU A 1 81  ? 12.303 66.292 49.040 1.00 13.82  ? 81   LEU A C   1 
ATOM   632  O  O   . LEU A 1 81  ? 13.116 66.323 49.986 1.00 14.39  ? 81   LEU A O   1 
ATOM   633  C  CB  . LEU A 1 81  ? 9.977  65.395 49.486 1.00 12.32  ? 81   LEU A CB  1 
ATOM   634  C  CG  . LEU A 1 81  ? 8.568  65.649 49.997 1.00 12.17  ? 81   LEU A CG  1 
ATOM   635  C  CD1 . LEU A 1 81  ? 7.825  64.326 50.075 1.00 15.08  ? 81   LEU A CD1 1 
ATOM   636  C  CD2 . LEU A 1 81  ? 8.557  66.392 51.322 1.00 14.14  ? 81   LEU A CD2 1 
ATOM   637  N  N   . ILE A 1 82  ? 12.641 65.983 47.795 1.00 13.30  ? 82   ILE A N   1 
ATOM   638  C  CA  . ILE A 1 82  ? 14.039 65.704 47.437 1.00 14.73  ? 82   ILE A CA  1 
ATOM   639  C  C   . ILE A 1 82  ? 14.929 66.903 47.819 1.00 13.95  ? 82   ILE A C   1 
ATOM   640  O  O   . ILE A 1 82  ? 15.982 66.785 48.439 1.00 14.83  ? 82   ILE A O   1 
ATOM   641  C  CB  . ILE A 1 82  ? 14.200 65.340 45.965 1.00 14.05  ? 82   ILE A CB  1 
ATOM   642  C  CG1 . ILE A 1 82  ? 13.610 63.975 45.628 1.00 16.33  ? 82   ILE A CG1 1 
ATOM   643  C  CG2 . ILE A 1 82  ? 15.642 65.386 45.483 1.00 16.98  ? 82   ILE A CG2 1 
ATOM   644  C  CD1 . ILE A 1 82  ? 13.462 63.749 44.150 1.00 19.86  ? 82   ILE A CD1 1 
ATOM   645  N  N   . ASP A 1 83  ? 14.509 68.100 47.497 1.00 13.52  ? 83   ASP A N   1 
ATOM   646  C  CA  . ASP A 1 83  ? 15.313 69.299 47.803 1.00 13.93  ? 83   ASP A CA  1 
ATOM   647  C  C   . ASP A 1 83  ? 15.388 69.517 49.312 1.00 14.26  ? 83   ASP A C   1 
ATOM   648  O  O   . ASP A 1 83  ? 16.452 69.953 49.741 1.00 16.49  ? 83   ASP A O   1 
ATOM   649  C  CB  . ASP A 1 83  ? 14.777 70.509 47.002 1.00 14.47  ? 83   ASP A CB  1 
ATOM   650  C  CG  . ASP A 1 83  ? 15.186 70.338 45.546 1.00 16.30  ? 83   ASP A CG  1 
ATOM   651  O  OD1 . ASP A 1 83  ? 14.309 70.390 44.660 1.00 17.87  ? 83   ASP A OD1 1 
ATOM   652  O  OD2 . ASP A 1 83  ? 16.406 70.152 45.287 1.00 17.60  ? 83   ASP A OD2 1 
ATOM   653  N  N   . PHE A 1 84  ? 14.349 69.245 50.080 1.00 12.95  ? 84   PHE A N   1 
ATOM   654  C  CA  . PHE A 1 84  ? 14.464 69.302 51.531 1.00 13.31  ? 84   PHE A CA  1 
ATOM   655  C  C   . PHE A 1 84  ? 15.527 68.323 52.016 1.00 13.39  ? 84   PHE A C   1 
ATOM   656  O  O   . PHE A 1 84  ? 16.320 68.706 52.851 1.00 14.36  ? 84   PHE A O   1 
ATOM   657  C  CB  . PHE A 1 84  ? 13.143 69.033 52.247 1.00 13.09  ? 84   PHE A CB  1 
ATOM   658  C  CG  . PHE A 1 84  ? 12.205 70.235 52.176 1.00 13.46  ? 84   PHE A CG  1 
ATOM   659  C  CD1 . PHE A 1 84  ? 12.628 71.500 52.528 1.00 15.01  ? 84   PHE A CD1 1 
ATOM   660  C  CD2 . PHE A 1 84  ? 10.904 70.118 51.748 1.00 15.82  ? 84   PHE A CD2 1 
ATOM   661  C  CE1 . PHE A 1 84  ? 11.758 72.576 52.479 1.00 14.87  ? 84   PHE A CE1 1 
ATOM   662  C  CE2 . PHE A 1 84  ? 10.029 71.169 51.703 1.00 16.19  ? 84   PHE A CE2 1 
ATOM   663  C  CZ  . PHE A 1 84  ? 10.443 72.435 52.051 1.00 15.64  ? 84   PHE A CZ  1 
ATOM   664  N  N   . MET A 1 85  ? 15.540 67.090 51.511 1.00 13.76  ? 85   MET A N   1 
ATOM   665  C  CA  . MET A 1 85  ? 16.531 66.117 51.954 1.00 14.17  ? 85   MET A CA  1 
ATOM   666  C  C   . MET A 1 85  ? 17.943 66.588 51.644 1.00 14.51  ? 85   MET A C   1 
ATOM   667  O  O   . MET A 1 85  ? 18.861 66.408 52.451 1.00 16.71  ? 85   MET A O   1 
ATOM   668  C  CB  A MET A 1 85  ? 16.224 64.722 51.354 0.39 15.48  ? 85   MET A CB  1 
ATOM   669  C  CB  B MET A 1 85  ? 16.359 64.767 51.241 0.61 15.23  ? 85   MET A CB  1 
ATOM   670  C  CG  A MET A 1 85  ? 15.096 64.017 52.089 0.39 15.99  ? 85   MET A CG  1 
ATOM   671  C  CG  B MET A 1 85  ? 15.123 64.025 51.734 0.61 13.94  ? 85   MET A CG  1 
ATOM   672  S  SD  A MET A 1 85  ? 14.721 62.310 51.680 0.39 16.08  ? 85   MET A SD  1 
ATOM   673  S  SD  B MET A 1 85  ? 14.934 62.520 50.768 0.61 20.34  ? 85   MET A SD  1 
ATOM   674  C  CE  A MET A 1 85  ? 13.904 62.523 50.093 0.39 12.85  ? 85   MET A CE  1 
ATOM   675  C  CE  B MET A 1 85  ? 13.386 61.941 51.452 0.61 21.64  ? 85   MET A CE  1 
ATOM   676  N  N   . LEU A 1 86  ? 18.160 67.172 50.471 1.00 14.69  ? 86   LEU A N   1 
ATOM   677  C  CA  . LEU A 1 86  ? 19.506 67.645 50.137 1.00 14.62  ? 86   LEU A CA  1 
ATOM   678  C  C   . LEU A 1 86  ? 19.973 68.804 51.014 1.00 18.20  ? 86   LEU A C   1 
ATOM   679  O  O   . LEU A 1 86  ? 21.163 68.898 51.337 1.00 16.52  ? 86   LEU A O   1 
ATOM   680  C  CB  . LEU A 1 86  ? 19.560 68.110 48.697 1.00 18.32  ? 86   LEU A CB  1 
ATOM   681  C  CG  . LEU A 1 86  ? 19.337 67.050 47.633 1.00 20.87  ? 86   LEU A CG  1 
ATOM   682  C  CD1 . LEU A 1 86  ? 19.189 67.684 46.268 1.00 26.06  ? 86   LEU A CD1 1 
ATOM   683  C  CD2 . LEU A 1 86  ? 20.520 66.089 47.606 1.00 29.80  ? 86   LEU A CD2 1 
ATOM   684  N  N   . GLN A 1 87  ? 19.040 69.697 51.378 1.00 16.95  ? 87   GLN A N   1 
ATOM   685  C  CA  . GLN A 1 87  ? 19.350 70.847 52.208 1.00 16.49  ? 87   GLN A CA  1 
ATOM   686  C  C   . GLN A 1 87  ? 19.388 70.521 53.688 1.00 15.76  ? 87   GLN A C   1 
ATOM   687  O  O   . GLN A 1 87  ? 19.947 71.320 54.469 1.00 18.25  ? 87   GLN A O   1 
ATOM   688  C  CB  . GLN A 1 87  ? 18.334 71.962 51.942 1.00 16.51  ? 87   GLN A CB  1 
ATOM   689  C  CG  . GLN A 1 87  ? 18.389 72.385 50.470 1.00 18.29  ? 87   GLN A CG  1 
ATOM   690  C  CD  . GLN A 1 87  ? 19.801 72.669 50.003 1.00 23.31  ? 87   GLN A CD  1 
ATOM   691  O  OE1 . GLN A 1 87  ? 20.259 72.209 48.935 1.00 36.12  ? 87   GLN A OE1 1 
ATOM   692  N  NE2 . GLN A 1 87  ? 20.496 73.439 50.807 1.00 25.84  ? 87   GLN A NE2 1 
ATOM   693  N  N   . HIS A 1 88  ? 18.804 69.396 54.080 1.00 14.63  ? 88   HIS A N   1 
ATOM   694  C  CA  . HIS A 1 88  ? 18.700 68.998 55.480 1.00 15.02  ? 88   HIS A CA  1 
ATOM   695  C  C   . HIS A 1 88  ? 18.898 67.494 55.557 1.00 15.41  ? 88   HIS A C   1 
ATOM   696  O  O   . HIS A 1 88  ? 17.965 66.731 55.701 1.00 14.23  ? 88   HIS A O   1 
ATOM   697  C  CB  . HIS A 1 88  ? 17.362 69.381 56.129 1.00 16.42  ? 88   HIS A CB  1 
ATOM   698  C  CG  . HIS A 1 88  ? 16.913 70.771 55.829 1.00 16.90  ? 88   HIS A CG  1 
ATOM   699  N  ND1 . HIS A 1 88  ? 17.331 71.862 56.528 1.00 21.85  ? 88   HIS A ND1 1 
ATOM   700  C  CD2 . HIS A 1 88  ? 16.139 71.249 54.836 1.00 16.98  ? 88   HIS A CD2 1 
ATOM   701  C  CE1 . HIS A 1 88  ? 16.793 72.979 56.006 1.00 24.34  ? 88   HIS A CE1 1 
ATOM   702  N  NE2 . HIS A 1 88  ? 16.055 72.620 54.968 1.00 17.70  ? 88   HIS A NE2 1 
ATOM   703  N  N   . PRO A 1 89  ? 20.115 67.012 55.387 1.00 15.08  ? 89   PRO A N   1 
ATOM   704  C  CA  . PRO A 1 89  ? 20.357 65.576 55.210 1.00 15.74  ? 89   PRO A CA  1 
ATOM   705  C  C   . PRO A 1 89  ? 19.917 64.665 56.357 1.00 14.33  ? 89   PRO A C   1 
ATOM   706  O  O   . PRO A 1 89  ? 19.803 63.449 56.169 1.00 15.45  ? 89   PRO A O   1 
ATOM   707  C  CB  . PRO A 1 89  ? 21.892 65.500 55.057 1.00 18.38  ? 89   PRO A CB  1 
ATOM   708  C  CG  . PRO A 1 89  ? 22.348 66.862 54.733 1.00 21.14  ? 89   PRO A CG  1 
ATOM   709  C  CD  . PRO A 1 89  ? 21.341 67.829 55.266 1.00 17.47  ? 89   PRO A CD  1 
ATOM   710  N  N   . ILE A 1 90  ? 19.629 65.217 57.536 1.00 13.53  ? 90   ILE A N   1 
ATOM   711  C  CA  . ILE A 1 90  ? 19.073 64.402 58.621 1.00 15.61  ? 90   ILE A CA  1 
ATOM   712  C  C   . ILE A 1 90  ? 17.713 63.840 58.230 1.00 12.08  ? 90   ILE A C   1 
ATOM   713  O  O   . ILE A 1 90  ? 17.243 62.844 58.795 1.00 16.18  ? 90   ILE A O   1 
ATOM   714  C  CB  . ILE A 1 90  ? 19.002 65.189 59.939 1.00 15.81  ? 90   ILE A CB  1 
ATOM   715  C  CG1 . ILE A 1 90  ? 18.768 64.264 61.146 1.00 18.77  ? 90   ILE A CG1 1 
ATOM   716  C  CG2 . ILE A 1 90  ? 17.973 66.313 59.873 1.00 19.19  ? 90   ILE A CG2 1 
ATOM   717  C  CD1 . ILE A 1 90  ? 18.789 64.989 62.473 1.00 26.23  ? 90   ILE A CD1 1 
ATOM   718  N  N   . LEU A 1 91  ? 17.063 64.419 57.221 1.00 13.60  ? 91   LEU A N   1 
ATOM   719  C  CA  . LEU A 1 91  ? 15.796 63.947 56.698 1.00 14.75  ? 91   LEU A CA  1 
ATOM   720  C  C   . LEU A 1 91  ? 15.915 62.671 55.878 1.00 14.02  ? 91   LEU A C   1 
ATOM   721  O  O   . LEU A 1 91  ? 14.922 62.035 55.575 1.00 15.15  ? 91   LEU A O   1 
ATOM   722  C  CB  . LEU A 1 91  ? 15.170 65.017 55.805 1.00 14.61  ? 91   LEU A CB  1 
ATOM   723  C  CG  . LEU A 1 91  ? 14.577 66.252 56.457 1.00 14.44  ? 91   LEU A CG  1 
ATOM   724  C  CD1 . LEU A 1 91  ? 14.129 67.215 55.359 1.00 14.87  ? 91   LEU A CD1 1 
ATOM   725  C  CD2 . LEU A 1 91  ? 13.427 65.885 57.389 1.00 17.41  ? 91   LEU A CD2 1 
ATOM   726  N  N   . ILE A 1 92  ? 17.119 62.245 55.523 1.00 14.59  ? 92   ILE A N   1 
ATOM   727  C  CA  . ILE A 1 92  ? 17.303 61.053 54.690 1.00 14.79  ? 92   ILE A CA  1 
ATOM   728  C  C   . ILE A 1 92  ? 17.298 59.856 55.608 1.00 14.36  ? 92   ILE A C   1 
ATOM   729  O  O   . ILE A 1 92  ? 18.178 59.763 56.474 1.00 15.73  ? 92   ILE A O   1 
ATOM   730  C  CB  . ILE A 1 92  ? 18.601 61.147 53.857 1.00 15.16  ? 92   ILE A CB  1 
ATOM   731  C  CG1 . ILE A 1 92  ? 18.652 62.343 52.909 1.00 16.54  ? 92   ILE A CG1 1 
ATOM   732  C  CG2 . ILE A 1 92  ? 18.809 59.837 53.100 1.00 16.53  ? 92   ILE A CG2 1 
ATOM   733  C  CD1 . ILE A 1 92  ? 20.025 62.615 52.321 1.00 19.03  ? 92   ILE A CD1 1 
ATOM   734  N  N   . ASN A 1 93  ? 16.346 58.947 55.486 1.00 14.09  ? 93   ASN A N   1 
ATOM   735  C  CA  . ASN A 1 93  ? 16.344 57.785 56.395 1.00 14.68  ? 93   ASN A CA  1 
ATOM   736  C  C   . ASN A 1 93  ? 17.541 56.913 56.049 1.00 16.19  ? 93   ASN A C   1 
ATOM   737  O  O   . ASN A 1 93  ? 18.206 57.091 55.019 1.00 16.09  ? 93   ASN A O   1 
ATOM   738  C  CB  . ASN A 1 93  ? 15.021 57.042 56.399 1.00 15.33  ? 93   ASN A CB  1 
ATOM   739  C  CG  . ASN A 1 93  ? 14.674 56.445 57.743 1.00 15.95  ? 93   ASN A CG  1 
ATOM   740  O  OD1 . ASN A 1 93  ? 15.545 56.311 58.620 1.00 17.75  ? 93   ASN A OD1 1 
ATOM   741  N  ND2 . ASN A 1 93  ? 13.392 56.112 57.916 1.00 19.97  ? 93   ASN A ND2 1 
ATOM   742  N  N   . ARG A 1 94  ? 17.813 55.983 56.958 1.00 14.91  ? 94   ARG A N   1 
ATOM   743  C  CA  . ARG A 1 94  ? 19.114 55.340 56.992 1.00 13.25  ? 94   ARG A CA  1 
ATOM   744  C  C   . ARG A 1 94  ? 19.024 53.956 57.594 1.00 13.66  ? 94   ARG A C   1 
ATOM   745  O  O   . ARG A 1 94  ? 18.182 53.684 58.433 1.00 15.29  ? 94   ARG A O   1 
ATOM   746  C  CB  . ARG A 1 94  ? 20.062 56.206 57.813 1.00 14.75  ? 94   ARG A CB  1 
ATOM   747  C  CG  . ARG A 1 94  ? 19.813 56.203 59.309 1.00 14.27  ? 94   ARG A CG  1 
ATOM   748  C  CD  . ARG A 1 94  ? 18.541 56.943 59.750 1.00 17.38  ? 94   ARG A CD  1 
ATOM   749  N  NE  . ARG A 1 94  ? 18.457 57.062 61.198 1.00 18.93  ? 94   ARG A NE  1 
ATOM   750  C  CZ  . ARG A 1 94  ? 18.674 58.073 62.005 1.00 19.63  ? 94   ARG A CZ  1 
ATOM   751  N  NH1 . ARG A 1 94  ? 19.035 59.299 61.540 1.00 18.92  ? 94   ARG A NH1 1 
ATOM   752  N  NH2 . ARG A 1 94  ? 18.494 57.816 63.313 1.00 23.04  ? 94   ARG A NH2 1 
ATOM   753  N  N   . PRO A 1 95  ? 19.909 53.048 57.221 1.00 12.80  ? 95   PRO A N   1 
ATOM   754  C  CA  . PRO A 1 95  ? 20.925 53.269 56.204 1.00 14.07  ? 95   PRO A CA  1 
ATOM   755  C  C   . PRO A 1 95  ? 20.502 52.877 54.791 1.00 13.17  ? 95   PRO A C   1 
ATOM   756  O  O   . PRO A 1 95  ? 19.707 51.958 54.609 1.00 15.95  ? 95   PRO A O   1 
ATOM   757  C  CB  . PRO A 1 95  ? 21.999 52.291 56.649 1.00 16.02  ? 95   PRO A CB  1 
ATOM   758  C  CG  . PRO A 1 95  ? 21.252 51.130 57.206 1.00 14.64  ? 95   PRO A CG  1 
ATOM   759  C  CD  . PRO A 1 95  ? 20.014 51.736 57.867 1.00 13.50  ? 95   PRO A CD  1 
ATOM   760  N  N   . ILE A 1 96  ? 21.018 53.569 53.797 1.00 15.11  ? 96   ILE A N   1 
ATOM   761  C  CA  . ILE A 1 96  ? 20.942 53.135 52.421 1.00 14.38  ? 96   ILE A CA  1 
ATOM   762  C  C   . ILE A 1 96  ? 22.206 52.358 52.038 1.00 15.14  ? 96   ILE A C   1 
ATOM   763  O  O   . ILE A 1 96  ? 23.307 52.803 52.344 1.00 14.06  ? 96   ILE A O   1 
ATOM   764  C  CB  . ILE A 1 96  ? 20.795 54.345 51.497 1.00 14.39  ? 96   ILE A CB  1 
ATOM   765  C  CG1 . ILE A 1 96  ? 19.534 55.174 51.769 1.00 15.00  ? 96   ILE A CG1 1 
ATOM   766  C  CG2 . ILE A 1 96  ? 20.887 53.906 50.035 1.00 17.09  ? 96   ILE A CG2 1 
ATOM   767  C  CD1 . ILE A 1 96  ? 19.581 56.605 51.255 1.00 17.59  ? 96   ILE A CD1 1 
ATOM   768  N  N   . VAL A 1 97  ? 22.055 51.226 51.399 1.00 14.21  ? 97   VAL A N   1 
ATOM   769  C  CA  . VAL A 1 97  ? 23.178 50.403 50.950 1.00 12.62  ? 97   VAL A CA  1 
ATOM   770  C  C   . VAL A 1 97  ? 23.069 50.128 49.466 1.00 13.98  ? 97   VAL A C   1 
ATOM   771  O  O   . VAL A 1 97  ? 21.987 49.777 48.994 1.00 14.70  ? 97   VAL A O   1 
ATOM   772  C  CB  . VAL A 1 97  ? 23.267 49.093 51.763 1.00 11.48  ? 97   VAL A CB  1 
ATOM   773  C  CG1 . VAL A 1 97  ? 24.350 48.174 51.206 1.00 14.81  ? 97   VAL A CG1 1 
ATOM   774  C  CG2 . VAL A 1 97  ? 23.479 49.397 53.218 1.00 14.56  ? 97   VAL A CG2 1 
ATOM   775  N  N   . VAL A 1 98  ? 24.190 50.276 48.776 1.00 14.80  ? 98   VAL A N   1 
ATOM   776  C  CA  . VAL A 1 98  ? 24.358 49.975 47.361 1.00 13.39  ? 98   VAL A CA  1 
ATOM   777  C  C   . VAL A 1 98  ? 25.373 48.847 47.195 1.00 14.58  ? 98   VAL A C   1 
ATOM   778  O  O   . VAL A 1 98  ? 26.475 48.921 47.728 1.00 13.95  ? 98   VAL A O   1 
ATOM   779  C  CB  . VAL A 1 98  ? 24.851 51.207 46.584 1.00 16.27  ? 98   VAL A CB  1 
ATOM   780  C  CG1 . VAL A 1 98  ? 24.999 50.857 45.106 1.00 19.68  ? 98   VAL A CG1 1 
ATOM   781  C  CG2 . VAL A 1 98  ? 23.942 52.416 46.832 1.00 19.48  ? 98   VAL A CG2 1 
ATOM   782  N  N   . THR A 1 99  ? 25.014 47.804 46.463 1.00 14.60  ? 99   THR A N   1 
ATOM   783  C  CA  . THR A 1 99  ? 25.915 46.743 46.112 1.00 15.52  ? 99   THR A CA  1 
ATOM   784  C  C   . THR A 1 99  ? 25.763 46.451 44.609 1.00 15.51  ? 99   THR A C   1 
ATOM   785  O  O   . THR A 1 99  ? 24.845 47.008 43.993 1.00 16.09  ? 99   THR A O   1 
ATOM   786  C  CB  . THR A 1 99  ? 25.631 45.451 46.881 1.00 16.03  ? 99   THR A CB  1 
ATOM   787  O  OG1 . THR A 1 99  ? 24.430 44.853 46.354 1.00 18.71  ? 99   THR A OG1 1 
ATOM   788  C  CG2 . THR A 1 99  ? 25.307 45.663 48.351 1.00 16.45  ? 99   THR A CG2 1 
ATOM   789  N  N   . PRO A 1 100 ? 26.595 45.615 44.024 1.00 17.09  ? 100  PRO A N   1 
ATOM   790  C  CA  . PRO A 1 100 ? 26.374 45.282 42.595 1.00 17.97  ? 100  PRO A CA  1 
ATOM   791  C  C   . PRO A 1 100 ? 25.027 44.672 42.275 1.00 17.14  ? 100  PRO A C   1 
ATOM   792  O  O   . PRO A 1 100 ? 24.512 44.693 41.159 1.00 19.57  ? 100  PRO A O   1 
ATOM   793  C  CB  . PRO A 1 100 ? 27.511 44.304 42.274 1.00 19.53  ? 100  PRO A CB  1 
ATOM   794  C  CG  . PRO A 1 100 ? 28.590 44.702 43.245 1.00 20.17  ? 100  PRO A CG  1 
ATOM   795  C  CD  . PRO A 1 100 ? 27.816 44.965 44.515 1.00 19.04  ? 100  PRO A CD  1 
ATOM   796  N  N   . LEU A 1 101 ? 24.324 44.002 43.158 1.00 16.13  ? 101  LEU A N   1 
ATOM   797  C  CA  . LEU A 1 101 ? 22.969 43.500 43.091 1.00 17.80  ? 101  LEU A CA  1 
ATOM   798  C  C   . LEU A 1 101 ? 21.866 44.521 43.277 1.00 15.77  ? 101  LEU A C   1 
ATOM   799  O  O   . LEU A 1 101 ? 20.760 44.219 42.780 1.00 19.30  ? 101  LEU A O   1 
ATOM   800  C  CB  . LEU A 1 101 ? 22.765 42.351 44.081 1.00 18.24  ? 101  LEU A CB  1 
ATOM   801  C  CG  . LEU A 1 101 ? 23.549 41.076 43.767 1.00 18.73  ? 101  LEU A CG  1 
ATOM   802  C  CD1 . LEU A 1 101 ? 23.270 40.075 44.883 1.00 19.30  ? 101  LEU A CD1 1 
ATOM   803  C  CD2 . LEU A 1 101 ? 23.208 40.499 42.409 1.00 22.22  ? 101  LEU A CD2 1 
ATOM   804  N  N   . GLY A 1 102 ? 22.032 45.670 43.891 1.00 16.90  ? 102  GLY A N   1 
ATOM   805  C  CA  . GLY A 1 102 ? 20.856 46.539 44.048 1.00 17.02  ? 102  GLY A CA  1 
ATOM   806  C  C   . GLY A 1 102 ? 21.139 47.538 45.166 1.00 16.35  ? 102  GLY A C   1 
ATOM   807  O  O   . GLY A 1 102 ? 22.219 47.587 45.743 1.00 18.25  ? 102  GLY A O   1 
ATOM   808  N  N   . THR A 1 103 ? 20.115 48.330 45.422 1.00 14.94  ? 103  THR A N   1 
ATOM   809  C  CA  . THR A 1 103 ? 20.130 49.359 46.447 1.00 14.45  ? 103  THR A CA  1 
ATOM   810  C  C   . THR A 1 103 ? 18.904 49.179 47.328 1.00 14.68  ? 103  THR A C   1 
ATOM   811  O  O   . THR A 1 103 ? 17.794 48.967 46.834 1.00 17.05  ? 103  THR A O   1 
ATOM   812  C  CB  . THR A 1 103 ? 20.118 50.748 45.801 1.00 15.75  ? 103  THR A CB  1 
ATOM   813  O  OG1 . THR A 1 103 ? 21.279 50.909 44.962 1.00 18.37  ? 103  THR A OG1 1 
ATOM   814  C  CG2 . THR A 1 103 ? 20.186 51.845 46.831 1.00 15.88  ? 103  THR A CG2 1 
ATOM   815  N  N   . ARG A 1 104 ? 19.070 49.256 48.637 1.00 14.72  ? 104  ARG A N   1 
ATOM   816  C  CA  . ARG A 1 104 ? 17.942 49.178 49.552 1.00 14.81  ? 104  ARG A CA  1 
ATOM   817  C  C   . ARG A 1 104 ? 18.078 50.185 50.696 1.00 13.76  ? 104  ARG A C   1 
ATOM   818  O  O   . ARG A 1 104 ? 19.171 50.426 51.163 1.00 14.22  ? 104  ARG A O   1 
ATOM   819  C  CB  A ARG A 1 104 ? 17.797 47.805 50.205 0.57 16.88  ? 104  ARG A CB  1 
ATOM   820  C  CB  B ARG A 1 104 ? 17.774 47.794 50.173 0.43 17.14  ? 104  ARG A CB  1 
ATOM   821  C  CG  A ARG A 1 104 ? 17.610 46.654 49.252 0.57 16.84  ? 104  ARG A CG  1 
ATOM   822  C  CG  B ARG A 1 104 ? 17.541 46.656 49.216 0.43 17.27  ? 104  ARG A CG  1 
ATOM   823  C  CD  A ARG A 1 104 ? 16.211 46.577 48.662 0.57 21.79  ? 104  ARG A CD  1 
ATOM   824  C  CD  B ARG A 1 104 ? 16.288 46.785 48.363 0.43 20.75  ? 104  ARG A CD  1 
ATOM   825  N  NE  A ARG A 1 104 ? 16.098 45.291 47.936 0.57 23.91  ? 104  ARG A NE  1 
ATOM   826  N  NE  B ARG A 1 104 ? 16.188 45.586 47.514 0.43 24.22  ? 104  ARG A NE  1 
ATOM   827  C  CZ  A ARG A 1 104 ? 16.574 45.097 46.710 0.57 22.16  ? 104  ARG A CZ  1 
ATOM   828  C  CZ  B ARG A 1 104 ? 15.786 44.384 47.893 0.43 22.19  ? 104  ARG A CZ  1 
ATOM   829  N  NH1 A ARG A 1 104 ? 17.193 46.083 46.049 0.57 23.07  ? 104  ARG A NH1 1 
ATOM   830  N  NH1 B ARG A 1 104 ? 15.403 44.124 49.138 0.43 28.69  ? 104  ARG A NH1 1 
ATOM   831  N  NH2 A ARG A 1 104 ? 16.435 43.913 46.133 0.57 25.87  ? 104  ARG A NH2 1 
ATOM   832  N  NH2 B ARG A 1 104 ? 15.766 43.414 46.991 0.43 20.99  ? 104  ARG A NH2 1 
ATOM   833  N  N   . LEU A 1 105 ? 16.939 50.668 51.125 1.00 14.27  ? 105  LEU A N   1 
ATOM   834  C  CA  . LEU A 1 105 ? 16.804 51.232 52.459 1.00 14.48  ? 105  LEU A CA  1 
ATOM   835  C  C   . LEU A 1 105 ? 16.759 50.036 53.410 1.00 12.71  ? 105  LEU A C   1 
ATOM   836  O  O   . LEU A 1 105 ? 15.755 49.313 53.371 1.00 14.14  ? 105  LEU A O   1 
ATOM   837  C  CB  . LEU A 1 105 ? 15.575 52.120 52.572 1.00 15.19  ? 105  LEU A CB  1 
ATOM   838  C  CG  . LEU A 1 105 ? 15.289 52.760 53.936 1.00 15.06  ? 105  LEU A CG  1 
ATOM   839  C  CD1 . LEU A 1 105 ? 16.459 53.631 54.357 1.00 16.09  ? 105  LEU A CD1 1 
ATOM   840  C  CD2 . LEU A 1 105 ? 13.949 53.491 53.885 1.00 17.07  ? 105  LEU A CD2 1 
ATOM   841  N  N   . CYS A 1 106 ? 17.827 49.857 54.205 1.00 13.87  ? 106  CYS A N   1 
ATOM   842  C  CA  . CYS A 1 106 ? 17.922 48.632 55.003 1.00 13.64  ? 106  CYS A CA  1 
ATOM   843  C  C   . CYS A 1 106 ? 17.276 48.833 56.363 1.00 14.79  ? 106  CYS A C   1 
ATOM   844  O  O   . CYS A 1 106 ? 17.892 48.896 57.394 1.00 15.00  ? 106  CYS A O   1 
ATOM   845  C  CB  . CYS A 1 106 ? 19.365 48.154 55.109 1.00 14.88  ? 106  CYS A CB  1 
ATOM   846  S  SG  . CYS A 1 106 ? 20.084 47.750 53.511 1.00 16.63  ? 106  CYS A SG  1 
ATOM   847  N  N   . ARG A 1 107 ? 15.945 48.930 56.306 1.00 15.73  ? 107  ARG A N   1 
ATOM   848  C  CA  . ARG A 1 107 ? 15.079 49.062 57.481 1.00 14.63  ? 107  ARG A CA  1 
ATOM   849  C  C   . ARG A 1 107 ? 13.994 48.019 57.328 1.00 15.00  ? 107  ARG A C   1 
ATOM   850  O  O   . ARG A 1 107 ? 13.092 48.191 56.490 1.00 16.71  ? 107  ARG A O   1 
ATOM   851  C  CB  . ARG A 1 107 ? 14.505 50.465 57.624 1.00 15.97  ? 107  ARG A CB  1 
ATOM   852  C  CG  . ARG A 1 107 ? 15.588 51.528 57.757 1.00 15.90  ? 107  ARG A CG  1 
ATOM   853  C  CD  . ARG A 1 107 ? 14.978 52.910 58.034 1.00 16.30  ? 107  ARG A CD  1 
ATOM   854  N  NE  . ARG A 1 107 ? 14.348 52.864 59.363 1.00 16.01  ? 107  ARG A NE  1 
ATOM   855  C  CZ  . ARG A 1 107 ? 14.999 52.964 60.510 1.00 17.34  ? 107  ARG A CZ  1 
ATOM   856  N  NH1 . ARG A 1 107 ? 16.310 53.147 60.547 1.00 18.00  ? 107  ARG A NH1 1 
ATOM   857  N  NH2 . ARG A 1 107 ? 14.354 52.892 61.691 1.00 20.37  ? 107  ARG A NH2 1 
ATOM   858  N  N   . PRO A 1 108 ? 14.057 46.936 58.090 1.00 15.48  ? 108  PRO A N   1 
ATOM   859  C  CA  . PRO A 1 108 ? 15.034 46.638 59.130 1.00 15.57  ? 108  PRO A CA  1 
ATOM   860  C  C   . PRO A 1 108 ? 16.391 46.236 58.531 1.00 16.10  ? 108  PRO A C   1 
ATOM   861  O  O   . PRO A 1 108 ? 16.479 46.019 57.318 1.00 15.46  ? 108  PRO A O   1 
ATOM   862  C  CB  . PRO A 1 108 ? 14.413 45.478 59.897 1.00 16.70  ? 108  PRO A CB  1 
ATOM   863  C  CG  . PRO A 1 108 ? 13.626 44.783 58.858 1.00 19.38  ? 108  PRO A CG  1 
ATOM   864  C  CD  . PRO A 1 108 ? 13.043 45.858 57.975 1.00 16.36  ? 108  PRO A CD  1 
ATOM   865  N  N   . SER A 1 109 ? 17.400 46.168 59.388 1.00 14.90  ? 109  SER A N   1 
ATOM   866  C  CA  . SER A 1 109 ? 18.783 46.001 58.905 1.00 12.86  ? 109  SER A CA  1 
ATOM   867  C  C   . SER A 1 109 ? 18.921 44.752 58.053 1.00 12.32  ? 109  SER A C   1 
ATOM   868  O  O   . SER A 1 109 ? 19.672 44.780 57.054 1.00 14.29  ? 109  SER A O   1 
ATOM   869  C  CB  . SER A 1 109 ? 19.728 46.001 60.095 1.00 14.05  ? 109  SER A CB  1 
ATOM   870  O  OG  . SER A 1 109 ? 19.445 45.035 61.083 1.00 14.92  ? 109  SER A OG  1 
ATOM   871  N  N   . GLU A 1 110 ? 18.197 43.687 58.395 1.00 13.04  ? 110  GLU A N   1 
ATOM   872  C  CA  . GLU A 1 110 ? 18.412 42.407 57.697 1.00 14.55  ? 110  GLU A CA  1 
ATOM   873  C  C   . GLU A 1 110 ? 17.929 42.430 56.247 1.00 15.58  ? 110  GLU A C   1 
ATOM   874  O  O   . GLU A 1 110 ? 18.207 41.480 55.509 1.00 15.08  ? 110  GLU A O   1 
ATOM   875  C  CB  . GLU A 1 110 ? 17.780 41.249 58.460 1.00 15.97  ? 110  GLU A CB  1 
ATOM   876  C  CG  . GLU A 1 110 ? 16.285 41.303 58.607 1.00 16.88  ? 110  GLU A CG  1 
ATOM   877  C  CD  . GLU A 1 110 ? 15.764 41.985 59.854 1.00 16.15  ? 110  GLU A CD  1 
ATOM   878  O  OE1 . GLU A 1 110 ? 14.595 41.673 60.229 1.00 19.08  ? 110  GLU A OE1 1 
ATOM   879  O  OE2 . GLU A 1 110 ? 16.499 42.814 60.445 1.00 16.96  ? 110  GLU A OE2 1 
ATOM   880  N  N   . VAL A 1 111 ? 17.267 43.510 55.822 1.00 15.08  ? 111  VAL A N   1 
ATOM   881  C  CA  . VAL A 1 111 ? 17.008 43.704 54.393 1.00 14.36  ? 111  VAL A CA  1 
ATOM   882  C  C   . VAL A 1 111 ? 18.289 43.661 53.577 1.00 12.97  ? 111  VAL A C   1 
ATOM   883  O  O   . VAL A 1 111 ? 18.294 43.291 52.408 1.00 14.38  ? 111  VAL A O   1 
ATOM   884  C  CB  . VAL A 1 111 ? 16.291 45.048 54.203 1.00 14.55  ? 111  VAL A CB  1 
ATOM   885  C  CG1 . VAL A 1 111 ? 16.374 45.504 52.762 1.00 15.87  ? 111  VAL A CG1 1 
ATOM   886  C  CG2 . VAL A 1 111 ? 14.864 44.938 54.734 1.00 18.35  ? 111  VAL A CG2 1 
ATOM   887  N  N   . VAL A 1 112 ? 19.427 44.047 54.183 1.00 13.60  ? 112  VAL A N   1 
ATOM   888  C  CA  . VAL A 1 112 ? 20.689 44.093 53.437 1.00 13.88  ? 112  VAL A CA  1 
ATOM   889  C  C   . VAL A 1 112 ? 21.072 42.710 52.935 1.00 13.39  ? 112  VAL A C   1 
ATOM   890  O  O   . VAL A 1 112 ? 21.808 42.639 51.958 1.00 15.95  ? 112  VAL A O   1 
ATOM   891  C  CB  . VAL A 1 112 ? 21.823 44.717 54.273 1.00 13.06  ? 112  VAL A CB  1 
ATOM   892  C  CG1 . VAL A 1 112 ? 22.280 43.742 55.353 1.00 13.68  ? 112  VAL A CG1 1 
ATOM   893  C  CG2 . VAL A 1 112 ? 22.981 45.187 53.405 1.00 15.13  ? 112  VAL A CG2 1 
ATOM   894  N  N   . LEU A 1 113 ? 20.579 41.650 53.563 1.00 14.30  ? 113  LEU A N   1 
ATOM   895  C  CA  . LEU A 1 113 ? 20.901 40.289 53.135 1.00 13.36  ? 113  LEU A CA  1 
ATOM   896  C  C   . LEU A 1 113 ? 20.431 40.056 51.701 1.00 13.73  ? 113  LEU A C   1 
ATOM   897  O  O   . LEU A 1 113 ? 20.985 39.221 50.947 1.00 16.54  ? 113  LEU A O   1 
ATOM   898  C  CB  . LEU A 1 113 ? 20.293 39.271 54.084 1.00 14.06  ? 113  LEU A CB  1 
ATOM   899  C  CG  . LEU A 1 113 ? 20.773 39.329 55.546 1.00 15.08  ? 113  LEU A CG  1 
ATOM   900  C  CD1 . LEU A 1 113 ? 20.014 38.308 56.365 1.00 16.14  ? 113  LEU A CD1 1 
ATOM   901  C  CD2 . LEU A 1 113 ? 22.272 39.098 55.643 1.00 18.55  ? 113  LEU A CD2 1 
ATOM   902  N  N   . ASP A 1 114 ? 19.416 40.816 51.280 1.00 14.78  ? 114  ASP A N   1 
ATOM   903  C  CA  . ASP A 1 114 ? 18.884 40.670 49.926 1.00 16.26  ? 114  ASP A CA  1 
ATOM   904  C  C   . ASP A 1 114 ? 19.934 41.018 48.863 1.00 17.58  ? 114  ASP A C   1 
ATOM   905  O  O   . ASP A 1 114 ? 19.987 40.444 47.771 1.00 16.69  ? 114  ASP A O   1 
ATOM   906  C  CB  . ASP A 1 114 ? 17.680 41.565 49.665 1.00 18.97  ? 114  ASP A CB  1 
ATOM   907  C  CG  . ASP A 1 114 ? 16.427 41.138 50.396 1.00 21.98  ? 114  ASP A CG  1 
ATOM   908  O  OD1 . ASP A 1 114 ? 15.379 41.797 50.190 1.00 31.35  ? 114  ASP A OD1 1 
ATOM   909  O  OD2 . ASP A 1 114 ? 16.431 40.174 51.198 1.00 25.84  ? 114  ASP A OD2 1 
ATOM   910  N  N   . ILE A 1 115 ? 20.761 42.022 49.176 1.00 14.53  ? 115  ILE A N   1 
ATOM   911  C  CA  . ILE A 1 115 ? 21.664 42.570 48.164 1.00 14.74  ? 115  ILE A CA  1 
ATOM   912  C  C   . ILE A 1 115 ? 23.129 42.241 48.411 1.00 15.12  ? 115  ILE A C   1 
ATOM   913  O  O   . ILE A 1 115 ? 23.973 42.613 47.589 1.00 16.98  ? 115  ILE A O   1 
ATOM   914  C  CB  . ILE A 1 115 ? 21.418 44.090 48.031 1.00 14.87  ? 115  ILE A CB  1 
ATOM   915  C  CG1 . ILE A 1 115 ? 21.559 44.909 49.313 1.00 15.98  ? 115  ILE A CG1 1 
ATOM   916  C  CG2 . ILE A 1 115 ? 20.048 44.311 47.364 1.00 19.23  ? 115  ILE A CG2 1 
ATOM   917  C  CD1 . ILE A 1 115 ? 21.592 46.426 49.154 1.00 18.98  ? 115  ILE A CD1 1 
ATOM   918  N  N   . LEU A 1 116 ? 23.459 41.545 49.484 1.00 15.19  ? 116  LEU A N   1 
ATOM   919  C  CA  . LEU A 1 116 ? 24.826 41.054 49.691 1.00 15.72  ? 116  LEU A CA  1 
ATOM   920  C  C   . LEU A 1 116 ? 25.022 39.791 48.847 1.00 14.21  ? 116  LEU A C   1 
ATOM   921  O  O   . LEU A 1 116 ? 24.233 38.849 48.931 1.00 15.30  ? 116  LEU A O   1 
ATOM   922  C  CB  . LEU A 1 116 ? 25.143 40.822 51.141 1.00 15.54  ? 116  LEU A CB  1 
ATOM   923  C  CG  . LEU A 1 116 ? 25.156 42.073 52.013 1.00 14.97  ? 116  LEU A CG  1 
ATOM   924  C  CD1 . LEU A 1 116 ? 25.219 41.701 53.494 1.00 15.22  ? 116  LEU A CD1 1 
ATOM   925  C  CD2 . LEU A 1 116 ? 26.324 42.973 51.716 1.00 16.31  ? 116  LEU A CD2 1 
ATOM   926  N  N   . GLN A 1 117 ? 26.050 39.889 47.994 1.00 15.73  ? 117  GLN A N   1 
ATOM   927  C  CA  . GLN A 1 117 ? 26.345 38.819 47.058 1.00 19.79  ? 117  GLN A CA  1 
ATOM   928  C  C   . GLN A 1 117 ? 26.826 37.581 47.782 1.00 17.98  ? 117  GLN A C   1 
ATOM   929  O  O   . GLN A 1 117 ? 26.499 36.447 47.417 1.00 20.10  ? 117  GLN A O   1 
ATOM   930  C  CB  . GLN A 1 117 ? 27.488 39.214 46.099 1.00 19.03  ? 117  GLN A CB  1 
ATOM   931  C  CG  . GLN A 1 117 ? 27.053 40.270 45.110 1.00 21.69  ? 117  GLN A CG  1 
ATOM   932  C  CD  . GLN A 1 117 ? 28.199 40.915 44.391 1.00 23.25  ? 117  GLN A CD  1 
ATOM   933  O  OE1 . GLN A 1 117 ? 29.054 41.541 45.006 1.00 28.54  ? 117  GLN A OE1 1 
ATOM   934  N  NE2 . GLN A 1 117 ? 28.162 40.747 43.065 1.00 25.24  ? 117  GLN A NE2 1 
ATOM   935  N  N   . ASP A 1 118 ? 27.647 37.781 48.820 1.00 16.31  ? 118  ASP A N   1 
ATOM   936  C  CA  . ASP A 1 118 ? 28.211 36.608 49.496 1.00 17.18  ? 118  ASP A CA  1 
ATOM   937  C  C   . ASP A 1 118 ? 27.481 36.367 50.809 1.00 17.29  ? 118  ASP A C   1 
ATOM   938  O  O   . ASP A 1 118 ? 27.126 37.331 51.480 1.00 17.11  ? 118  ASP A O   1 
ATOM   939  C  CB  . ASP A 1 118 ? 29.710 36.778 49.723 1.00 18.14  ? 118  ASP A CB  1 
ATOM   940  C  CG  . ASP A 1 118 ? 30.503 37.014 48.452 1.00 20.63  ? 118  ASP A CG  1 
ATOM   941  O  OD1 . ASP A 1 118 ? 30.137 36.393 47.416 1.00 23.83  ? 118  ASP A OD1 1 
ATOM   942  O  OD2 . ASP A 1 118 ? 31.464 37.827 48.472 1.00 26.61  ? 118  ASP A OD2 1 
ATOM   943  N  N   . ALA A 1 119 ? 27.295 35.090 51.135 1.00 16.71  ? 119  ALA A N   1 
ATOM   944  C  CA  . ALA A 1 119 ? 26.578 34.716 52.356 1.00 15.02  ? 119  ALA A CA  1 
ATOM   945  C  C   . ALA A 1 119 ? 27.278 35.170 53.639 1.00 14.93  ? 119  ALA A C   1 
ATOM   946  O  O   . ALA A 1 119 ? 28.495 35.283 53.693 1.00 17.07  ? 119  ALA A O   1 
ATOM   947  C  CB  . ALA A 1 119 ? 26.387 33.204 52.412 1.00 18.30  ? 119  ALA A CB  1 
ATOM   948  N  N   . GLN A 1 120 ? 26.459 35.387 54.664 1.00 13.90  ? 120  GLN A N   1 
ATOM   949  C  CA  . GLN A 1 120 ? 27.051 35.614 55.999 1.00 14.55  ? 120  GLN A CA  1 
ATOM   950  C  C   . GLN A 1 120 ? 28.050 34.513 56.326 1.00 14.67  ? 120  GLN A C   1 
ATOM   951  O  O   . GLN A 1 120 ? 27.784 33.328 56.078 1.00 16.95  ? 120  GLN A O   1 
ATOM   952  C  CB  . GLN A 1 120 ? 25.962 35.643 57.066 1.00 15.84  ? 120  GLN A CB  1 
ATOM   953  C  CG  . GLN A 1 120 ? 24.948 36.783 56.878 1.00 16.22  ? 120  GLN A CG  1 
ATOM   954  C  CD  . GLN A 1 120 ? 25.572 38.121 57.213 1.00 13.97  ? 120  GLN A CD  1 
ATOM   955  O  OE1 . GLN A 1 120 ? 25.813 38.489 58.380 1.00 15.57  ? 120  GLN A OE1 1 
ATOM   956  N  NE2 . GLN A 1 120 ? 25.858 38.905 56.191 1.00 15.60  ? 120  GLN A NE2 1 
ATOM   957  N  N   . LYS A 1 121 ? 29.200 34.883 56.867 1.00 16.65  ? 121  LYS A N   1 
ATOM   958  C  CA  . LYS A 1 121 ? 30.249 33.920 57.088 1.00 16.71  ? 121  LYS A CA  1 
ATOM   959  C  C   . LYS A 1 121 ? 30.073 33.077 58.332 1.00 18.29  ? 121  LYS A C   1 
ATOM   960  O  O   . LYS A 1 121 ? 30.776 32.068 58.560 1.00 23.31  ? 121  LYS A O   1 
ATOM   961  C  CB  . LYS A 1 121 ? 31.592 34.678 57.146 1.00 18.02  ? 121  LYS A CB  1 
ATOM   962  C  CG  . LYS A 1 121 ? 32.046 35.121 55.756 1.00 24.75  ? 121  LYS A CG  1 
ATOM   963  C  CD  . LYS A 1 121 ? 33.218 36.072 55.779 1.00 28.19  ? 121  LYS A CD  1 
ATOM   964  C  CE  . LYS A 1 121 ? 34.475 35.546 56.428 1.00 40.43  ? 121  LYS A CE  1 
ATOM   965  N  NZ  . LYS A 1 121 ? 35.605 36.538 56.277 1.00 49.99  ? 121  LYS A NZ  1 
ATOM   966  N  N   . GLY A 1 122 ? 29.132 33.479 59.148 1.00 18.94  ? 122  GLY A N   1 
ATOM   967  C  CA  . GLY A 1 122 ? 28.830 32.784 60.400 1.00 18.83  ? 122  GLY A CA  1 
ATOM   968  C  C   . GLY A 1 122 ? 27.574 33.390 60.991 1.00 17.38  ? 122  GLY A C   1 
ATOM   969  O  O   . GLY A 1 122 ? 27.014 34.305 60.401 1.00 16.77  ? 122  GLY A O   1 
ATOM   970  N  N   . ALA A 1 123 ? 27.123 32.910 62.143 1.00 17.62  ? 123  ALA A N   1 
ATOM   971  C  CA  . ALA A 1 123 ? 25.932 33.496 62.740 1.00 17.18  ? 123  ALA A CA  1 
ATOM   972  C  C   . ALA A 1 123 ? 26.075 34.995 62.945 1.00 16.51  ? 123  ALA A C   1 
ATOM   973  O  O   . ALA A 1 123 ? 27.120 35.609 63.185 1.00 17.31  ? 123  ALA A O   1 
ATOM   974  C  CB  . ALA A 1 123 ? 25.638 32.821 64.077 1.00 20.03  ? 123  ALA A CB  1 
ATOM   975  N  N   . PHE A 1 124 ? 24.919 35.642 62.874 1.00 13.71  ? 124  PHE A N   1 
ATOM   976  C  CA  . PHE A 1 124 ? 24.786 37.057 63.086 1.00 12.74  ? 124  PHE A CA  1 
ATOM   977  C  C   . PHE A 1 124 ? 23.627 37.285 64.075 1.00 13.15  ? 124  PHE A C   1 
ATOM   978  O  O   . PHE A 1 124 ? 22.481 36.907 63.823 1.00 14.42  ? 124  PHE A O   1 
ATOM   979  C  CB  . PHE A 1 124 ? 24.535 37.883 61.819 1.00 13.52  ? 124  PHE A CB  1 
ATOM   980  C  CG  . PHE A 1 124 ? 24.689 39.372 62.108 1.00 11.48  ? 124  PHE A CG  1 
ATOM   981  C  CD1 . PHE A 1 124 ? 23.603 40.153 62.505 1.00 14.86  ? 124  PHE A CD1 1 
ATOM   982  C  CD2 . PHE A 1 124 ? 25.924 39.975 62.025 1.00 15.18  ? 124  PHE A CD2 1 
ATOM   983  C  CE1 . PHE A 1 124 ? 23.757 41.483 62.848 1.00 14.75  ? 124  PHE A CE1 1 
ATOM   984  C  CE2 . PHE A 1 124 ? 26.093 41.313 62.346 1.00 15.87  ? 124  PHE A CE2 1 
ATOM   985  C  CZ  . PHE A 1 124 ? 25.008 42.072 62.779 1.00 14.57  ? 124  PHE A CZ  1 
ATOM   986  N  N   . THR A 1 125 ? 23.958 37.978 65.146 1.00 14.29  ? 125  THR A N   1 
ATOM   987  C  CA  . THR A 1 125 ? 23.063 38.479 66.176 1.00 14.23  ? 125  THR A CA  1 
ATOM   988  C  C   . THR A 1 125 ? 23.181 39.995 66.260 1.00 12.97  ? 125  THR A C   1 
ATOM   989  O  O   . THR A 1 125 ? 24.292 40.526 66.359 1.00 13.82  ? 125  THR A O   1 
ATOM   990  C  CB  . THR A 1 125 ? 23.407 37.807 67.524 1.00 14.82  ? 125  THR A CB  1 
ATOM   991  O  OG1 . THR A 1 125 ? 23.255 36.394 67.366 1.00 15.90  ? 125  THR A OG1 1 
ATOM   992  C  CG2 . THR A 1 125 ? 22.460 38.295 68.606 1.00 16.20  ? 125  THR A CG2 1 
ATOM   993  N  N   . LYS A 1 126 ? 22.063 40.711 66.231 1.00 14.56  ? 126  LYS A N   1 
ATOM   994  C  CA  . LYS A 1 126 ? 22.038 42.152 66.326 1.00 12.93  ? 126  LYS A CA  1 
ATOM   995  C  C   . LYS A 1 126 ? 22.617 42.617 67.666 1.00 11.96  ? 126  LYS A C   1 
ATOM   996  O  O   . LYS A 1 126 ? 22.699 41.804 68.603 1.00 12.78  ? 126  LYS A O   1 
ATOM   997  C  CB  . LYS A 1 126 ? 20.606 42.652 66.155 1.00 12.54  ? 126  LYS A CB  1 
ATOM   998  C  CG  . LYS A 1 126 ? 19.929 42.335 64.840 1.00 15.16  ? 126  LYS A CG  1 
ATOM   999  C  CD  . LYS A 1 126 ? 18.604 43.070 64.648 1.00 15.84  ? 126  LYS A CD  1 
ATOM   1000 C  CE  . LYS A 1 126 ? 17.965 42.788 63.290 1.00 15.94  ? 126  LYS A CE  1 
ATOM   1001 N  NZ  . LYS A 1 126 ? 16.590 43.345 63.195 1.00 15.56  ? 126  LYS A NZ  1 
ATOM   1002 N  N   . GLU A 1 127 ? 22.954 43.891 67.768 1.00 13.48  ? 127  GLU A N   1 
ATOM   1003 C  CA  . GLU A 1 127 ? 23.517 44.355 69.041 1.00 16.18  ? 127  GLU A CA  1 
ATOM   1004 C  C   . GLU A 1 127 ? 22.550 44.172 70.191 1.00 14.53  ? 127  GLU A C   1 
ATOM   1005 O  O   . GLU A 1 127 ? 23.047 43.987 71.309 1.00 17.59  ? 127  GLU A O   1 
ATOM   1006 C  CB  . GLU A 1 127 ? 23.989 45.801 68.932 1.00 23.14  ? 127  GLU A CB  1 
ATOM   1007 C  CG  . GLU A 1 127 ? 23.155 46.798 68.276 1.00 27.91  ? 127  GLU A CG  1 
ATOM   1008 C  CD  . GLU A 1 127 ? 23.719 48.210 68.225 1.00 20.07  ? 127  GLU A CD  1 
ATOM   1009 O  OE1 . GLU A 1 127 ? 22.861 49.071 68.365 1.00 22.84  ? 127  GLU A OE1 1 
ATOM   1010 O  OE2 . GLU A 1 127 ? 24.930 48.466 68.033 1.00 20.60  ? 127  GLU A OE2 1 
ATOM   1011 N  N   . ASP A 1 128 ? 21.235 44.176 70.033 1.00 15.33  ? 128  ASP A N   1 
ATOM   1012 C  CA  . ASP A 1 128 ? 20.349 44.008 71.198 1.00 16.79  ? 128  ASP A CA  1 
ATOM   1013 C  C   . ASP A 1 128 ? 20.059 42.544 71.513 1.00 15.29  ? 128  ASP A C   1 
ATOM   1014 O  O   . ASP A 1 128 ? 19.251 42.225 72.396 1.00 16.77  ? 128  ASP A O   1 
ATOM   1015 C  CB  . ASP A 1 128 ? 19.027 44.756 70.958 1.00 16.30  ? 128  ASP A CB  1 
ATOM   1016 C  CG  . ASP A 1 128 ? 18.084 44.116 69.970 1.00 17.49  ? 128  ASP A CG  1 
ATOM   1017 O  OD1 . ASP A 1 128 ? 18.477 43.146 69.294 1.00 17.57  ? 128  ASP A OD1 1 
ATOM   1018 O  OD2 . ASP A 1 128 ? 16.952 44.626 69.845 1.00 19.29  ? 128  ASP A OD2 1 
ATOM   1019 N  N   . GLY A 1 129 ? 20.716 41.643 70.774 1.00 15.85  ? 129  GLY A N   1 
ATOM   1020 C  CA  . GLY A 1 129 ? 20.532 40.210 71.022 1.00 15.38  ? 129  GLY A CA  1 
ATOM   1021 C  C   . GLY A 1 129 ? 19.598 39.453 70.121 1.00 16.15  ? 129  GLY A C   1 
ATOM   1022 O  O   . GLY A 1 129 ? 19.458 38.225 70.216 1.00 17.31  ? 129  GLY A O   1 
ATOM   1023 N  N   . GLU A 1 130 ? 18.951 40.180 69.209 1.00 15.64  ? 130  GLU A N   1 
ATOM   1024 C  CA  . GLU A 1 130 ? 18.054 39.568 68.244 1.00 15.98  ? 130  GLU A CA  1 
ATOM   1025 C  C   . GLU A 1 130 ? 18.853 38.731 67.251 1.00 15.46  ? 130  GLU A C   1 
ATOM   1026 O  O   . GLU A 1 130 ? 19.678 39.281 66.516 1.00 15.74  ? 130  GLU A O   1 
ATOM   1027 C  CB  A GLU A 1 130 ? 17.237 40.622 67.498 0.38 18.69  ? 130  GLU A CB  1 
ATOM   1028 C  CB  B GLU A 1 130 ? 17.219 40.594 67.491 0.62 17.15  ? 130  GLU A CB  1 
ATOM   1029 C  CG  A GLU A 1 130 ? 16.300 41.509 68.292 0.38 20.24  ? 130  GLU A CG  1 
ATOM   1030 C  CG  B GLU A 1 130 ? 16.293 40.024 66.424 0.62 18.32  ? 130  GLU A CG  1 
ATOM   1031 C  CD  A GLU A 1 130 ? 15.500 42.505 67.453 0.38 22.38  ? 130  GLU A CD  1 
ATOM   1032 C  CD  B GLU A 1 130 ? 15.758 41.112 65.500 0.62 18.41  ? 130  GLU A CD  1 
ATOM   1033 O  OE1 A GLU A 1 130 ? 14.935 42.060 66.417 0.38 26.42  ? 130  GLU A OE1 1 
ATOM   1034 O  OE1 B GLU A 1 130 ? 15.856 42.318 65.785 0.62 27.51  ? 130  GLU A OE1 1 
ATOM   1035 O  OE2 A GLU A 1 130 ? 15.409 43.710 67.794 0.38 13.15  ? 130  GLU A OE2 1 
ATOM   1036 O  OE2 B GLU A 1 130 ? 15.269 40.813 64.422 0.62 22.26  ? 130  GLU A OE2 1 
ATOM   1037 N  N   . LYS A 1 131 ? 18.599 37.446 67.207 1.00 17.21  ? 131  LYS A N   1 
ATOM   1038 C  CA  . LYS A 1 131 ? 19.255 36.554 66.270 1.00 16.13  ? 131  LYS A CA  1 
ATOM   1039 C  C   . LYS A 1 131 ? 18.715 36.794 64.871 1.00 16.27  ? 131  LYS A C   1 
ATOM   1040 O  O   . LYS A 1 131 ? 17.501 36.964 64.646 1.00 23.44  ? 131  LYS A O   1 
ATOM   1041 C  CB  A LYS A 1 131 ? 19.041 35.081 66.639 0.56 17.77  ? 131  LYS A CB  1 
ATOM   1042 C  CB  B LYS A 1 131 ? 19.032 35.133 66.784 0.44 17.14  ? 131  LYS A CB  1 
ATOM   1043 C  CG  A LYS A 1 131 ? 19.314 34.767 68.097 0.56 19.17  ? 131  LYS A CG  1 
ATOM   1044 C  CG  B LYS A 1 131 ? 20.035 34.636 67.798 0.44 18.78  ? 131  LYS A CG  1 
ATOM   1045 C  CD  A LYS A 1 131 ? 18.947 33.320 68.390 0.56 20.83  ? 131  LYS A CD  1 
ATOM   1046 C  CD  B LYS A 1 131 ? 19.714 33.198 68.184 0.44 22.07  ? 131  LYS A CD  1 
ATOM   1047 C  CE  A LYS A 1 131 ? 19.904 32.704 69.403 0.56 24.52  ? 131  LYS A CE  1 
ATOM   1048 C  CE  B LYS A 1 131 ? 19.361 33.108 69.665 0.44 22.51  ? 131  LYS A CE  1 
ATOM   1049 N  NZ  A LYS A 1 131 ? 19.680 33.263 70.760 0.56 31.60  ? 131  LYS A NZ  1 
ATOM   1050 N  NZ  B LYS A 1 131 ? 19.475 31.708 70.164 0.44 28.36  ? 131  LYS A NZ  1 
ATOM   1051 N  N   . VAL A 1 132 ? 19.636 36.823 63.925 1.00 15.18  ? 132  VAL A N   1 
ATOM   1052 C  CA  . VAL A 1 132 ? 19.307 37.057 62.535 1.00 17.11  ? 132  VAL A CA  1 
ATOM   1053 C  C   . VAL A 1 132 ? 19.578 35.825 61.664 1.00 15.31  ? 132  VAL A C   1 
ATOM   1054 O  O   . VAL A 1 132 ? 18.618 35.336 61.050 1.00 16.46  ? 132  VAL A O   1 
ATOM   1055 C  CB  . VAL A 1 132 ? 20.097 38.225 61.904 1.00 18.21  ? 132  VAL A CB  1 
ATOM   1056 C  CG1 . VAL A 1 132 ? 19.677 38.439 60.454 1.00 19.23  ? 132  VAL A CG1 1 
ATOM   1057 C  CG2 . VAL A 1 132 ? 19.891 39.470 62.720 1.00 18.35  ? 132  VAL A CG2 1 
ATOM   1058 N  N   . VAL A 1 133 ? 20.814 35.373 61.641 1.00 17.08  ? 133  VAL A N   1 
ATOM   1059 C  CA  . VAL A 1 133 ? 21.086 34.101 60.955 1.00 18.12  ? 133  VAL A CA  1 
ATOM   1060 C  C   . VAL A 1 133 ? 21.855 33.193 61.908 1.00 16.95  ? 133  VAL A C   1 
ATOM   1061 O  O   . VAL A 1 133 ? 22.663 33.695 62.702 1.00 17.06  ? 133  VAL A O   1 
ATOM   1062 C  CB  . VAL A 1 133 ? 21.791 34.228 59.596 1.00 23.22  ? 133  VAL A CB  1 
ATOM   1063 C  CG1 . VAL A 1 133 ? 21.004 35.178 58.683 1.00 26.55  ? 133  VAL A CG1 1 
ATOM   1064 C  CG2 . VAL A 1 133 ? 23.217 34.689 59.725 1.00 24.01  ? 133  VAL A CG2 1 
ATOM   1065 N  N   . ASP A 1 134 ? 21.589 31.894 61.833 1.00 20.18  ? 134  ASP A N   1 
ATOM   1066 C  CA  . ASP A 1 134 ? 22.337 30.943 62.678 1.00 19.05  ? 134  ASP A CA  1 
ATOM   1067 C  C   . ASP A 1 134 ? 23.637 30.527 61.999 1.00 17.07  ? 134  ASP A C   1 
ATOM   1068 O  O   . ASP A 1 134 ? 23.972 30.998 60.928 1.00 19.32  ? 134  ASP A O   1 
ATOM   1069 C  CB  . ASP A 1 134 ? 21.525 29.716 63.061 1.00 20.48  ? 134  ASP A CB  1 
ATOM   1070 C  CG  . ASP A 1 134 ? 21.108 28.812 61.942 1.00 25.16  ? 134  ASP A CG  1 
ATOM   1071 O  OD1 . ASP A 1 134 ? 20.197 27.960 62.083 1.00 29.16  ? 134  ASP A OD1 1 
ATOM   1072 O  OD2 . ASP A 1 134 ? 21.661 28.925 60.830 1.00 23.00  ? 134  ASP A OD2 1 
ATOM   1073 N  N   . GLU A 1 135 ? 24.414 29.653 62.604 1.00 21.30  ? 135  GLU A N   1 
ATOM   1074 C  CA  . GLU A 1 135 ? 25.757 29.346 62.112 1.00 22.73  ? 135  GLU A CA  1 
ATOM   1075 C  C   . GLU A 1 135 ? 25.654 28.628 60.775 1.00 25.94  ? 135  GLU A C   1 
ATOM   1076 O  O   . GLU A 1 135 ? 26.496 28.729 59.890 1.00 30.11  ? 135  GLU A O   1 
ATOM   1077 C  CB  . GLU A 1 135 ? 26.506 28.545 63.169 1.00 27.76  ? 135  GLU A CB  1 
ATOM   1078 C  CG  . GLU A 1 135 ? 27.990 28.366 62.921 1.00 34.00  ? 135  GLU A CG  1 
ATOM   1079 C  CD  . GLU A 1 135 ? 28.887 29.548 62.633 1.00 32.72  ? 135  GLU A CD  1 
ATOM   1080 O  OE1 . GLU A 1 135 ? 29.805 29.382 61.789 1.00 41.88  ? 135  GLU A OE1 1 
ATOM   1081 O  OE2 . GLU A 1 135 ? 28.734 30.648 63.197 1.00 27.78  ? 135  GLU A OE2 1 
ATOM   1082 N  N   . ALA A 1 136 ? 24.563 27.886 60.640 1.00 24.80  ? 136  ALA A N   1 
ATOM   1083 C  CA  . ALA A 1 136 ? 24.248 27.229 59.393 1.00 26.39  ? 136  ALA A CA  1 
ATOM   1084 C  C   . ALA A 1 136 ? 23.889 28.187 58.276 1.00 28.00  ? 136  ALA A C   1 
ATOM   1085 O  O   . ALA A 1 136 ? 23.993 27.779 57.090 1.00 31.87  ? 136  ALA A O   1 
ATOM   1086 C  CB  . ALA A 1 136 ? 23.106 26.231 59.651 1.00 30.04  ? 136  ALA A CB  1 
ATOM   1087 N  N   . GLY A 1 137 ? 23.500 29.411 58.574 1.00 23.43  ? 137  GLY A N   1 
ATOM   1088 C  CA  . GLY A 1 137 ? 23.117 30.404 57.575 1.00 21.69  ? 137  GLY A CA  1 
ATOM   1089 C  C   . GLY A 1 137 ? 21.632 30.638 57.371 1.00 21.35  ? 137  GLY A C   1 
ATOM   1090 O  O   . GLY A 1 137 ? 21.180 31.398 56.490 1.00 22.36  ? 137  GLY A O   1 
ATOM   1091 N  N   . LYS A 1 138 ? 20.827 29.978 58.211 1.00 20.51  ? 138  LYS A N   1 
ATOM   1092 C  CA  . LYS A 1 138 ? 19.395 30.084 58.064 1.00 20.77  ? 138  LYS A CA  1 
ATOM   1093 C  C   . LYS A 1 138 ? 18.921 31.333 58.765 1.00 20.41  ? 138  LYS A C   1 
ATOM   1094 O  O   . LYS A 1 138 ? 19.333 31.612 59.887 1.00 20.88  ? 138  LYS A O   1 
ATOM   1095 C  CB  . LYS A 1 138 ? 18.733 28.857 58.689 1.00 27.14  ? 138  LYS A CB  1 
ATOM   1096 C  CG  . LYS A 1 138 ? 17.248 28.799 58.464 1.00 36.00  ? 138  LYS A CG  1 
ATOM   1097 C  CD  . LYS A 1 138 ? 16.477 27.649 59.039 1.00 47.90  ? 138  LYS A CD  1 
ATOM   1098 C  CE  . LYS A 1 138 ? 17.252 26.757 59.968 1.00 61.02  ? 138  LYS A CE  1 
ATOM   1099 N  NZ  . LYS A 1 138 ? 16.926 27.012 61.412 1.00 84.99  ? 138  LYS A NZ  1 
ATOM   1100 N  N   . ARG A 1 139 ? 18.053 32.104 58.153 1.00 21.39  ? 139  ARG A N   1 
ATOM   1101 C  CA  . ARG A 1 139 ? 17.337 33.164 58.815 1.00 23.64  ? 139  ARG A CA  1 
ATOM   1102 C  C   . ARG A 1 139 ? 16.413 32.631 59.894 1.00 26.90  ? 139  ARG A C   1 
ATOM   1103 O  O   . ARG A 1 139 ? 15.630 31.697 59.712 1.00 35.49  ? 139  ARG A O   1 
ATOM   1104 C  CB  . ARG A 1 139 ? 16.446 33.886 57.809 1.00 27.94  ? 139  ARG A CB  1 
ATOM   1105 C  CG  . ARG A 1 139 ? 17.113 35.035 57.097 1.00 36.42  ? 139  ARG A CG  1 
ATOM   1106 C  CD  . ARG A 1 139 ? 17.259 36.185 58.067 1.00 31.59  ? 139  ARG A CD  1 
ATOM   1107 N  NE  . ARG A 1 139 ? 16.067 36.974 58.298 1.00 35.82  ? 139  ARG A NE  1 
ATOM   1108 C  CZ  . ARG A 1 139 ? 15.510 37.334 59.445 1.00 35.67  ? 139  ARG A CZ  1 
ATOM   1109 N  NH1 . ARG A 1 139 ? 15.997 36.985 60.648 1.00 40.90  ? 139  ARG A NH1 1 
ATOM   1110 N  NH2 . ARG A 1 139 ? 14.405 38.079 59.390 1.00 39.75  ? 139  ARG A NH2 1 
ATOM   1111 N  N   . LEU A 1 140 ? 16.487 33.286 61.047 1.00 27.58  ? 140  LEU A N   1 
ATOM   1112 C  CA  . LEU A 1 140 ? 15.519 32.856 62.041 1.00 29.65  ? 140  LEU A CA  1 
ATOM   1113 C  C   . LEU A 1 140 ? 14.215 33.625 61.858 1.00 33.55  ? 140  LEU A C   1 
ATOM   1114 O  O   . LEU A 1 140 ? 14.333 34.848 61.915 1.00 49.38  ? 140  LEU A O   1 
ATOM   1115 C  CB  . LEU A 1 140 ? 16.081 33.135 63.418 1.00 33.08  ? 140  LEU A CB  1 
ATOM   1116 C  CG  . LEU A 1 140 ? 17.189 32.137 63.790 1.00 37.72  ? 140  LEU A CG  1 
ATOM   1117 C  CD1 . LEU A 1 140 ? 18.532 32.798 63.604 1.00 35.78  ? 140  LEU A CD1 1 
ATOM   1118 C  CD2 . LEU A 1 140 ? 16.957 31.619 65.203 1.00 60.06  ? 140  LEU A CD2 1 
HETATM 1119 S  S   . SO4 B 2 .   ? 16.464 54.894 64.002 0.67 19.44  ? 201  SO4 A S   1 
HETATM 1120 O  O1  . SO4 B 2 .   ? 16.572 53.476 63.603 0.67 15.71  ? 201  SO4 A O1  1 
HETATM 1121 O  O2  . SO4 B 2 .   ? 17.531 55.298 64.910 0.67 20.11  ? 201  SO4 A O2  1 
HETATM 1122 O  O3  . SO4 B 2 .   ? 16.364 55.819 62.829 0.67 21.07  ? 201  SO4 A O3  1 
HETATM 1123 O  O4  . SO4 B 2 .   ? 15.255 55.133 64.821 0.67 21.25  ? 201  SO4 A O4  1 
HETATM 1124 S  S   . SO4 C 2 .   ? 10.821 52.599 60.364 0.61 27.71  ? 202  SO4 A S   1 
HETATM 1125 O  O1  . SO4 C 2 .   ? 11.585 51.477 60.910 0.61 42.91  ? 202  SO4 A O1  1 
HETATM 1126 O  O2  . SO4 C 2 .   ? 9.455  52.211 60.045 0.61 44.74  ? 202  SO4 A O2  1 
HETATM 1127 O  O3  . SO4 C 2 .   ? 10.844 53.856 61.127 0.61 39.35  ? 202  SO4 A O3  1 
HETATM 1128 O  O4  . SO4 C 2 .   ? 11.286 52.862 58.984 0.61 45.87  ? 202  SO4 A O4  1 
HETATM 1129 S  S   . SO4 D 2 .   ? 17.274 46.924 63.350 0.88 14.25  ? 203  SO4 A S   1 
HETATM 1130 O  O1  . SO4 D 2 .   ? 17.203 48.205 64.013 0.88 18.35  ? 203  SO4 A O1  1 
HETATM 1131 O  O2  . SO4 D 2 .   ? 16.547 46.982 62.079 0.88 17.55  ? 203  SO4 A O2  1 
HETATM 1132 O  O3  . SO4 D 2 .   ? 18.672 46.609 63.089 0.88 17.12  ? 203  SO4 A O3  1 
HETATM 1133 O  O4  . SO4 D 2 .   ? 16.630 45.911 64.238 0.88 14.03  ? 203  SO4 A O4  1 
HETATM 1134 CS CS  . CS  E 3 .   ? 35.119 40.171 49.509 0.10 43.20  ? 404  CS  A CS  1 
HETATM 1135 CS CS  . CS  F 3 .   ? 21.486 37.593 48.346 0.37 11.58  ? 401  CS  A CS  1 
HETATM 1136 CS CS  . CS  G 3 .   ? 16.455 47.918 68.699 0.20 17.13  ? 402  CS  A CS  1 
HETATM 1137 CS CS  . CS  H 3 .   ? 28.330 63.868 47.120 0.18 27.61  ? 403  CS  A CS  1 
HETATM 1138 CS CS  . CS  I 3 .   ? 19.423 73.035 65.226 0.22 42.73  ? 405  CS  A CS  1 
HETATM 1139 O  O   . HOH J 4 .   ? 17.933 51.956 65.615 1.00 21.16  ? 1001 HOH A O   1 
HETATM 1140 O  O   . HOH J 4 .   ? 19.120 54.421 66.829 1.00 25.48  ? 1002 HOH A O   1 
HETATM 1141 O  O   . HOH J 4 .   ? 25.752 44.961 64.992 1.00 13.52  ? 1003 HOH A O   1 
HETATM 1142 O  O   . HOH J 4 .   ? 19.881 45.595 67.759 1.00 16.64  ? 1004 HOH A O   1 
HETATM 1143 O  O   . HOH J 4 .   ? 7.505  76.136 61.314 1.00 16.70  ? 1005 HOH A O   1 
HETATM 1144 O  O   . HOH J 4 .   ? 22.851 37.349 52.236 1.00 14.74  ? 1006 HOH A O   1 
HETATM 1145 O  O   . HOH J 4 .   ? 25.306 38.189 53.453 1.00 16.71  ? 1007 HOH A O   1 
HETATM 1146 O  O   . HOH J 4 .   ? 18.199 43.437 74.630 1.00 20.09  ? 1008 HOH A O   1 
HETATM 1147 O  O   . HOH J 4 .   ? 26.289 60.409 58.783 1.00 15.07  ? 1009 HOH A O   1 
HETATM 1148 O  O   . HOH J 4 .   ? 5.722  67.520 60.370 1.00 15.85  ? 1010 HOH A O   1 
HETATM 1149 O  O   . HOH J 4 .   ? 29.017 33.950 47.046 1.00 20.91  ? 1011 HOH A O   1 
HETATM 1150 O  O   . HOH J 4 .   ? 4.756  72.977 49.530 1.00 17.45  ? 1012 HOH A O   1 
HETATM 1151 O  O   . HOH J 4 .   ? 26.793 47.235 66.388 1.00 14.59  ? 1013 HOH A O   1 
HETATM 1152 O  O   . HOH J 4 .   ? 23.581 35.297 54.134 1.00 19.45  ? 1014 HOH A O   1 
HETATM 1153 O  O   . HOH J 4 .   ? 25.798 44.216 71.544 1.00 15.41  ? 1015 HOH A O   1 
HETATM 1154 O  O   . HOH J 4 .   ? 18.678 60.585 58.975 1.00 16.35  ? 1016 HOH A O   1 
HETATM 1155 O  O   . HOH J 4 .   ? 28.826 40.426 50.000 1.00 18.94  ? 1017 HOH A O   1 
HETATM 1156 O  O   . HOH J 4 .   ? 23.997 40.729 71.139 1.00 19.34  ? 1018 HOH A O   1 
HETATM 1157 O  O   . HOH J 4 .   ? 7.473  73.264 49.851 1.00 14.37  ? 1019 HOH A O   1 
HETATM 1158 O  O   . HOH J 4 .   ? 9.885  73.353 48.519 1.00 15.57  ? 1020 HOH A O   1 
HETATM 1159 O  O   . HOH J 4 .   ? 28.211 61.739 49.254 1.00 20.45  ? 1021 HOH A O   1 
HETATM 1160 O  O   . HOH J 4 .   ? 31.673 60.571 54.473 1.00 20.07  ? 1022 HOH A O   1 
HETATM 1161 O  O   . HOH J 4 .   ? 28.030 35.886 65.958 1.00 17.54  ? 1023 HOH A O   1 
HETATM 1162 O  O   . HOH J 4 .   ? 5.010  63.784 47.328 1.00 22.44  ? 1024 HOH A O   1 
HETATM 1163 O  O   . HOH J 4 .   ? 3.274  65.559 50.279 1.00 18.16  ? 1025 HOH A O   1 
HETATM 1164 O  O   . HOH J 4 .   ? 7.886  69.546 42.155 1.00 17.11  ? 1026 HOH A O   1 
HETATM 1165 O  O   . HOH J 4 .   ? 15.285 74.101 52.772 1.00 17.52  ? 1027 HOH A O   1 
HETATM 1166 O  O   . HOH J 4 .   ? 27.045 59.895 47.306 1.00 19.59  ? 1028 HOH A O   1 
HETATM 1167 O  O   . HOH J 4 .   ? 7.903  66.743 41.725 1.00 16.87  ? 1029 HOH A O   1 
HETATM 1168 O  O   . HOH J 4 .   ? 27.813 42.252 47.922 1.00 20.73  ? 1030 HOH A O   1 
HETATM 1169 O  O   . HOH J 4 .   ? 12.291 72.028 48.940 1.00 16.51  ? 1031 HOH A O   1 
HETATM 1170 O  O   . HOH J 4 .   ? 14.253 72.972 60.837 1.00 24.41  ? 1032 HOH A O   1 
HETATM 1171 O  O   . HOH J 4 .   ? 14.632 49.821 49.547 1.00 18.48  ? 1033 HOH A O   1 
HETATM 1172 O  O   . HOH J 4 .   ? 11.175 56.771 56.292 1.00 19.38  ? 1034 HOH A O   1 
HETATM 1173 O  O   . HOH J 4 .   ? 25.425 35.057 66.807 1.00 20.28  ? 1035 HOH A O   1 
HETATM 1174 O  O   . HOH J 4 .   ? 18.379 49.184 66.338 1.00 17.25  ? 1036 HOH A O   1 
HETATM 1175 O  O   . HOH J 4 .   ? 23.992 36.408 49.958 1.00 16.36  ? 1037 HOH A O   1 
HETATM 1176 O  O   . HOH J 4 .   ? 25.432 32.051 55.927 1.00 24.55  ? 1038 HOH A O   1 
HETATM 1177 O  O   . HOH J 4 .   ? 14.774 72.996 50.372 1.00 26.15  ? 1039 HOH A O   1 
HETATM 1178 O  O   . HOH J 4 .   ? 33.422 47.764 49.099 1.00 22.39  ? 1040 HOH A O   1 
HETATM 1179 O  O   . HOH J 4 .   ? 6.485  60.431 47.600 1.00 19.10  ? 1041 HOH A O   1 
HETATM 1180 O  O   . HOH J 4 .   ? 3.293  71.088 46.487 1.00 15.43  ? 1042 HOH A O   1 
HETATM 1181 O  O   . HOH J 4 .   ? 22.847 32.712 54.909 1.00 19.38  ? 1043 HOH A O   1 
HETATM 1182 O  O   . HOH J 4 .   ? 16.779 72.225 43.390 1.00 20.87  ? 1044 HOH A O   1 
HETATM 1183 O  O   . HOH J 4 .   ? 29.155 48.529 66.002 1.00 20.72  ? 1045 HOH A O   1 
HETATM 1184 O  O   . HOH J 4 .   ? 5.109  72.701 61.122 1.00 18.71  ? 1046 HOH A O   1 
HETATM 1185 O  O   . HOH J 4 .   ? 16.757 66.840 65.001 1.00 23.95  ? 1047 HOH A O   1 
HETATM 1186 O  O   . HOH J 4 .   ? 22.179 34.314 65.441 1.00 19.65  ? 1048 HOH A O   1 
HETATM 1187 O  O   . HOH J 4 .   ? 20.935 36.362 71.482 1.00 24.88  ? 1049 HOH A O   1 
HETATM 1188 O  O   . HOH J 4 .   ? 21.022 56.704 54.488 1.00 20.41  ? 1050 HOH A O   1 
HETATM 1189 O  O   . HOH J 4 .   ? 6.364  61.069 56.085 1.00 22.42  ? 1051 HOH A O   1 
HETATM 1190 O  O   . HOH J 4 .   ? 27.662 61.154 61.235 1.00 19.08  ? 1052 HOH A O   1 
HETATM 1191 O  O   . HOH J 4 .   ? 23.355 66.621 41.061 1.00 27.26  ? 1053 HOH A O   1 
HETATM 1192 O  O   . HOH J 4 .   ? 33.603 57.413 56.213 1.00 25.17  ? 1054 HOH A O   1 
HETATM 1193 O  O   . HOH J 4 .   ? 7.713  63.534 63.577 1.00 22.33  ? 1055 HOH A O   1 
HETATM 1194 O  O   . HOH J 4 .   ? 13.365 42.856 62.271 1.00 29.40  ? 1056 HOH A O   1 
HETATM 1195 O  O   . HOH J 4 .   ? 20.591 67.960 58.544 1.00 21.68  ? 1057 HOH A O   1 
HETATM 1196 O  O   . HOH J 4 .   ? 33.547 52.186 60.632 1.00 22.31  ? 1058 HOH A O   1 
HETATM 1197 O  O   . HOH J 4 .   ? 5.641  65.965 62.607 1.00 19.31  ? 1059 HOH A O   1 
HETATM 1198 O  O   . HOH J 4 .   ? 22.632 35.057 69.803 1.00 19.78  ? 1060 HOH A O   1 
HETATM 1199 O  O   . HOH J 4 .   ? 5.092  64.467 43.438 1.00 20.92  ? 1061 HOH A O   1 
HETATM 1200 O  O   . HOH J 4 .   ? 30.075 60.692 62.378 1.00 27.37  ? 1062 HOH A O   1 
HETATM 1201 O  O   . HOH J 4 .   ? 4.081  62.349 49.263 1.00 21.24  ? 1063 HOH A O   1 
HETATM 1202 O  O   . HOH J 4 .   ? 20.335 48.179 67.999 1.00 19.76  ? 1064 HOH A O   1 
HETATM 1203 O  O   . HOH J 4 .   ? 21.735 53.147 43.424 1.00 23.57  ? 1065 HOH A O   1 
HETATM 1204 O  O   . HOH J 4 .   ? 11.101 57.843 60.527 1.00 26.42  ? 1066 HOH A O   1 
HETATM 1205 O  O   . HOH J 4 .   ? 34.922 54.510 53.476 1.00 23.73  ? 1067 HOH A O   1 
HETATM 1206 O  O   . HOH J 4 .   ? 24.337 41.586 73.543 1.00 25.94  ? 1068 HOH A O   1 
HETATM 1207 O  O   . HOH J 4 .   ? 8.398  59.030 55.758 1.00 19.51  ? 1069 HOH A O   1 
HETATM 1208 O  O   . HOH J 4 .   ? 21.998 27.730 55.218 1.00 28.29  ? 1070 HOH A O   1 
HETATM 1209 O  O   . HOH J 4 .   ? 2.551  72.030 60.058 1.00 23.56  ? 1071 HOH A O   1 
HETATM 1210 O  O   . HOH J 4 .   ? 17.511 74.481 63.150 1.00 27.40  ? 1072 HOH A O   1 
HETATM 1211 O  O   . HOH J 4 .   ? 21.216 53.734 68.700 1.00 23.89  ? 1073 HOH A O   1 
HETATM 1212 O  O   . HOH J 4 .   ? 16.426 36.374 68.937 1.00 26.33  ? 1074 HOH A O   1 
HETATM 1213 O  O   . HOH J 4 .   ? 17.257 45.556 66.874 1.00 20.51  ? 1075 HOH A O   1 
HETATM 1214 O  O   . HOH J 4 .   ? 7.181  53.395 49.004 1.00 24.59  ? 1076 HOH A O   1 
HETATM 1215 O  O   . HOH J 4 .   ? 29.687 52.853 63.432 1.00 26.13  ? 1077 HOH A O   1 
HETATM 1216 O  O   . HOH J 4 .   ? 22.257 31.647 66.391 1.00 28.10  ? 1078 HOH A O   1 
HETATM 1217 O  O   . HOH J 4 .   ? 10.134 53.790 54.596 1.00 24.29  ? 1079 HOH A O   1 
HETATM 1218 O  O   . HOH J 4 .   ? -2.062 68.999 48.841 1.00 24.72  ? 1080 HOH A O   1 
HETATM 1219 O  O   . HOH J 4 .   ? 23.434 68.367 44.029 1.00 27.10  ? 1081 HOH A O   1 
HETATM 1220 O  O   . HOH J 4 .   ? 17.901 47.947 43.517 1.00 23.89  ? 1082 HOH A O   1 
HETATM 1221 O  O   . HOH J 4 .   ? 7.994  58.972 44.812 1.00 24.43  ? 1083 HOH A O   1 
HETATM 1222 O  O   . HOH J 4 .   ? 25.865 60.738 63.672 1.00 21.77  ? 1084 HOH A O   1 
HETATM 1223 O  O   . HOH J 4 .   ? 13.513 48.645 52.046 1.00 32.57  ? 1085 HOH A O   1 
HETATM 1224 O  O   . HOH J 4 .   ? 21.264 49.901 42.474 1.00 24.96  ? 1086 HOH A O   1 
HETATM 1225 O  O   . HOH J 4 .   ? 33.576 56.318 58.757 1.00 24.84  ? 1087 HOH A O   1 
HETATM 1226 O  O   . HOH J 4 .   ? 13.864 58.879 41.633 1.00 23.95  ? 1088 HOH A O   1 
HETATM 1227 O  O   . HOH J 4 .   ? 17.462 37.830 51.622 1.00 26.42  ? 1089 HOH A O   1 
HETATM 1228 O  O   . HOH J 4 .   ? 18.420 71.504 46.640 1.00 33.29  ? 1090 HOH A O   1 
HETATM 1229 O  O   . HOH J 4 .   ? 32.227 39.394 50.521 1.00 35.82  ? 1091 HOH A O   1 
HETATM 1230 O  O   . HOH J 4 .   ? 32.806 37.808 59.867 1.00 24.13  ? 1092 HOH A O   1 
HETATM 1231 O  O   . HOH J 4 .   ? 17.299 74.282 66.898 1.00 28.53  ? 1093 HOH A O   1 
HETATM 1232 O  O   . HOH J 4 .   ? 24.058 54.679 43.306 1.00 26.18  ? 1094 HOH A O   1 
HETATM 1233 O  O   . HOH J 4 .   ? 35.538 51.509 55.393 1.00 29.06  ? 1095 HOH A O   1 
HETATM 1234 O  O   . HOH J 4 .   ? 11.563 52.703 56.713 1.00 30.45  ? 1096 HOH A O   1 
HETATM 1235 O  O   . HOH J 4 .   ? 11.676 57.067 41.750 1.00 27.16  ? 1097 HOH A O   1 
HETATM 1236 O  O   . HOH J 4 .   ? 32.405 60.627 51.992 1.00 26.73  ? 1098 HOH A O   1 
HETATM 1237 O  O   . HOH J 4 .   ? 26.163 30.455 66.904 1.00 29.38  ? 1099 HOH A O   1 
HETATM 1238 O  O   . HOH J 4 .   ? 33.353 57.911 52.030 1.00 31.40  ? 1100 HOH A O   1 
HETATM 1239 O  O   . HOH J 4 .   ? 23.882 29.794 65.565 1.00 27.20  ? 1101 HOH A O   1 
HETATM 1240 O  O   . HOH J 4 .   ? 18.976 61.242 63.415 1.00 33.43  ? 1102 HOH A O   1 
HETATM 1241 O  O   . HOH J 4 .   ? 11.396 46.792 55.014 1.00 29.99  ? 1103 HOH A O   1 
HETATM 1242 O  O   . HOH J 4 .   ? 24.470 67.259 48.113 1.00 27.80  ? 1104 HOH A O   1 
HETATM 1243 O  O   . HOH J 4 .   ? -1.986 65.869 54.986 1.00 28.88  ? 1105 HOH A O   1 
HETATM 1244 O  O   . HOH J 4 .   ? 16.291 39.814 54.407 1.00 31.74  ? 1106 HOH A O   1 
HETATM 1245 O  O   . HOH J 4 .   ? 23.068 70.378 52.764 1.00 33.59  ? 1107 HOH A O   1 
HETATM 1246 O  O   . HOH J 4 .   ? 30.970 35.582 61.710 1.00 32.58  ? 1108 HOH A O   1 
HETATM 1247 O  O   . HOH J 4 .   ? 31.865 54.565 60.451 1.00 28.53  ? 1109 HOH A O   1 
HETATM 1248 O  O   . HOH J 4 .   ? 28.566 51.038 45.713 1.00 34.21  ? 1110 HOH A O   1 
HETATM 1249 O  O   . HOH J 4 .   ? 2.404  64.287 46.397 1.00 32.91  ? 1111 HOH A O   1 
HETATM 1250 O  O   . HOH J 4 .   ? 12.537 41.031 58.552 1.00 33.55  ? 1112 HOH A O   1 
HETATM 1251 O  O   . HOH J 4 .   ? 17.379 61.439 65.374 1.00 31.44  ? 1113 HOH A O   1 
HETATM 1252 O  O   . HOH J 4 .   ? 0.575  66.329 47.517 1.00 26.81  ? 1114 HOH A O   1 
HETATM 1253 O  O   . HOH J 4 .   ? 25.896 31.700 58.709 1.00 30.50  ? 1115 HOH A O   1 
HETATM 1254 O  O   . HOH J 4 .   ? 12.447 61.018 42.234 1.00 31.75  ? 1116 HOH A O   1 
HETATM 1255 O  O   . HOH J 4 .   ? 31.953 58.732 62.671 1.00 28.52  ? 1117 HOH A O   1 
HETATM 1256 O  O   . HOH J 4 .   ? 19.282 70.956 59.210 1.00 39.97  ? 1118 HOH A O   1 
HETATM 1257 O  O   . HOH J 4 .   ? 19.599 41.792 42.223 1.00 31.39  ? 1119 HOH A O   1 
HETATM 1258 O  O   . HOH J 4 .   ? 28.254 66.121 50.127 1.00 33.02  ? 1120 HOH A O   1 
HETATM 1259 O  O   . HOH J 4 .   ? 23.413 26.513 62.795 1.00 35.30  ? 1121 HOH A O   1 
HETATM 1260 O  O   . HOH J 4 .   ? 21.654 70.536 43.035 1.00 31.13  ? 1122 HOH A O   1 
HETATM 1261 O  O   . HOH J 4 .   ? 13.759 64.807 40.201 1.00 28.99  ? 1123 HOH A O   1 
HETATM 1262 O  O   . HOH J 4 .   ? 18.065 66.656 39.472 1.00 37.62  ? 1124 HOH A O   1 
HETATM 1263 O  O   . HOH J 4 .   ? 18.092 69.055 65.939 1.00 39.16  ? 1125 HOH A O   1 
HETATM 1264 O  O   . HOH J 4 .   ? 11.547 50.088 55.887 1.00 35.96  ? 1126 HOH A O   1 
HETATM 1265 O  O   . HOH J 4 .   ? 30.136 33.757 52.299 1.00 35.84  ? 1127 HOH A O   1 
HETATM 1266 O  O   . HOH J 4 .   ? 23.258 67.154 58.932 1.00 34.58  ? 1128 HOH A O   1 
HETATM 1267 O  O   . HOH J 4 .   ? 21.297 58.104 69.325 1.00 32.07  ? 1129 HOH A O   1 
HETATM 1268 O  O   . HOH J 4 .   ? 16.926 72.306 61.928 1.00 31.86  ? 1130 HOH A O   1 
HETATM 1269 O  O   . HOH J 4 .   ? 24.889 62.942 64.721 1.00 39.16  ? 1131 HOH A O   1 
HETATM 1270 O  O   . HOH J 4 .   ? 34.513 38.751 57.492 1.00 41.92  ? 1132 HOH A O   1 
HETATM 1271 O  O   . HOH J 4 .   ? 11.280 54.850 43.504 1.00 36.30  ? 1133 HOH A O   1 
HETATM 1272 O  O   . HOH J 4 .   ? 22.726 66.024 62.196 1.00 36.89  ? 1134 HOH A O   1 
HETATM 1273 O  O   . HOH J 4 .   ? 25.674 68.418 55.813 1.00 35.58  ? 1135 HOH A O   1 
HETATM 1274 O  O   . HOH J 4 .   ? 23.369 60.289 69.527 1.00 32.22  ? 1136 HOH A O   1 
HETATM 1275 O  O   . HOH J 4 .   ? 3.824  59.220 48.582 1.00 33.16  ? 1137 HOH A O   1 
HETATM 1276 O  O   . HOH J 4 .   ? 23.581 32.571 69.876 1.00 35.11  ? 1138 HOH A O   1 
HETATM 1277 O  O   . HOH J 4 .   ? 36.655 44.412 51.337 1.00 32.18  ? 1139 HOH A O   1 
HETATM 1278 O  O   . HOH J 4 .   ? 19.897 60.729 38.800 1.00 33.35  ? 1140 HOH A O   1 
HETATM 1279 O  O   . HOH J 4 .   ? 4.287  61.794 60.063 1.00 34.08  ? 1141 HOH A O   1 
HETATM 1280 O  O   . HOH J 4 .   ? 20.525 70.469 40.724 1.00 35.09  ? 1142 HOH A O   1 
HETATM 1281 O  O   . HOH J 4 .   ? 34.802 42.095 56.385 1.00 33.75  ? 1143 HOH A O   1 
HETATM 1282 O  O   . HOH J 4 .   ? 33.241 58.048 49.349 1.00 38.45  ? 1144 HOH A O   1 
HETATM 1283 O  O   . HOH J 4 .   ? 20.157 72.203 44.897 1.00 32.89  ? 1145 HOH A O   1 
HETATM 1284 O  O   . HOH J 4 .   ? 12.119 55.735 60.779 1.00 32.43  ? 1146 HOH A O   1 
HETATM 1285 O  O   . HOH J 4 .   ? 18.693 68.941 62.976 1.00 50.95  ? 1147 HOH A O   1 
HETATM 1286 O  O   . HOH J 4 .   ? 27.658 60.129 65.578 1.00 36.72  ? 1148 HOH A O   1 
HETATM 1287 O  O   . HOH J 4 .   ? 15.441 73.825 58.842 1.00 40.26  ? 1149 HOH A O   1 
HETATM 1288 O  O   . HOH J 4 .   ? 0.975  62.895 54.467 1.00 41.54  ? 1150 HOH A O   1 
HETATM 1289 O  O   . HOH J 4 .   ? 7.711  54.471 54.883 1.00 47.58  ? 1151 HOH A O   1 
HETATM 1290 O  O   . HOH J 4 .   ? 23.343 69.053 49.930 1.00 36.36  ? 1152 HOH A O   1 
HETATM 1291 O  O   . HOH J 4 .   ? 3.824  59.942 56.234 1.00 32.38  ? 1153 HOH A O   1 
HETATM 1292 O  O   . HOH J 4 .   ? 22.389 61.597 67.204 1.00 40.64  ? 1154 HOH A O   1 
HETATM 1293 O  O   . HOH J 4 .   ? 35.630 54.755 58.578 1.00 38.37  ? 1155 HOH A O   1 
HETATM 1294 O  O   . HOH J 4 .   ? 33.638 50.193 47.962 1.00 36.28  ? 1156 HOH A O   1 
HETATM 1295 O  O   . HOH J 4 .   ? 22.017 61.119 64.692 1.00 37.38  ? 1157 HOH A O   1 
HETATM 1296 O  O   . HOH J 4 .   ? 35.734 44.484 57.012 1.00 32.50  ? 1158 HOH A O   1 
HETATM 1297 O  O   . HOH J 4 .   ? 33.909 60.157 56.072 1.00 27.71  ? 1159 HOH A O   1 
HETATM 1298 O  O   . HOH J 4 .   ? 2.258  61.971 57.824 1.00 39.58  ? 1160 HOH A O   1 
HETATM 1299 O  O   . HOH J 4 .   ? 27.721 57.852 67.279 1.00 53.59  ? 1161 HOH A O   1 
HETATM 1300 O  O   . HOH J 4 .   ? 30.769 61.180 49.649 1.00 31.03  ? 1162 HOH A O   1 
HETATM 1301 O  O   . HOH J 4 .   ? 33.001 33.352 61.016 1.00 48.63  ? 1163 HOH A O   1 
HETATM 1302 O  O   . HOH J 4 .   ? 4.439  54.303 49.394 1.00 58.90  ? 1164 HOH A O   1 
HETATM 1303 O  O   . HOH J 4 .   ? 10.010 63.623 39.841 1.00 38.33  ? 1165 HOH A O   1 
HETATM 1304 O  O   . HOH J 4 .   ? 12.741 62.678 40.632 1.00 37.60  ? 1166 HOH A O   1 
HETATM 1305 O  O   . HOH J 4 .   ? 12.727 58.218 66.502 1.00 44.26  ? 1167 HOH A O   1 
HETATM 1306 O  O   . HOH J 4 .   ? 14.828 49.424 65.381 1.00 35.07  ? 1168 HOH A O   1 
HETATM 1307 O  O   . HOH J 4 .   ? 3.420  62.454 44.946 1.00 41.32  ? 1169 HOH A O   1 
HETATM 1308 O  O   . HOH J 4 .   ? 31.923 54.766 63.274 1.00 36.49  ? 1170 HOH A O   1 
HETATM 1309 O  O   . HOH J 4 .   ? 34.653 62.201 51.854 1.00 41.57  ? 1171 HOH A O   1 
HETATM 1310 O  O   . HOH J 4 .   ? 12.639 49.095 60.299 1.00 29.61  ? 1172 HOH A O   1 
HETATM 1311 O  O   . HOH J 4 .   ? 14.650 49.145 61.732 1.00 34.98  ? 1173 HOH A O   1 
HETATM 1312 O  O   . HOH J 4 .   ? 19.882 26.079 56.605 1.00 38.79  ? 1174 HOH A O   1 
HETATM 1313 O  O   . HOH J 4 .   ? 28.171 48.579 43.423 1.00 41.29  ? 1175 HOH A O   1 
HETATM 1314 O  O   . HOH J 4 .   ? 23.203 27.202 66.060 1.00 55.90  ? 1176 HOH A O   1 
HETATM 1315 O  O   . HOH J 4 .   ? 13.737 46.598 69.498 1.00 41.09  ? 1177 HOH A O   1 
HETATM 1316 O  O   . HOH J 4 .   ? 14.475 47.978 44.193 1.00 58.73  ? 1178 HOH A O   1 
HETATM 1317 O  O   . HOH J 4 .   ? 25.925 55.713 45.637 1.00 39.66  ? 1179 HOH A O   1 
HETATM 1318 O  O   . HOH J 4 .   ? 7.528  53.051 58.270 1.00 49.40  ? 1180 HOH A O   1 
HETATM 1319 O  O   . HOH J 4 .   ? 7.466  52.069 51.196 1.00 36.62  ? 1181 HOH A O   1 
HETATM 1320 O  O   . HOH J 4 .   ? 30.417 54.970 46.539 1.00 44.18  ? 1182 HOH A O   1 
HETATM 1321 O  O   . HOH J 4 .   ? 15.685 42.317 74.000 1.00 47.23  ? 1183 HOH A O   1 
HETATM 1322 O  O   . HOH J 4 .   ? 29.655 34.562 63.426 1.00 35.43  ? 1184 HOH A O   1 
HETATM 1323 O  O   . HOH J 4 .   ? 27.245 66.597 47.015 1.00 43.87  ? 1185 HOH A O   1 
HETATM 1324 O  O   . HOH J 4 .   ? 15.738 74.260 44.898 1.00 36.80  ? 1186 HOH A O   1 
HETATM 1325 O  O   . HOH J 4 .   ? 25.891 29.650 54.442 1.00 40.48  ? 1187 HOH A O   1 
HETATM 1326 O  O   . HOH J 4 .   ? 0.751  62.626 48.282 1.00 54.63  ? 1188 HOH A O   1 
HETATM 1327 O  O   . HOH J 4 .   ? 35.692 53.964 56.047 1.00 45.49  ? 1189 HOH A O   1 
HETATM 1328 O  O   . HOH J 4 .   ? 4.324  57.450 49.951 1.00 37.85  ? 1190 HOH A O   1 
HETATM 1329 O  O   . HOH J 4 .   ? 13.517 49.674 41.591 1.00 38.66  ? 1191 HOH A O   1 
HETATM 1330 O  O   . HOH J 4 .   ? 21.829 63.881 63.747 1.00 36.91  ? 1192 HOH A O   1 
HETATM 1331 O  O   . HOH J 4 .   ? 13.996 58.480 38.711 1.00 38.54  ? 1193 HOH A O   1 
HETATM 1332 O  O   . HOH J 4 .   ? 26.226 54.109 43.894 1.00 59.81  ? 1194 HOH A O   1 
HETATM 1333 O  O   . HOH J 4 .   ? 16.499 41.272 71.679 1.00 49.54  ? 1195 HOH A O   1 
HETATM 1334 O  O   . HOH J 4 .   ? 29.882 43.165 46.605 1.00 35.39  ? 1196 HOH A O   1 
HETATM 1335 O  O   . HOH J 4 .   ? 32.789 35.762 51.959 1.00 41.41  ? 1197 HOH A O   1 
HETATM 1336 O  O   . HOH J 4 .   ? 20.631 68.000 61.533 1.00 72.84  ? 1198 HOH A O   1 
HETATM 1337 O  O   . HOH J 4 .   ? 31.627 57.250 64.592 1.00 40.09  ? 1199 HOH A O   1 
HETATM 1338 O  O   . HOH J 4 .   ? 5.013  56.932 52.598 1.00 49.92  ? 1200 HOH A O   1 
HETATM 1339 O  O   . HOH J 4 .   ? 11.676 48.175 47.054 1.00 68.99  ? 1201 HOH A O   1 
HETATM 1340 O  O   . HOH J 4 .   ? 23.795 47.210 39.870 1.00 35.41  ? 1202 HOH A O   1 
HETATM 1341 O  O   . HOH J 4 .   ? 13.887 52.694 65.187 1.00 41.10  ? 1203 HOH A O   1 
HETATM 1342 O  O   . HOH J 4 .   ? 36.721 49.487 51.382 1.00 45.84  ? 1204 HOH A O   1 
HETATM 1343 O  O   . HOH J 4 .   ? 30.916 37.055 44.958 1.00 43.48  ? 1205 HOH A O   1 
HETATM 1344 O  O   . HOH J 4 .   ? 11.384 49.549 52.619 1.00 40.98  ? 1206 HOH A O   1 
HETATM 1345 O  O   . HOH J 4 .   ? 19.540 25.780 61.248 1.00 37.98  ? 1207 HOH A O   1 
HETATM 1346 O  O   . HOH J 4 .   ? 5.700  57.000 44.376 1.00 50.46  ? 1208 HOH A O   1 
HETATM 1347 O  O   . HOH J 4 .   ? 13.389 45.990 50.801 1.00 37.49  ? 1209 HOH A O   1 
HETATM 1348 O  O   . HOH J 4 .   ? 19.102 27.635 64.626 1.00 42.38  ? 1210 HOH A O   1 
HETATM 1349 O  O   . HOH J 4 .   ? 23.870 48.597 42.121 1.00 41.83  ? 1211 HOH A O   1 
HETATM 1350 O  O   . HOH J 4 .   ? 14.050 57.118 64.977 1.00 47.04  ? 1212 HOH A O   1 
HETATM 1351 O  O   . HOH J 4 .   ? -1.583 63.051 47.321 1.00 51.07  ? 1213 HOH A O   1 
HETATM 1352 O  O   . HOH J 4 .   ? 13.956 41.513 52.553 1.00 42.86  ? 1214 HOH A O   1 
HETATM 1353 O  O   . HOH J 4 .   ? 11.183 43.869 55.263 1.00 39.28  ? 1215 HOH A O   1 
HETATM 1354 O  O   . HOH J 4 .   ? 14.933 75.382 67.272 1.00 51.03  ? 1216 HOH A O   1 
HETATM 1355 O  O   . HOH J 4 .   ? 23.748 72.760 50.554 1.00 52.58  ? 1217 HOH A O   1 
HETATM 1356 O  O   . HOH J 4 .   ? 31.926 62.664 61.896 1.00 46.71  ? 1218 HOH A O   1 
HETATM 1357 O  O   . HOH J 4 .   ? 19.110 38.194 73.965 1.00 62.47  ? 1219 HOH A O   1 
HETATM 1358 O  O   . HOH J 4 .   ? 16.959 36.120 71.973 1.00 49.17  ? 1220 HOH A O   1 
HETATM 1359 O  O   . HOH J 4 .   ? 29.301 58.902 45.898 1.00 35.89  ? 1221 HOH A O   1 
HETATM 1360 O  O   . HOH J 4 .   ? 17.916 44.207 43.905 1.00 38.84  ? 1222 HOH A O   1 
HETATM 1361 O  O   . HOH J 4 .   ? 29.050 30.800 55.491 1.00 45.45  ? 1223 HOH A O   1 
HETATM 1362 O  O   . HOH J 4 .   ? 25.807 53.157 41.845 1.00 51.98  ? 1224 HOH A O   1 
HETATM 1363 O  O   . HOH J 4 .   ? 6.640  51.284 46.503 1.00 71.27  ? 1225 HOH A O   1 
HETATM 1364 O  O   . HOH J 4 .   ? 17.064 26.098 56.031 1.00 49.48  ? 1226 HOH A O   1 
HETATM 1365 O  O   . HOH J 4 .   ? 28.614 31.028 65.810 1.00 40.98  ? 1227 HOH A O   1 
HETATM 1366 O  O   . HOH J 4 .   ? 16.096 39.213 62.990 1.00 35.89  ? 1228 HOH A O   1 
HETATM 1367 O  O   . HOH J 4 .   ? 9.769  51.926 52.705 1.00 44.57  ? 1229 HOH A O   1 
HETATM 1368 O  O   . HOH J 4 .   ? 9.659  55.865 58.300 1.00 37.91  ? 1230 HOH A O   1 
HETATM 1369 O  O   . HOH J 4 .   ? 32.632 30.548 56.614 1.00 43.62  ? 1231 HOH A O   1 
HETATM 1370 O  O   . HOH J 4 .   ? 34.788 36.080 60.231 1.00 40.76  ? 1232 HOH A O   1 
HETATM 1371 O  O   . HOH J 4 .   ? 5.788  74.998 58.015 0.50 38.48  ? 1233 HOH A O   1 
HETATM 1372 O  O   . HOH J 4 .   ? 12.756 42.389 56.316 1.00 52.54  ? 1234 HOH A O   1 
HETATM 1373 O  O   . HOH J 4 .   ? 34.186 36.014 50.004 1.00 48.22  ? 1235 HOH A O   1 
HETATM 1374 O  O   . HOH J 4 .   ? 35.446 56.754 62.675 1.00 44.59  ? 1236 HOH A O   1 
HETATM 1375 O  O   . HOH J 4 .   ? 31.698 39.663 46.419 1.00 51.78  ? 1237 HOH A O   1 
HETATM 1376 O  O   . HOH J 4 .   ? 8.063  63.119 67.493 1.00 37.02  ? 1238 HOH A O   1 
HETATM 1377 O  O   . HOH J 4 .   ? 19.420 46.193 40.516 1.00 66.69  ? 1239 HOH A O   1 
HETATM 1378 O  O   . HOH J 4 .   ? 7.791  61.992 40.962 1.00 49.26  ? 1240 HOH A O   1 
HETATM 1379 O  O   . HOH J 4 .   ? 29.645 28.880 58.785 1.00 49.55  ? 1241 HOH A O   1 
HETATM 1380 O  O   . HOH J 4 .   ? 15.326 36.097 66.176 1.00 49.72  ? 1242 HOH A O   1 
HETATM 1381 O  O   . HOH J 4 .   ? 25.113 50.922 41.416 1.00 49.41  ? 1243 HOH A O   1 
HETATM 1382 O  O   . HOH J 4 .   ? 18.215 73.523 59.278 1.00 54.50  ? 1244 HOH A O   1 
HETATM 1383 O  O   . HOH J 4 .   ? 17.600 64.444 37.620 1.00 55.23  ? 1245 HOH A O   1 
HETATM 1384 O  O   . HOH J 4 .   ? 20.042 29.914 66.746 1.00 38.76  ? 1246 HOH A O   1 
HETATM 1385 O  O   . HOH J 4 .   ? 21.606 67.533 37.697 1.00 49.51  ? 1247 HOH A O   1 
HETATM 1386 O  O   . HOH J 4 .   ? 11.697 52.784 40.590 1.00 52.82  ? 1248 HOH A O   1 
HETATM 1387 O  O   . HOH J 4 .   ? 25.574 25.083 62.400 1.00 49.30  ? 1249 HOH A O   1 
HETATM 1388 O  O   . HOH J 4 .   ? 24.861 51.492 37.799 1.00 60.69  ? 1250 HOH A O   1 
HETATM 1389 O  O   . HOH J 4 .   ? 28.787 54.362 66.475 1.00 51.52  ? 1251 HOH A O   1 
HETATM 1390 O  O   . HOH J 4 .   ? 8.659  53.743 42.890 1.00 67.74  ? 1252 HOH A O   1 
HETATM 1391 O  O   . HOH J 4 .   ? 10.682 47.269 60.484 1.00 58.67  ? 1253 HOH A O   1 
HETATM 1392 O  O   . HOH J 4 .   ? 36.921 41.555 55.026 1.00 51.75  ? 1254 HOH A O   1 
HETATM 1393 O  O   . HOH J 4 .   ? 34.123 58.154 61.090 1.00 34.39  ? 1255 HOH A O   1 
HETATM 1394 O  O   . HOH J 4 .   ? 35.760 49.888 47.129 1.00 50.96  ? 1256 HOH A O   1 
HETATM 1395 O  O   . HOH J 4 .   ? 32.548 44.176 43.706 1.00 69.26  ? 1257 HOH A O   1 
HETATM 1396 O  O   . HOH J 4 .   ? 33.759 37.389 46.932 1.00 53.90  ? 1258 HOH A O   1 
HETATM 1397 O  O   . HOH J 4 .   ? 12.283 52.707 67.702 1.00 49.68  ? 1259 HOH A O   1 
HETATM 1398 O  O   . HOH J 4 .   ? 36.471 51.738 50.290 1.00 57.35  ? 1260 HOH A O   1 
HETATM 1399 O  O   . HOH J 4 .   ? 19.976 74.132 54.367 1.00 55.36  ? 1261 HOH A O   1 
HETATM 1400 O  O   . HOH J 4 .   ? 12.416 34.765 59.570 1.00 52.14  ? 1262 HOH A O   1 
HETATM 1401 O  O   . HOH J 4 .   ? 10.986 58.101 63.888 1.00 61.87  ? 1263 HOH A O   1 
HETATM 1402 O  O   . HOH J 4 .   ? 37.842 51.374 54.102 1.00 49.26  ? 1264 HOH A O   1 
HETATM 1403 O  O   . HOH J 4 .   ? 23.811 26.330 53.750 1.00 93.28  ? 1265 HOH A O   1 
HETATM 1404 O  O   . HOH J 4 .   ? 4.540  60.700 43.969 1.00 41.54  ? 1266 HOH A O   1 
HETATM 1405 O  O   . HOH J 4 .   ? 25.958 65.962 41.096 1.00 78.82  ? 1267 HOH A O   1 
HETATM 1406 O  O   . HOH J 4 .   ? 10.263 56.108 39.468 1.00 68.01  ? 1268 HOH A O   1 
HETATM 1407 O  O   . HOH J 4 .   ? 13.767 45.934 64.226 1.00 52.61  ? 1269 HOH A O   1 
HETATM 1408 O  O   . HOH J 4 .   ? 22.174 30.835 69.361 1.00 50.15  ? 1270 HOH A O   1 
HETATM 1409 O  O   . HOH J 4 .   ? 26.632 66.047 60.682 1.00 68.52  ? 1271 HOH A O   1 
HETATM 1410 O  O   . HOH J 4 .   ? 11.561 54.767 64.333 1.00 46.64  ? 1272 HOH A O   1 
HETATM 1411 O  O   . HOH J 4 .   ? 13.808 38.620 56.510 1.00 49.03  ? 1273 HOH A O   1 
HETATM 1412 O  O   . HOH J 4 .   ? 1.052  61.840 52.421 1.00 65.09  ? 1274 HOH A O   1 
HETATM 1413 O  O   . HOH J 4 .   ? 23.008 69.659 46.621 1.00 50.69  ? 1275 HOH A O   1 
HETATM 1414 O  O   . HOH J 4 .   ? 24.837 63.229 67.057 1.00 59.20  ? 1276 HOH A O   1 
HETATM 1415 O  O   . HOH J 4 .   ? 23.540 70.328 55.262 1.00 46.03  ? 1277 HOH A O   1 
HETATM 1416 O  O   . HOH J 4 .   ? 28.926 49.008 63.462 1.00 47.75  ? 1278 HOH A O   1 
HETATM 1417 O  O   . HOH J 4 .   ? 19.666 57.544 66.726 1.00 50.54  ? 1279 HOH A O   1 
HETATM 1418 O  O   . HOH J 4 .   ? 26.036 69.428 50.537 1.00 48.95  ? 1280 HOH A O   1 
HETATM 1419 O  O   . HOH J 4 .   ? 31.065 41.580 47.845 1.00 69.15  ? 1281 HOH A O   1 
HETATM 1420 O  O   . HOH J 4 .   ? 27.720 57.658 44.142 1.00 48.92  ? 1282 HOH A O   1 
HETATM 1421 O  O   . HOH J 4 .   ? 16.697 23.936 58.288 1.00 65.70  ? 1283 HOH A O   1 
HETATM 1422 O  O   . HOH J 4 .   ? 37.683 41.653 50.438 1.00 60.68  ? 1284 HOH A O   1 
HETATM 1423 O  O   . HOH J 4 .   ? 4.710  57.212 57.376 1.00 48.37  ? 1285 HOH A O   1 
HETATM 1424 O  O   . HOH J 4 .   ? 19.261 65.614 35.901 1.00 62.07  ? 1286 HOH A O   1 
HETATM 1425 O  O   . HOH J 4 .   ? 31.751 52.427 46.893 1.00 55.18  ? 1287 HOH A O   1 
HETATM 1426 O  O   . HOH J 4 .   ? 28.152 52.802 43.176 1.00 44.45  ? 1288 HOH A O   1 
HETATM 1427 O  O   . HOH J 4 .   ? 36.423 52.351 45.326 1.00 96.58  ? 1289 HOH A O   1 
HETATM 1428 O  O   . HOH J 4 .   ? 31.877 57.142 47.068 1.00 42.14  ? 1290 HOH A O   1 
HETATM 1429 O  O   . HOH J 4 .   ? 24.901 59.522 40.289 1.00 55.03  ? 1291 HOH A O   1 
HETATM 1430 O  O   . HOH J 4 .   ? 30.660 54.152 43.717 1.00 57.65  ? 1292 HOH A O   1 
HETATM 1431 O  O   . HOH J 4 .   ? 22.623 59.908 37.384 1.00 48.19  ? 1293 HOH A O   1 
HETATM 1432 O  O   . HOH J 4 .   ? 25.950 69.578 53.016 1.00 55.26  ? 1294 HOH A O   1 
HETATM 1433 O  O   . HOH J 4 .   ? -2.187 63.063 55.090 1.00 65.69  ? 1295 HOH A O   1 
HETATM 1434 O  O   . HOH J 4 .   ? 5.810  53.522 52.624 1.00 47.81  ? 1296 HOH A O   1 
HETATM 1435 O  O   . HOH J 4 .   ? 33.831 64.762 50.870 1.00 70.65  ? 1297 HOH A O   1 
HETATM 1436 O  O   . HOH J 4 .   ? 39.206 45.208 53.049 1.00 56.23  ? 1298 HOH A O   1 
HETATM 1437 O  O   . HOH J 4 .   ? 2.969  58.682 54.074 1.00 48.71  ? 1299 HOH A O   1 
HETATM 1438 O  O   . HOH J 4 .   ? 31.685 59.838 47.688 1.00 67.19  ? 1300 HOH A O   1 
HETATM 1439 O  O   . HOH J 4 .   ? 27.307 57.923 41.486 1.00 59.96  ? 1301 HOH A O   1 
HETATM 1440 O  O   . HOH J 4 .   ? 13.762 39.255 62.099 1.00 51.84  ? 1302 HOH A O   1 
HETATM 1441 O  O   . HOH J 4 .   ? 34.133 45.217 47.109 1.00 49.95  ? 1303 HOH A O   1 
HETATM 1442 O  O   . HOH J 4 .   ? 36.122 45.471 48.229 1.00 60.82  ? 1304 HOH A O   1 
HETATM 1443 O  O   . HOH J 4 .   ? 11.553 38.154 55.949 1.00 67.69  ? 1305 HOH A O   1 
HETATM 1444 O  O   . HOH J 4 .   ? 26.634 26.891 66.317 1.00 62.79  ? 1306 HOH A O   1 
HETATM 1445 O  O   . HOH J 4 .   ? 8.953  57.299 62.902 1.00 54.61  ? 1307 HOH A O   1 
HETATM 1446 O  O   . HOH J 4 .   ? 25.781 59.573 70.122 1.00 50.53  ? 1308 HOH A O   1 
HETATM 1447 O  O   . HOH J 4 .   ? 21.293 25.081 62.561 1.00 51.02  ? 1309 HOH A O   1 
HETATM 1448 O  O   . HOH J 4 .   ? 29.941 68.234 52.146 1.00 55.07  ? 1310 HOH A O   1 
HETATM 1449 O  O   . HOH J 4 .   ? 9.705  44.407 59.136 1.00 62.54  ? 1311 HOH A O   1 
HETATM 1450 O  O   . HOH J 4 .   ? 25.138 66.282 62.910 1.00 86.33  ? 1312 HOH A O   1 
HETATM 1451 O  O   . HOH J 4 .   ? 19.608 24.866 58.537 1.00 39.00  ? 1313 HOH A O   1 
HETATM 1452 O  O   . HOH J 4 .   ? 23.328 71.344 48.150 1.00 71.01  ? 1314 HOH A O   1 
HETATM 1453 O  O   . HOH J 4 .   ? 16.758 74.001 47.506 1.00 46.98  ? 1315 HOH A O   1 
HETATM 1454 O  O   . HOH J 4 .   ? 20.251 60.472 68.159 1.00 69.10  ? 1316 HOH A O   1 
HETATM 1455 O  O   . HOH J 4 .   ? 15.407 58.217 66.458 1.00 56.30  ? 1317 HOH A O   1 
HETATM 1456 O  O   . HOH J 4 .   ? 34.797 61.609 49.273 1.00 79.84  ? 1318 HOH A O   1 
HETATM 1457 O  O   . HOH J 4 .   ? 18.522 58.632 38.134 1.00 64.19  ? 1319 HOH A O   1 
HETATM 1458 O  O   . HOH J 4 .   ? 23.639 23.299 57.554 1.00 65.20  ? 1320 HOH A O   1 
HETATM 1459 O  O   . HOH J 4 .   ? -3.943 68.456 55.756 1.00 111.53 ? 1321 HOH A O   1 
HETATM 1460 O  O   . HOH J 4 .   ? 4.628  59.243 41.534 1.00 56.72  ? 1322 HOH A O   1 
HETATM 1461 O  O   . HOH J 4 .   ? 26.822 54.781 40.174 1.00 65.25  ? 1323 HOH A O   1 
HETATM 1462 O  O   . HOH J 4 .   ? 27.718 60.296 39.986 1.00 68.70  ? 1324 HOH A O   1 
HETATM 1463 O  O   . HOH J 4 .   ? 17.755 54.939 37.932 1.00 74.12  ? 1325 HOH A O   1 
HETATM 1464 O  O   . HOH J 4 .   ? 7.369  55.058 60.510 1.00 87.16  ? 1326 HOH A O   1 
HETATM 1465 O  O   . HOH J 4 .   ? 35.919 58.591 53.230 1.00 69.54  ? 1327 HOH A O   1 
HETATM 1466 O  O   . HOH J 4 .   ? 33.029 34.276 48.832 1.00 64.50  ? 1328 HOH A O   1 
HETATM 1467 O  O   . HOH J 4 .   ? 35.795 56.891 55.760 1.00 89.80  ? 1329 HOH A O   1 
HETATM 1468 O  O   . HOH J 4 .   ? 26.436 61.880 68.287 1.00 68.78  ? 1330 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N   . ASN A 3   ? 0.5259 0.4803 0.4738 0.1848  0.0487  -0.1116 3    ASN A N   
2    C  CA  . ASN A 3   ? 0.4136 0.4453 0.3353 0.0187  0.1935  -0.0890 3    ASN A CA  
3    C  C   . ASN A 3   ? 0.3041 0.3417 0.2261 -0.0218 0.0659  -0.1064 3    ASN A C   
4    O  O   . ASN A 3   ? 0.3689 0.4242 0.1761 -0.0686 0.0278  -0.0683 3    ASN A O   
5    C  CB  . ASN A 3   ? 0.2156 0.6220 0.4028 0.0579  0.1897  0.0199  3    ASN A CB  
6    C  CG  . ASN A 3   ? 0.9463 0.6646 0.4172 -0.2043 0.0549  0.0852  3    ASN A CG  
7    O  OD1 . ASN A 3   ? 2.0742 1.0511 0.6060 -0.7322 -0.3776 0.3876  3    ASN A OD1 
8    N  ND2 . ASN A 3   ? 1.2999 0.7977 0.6653 -0.2388 0.6197  -0.2193 3    ASN A ND2 
9    N  N   . ILE A 4   ? 0.2263 0.2092 0.2024 -0.0029 0.0402  -0.0361 4    ILE A N   
10   C  CA  . ILE A 4   ? 0.2296 0.1729 0.1806 0.0078  0.0392  -0.0076 4    ILE A CA  
11   C  C   . ILE A 4   ? 0.1723 0.1684 0.1959 0.0073  0.0117  -0.0024 4    ILE A C   
12   O  O   . ILE A 4   ? 0.1628 0.2391 0.2310 0.0040  0.0058  -0.0113 4    ILE A O   
13   C  CB  . ILE A 4   ? 0.2495 0.1797 0.2566 0.0196  0.0522  0.0335  4    ILE A CB  
14   C  CG1 . ILE A 4   ? 0.2044 0.1835 0.1984 0.0382  0.0034  0.0393  4    ILE A CG1 
15   C  CG2 . ILE A 4   ? 0.2055 0.1942 0.1343 -0.0201 -0.0164 0.0081  4    ILE A CG2 
16   C  CD1 . ILE A 4   ? 0.3457 0.1844 0.1865 0.0399  -0.0105 0.0390  4    ILE A CD1 
17   N  N   . THR A 5   ? 0.1688 0.1869 0.1824 0.0117  0.0019  -0.0288 5    THR A N   
18   C  CA  . THR A 5   ? 0.2171 0.2018 0.1838 0.0280  0.0117  -0.0376 5    THR A CA  
19   C  C   . THR A 5   ? 0.2215 0.1739 0.1934 -0.0084 0.0169  -0.0493 5    THR A C   
20   O  O   . THR A 5   ? 0.2090 0.2101 0.1776 0.0055  -0.0182 -0.0143 5    THR A O   
21   C  CB  . THR A 5   ? 0.2422 0.1850 0.2271 0.0095  0.0287  -0.0168 5    THR A CB  
22   O  OG1 . THR A 5   ? 0.2598 0.2438 0.2181 0.0111  0.0340  -0.0102 5    THR A OG1 
23   C  CG2 . THR A 5   ? 0.2667 0.2055 0.2240 0.0306  -0.0239 -0.0343 5    THR A CG2 
24   N  N   . ILE A 6   ? 0.1953 0.1823 0.1843 -0.0143 0.0197  -0.0324 6    ILE A N   
25   C  CA  . ILE A 6   ? 0.1597 0.1815 0.1572 0.0268  -0.0193 -0.0146 6    ILE A CA  
26   C  C   . ILE A 6   ? 0.1731 0.1747 0.1899 0.0130  -0.0031 -0.0158 6    ILE A C   
27   O  O   . ILE A 6   ? 0.1745 0.1753 0.1961 -0.0035 0.0030  0.0223  6    ILE A O   
28   C  CB  . ILE A 6   ? 0.1672 0.1950 0.1877 -0.0032 -0.0158 0.0148  6    ILE A CB  
29   C  CG1 . ILE A 6   ? 0.2128 0.1615 0.1708 -0.0270 -0.0009 -0.0189 6    ILE A CG1 
30   C  CG2 . ILE A 6   ? 0.1948 0.1686 0.2058 -0.0044 -0.0470 0.0409  6    ILE A CG2 
31   C  CD1 . ILE A 6   ? 0.1948 0.2036 0.1982 -0.0065 -0.0089 0.0205  6    ILE A CD1 
32   N  N   . TYR A 7   ? 0.1812 0.1660 0.1699 0.0155  -0.0095 -0.0338 7    TYR A N   
33   C  CA  . TYR A 7   ? 0.1748 0.1684 0.1437 0.0027  -0.0007 -0.0324 7    TYR A CA  
34   C  C   . TYR A 7   ? 0.1663 0.1767 0.1550 -0.0031 0.0023  -0.0272 7    TYR A C   
35   O  O   . TYR A 7   ? 0.1506 0.2148 0.1576 0.0031  -0.0182 0.0227  7    TYR A O   
36   C  CB  . TYR A 7   ? 0.1989 0.1660 0.1834 0.0158  -0.0013 -0.0033 7    TYR A CB  
37   C  CG  . TYR A 7   ? 0.1591 0.1756 0.1763 0.0011  -0.0240 -0.0040 7    TYR A CG  
38   C  CD1 . TYR A 7   ? 0.2001 0.1605 0.1786 0.0383  -0.0172 0.0033  7    TYR A CD1 
39   C  CD2 . TYR A 7   ? 0.2011 0.1722 0.1859 0.0095  -0.0002 -0.0030 7    TYR A CD2 
40   C  CE1 . TYR A 7   ? 0.3280 0.2043 0.1760 -0.0078 -0.0063 -0.0023 7    TYR A CE1 
41   C  CE2 . TYR A 7   ? 0.2458 0.1876 0.1942 0.0087  0.0086  0.0086  7    TYR A CE2 
42   C  CZ  . TYR A 7   ? 0.1598 0.2146 0.1816 0.0103  0.0032  0.0007  7    TYR A CZ  
43   O  OH  . TYR A 7   ? 0.3307 0.2666 0.1771 0.0136  0.0069  0.0300  7    TYR A OH  
44   N  N   . HIS A 8   ? 0.1674 0.1826 0.1417 -0.0111 -0.0012 -0.0022 8    HIS A N   
45   C  CA  . HIS A 8   ? 0.2051 0.1833 0.1396 0.0077  0.0102  -0.0056 8    HIS A CA  
46   C  C   . HIS A 8   ? 0.1652 0.2101 0.1594 -0.0024 0.0079  -0.0381 8    HIS A C   
47   O  O   . HIS A 8   ? 0.1963 0.1870 0.1790 0.0081  0.0012  -0.0038 8    HIS A O   
48   C  CB  . HIS A 8   ? 0.2227 0.1694 0.1417 0.0103  -0.0056 -0.0070 8    HIS A CB  
49   C  CG  . HIS A 8   ? 0.2245 0.1370 0.1363 -0.0165 -0.0035 -0.0034 8    HIS A CG  
50   N  ND1 . HIS A 8   ? 0.2074 0.2006 0.1883 -0.0254 -0.0034 0.0273  8    HIS A ND1 
51   C  CD2 . HIS A 8   ? 0.2020 0.1554 0.1273 -0.0108 0.0136  -0.0022 8    HIS A CD2 
52   C  CE1 . HIS A 8   ? 0.2287 0.2173 0.1255 -0.0303 0.0388  0.0022  8    HIS A CE1 
53   N  NE2 . HIS A 8   ? 0.2126 0.2168 0.1728 -0.0111 -0.0057 0.0548  8    HIS A NE2 
54   N  N   . ASN A 9   ? 0.1788 0.2371 0.1416 -0.0064 -0.0044 -0.0306 9    ASN A N   
55   C  CA  . ASN A 9   ? 0.2076 0.1492 0.1299 0.0240  -0.0155 -0.0122 9    ASN A CA  
56   C  C   . ASN A 9   ? 0.2046 0.1456 0.1518 0.0273  -0.0066 0.0084  9    ASN A C   
57   O  O   . ASN A 9   ? 0.2345 0.1582 0.1886 -0.0032 -0.0101 0.0111  9    ASN A O   
58   C  CB  . ASN A 9   ? 0.2133 0.1516 0.1842 0.0402  -0.0239 -0.0139 9    ASN A CB  
59   C  CG  . ASN A 9   ? 0.2299 0.1563 0.1640 0.0356  0.0035  -0.0094 9    ASN A CG  
60   O  OD1 . ASN A 9   ? 0.2440 0.2319 0.1929 -0.0131 -0.0113 -0.0261 9    ASN A OD1 
61   N  ND2 . ASN A 9   ? 0.2530 0.2227 0.2797 0.0629  0.0166  -0.0585 9    ASN A ND2 
62   N  N   . PRO A 10  ? 0.2421 0.1249 0.1809 0.0018  -0.0475 0.0211  10   PRO A N   
63   C  CA  . PRO A 10  ? 0.2412 0.1496 0.1480 0.0107  -0.0379 0.0033  10   PRO A CA  
64   C  C   . PRO A 10  ? 0.2377 0.2124 0.1565 -0.0037 -0.0362 -0.0103 10   PRO A C   
65   O  O   . PRO A 10  ? 0.2325 0.2356 0.1632 -0.0123 -0.0172 0.0101  10   PRO A O   
66   C  CB  . PRO A 10  ? 0.2451 0.2466 0.1579 -0.0127 -0.0423 0.0182  10   PRO A CB  
67   C  CG  . PRO A 10  ? 0.3011 0.3386 0.1855 -0.1273 -0.1046 0.0743  10   PRO A CG  
68   C  CD  . PRO A 10  ? 0.3028 0.2721 0.1678 -0.0993 -0.0834 0.0580  10   PRO A CD  
69   N  N   . ALA A 11  ? 0.2081 0.2144 0.1582 -0.0228 -0.0307 -0.0194 11   ALA A N   
70   C  CA  . ALA A 11  ? 0.2749 0.2416 0.1987 -0.0564 0.0163  -0.0792 11   ALA A CA  
71   C  C   . ALA A 11  ? 0.2293 0.2682 0.2339 -0.0247 0.0485  -0.1158 11   ALA A C   
72   O  O   . ALA A 11  ? 0.3301 0.4278 0.2964 -0.1127 0.1259  -0.2056 11   ALA A O   
73   C  CB  . ALA A 11  ? 0.2804 0.2348 0.2013 -0.0269 0.0320  -0.0263 11   ALA A CB  
74   N  N   . CYS A 12  ? 0.1961 0.2143 0.1664 -0.0247 0.0126  -0.0293 12   CYS A N   
75   C  CA  . CYS A 12  ? 0.1707 0.1675 0.1597 0.0055  0.0162  0.0122  12   CYS A CA  
76   C  C   . CYS A 12  ? 0.1762 0.1698 0.1763 0.0148  0.0079  0.0089  12   CYS A C   
77   O  O   . CYS A 12  ? 0.1735 0.1755 0.1893 0.0296  0.0066  0.0176  12   CYS A O   
78   C  CB  . CYS A 12  ? 0.1914 0.1914 0.1778 0.0306  -0.0107 0.0029  12   CYS A CB  
79   S  SG  . CYS A 12  ? 0.2244 0.2021 0.2094 0.0208  -0.0320 -0.0164 12   CYS A SG  
80   N  N   . GLY A 13  ? 0.2108 0.1526 0.1655 0.0096  0.0192  -0.0119 13   GLY A N   
81   C  CA  . GLY A 13  ? 0.2378 0.1600 0.1252 -0.0114 -0.0378 0.0012  13   GLY A CA  
82   C  C   . GLY A 13  ? 0.1895 0.1478 0.1267 0.0034  -0.0299 0.0030  13   GLY A C   
83   O  O   . GLY A 13  ? 0.1677 0.1978 0.1728 0.0132  -0.0037 -0.0193 13   GLY A O   
84   N  N   . THR A 14  ? 0.1923 0.1844 0.1318 0.0034  -0.0392 -0.0049 14   THR A N   
85   C  CA  . THR A 14  ? 0.1600 0.2148 0.1112 0.0218  -0.0077 -0.0114 14   THR A CA  
86   C  C   . THR A 14  ? 0.1645 0.1711 0.2134 0.0040  0.0282  -0.0335 14   THR A C   
87   O  O   . THR A 14  ? 0.1547 0.1502 0.1548 0.0034  0.0212  0.0045  14   THR A O   
88   C  CB  . THR A 14  ? 0.1577 0.2412 0.1413 0.0195  -0.0313 -0.0411 14   THR A CB  
89   O  OG1 . THR A 14  ? 0.1502 0.2287 0.2058 0.0107  -0.0146 -0.0266 14   THR A OG1 
90   C  CG2 . THR A 14  ? 0.2139 0.1506 0.1614 -0.0188 -0.0559 -0.0096 14   THR A CG2 
91   N  N   . SER A 15  ? 0.1906 0.1789 0.1802 -0.0166 -0.0084 -0.0405 15   SER A N   
92   C  CA  . SER A 15  ? 0.1671 0.1339 0.1483 -0.0023 -0.0404 -0.0215 15   SER A CA  
93   C  C   . SER A 15  ? 0.1952 0.1541 0.1504 0.0251  -0.0635 -0.0302 15   SER A C   
94   O  O   . SER A 15  ? 0.1926 0.1470 0.1577 0.0182  -0.0220 0.0094  15   SER A O   
95   C  CB  . SER A 15  ? 0.2440 0.1255 0.1627 0.0139  -0.0091 -0.0276 15   SER A CB  
96   O  OG  . SER A 15  ? 0.2118 0.1893 0.1728 -0.0185 -0.0366 0.0214  15   SER A OG  
97   N  N   . ARG A 16  ? 0.2464 0.1483 0.1392 0.0133  -0.0321 0.0284  16   ARG A N   
98   C  CA  . ARG A 16  ? 0.2199 0.1538 0.1283 -0.0013 -0.0400 0.0141  16   ARG A CA  
99   C  C   . ARG A 16  ? 0.1651 0.1563 0.1526 0.0094  -0.0332 0.0089  16   ARG A C   
100  O  O   . ARG A 16  ? 0.1662 0.1797 0.1920 0.0276  -0.0318 0.0040  16   ARG A O   
101  C  CB  . ARG A 16  ? 0.1744 0.1725 0.1309 -0.0122 -0.0227 0.0164  16   ARG A CB  
102  C  CG  . ARG A 16  ? 0.2145 0.1922 0.1204 -0.0262 -0.0164 0.0002  16   ARG A CG  
103  C  CD  . ARG A 16  ? 0.2252 0.2120 0.1289 0.0107  -0.0335 -0.0110 16   ARG A CD  
104  N  NE  . ARG A 16  ? 0.2641 0.1916 0.1088 -0.0043 -0.0148 -0.0378 16   ARG A NE  
105  C  CZ  . ARG A 16  ? 0.3069 0.1793 0.1577 0.0002  0.0410  -0.0172 16   ARG A CZ  
106  N  NH1 . ARG A 16  ? 0.2380 0.1903 0.1753 -0.0041 -0.0252 0.0065  16   ARG A NH1 
107  N  NH2 . ARG A 16  ? 0.2201 0.2182 0.1859 0.0017  -0.0105 0.0152  16   ARG A NH2 
108  N  N   . ASN A 17  ? 0.1707 0.1769 0.1415 -0.0005 -0.0299 -0.0221 17   ASN A N   
109  C  CA  . ASN A 17  ? 0.1948 0.1787 0.1170 -0.0212 -0.0247 -0.0025 17   ASN A CA  
110  C  C   . ASN A 17  ? 0.1855 0.1462 0.1189 -0.0047 -0.0308 0.0031  17   ASN A C   
111  O  O   . ASN A 17  ? 0.1781 0.1914 0.1748 0.0238  -0.0235 -0.0296 17   ASN A O   
112  C  CB  . ASN A 17  ? 0.2058 0.2425 0.1501 -0.0485 -0.0092 -0.0110 17   ASN A CB  
113  C  CG  . ASN A 17  ? 0.1737 0.2198 0.1604 -0.0176 -0.0169 0.0283  17   ASN A CG  
114  O  OD1 . ASN A 17  ? 0.1868 0.1862 0.1880 -0.0006 -0.0435 -0.0107 17   ASN A OD1 
115  N  ND2 . ASN A 17  ? 0.1916 0.2277 0.1454 0.0123  -0.0237 0.0099  17   ASN A ND2 
116  N  N   . THR A 18  ? 0.1985 0.1881 0.1251 0.0075  -0.0281 0.0179  18   THR A N   
117  C  CA  . THR A 18  ? 0.1726 0.1746 0.1263 -0.0183 -0.0224 0.0285  18   THR A CA  
118  C  C   . THR A 18  ? 0.1630 0.1740 0.1355 -0.0049 -0.0402 -0.0196 18   THR A C   
119  O  O   . THR A 18  ? 0.2215 0.1712 0.1370 0.0045  -0.0229 -0.0172 18   THR A O   
120  C  CB  . THR A 18  ? 0.1780 0.1686 0.1230 0.0059  -0.0295 0.0058  18   THR A CB  
121  O  OG1 . THR A 18  ? 0.1786 0.1922 0.1488 -0.0021 -0.0239 0.0013  18   THR A OG1 
122  C  CG2 . THR A 18  ? 0.2187 0.2127 0.1153 -0.0350 -0.0185 0.0343  18   THR A CG2 
123  N  N   . LEU A 19  ? 0.1624 0.1473 0.1481 -0.0047 -0.0340 0.0000  19   LEU A N   
124  C  CA  . LEU A 19  ? 0.1640 0.1532 0.1582 -0.0096 -0.0401 -0.0013 19   LEU A CA  
125  C  C   . LEU A 19  ? 0.1621 0.1595 0.1477 -0.0020 -0.0247 0.0020  19   LEU A C   
126  O  O   . LEU A 19  ? 0.1980 0.1855 0.1533 0.0176  -0.0155 -0.0056 19   LEU A O   
127  C  CB  . LEU A 19  ? 0.1572 0.1675 0.1622 -0.0134 -0.0003 -0.0354 19   LEU A CB  
128  C  CG  . LEU A 19  ? 0.1617 0.1689 0.1634 -0.0252 -0.0163 -0.0013 19   LEU A CG  
129  C  CD1 . LEU A 19  ? 0.1979 0.1648 0.1781 -0.0620 0.0224  0.0141  19   LEU A CD1 
130  C  CD2 . LEU A 19  ? 0.2016 0.1803 0.1740 -0.0542 -0.0206 0.0006  19   LEU A CD2 
131  N  N   . GLU A 20  ? 0.2114 0.1550 0.1587 -0.0008 -0.0059 0.0057  20   GLU A N   
132  C  CA  . GLU A 20  ? 0.2372 0.1492 0.1634 -0.0071 -0.0084 0.0101  20   GLU A CA  
133  C  C   . GLU A 20  ? 0.2078 0.1582 0.1829 0.0114  -0.0263 -0.0077 20   GLU A C   
134  O  O   . GLU A 20  ? 0.1983 0.1859 0.1590 0.0164  -0.0088 -0.0142 20   GLU A O   
135  C  CB  . GLU A 20  ? 0.1825 0.1994 0.1584 0.0056  -0.0229 0.0129  20   GLU A CB  
136  C  CG  . GLU A 20  ? 0.1880 0.1979 0.1515 -0.0202 -0.0500 0.0411  20   GLU A CG  
137  C  CD  . GLU A 20  ? 0.1741 0.2567 0.1478 0.0033  -0.0301 -0.0078 20   GLU A CD  
138  O  OE1 . GLU A 20  ? 0.2190 0.2360 0.1758 -0.0253 0.0020  -0.0675 20   GLU A OE1 
139  O  OE2 . GLU A 20  ? 0.1980 0.2264 0.1540 -0.0202 -0.0448 -0.0045 20   GLU A OE2 
140  N  N   . MET A 21  ? 0.1980 0.1483 0.1876 0.0199  -0.0074 -0.0090 21   MET A N   
141  C  CA  . MET A 21  ? 0.1869 0.1741 0.1780 0.0010  -0.0158 -0.0042 21   MET A CA  
142  C  C   . MET A 21  ? 0.1857 0.1686 0.1620 0.0090  -0.0267 0.0036  21   MET A C   
143  O  O   . MET A 21  ? 0.1988 0.1624 0.1674 -0.0056 -0.0177 0.0012  21   MET A O   
144  C  CB  . MET A 21  ? 0.1947 0.2160 0.1476 0.0063  -0.0240 0.0221  21   MET A CB  
145  C  CG  . MET A 21  ? 0.1913 0.2649 0.1563 -0.0083 -0.0211 0.0437  21   MET A CG  
146  S  SD  . MET A 21  ? 0.1941 0.2271 0.2220 0.0034  -0.0252 -0.0078 21   MET A SD  
147  C  CE  . MET A 21  ? 0.2543 0.2953 0.2695 0.0238  -0.0156 -0.1000 21   MET A CE  
148  N  N   . ILE A 22  ? 0.1745 0.1668 0.1887 0.0266  0.0019  0.0016  22   ILE A N   
149  C  CA  . ILE A 22  ? 0.1659 0.1688 0.1711 0.0206  -0.0124 0.0044  22   ILE A CA  
150  C  C   . ILE A 22  ? 0.1580 0.1708 0.1597 0.0053  -0.0110 -0.0063 22   ILE A C   
151  O  O   . ILE A 22  ? 0.1680 0.2040 0.1739 0.0188  0.0197  -0.0132 22   ILE A O   
152  C  CB  . ILE A 22  ? 0.1627 0.1699 0.1649 0.0045  -0.0120 -0.0132 22   ILE A CB  
153  C  CG1 . ILE A 22  ? 0.2019 0.1671 0.1338 0.0194  -0.0420 0.0013  22   ILE A CG1 
154  C  CG2 . ILE A 22  ? 0.1951 0.2256 0.1438 -0.0255 -0.0133 -0.0037 22   ILE A CG2 
155  C  CD1 . ILE A 22  ? 0.1808 0.1605 0.2704 -0.0023 -0.0253 -0.0083 22   ILE A CD1 
156  N  N   . ARG A 23  ? 0.1827 0.1795 0.1997 -0.0155 -0.0443 -0.0146 23   ARG A N   
157  C  CA  . ARG A 23  ? 0.1826 0.1922 0.1640 -0.0080 -0.0302 -0.0150 23   ARG A CA  
158  C  C   . ARG A 23  ? 0.1757 0.1914 0.1898 -0.0061 -0.0193 -0.0065 23   ARG A C   
159  O  O   . ARG A 23  ? 0.2033 0.2124 0.2280 0.0093  0.0142  -0.0085 23   ARG A O   
160  C  CB  . ARG A 23  ? 0.2169 0.2066 0.1698 -0.0342 -0.0518 0.0010  23   ARG A CB  
161  C  CG  . ARG A 23  ? 0.1942 0.1723 0.2311 0.0180  -0.0497 -0.0277 23   ARG A CG  
162  C  CD  . ARG A 23  ? 0.1779 0.2185 0.2230 -0.0453 -0.0447 -0.0210 23   ARG A CD  
163  N  NE  . ARG A 23  ? 0.1774 0.2169 0.1885 -0.0382 0.0243  -0.0284 23   ARG A NE  
164  C  CZ  . ARG A 23  ? 0.2222 0.1830 0.1459 0.0004  -0.0286 0.0067  23   ARG A CZ  
165  N  NH1 . ARG A 23  ? 0.2735 0.1915 0.1402 -0.0339 -0.0205 -0.0192 23   ARG A NH1 
166  N  NH2 . ARG A 23  ? 0.2109 0.1974 0.1761 -0.0111 -0.0225 0.0002  23   ARG A NH2 
167  N  N   . ASN A 24  ? 0.1803 0.1899 0.1891 0.0044  -0.0088 -0.0102 24   ASN A N   
168  C  CA  . ASN A 24  ? 0.2184 0.1978 0.1632 -0.0186 -0.0024 -0.0042 24   ASN A CA  
169  C  C   . ASN A 24  ? 0.1810 0.1933 0.1676 -0.0125 -0.0045 -0.0058 24   ASN A C   
170  O  O   . ASN A 24  ? 0.2642 0.1949 0.1713 -0.0091 0.0004  -0.0045 24   ASN A O   
171  C  CB  . ASN A 24  ? 0.2255 0.2077 0.1581 0.0345  0.0016  0.0353  24   ASN A CB  
172  C  CG  . ASN A 24  ? 0.2325 0.2065 0.1733 0.0009  -0.0236 0.0424  24   ASN A CG  
173  O  OD1 . ASN A 24  ? 0.2364 0.2355 0.2574 -0.0181 -0.0038 0.0072  24   ASN A OD1 
174  N  ND2 . ASN A 24  ? 0.2388 0.1356 0.1740 -0.0028 -0.0402 -0.0011 24   ASN A ND2 
175  N  N   . SER A 25  ? 0.1755 0.2024 0.1585 0.0078  -0.0010 -0.0137 25   SER A N   
176  C  CA  . SER A 25  ? 0.1680 0.2005 0.1712 0.0181  -0.0189 -0.0237 25   SER A CA  
177  C  C   . SER A 25  ? 0.1827 0.2373 0.1621 0.0211  -0.0032 -0.0225 25   SER A C   
178  O  O   . SER A 25  ? 0.2351 0.2448 0.1684 0.0383  0.0061  -0.0226 25   SER A O   
179  C  CB  . SER A 25  ? 0.1735 0.2152 0.1663 -0.0039 -0.0135 0.0143  25   SER A CB  
180  O  OG  . SER A 25  ? 0.2199 0.1730 0.2023 -0.0061 -0.0136 -0.0121 25   SER A OG  
181  N  N   . GLY A 26  ? 0.1594 0.2414 0.1940 0.0258  -0.0044 -0.0146 26   GLY A N   
182  C  CA  . GLY A 26  ? 0.1812 0.2555 0.2132 0.0175  0.0211  -0.0314 26   GLY A CA  
183  C  C   . GLY A 26  ? 0.2331 0.2412 0.1874 -0.0171 0.0471  -0.0746 26   GLY A C   
184  O  O   . GLY A 26  ? 0.2390 0.2812 0.2618 0.0316  0.0563  0.0177  26   GLY A O   
185  N  N   . THR A 27  ? 0.1870 0.2351 0.2594 -0.0320 0.0309  -0.0327 27   THR A N   
186  C  CA  . THR A 27  ? 0.2803 0.2492 0.2445 -0.0368 0.1235  -0.0466 27   THR A CA  
187  C  C   . THR A 27  ? 0.1227 0.2005 0.3186 0.0552  0.0392  -0.0180 27   THR A C   
188  O  O   . THR A 27  ? 0.1721 0.2213 0.2842 0.0607  0.0593  -0.0003 27   THR A O   
189  C  CB  . THR A 27  ? 0.5734 0.2025 0.3201 -0.0155 -0.0175 0.0008  27   THR A CB  
190  O  OG1 . THR A 27  ? 0.4506 0.4070 0.5581 0.1213  -0.1918 -0.0890 27   THR A OG1 
191  C  CG2 . THR A 27  ? 0.1826 0.3136 0.3112 -0.0718 -0.0755 0.2100  27   THR A CG2 
192  N  N   . GLU A 28  ? 0.2012 0.2415 0.1807 -0.0085 0.0141  0.0014  28   GLU A N   
193  C  CA  . GLU A 28  ? 0.1454 0.2427 0.2286 0.0128  0.0324  -0.0194 28   GLU A CA  
194  C  C   . GLU A 28  ? 0.1837 0.2350 0.2388 -0.0114 0.0083  -0.0110 28   GLU A C   
195  O  O   . GLU A 28  ? 0.1925 0.2964 0.2524 0.0203  0.0249  0.0125  28   GLU A O   
196  C  CB  . GLU A 28  ? 0.1597 0.2343 0.2283 -0.0124 0.0374  0.0023  28   GLU A CB  
197  C  CG  . GLU A 28  ? 0.2453 0.2325 0.1861 -0.0215 0.0085  0.0102  28   GLU A CG  
198  C  CD  . GLU A 28  ? 0.2745 0.2390 0.1766 -0.0062 0.0022  0.0228  28   GLU A CD  
199  O  OE1 . GLU A 28  ? 0.2372 0.2630 0.2471 -0.0134 0.0518  -0.0161 28   GLU A OE1 
200  O  OE2 . GLU A 28  ? 0.2018 0.2615 0.2499 -0.0089 0.0437  0.0458  28   GLU A OE2 
201  N  N   . PRO A 29  ? 0.2132 0.2029 0.2076 0.0080  0.0112  -0.0017 29   PRO A N   
202  C  CA  . PRO A 29  ? 0.2273 0.1776 0.1869 -0.0025 0.0188  -0.0162 29   PRO A CA  
203  C  C   . PRO A 29  ? 0.2066 0.1888 0.1858 0.0013  0.0172  -0.0204 29   PRO A C   
204  O  O   . PRO A 29  ? 0.2355 0.2046 0.1999 -0.0155 0.0034  -0.0251 29   PRO A O   
205  C  CB  . PRO A 29  ? 0.2292 0.1518 0.1785 0.0100  0.0241  0.0065  29   PRO A CB  
206  C  CG  . PRO A 29  ? 0.1996 0.1610 0.1862 -0.0017 0.0039  0.0276  29   PRO A CG  
207  C  CD  . PRO A 29  ? 0.2596 0.1727 0.1745 0.0434  0.0037  -0.0232 29   PRO A CD  
208  N  N   . THR A 30  ? 0.2316 0.2011 0.1911 -0.0234 0.0275  0.0014  30   THR A N   
209  C  CA  . THR A 30  ? 0.1844 0.2024 0.2080 -0.0283 0.0113  -0.0039 30   THR A CA  
210  C  C   . THR A 30  ? 0.2039 0.1935 0.1752 -0.0175 0.0046  0.0149  30   THR A C   
211  O  O   . THR A 30  ? 0.1966 0.2129 0.1924 -0.0154 0.0227  -0.0183 30   THR A O   
212  C  CB  . THR A 30  ? 0.2693 0.2576 0.2356 -0.0260 0.0989  0.0597  30   THR A CB  
213  O  OG1 . THR A 30  ? 0.2908 0.2556 0.2560 -0.0146 0.0905  0.0121  30   THR A OG1 
214  C  CG2 . THR A 30  ? 0.3437 0.2487 0.2239 0.0376  0.0339  0.0374  30   THR A CG2 
215  N  N   . ILE A 31  ? 0.2265 0.2054 0.2097 -0.0059 -0.0051 -0.0136 31   ILE A N   
216  C  CA  . ILE A 31  ? 0.2130 0.1946 0.1826 -0.0084 0.0000  0.0176  31   ILE A CA  
217  C  C   . ILE A 31  ? 0.1808 0.1988 0.1866 -0.0117 -0.0014 0.0153  31   ILE A C   
218  O  O   . ILE A 31  ? 0.1776 0.2060 0.2607 -0.0160 -0.0089 0.0260  31   ILE A O   
219  C  CB  . ILE A 31  ? 0.1530 0.2038 0.2048 0.0052  -0.0101 0.0158  31   ILE A CB  
220  C  CG1 . ILE A 31  ? 0.1998 0.2010 0.1900 -0.0285 -0.0372 0.0234  31   ILE A CG1 
221  C  CG2 . ILE A 31  ? 0.2250 0.2595 0.1920 0.0060  0.0081  -0.0039 31   ILE A CG2 
222  C  CD1 . ILE A 31  ? 0.2018 0.2649 0.2113 -0.0124 -0.0573 0.0469  31   ILE A CD1 
223  N  N   . ILE A 32  ? 0.1728 0.2074 0.1603 -0.0019 0.0151  0.0020  32   ILE A N   
224  C  CA  . ILE A 32  ? 0.1937 0.2128 0.1795 -0.0029 -0.0064 0.0032  32   ILE A CA  
225  C  C   . ILE A 32  ? 0.1755 0.1859 0.1847 0.0072  -0.0136 0.0041  32   ILE A C   
226  O  O   . ILE A 32  ? 0.2079 0.2028 0.1612 -0.0201 0.0002  -0.0144 32   ILE A O   
227  C  CB  . ILE A 32  ? 0.1834 0.1915 0.1862 -0.0115 -0.0109 0.0044  32   ILE A CB  
228  C  CG1 . ILE A 32  ? 0.2005 0.2382 0.1725 -0.0049 -0.0057 0.0198  32   ILE A CG1 
229  C  CG2 . ILE A 32  ? 0.1795 0.1916 0.2620 -0.0201 -0.0023 0.0306  32   ILE A CG2 
230  C  CD1 . ILE A 32  ? 0.3600 0.2280 0.1851 0.0821  -0.0543 0.0019  32   ILE A CD1 
231  N  N   . LEU A 33  ? 0.1724 0.2449 0.1792 -0.0289 0.0088  -0.0034 33   LEU A N   
232  C  CA  . LEU A 33  ? 0.1982 0.2024 0.1781 -0.0043 -0.0086 -0.0049 33   LEU A CA  
233  C  C   . LEU A 33  ? 0.2284 0.2162 0.1743 0.0019  -0.0270 0.0069  33   LEU A C   
234  O  O   . LEU A 33  ? 0.2357 0.2067 0.2391 0.0110  -0.0208 -0.0092 33   LEU A O   
235  C  CB  . LEU A 33  ? 0.1625 0.2109 0.1905 -0.0091 -0.0005 0.0024  33   LEU A CB  
236  C  CG  . LEU A 33  ? 0.1673 0.2073 0.1916 -0.0052 0.0102  0.0080  33   LEU A CG  
237  C  CD1 . LEU A 33  ? 0.2099 0.2468 0.2056 -0.0005 -0.0355 0.0104  33   LEU A CD1 
238  C  CD2 . LEU A 33  ? 0.2387 0.2281 0.2439 -0.0115 0.0385  0.0380  33   LEU A CD2 
239  N  N   . TYR A 34  ? 0.2305 0.2072 0.1705 0.0181  -0.0299 -0.0185 34   TYR A N   
240  C  CA  . TYR A 34  ? 0.2080 0.2076 0.1870 0.0206  -0.0153 -0.0130 34   TYR A CA  
241  C  C   . TYR A 34  ? 0.2023 0.2081 0.1760 0.0152  0.0036  -0.0034 34   TYR A C   
242  O  O   . TYR A 34  ? 0.2936 0.1813 0.2249 -0.0012 -0.0223 0.0092  34   TYR A O   
243  C  CB  . TYR A 34  ? 0.1994 0.2168 0.1674 0.0054  0.0025  -0.0011 34   TYR A CB  
244  C  CG  . TYR A 34  ? 0.2288 0.1993 0.1300 0.0196  0.0015  -0.0201 34   TYR A CG  
245  C  CD1 . TYR A 34  ? 0.2228 0.1959 0.1864 0.0162  0.0082  -0.0310 34   TYR A CD1 
246  C  CD2 . TYR A 34  ? 0.2281 0.1915 0.1908 0.0056  0.0117  0.0069  34   TYR A CD2 
247  C  CE1 . TYR A 34  ? 0.1801 0.2156 0.2090 0.0246  0.0019  -0.0072 34   TYR A CE1 
248  C  CE2 . TYR A 34  ? 0.1654 0.1984 0.2100 -0.0038 -0.0064 0.0259  34   TYR A CE2 
249  C  CZ  . TYR A 34  ? 0.1626 0.2012 0.2206 -0.0108 -0.0169 -0.0056 34   TYR A CZ  
250  O  OH  . TYR A 34  ? 0.2313 0.1857 0.2281 0.0082  0.0290  -0.0201 34   TYR A OH  
251  N  N   . LEU A 35  ? 0.1853 0.2251 0.1777 0.0061  0.0316  -0.0041 35   LEU A N   
252  C  CA  . LEU A 35  ? 0.2242 0.2293 0.1786 -0.0055 0.0286  -0.0110 35   LEU A CA  
253  C  C   . LEU A 35  ? 0.2061 0.2013 0.2293 0.0183  -0.0412 0.0627  35   LEU A C   
254  O  O   . LEU A 35  ? 0.2912 0.1959 0.2940 0.0341  -0.0675 -0.0224 35   LEU A O   
255  C  CB  . LEU A 35  ? 0.1800 0.2206 0.1694 0.0023  -0.0058 -0.0159 35   LEU A CB  
256  C  CG  . LEU A 35  ? 0.1930 0.2642 0.1801 -0.0131 -0.0208 0.0322  35   LEU A CG  
257  C  CD1 . LEU A 35  ? 0.5108 0.2368 0.2102 -0.0789 -0.0928 0.0741  35   LEU A CD1 
258  C  CD2 . LEU A 35  ? 0.1845 0.2940 0.2830 0.0010  0.0319  -0.0172 35   LEU A CD2 
259  N  N   . GLU A 36  ? 0.2081 0.2123 0.2435 -0.0137 -0.0123 -0.0172 36   GLU A N   
260  C  CA  . GLU A 36  ? 0.2597 0.2836 0.3078 -0.0722 0.0155  -0.0327 36   GLU A CA  
261  C  C   . GLU A 36  ? 0.2514 0.2473 0.3261 -0.0486 0.0473  -0.0179 36   GLU A C   
262  O  O   . GLU A 36  ? 0.4010 0.2259 0.3375 -0.0649 0.0396  -0.0146 36   GLU A O   
263  C  CB  A GLU A 36  ? 0.2522 0.3825 0.3676 -0.1202 -0.0166 -0.0149 36   GLU A CB  
264  C  CB  B GLU A 36  ? 0.2492 0.3711 0.3629 -0.1153 -0.0077 -0.0147 36   GLU A CB  
265  C  CG  A GLU A 36  ? 0.3286 0.4360 0.3638 -0.1484 -0.0689 -0.0011 36   GLU A CG  
266  C  CG  B GLU A 36  ? 0.2434 0.3977 0.4589 -0.0759 -0.0505 0.0123  36   GLU A CG  
267  C  CD  A GLU A 36  ? 0.3274 0.4922 0.3710 -0.1096 -0.0570 -0.0329 36   GLU A CD  
268  C  CD  B GLU A 36  ? 0.2297 0.4792 0.3808 -0.0695 -0.0151 -0.0430 36   GLU A CD  
269  O  OE1 A GLU A 36  ? 0.3275 0.4849 0.4001 0.0497  0.0012  0.0112  36   GLU A OE1 
270  O  OE1 B GLU A 36  ? 0.3956 0.5198 0.3756 -0.0505 0.0245  -0.1167 36   GLU A OE1 
271  O  OE2 A GLU A 36  ? 0.3646 0.5858 0.3495 -0.0518 -0.0398 -0.0395 36   GLU A OE2 
272  O  OE2 B GLU A 36  ? 0.2331 0.5432 0.4602 0.0103  -0.0285 -0.1545 36   GLU A OE2 
273  N  N   . ASN A 37  ? 0.2568 0.2165 0.2631 -0.0363 0.0136  0.0303  37   ASN A N   
274  C  CA  . ASN A 37  ? 0.3044 0.1879 0.2659 -0.0248 0.0241  0.0463  37   ASN A CA  
275  C  C   . ASN A 37  ? 0.3087 0.2051 0.2447 0.0073  0.0026  0.0390  37   ASN A C   
276  O  O   . ASN A 37  ? 0.2450 0.2274 0.1702 0.0182  0.0240  0.0342  37   ASN A O   
277  C  CB  . ASN A 37  ? 0.3025 0.3097 0.2821 0.0169  0.0160  0.0068  37   ASN A CB  
278  C  CG  . ASN A 37  ? 0.2982 0.4098 0.3897 -0.0519 0.0207  0.0662  37   ASN A CG  
279  O  OD1 . ASN A 37  ? 0.4128 0.4357 0.5427 -0.1039 0.0566  0.0906  37   ASN A OD1 
280  N  ND2 . ASN A 37  ? 0.4338 0.5006 0.3030 -0.1018 -0.0635 0.0083  37   ASN A ND2 
281  N  N   . PRO A 38  ? 0.3205 0.2046 0.1937 0.0169  0.0221  0.0242  38   PRO A N   
282  C  CA  . PRO A 38  ? 0.3020 0.2111 0.1995 0.0326  0.0162  0.0369  38   PRO A CA  
283  C  C   . PRO A 38  ? 0.2135 0.1952 0.2067 0.0420  0.0056  0.0369  38   PRO A C   
284  O  O   . PRO A 38  ? 0.2654 0.2445 0.2110 -0.0052 0.0104  0.0373  38   PRO A O   
285  C  CB  . PRO A 38  ? 0.3266 0.2244 0.2283 0.0432  0.0170  -0.0156 38   PRO A CB  
286  C  CG  . PRO A 38  ? 0.3427 0.2237 0.2195 0.0413  0.0116  -0.0091 38   PRO A CG  
287  C  CD  . PRO A 38  ? 0.3144 0.2138 0.2163 0.0164  0.0400  0.0311  38   PRO A CD  
288  N  N   . PRO A 39  ? 0.2175 0.2337 0.2105 0.0243  0.0195  0.0209  39   PRO A N   
289  C  CA  . PRO A 39  ? 0.1899 0.2383 0.2093 0.0366  0.0272  0.0130  39   PRO A CA  
290  C  C   . PRO A 39  ? 0.2014 0.2436 0.2079 0.0399  0.0150  0.0094  39   PRO A C   
291  O  O   . PRO A 39  ? 0.2215 0.2212 0.2489 0.0311  0.0303  0.0058  39   PRO A O   
292  C  CB  . PRO A 39  ? 0.2485 0.2742 0.2008 -0.0043 0.0119  0.0243  39   PRO A CB  
293  C  CG  . PRO A 39  ? 0.2140 0.2678 0.1971 0.0111  0.0059  0.0800  39   PRO A CG  
294  C  CD  . PRO A 39  ? 0.2846 0.2211 0.1936 -0.0142 0.0089  0.0400  39   PRO A CD  
295  N  N   . SER A 40  ? 0.2169 0.2463 0.2134 0.0272  0.0190  0.0214  40   SER A N   
296  C  CA  . SER A 40  ? 0.2110 0.2138 0.2402 0.0059  0.0171  0.0233  40   SER A CA  
297  C  C   . SER A 40  ? 0.2115 0.2056 0.2272 0.0180  0.0156  0.0085  40   SER A C   
298  O  O   . SER A 40  ? 0.2000 0.2226 0.1950 0.0096  0.0337  0.0270  40   SER A O   
299  C  CB  . SER A 40  ? 0.2349 0.2742 0.2570 -0.0194 0.0298  0.0500  40   SER A CB  
300  O  OG  . SER A 40  ? 0.2129 0.3055 0.2145 0.0272  0.0174  0.0406  40   SER A OG  
301  N  N   . ARG A 41  ? 0.2161 0.2055 0.2042 0.0271  0.0281  0.0033  41   ARG A N   
302  C  CA  . ARG A 41  ? 0.2206 0.2060 0.2054 0.0211  0.0162  0.0082  41   ARG A CA  
303  C  C   . ARG A 41  ? 0.2382 0.1970 0.2010 0.0358  0.0030  0.0107  41   ARG A C   
304  O  O   . ARG A 41  ? 0.2448 0.2176 0.2113 0.0199  -0.0149 0.0079  41   ARG A O   
305  C  CB  . ARG A 41  ? 0.2143 0.1829 0.2652 -0.0041 -0.0170 -0.0031 41   ARG A CB  
306  C  CG  . ARG A 41  ? 0.2251 0.2497 0.2607 -0.0213 -0.0536 0.0584  41   ARG A CG  
307  C  CD  . ARG A 41  ? 0.2318 0.2611 0.2091 0.0060  -0.0401 0.0485  41   ARG A CD  
308  N  NE  . ARG A 41  ? 0.2426 0.2256 0.2224 -0.0224 -0.0148 0.0713  41   ARG A NE  
309  C  CZ  . ARG A 41  ? 0.2222 0.2155 0.1866 0.0234  0.0039  0.0157  41   ARG A CZ  
310  N  NH1 . ARG A 41  ? 0.2811 0.2552 0.1980 0.0621  0.0152  0.0010  41   ARG A NH1 
311  N  NH2 . ARG A 41  ? 0.2179 0.1890 0.2420 0.0460  -0.0102 -0.0112 41   ARG A NH2 
312  N  N   . ASP A 42  ? 0.2837 0.2019 0.2318 0.0302  0.0341  -0.0018 42   ASP A N   
313  C  CA  . ASP A 42  ? 0.2878 0.2085 0.2311 0.0796  0.0244  -0.0023 42   ASP A CA  
314  C  C   . ASP A 42  ? 0.3335 0.2045 0.2271 0.0493  -0.0161 -0.0019 42   ASP A C   
315  O  O   . ASP A 42  ? 0.2935 0.2327 0.2439 0.0232  0.0539  -0.0120 42   ASP A O   
316  C  CB  . ASP A 42  ? 0.4362 0.2889 0.2682 0.0030  0.1107  -0.0291 42   ASP A CB  
317  C  CG  . ASP A 42  ? 0.5616 0.2975 0.2462 -0.0320 0.1058  -0.0193 42   ASP A CG  
318  O  OD1 . ASP A 42  ? 0.5972 0.4217 0.3103 0.0417  0.0875  0.1297  42   ASP A OD1 
319  O  OD2 . ASP A 42  ? 0.6503 0.4221 0.3381 -0.0638 0.1731  0.0355  42   ASP A OD2 
320  N  N   . GLU A 43  ? 0.2532 0.2506 0.2428 0.0657  0.0225  0.0231  43   GLU A N   
321  C  CA  . GLU A 43  ? 0.2619 0.2478 0.1967 0.0343  0.0111  0.0121  43   GLU A CA  
322  C  C   . GLU A 43  ? 0.2400 0.2503 0.1819 0.0257  -0.0100 -0.0116 43   GLU A C   
323  O  O   . GLU A 43  ? 0.2371 0.2418 0.2342 0.0320  0.0453  -0.0335 43   GLU A O   
324  C  CB  A GLU A 43  ? 0.2344 0.2535 0.3087 0.0496  -0.0078 0.0338  43   GLU A CB  
325  C  CB  B GLU A 43  ? 0.2417 0.2800 0.3186 0.0147  -0.0259 0.0594  43   GLU A CB  
326  C  CG  A GLU A 43  ? 0.2499 0.2199 0.3677 0.0313  -0.0381 0.0069  43   GLU A CG  
327  C  CG  B GLU A 43  ? 0.2451 0.2399 0.1797 0.1071  -0.0121 -0.0187 43   GLU A CG  
328  C  CD  A GLU A 43  ? 0.2451 0.3030 0.4268 0.0600  0.0837  -0.0634 43   GLU A CD  
329  C  CD  B GLU A 43  ? 0.1853 0.3167 0.2745 0.0999  0.0364  -0.1065 43   GLU A CD  
330  O  OE1 A GLU A 43  ? 0.5176 0.2618 0.4226 0.1434  0.1106  0.0244  43   GLU A OE1 
331  O  OE1 B GLU A 43  ? 0.1526 0.1600 0.1691 0.0339  -0.0012 0.0592  43   GLU A OE1 
332  O  OE2 A GLU A 43  ? 0.2881 0.3670 0.3810 -0.0828 0.1681  -0.1950 43   GLU A OE2 
333  O  OE2 B GLU A 43  ? 0.2250 0.4284 0.3110 0.0566  0.1094  0.0051  43   GLU A OE2 
334  N  N   . LEU A 44  ? 0.2782 0.2098 0.1808 0.0243  0.0216  0.0226  44   LEU A N   
335  C  CA  . LEU A 44  ? 0.2234 0.2208 0.1851 0.0377  -0.0115 0.0195  44   LEU A CA  
336  C  C   . LEU A 44  ? 0.2804 0.2020 0.1919 0.0185  -0.0435 0.0297  44   LEU A C   
337  O  O   . LEU A 44  ? 0.2830 0.2060 0.1635 0.0125  -0.0267 0.0039  44   LEU A O   
338  C  CB  . LEU A 44  ? 0.2029 0.2193 0.2150 0.0063  0.0085  0.0020  44   LEU A CB  
339  C  CG  . LEU A 44  ? 0.2322 0.2138 0.2339 0.0000  0.0349  0.0049  44   LEU A CG  
340  C  CD1 . LEU A 44  ? 0.1959 0.2341 0.2772 0.0073  0.0299  0.0323  44   LEU A CD1 
341  C  CD2 . LEU A 44  ? 0.2178 0.2206 0.2224 -0.0084 0.0284  0.0016  44   LEU A CD2 
342  N  N   . VAL A 45  ? 0.2663 0.2092 0.1822 0.0289  -0.0268 0.0201  45   VAL A N   
343  C  CA  . VAL A 45  ? 0.2649 0.2370 0.1996 0.0478  -0.0419 0.0171  45   VAL A CA  
344  C  C   . VAL A 45  ? 0.2881 0.2558 0.1705 0.0219  -0.0104 -0.0172 45   VAL A C   
345  O  O   . VAL A 45  ? 0.2924 0.2537 0.1800 0.0236  -0.0255 0.0013  45   VAL A O   
346  C  CB  . VAL A 45  ? 0.3634 0.2829 0.1819 0.0414  -0.0610 0.0168  45   VAL A CB  
347  C  CG1 . VAL A 45  ? 0.3972 0.3583 0.1469 -0.0132 -0.0288 0.0022  45   VAL A CG1 
348  C  CG2 . VAL A 45  ? 0.4111 0.2177 0.2809 0.0039  -0.0769 0.0422  45   VAL A CG2 
349  N  N   . LYS A 46  ? 0.3033 0.2295 0.1936 0.0302  0.0213  0.0151  46   LYS A N   
350  C  CA  . LYS A 46  ? 0.3193 0.2428 0.1584 0.0124  0.0250  -0.0132 46   LYS A CA  
351  C  C   . LYS A 46  ? 0.2232 0.2268 0.1854 0.0231  -0.0205 0.0100  46   LYS A C   
352  O  O   . LYS A 46  ? 0.2814 0.2462 0.2089 -0.0036 -0.0347 -0.0033 46   LYS A O   
353  C  CB  . LYS A 46  ? 0.3693 0.3009 0.2192 0.0300  0.1088  -0.0273 46   LYS A CB  
354  C  CG  . LYS A 46  ? 0.4204 0.3343 0.2787 0.0694  0.0813  -0.0623 46   LYS A CG  
355  C  CD  . LYS A 46  ? 0.4297 0.4116 0.3433 0.1155  0.1097  -0.0704 46   LYS A CD  
356  C  CE  . LYS A 46  ? 0.5255 0.3978 0.4369 0.1131  0.1975  -0.0751 46   LYS A CE  
357  N  NZ  . LYS A 46  ? 0.6812 0.3962 0.7607 0.1213  0.0011  -0.1135 46   LYS A NZ  
358  N  N   . LEU A 47  ? 0.2652 0.2155 0.2008 0.0031  -0.0464 0.0236  47   LEU A N   
359  C  CA  . LEU A 47  ? 0.2286 0.2422 0.1863 0.0062  -0.0570 0.0212  47   LEU A CA  
360  C  C   . LEU A 47  ? 0.2317 0.2220 0.2086 0.0036  -0.0535 0.0114  47   LEU A C   
361  O  O   . LEU A 47  ? 0.2569 0.2185 0.1819 0.0083  -0.0095 0.0014  47   LEU A O   
362  C  CB  . LEU A 47  ? 0.2067 0.1927 0.1860 0.0175  -0.0109 -0.0270 47   LEU A CB  
363  C  CG  . LEU A 47  ? 0.2102 0.1535 0.1930 0.0189  -0.0330 0.0070  47   LEU A CG  
364  C  CD1 . LEU A 47  ? 0.2708 0.1668 0.2151 -0.0014 -0.0671 0.0100  47   LEU A CD1 
365  C  CD2 . LEU A 47  ? 0.2443 0.1803 0.2360 0.0600  0.0664  0.0304  47   LEU A CD2 
366  N  N   . ILE A 48  ? 0.2363 0.2193 0.2116 0.0127  -0.0338 -0.0076 48   ILE A N   
367  C  CA  . ILE A 48  ? 0.2497 0.2031 0.2150 0.0068  0.0114  -0.0210 48   ILE A CA  
368  C  C   . ILE A 48  ? 0.2038 0.2127 0.2339 0.0484  -0.0233 -0.0299 48   ILE A C   
369  O  O   . ILE A 48  ? 0.2704 0.2527 0.2468 -0.0072 -0.0462 -0.0332 48   ILE A O   
370  C  CB  . ILE A 48  ? 0.2166 0.2059 0.2018 0.0005  -0.0677 -0.0243 48   ILE A CB  
371  C  CG1 . ILE A 48  ? 0.2473 0.1966 0.2081 -0.0460 -0.0361 -0.0326 48   ILE A CG1 
372  C  CG2 . ILE A 48  ? 0.2118 0.2902 0.2102 -0.0067 -0.0548 -0.0284 48   ILE A CG2 
373  C  CD1 . ILE A 48  ? 0.2432 0.2191 0.2638 0.0105  -0.0442 -0.0574 48   ILE A CD1 
374  N  N   . ALA A 49  ? 0.2864 0.2346 0.2225 0.0497  -0.0559 -0.0014 49   ALA A N   
375  C  CA  . ALA A 49  ? 0.2944 0.2730 0.2184 0.0596  -0.0781 -0.0036 49   ALA A CA  
376  C  C   . ALA A 49  ? 0.2945 0.2396 0.2281 0.0161  -0.0705 -0.0054 49   ALA A C   
377  O  O   . ALA A 49  ? 0.3284 0.2927 0.3239 -0.0156 -0.0907 -0.0932 49   ALA A O   
378  C  CB  . ALA A 49  ? 0.3673 0.2575 0.2257 0.0305  -0.0748 0.0086  49   ALA A CB  
379  N  N   . ASP A 50  ? 0.2849 0.2030 0.2387 0.0379  -0.0516 -0.0335 50   ASP A N   
380  C  CA  . ASP A 50  ? 0.2922 0.1920 0.2383 0.0266  -0.0262 -0.0586 50   ASP A CA  
381  C  C   . ASP A 50  ? 0.2497 0.2059 0.2718 0.0363  -0.0308 -0.0210 50   ASP A C   
382  O  O   . ASP A 50  ? 0.3293 0.2096 0.3039 0.0352  -0.0087 -0.0228 50   ASP A O   
383  C  CB  . ASP A 50  ? 0.2881 0.2409 0.1982 0.0458  -0.0219 0.0400  50   ASP A CB  
384  C  CG  . ASP A 50  ? 0.3299 0.2746 0.1831 -0.0006 -0.0288 0.0271  50   ASP A CG  
385  O  OD1 . ASP A 50  ? 0.3299 0.3377 0.2158 0.0058  0.0191  -0.0008 50   ASP A OD1 
386  O  OD2 . ASP A 50  ? 0.3867 0.3117 0.1696 0.0685  -0.0319 -0.0176 50   ASP A OD2 
387  N  N   . MET A 51  ? 0.3103 0.2150 0.2043 0.0068  -0.0562 -0.0088 51   MET A N   
388  C  CA  . MET A 51  ? 0.3060 0.2196 0.2576 0.0349  -0.0252 0.0277  51   MET A CA  
389  C  C   . MET A 51  ? 0.3326 0.3081 0.3085 -0.0267 -0.0182 -0.0102 51   MET A C   
390  O  O   . MET A 51  ? 0.3339 0.2169 0.4341 0.0242  0.0363  0.0022  51   MET A O   
391  C  CB  . MET A 51  ? 0.2658 0.2720 0.2447 -0.0347 0.0531  0.0090  51   MET A CB  
392  C  CG  . MET A 51  ? 0.2944 0.2457 0.3107 0.0459  -0.0043 -0.0484 51   MET A CG  
393  S  SD  . MET A 51  ? 0.3510 0.2615 0.2318 0.0018  0.0192  0.0088  51   MET A SD  
394  C  CE  . MET A 51  ? 0.3945 0.2510 0.1587 0.0417  -0.0754 -0.0266 51   MET A CE  
395  N  N   . GLY A 52  ? 0.2998 0.3416 0.2666 -0.0068 -0.0302 -0.0705 52   GLY A N   
396  C  CA  . GLY A 52  ? 0.2924 0.3757 0.4029 -0.0019 -0.0350 -0.1143 52   GLY A CA  
397  C  C   . GLY A 52  ? 0.3009 0.3516 0.4486 -0.0260 -0.0035 -0.1265 52   GLY A C   
398  O  O   . GLY A 52  ? 0.3296 0.4272 0.5813 -0.0751 0.0504  -0.2423 52   GLY A O   
399  N  N   . ILE A 53  ? 0.2161 0.2658 0.3977 0.0456  -0.0617 -0.0575 53   ILE A N   
400  C  CA  . ILE A 53  ? 0.2052 0.2301 0.3198 0.0195  -0.0664 -0.0032 53   ILE A CA  
401  C  C   . ILE A 53  ? 0.2527 0.2095 0.1905 0.0055  -0.0119 -0.0243 53   ILE A C   
402  O  O   . ILE A 53  ? 0.2630 0.2825 0.2756 -0.0421 0.0164  0.0027  53   ILE A O   
403  C  CB  . ILE A 53  ? 0.2590 0.2113 0.3594 0.0639  -0.1192 -0.0139 53   ILE A CB  
404  C  CG1 . ILE A 53  ? 0.2800 0.2055 0.3811 0.0542  -0.1571 -0.0052 53   ILE A CG1 
405  C  CG2 . ILE A 53  ? 0.2516 0.2244 0.3528 0.0611  -0.0531 0.0150  53   ILE A CG2 
406  C  CD1 . ILE A 53  ? 0.2618 0.2887 0.3483 0.0203  -0.1174 0.0267  53   ILE A CD1 
407  N  N   . SER A 54  ? 0.2640 0.1948 0.1843 0.0039  -0.0161 -0.0372 54   SER A N   
408  C  CA  . SER A 54  ? 0.2517 0.1917 0.2389 -0.0093 0.0057  -0.0237 54   SER A CA  
409  C  C   . SER A 54  ? 0.2131 0.1837 0.2752 0.0069  -0.0344 0.0041  54   SER A C   
410  O  O   . SER A 54  ? 0.2201 0.2175 0.2562 0.0177  -0.0093 0.0186  54   SER A O   
411  C  CB  . SER A 54  ? 0.2142 0.2264 0.2442 0.0010  -0.0389 0.0265  54   SER A CB  
412  O  OG  . SER A 54  ? 0.2436 0.2440 0.2500 -0.0190 0.0069  -0.0451 54   SER A OG  
413  N  N   . VAL A 55  ? 0.2461 0.2007 0.1803 -0.0190 0.0006  -0.0033 55   VAL A N   
414  C  CA  . VAL A 55  ? 0.2008 0.1812 0.2126 0.0054  -0.0050 -0.0037 55   VAL A CA  
415  C  C   . VAL A 55  ? 0.2053 0.1724 0.2082 -0.0046 -0.0135 -0.0138 55   VAL A C   
416  O  O   . VAL A 55  ? 0.2107 0.2301 0.2133 -0.0326 -0.0169 -0.0030 55   VAL A O   
417  C  CB  . VAL A 55  ? 0.2281 0.1935 0.2216 -0.0005 -0.0211 0.0070  55   VAL A CB  
418  C  CG1 . VAL A 55  ? 0.2501 0.2000 0.2390 -0.0408 0.0436  -0.0208 55   VAL A CG1 
419  C  CG2 . VAL A 55  ? 0.3551 0.2223 0.2022 0.0144  -0.0234 0.0136  55   VAL A CG2 
420  N  N   . ARG A 56  ? 0.2091 0.2136 0.2060 0.0201  -0.0124 -0.0151 56   ARG A N   
421  C  CA  . ARG A 56  ? 0.1873 0.2003 0.2045 -0.0242 -0.0180 -0.0226 56   ARG A CA  
422  C  C   . ARG A 56  ? 0.2023 0.2033 0.2096 -0.0204 0.0060  -0.0127 56   ARG A C   
423  O  O   . ARG A 56  ? 0.2858 0.2113 0.2251 -0.0398 -0.0493 -0.0068 56   ARG A O   
424  C  CB  . ARG A 56  ? 0.1915 0.1956 0.2710 -0.0180 -0.0001 -0.0357 56   ARG A CB  
425  C  CG  . ARG A 56  ? 0.2174 0.1834 0.2903 -0.0124 0.0381  0.0036  56   ARG A CG  
426  C  CD  . ARG A 56  ? 0.2353 0.1969 0.3570 0.0175  0.0533  0.0076  56   ARG A CD  
427  N  NE  . ARG A 56  ? 0.2572 0.2082 0.2084 -0.0004 -0.0233 0.0247  56   ARG A NE  
428  C  CZ  . ARG A 56  ? 0.2658 0.2023 0.2038 -0.0434 -0.0249 0.0373  56   ARG A CZ  
429  N  NH1 . ARG A 56  ? 0.2836 0.2085 0.1540 -0.0009 -0.0053 0.0192  56   ARG A NH1 
430  N  NH2 . ARG A 56  ? 0.2932 0.1838 0.2126 -0.0093 -0.0357 0.0357  56   ARG A NH2 
431  N  N   . ALA A 57  ? 0.2380 0.2132 0.2220 0.0238  -0.0090 -0.0208 57   ALA A N   
432  C  CA  . ALA A 57  ? 0.2132 0.2253 0.1937 0.0484  0.0390  -0.0159 57   ALA A CA  
433  C  C   . ALA A 57  ? 0.2569 0.2205 0.2287 0.0002  -0.0222 0.0153  57   ALA A C   
434  O  O   . ALA A 57  ? 0.2659 0.2412 0.2109 0.0296  0.0047  0.0179  57   ALA A O   
435  C  CB  . ALA A 57  ? 0.2847 0.2069 0.2848 -0.0008 -0.0327 -0.0099 57   ALA A CB  
436  N  N   . LEU A 58  ? 0.2342 0.2231 0.1951 0.0197  -0.0245 0.0096  58   LEU A N   
437  C  CA  . LEU A 58  ? 0.2207 0.1831 0.1800 0.0441  -0.0125 0.0188  58   LEU A CA  
438  C  C   . LEU A 58  ? 0.1877 0.1985 0.2176 0.0192  0.0012  -0.0042 58   LEU A C   
439  O  O   . LEU A 58  ? 0.2198 0.2137 0.2158 0.0369  -0.0389 0.0148  58   LEU A O   
440  C  CB  . LEU A 58  ? 0.2669 0.2199 0.1543 -0.0389 -0.0324 0.0213  58   LEU A CB  
441  C  CG  . LEU A 58  ? 0.2593 0.1724 0.1745 -0.0467 0.0077  0.0260  58   LEU A CG  
442  C  CD1 . LEU A 58  ? 0.2646 0.1955 0.2010 -0.0010 0.0368  0.0339  58   LEU A CD1 
443  C  CD2 . LEU A 58  ? 0.3039 0.2208 0.1339 -0.0146 0.0045  0.0089  58   LEU A CD2 
444  N  N   . LEU A 59  ? 0.1886 0.1951 0.1977 0.0121  0.0073  -0.0017 59   LEU A N   
445  C  CA  . LEU A 59  ? 0.1852 0.1778 0.1997 0.0179  -0.0116 0.0051  59   LEU A CA  
446  C  C   . LEU A 59  ? 0.2752 0.1513 0.2011 0.0065  -0.0139 0.0064  59   LEU A C   
447  O  O   . LEU A 59  ? 0.3157 0.2174 0.2196 -0.0511 -0.0474 0.0378  59   LEU A O   
448  C  CB  . LEU A 59  ? 0.2046 0.1643 0.2971 0.0285  -0.0129 0.0141  59   LEU A CB  
449  C  CG  . LEU A 59  ? 0.1641 0.2328 0.3786 0.0311  0.0180  0.0949  59   LEU A CG  
450  C  CD1 . LEU A 59  ? 0.1918 0.2168 0.3097 0.0531  -0.0001 0.0269  59   LEU A CD1 
451  C  CD2 . LEU A 59  ? 0.2059 0.2908 0.3781 -0.0210 -0.0365 0.1148  59   LEU A CD2 
452  N  N   . LYS A 60  ? 0.2421 0.1763 0.1677 0.0049  0.0100  0.0265  60   LYS A N   
453  C  CA  . LYS A 60  ? 0.2734 0.1991 0.1663 -0.0012 0.0188  0.0118  60   LYS A CA  
454  C  C   . LYS A 60  ? 0.2878 0.2156 0.2085 -0.0311 0.0576  -0.0179 60   LYS A C   
455  O  O   . LYS A 60  ? 0.2306 0.2128 0.1894 -0.0132 0.0455  -0.0199 60   LYS A O   
456  C  CB  . LYS A 60  ? 0.2878 0.3048 0.2097 0.0277  -0.0350 -0.0507 60   LYS A CB  
457  C  CG  . LYS A 60  ? 0.3347 0.3199 0.2041 0.0344  -0.0278 -0.0002 60   LYS A CG  
458  C  CD  . LYS A 60  ? 0.3011 0.3745 0.2862 0.0939  0.0374  0.0472  60   LYS A CD  
459  C  CE  . LYS A 60  ? 0.3149 0.3819 0.2928 0.0453  -0.0326 0.0930  60   LYS A CE  
460  N  NZ  . LYS A 60  ? 0.4181 0.3180 0.2473 -0.0311 0.0102  -0.0039 60   LYS A NZ  
461  N  N   . LYS A 61  ? 0.2654 0.2258 0.2002 0.0193  0.0351  0.0479  61   LYS A N   
462  C  CA  . LYS A 61  ? 0.3336 0.2415 0.2038 -0.0109 0.0822  0.0288  61   LYS A CA  
463  C  C   . LYS A 61  ? 0.3362 0.2905 0.2295 -0.0665 0.0725  0.0056  61   LYS A C   
464  O  O   . LYS A 61  ? 0.3898 0.2547 0.2282 -0.0046 0.0434  -0.0343 61   LYS A O   
465  C  CB  . LYS A 61  ? 0.2864 0.2772 0.2477 -0.0047 0.0709  -0.0262 61   LYS A CB  
466  C  CG  . LYS A 61  ? 0.3142 0.2887 0.2221 0.0141  0.0392  0.0355  61   LYS A CG  
467  C  CD  . LYS A 61  ? 0.2506 0.3879 0.3541 0.0130  0.0178  -0.0164 61   LYS A CD  
468  C  CE  . LYS A 61  ? 0.3597 0.4734 0.3323 -0.0397 -0.0842 0.1050  61   LYS A CE  
469  N  NZ  . LYS A 61  ? 0.5486 0.7361 0.4998 -0.3474 -0.0711 0.0614  61   LYS A NZ  
470  N  N   . ASN A 62  ? 0.2625 0.3056 0.2102 -0.0465 0.0157  0.0161  62   ASN A N   
471  C  CA  . ASN A 62  ? 0.2343 0.2131 0.2177 -0.0002 0.0044  0.0281  62   ASN A CA  
472  C  C   . ASN A 62  ? 0.2199 0.2274 0.1901 0.0098  0.0169  0.0262  62   ASN A C   
473  O  O   . ASN A 62  ? 0.2141 0.2370 0.2023 0.0333  0.0182  0.0270  62   ASN A O   
474  C  CB  A ASN A 62  ? 0.3718 0.1906 0.2000 -0.0140 0.0685  0.0040  62   ASN A CB  
475  C  CB  B ASN A 62  ? 0.3288 0.1989 0.2123 -0.0102 0.0471  0.0168  62   ASN A CB  
476  C  CG  A ASN A 62  ? 0.3671 0.2435 0.1898 0.0293  -0.0475 0.0526  62   ASN A CG  
477  C  CG  B ASN A 62  ? 0.3274 0.1901 0.2082 -0.0171 0.0580  0.0151  62   ASN A CG  
478  O  OD1 A ASN A 62  ? 0.2844 0.3480 0.4349 0.0821  -0.0670 -0.1506 62   ASN A OD1 
479  O  OD1 B ASN A 62  ? 0.2577 0.2120 0.2207 0.0108  0.0141  0.0088  62   ASN A OD1 
480  N  ND2 A ASN A 62  ? 0.7654 0.4454 0.2396 0.1389  -0.2744 0.1910  62   ASN A ND2 
481  N  ND2 B ASN A 62  ? 0.4096 0.2101 0.2233 0.0522  -0.0560 -0.0824 62   ASN A ND2 
482  N  N   . VAL A 63  ? 0.2323 0.1799 0.1832 -0.0036 0.0027  -0.0010 63   VAL A N   
483  C  CA  . VAL A 63  ? 0.2130 0.1760 0.1421 0.0146  -0.0108 -0.0111 63   VAL A CA  
484  C  C   . VAL A 63  ? 0.2142 0.1773 0.1749 0.0099  0.0105  0.0099  63   VAL A C   
485  O  O   . VAL A 63  ? 0.2206 0.1793 0.1695 0.0115  0.0062  0.0328  63   VAL A O   
486  C  CB  . VAL A 63  ? 0.2389 0.1795 0.1363 0.0264  0.0100  0.0288  63   VAL A CB  
487  C  CG1 . VAL A 63  ? 0.1957 0.1757 0.2651 0.0276  -0.0121 0.0243  63   VAL A CG1 
488  C  CG2 . VAL A 63  ? 0.2496 0.2103 0.1272 -0.0375 0.0225  0.0249  63   VAL A CG2 
489  N  N   . GLU A 64  ? 0.2321 0.1699 0.1582 0.0216  0.0054  -0.0091 64   GLU A N   
490  C  CA  . GLU A 64  ? 0.1902 0.1709 0.1598 0.0227  0.0262  0.0129  64   GLU A CA  
491  C  C   . GLU A 64  ? 0.2128 0.1985 0.1686 0.0243  0.0251  0.0265  64   GLU A C   
492  O  O   . GLU A 64  ? 0.1957 0.1971 0.2002 0.0137  -0.0042 0.0215  64   GLU A O   
493  C  CB  . GLU A 64  ? 0.2427 0.1767 0.1950 -0.0137 0.0129  0.0076  64   GLU A CB  
494  C  CG  . GLU A 64  ? 0.2073 0.1930 0.2534 -0.0028 0.0234  -0.0114 64   GLU A CG  
495  C  CD  . GLU A 64  ? 0.2779 0.1827 0.1666 0.0208  -0.0026 -0.0115 64   GLU A CD  
496  O  OE1 . GLU A 64  ? 0.3627 0.1808 0.2523 0.0256  -0.0340 -0.0167 64   GLU A OE1 
497  O  OE2 . GLU A 64  ? 0.3038 0.2070 0.2828 0.0252  -0.0642 -0.0226 64   GLU A OE2 
498  N  N   . PRO A 65  ? 0.2218 0.1858 0.1648 -0.0073 0.0242  0.0200  65   PRO A N   
499  C  CA  . PRO A 65  ? 0.2146 0.1699 0.1518 -0.0066 0.0209  -0.0123 65   PRO A CA  
500  C  C   . PRO A 65  ? 0.1809 0.1517 0.1683 0.0209  0.0473  -0.0411 65   PRO A C   
501  O  O   . PRO A 65  ? 0.2146 0.1990 0.1964 0.0059  0.0153  0.0242  65   PRO A O   
502  C  CB  . PRO A 65  ? 0.1863 0.2004 0.1584 -0.0148 0.0139  0.0005  65   PRO A CB  
503  C  CG  . PRO A 65  ? 0.2077 0.3779 0.1850 0.0599  0.0475  0.0728  65   PRO A CG  
504  C  CD  . PRO A 65  ? 0.2098 0.2574 0.1791 0.0004  0.0569  0.0812  65   PRO A CD  
505  N  N   . TYR A 66  ? 0.1920 0.1714 0.1939 0.0025  0.0059  -0.0057 66   TYR A N   
506  C  CA  . TYR A 66  ? 0.1905 0.1749 0.1697 -0.0062 0.0193  0.0147  66   TYR A CA  
507  C  C   . TYR A 66  ? 0.1932 0.1794 0.1707 0.0055  -0.0007 -0.0148 66   TYR A C   
508  O  O   . TYR A 66  ? 0.1951 0.1918 0.1645 0.0003  0.0050  0.0178  66   TYR A O   
509  C  CB  . TYR A 66  ? 0.1946 0.1756 0.2107 -0.0003 0.0839  0.0164  66   TYR A CB  
510  C  CG  . TYR A 66  ? 0.2136 0.1600 0.2360 -0.0037 0.0629  0.0343  66   TYR A CG  
511  C  CD1 . TYR A 66  ? 0.1568 0.2331 0.2679 0.0112  0.0337  0.0309  66   TYR A CD1 
512  C  CD2 . TYR A 66  ? 0.2543 0.2033 0.1905 0.0003  0.0062  0.0632  66   TYR A CD2 
513  C  CE1 . TYR A 66  ? 0.1950 0.2266 0.3620 -0.0146 0.0606  -0.0412 66   TYR A CE1 
514  C  CE2 . TYR A 66  ? 0.2631 0.2270 0.2655 -0.0099 0.0154  0.0185  66   TYR A CE2 
515  C  CZ  . TYR A 66  ? 0.3195 0.2299 0.3224 -0.0728 0.0728  -0.0101 66   TYR A CZ  
516  O  OH  . TYR A 66  ? 0.2804 0.2205 0.3211 -0.0220 0.0607  -0.0348 66   TYR A OH  
517  N  N   . GLU A 67  ? 0.2162 0.1948 0.1780 0.0312  -0.0113 -0.0138 67   GLU A N   
518  C  CA  . GLU A 67  ? 0.2213 0.1733 0.1680 -0.0011 0.0070  -0.0185 67   GLU A CA  
519  C  C   . GLU A 67  ? 0.2085 0.1720 0.1654 0.0007  0.0136  -0.0219 67   GLU A C   
520  O  O   . GLU A 67  ? 0.2056 0.1896 0.1880 -0.0019 0.0286  0.0147  67   GLU A O   
521  C  CB  . GLU A 67  ? 0.1841 0.2500 0.1725 -0.0022 -0.0030 -0.0013 67   GLU A CB  
522  C  CG  . GLU A 67  ? 0.4269 0.2545 0.1768 0.0120  0.0029  0.0288  67   GLU A CG  
523  C  CD  . GLU A 67  ? 0.4690 0.2466 0.3582 0.0034  0.0207  0.0607  67   GLU A CD  
524  O  OE1 . GLU A 67  ? 0.4307 0.2921 0.3067 -0.0082 0.0748  0.0197  67   GLU A OE1 
525  O  OE2 . GLU A 67  ? 0.5050 0.2507 0.7271 0.1287  0.3405  0.1443  67   GLU A OE2 
526  N  N   . GLN A 68  ? 0.2129 0.2033 0.1421 -0.0132 -0.0245 0.0260  68   GLN A N   
527  C  CA  . GLN A 68  ? 0.2116 0.2001 0.1592 -0.0130 0.0220  0.0319  68   GLN A CA  
528  C  C   . GLN A 68  ? 0.2762 0.1641 0.1726 -0.0060 -0.0218 0.0144  68   GLN A C   
529  O  O   . GLN A 68  ? 0.2749 0.1799 0.1687 0.0118  0.0066  0.0143  68   GLN A O   
530  C  CB  . GLN A 68  ? 0.2357 0.2051 0.1602 -0.0204 0.0120  -0.0024 68   GLN A CB  
531  C  CG  . GLN A 68  ? 0.2404 0.2031 0.1720 -0.0078 0.0027  0.0194  68   GLN A CG  
532  C  CD  . GLN A 68  ? 0.2259 0.1746 0.1803 0.0191  -0.0023 0.0017  68   GLN A CD  
533  O  OE1 . GLN A 68  ? 0.2610 0.1952 0.2031 -0.0261 0.0159  -0.0002 68   GLN A OE1 
534  N  NE2 . GLN A 68  ? 0.2837 0.2378 0.1929 -0.0219 0.0056  -0.0310 68   GLN A NE2 
535  N  N   . LEU A 69  ? 0.1979 0.1901 0.1588 0.0223  0.0054  0.0407  69   LEU A N   
536  C  CA  . LEU A 69  ? 0.2202 0.2150 0.1474 -0.0128 0.0139  0.0498  69   LEU A CA  
537  C  C   . LEU A 69  ? 0.2108 0.1611 0.1861 0.0111  -0.0148 0.0832  69   LEU A C   
538  O  O   . LEU A 69  ? 0.2473 0.2094 0.1713 -0.0117 -0.0129 0.0391  69   LEU A O   
539  C  CB  . LEU A 69  ? 0.2486 0.2496 0.1781 -0.0353 0.0384  0.0078  69   LEU A CB  
540  C  CG  . LEU A 69  ? 0.2408 0.1929 0.1651 -0.0085 0.0516  0.0079  69   LEU A CG  
541  C  CD1 . LEU A 69  ? 0.2613 0.1869 0.2170 -0.0150 0.0506  -0.0448 69   LEU A CD1 
542  C  CD2 . LEU A 69  ? 0.2679 0.1955 0.2690 0.0046  0.0371  0.0279  69   LEU A CD2 
543  N  N   . GLY A 70  ? 0.2485 0.1952 0.1711 -0.0271 0.0291  0.0337  70   GLY A N   
544  C  CA  . GLY A 70  ? 0.2459 0.2128 0.2472 -0.0288 0.0798  -0.0388 70   GLY A CA  
545  C  C   . GLY A 70  ? 0.2341 0.2184 0.1805 0.0039  0.0176  -0.0096 70   GLY A C   
546  O  O   . GLY A 70  ? 0.2658 0.2013 0.2200 0.0135  -0.0338 0.0510  70   GLY A O   
547  N  N   . LEU A 71  ? 0.2340 0.1949 0.1684 0.0013  0.0020  -0.0075 71   LEU A N   
548  C  CA  . LEU A 71  ? 0.1998 0.2409 0.1486 -0.0313 0.0478  -0.0184 71   LEU A CA  
549  C  C   . LEU A 71  ? 0.1765 0.1828 0.1435 0.0128  0.0061  0.0095  71   LEU A C   
550  O  O   . LEU A 71  ? 0.3122 0.2133 0.1517 -0.0349 -0.0226 0.0123  71   LEU A O   
551  C  CB  . LEU A 71  ? 0.2010 0.2490 0.1645 -0.0278 0.0331  -0.0200 71   LEU A CB  
552  C  CG  . LEU A 71  ? 0.1350 0.1956 0.1873 0.0158  -0.0352 0.0044  71   LEU A CG  
553  C  CD1 . LEU A 71  ? 0.1473 0.2596 0.2721 0.0365  -0.0110 0.0067  71   LEU A CD1 
554  C  CD2 . LEU A 71  ? 0.1876 0.2037 0.1782 0.0177  -0.0462 -0.0041 71   LEU A CD2 
555  N  N   . ALA A 72  ? 0.1842 0.2035 0.1666 -0.0003 0.0251  0.0225  72   ALA A N   
556  C  CA  . ALA A 72  ? 0.2550 0.2849 0.1553 -0.0681 -0.0142 0.0637  72   ALA A CA  
557  C  C   . ALA A 72  ? 0.2391 0.2470 0.1543 -0.0423 -0.0118 0.0012  72   ALA A C   
558  O  O   . ALA A 72  ? 0.2630 0.2645 0.2780 -0.0644 -0.0340 -0.0026 72   ALA A O   
559  C  CB  . ALA A 72  ? 0.3072 0.2454 0.1516 -0.0954 -0.0070 0.0651  72   ALA A CB  
560  N  N   . GLU A 73  ? 0.2322 0.2555 0.2164 -0.0445 -0.0096 0.0307  73   GLU A N   
561  C  CA  . GLU A 73  ? 0.2068 0.2462 0.1835 -0.0269 0.0257  0.0057  73   GLU A CA  
562  C  C   . GLU A 73  ? 0.2383 0.2460 0.1874 -0.0322 0.0233  -0.0044 73   GLU A C   
563  O  O   . GLU A 73  ? 0.2259 0.2047 0.1783 0.0212  0.0274  0.0120  73   GLU A O   
564  C  CB  . GLU A 73  ? 0.3079 0.2740 0.2293 0.0398  0.0736  -0.0005 73   GLU A CB  
565  C  CG  . GLU A 73  ? 0.6072 0.3470 0.3660 -0.0750 0.1989  -0.1319 73   GLU A CG  
566  C  CD  . GLU A 73  ? 0.5492 0.3676 0.6404 0.0372  0.2553  -0.1621 73   GLU A CD  
567  O  OE1 . GLU A 73  ? 1.5649 0.3770 0.5154 -0.2772 -0.2066 -0.0039 73   GLU A OE1 
568  O  OE2 . GLU A 73  ? 0.4997 0.6365 0.7901 0.1268  0.2885  -0.0132 73   GLU A OE2 
569  N  N   . ASP A 74  ? 0.2528 0.2133 0.1830 -0.0227 -0.0125 0.0446  74   ASP A N   
570  C  CA  . ASP A 74  ? 0.3062 0.2359 0.1793 -0.0673 -0.0027 0.0425  74   ASP A CA  
571  C  C   . ASP A 74  ? 0.2704 0.2352 0.1640 -0.0623 -0.0246 0.0256  74   ASP A C   
572  O  O   . ASP A 74  ? 0.2564 0.2829 0.2944 -0.0648 -0.0486 0.0704  74   ASP A O   
573  C  CB  . ASP A 74  ? 0.4422 0.3022 0.1897 -0.1594 -0.0657 0.0840  74   ASP A CB  
574  C  CG  . ASP A 74  ? 0.2635 0.3767 0.2086 -0.0517 -0.1249 0.0370  74   ASP A CG  
575  O  OD1 . ASP A 74  ? 0.2965 0.4583 0.3779 -0.0733 -0.1277 -0.0774 74   ASP A OD1 
576  O  OD2 . ASP A 74  ? 0.3443 0.3121 0.3101 -0.0766 -0.0235 -0.0115 74   ASP A OD2 
577  N  N   . LYS A 75  ? 0.1991 0.1775 0.2202 -0.0005 0.0269  0.0176  75   LYS A N   
578  C  CA  . LYS A 75  ? 0.1907 0.2146 0.2122 0.0000  -0.0053 0.0496  75   LYS A CA  
579  C  C   . LYS A 75  ? 0.1920 0.1950 0.1928 -0.0033 -0.0089 0.0389  75   LYS A C   
580  O  O   . LYS A 75  ? 0.2045 0.1798 0.1862 -0.0075 -0.0021 0.0132  75   LYS A O   
581  C  CB  . LYS A 75  ? 0.4772 0.1704 0.2866 0.0642  0.1422  0.0723  75   LYS A CB  
582  C  CG  . LYS A 75  ? 0.5346 0.3396 0.4102 0.0378  0.2174  -0.0204 75   LYS A CG  
583  C  CD  . LYS A 75  ? 0.6104 0.4116 0.4193 0.0250  0.2516  -0.0803 75   LYS A CD  
584  C  CE  . LYS A 75  ? 0.9485 0.5406 0.4053 -0.2035 -0.0454 0.0568  75   LYS A CE  
585  N  NZ  . LYS A 75  ? 1.2464 0.6779 0.3770 -0.2298 -0.0965 -0.0835 75   LYS A NZ  
586  N  N   . PHE A 76  ? 0.2121 0.1799 0.1693 -0.0163 -0.0043 0.0115  76   PHE A N   
587  C  CA  . PHE A 76  ? 0.2039 0.1936 0.1398 -0.0080 -0.0188 -0.0073 76   PHE A CA  
588  C  C   . PHE A 76  ? 0.2404 0.2056 0.1326 -0.0539 -0.0105 -0.0089 76   PHE A C   
589  O  O   . PHE A 76  ? 0.2593 0.1762 0.2032 -0.0078 0.0341  -0.0094 76   PHE A O   
590  C  CB  . PHE A 76  ? 0.2148 0.2649 0.1352 -0.0481 -0.0289 0.0184  76   PHE A CB  
591  C  CG  . PHE A 76  ? 0.2540 0.2117 0.1253 -0.0486 -0.0359 0.0491  76   PHE A CG  
592  C  CD1 . PHE A 76  ? 0.1870 0.1986 0.1652 -0.0141 0.0014  0.0281  76   PHE A CD1 
593  C  CD2 . PHE A 76  ? 0.2697 0.2063 0.1708 -0.0480 -0.0172 0.0488  76   PHE A CD2 
594  C  CE1 . PHE A 76  ? 0.2740 0.1837 0.1961 -0.0263 0.0355  0.0121  76   PHE A CE1 
595  C  CE2 . PHE A 76  ? 0.1638 0.1932 0.1742 -0.0037 -0.0431 0.0447  76   PHE A CE2 
596  C  CZ  . PHE A 76  ? 0.2379 0.1702 0.2003 -0.0091 -0.0018 0.0404  76   PHE A CZ  
597  N  N   . THR A 77  ? 0.2710 0.2157 0.1563 0.0027  0.0286  0.0099  77   THR A N   
598  C  CA  . THR A 77  ? 0.2374 0.1966 0.1420 0.0020  0.0021  0.0146  77   THR A CA  
599  C  C   . THR A 77  ? 0.2281 0.1925 0.1603 -0.0085 -0.0146 0.0026  77   THR A C   
600  O  O   . THR A 77  ? 0.2595 0.1756 0.1515 -0.0018 -0.0209 -0.0030 77   THR A O   
601  C  CB  . THR A 77  ? 0.2010 0.1897 0.1654 -0.0087 0.0293  0.0270  77   THR A CB  
602  O  OG1 . THR A 77  ? 0.2299 0.1426 0.1897 0.0100  0.0018  -0.0030 77   THR A OG1 
603  C  CG2 . THR A 77  ? 0.2292 0.2067 0.1799 0.0171  0.0115  0.0310  77   THR A CG2 
604  N  N   . ASP A 78  ? 0.2289 0.1686 0.1816 -0.0117 -0.0367 0.0053  78   ASP A N   
605  C  CA  . ASP A 78  ? 0.2488 0.1810 0.1743 0.0076  -0.0388 0.0077  78   ASP A CA  
606  C  C   . ASP A 78  ? 0.2187 0.1411 0.1775 0.0489  -0.0022 -0.0193 78   ASP A C   
607  O  O   . ASP A 78  ? 0.2285 0.1859 0.2069 0.0094  -0.0208 0.0505  78   ASP A O   
608  C  CB  . ASP A 78  ? 0.2690 0.1894 0.2074 0.0036  -0.0366 -0.0128 78   ASP A CB  
609  C  CG  . ASP A 78  ? 0.2984 0.1999 0.1965 -0.0213 -0.0790 0.0143  78   ASP A CG  
610  O  OD1 . ASP A 78  ? 0.3066 0.2616 0.2492 -0.0683 -0.0741 -0.0367 78   ASP A OD1 
611  O  OD2 . ASP A 78  ? 0.2771 0.1984 0.3086 0.0062  0.0170  -0.0085 78   ASP A OD2 
612  N  N   . ASP A 79  ? 0.1908 0.1886 0.1663 0.0074  -0.0515 -0.0072 79   ASP A N   
613  C  CA  . ASP A 79  ? 0.1845 0.2214 0.1485 0.0118  -0.0045 -0.0197 79   ASP A CA  
614  C  C   . ASP A 79  ? 0.1816 0.1508 0.1609 0.0092  -0.0147 0.0021  79   ASP A C   
615  O  O   . ASP A 79  ? 0.1835 0.2006 0.1718 -0.0023 -0.0319 0.0172  79   ASP A O   
616  C  CB  . ASP A 79  ? 0.2318 0.1830 0.1664 0.0098  -0.0411 -0.0052 79   ASP A CB  
617  C  CG  . ASP A 79  ? 0.2217 0.2390 0.1361 0.0247  -0.0321 -0.0118 79   ASP A CG  
618  O  OD1 . ASP A 79  ? 0.2459 0.1972 0.1671 -0.0014 -0.0386 -0.0093 79   ASP A OD1 
619  O  OD2 . ASP A 79  ? 0.2093 0.2804 0.2260 0.0069  -0.0037 -0.0328 79   ASP A OD2 
620  N  N   . GLN A 80  ? 0.2012 0.1383 0.1478 0.0020  0.0051  0.0221  80   GLN A N   
621  C  CA  . GLN A 80  ? 0.1987 0.1277 0.1561 0.0013  -0.0028 0.0136  80   GLN A CA  
622  C  C   . GLN A 80  ? 0.1827 0.1524 0.1569 -0.0040 0.0010  0.0318  80   GLN A C   
623  O  O   . GLN A 80  ? 0.2081 0.1628 0.1485 -0.0010 -0.0101 0.0200  80   GLN A O   
624  C  CB  . GLN A 80  ? 0.2021 0.1459 0.1684 0.0147  -0.0150 0.0023  80   GLN A CB  
625  C  CG  . GLN A 80  ? 0.1924 0.1513 0.1826 -0.0036 -0.0045 0.0308  80   GLN A CG  
626  C  CD  . GLN A 80  ? 0.1838 0.1659 0.1609 -0.0036 -0.0304 0.0179  80   GLN A CD  
627  O  OE1 . GLN A 80  ? 0.1964 0.1786 0.1651 -0.0157 -0.0105 0.0126  80   GLN A OE1 
628  N  NE2 . GLN A 80  ? 0.1968 0.1596 0.1684 0.0024  0.0136  0.0003  80   GLN A NE2 
629  N  N   . LEU A 81  ? 0.2071 0.1310 0.1824 0.0168  -0.0079 0.0182  81   LEU A N   
630  C  CA  . LEU A 81  ? 0.1880 0.1394 0.1878 0.0129  0.0073  0.0319  81   LEU A CA  
631  C  C   . LEU A 81  ? 0.1683 0.2143 0.1424 0.0060  -0.0243 -0.0159 81   LEU A C   
632  O  O   . LEU A 81  ? 0.2159 0.1914 0.1393 -0.0098 -0.0390 0.0219  81   LEU A O   
633  C  CB  . LEU A 81  ? 0.2065 0.1498 0.1120 -0.0002 0.0317  0.0024  81   LEU A CB  
634  C  CG  . LEU A 81  ? 0.2044 0.1009 0.1571 0.0061  0.0302  -0.0152 81   LEU A CG  
635  C  CD1 . LEU A 81  ? 0.2268 0.1381 0.2081 -0.0282 0.0144  0.0131  81   LEU A CD1 
636  C  CD2 . LEU A 81  ? 0.2238 0.1532 0.1601 0.0409  0.0266  -0.0303 81   LEU A CD2 
637  N  N   . ILE A 82  ? 0.1777 0.1841 0.1435 -0.0066 -0.0240 -0.0138 82   ILE A N   
638  C  CA  . ILE A 82  ? 0.1948 0.1796 0.1852 -0.0144 0.0271  0.0200  82   ILE A CA  
639  C  C   . ILE A 82  ? 0.1691 0.1641 0.1970 0.0025  -0.0050 0.0537  82   ILE A C   
640  O  O   . ILE A 82  ? 0.2082 0.1641 0.1912 0.0251  -0.0349 0.0377  82   ILE A O   
641  C  CB  . ILE A 82  ? 0.1923 0.1618 0.1798 0.0144  0.0161  0.0411  82   ILE A CB  
642  C  CG1 . ILE A 82  ? 0.2370 0.1644 0.2191 0.0178  -0.0289 0.0167  82   ILE A CG1 
643  C  CG2 . ILE A 82  ? 0.1929 0.2584 0.1938 0.0173  0.0197  -0.0409 82   ILE A CG2 
644  C  CD1 . ILE A 82  ? 0.3241 0.2063 0.2241 0.0167  -0.0278 0.0017  82   ILE A CD1 
645  N  N   . ASP A 83  ? 0.2106 0.1609 0.1422 0.0174  -0.0206 0.0469  83   ASP A N   
646  C  CA  . ASP A 83  ? 0.2177 0.1621 0.1496 0.0204  0.0048  0.0187  83   ASP A CA  
647  C  C   . ASP A 83  ? 0.1631 0.2319 0.1469 0.0128  -0.0055 0.0130  83   ASP A C   
648  O  O   . ASP A 83  ? 0.1883 0.2713 0.1671 -0.0343 -0.0036 0.0296  83   ASP A O   
649  C  CB  . ASP A 83  ? 0.2073 0.1640 0.1785 -0.0120 0.0021  0.0480  83   ASP A CB  
650  C  CG  . ASP A 83  ? 0.2274 0.2199 0.1718 0.0285  -0.0102 0.0502  83   ASP A CG  
651  O  OD1 . ASP A 83  ? 0.2533 0.2313 0.1945 0.0101  -0.0357 0.0298  83   ASP A OD1 
652  O  OD2 . ASP A 83  ? 0.2293 0.2652 0.1743 0.0193  0.0079  0.0430  83   ASP A OD2 
653  N  N   . PHE A 84  ? 0.1625 0.1842 0.1455 0.0091  -0.0071 -0.0037 84   PHE A N   
654  C  CA  . PHE A 84  ? 0.1976 0.1608 0.1472 0.0179  0.0051  0.0257  84   PHE A CA  
655  C  C   . PHE A 84  ? 0.1888 0.1581 0.1619 0.0083  -0.0196 0.0041  84   PHE A C   
656  O  O   . PHE A 84  ? 0.1737 0.1799 0.1922 -0.0013 -0.0141 -0.0234 84   PHE A O   
657  C  CB  . PHE A 84  ? 0.1954 0.1597 0.1422 0.0156  -0.0007 0.0021  84   PHE A CB  
658  C  CG  . PHE A 84  ? 0.1937 0.1520 0.1656 0.0075  0.0173  0.0107  84   PHE A CG  
659  C  CD1 . PHE A 84  ? 0.2274 0.1496 0.1935 0.0142  -0.0047 0.0107  84   PHE A CD1 
660  C  CD2 . PHE A 84  ? 0.2105 0.1661 0.2247 0.0123  -0.0253 0.0444  84   PHE A CD2 
661  C  CE1 . PHE A 84  ? 0.1989 0.1765 0.1897 0.0256  0.0356  -0.0326 84   PHE A CE1 
662  C  CE2 . PHE A 84  ? 0.2102 0.1817 0.2233 0.0223  -0.0097 -0.0028 84   PHE A CE2 
663  C  CZ  . PHE A 84  ? 0.1962 0.1797 0.2185 0.0039  0.0368  0.0072  84   PHE A CZ  
664  N  N   . MET A 85  ? 0.1887 0.1722 0.1620 0.0214  -0.0179 -0.0168 85   MET A N   
665  C  CA  . MET A 85  ? 0.2075 0.1787 0.1524 0.0323  -0.0026 0.0109  85   MET A CA  
666  C  C   . MET A 85  ? 0.1935 0.2078 0.1501 0.0435  0.0173  -0.0152 85   MET A C   
667  O  O   . MET A 85  ? 0.2051 0.2901 0.1397 0.0055  0.0138  0.0155  85   MET A O   
668  C  CB  A MET A 85  ? 0.2431 0.1744 0.1705 0.0346  0.0018  0.0115  85   MET A CB  
669  C  CB  B MET A 85  ? 0.2302 0.1789 0.1695 0.0395  0.0135  0.0080  85   MET A CB  
670  C  CG  A MET A 85  ? 0.2542 0.2181 0.1354 -0.0137 -0.0092 -0.0207 85   MET A CG  
671  C  CG  B MET A 85  ? 0.1902 0.1851 0.1543 0.0349  -0.0347 0.0043  85   MET A CG  
672  S  SD  A MET A 85  ? 0.2351 0.2083 0.1677 0.0047  -0.0245 -0.0086 85   MET A SD  
673  S  SD  B MET A 85  ? 0.2672 0.2404 0.2653 0.0179  -0.0246 -0.0739 85   MET A SD  
674  C  CE  A MET A 85  ? 0.2805 0.0651 0.1426 0.0100  -0.0050 0.0085  85   MET A CE  
675  C  CE  B MET A 85  ? 0.3860 0.1886 0.2476 -0.0592 -0.0159 0.0492  85   MET A CE  
676  N  N   . LEU A 86  ? 0.1863 0.2053 0.1667 0.0266  -0.0101 0.0061  86   LEU A N   
677  C  CA  . LEU A 86  ? 0.2080 0.1608 0.1866 0.0175  -0.0267 0.0566  86   LEU A CA  
678  C  C   . LEU A 86  ? 0.2183 0.2219 0.2515 -0.0015 -0.0208 0.0007  86   LEU A C   
679  O  O   . LEU A 86  ? 0.2059 0.2459 0.1760 -0.0176 0.0093  0.0347  86   LEU A O   
680  C  CB  . LEU A 86  ? 0.3043 0.1964 0.1954 0.0266  -0.0051 0.0780  86   LEU A CB  
681  C  CG  . LEU A 86  ? 0.2969 0.2966 0.1993 0.0523  -0.0581 0.0311  86   LEU A CG  
682  C  CD1 . LEU A 86  ? 0.3338 0.4704 0.1862 0.0414  -0.0032 0.0689  86   LEU A CD1 
683  C  CD2 . LEU A 86  ? 0.4306 0.3291 0.3726 0.1464  -0.0176 -0.0157 86   LEU A CD2 
684  N  N   . GLN A 87  ? 0.2019 0.2290 0.2130 -0.0179 -0.0253 -0.0231 87   GLN A N   
685  C  CA  . GLN A 87  ? 0.2404 0.1975 0.1887 -0.0265 -0.0401 0.0155  87   GLN A CA  
686  C  C   . GLN A 87  ? 0.2184 0.1934 0.1870 -0.0205 -0.0199 0.0097  87   GLN A C   
687  O  O   . GLN A 87  ? 0.2988 0.1990 0.1955 -0.0280 -0.0391 -0.0057 87   GLN A O   
688  C  CB  . GLN A 87  ? 0.2272 0.2097 0.1903 -0.0233 -0.0518 -0.0009 87   GLN A CB  
689  C  CG  . GLN A 87  ? 0.2485 0.2339 0.2126 0.0061  -0.0177 0.0397  87   GLN A CG  
690  C  CD  . GLN A 87  ? 0.2658 0.3922 0.2276 -0.0293 0.0075  -0.0137 87   GLN A CD  
691  O  OE1 . GLN A 87  ? 0.4297 0.6389 0.3037 -0.0261 0.1265  -0.0709 87   GLN A OE1 
692  N  NE2 . GLN A 87  ? 0.3813 0.3542 0.2463 -0.1583 -0.0574 0.1194  87   GLN A NE2 
693  N  N   . HIS A 88  ? 0.1861 0.1880 0.1819 0.0022  0.0015  0.0017  88   HIS A N   
694  C  CA  . HIS A 88  ? 0.2116 0.1811 0.1782 0.0063  0.0231  -0.0096 88   HIS A CA  
695  C  C   . HIS A 88  ? 0.2166 0.1864 0.1824 0.0145  0.0188  0.0024  88   HIS A C   
696  O  O   . HIS A 88  ? 0.2087 0.1711 0.1607 0.0175  -0.0087 -0.0091 88   HIS A O   
697  C  CB  . HIS A 88  ? 0.2243 0.2190 0.1806 0.0339  0.0219  -0.0010 88   HIS A CB  
698  C  CG  . HIS A 88  ? 0.2406 0.2100 0.1914 0.0413  0.0121  -0.0151 88   HIS A CG  
699  N  ND1 . HIS A 88  ? 0.3501 0.2142 0.2659 -0.0019 -0.1049 0.0172  88   HIS A ND1 
700  C  CD2 . HIS A 88  ? 0.2275 0.2094 0.2081 0.0363  -0.0100 -0.0294 88   HIS A CD2 
701  C  CE1 . HIS A 88  ? 0.4240 0.1899 0.3110 -0.0403 -0.1633 0.0306  88   HIS A CE1 
702  N  NE2 . HIS A 88  ? 0.2390 0.2118 0.2216 0.0362  -0.0370 -0.0196 88   HIS A NE2 
703  N  N   . PRO A 89  ? 0.2170 0.2037 0.1525 0.0235  0.0192  0.0122  89   PRO A N   
704  C  CA  . PRO A 89  ? 0.1998 0.2053 0.1927 0.0291  0.0125  0.0310  89   PRO A CA  
705  C  C   . PRO A 89  ? 0.1674 0.2002 0.1768 0.0041  -0.0018 0.0125  89   PRO A C   
706  O  O   . PRO A 89  ? 0.2050 0.2016 0.1804 0.0048  0.0520  -0.0034 89   PRO A O   
707  C  CB  . PRO A 89  ? 0.2077 0.2457 0.2448 0.0376  0.0602  0.0573  89   PRO A CB  
708  C  CG  . PRO A 89  ? 0.2333 0.2460 0.3238 -0.0079 0.0704  -0.0102 89   PRO A CG  
709  C  CD  . PRO A 89  ? 0.2117 0.2382 0.2139 0.0032  -0.0231 -0.0263 89   PRO A CD  
710  N  N   . ILE A 90  ? 0.1573 0.1753 0.1815 0.0234  -0.0111 0.0125  90   ILE A N   
711  C  CA  . ILE A 90  ? 0.1764 0.2447 0.1719 0.0029  0.0023  0.0117  90   ILE A CA  
712  C  C   . ILE A 90  ? 0.1416 0.1540 0.1632 0.0520  0.0215  0.0161  90   ILE A C   
713  O  O   . ILE A 90  ? 0.2510 0.1965 0.1671 -0.0156 -0.0050 0.0404  90   ILE A O   
714  C  CB  . ILE A 90  ? 0.2073 0.2013 0.1920 -0.0006 0.0064  0.0063  90   ILE A CB  
715  C  CG1 . ILE A 90  ? 0.2423 0.2938 0.1769 0.0002  0.0300  0.0269  90   ILE A CG1 
716  C  CG2 . ILE A 90  ? 0.2267 0.2511 0.2513 0.0339  -0.0579 -0.0361 90   ILE A CG2 
717  C  CD1 . ILE A 90  ? 0.3103 0.4945 0.1919 -0.1191 0.0370  -0.0387 90   ILE A CD1 
718  N  N   . LEU A 91  ? 0.1725 0.1658 0.1783 0.0269  -0.0005 0.0297  91   LEU A N   
719  C  CA  . LEU A 91  ? 0.1940 0.1704 0.1960 0.0306  -0.0249 0.0189  91   LEU A CA  
720  C  C   . LEU A 91  ? 0.2084 0.1573 0.1669 0.0060  0.0091  0.0374  91   LEU A C   
721  O  O   . LEU A 91  ? 0.1976 0.2124 0.1655 0.0066  0.0081  -0.0072 91   LEU A O   
722  C  CB  . LEU A 91  ? 0.1719 0.1766 0.2067 0.0395  -0.0079 0.0299  91   LEU A CB  
723  C  CG  . LEU A 91  ? 0.2245 0.1743 0.1497 0.0411  0.0100  0.0435  91   LEU A CG  
724  C  CD1 . LEU A 91  ? 0.2515 0.1366 0.1770 0.0180  0.0019  0.0493  91   LEU A CD1 
725  C  CD2 . LEU A 91  ? 0.2643 0.2050 0.1922 0.0481  0.0510  0.0650  91   LEU A CD2 
726  N  N   . ILE A 92  ? 0.1974 0.1892 0.1676 -0.0091 -0.0003 -0.0087 92   ILE A N   
727  C  CA  . ILE A 92  ? 0.2343 0.1828 0.1448 0.0064  -0.0082 0.0030  92   ILE A CA  
728  C  C   . ILE A 92  ? 0.1924 0.1907 0.1625 0.0055  -0.0140 0.0114  92   ILE A C   
729  O  O   . ILE A 92  ? 0.1836 0.2326 0.1813 0.0070  -0.0199 0.0264  92   ILE A O   
730  C  CB  . ILE A 92  ? 0.2545 0.1734 0.1480 0.0269  0.0049  0.0120  92   ILE A CB  
731  C  CG1 . ILE A 92  ? 0.2921 0.1956 0.1409 0.0053  0.0044  0.0236  92   ILE A CG1 
732  C  CG2 . ILE A 92  ? 0.2174 0.1864 0.2243 -0.0085 0.0064  -0.0309 92   ILE A CG2 
733  C  CD1 . ILE A 92  ? 0.3118 0.1995 0.2118 -0.0265 0.0315  0.0041  92   ILE A CD1 
734  N  N   . ASN A 93  ? 0.1761 0.1745 0.1848 0.0238  -0.0091 0.0009  93   ASN A N   
735  C  CA  . ASN A 93  ? 0.2172 0.1528 0.1876 0.0173  -0.0067 -0.0110 93   ASN A CA  
736  C  C   . ASN A 93  ? 0.2318 0.1738 0.2097 0.0351  0.0258  0.0340  93   ASN A C   
737  O  O   . ASN A 93  ? 0.2036 0.2170 0.1910 0.0144  0.0035  0.0224  93   ASN A O   
738  C  CB  . ASN A 93  ? 0.2216 0.1534 0.2076 0.0123  -0.0162 -0.0058 93   ASN A CB  
739  C  CG  . ASN A 93  ? 0.1890 0.1801 0.2368 0.0355  0.0005  0.0245  93   ASN A CG  
740  O  OD1 . ASN A 93  ? 0.2260 0.2369 0.2114 0.0165  -0.0076 0.0237  93   ASN A OD1 
741  N  ND2 . ASN A 93  ? 0.2014 0.2734 0.2841 0.0122  0.0203  0.0091  93   ASN A ND2 
742  N  N   . ARG A 94  ? 0.2138 0.1840 0.1687 0.0315  -0.0115 0.0047  94   ARG A N   
743  C  CA  . ARG A 94  ? 0.1948 0.1601 0.1485 0.0075  -0.0064 -0.0118 94   ARG A CA  
744  C  C   . ARG A 94  ? 0.1590 0.1745 0.1856 -0.0015 -0.0304 0.0162  94   ARG A C   
745  O  O   . ARG A 94  ? 0.2466 0.1462 0.1883 -0.0057 0.0134  -0.0093 94   ARG A O   
746  C  CB  . ARG A 94  ? 0.2329 0.1780 0.1496 -0.0139 -0.0175 -0.0155 94   ARG A CB  
747  C  CG  . ARG A 94  ? 0.2410 0.1610 0.1403 -0.0282 -0.0305 0.0268  94   ARG A CG  
748  C  CD  . ARG A 94  ? 0.2690 0.2139 0.1773 -0.0311 0.0277  -0.0053 94   ARG A CD  
749  N  NE  . ARG A 94  ? 0.3239 0.2224 0.1729 0.0341  -0.0054 0.0127  94   ARG A NE  
750  C  CZ  . ARG A 94  ? 0.3847 0.2109 0.1502 0.0373  -0.0029 0.0256  94   ARG A CZ  
751  N  NH1 . ARG A 94  ? 0.3558 0.2034 0.1597 0.0653  -0.0261 0.0402  94   ARG A NH1 
752  N  NH2 . ARG A 94  ? 0.4762 0.2327 0.1663 0.0330  0.0588  0.0228  94   ARG A NH2 
753  N  N   . PRO A 95  ? 0.1931 0.1582 0.1350 -0.0051 -0.0429 -0.0042 95   PRO A N   
754  C  CA  . PRO A 95  ? 0.2005 0.1897 0.1446 0.0078  -0.0256 -0.0011 95   PRO A CA  
755  C  C   . PRO A 95  ? 0.1680 0.1827 0.1496 0.0248  -0.0166 -0.0113 95   PRO A C   
756  O  O   . PRO A 95  ? 0.1858 0.2422 0.1779 -0.0200 -0.0293 -0.0059 95   PRO A O   
757  C  CB  . PRO A 95  ? 0.1682 0.2359 0.2046 -0.0091 -0.0576 0.0211  95   PRO A CB  
758  C  CG  . PRO A 95  ? 0.2098 0.1563 0.1903 -0.0033 -0.0499 -0.0371 95   PRO A CG  
759  C  CD  . PRO A 95  ? 0.2081 0.1740 0.1307 0.0104  -0.0476 0.0076  95   PRO A CD  
760  N  N   . ILE A 96  ? 0.2407 0.1880 0.1455 0.0085  -0.0010 -0.0083 96   ILE A N   
761  C  CA  . ILE A 96  ? 0.2106 0.1794 0.1563 0.0151  0.0071  -0.0193 96   ILE A CA  
762  C  C   . ILE A 96  ? 0.2034 0.1763 0.1956 0.0151  0.0087  -0.0135 96   ILE A C   
763  O  O   . ILE A 96  ? 0.2140 0.1767 0.1433 0.0217  -0.0020 -0.0149 96   ILE A O   
764  C  CB  . ILE A 96  ? 0.1999 0.2023 0.1446 0.0197  -0.0313 -0.0161 96   ILE A CB  
765  C  CG1 . ILE A 96  ? 0.1924 0.1770 0.2007 0.0032  -0.0139 -0.0142 96   ILE A CG1 
766  C  CG2 . ILE A 96  ? 0.2597 0.2437 0.1460 -0.0234 0.0122  -0.0216 96   ILE A CG2 
767  C  CD1 . ILE A 96  ? 0.2354 0.2023 0.2304 0.0169  -0.0235 0.0326  96   ILE A CD1 
768  N  N   . VAL A 97  ? 0.1906 0.1728 0.1766 0.0234  -0.0088 -0.0062 97   VAL A N   
769  C  CA  . VAL A 97  ? 0.1853 0.1575 0.1368 0.0097  -0.0068 0.0095  97   VAL A CA  
770  C  C   . VAL A 97  ? 0.2141 0.1854 0.1316 -0.0055 -0.0060 0.0121  97   VAL A C   
771  O  O   . VAL A 97  ? 0.2155 0.1943 0.1489 0.0129  -0.0106 -0.0263 97   VAL A O   
772  C  CB  . VAL A 97  ? 0.1739 0.1411 0.1211 -0.0134 -0.0093 -0.0092 97   VAL A CB  
773  C  CG1 . VAL A 97  ? 0.2409 0.1503 0.1716 0.0246  0.0078  -0.0157 97   VAL A CG1 
774  C  CG2 . VAL A 97  ? 0.2912 0.1433 0.1185 0.0188  -0.0306 -0.0125 97   VAL A CG2 
775  N  N   . VAL A 98  ? 0.2287 0.1925 0.1409 -0.0123 0.0051  -0.0215 98   VAL A N   
776  C  CA  . VAL A 98  ? 0.1492 0.2281 0.1314 0.0119  -0.0243 -0.0089 98   VAL A CA  
777  C  C   . VAL A 98  ? 0.1795 0.2247 0.1498 0.0184  -0.0179 -0.0209 98   VAL A C   
778  O  O   . VAL A 98  ? 0.1724 0.1779 0.1798 0.0323  -0.0197 -0.0356 98   VAL A O   
779  C  CB  . VAL A 98  ? 0.2536 0.2193 0.1452 0.0242  0.0209  -0.0114 98   VAL A CB  
780  C  CG1 . VAL A 98  ? 0.3587 0.2427 0.1462 0.0047  0.0352  -0.0060 98   VAL A CG1 
781  C  CG2 . VAL A 98  ? 0.2718 0.2124 0.2558 0.0221  0.0396  -0.0257 98   VAL A CG2 
782  N  N   . THR A 99  ? 0.1764 0.2122 0.1662 -0.0066 -0.0138 -0.0104 99   THR A N   
783  C  CA  . THR A 99  ? 0.2205 0.2147 0.1546 0.0064  -0.0007 -0.0101 99   THR A CA  
784  C  C   . THR A 99  ? 0.1788 0.2502 0.1604 -0.0099 0.0083  -0.0150 99   THR A C   
785  O  O   . THR A 99  ? 0.2630 0.2007 0.1477 0.0231  -0.0156 -0.0319 99   THR A O   
786  C  CB  . THR A 99  ? 0.1795 0.2343 0.1951 0.0309  0.0425  0.0140  99   THR A CB  
787  O  OG1 . THR A 99  ? 0.3261 0.2147 0.1700 -0.0357 -0.0392 0.0127  99   THR A OG1 
788  C  CG2 . THR A 99  ? 0.2131 0.2513 0.1606 -0.0190 -0.0093 0.0062  99   THR A CG2 
789  N  N   . PRO A 100 ? 0.1952 0.2730 0.1811 0.0045  0.0101  -0.0342 100  PRO A N   
790  C  CA  . PRO A 100 ? 0.2438 0.2407 0.1984 0.0196  -0.0105 -0.0522 100  PRO A CA  
791  C  C   . PRO A 100 ? 0.2695 0.1987 0.1830 -0.0060 -0.0444 0.0239  100  PRO A C   
792  O  O   . PRO A 100 ? 0.3270 0.2552 0.1612 -0.0081 -0.0514 0.0079  100  PRO A O   
793  C  CB  . PRO A 100 ? 0.2848 0.2378 0.2194 0.0412  -0.0251 -0.0668 100  PRO A CB  
794  C  CG  . PRO A 100 ? 0.2301 0.3057 0.2307 0.0382  0.0032  -0.0754 100  PRO A CG  
795  C  CD  . PRO A 100 ? 0.2068 0.2954 0.2212 0.0278  -0.0179 -0.0873 100  PRO A CD  
796  N  N   . LEU A 101 ? 0.2506 0.1903 0.1718 0.0503  -0.0162 0.0123  101  LEU A N   
797  C  CA  . LEU A 101 ? 0.2593 0.2181 0.1989 0.0419  0.0687  -0.0244 101  LEU A CA  
798  C  C   . LEU A 101 ? 0.2320 0.1949 0.1725 0.0196  -0.0193 -0.0396 101  LEU A C   
799  O  O   . LEU A 101 ? 0.2602 0.2580 0.2149 -0.0044 -0.0523 -0.0510 101  LEU A O   
800  C  CB  . LEU A 101 ? 0.2686 0.1966 0.2279 0.0299  0.0169  -0.0211 101  LEU A CB  
801  C  CG  . LEU A 101 ? 0.3103 0.1786 0.2226 0.0108  0.0140  -0.0528 101  LEU A CG  
802  C  CD1 . LEU A 101 ? 0.3110 0.1950 0.2274 0.0063  -0.0511 -0.0224 101  LEU A CD1 
803  C  CD2 . LEU A 101 ? 0.3931 0.2352 0.2159 0.0255  -0.0039 -0.0506 101  LEU A CD2 
804  N  N   . GLY A 102 ? 0.2714 0.2071 0.1637 0.0366  -0.0488 -0.0564 102  GLY A N   
805  C  CA  . GLY A 102 ? 0.2908 0.1951 0.1609 0.0363  -0.0151 -0.0301 102  GLY A CA  
806  C  C   . GLY A 102 ? 0.2390 0.2064 0.1759 0.0261  -0.0150 -0.0419 102  GLY A C   
807  O  O   . GLY A 102 ? 0.2263 0.2518 0.2151 0.0179  -0.0174 -0.0404 102  GLY A O   
808  N  N   . THR A 103 ? 0.2557 0.1754 0.1367 0.0355  -0.0223 -0.0062 103  THR A N   
809  C  CA  . THR A 103 ? 0.2300 0.1805 0.1387 0.0238  -0.0193 -0.0090 103  THR A CA  
810  C  C   . THR A 103 ? 0.2194 0.1879 0.1506 0.0180  -0.0201 -0.0090 103  THR A C   
811  O  O   . THR A 103 ? 0.2345 0.2232 0.1901 -0.0173 -0.0276 -0.0501 103  THR A O   
812  C  CB  . THR A 103 ? 0.2652 0.1739 0.1593 0.0060  -0.0018 -0.0170 103  THR A CB  
813  O  OG1 . THR A 103 ? 0.2764 0.2523 0.1693 -0.0165 0.0079  0.0043  103  THR A OG1 
814  C  CG2 . THR A 103 ? 0.2390 0.1897 0.1749 0.0299  -0.0718 -0.0351 103  THR A CG2 
815  N  N   . ARG A 104 ? 0.2356 0.1743 0.1496 -0.0164 -0.0092 -0.0030 104  ARG A N   
816  C  CA  . ARG A 104 ? 0.2245 0.1791 0.1591 -0.0202 -0.0131 -0.0199 104  ARG A CA  
817  C  C   . ARG A 104 ? 0.1836 0.1623 0.1770 0.0145  -0.0276 -0.0241 104  ARG A C   
818  O  O   . ARG A 104 ? 0.1876 0.2016 0.1511 -0.0303 -0.0036 -0.0156 104  ARG A O   
819  C  CB  A ARG A 104 ? 0.2704 0.1872 0.1838 -0.0893 -0.0141 -0.0196 104  ARG A CB  
820  C  CB  B ARG A 104 ? 0.2711 0.1861 0.1939 -0.0839 -0.0026 -0.0222 104  ARG A CB  
821  C  CG  A ARG A 104 ? 0.2237 0.1912 0.2251 -0.0520 0.0258  -0.0500 104  ARG A CG  
822  C  CG  B ARG A 104 ? 0.2317 0.1967 0.2277 -0.0611 0.0070  -0.0475 104  ARG A CG  
823  C  CD  A ARG A 104 ? 0.2500 0.2917 0.2861 -0.1149 -0.0117 -0.0869 104  ARG A CD  
824  C  CD  B ARG A 104 ? 0.2131 0.2823 0.2931 -0.0814 -0.0108 -0.0904 104  ARG A CD  
825  N  NE  A ARG A 104 ? 0.3081 0.2657 0.3346 -0.1187 -0.0122 -0.0742 104  ARG A NE  
826  N  NE  B ARG A 104 ? 0.3397 0.2552 0.3255 -0.1233 -0.0489 -0.0755 104  ARG A NE  
827  C  CZ  A ARG A 104 ? 0.2961 0.2459 0.2999 -0.0826 -0.0698 -0.0880 104  ARG A CZ  
828  C  CZ  B ARG A 104 ? 0.3098 0.2676 0.2658 -0.0955 -0.0942 -0.0193 104  ARG A CZ  
829  N  NH1 A ARG A 104 ? 0.2350 0.2622 0.3793 -0.0953 0.0890  -0.1783 104  ARG A NH1 
830  N  NH1 B ARG A 104 ? 0.5798 0.3265 0.1838 -0.0107 -0.1991 0.0418  104  ARG A NH1 
831  N  NH2 A ARG A 104 ? 0.3366 0.2228 0.4235 -0.0516 -0.0327 -0.1065 104  ARG A NH2 
832  N  NH2 B ARG A 104 ? 0.3655 0.1538 0.2783 -0.0117 -0.0022 0.0353  104  ARG A NH2 
833  N  N   . LEU A 105 ? 0.1972 0.1765 0.1684 0.0343  -0.0205 0.0115  105  LEU A N   
834  C  CA  . LEU A 105 ? 0.2127 0.1510 0.1864 0.0268  0.0027  0.0007  105  LEU A CA  
835  C  C   . LEU A 105 ? 0.1551 0.1569 0.1708 0.0240  0.0124  -0.0032 105  LEU A C   
836  O  O   . LEU A 105 ? 0.1660 0.1944 0.1770 0.0051  0.0040  0.0010  105  LEU A O   
837  C  CB  . LEU A 105 ? 0.2187 0.1559 0.2024 0.0314  -0.0074 0.0020  105  LEU A CB  
838  C  CG  . LEU A 105 ? 0.2130 0.1439 0.2151 0.0229  0.0194  -0.0029 105  LEU A CG  
839  C  CD1 . LEU A 105 ? 0.2181 0.1980 0.1951 0.0087  0.0191  -0.0154 105  LEU A CD1 
840  C  CD2 . LEU A 105 ? 0.2211 0.1951 0.2322 0.0430  0.0061  -0.0028 105  LEU A CD2 
841  N  N   . CYS A 106 ? 0.2085 0.1599 0.1587 -0.0138 -0.0285 -0.0137 106  CYS A N   
842  C  CA  . CYS A 106 ? 0.1799 0.1803 0.1583 -0.0173 -0.0341 0.0011  106  CYS A CA  
843  C  C   . CYS A 106 ? 0.1967 0.2013 0.1639 -0.0126 -0.0257 0.0007  106  CYS A C   
844  O  O   . CYS A 106 ? 0.2373 0.1685 0.1641 0.0177  -0.0410 -0.0122 106  CYS A O   
845  C  CB  . CYS A 106 ? 0.1939 0.1992 0.1723 -0.0010 -0.0350 -0.0118 106  CYS A CB  
846  S  SG  . CYS A 106 ? 0.2375 0.2038 0.1905 0.0167  -0.0002 0.0028  106  CYS A SG  
847  N  N   . ARG A 107 ? 0.1979 0.2019 0.1979 0.0063  -0.0121 -0.0127 107  ARG A N   
848  C  CA  . ARG A 107 ? 0.2084 0.1737 0.1736 -0.0003 -0.0174 -0.0126 107  ARG A CA  
849  C  C   . ARG A 107 ? 0.1983 0.1808 0.1909 0.0022  -0.0213 -0.0082 107  ARG A C   
850  O  O   . ARG A 107 ? 0.1906 0.2481 0.1961 -0.0069 -0.0230 0.0133  107  ARG A O   
851  C  CB  . ARG A 107 ? 0.2439 0.1742 0.1887 0.0003  0.0076  -0.0038 107  ARG A CB  
852  C  CG  . ARG A 107 ? 0.2372 0.1607 0.2063 0.0073  -0.0161 0.0210  107  ARG A CG  
853  C  CD  . ARG A 107 ? 0.2717 0.1608 0.1867 0.0229  -0.0311 0.0234  107  ARG A CD  
854  N  NE  . ARG A 107 ? 0.2022 0.2066 0.1995 0.0129  -0.0330 0.0066  107  ARG A NE  
855  C  CZ  . ARG A 107 ? 0.2020 0.2701 0.1869 0.0287  -0.0148 -0.0187 107  ARG A CZ  
856  N  NH1 . ARG A 107 ? 0.2143 0.2716 0.1982 -0.0143 -0.0441 0.0195  107  ARG A NH1 
857  N  NH2 . ARG A 107 ? 0.2611 0.3148 0.1979 -0.0053 0.0078  -0.0317 107  ARG A NH2 
858  N  N   . PRO A 108 ? 0.1584 0.1986 0.2312 0.0012  -0.0053 0.0164  108  PRO A N   
859  C  CA  . PRO A 108 ? 0.1619 0.1974 0.2323 0.0082  -0.0009 0.0283  108  PRO A CA  
860  C  C   . PRO A 108 ? 0.1563 0.2577 0.1979 0.0115  -0.0085 0.0116  108  PRO A C   
861  O  O   . PRO A 108 ? 0.1982 0.1924 0.1968 0.0166  -0.0273 -0.0022 108  PRO A O   
862  C  CB  . PRO A 108 ? 0.1646 0.2119 0.2580 -0.0060 -0.0087 0.0389  108  PRO A CB  
863  C  CG  . PRO A 108 ? 0.2818 0.2121 0.2424 -0.0441 0.0040  0.0127  108  PRO A CG  
864  C  CD  . PRO A 108 ? 0.2226 0.2327 0.1663 -0.0499 0.0151  -0.0063 108  PRO A CD  
865  N  N   . SER A 109 ? 0.1612 0.2359 0.1688 -0.0030 0.0053  -0.0028 109  SER A N   
866  C  CA  . SER A 109 ? 0.1453 0.1717 0.1717 -0.0008 -0.0290 -0.0116 109  SER A CA  
867  C  C   . SER A 109 ? 0.1858 0.1523 0.1301 0.0117  -0.0269 0.0202  109  SER A C   
868  O  O   . SER A 109 ? 0.1957 0.1921 0.1553 -0.0090 -0.0052 -0.0029 109  SER A O   
869  C  CB  . SER A 109 ? 0.1909 0.1854 0.1576 -0.0272 -0.0364 0.0102  109  SER A CB  
870  O  OG  . SER A 109 ? 0.2325 0.1885 0.1461 -0.0154 0.0143  0.0008  109  SER A OG  
871  N  N   . GLU A 110 ? 0.1659 0.1625 0.1670 0.0012  -0.0184 0.0013  110  GLU A N   
872  C  CA  . GLU A 110 ? 0.2116 0.1599 0.1814 0.0088  -0.0407 -0.0038 110  GLU A CA  
873  C  C   . GLU A 110 ? 0.2178 0.1833 0.1908 0.0205  -0.0559 -0.0175 110  GLU A C   
874  O  O   . GLU A 110 ? 0.2174 0.1800 0.1756 0.0034  -0.0177 -0.0053 110  GLU A O   
875  C  CB  . GLU A 110 ? 0.2549 0.1656 0.1861 -0.0251 -0.0045 -0.0381 110  GLU A CB  
876  C  CG  . GLU A 110 ? 0.2518 0.1686 0.2209 -0.0160 -0.0138 -0.0046 110  GLU A CG  
877  C  CD  . GLU A 110 ? 0.2289 0.1889 0.1960 -0.0005 -0.0120 0.0195  110  GLU A CD  
878  O  OE1 . GLU A 110 ? 0.2508 0.2582 0.2159 -0.0348 -0.0043 0.0189  110  GLU A OE1 
879  O  OE2 . GLU A 110 ? 0.2267 0.2292 0.1884 -0.0028 0.0041  -0.0174 110  GLU A OE2 
880  N  N   . VAL A 111 ? 0.2206 0.1853 0.1670 0.0172  -0.0138 0.0101  111  VAL A N   
881  C  CA  . VAL A 111 ? 0.1812 0.1856 0.1789 0.0055  -0.0249 0.0050  111  VAL A CA  
882  C  C   . VAL A 111 ? 0.1825 0.1631 0.1471 0.0006  -0.0388 0.0137  111  VAL A C   
883  O  O   . VAL A 111 ? 0.1922 0.2132 0.1409 0.0055  -0.0481 0.0106  111  VAL A O   
884  C  CB  . VAL A 111 ? 0.1804 0.1779 0.1946 -0.0031 -0.0136 0.0269  111  VAL A CB  
885  C  CG1 . VAL A 111 ? 0.2100 0.1955 0.1974 -0.0088 -0.0026 0.0290  111  VAL A CG1 
886  C  CG2 . VAL A 111 ? 0.2345 0.2024 0.2603 0.0296  0.0767  -0.0160 111  VAL A CG2 
887  N  N   . VAL A 112 ? 0.1841 0.1720 0.1605 -0.0112 -0.0161 -0.0321 112  VAL A N   
888  C  CA  . VAL A 112 ? 0.1935 0.1697 0.1641 -0.0163 -0.0054 -0.0024 112  VAL A CA  
889  C  C   . VAL A 112 ? 0.1480 0.1793 0.1815 0.0136  -0.0239 0.0012  112  VAL A C   
890  O  O   . VAL A 112 ? 0.2145 0.2268 0.1647 0.0084  -0.0072 -0.0177 112  VAL A O   
891  C  CB  . VAL A 112 ? 0.1787 0.1788 0.1386 -0.0096 0.0067  0.0089  112  VAL A CB  
892  C  CG1 . VAL A 112 ? 0.2281 0.1360 0.1556 -0.0116 -0.0105 -0.0018 112  VAL A CG1 
893  C  CG2 . VAL A 112 ? 0.1767 0.2348 0.1635 -0.0131 0.0073  0.0325  112  VAL A CG2 
894  N  N   . LEU A 113 ? 0.1865 0.1688 0.1881 -0.0094 -0.0120 -0.0264 113  LEU A N   
895  C  CA  . LEU A 113 ? 0.1571 0.1740 0.1765 -0.0091 -0.0296 -0.0223 113  LEU A CA  
896  C  C   . LEU A 113 ? 0.1626 0.1944 0.1648 0.0024  -0.0159 -0.0257 113  LEU A C   
897  O  O   . LEU A 113 ? 0.2164 0.2202 0.1921 0.0449  -0.0223 -0.0423 113  LEU A O   
898  C  CB  . LEU A 113 ? 0.1970 0.1679 0.1693 0.0126  -0.0187 -0.0193 113  LEU A CB  
899  C  CG  . LEU A 113 ? 0.1898 0.2197 0.1636 0.0082  -0.0082 -0.0277 113  LEU A CG  
900  C  CD1 . LEU A 113 ? 0.2427 0.1906 0.1802 0.0132  -0.0187 -0.0056 113  LEU A CD1 
901  C  CD2 . LEU A 113 ? 0.2011 0.2399 0.2637 0.0218  -0.0553 0.0013  113  LEU A CD2 
902  N  N   . ASP A 114 ? 0.1768 0.2085 0.1764 0.0221  -0.0290 -0.0399 114  ASP A N   
903  C  CA  . ASP A 114 ? 0.2180 0.2192 0.1807 -0.0073 -0.0520 -0.0114 114  ASP A CA  
904  C  C   . ASP A 114 ? 0.2631 0.2310 0.1740 -0.0317 -0.0353 -0.0217 114  ASP A C   
905  O  O   . ASP A 114 ? 0.2381 0.2190 0.1772 -0.0119 -0.0547 -0.0240 114  ASP A O   
906  C  CB  . ASP A 114 ? 0.2404 0.2488 0.2314 0.0203  -0.1002 -0.0668 114  ASP A CB  
907  C  CG  . ASP A 114 ? 0.2630 0.2931 0.2790 0.0633  -0.0164 -0.1213 114  ASP A CG  
908  O  OD1 . ASP A 114 ? 0.2816 0.4561 0.4535 0.1165  -0.0242 -0.0814 114  ASP A OD1 
909  O  OD2 . ASP A 114 ? 0.2555 0.3331 0.3932 -0.0312 -0.0190 -0.0518 114  ASP A OD2 
910  N  N   . ILE A 115 ? 0.2241 0.1522 0.1756 0.0308  -0.0044 -0.0329 115  ILE A N   
911  C  CA  . ILE A 115 ? 0.2267 0.1736 0.1598 0.0125  -0.0176 -0.0390 115  ILE A CA  
912  C  C   . ILE A 115 ? 0.2162 0.1686 0.1898 -0.0252 -0.0298 0.0081  115  ILE A C   
913  O  O   . ILE A 115 ? 0.2341 0.2276 0.1833 -0.0078 -0.0091 0.0122  115  ILE A O   
914  C  CB  . ILE A 115 ? 0.2286 0.1733 0.1631 -0.0189 -0.0777 -0.0217 115  ILE A CB  
915  C  CG1 . ILE A 115 ? 0.2473 0.1565 0.2033 -0.0433 -0.0684 -0.0456 115  ILE A CG1 
916  C  CG2 . ILE A 115 ? 0.2692 0.2378 0.2237 0.0079  -0.1268 -0.0083 115  ILE A CG2 
917  C  CD1 . ILE A 115 ? 0.3012 0.1592 0.2607 -0.0601 -0.0056 -0.0302 115  ILE A CD1 
918  N  N   . LEU A 116 ? 0.2342 0.1702 0.1727 -0.0033 -0.0174 -0.0071 116  LEU A N   
919  C  CA  . LEU A 116 ? 0.2459 0.1836 0.1679 0.0094  -0.0291 -0.0032 116  LEU A CA  
920  C  C   . LEU A 116 ? 0.1551 0.2136 0.1714 -0.0150 -0.0359 -0.0291 116  LEU A C   
921  O  O   . LEU A 116 ? 0.1695 0.2244 0.1875 -0.0326 -0.0545 -0.0258 116  LEU A O   
922  C  CB  . LEU A 116 ? 0.2465 0.1920 0.1518 0.0343  0.0039  -0.0091 116  LEU A CB  
923  C  CG  . LEU A 116 ? 0.2172 0.1944 0.1574 0.0181  0.0741  -0.0199 116  LEU A CG  
924  C  CD1 . LEU A 116 ? 0.1595 0.2619 0.1566 -0.0192 0.0330  -0.0266 116  LEU A CD1 
925  C  CD2 . LEU A 116 ? 0.2234 0.1802 0.2160 0.0126  -0.0193 0.0689  116  LEU A CD2 
926  N  N   . GLN A 117 ? 0.1989 0.2317 0.1672 0.0092  -0.0106 0.0113  117  GLN A N   
927  C  CA  . GLN A 117 ? 0.2878 0.2684 0.1959 0.0436  0.0210  -0.0120 117  GLN A CA  
928  C  C   . GLN A 117 ? 0.2402 0.2463 0.1967 0.0261  0.0099  -0.0251 117  GLN A C   
929  O  O   . GLN A 117 ? 0.2756 0.2631 0.2251 0.0195  -0.0278 -0.0309 117  GLN A O   
930  C  CB  . GLN A 117 ? 0.2957 0.2347 0.1927 0.0327  0.0207  -0.0296 117  GLN A CB  
931  C  CG  . GLN A 117 ? 0.3724 0.2478 0.2039 0.0338  0.0221  -0.0120 117  GLN A CG  
932  C  CD  . GLN A 117 ? 0.3300 0.2897 0.2636 0.0287  -0.0153 0.0486  117  GLN A CD  
933  O  OE1 . GLN A 117 ? 0.4439 0.3233 0.3173 -0.0465 -0.0704 0.0795  117  GLN A OE1 
934  N  NE2 . GLN A 117 ? 0.3537 0.3357 0.2698 -0.0224 0.0508  0.0176  117  GLN A NE2 
935  N  N   . ASP A 118 ? 0.1784 0.2439 0.1973 0.0150  0.0375  -0.0238 118  ASP A N   
936  C  CA  . ASP A 118 ? 0.1809 0.2449 0.2269 -0.0310 0.0036  0.0085  118  ASP A CA  
937  C  C   . ASP A 118 ? 0.1919 0.2342 0.2308 -0.0241 0.0074  0.0017  118  ASP A C   
938  O  O   . ASP A 118 ? 0.2104 0.2451 0.1946 0.0091  -0.0306 0.0082  118  ASP A O   
939  C  CB  . ASP A 118 ? 0.1740 0.2730 0.2423 0.0032  0.0064  -0.0419 118  ASP A CB  
940  C  CG  . ASP A 118 ? 0.1769 0.3393 0.2678 -0.0062 0.0370  -0.0744 118  ASP A CG  
941  O  OD1 . ASP A 118 ? 0.2174 0.4082 0.2799 -0.0053 0.0487  -0.1207 118  ASP A OD1 
942  O  OD2 . ASP A 118 ? 0.2844 0.4468 0.2797 -0.1153 0.0447  -0.0511 118  ASP A OD2 
943  N  N   . ALA A 119 ? 0.2076 0.2412 0.1862 0.0205  -0.0260 0.0396  119  ALA A N   
944  C  CA  . ALA A 119 ? 0.2149 0.1944 0.1616 0.0163  -0.0251 -0.0040 119  ALA A CA  
945  C  C   . ALA A 119 ? 0.1928 0.1918 0.1828 -0.0030 -0.0157 -0.0189 119  ALA A C   
946  O  O   . ALA A 119 ? 0.1878 0.2588 0.2019 -0.0017 -0.0203 0.0176  119  ALA A O   
947  C  CB  . ALA A 119 ? 0.2974 0.2147 0.1831 -0.0514 -0.0908 0.0156  119  ALA A CB  
948  N  N   . GLN A 120 ? 0.1926 0.1744 0.1611 0.0198  -0.0294 -0.0036 120  GLN A N   
949  C  CA  . GLN A 120 ? 0.1944 0.1960 0.1623 0.0269  -0.0311 0.0173  120  GLN A CA  
950  C  C   . GLN A 120 ? 0.1938 0.1849 0.1785 0.0331  -0.0315 -0.0048 120  GLN A C   
951  O  O   . GLN A 120 ? 0.2423 0.1923 0.2093 0.0298  -0.0066 -0.0301 120  GLN A O   
952  C  CB  . GLN A 120 ? 0.2387 0.1752 0.1880 0.0230  0.0075  -0.0569 120  GLN A CB  
953  C  CG  . GLN A 120 ? 0.2302 0.1751 0.2108 0.0106  0.0203  -0.0279 120  GLN A CG  
954  C  CD  . GLN A 120 ? 0.1943 0.1680 0.1687 0.0186  0.0346  -0.0186 120  GLN A CD  
955  O  OE1 . GLN A 120 ? 0.2159 0.1995 0.1762 -0.0019 0.0085  -0.0154 120  GLN A OE1 
956  N  NE2 . GLN A 120 ? 0.1967 0.2153 0.1807 -0.0064 0.0108  0.0065  120  GLN A NE2 
957  N  N   . LYS A 121 ? 0.1754 0.2282 0.2290 0.0337  -0.0202 -0.0119 121  LYS A N   
958  C  CA  . LYS A 121 ? 0.1727 0.2332 0.2292 0.0403  -0.0139 -0.0111 121  LYS A CA  
959  C  C   . LYS A 121 ? 0.2238 0.2351 0.2359 0.0405  -0.0262 -0.0018 121  LYS A C   
960  O  O   . LYS A 121 ? 0.3148 0.2385 0.3322 0.0811  0.0051  0.0270  121  LYS A O   
961  C  CB  . LYS A 121 ? 0.1864 0.2420 0.2563 0.0279  -0.0538 -0.0018 121  LYS A CB  
962  C  CG  . LYS A 121 ? 0.2971 0.2956 0.3476 -0.0293 -0.0252 0.1264  121  LYS A CG  
963  C  CD  . LYS A 121 ? 0.2294 0.3280 0.5135 0.0031  0.0037  0.0987  121  LYS A CD  
964  C  CE  . LYS A 121 ? 0.2697 0.5331 0.7333 0.0561  -0.0889 0.0884  121  LYS A CE  
965  N  NZ  . LYS A 121 ? 0.2353 0.6708 0.9934 0.0099  -0.0802 0.0453  121  LYS A NZ  
966  N  N   . GLY A 122 ? 0.2569 0.2214 0.2415 0.0384  0.0036  0.0305  122  GLY A N   
967  C  CA  . GLY A 122 ? 0.2908 0.1911 0.2335 0.0721  -0.0047 0.0273  122  GLY A CA  
968  C  C   . GLY A 122 ? 0.2521 0.2064 0.2020 0.0372  -0.0248 0.0077  122  GLY A C   
969  O  O   . GLY A 122 ? 0.2278 0.2251 0.1845 0.0497  -0.0148 0.0022  122  GLY A O   
970  N  N   . ALA A 123 ? 0.2705 0.1768 0.2223 0.0086  -0.0146 0.0072  123  ALA A N   
971  C  CA  . ALA A 123 ? 0.2736 0.1602 0.2189 0.0235  -0.0046 0.0411  123  ALA A CA  
972  C  C   . ALA A 123 ? 0.2170 0.1710 0.2393 0.0169  -0.0621 0.0164  123  ALA A C   
973  O  O   . ALA A 123 ? 0.1984 0.2215 0.2376 0.0057  -0.0063 0.0042  123  ALA A O   
974  C  CB  . ALA A 123 ? 0.2841 0.2461 0.2310 -0.0231 -0.0141 0.0654  123  ALA A CB  
975  N  N   . PHE A 124 ? 0.2056 0.1593 0.1562 0.0047  -0.0343 -0.0132 124  PHE A N   
976  C  CA  . PHE A 124 ? 0.1820 0.1493 0.1527 -0.0179 -0.0153 0.0037  124  PHE A CA  
977  C  C   . PHE A 124 ? 0.1867 0.1596 0.1534 -0.0067 -0.0168 -0.0070 124  PHE A C   
978  O  O   . PHE A 124 ? 0.1698 0.1902 0.1879 0.0153  -0.0252 -0.0058 124  PHE A O   
979  C  CB  . PHE A 124 ? 0.2174 0.1644 0.1317 0.0108  -0.0259 -0.0168 124  PHE A CB  
980  C  CG  . PHE A 124 ? 0.1863 0.1558 0.0940 0.0048  -0.0329 -0.0063 124  PHE A CG  
981  C  CD1 . PHE A 124 ? 0.2035 0.1728 0.1883 -0.0088 0.0268  -0.0348 124  PHE A CD1 
982  C  CD2 . PHE A 124 ? 0.2075 0.1769 0.1925 -0.0081 0.0376  0.0149  124  PHE A CD2 
983  C  CE1 . PHE A 124 ? 0.2281 0.1576 0.1748 0.0117  0.0031  -0.0068 124  PHE A CE1 
984  C  CE2 . PHE A 124 ? 0.1965 0.1720 0.2344 -0.0146 -0.0506 0.0234  124  PHE A CE2 
985  C  CZ  . PHE A 124 ? 0.2451 0.1464 0.1621 -0.0104 -0.0261 0.0264  124  PHE A CZ  
986  N  N   . THR A 125 ? 0.2190 0.1645 0.1595 0.0112  -0.0315 -0.0112 125  THR A N   
987  C  CA  . THR A 125 ? 0.2166 0.1770 0.1470 -0.0047 -0.0356 -0.0185 125  THR A CA  
988  C  C   . THR A 125 ? 0.1758 0.1758 0.1414 -0.0056 0.0373  0.0069  125  THR A C   
989  O  O   . THR A 125 ? 0.1775 0.1749 0.1726 0.0014  -0.0109 -0.0260 125  THR A O   
990  C  CB  . THR A 125 ? 0.2171 0.1778 0.1681 0.0546  -0.0141 -0.0015 125  THR A CB  
991  O  OG1 . THR A 125 ? 0.2097 0.1874 0.2070 -0.0004 -0.0133 0.0094  125  THR A OG1 
992  C  CG2 . THR A 125 ? 0.2309 0.1766 0.2080 -0.0093 0.0650  0.0416  125  THR A CG2 
993  N  N   . LYS A 126 ? 0.1688 0.1826 0.2016 -0.0112 0.0079  -0.0235 126  LYS A N   
994  C  CA  . LYS A 126 ? 0.1521 0.1864 0.1529 0.0046  -0.0053 -0.0089 126  LYS A CA  
995  C  C   . LYS A 126 ? 0.1353 0.1636 0.1555 -0.0011 -0.0135 0.0080  126  LYS A C   
996  O  O   . LYS A 126 ? 0.1566 0.1593 0.1695 0.0070  -0.0192 0.0111  126  LYS A O   
997  C  CB  . LYS A 126 ? 0.1388 0.2042 0.1333 -0.0096 -0.0082 0.0108  126  LYS A CB  
998  C  CG  . LYS A 126 ? 0.2004 0.2359 0.1396 -0.0020 -0.0326 0.0120  126  LYS A CG  
999  C  CD  . LYS A 126 ? 0.2023 0.2595 0.1399 -0.0033 -0.0488 0.0532  126  LYS A CD  
1000 C  CE  . LYS A 126 ? 0.1656 0.2477 0.1923 -0.0508 -0.0517 -0.0171 126  LYS A CE  
1001 N  NZ  . LYS A 126 ? 0.1789 0.2698 0.1424 -0.0254 -0.0398 0.0397  126  LYS A NZ  
1002 N  N   . GLU A 127 ? 0.1755 0.1618 0.1748 -0.0161 -0.0047 0.0034  127  GLU A N   
1003 C  CA  . GLU A 127 ? 0.2369 0.1815 0.1964 -0.0070 0.0038  -0.0483 127  GLU A CA  
1004 C  C   . GLU A 127 ? 0.2071 0.1669 0.1780 0.0473  -0.0212 -0.0377 127  GLU A C   
1005 O  O   . GLU A 127 ? 0.2024 0.2843 0.1814 0.0265  -0.0311 -0.0312 127  GLU A O   
1006 C  CB  . GLU A 127 ? 0.4550 0.2188 0.2053 -0.1056 -0.0952 0.0088  127  GLU A CB  
1007 C  CG  . GLU A 127 ? 0.5558 0.2046 0.2999 -0.0712 -0.1154 0.0147  127  GLU A CG  
1008 C  CD  . GLU A 127 ? 0.4144 0.2013 0.1470 -0.0435 -0.0056 -0.0346 127  GLU A CD  
1009 O  OE1 . GLU A 127 ? 0.3452 0.2183 0.3044 -0.0634 0.0373  0.0173  127  GLU A OE1 
1010 O  OE2 . GLU A 127 ? 0.3638 0.2234 0.1954 0.0234  -0.0808 -0.0032 127  GLU A OE2 
1011 N  N   . ASP A 128 ? 0.2079 0.1919 0.1827 0.0368  -0.0263 0.0174  128  ASP A N   
1012 C  CA  . ASP A 128 ? 0.2172 0.2162 0.2047 0.0190  -0.0127 0.0209  128  ASP A CA  
1013 C  C   . ASP A 128 ? 0.1611 0.2134 0.2063 -0.0001 -0.0079 -0.0126 128  ASP A C   
1014 O  O   . ASP A 128 ? 0.2151 0.2192 0.2026 0.0037  0.0169  -0.0123 128  ASP A O   
1015 C  CB  . ASP A 128 ? 0.2100 0.2248 0.1844 0.0130  -0.0085 0.0070  128  ASP A CB  
1016 C  CG  . ASP A 128 ? 0.2343 0.2341 0.1962 0.0279  -0.0318 0.0052  128  ASP A CG  
1017 O  OD1 . ASP A 128 ? 0.2127 0.2331 0.2219 -0.0034 -0.0143 -0.0139 128  ASP A OD1 
1018 O  OD2 . ASP A 128 ? 0.2291 0.2621 0.2417 0.0333  -0.0486 -0.0128 128  ASP A OD2 
1019 N  N   . GLY A 129 ? 0.2011 0.2215 0.1798 -0.0002 0.0005  -0.0160 129  GLY A N   
1020 C  CA  . GLY A 129 ? 0.2016 0.2241 0.1586 0.0127  0.0203  -0.0105 129  GLY A CA  
1021 C  C   . GLY A 129 ? 0.2117 0.2029 0.1991 -0.0085 0.0024  0.0190  129  GLY A C   
1022 O  O   . GLY A 129 ? 0.2385 0.2002 0.2190 0.0058  0.0265  -0.0033 129  GLY A O   
1023 N  N   . GLU A 130 ? 0.2094 0.2226 0.1624 0.0157  0.0079  -0.0039 130  GLU A N   
1024 C  CA  . GLU A 130 ? 0.1792 0.2186 0.2092 0.0163  0.0110  -0.0221 130  GLU A CA  
1025 C  C   . GLU A 130 ? 0.2162 0.1911 0.1803 0.0058  0.0253  -0.0029 130  GLU A C   
1026 O  O   . GLU A 130 ? 0.1736 0.2508 0.1736 -0.0131 -0.0033 -0.0001 130  GLU A O   
1027 C  CB  A GLU A 130 ? 0.1611 0.2580 0.2910 0.0241  -0.0343 -0.0118 130  GLU A CB  
1028 C  CB  B GLU A 130 ? 0.1406 0.2702 0.2407 0.0247  -0.0002 -0.0112 130  GLU A CB  
1029 C  CG  A GLU A 130 ? 0.2209 0.2542 0.2941 0.0603  -0.0537 -0.0172 130  GLU A CG  
1030 C  CG  B GLU A 130 ? 0.1899 0.2665 0.2396 -0.0031 -0.0107 -0.0030 130  GLU A CG  
1031 C  CD  A GLU A 130 ? 0.2059 0.3148 0.3299 0.0726  -0.1422 -0.0532 130  GLU A CD  
1032 C  CD  B GLU A 130 ? 0.0737 0.2840 0.3417 0.0407  -0.0385 -0.0032 130  GLU A CD  
1033 O  OE1 A GLU A 130 ? 0.1390 0.3804 0.4844 0.0591  -0.2115 -0.1329 130  GLU A OE1 
1034 O  OE1 B GLU A 130 ? 0.3599 0.2790 0.4064 0.1047  0.0058  -0.0187 130  GLU A OE1 
1035 O  OE2 A GLU A 130 ? 0.0502 0.2260 0.2234 -0.0708 -0.0903 0.0771  130  GLU A OE2 
1036 O  OE2 B GLU A 130 ? 0.1888 0.3733 0.2836 -0.0419 -0.0272 0.0747  130  GLU A OE2 
1037 N  N   . LYS A 131 ? 0.2606 0.1870 0.2061 0.0107  0.0149  -0.0018 131  LYS A N   
1038 C  CA  . LYS A 131 ? 0.2441 0.1927 0.1762 -0.0051 0.0051  -0.0071 131  LYS A CA  
1039 C  C   . LYS A 131 ? 0.1746 0.2485 0.1951 -0.0134 -0.0082 0.0094  131  LYS A C   
1040 O  O   . LYS A 131 ? 0.1738 0.4297 0.2870 -0.0006 -0.0250 -0.0622 131  LYS A O   
1041 C  CB  A LYS A 131 ? 0.2726 0.1922 0.2104 0.0245  0.0591  0.0011  131  LYS A CB  
1042 C  CB  B LYS A 131 ? 0.2211 0.1929 0.2371 0.0455  0.0313  0.0137  131  LYS A CB  
1043 C  CG  A LYS A 131 ? 0.2615 0.2376 0.2293 0.0375  0.0474  0.0374  131  LYS A CG  
1044 C  CG  B LYS A 131 ? 0.2554 0.2325 0.2257 0.0210  0.0094  0.0258  131  LYS A CG  
1045 C  CD  A LYS A 131 ? 0.3123 0.2534 0.2259 0.0128  0.0664  0.0415  131  LYS A CD  
1046 C  CD  B LYS A 131 ? 0.3341 0.2736 0.2309 -0.0010 0.0072  0.0929  131  LYS A CD  
1047 C  CE  A LYS A 131 ? 0.4107 0.2857 0.2351 -0.0188 0.0316  0.1052  131  LYS A CE  
1048 C  CE  B LYS A 131 ? 0.3067 0.2814 0.2672 0.0258  0.1041  0.0346  131  LYS A CE  
1049 N  NZ  A LYS A 131 ? 0.6586 0.3269 0.2154 -0.1158 0.0271  0.0914  131  LYS A NZ  
1050 N  NZ  B LYS A 131 ? 0.4599 0.3280 0.2898 -0.0836 0.0807  0.1322  131  LYS A NZ  
1051 N  N   . VAL A 132 ? 0.1966 0.2094 0.1706 -0.0121 -0.0086 -0.0170 132  VAL A N   
1052 C  CA  . VAL A 132 ? 0.2557 0.2164 0.1780 -0.0145 -0.0378 0.0052  132  VAL A CA  
1053 C  C   . VAL A 132 ? 0.2222 0.2158 0.1438 -0.0395 -0.0062 0.0152  132  VAL A C   
1054 O  O   . VAL A 132 ? 0.1997 0.2377 0.1879 -0.0154 -0.0093 -0.0103 132  VAL A O   
1055 C  CB  . VAL A 132 ? 0.3051 0.2176 0.1693 -0.0475 -0.0811 0.0060  132  VAL A CB  
1056 C  CG1 . VAL A 132 ? 0.2733 0.2869 0.1703 0.0012  -0.0534 0.0290  132  VAL A CG1 
1057 C  CG2 . VAL A 132 ? 0.2310 0.2349 0.2313 -0.0425 -0.0428 -0.0205 132  VAL A CG2 
1058 N  N   . VAL A 133 ? 0.2210 0.2192 0.2086 -0.0284 -0.0514 -0.0019 133  VAL A N   
1059 C  CA  . VAL A 133 ? 0.2414 0.2609 0.1862 -0.0070 -0.0349 -0.0223 133  VAL A CA  
1060 C  C   . VAL A 133 ? 0.1809 0.2504 0.2128 0.0004  0.0032  -0.0078 133  VAL A C   
1061 O  O   . VAL A 133 ? 0.2064 0.2440 0.1978 -0.0233 -0.0140 0.0273  133  VAL A O   
1062 C  CB  . VAL A 133 ? 0.3335 0.3064 0.2424 0.0247  0.0403  0.0366  133  VAL A CB  
1063 C  CG1 . VAL A 133 ? 0.2870 0.4709 0.2507 0.0373  0.0457  0.1018  133  VAL A CG1 
1064 C  CG2 . VAL A 133 ? 0.3162 0.3233 0.2727 0.0394  0.0291  0.1439  133  VAL A CG2 
1065 N  N   . ASP A 134 ? 0.2615 0.2546 0.2505 -0.0078 -0.0490 -0.0171 134  ASP A N   
1066 C  CA  . ASP A 134 ? 0.2669 0.2398 0.2173 -0.0216 -0.0214 -0.0073 134  ASP A CA  
1067 C  C   . ASP A 134 ? 0.2514 0.1839 0.2134 -0.0353 -0.0230 0.0197  134  ASP A C   
1068 O  O   . ASP A 134 ? 0.3387 0.2062 0.1891 0.0190  -0.0025 0.0022  134  ASP A O   
1069 C  CB  . ASP A 134 ? 0.2394 0.2618 0.2772 -0.0210 0.0150  -0.0045 134  ASP A CB  
1070 C  CG  . ASP A 134 ? 0.3583 0.2276 0.3703 -0.0553 0.1326  -0.0987 134  ASP A CG  
1071 O  OD1 . ASP A 134 ? 0.4033 0.3328 0.3716 -0.1385 -0.0190 0.0052  134  ASP A OD1 
1072 O  OD2 . ASP A 134 ? 0.3641 0.2667 0.2430 0.0164  -0.0182 0.0379  134  ASP A OD2 
1073 N  N   . GLU A 135 ? 0.2769 0.3054 0.2273 0.0087  -0.0385 0.0510  135  GLU A N   
1074 C  CA  . GLU A 135 ? 0.2911 0.3065 0.2661 0.0372  -0.0340 0.0229  135  GLU A CA  
1075 C  C   . GLU A 135 ? 0.3658 0.3178 0.3022 0.0656  -0.0349 -0.0137 135  GLU A C   
1076 O  O   . GLU A 135 ? 0.4509 0.3858 0.3073 0.0214  0.0090  -0.0499 135  GLU A O   
1077 C  CB  . GLU A 135 ? 0.3400 0.3313 0.3834 0.0400  -0.1366 0.0281  135  GLU A CB  
1078 C  CG  . GLU A 135 ? 0.3481 0.3537 0.5901 0.0627  -0.1162 0.1001  135  GLU A CG  
1079 C  CD  . GLU A 135 ? 0.3853 0.3665 0.4914 0.0546  0.0270  0.0221  135  GLU A CD  
1080 O  OE1 . GLU A 135 ? 0.5183 0.4231 0.6497 0.1073  0.1599  -0.0134 135  GLU A OE1 
1081 O  OE2 . GLU A 135 ? 0.4185 0.3160 0.3211 0.0863  0.0255  0.1189  135  GLU A OE2 
1082 N  N   . ALA A 136 ? 0.3994 0.2256 0.3173 0.0775  -0.0360 -0.0321 136  ALA A N   
1083 C  CA  . ALA A 136 ? 0.4323 0.2505 0.3201 0.0848  -0.0373 -0.0419 136  ALA A CA  
1084 C  C   . ALA A 136 ? 0.5177 0.2873 0.2588 0.1044  0.0525  -0.0295 136  ALA A C   
1085 O  O   . ALA A 136 ? 0.5237 0.4084 0.2788 0.1248  0.0396  -0.0795 136  ALA A O   
1086 C  CB  . ALA A 136 ? 0.5527 0.2764 0.3122 -0.0015 -0.0565 -0.0338 136  ALA A CB  
1087 N  N   . GLY A 137 ? 0.4063 0.2511 0.2328 0.0434  -0.0049 -0.0124 137  GLY A N   
1088 C  CA  . GLY A 137 ? 0.3190 0.2704 0.2346 -0.0023 -0.0310 -0.0021 137  GLY A CA  
1089 C  C   . GLY A 137 ? 0.3073 0.2708 0.2330 -0.0102 -0.0138 -0.0545 137  GLY A C   
1090 O  O   . GLY A 137 ? 0.2356 0.3368 0.2771 -0.0250 -0.0060 -0.0008 137  GLY A O   
1091 N  N   . LYS A 138 ? 0.3314 0.2357 0.2122 -0.0281 -0.0242 -0.0736 138  LYS A N   
1092 C  CA  . LYS A 138 ? 0.3268 0.2774 0.1849 -0.0429 -0.0141 -0.0267 138  LYS A CA  
1093 C  C   . LYS A 138 ? 0.2706 0.3060 0.1989 -0.0427 -0.0247 -0.0458 138  LYS A C   
1094 O  O   . LYS A 138 ? 0.2567 0.2835 0.2533 -0.0636 -0.0682 -0.0718 138  LYS A O   
1095 C  CB  . LYS A 138 ? 0.4205 0.3140 0.2969 -0.0998 0.0126  -0.0143 138  LYS A CB  
1096 C  CG  . LYS A 138 ? 0.4375 0.5373 0.3931 -0.2092 -0.0256 0.0629  138  LYS A CG  
1097 C  CD  . LYS A 138 ? 0.6098 0.8092 0.4011 -0.3932 -0.0680 0.2029  138  LYS A CD  
1098 C  CE  . LYS A 138 ? 0.9137 0.9301 0.4748 -0.4472 -0.1756 0.3518  138  LYS A CE  
1099 N  NZ  . LYS A 138 ? 1.3636 1.4559 0.4096 -0.6371 -0.2268 0.2793  138  LYS A NZ  
1100 N  N   . ARG A 139 ? 0.2945 0.3133 0.2050 -0.0262 -0.0329 -0.0559 139  ARG A N   
1101 C  CA  . ARG A 139 ? 0.2349 0.3920 0.2715 -0.0135 -0.0374 -0.1156 139  ARG A CA  
1102 C  C   . ARG A 139 ? 0.3159 0.3616 0.3444 -0.0620 0.0353  -0.1494 139  ARG A C   
1103 O  O   . ARG A 139 ? 0.3550 0.5326 0.4610 -0.1709 0.0702  -0.2334 139  ARG A O   
1104 C  CB  . ARG A 139 ? 0.3758 0.3285 0.3572 0.0214  -0.1228 -0.1398 139  ARG A CB  
1105 C  CG  . ARG A 139 ? 0.6142 0.4238 0.3460 -0.1356 -0.2479 -0.0729 139  ARG A CG  
1106 C  CD  . ARG A 139 ? 0.5123 0.3777 0.3105 -0.1029 -0.0786 -0.0577 139  ARG A CD  
1107 N  NE  . ARG A 139 ? 0.4086 0.4705 0.4820 -0.1449 -0.0491 -0.0022 139  ARG A NE  
1108 C  CZ  . ARG A 139 ? 0.3468 0.5450 0.4634 0.0038  -0.0600 0.1019  139  ARG A CZ  
1109 N  NH1 . ARG A 139 ? 0.4216 0.6564 0.4761 -0.0645 -0.1604 0.0487  139  ARG A NH1 
1110 N  NH2 . ARG A 139 ? 0.3386 0.4493 0.7223 -0.0311 0.0440  0.2861  139  ARG A NH2 
1111 N  N   . LEU A 140 ? 0.2919 0.3996 0.3564 -0.0659 0.0793  -0.1719 140  LEU A N   
1112 C  CA  . LEU A 140 ? 0.2531 0.4320 0.4416 0.0216  0.1356  -0.1556 140  LEU A CA  
1113 C  C   . LEU A 140 ? 0.3406 0.4239 0.5103 0.0935  0.1065  -0.1628 140  LEU A C   
1114 O  O   . LEU A 140 ? 0.5841 0.4223 0.8700 0.0950  -0.0801 -0.1392 140  LEU A O   
1115 C  CB  . LEU A 140 ? 0.4352 0.4401 0.3815 0.0315  0.1130  -0.0495 140  LEU A CB  
1116 C  CG  . LEU A 140 ? 0.3913 0.5497 0.4923 0.0524  0.1069  -0.0196 140  LEU A CG  
1117 C  CD1 . LEU A 140 ? 0.4461 0.4228 0.4905 -0.0021 -0.0100 -0.0033 140  LEU A CD1 
1118 C  CD2 . LEU A 140 ? 0.6858 0.8930 0.7034 -0.1880 -0.0722 0.3679  140  LEU A CD2 
1119 S  S   . SO4 B .   ? 0.2741 0.2313 0.2333 0.0201  0.0004  0.0090  201  SO4 A S   
1120 O  O1  . SO4 B .   ? 0.1879 0.2202 0.1886 0.0200  -0.0201 0.0365  201  SO4 A O1  
1121 O  O2  . SO4 B .   ? 0.2831 0.3058 0.1751 -0.0429 0.0556  -0.0309 201  SO4 A O2  
1122 O  O3  . SO4 B .   ? 0.1839 0.2456 0.3710 0.0057  -0.0194 0.1001  201  SO4 A O3  
1123 O  O4  . SO4 B .   ? 0.2736 0.3328 0.2011 0.0510  -0.0276 -0.0482 201  SO4 A O4  
1124 S  S   . SO4 C .   ? 0.2948 0.3933 0.3648 -0.0117 -0.0566 -0.0174 202  SO4 A S   
1125 O  O1  . SO4 C .   ? 0.4227 0.3534 0.8543 0.0646  -0.0557 0.0361  202  SO4 A O1  
1126 O  O2  . SO4 C .   ? 0.2126 0.6837 0.8037 -0.0207 0.0390  -0.0905 202  SO4 A O2  
1127 O  O3  . SO4 C .   ? 0.5269 0.3563 0.6119 0.0554  0.0620  -0.0612 202  SO4 A O3  
1128 O  O4  . SO4 C .   ? 0.4788 0.8362 0.4277 -0.2193 0.0567  -0.0483 202  SO4 A O4  
1129 S  S   . SO4 D .   ? 0.1739 0.1947 0.1730 -0.0097 -0.0019 0.0141  203  SO4 A S   
1130 O  O1  . SO4 D .   ? 0.2991 0.1940 0.2040 -0.0345 0.0381  -0.0050 203  SO4 A O1  
1131 O  O2  . SO4 D .   ? 0.1946 0.2804 0.1919 -0.0375 -0.0276 0.0200  203  SO4 A O2  
1132 O  O3  . SO4 D .   ? 0.1638 0.2397 0.2471 -0.0113 0.0049  0.0548  203  SO4 A O3  
1133 O  O4  . SO4 D .   ? 0.1836 0.1700 0.1796 0.0277  0.0553  -0.0084 203  SO4 A O4  
1134 CS CS  . CS  E .   ? 0.3678 0.9687 0.3050 -0.1227 0.1201  -0.2554 404  CS  A CS  
1135 CS CS  . CS  F .   ? 0.1497 0.1496 0.1406 -0.0001 -0.0222 -0.0384 401  CS  A CS  
1136 CS CS  . CS  G .   ? 0.1963 0.2854 0.1690 -0.0027 0.0004  -0.0171 402  CS  A CS  
1137 CS CS  . CS  H .   ? 0.3159 0.4191 0.3140 -0.0131 0.0278  0.0904  403  CS  A CS  
1138 CS CS  . CS  I .   ? 0.4306 0.7542 0.4389 -0.1243 -0.0829 0.1104  405  CS  A CS  
1139 O  O   . HOH J .   ? 0.2183 0.2683 0.3172 0.0393  0.0191  0.1519  1001 HOH A O   
1140 O  O   . HOH J .   ? 0.2829 0.4369 0.2484 0.0433  0.0708  0.0166  1002 HOH A O   
1141 O  O   . HOH J .   ? 0.1414 0.2118 0.1603 0.0050  -0.0333 0.0063  1003 HOH A O   
1142 O  O   . HOH J .   ? 0.2483 0.1999 0.1842 0.0229  -0.0231 0.0215  1004 HOH A O   
1143 O  O   . HOH J .   ? 0.2381 0.1940 0.2026 -0.0020 -0.0099 -0.0065 1005 HOH A O   
1144 O  O   . HOH J .   ? 0.1715 0.2042 0.1843 0.0110  -0.0460 -0.0417 1006 HOH A O   
1145 O  O   . HOH J .   ? 0.1979 0.2248 0.2121 -0.0186 -0.0345 -0.0064 1007 HOH A O   
1146 O  O   . HOH J .   ? 0.2855 0.2267 0.2510 0.0171  -0.0168 0.0001  1008 HOH A O   
1147 O  O   . HOH J .   ? 0.2248 0.1700 0.1775 0.0059  -0.0134 -0.0072 1009 HOH A O   
1148 O  O   . HOH J .   ? 0.2340 0.2107 0.1575 0.0003  -0.0120 0.0206  1010 HOH A O   
1149 O  O   . HOH J .   ? 0.2729 0.2765 0.2451 0.0412  -0.0124 -0.0280 1011 HOH A O   
1150 O  O   . HOH J .   ? 0.2364 0.2419 0.1846 -0.0171 0.0195  -0.0279 1012 HOH A O   
1151 O  O   . HOH J .   ? 0.2319 0.1566 0.1661 0.0153  -0.0318 0.0137  1013 HOH A O   
1152 O  O   . HOH J .   ? 0.1986 0.2537 0.2867 -0.0362 -0.0221 -0.0155 1014 HOH A O   
1153 O  O   . HOH J .   ? 0.1966 0.2076 0.1814 0.0155  -0.0020 -0.0293 1015 HOH A O   
1154 O  O   . HOH J .   ? 0.1954 0.2456 0.1802 0.0037  -0.0042 0.0105  1016 HOH A O   
1155 O  O   . HOH J .   ? 0.2436 0.2444 0.2316 0.0058  -0.0031 -0.0166 1017 HOH A O   
1156 O  O   . HOH J .   ? 0.2301 0.3164 0.1883 -0.0271 0.0446  0.0048  1018 HOH A O   
1157 O  O   . HOH J .   ? 0.1856 0.1926 0.1676 -0.0017 0.0165  0.0008  1019 HOH A O   
1158 O  O   . HOH J .   ? 0.2081 0.1997 0.1837 0.0187  -0.0163 0.0400  1020 HOH A O   
1159 O  O   . HOH J .   ? 0.3367 0.2417 0.1985 0.0286  0.0178  -0.0364 1021 HOH A O   
1160 O  O   . HOH J .   ? 0.1916 0.3015 0.2694 -0.0019 -0.0008 -0.0377 1022 HOH A O   
1161 O  O   . HOH J .   ? 0.2221 0.2068 0.2375 0.0244  -0.0262 -0.0182 1023 HOH A O   
1162 O  O   . HOH J .   ? 0.3208 0.2405 0.2913 -0.0024 0.0229  -0.0480 1024 HOH A O   
1163 O  O   . HOH J .   ? 0.3259 0.2130 0.1510 -0.0620 -0.0252 0.0393  1025 HOH A O   
1164 O  O   . HOH J .   ? 0.2481 0.2053 0.1967 0.0523  0.0042  0.0174  1026 HOH A O   
1165 O  O   . HOH J .   ? 0.2496 0.1810 0.2352 0.0374  -0.0213 0.0008  1027 HOH A O   
1166 O  O   . HOH J .   ? 0.2988 0.2291 0.2164 0.0144  -0.0050 0.0280  1028 HOH A O   
1167 O  O   . HOH J .   ? 0.2601 0.2074 0.1736 0.0231  -0.0394 -0.0064 1029 HOH A O   
1168 O  O   . HOH J .   ? 0.2398 0.2411 0.3069 0.0069  -0.0157 -0.0373 1030 HOH A O   
1169 O  O   . HOH J .   ? 0.2047 0.1919 0.2306 -0.0011 0.0000  -0.0417 1031 HOH A O   
1170 O  O   . HOH J .   ? 0.3007 0.3208 0.3060 -0.0119 0.0373  -0.0697 1032 HOH A O   
1171 O  O   . HOH J .   ? 0.2349 0.2297 0.2377 -0.0200 0.0023  -0.0048 1033 HOH A O   
1172 O  O   . HOH J .   ? 0.2962 0.2267 0.2136 0.0314  0.0136  0.0327  1034 HOH A O   
1173 O  O   . HOH J .   ? 0.2682 0.2545 0.2477 0.0105  0.0033  -0.0357 1035 HOH A O   
1174 O  O   . HOH J .   ? 0.2680 0.2117 0.1758 0.0123  -0.0139 -0.0091 1036 HOH A O   
1175 O  O   . HOH J .   ? 0.2477 0.1959 0.1782 -0.0042 0.0098  -0.0500 1037 HOH A O   
1176 O  O   . HOH J .   ? 0.2288 0.3123 0.3919 -0.0176 -0.0426 0.0147  1038 HOH A O   
1177 O  O   . HOH J .   ? 0.3306 0.3683 0.2945 -0.0405 0.0770  -0.0458 1039 HOH A O   
1178 O  O   . HOH J .   ? 0.2254 0.3419 0.2836 0.0506  0.0171  0.0021  1040 HOH A O   
1179 O  O   . HOH J .   ? 0.2721 0.2254 0.2282 -0.0026 -0.0332 0.0193  1041 HOH A O   
1180 O  O   . HOH J .   ? 0.2072 0.1806 0.1985 0.0117  -0.0381 0.0367  1042 HOH A O   
1181 O  O   . HOH J .   ? 0.2993 0.2028 0.2344 0.0112  -0.0672 0.0047  1043 HOH A O   
1182 O  O   . HOH J .   ? 0.2599 0.2698 0.2635 -0.0495 -0.0636 0.0527  1044 HOH A O   
1183 O  O   . HOH J .   ? 0.2519 0.2547 0.2806 -0.0070 -0.0243 0.0025  1045 HOH A O   
1184 O  O   . HOH J .   ? 0.2176 0.2525 0.2408 0.0042  -0.0597 0.0230  1046 HOH A O   
1185 O  O   . HOH J .   ? 0.2745 0.2449 0.3906 0.0300  -0.0837 -0.0782 1047 HOH A O   
1186 O  O   . HOH J .   ? 0.2811 0.2554 0.2102 -0.0086 -0.0209 0.0063  1048 HOH A O   
1187 O  O   . HOH J .   ? 0.3442 0.3325 0.2688 -0.0006 -0.0735 0.0748  1049 HOH A O   
1188 O  O   . HOH J .   ? 0.2520 0.3322 0.1912 -0.0267 -0.0290 0.0042  1050 HOH A O   
1189 O  O   . HOH J .   ? 0.3480 0.2626 0.2412 0.0473  0.0034  0.0461  1051 HOH A O   
1190 O  O   . HOH J .   ? 0.2828 0.2328 0.2091 -0.0306 -0.0490 -0.0057 1052 HOH A O   
1191 O  O   . HOH J .   ? 0.3873 0.3813 0.2672 -0.0234 0.0992  0.0527  1053 HOH A O   
1192 O  O   . HOH J .   ? 0.2705 0.3430 0.3429 -0.0451 -0.0016 -0.0496 1054 HOH A O   
1193 O  O   . HOH J .   ? 0.2663 0.3194 0.2628 -0.0505 0.0688  -0.0633 1055 HOH A O   
1194 O  O   . HOH J .   ? 0.3900 0.4462 0.2810 -0.0864 0.0457  -0.0436 1056 HOH A O   
1195 O  O   . HOH J .   ? 0.3860 0.2207 0.2171 -0.0503 0.0089  -0.0326 1057 HOH A O   
1196 O  O   . HOH J .   ? 0.3511 0.2576 0.2388 0.0092  -0.0265 0.0268  1058 HOH A O   
1197 O  O   . HOH J .   ? 0.2833 0.2586 0.1918 -0.0427 0.0211  0.0051  1059 HOH A O   
1198 O  O   . HOH J .   ? 0.2460 0.2372 0.2682 -0.0099 -0.0031 -0.0215 1060 HOH A O   
1199 O  O   . HOH J .   ? 0.2648 0.2999 0.2303 -0.0093 -0.0702 0.0140  1061 HOH A O   
1200 O  O   . HOH J .   ? 0.3224 0.4274 0.2900 -0.0684 -0.0057 -0.0172 1062 HOH A O   
1201 O  O   . HOH J .   ? 0.3202 0.2253 0.2617 0.0076  -0.0097 -0.0257 1063 HOH A O   
1202 O  O   . HOH J .   ? 0.3367 0.2262 0.1880 -0.0272 -0.0977 0.0309  1064 HOH A O   
1203 O  O   . HOH J .   ? 0.3596 0.2701 0.2659 -0.0507 -0.0317 0.0495  1065 HOH A O   
1204 O  O   . HOH J .   ? 0.3712 0.2715 0.3611 0.0224  0.0595  -0.0511 1066 HOH A O   
1205 O  O   . HOH J .   ? 0.2573 0.3299 0.3142 -0.0326 -0.0346 -0.0373 1067 HOH A O   
1206 O  O   . HOH J .   ? 0.3525 0.3509 0.2823 -0.0433 0.0169  -0.0495 1068 HOH A O   
1207 O  O   . HOH J .   ? 0.2332 0.2241 0.2839 -0.0047 0.0079  -0.0058 1069 HOH A O   
1208 O  O   . HOH J .   ? 0.3922 0.2840 0.3987 0.0058  -0.1411 0.0351  1070 HOH A O   
1209 O  O   . HOH J .   ? 0.3548 0.2835 0.2567 0.0100  -0.0425 0.0100  1071 HOH A O   
1210 O  O   . HOH J .   ? 0.3290 0.3378 0.3743 -0.0024 0.0214  0.0224  1072 HOH A O   
1211 O  O   . HOH J .   ? 0.3055 0.4258 0.1764 0.0814  -0.0181 -0.0502 1073 HOH A O   
1212 O  O   . HOH J .   ? 0.3429 0.3373 0.3203 -0.0522 0.1425  -0.0164 1074 HOH A O   
1213 O  O   . HOH J .   ? 0.2423 0.2895 0.2477 0.0053  0.0102  0.0102  1075 HOH A O   
1214 O  O   . HOH J .   ? 0.3040 0.3514 0.2791 -0.1029 0.0468  -0.0518 1076 HOH A O   
1215 O  O   . HOH J .   ? 0.2472 0.5260 0.2198 -0.0063 -0.0734 0.0429  1077 HOH A O   
1216 O  O   . HOH J .   ? 0.4328 0.3210 0.3139 0.0474  0.0694  0.0221  1078 HOH A O   
1217 O  O   . HOH J .   ? 0.2894 0.3132 0.3205 -0.0320 -0.0311 0.0834  1079 HOH A O   
1218 O  O   . HOH J .   ? 0.3146 0.3255 0.2992 -0.0748 0.0188  0.0318  1080 HOH A O   
1219 O  O   . HOH J .   ? 0.3436 0.2604 0.4257 -0.0092 -0.0949 0.0884  1081 HOH A O   
1220 O  O   . HOH J .   ? 0.2594 0.3598 0.2885 0.0462  -0.0904 -0.0324 1082 HOH A O   
1221 O  O   . HOH J .   ? 0.4145 0.2437 0.2699 0.0139  -0.0707 -0.0338 1083 HOH A O   
1222 O  O   . HOH J .   ? 0.3308 0.2211 0.2751 0.0060  -0.0648 -0.0261 1084 HOH A O   
1223 O  O   . HOH J .   ? 0.2951 0.5681 0.3745 -0.1296 -0.0160 0.0434  1085 HOH A O   
1224 O  O   . HOH J .   ? 0.4199 0.3084 0.2201 -0.0471 0.0757  -0.0508 1086 HOH A O   
1225 O  O   . HOH J .   ? 0.3101 0.2715 0.3620 0.0002  -0.1215 0.0425  1087 HOH A O   
1226 O  O   . HOH J .   ? 0.2623 0.3455 0.3021 0.0270  -0.0673 0.0219  1088 HOH A O   
1227 O  O   . HOH J .   ? 0.3930 0.3376 0.2732 0.0085  0.0741  -0.1400 1089 HOH A O   
1228 O  O   . HOH J .   ? 0.3849 0.4216 0.4585 -0.0774 -0.1146 0.0449  1090 HOH A O   
1229 O  O   . HOH J .   ? 0.5665 0.4828 0.3118 -0.1148 -0.1096 0.0245  1091 HOH A O   
1230 O  O   . HOH J .   ? 0.2273 0.2823 0.4074 0.0069  -0.1142 0.0333  1092 HOH A O   
1231 O  O   . HOH J .   ? 0.4007 0.3096 0.3738 0.0160  -0.0554 -0.0075 1093 HOH A O   
1232 O  O   . HOH J .   ? 0.2334 0.3287 0.4327 -0.0078 -0.0126 0.0667  1094 HOH A O   
1233 O  O   . HOH J .   ? 0.4637 0.3125 0.3281 -0.0402 0.0804  0.0593  1095 HOH A O   
1234 O  O   . HOH J .   ? 0.3680 0.4097 0.3793 -0.0217 0.0232  0.1233  1096 HOH A O   
1235 O  O   . HOH J .   ? 0.3147 0.3296 0.3875 0.0295  -0.0880 -0.0455 1097 HOH A O   
1236 O  O   . HOH J .   ? 0.3059 0.3739 0.3356 -0.0045 0.0991  -0.0001 1098 HOH A O   
1237 O  O   . HOH J .   ? 0.4565 0.3273 0.3323 0.0264  -0.0539 0.0813  1099 HOH A O   
1238 O  O   . HOH J .   ? 0.3908 0.3594 0.4427 -0.1028 0.1728  -0.0120 1100 HOH A O   
1239 O  O   . HOH J .   ? 0.4654 0.3036 0.2645 0.0052  -0.0691 0.0528  1101 HOH A O   
1240 O  O   . HOH J .   ? 0.4543 0.3759 0.4401 0.0192  -0.0095 -0.1705 1102 HOH A O   
1241 O  O   . HOH J .   ? 0.3037 0.3981 0.4378 -0.0109 -0.0777 0.0175  1103 HOH A O   
1242 O  O   . HOH J .   ? 0.4203 0.3376 0.2983 0.0025  0.1028  0.0526  1104 HOH A O   
1243 O  O   . HOH J .   ? 0.3071 0.4935 0.2969 -0.0454 -0.0111 0.0175  1105 HOH A O   
1244 O  O   . HOH J .   ? 0.3589 0.3735 0.4734 -0.0500 -0.0945 -0.0403 1106 HOH A O   
1245 O  O   . HOH J .   ? 0.3595 0.4064 0.5104 -0.0760 -0.0770 0.0595  1107 HOH A O   
1246 O  O   . HOH J .   ? 0.6585 0.2522 0.3271 0.0434  -0.1035 0.0178  1108 HOH A O   
1247 O  O   . HOH J .   ? 0.2780 0.4530 0.3529 -0.0634 -0.1078 -0.0048 1109 HOH A O   
1248 O  O   . HOH J .   ? 0.4982 0.4939 0.3077 -0.0127 -0.0319 -0.1001 1110 HOH A O   
1249 O  O   . HOH J .   ? 0.3464 0.5086 0.3955 -0.0021 -0.0233 -0.0494 1111 HOH A O   
1250 O  O   . HOH J .   ? 0.4490 0.4115 0.4143 -0.0677 -0.1106 0.0205  1112 HOH A O   
1251 O  O   . HOH J .   ? 0.2958 0.4501 0.4487 0.0972  0.0520  0.0293  1113 HOH A O   
1252 O  O   . HOH J .   ? 0.4442 0.2885 0.2859 -0.0611 -0.1014 0.0756  1114 HOH A O   
1253 O  O   . HOH J .   ? 0.3556 0.5066 0.2968 -0.0318 -0.0241 0.0186  1115 HOH A O   
1254 O  O   . HOH J .   ? 0.3921 0.4865 0.3279 0.0220  0.0361  -0.0704 1116 HOH A O   
1255 O  O   . HOH J .   ? 0.2906 0.4477 0.3455 -0.0297 -0.0958 0.0686  1117 HOH A O   
1256 O  O   . HOH J .   ? 0.4794 0.5242 0.5151 0.0773  -0.1799 -0.0617 1118 HOH A O   
1257 O  O   . HOH J .   ? 0.3187 0.3666 0.5074 -0.0002 -0.0115 -0.1169 1119 HOH A O   
1258 O  O   . HOH J .   ? 0.3555 0.5644 0.3347 -0.1444 0.0490  -0.0011 1120 HOH A O   
1259 O  O   . HOH J .   ? 0.5368 0.4277 0.3765 -0.0578 -0.0574 0.0932  1121 HOH A O   
1260 O  O   . HOH J .   ? 0.3700 0.3115 0.5013 -0.0285 -0.1023 0.1065  1122 HOH A O   
1261 O  O   . HOH J .   ? 0.3408 0.3892 0.3714 0.0160  0.0427  -0.0183 1123 HOH A O   
1262 O  O   . HOH J .   ? 0.4440 0.5491 0.4361 -0.0856 0.1694  -0.2351 1124 HOH A O   
1263 O  O   . HOH J .   ? 0.3970 0.5412 0.5497 -0.0257 -0.0966 0.1985  1125 HOH A O   
1264 O  O   . HOH J .   ? 0.4086 0.3289 0.6289 0.0222  -0.1775 -0.0139 1126 HOH A O   
1265 O  O   . HOH J .   ? 0.5113 0.3862 0.4644 0.1520  0.1138  -0.0128 1127 HOH A O   
1266 O  O   . HOH J .   ? 0.3762 0.4032 0.5343 0.0902  -0.1203 -0.1202 1128 HOH A O   
1267 O  O   . HOH J .   ? 0.4608 0.4496 0.3082 -0.0280 0.0310  0.0921  1129 HOH A O   
1268 O  O   . HOH J .   ? 0.3958 0.3771 0.4378 0.0313  0.0176  -0.0310 1130 HOH A O   
1269 O  O   . HOH J .   ? 0.5652 0.4025 0.5204 0.1333  -0.0753 -0.0320 1131 HOH A O   
1270 O  O   . HOH J .   ? 0.5647 0.5444 0.4835 -0.0483 0.1946  -0.1328 1132 HOH A O   
1271 O  O   . HOH J .   ? 0.5190 0.5095 0.3506 -0.0705 0.0509  -0.1599 1133 HOH A O   
1272 O  O   . HOH J .   ? 0.3116 0.4595 0.6308 0.0661  -0.0459 0.1216  1134 HOH A O   
1273 O  O   . HOH J .   ? 0.4370 0.3926 0.5222 -0.0216 -0.1107 0.0519  1135 HOH A O   
1274 O  O   . HOH J .   ? 0.5153 0.3578 0.3510 -0.0142 0.0251  0.0085  1136 HOH A O   
1275 O  O   . HOH J .   ? 0.2415 0.4976 0.5210 0.0998  -0.0449 -0.0694 1137 HOH A O   
1276 O  O   . HOH J .   ? 0.4545 0.3053 0.5742 -0.0075 0.0038  0.2145  1138 HOH A O   
1277 O  O   . HOH J .   ? 0.4031 0.4205 0.3992 -0.0336 0.1741  -0.0958 1139 HOH A O   
1278 O  O   . HOH J .   ? 0.5615 0.4358 0.2698 0.0698  -0.0407 -0.0286 1140 HOH A O   
1279 O  O   . HOH J .   ? 0.3918 0.2663 0.6369 0.0609  -0.0122 0.0597  1141 HOH A O   
1280 O  O   . HOH J .   ? 0.4755 0.4214 0.4362 -0.0498 0.0378  0.0644  1142 HOH A O   
1281 O  O   . HOH J .   ? 0.2487 0.4547 0.5789 0.0261  0.0467  -0.0389 1143 HOH A O   
1282 O  O   . HOH J .   ? 0.6420 0.4143 0.4048 -0.1413 0.0586  0.0714  1144 HOH A O   
1283 O  O   . HOH J .   ? 0.3475 0.4756 0.4265 0.0571  0.0550  0.0120  1145 HOH A O   
1284 O  O   . HOH J .   ? 0.3881 0.3738 0.4702 0.0200  0.0361  0.1184  1146 HOH A O   
1285 O  O   . HOH J .   ? 0.3258 0.8236 0.7865 -0.0723 0.1420  -0.0616 1147 HOH A O   
1286 O  O   . HOH J .   ? 0.5353 0.4338 0.4261 -0.0340 -0.2623 0.0136  1148 HOH A O   
1287 O  O   . HOH J .   ? 0.5647 0.4621 0.5028 0.0049  0.1982  0.0265  1149 HOH A O   
1288 O  O   . HOH J .   ? 0.5257 0.5339 0.5187 -0.0358 -0.1244 0.0396  1150 HOH A O   
1289 O  O   . HOH J .   ? 0.5713 0.4849 0.7514 0.0879  0.0336  -0.0016 1151 HOH A O   
1290 O  O   . HOH J .   ? 0.4274 0.4261 0.5281 0.0435  0.0764  -0.0664 1152 HOH A O   
1291 O  O   . HOH J .   ? 0.3796 0.4153 0.4354 0.0687  -0.0435 -0.0108 1153 HOH A O   
1292 O  O   . HOH J .   ? 0.6857 0.3729 0.4855 0.1887  0.0072  0.0532  1154 HOH A O   
1293 O  O   . HOH J .   ? 0.5512 0.5014 0.4054 0.0265  -0.0119 0.0462  1155 HOH A O   
1294 O  O   . HOH J .   ? 0.4475 0.4494 0.4816 -0.1147 0.1771  -0.1045 1156 HOH A O   
1295 O  O   . HOH J .   ? 0.5628 0.4549 0.4026 0.0354  0.1273  -0.1827 1157 HOH A O   
1296 O  O   . HOH J .   ? 0.4131 0.3515 0.4703 0.0630  -0.0290 0.0762  1158 HOH A O   
1297 O  O   . HOH J .   ? 0.2881 0.3678 0.3970 -0.0252 0.0013  -0.0252 1159 HOH A O   
1298 O  O   . HOH J .   ? 0.5498 0.4234 0.5308 0.0034  -0.2134 -0.0837 1160 HOH A O   
1299 O  O   . HOH J .   ? 0.7393 0.6632 0.6336 -0.0373 -0.0696 0.0501  1161 HOH A O   
1300 O  O   . HOH J .   ? 0.3693 0.4163 0.3934 0.0062  0.1000  0.0954  1162 HOH A O   
1301 O  O   . HOH J .   ? 0.5173 0.5569 0.7737 0.1915  -0.0450 -0.0943 1163 HOH A O   
1302 O  O   . HOH J .   ? 0.7407 0.6869 0.8105 -0.0390 0.1556  -0.0754 1164 HOH A O   
1303 O  O   . HOH J .   ? 0.5249 0.4108 0.5208 0.1355  0.0436  0.0511  1165 HOH A O   
1304 O  O   . HOH J .   ? 0.4072 0.5374 0.4841 -0.0561 -0.0083 -0.0020 1166 HOH A O   
1305 O  O   . HOH J .   ? 0.5996 0.4923 0.5899 0.0769  0.0484  -0.1387 1167 HOH A O   
1306 O  O   . HOH J .   ? 0.2605 0.7187 0.3533 -0.0482 0.1122  -0.2045 1168 HOH A O   
1307 O  O   . HOH J .   ? 0.4622 0.5436 0.5643 -0.1656 -0.0260 -0.0038 1169 HOH A O   
1308 O  O   . HOH J .   ? 0.3748 0.5297 0.4819 0.0091  -0.0375 -0.0097 1170 HOH A O   
1309 O  O   . HOH J .   ? 0.6084 0.4422 0.5288 -0.0737 0.0751  0.0512  1171 HOH A O   
1310 O  O   . HOH J .   ? 0.3523 0.3752 0.3977 0.0669  0.0029  0.0119  1172 HOH A O   
1311 O  O   . HOH J .   ? 0.4965 0.3707 0.4619 0.0836  -0.0281 -0.1263 1173 HOH A O   
1312 O  O   . HOH J .   ? 0.5251 0.4219 0.5267 -0.0062 -0.0930 0.0104  1174 HOH A O   
1313 O  O   . HOH J .   ? 0.4972 0.4187 0.6529 -0.0527 -0.1663 0.1839  1175 HOH A O   
1314 O  O   . HOH J .   ? 0.8406 0.5639 0.7195 -0.0716 -0.1767 0.0109  1176 HOH A O   
1315 O  O   . HOH J .   ? 0.5437 0.5632 0.4542 -0.0156 0.1971  -0.0422 1177 HOH A O   
1316 O  O   . HOH J .   ? 0.6779 0.6118 0.9417 0.0359  0.2390  -0.1897 1178 HOH A O   
1317 O  O   . HOH J .   ? 0.7109 0.4394 0.3566 0.0241  0.1082  -0.0260 1179 HOH A O   
1318 O  O   . HOH J .   ? 0.7557 0.6005 0.5208 -0.0247 -0.0731 0.0050  1180 HOH A O   
1319 O  O   . HOH J .   ? 0.5326 0.3932 0.4655 -0.0887 -0.1364 -0.0290 1181 HOH A O   
1320 O  O   . HOH J .   ? 0.7357 0.4209 0.5219 -0.1418 0.1136  -0.0615 1182 HOH A O   
1321 O  O   . HOH J .   ? 0.4823 0.5578 0.7544 0.0221  0.0316  -0.2179 1183 HOH A O   
1322 O  O   . HOH J .   ? 0.2473 0.5832 0.5156 0.0363  -0.0251 -0.0902 1184 HOH A O   
1323 O  O   . HOH J .   ? 0.4749 0.5873 0.6047 -0.0792 -0.0672 0.0610  1185 HOH A O   
1324 O  O   . HOH J .   ? 0.4680 0.4922 0.4381 -0.0546 0.0469  -0.0447 1186 HOH A O   
1325 O  O   . HOH J .   ? 0.4793 0.4273 0.6313 0.0702  -0.1249 -0.0203 1187 HOH A O   
1326 O  O   . HOH J .   ? 0.6997 0.6042 0.7718 -0.0331 0.1719  -0.2858 1188 HOH A O   
1327 O  O   . HOH J .   ? 0.4936 0.5909 0.6439 -0.0028 0.0539  -0.1192 1189 HOH A O   
1328 O  O   . HOH J .   ? 0.3891 0.5041 0.5448 -0.0929 0.1328  -0.1672 1190 HOH A O   
1329 O  O   . HOH J .   ? 0.5344 0.5321 0.4026 -0.0680 -0.0420 -0.1772 1191 HOH A O   
1330 O  O   . HOH J .   ? 0.6205 0.4089 0.3730 0.1635  0.0383  0.0299  1192 HOH A O   
1331 O  O   . HOH J .   ? 0.5814 0.4803 0.4026 0.0626  -0.0957 0.0517  1193 HOH A O   
1332 O  O   . HOH J .   ? 0.7549 0.7374 0.7803 -0.1125 0.2204  0.0525  1194 HOH A O   
1333 O  O   . HOH J .   ? 0.7369 0.6705 0.4748 -0.1641 0.0863  -0.1768 1195 HOH A O   
1334 O  O   . HOH J .   ? 0.4761 0.4370 0.4316 0.0493  0.0152  -0.1232 1196 HOH A O   
1335 O  O   . HOH J .   ? 0.5556 0.5330 0.4847 0.0882  -0.0247 -0.0951 1197 HOH A O   
1336 O  O   . HOH J .   ? 0.8706 0.9734 0.9233 -0.0672 -0.0486 0.0084  1198 HOH A O   
1337 O  O   . HOH J .   ? 0.4802 0.5095 0.5333 -0.0284 -0.1075 -0.0966 1199 HOH A O   
1338 O  O   . HOH J .   ? 0.6528 0.6189 0.6252 -0.2123 0.1430  0.0128  1200 HOH A O   
1339 O  O   . HOH J .   ? 1.0041 0.8030 0.8142 -0.0903 0.1810  -0.0257 1201 HOH A O   
1340 O  O   . HOH J .   ? 0.6808 0.3066 0.3580 0.0384  -0.0691 0.0483  1202 HOH A O   
1341 O  O   . HOH J .   ? 0.5366 0.5633 0.4616 -0.1080 0.1565  -0.1150 1203 HOH A O   
1342 O  O   . HOH J .   ? 0.5930 0.7207 0.4281 -0.0714 -0.0278 0.1625  1204 HOH A O   
1343 O  O   . HOH J .   ? 0.5521 0.6416 0.4582 -0.1355 0.1796  -0.1418 1205 HOH A O   
1344 O  O   . HOH J .   ? 0.4365 0.5513 0.5691 0.0193  -0.1628 0.0826  1206 HOH A O   
1345 O  O   . HOH J .   ? 0.4483 0.4477 0.5472 0.0129  -0.1001 -0.0148 1207 HOH A O   
1346 O  O   . HOH J .   ? 0.8377 0.5800 0.4997 -0.2068 -0.3345 0.1064  1208 HOH A O   
1347 O  O   . HOH J .   ? 0.4342 0.5500 0.4402 -0.1080 -0.1667 -0.0548 1209 HOH A O   
1348 O  O   . HOH J .   ? 0.7010 0.4959 0.4133 -0.1638 -0.0023 0.1274  1210 HOH A O   
1349 O  O   . HOH J .   ? 0.6486 0.4447 0.4960 0.0276  -0.2974 0.1960  1211 HOH A O   
1350 O  O   . HOH J .   ? 0.6074 0.5728 0.6071 0.1490  0.0090  0.0525  1212 HOH A O   
1351 O  O   . HOH J .   ? 0.7331 0.6383 0.5690 -0.0399 -0.1925 0.1266  1213 HOH A O   
1352 O  O   . HOH J .   ? 0.6078 0.4971 0.5234 -0.1580 0.1378  -0.2144 1214 HOH A O   
1353 O  O   . HOH J .   ? 0.3385 0.4557 0.6982 -0.0139 -0.1119 -0.0218 1215 HOH A O   
1354 O  O   . HOH J .   ? 0.7261 0.5854 0.6273 -0.1395 0.0534  0.0167  1216 HOH A O   
1355 O  O   . HOH J .   ? 0.6795 0.5769 0.7413 -0.0493 0.0025  0.0034  1217 HOH A O   
1356 O  O   . HOH J .   ? 0.5823 0.5873 0.6053 -0.0815 -0.0568 -0.0692 1218 HOH A O   
1357 O  O   . HOH J .   ? 0.7050 0.9333 0.7353 -0.0408 0.2399  -0.0085 1219 HOH A O   
1358 O  O   . HOH J .   ? 0.5569 0.7304 0.5808 -0.0380 0.0175  0.0359  1220 HOH A O   
1359 O  O   . HOH J .   ? 0.3876 0.4807 0.4952 0.0942  0.0546  0.0899  1221 HOH A O   
1360 O  O   . HOH J .   ? 0.4606 0.6198 0.3953 -0.1608 -0.0194 -0.1956 1222 HOH A O   
1361 O  O   . HOH J .   ? 0.6053 0.5824 0.5392 0.0056  -0.1204 0.0105  1223 HOH A O   
1362 O  O   . HOH J .   ? 0.6352 0.6766 0.6632 -0.0897 0.0814  0.0627  1224 HOH A O   
1363 O  O   . HOH J .   ? 0.8165 0.9543 0.9371 0.0106  0.0096  -0.0886 1225 HOH A O   
1364 O  O   . HOH J .   ? 0.7595 0.6307 0.4899 -0.2066 0.1708  -0.0974 1226 HOH A O   
1365 O  O   . HOH J .   ? 0.5401 0.5515 0.4653 0.0715  -0.1275 0.0240  1227 HOH A O   
1366 O  O   . HOH J .   ? 0.3668 0.5390 0.4578 0.0156  -0.0224 0.0583  1228 HOH A O   
1367 O  O   . HOH J .   ? 0.6721 0.5054 0.5159 -0.0677 -0.1045 -0.0149 1229 HOH A O   
1368 O  O   . HOH J .   ? 0.3855 0.6070 0.4481 -0.0435 -0.1060 0.0813  1230 HOH A O   
1369 O  O   . HOH J .   ? 0.6152 0.5453 0.4969 0.0034  0.0892  0.1037  1231 HOH A O   
1370 O  O   . HOH J .   ? 0.5015 0.4518 0.5954 0.0694  0.0697  0.0155  1232 HOH A O   
1371 O  O   . HOH J .   ? 0.4644 0.5284 0.4692 0.0000  0.0000  -0.2662 1233 HOH A O   
1372 O  O   . HOH J .   ? 0.8106 0.6296 0.5561 -0.2454 -0.2051 0.0028  1234 HOH A O   
1373 O  O   . HOH J .   ? 0.6017 0.6737 0.5569 -0.0981 0.0058  0.1168  1235 HOH A O   
1374 O  O   . HOH J .   ? 0.6284 0.4405 0.6254 0.0783  -0.1760 0.0774  1236 HOH A O   
1375 O  O   . HOH J .   ? 0.7007 0.6096 0.6569 -0.0620 0.1330  -0.0222 1237 HOH A O   
1376 O  O   . HOH J .   ? 0.4842 0.4324 0.4901 0.0047  0.0344  0.0048  1238 HOH A O   
1377 O  O   . HOH J .   ? 0.7920 0.9187 0.8232 0.0473  -0.1305 0.0111  1239 HOH A O   
1378 O  O   . HOH J .   ? 0.8179 0.3501 0.7037 0.0452  -0.1873 -0.0622 1240 HOH A O   
1379 O  O   . HOH J .   ? 0.6176 0.5688 0.6963 0.1152  0.0217  0.0191  1241 HOH A O   
1380 O  O   . HOH J .   ? 0.3750 0.7694 0.7446 0.0464  0.0657  0.0068  1242 HOH A O   
1381 O  O   . HOH J .   ? 0.9415 0.5250 0.4109 -0.1293 0.0432  -0.1506 1243 HOH A O   
1382 O  O   . HOH J .   ? 0.7584 0.7656 0.5469 0.0039  -0.0390 -0.1470 1244 HOH A O   
1383 O  O   . HOH J .   ? 0.8228 0.7275 0.5483 0.0108  0.1413  -0.0429 1245 HOH A O   
1384 O  O   . HOH J .   ? 0.6504 0.3706 0.4516 0.0378  0.1223  0.0235  1246 HOH A O   
1385 O  O   . HOH J .   ? 0.5788 0.5476 0.7546 0.1188  0.0286  0.1504  1247 HOH A O   
1386 O  O   . HOH J .   ? 0.6993 0.6365 0.6712 -0.0349 -0.2489 -0.0258 1248 HOH A O   
1387 O  O   . HOH J .   ? 0.6019 0.6131 0.6583 0.0503  0.0506  -0.1744 1249 HOH A O   
1388 O  O   . HOH J .   ? 0.7915 0.7480 0.7663 0.0449  -0.1805 0.1236  1250 HOH A O   
1389 O  O   . HOH J .   ? 0.4877 0.7516 0.7182 0.0429  -0.1372 0.2057  1251 HOH A O   
1390 O  O   . HOH J .   ? 0.9412 0.8895 0.7430 -0.1020 -0.0985 -0.0173 1252 HOH A O   
1391 O  O   . HOH J .   ? 0.6501 0.6934 0.8855 0.0454  0.2986  -0.1565 1253 HOH A O   
1392 O  O   . HOH J .   ? 0.4692 0.7007 0.7963 0.0511  -0.1509 -0.1124 1254 HOH A O   
1393 O  O   . HOH J .   ? 0.3535 0.5028 0.4502 -0.0198 -0.0905 0.0117  1255 HOH A O   
1394 O  O   . HOH J .   ? 0.6497 0.6213 0.6654 0.0797  -0.0274 -0.0271 1256 HOH A O   
1395 O  O   . HOH J .   ? 0.7157 0.9666 0.9492 0.0226  0.0637  0.0254  1257 HOH A O   
1396 O  O   . HOH J .   ? 0.5709 0.7984 0.6786 -0.1255 0.2340  -0.1369 1258 HOH A O   
1397 O  O   . HOH J .   ? 0.6759 0.7254 0.4864 -0.1069 -0.0165 0.0458  1259 HOH A O   
1398 O  O   . HOH J .   ? 0.6377 0.7983 0.7429 -0.0073 0.2193  -0.0746 1260 HOH A O   
1399 O  O   . HOH J .   ? 0.8061 0.6902 0.6072 -0.1012 0.0170  0.0549  1261 HOH A O   
1400 O  O   . HOH J .   ? 0.6622 0.6132 0.7058 0.0587  -0.1340 0.0880  1262 HOH A O   
1401 O  O   . HOH J .   ? 0.9111 0.7099 0.7299 -0.0244 -0.2455 0.0184  1263 HOH A O   
1402 O  O   . HOH J .   ? 0.5854 0.5603 0.7261 0.0565  0.2162  -0.1372 1264 HOH A O   
1403 O  O   . HOH J .   ? 1.2265 1.1544 1.1634 0.0002  0.1600  -0.1394 1265 HOH A O   
1404 O  O   . HOH J .   ? 0.4247 0.5981 0.5557 -0.1255 -0.1829 0.0529  1266 HOH A O   
1405 O  O   . HOH J .   ? 1.0155 1.1325 0.8468 -0.0919 -0.1353 0.1116  1267 HOH A O   
1406 O  O   . HOH J .   ? 1.0379 0.8192 0.7269 -0.0427 0.0952  -0.0666 1268 HOH A O   
1407 O  O   . HOH J .   ? 0.5036 0.6435 0.8518 -0.0157 -0.0679 0.2084  1269 HOH A O   
1408 O  O   . HOH J .   ? 0.5248 0.5977 0.7831 0.0305  -0.0295 -0.0523 1270 HOH A O   
1409 O  O   . HOH J .   ? 0.8586 0.8612 0.8838 -0.0159 0.2449  -0.0897 1271 HOH A O   
1410 O  O   . HOH J .   ? 0.7398 0.6658 0.3666 -0.0556 0.0491  0.0352  1272 HOH A O   
1411 O  O   . HOH J .   ? 0.7704 0.6110 0.4815 -0.1877 -0.1193 0.0128  1273 HOH A O   
1412 O  O   . HOH J .   ? 0.8520 0.7988 0.8223 -0.0667 0.0094  -0.1786 1274 HOH A O   
1413 O  O   . HOH J .   ? 0.8342 0.6576 0.4340 0.0577  -0.0247 0.1130  1275 HOH A O   
1414 O  O   . HOH J .   ? 0.8675 0.7745 0.6076 0.0895  -0.0974 0.0079  1276 HOH A O   
1415 O  O   . HOH J .   ? 0.5821 0.5629 0.6041 -0.2121 -0.2031 0.1190  1277 HOH A O   
1416 O  O   . HOH J .   ? 0.7551 0.4967 0.5626 -0.0082 0.0460  -0.0618 1278 HOH A O   
1417 O  O   . HOH J .   ? 0.4966 0.7694 0.6540 0.0977  0.0525  -0.0865 1279 HOH A O   
1418 O  O   . HOH J .   ? 0.6771 0.5764 0.6065 -0.1012 0.1305  0.1024  1280 HOH A O   
1419 O  O   . HOH J .   ? 0.7732 0.9183 0.9359 0.0042  -0.1133 -0.0618 1281 HOH A O   
1420 O  O   . HOH J .   ? 0.7566 0.5461 0.5559 0.0376  -0.0198 0.0664  1282 HOH A O   
1421 O  O   . HOH J .   ? 0.9437 0.8666 0.6861 -0.0934 0.1367  0.0214  1283 HOH A O   
1422 O  O   . HOH J .   ? 0.8802 0.8195 0.6058 -0.1459 -0.0606 0.0556  1284 HOH A O   
1423 O  O   . HOH J .   ? 0.7127 0.5394 0.5858 -0.0908 -0.0275 0.0549  1285 HOH A O   
1424 O  O   . HOH J .   ? 0.7125 0.7574 0.8884 0.1668  -0.0384 0.0932  1286 HOH A O   
1425 O  O   . HOH J .   ? 0.7107 0.7622 0.6236 0.1021  -0.0486 -0.0231 1287 HOH A O   
1426 O  O   . HOH J .   ? 0.5256 0.5816 0.5815 0.1581  -0.0563 -0.0814 1288 HOH A O   
1427 O  O   . HOH J .   ? 1.2312 1.2280 1.2106 -0.0207 -0.0335 0.0321  1289 HOH A O   
1428 O  O   . HOH J .   ? 0.5953 0.4178 0.5881 -0.0339 0.1514  -0.0460 1290 HOH A O   
1429 O  O   . HOH J .   ? 0.7623 0.7805 0.5482 -0.0426 0.2689  -0.2452 1291 HOH A O   
1430 O  O   . HOH J .   ? 0.9147 0.6380 0.6379 -0.0990 0.3713  -0.1010 1292 HOH A O   
1431 O  O   . HOH J .   ? 0.5545 0.6245 0.6520 0.0269  -0.0532 -0.0936 1293 HOH A O   
1432 O  O   . HOH J .   ? 0.8188 0.5505 0.7305 -0.0045 -0.0224 -0.1314 1294 HOH A O   
1433 O  O   . HOH J .   ? 0.8290 0.8255 0.8415 -0.0901 0.0964  0.0428  1295 HOH A O   
1434 O  O   . HOH J .   ? 0.5633 0.6214 0.6318 0.0249  -0.0017 0.0057  1296 HOH A O   
1435 O  O   . HOH J .   ? 0.8912 0.8758 0.9174 0.0137  0.1024  -0.0976 1297 HOH A O   
1436 O  O   . HOH J .   ? 0.5725 0.7285 0.8356 0.1016  0.1839  -0.0752 1298 HOH A O   
1437 O  O   . HOH J .   ? 0.6666 0.5434 0.6407 -0.0757 0.2394  0.0048  1299 HOH A O   
1438 O  O   . HOH J .   ? 0.9187 0.7110 0.9232 0.1118  0.0080  -0.0609 1300 HOH A O   
1439 O  O   . HOH J .   ? 0.8755 0.7329 0.6698 -0.0613 0.0447  0.1270  1301 HOH A O   
1440 O  O   . HOH J .   ? 0.6146 0.5627 0.7923 0.1263  -0.1309 0.0871  1302 HOH A O   
1441 O  O   . HOH J .   ? 0.7325 0.5249 0.6407 0.0120  0.1373  0.0223  1303 HOH A O   
1442 O  O   . HOH J .   ? 0.6960 0.8076 0.8073 0.0132  0.2393  -0.1369 1304 HOH A O   
1443 O  O   . HOH J .   ? 0.9187 0.7332 0.9201 0.0727  -0.0628 0.1015  1305 HOH A O   
1444 O  O   . HOH J .   ? 0.7277 0.8237 0.8341 0.0154  -0.2034 0.1435  1306 HOH A O   
1445 O  O   . HOH J .   ? 0.7161 0.5924 0.7664 0.0166  -0.1125 0.0302  1307 HOH A O   
1446 O  O   . HOH J .   ? 0.6214 0.6352 0.6632 -0.0372 0.1559  -0.0624 1308 HOH A O   
1447 O  O   . HOH J .   ? 0.6685 0.7079 0.5620 -0.1425 0.0399  0.2746  1309 HOH A O   
1448 O  O   . HOH J .   ? 0.9084 0.5814 0.6026 -0.1607 0.1437  0.1349  1310 HOH A O   
1449 O  O   . HOH J .   ? 0.6904 0.8185 0.8673 -0.0119 -0.0066 -0.0823 1311 HOH A O   
1450 O  O   . HOH J .   ? 1.1915 1.0707 1.0180 -0.0483 0.1316  -0.0785 1312 HOH A O   
1451 O  O   . HOH J .   ? 0.5788 0.5422 0.3610 -0.0510 -0.0639 0.0438  1313 HOH A O   
1452 O  O   . HOH J .   ? 0.8621 0.8985 0.9374 -0.0591 0.0533  -0.0667 1314 HOH A O   
1453 O  O   . HOH J .   ? 0.8990 0.4776 0.4084 -0.0550 -0.2734 0.1021  1315 HOH A O   
1454 O  O   . HOH J .   ? 0.9273 0.8782 0.8198 -0.0008 0.1100  0.0219  1316 HOH A O   
1455 O  O   . HOH J .   ? 0.6847 0.6352 0.8191 0.0028  0.0044  0.0475  1317 HOH A O   
1456 O  O   . HOH J .   ? 0.9819 1.0294 1.0221 -0.0398 -0.0392 0.0868  1318 HOH A O   
1457 O  O   . HOH J .   ? 0.6813 0.9087 0.8491 0.0462  0.0161  -0.0736 1319 HOH A O   
1458 O  O   . HOH J .   ? 0.8560 0.7479 0.8732 0.0619  0.0969  -0.2481 1320 HOH A O   
1459 O  O   . HOH J .   ? 1.4087 1.3886 1.4402 0.0211  -0.0386 -0.0216 1321 HOH A O   
1460 O  O   . HOH J .   ? 0.8055 0.6291 0.7205 -0.0097 -0.1361 -0.1383 1322 HOH A O   
1461 O  O   . HOH J .   ? 1.0007 0.8298 0.6486 -0.1578 -0.0089 0.1268  1323 HOH A O   
1462 O  O   . HOH J .   ? 0.9807 0.8515 0.7779 -0.0699 0.1119  -0.1450 1324 HOH A O   
1463 O  O   . HOH J .   ? 1.0417 1.0072 0.7673 -0.0746 0.2276  -0.0750 1325 HOH A O   
1464 O  O   . HOH J .   ? 1.1317 1.0189 1.1611 0.0808  0.0193  -0.0464 1326 HOH A O   
1465 O  O   . HOH J .   ? 0.6908 0.9827 0.9687 0.0458  0.0900  0.1180  1327 HOH A O   
1466 O  O   . HOH J .   ? 0.6014 0.8943 0.9549 0.0960  -0.1570 0.0183  1328 HOH A O   
1467 O  O   . HOH J .   ? 1.1712 1.1076 1.1331 0.0731  0.0248  0.0267  1329 HOH A O   
1468 O  O   . HOH J .   ? 0.9277 0.9400 0.7455 -0.0010 0.3947  -0.1648 1330 HOH A O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   SER 2   2   ?   ?   ?   A . n 
A 1 3   ASN 3   3   3   ASN ASN A . n 
A 1 4   ILE 4   4   4   ILE ILE A . n 
A 1 5   THR 5   5   5   THR THR A . n 
A 1 6   ILE 6   6   6   ILE ILE A . n 
A 1 7   TYR 7   7   7   TYR TYR A . n 
A 1 8   HIS 8   8   8   HIS HIS A . n 
A 1 9   ASN 9   9   9   ASN ASN A . n 
A 1 10  PRO 10  10  10  PRO PRO A . n 
A 1 11  ALA 11  11  11  ALA ALA A . n 
A 1 12  CYS 12  12  12  CYS CYS A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  THR 14  14  14  THR THR A . n 
A 1 15  SER 15  15  15  SER SER A . n 
A 1 16  ARG 16  16  16  ARG ARG A . n 
A 1 17  ASN 17  17  17  ASN ASN A . n 
A 1 18  THR 18  18  18  THR THR A . n 
A 1 19  LEU 19  19  19  LEU LEU A . n 
A 1 20  GLU 20  20  20  GLU GLU A . n 
A 1 21  MET 21  21  21  MET MET A . n 
A 1 22  ILE 22  22  22  ILE ILE A . n 
A 1 23  ARG 23  23  23  ARG ARG A . n 
A 1 24  ASN 24  24  24  ASN ASN A . n 
A 1 25  SER 25  25  25  SER SER A . n 
A 1 26  GLY 26  26  26  GLY GLY A . n 
A 1 27  THR 27  27  27  THR THR A . n 
A 1 28  GLU 28  28  28  GLU GLU A . n 
A 1 29  PRO 29  29  29  PRO PRO A . n 
A 1 30  THR 30  30  30  THR THR A . n 
A 1 31  ILE 31  31  31  ILE ILE A . n 
A 1 32  ILE 32  32  32  ILE ILE A . n 
A 1 33  LEU 33  33  33  LEU LEU A . n 
A 1 34  TYR 34  34  34  TYR TYR A . n 
A 1 35  LEU 35  35  35  LEU LEU A . n 
A 1 36  GLU 36  36  36  GLU GLU A . n 
A 1 37  ASN 37  37  37  ASN ASN A . n 
A 1 38  PRO 38  38  38  PRO PRO A . n 
A 1 39  PRO 39  39  39  PRO PRO A . n 
A 1 40  SER 40  40  40  SER SER A . n 
A 1 41  ARG 41  41  41  ARG ARG A . n 
A 1 42  ASP 42  42  42  ASP ASP A . n 
A 1 43  GLU 43  43  43  GLU GLU A . n 
A 1 44  LEU 44  44  44  LEU LEU A . n 
A 1 45  VAL 45  45  45  VAL VAL A . n 
A 1 46  LYS 46  46  46  LYS LYS A . n 
A 1 47  LEU 47  47  47  LEU LEU A . n 
A 1 48  ILE 48  48  48  ILE ILE A . n 
A 1 49  ALA 49  49  49  ALA ALA A . n 
A 1 50  ASP 50  50  50  ASP ASP A . n 
A 1 51  MET 51  51  51  MET MET A . n 
A 1 52  GLY 52  52  52  GLY GLY A . n 
A 1 53  ILE 53  53  53  ILE ILE A . n 
A 1 54  SER 54  54  54  SER SER A . n 
A 1 55  VAL 55  55  55  VAL VAL A . n 
A 1 56  ARG 56  56  56  ARG ARG A . n 
A 1 57  ALA 57  57  57  ALA ALA A . n 
A 1 58  LEU 58  58  58  LEU LEU A . n 
A 1 59  LEU 59  59  59  LEU LEU A . n 
A 1 60  LYS 60  60  60  LYS LYS A . n 
A 1 61  LYS 61  61  61  LYS LYS A . n 
A 1 62  ASN 62  62  62  ASN ASN A . n 
A 1 63  VAL 63  63  63  VAL VAL A . n 
A 1 64  GLU 64  64  64  GLU GLU A . n 
A 1 65  PRO 65  65  65  PRO PRO A . n 
A 1 66  TYR 66  66  66  TYR TYR A . n 
A 1 67  GLU 67  67  67  GLU GLU A . n 
A 1 68  GLN 68  68  68  GLN GLN A . n 
A 1 69  LEU 69  69  69  LEU LEU A . n 
A 1 70  GLY 70  70  70  GLY GLY A . n 
A 1 71  LEU 71  71  71  LEU LEU A . n 
A 1 72  ALA 72  72  72  ALA ALA A . n 
A 1 73  GLU 73  73  73  GLU GLU A . n 
A 1 74  ASP 74  74  74  ASP ASP A . n 
A 1 75  LYS 75  75  75  LYS LYS A . n 
A 1 76  PHE 76  76  76  PHE PHE A . n 
A 1 77  THR 77  77  77  THR THR A . n 
A 1 78  ASP 78  78  78  ASP ASP A . n 
A 1 79  ASP 79  79  79  ASP ASP A . n 
A 1 80  GLN 80  80  80  GLN GLN A . n 
A 1 81  LEU 81  81  81  LEU LEU A . n 
A 1 82  ILE 82  82  82  ILE ILE A . n 
A 1 83  ASP 83  83  83  ASP ASP A . n 
A 1 84  PHE 84  84  84  PHE PHE A . n 
A 1 85  MET 85  85  85  MET MET A . n 
A 1 86  LEU 86  86  86  LEU LEU A . n 
A 1 87  GLN 87  87  87  GLN GLN A . n 
A 1 88  HIS 88  88  88  HIS HIS A . n 
A 1 89  PRO 89  89  89  PRO PRO A . n 
A 1 90  ILE 90  90  90  ILE ILE A . n 
A 1 91  LEU 91  91  91  LEU LEU A . n 
A 1 92  ILE 92  92  92  ILE ILE A . n 
A 1 93  ASN 93  93  93  ASN ASN A . n 
A 1 94  ARG 94  94  94  ARG ARG A . n 
A 1 95  PRO 95  95  95  PRO PRO A . n 
A 1 96  ILE 96  96  96  ILE ILE A . n 
A 1 97  VAL 97  97  97  VAL VAL A . n 
A 1 98  VAL 98  98  98  VAL VAL A . n 
A 1 99  THR 99  99  99  THR THR A . n 
A 1 100 PRO 100 100 100 PRO PRO A . n 
A 1 101 LEU 101 101 101 LEU LEU A . n 
A 1 102 GLY 102 102 102 GLY GLY A . n 
A 1 103 THR 103 103 103 THR THR A . n 
A 1 104 ARG 104 104 104 ARG ARG A . n 
A 1 105 LEU 105 105 105 LEU LEU A . n 
A 1 106 CYS 106 106 106 CYS CYS A . n 
A 1 107 ARG 107 107 107 ARG ARG A . n 
A 1 108 PRO 108 108 108 PRO PRO A . n 
A 1 109 SER 109 109 109 SER SER A . n 
A 1 110 GLU 110 110 110 GLU GLU A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 VAL 112 112 112 VAL VAL A . n 
A 1 113 LEU 113 113 113 LEU LEU A . n 
A 1 114 ASP 114 114 114 ASP ASP A . n 
A 1 115 ILE 115 115 115 ILE ILE A . n 
A 1 116 LEU 116 116 116 LEU LEU A . n 
A 1 117 GLN 117 117 117 GLN GLN A . n 
A 1 118 ASP 118 118 118 ASP ASP A . n 
A 1 119 ALA 119 119 119 ALA ALA A . n 
A 1 120 GLN 120 120 120 GLN GLN A . n 
A 1 121 LYS 121 121 121 LYS LYS A . n 
A 1 122 GLY 122 122 122 GLY GLY A . n 
A 1 123 ALA 123 123 123 ALA ALA A . n 
A 1 124 PHE 124 124 124 PHE PHE A . n 
A 1 125 THR 125 125 125 THR THR A . n 
A 1 126 LYS 126 126 126 LYS LYS A . n 
A 1 127 GLU 127 127 127 GLU GLU A . n 
A 1 128 ASP 128 128 128 ASP ASP A . n 
A 1 129 GLY 129 129 129 GLY GLY A . n 
A 1 130 GLU 130 130 130 GLU GLU A . n 
A 1 131 LYS 131 131 131 LYS LYS A . n 
A 1 132 VAL 132 132 132 VAL VAL A . n 
A 1 133 VAL 133 133 133 VAL VAL A . n 
A 1 134 ASP 134 134 134 ASP ASP A . n 
A 1 135 GLU 135 135 135 GLU GLU A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 GLY 137 137 137 GLY GLY A . n 
A 1 138 LYS 138 138 138 LYS LYS A . n 
A 1 139 ARG 139 139 139 ARG ARG A . n 
A 1 140 LEU 140 140 140 LEU LEU A . n 
A 1 141 LYS 141 141 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 SO4 1   201  201  SO4 SO4 A . 
C 2 SO4 1   202  202  SO4 SO4 A . 
D 2 SO4 1   203  203  SO4 SO4 A . 
E 3 CS  1   404  404  CS  CS  A . 
F 3 CS  1   401  401  CS  CS  A . 
G 3 CS  1   402  402  CS  CS  A . 
H 3 CS  1   403  403  CS  CS  A . 
I 3 CS  1   405  405  CS  CS  A . 
J 4 HOH 1   1001 1001 HOH HOH A . 
J 4 HOH 2   1002 1002 HOH HOH A . 
J 4 HOH 3   1003 1003 HOH HOH A . 
J 4 HOH 4   1004 1004 HOH HOH A . 
J 4 HOH 5   1005 1005 HOH HOH A . 
J 4 HOH 6   1006 1006 HOH HOH A . 
J 4 HOH 7   1007 1007 HOH HOH A . 
J 4 HOH 8   1008 1008 HOH HOH A . 
J 4 HOH 9   1009 22   HOH HOH A . 
J 4 HOH 10  1010 1010 HOH HOH A . 
J 4 HOH 11  1011 1011 HOH HOH A . 
J 4 HOH 12  1012 1012 HOH HOH A . 
J 4 HOH 13  1013 1013 HOH HOH A . 
J 4 HOH 14  1014 1014 HOH HOH A . 
J 4 HOH 15  1015 1015 HOH HOH A . 
J 4 HOH 16  1016 14   HOH HOH A . 
J 4 HOH 17  1017 1017 HOH HOH A . 
J 4 HOH 18  1018 1018 HOH HOH A . 
J 4 HOH 19  1019 1019 HOH HOH A . 
J 4 HOH 20  1020 1020 HOH HOH A . 
J 4 HOH 21  1021 1021 HOH HOH A . 
J 4 HOH 22  1022 1022 HOH HOH A . 
J 4 HOH 23  1023 1023 HOH HOH A . 
J 4 HOH 24  1024 1024 HOH HOH A . 
J 4 HOH 25  1025 1025 HOH HOH A . 
J 4 HOH 26  1026 1026 HOH HOH A . 
J 4 HOH 27  1027 1027 HOH HOH A . 
J 4 HOH 28  1028 1028 HOH HOH A . 
J 4 HOH 29  1029 1029 HOH HOH A . 
J 4 HOH 30  1030 1030 HOH HOH A . 
J 4 HOH 31  1031 1031 HOH HOH A . 
J 4 HOH 32  1032 1032 HOH HOH A . 
J 4 HOH 33  1033 1033 HOH HOH A . 
J 4 HOH 34  1034 1034 HOH HOH A . 
J 4 HOH 35  1035 1035 HOH HOH A . 
J 4 HOH 36  1036 17   HOH HOH A . 
J 4 HOH 37  1037 1037 HOH HOH A . 
J 4 HOH 38  1038 1038 HOH HOH A . 
J 4 HOH 39  1039 1039 HOH HOH A . 
J 4 HOH 40  1040 1040 HOH HOH A . 
J 4 HOH 41  1041 1041 HOH HOH A . 
J 4 HOH 42  1042 1042 HOH HOH A . 
J 4 HOH 43  1043 1043 HOH HOH A . 
J 4 HOH 44  1044 1044 HOH HOH A . 
J 4 HOH 45  1045 1045 HOH HOH A . 
J 4 HOH 46  1046 1046 HOH HOH A . 
J 4 HOH 47  1047 1047 HOH HOH A . 
J 4 HOH 48  1048 1048 HOH HOH A . 
J 4 HOH 49  1049 1049 HOH HOH A . 
J 4 HOH 50  1050 45   HOH HOH A . 
J 4 HOH 51  1051 1051 HOH HOH A . 
J 4 HOH 52  1052 78   HOH HOH A . 
J 4 HOH 53  1053 1053 HOH HOH A . 
J 4 HOH 54  1054 1054 HOH HOH A . 
J 4 HOH 55  1055 1055 HOH HOH A . 
J 4 HOH 56  1056 1056 HOH HOH A . 
J 4 HOH 57  1057 1057 HOH HOH A . 
J 4 HOH 58  1058 1058 HOH HOH A . 
J 4 HOH 59  1059 1059 HOH HOH A . 
J 4 HOH 60  1060 1060 HOH HOH A . 
J 4 HOH 61  1061 1061 HOH HOH A . 
J 4 HOH 62  1062 1062 HOH HOH A . 
J 4 HOH 63  1063 1063 HOH HOH A . 
J 4 HOH 64  1064 1064 HOH HOH A . 
J 4 HOH 65  1065 1065 HOH HOH A . 
J 4 HOH 66  1066 58   HOH HOH A . 
J 4 HOH 67  1067 1067 HOH HOH A . 
J 4 HOH 68  1068 1068 HOH HOH A . 
J 4 HOH 69  1069 1069 HOH HOH A . 
J 4 HOH 70  1070 1070 HOH HOH A . 
J 4 HOH 71  1071 1071 HOH HOH A . 
J 4 HOH 72  1072 1072 HOH HOH A . 
J 4 HOH 73  1073 65   HOH HOH A . 
J 4 HOH 74  1074 1074 HOH HOH A . 
J 4 HOH 75  1075 1075 HOH HOH A . 
J 4 HOH 76  1076 1076 HOH HOH A . 
J 4 HOH 77  1077 1077 HOH HOH A . 
J 4 HOH 78  1078 1078 HOH HOH A . 
J 4 HOH 79  1079 1079 HOH HOH A . 
J 4 HOH 80  1080 1080 HOH HOH A . 
J 4 HOH 81  1081 1081 HOH HOH A . 
J 4 HOH 82  1082 1082 HOH HOH A . 
J 4 HOH 83  1083 1083 HOH HOH A . 
J 4 HOH 84  1084 62   HOH HOH A . 
J 4 HOH 85  1085 1085 HOH HOH A . 
J 4 HOH 86  1086 1086 HOH HOH A . 
J 4 HOH 87  1087 1087 HOH HOH A . 
J 4 HOH 88  1088 1088 HOH HOH A . 
J 4 HOH 89  1089 1089 HOH HOH A . 
J 4 HOH 90  1090 1090 HOH HOH A . 
J 4 HOH 91  1091 1091 HOH HOH A . 
J 4 HOH 92  1092 1092 HOH HOH A . 
J 4 HOH 93  1093 1093 HOH HOH A . 
J 4 HOH 94  1094 1094 HOH HOH A . 
J 4 HOH 95  1095 1095 HOH HOH A . 
J 4 HOH 96  1096 1096 HOH HOH A . 
J 4 HOH 97  1097 1097 HOH HOH A . 
J 4 HOH 98  1098 1098 HOH HOH A . 
J 4 HOH 99  1099 1099 HOH HOH A . 
J 4 HOH 100 1100 1100 HOH HOH A . 
J 4 HOH 101 1101 1101 HOH HOH A . 
J 4 HOH 102 1102 1102 HOH HOH A . 
J 4 HOH 103 1103 1103 HOH HOH A . 
J 4 HOH 104 1104 1104 HOH HOH A . 
J 4 HOH 105 1105 1105 HOH HOH A . 
J 4 HOH 106 1106 1106 HOH HOH A . 
J 4 HOH 107 1107 1107 HOH HOH A . 
J 4 HOH 108 1108 1108 HOH HOH A . 
J 4 HOH 109 1109 1109 HOH HOH A . 
J 4 HOH 110 1110 1110 HOH HOH A . 
J 4 HOH 111 1111 1111 HOH HOH A . 
J 4 HOH 112 1112 1112 HOH HOH A . 
J 4 HOH 113 1113 1113 HOH HOH A . 
J 4 HOH 114 1114 1114 HOH HOH A . 
J 4 HOH 115 1115 1115 HOH HOH A . 
J 4 HOH 116 1116 1116 HOH HOH A . 
J 4 HOH 117 1117 1117 HOH HOH A . 
J 4 HOH 118 1118 1118 HOH HOH A . 
J 4 HOH 119 1119 1119 HOH HOH A . 
J 4 HOH 120 1120 1120 HOH HOH A . 
J 4 HOH 121 1121 1121 HOH HOH A . 
J 4 HOH 122 1122 1122 HOH HOH A . 
J 4 HOH 123 1123 1123 HOH HOH A . 
J 4 HOH 124 1124 1124 HOH HOH A . 
J 4 HOH 125 1125 1125 HOH HOH A . 
J 4 HOH 126 1126 1126 HOH HOH A . 
J 4 HOH 127 1127 1127 HOH HOH A . 
J 4 HOH 128 1128 1128 HOH HOH A . 
J 4 HOH 129 1129 116  HOH HOH A . 
J 4 HOH 130 1130 1130 HOH HOH A . 
J 4 HOH 131 1131 1131 HOH HOH A . 
J 4 HOH 132 1132 1132 HOH HOH A . 
J 4 HOH 133 1133 1133 HOH HOH A . 
J 4 HOH 134 1134 1134 HOH HOH A . 
J 4 HOH 135 1135 1135 HOH HOH A . 
J 4 HOH 136 1136 1136 HOH HOH A . 
J 4 HOH 137 1137 1137 HOH HOH A . 
J 4 HOH 138 1138 1138 HOH HOH A . 
J 4 HOH 139 1139 1139 HOH HOH A . 
J 4 HOH 140 1140 1140 HOH HOH A . 
J 4 HOH 141 1141 1141 HOH HOH A . 
J 4 HOH 142 1142 1142 HOH HOH A . 
J 4 HOH 143 1143 1143 HOH HOH A . 
J 4 HOH 144 1144 1144 HOH HOH A . 
J 4 HOH 145 1145 1145 HOH HOH A . 
J 4 HOH 146 1146 156  HOH HOH A . 
J 4 HOH 147 1147 1147 HOH HOH A . 
J 4 HOH 148 1148 1148 HOH HOH A . 
J 4 HOH 149 1149 1149 HOH HOH A . 
J 4 HOH 150 1150 1150 HOH HOH A . 
J 4 HOH 151 1151 1151 HOH HOH A . 
J 4 HOH 152 1152 1152 HOH HOH A . 
J 4 HOH 153 1153 1153 HOH HOH A . 
J 4 HOH 154 1154 1154 HOH HOH A . 
J 4 HOH 155 1155 1155 HOH HOH A . 
J 4 HOH 156 1156 1156 HOH HOH A . 
J 4 HOH 157 1157 1157 HOH HOH A . 
J 4 HOH 158 1158 1158 HOH HOH A . 
J 4 HOH 159 1159 1159 HOH HOH A . 
J 4 HOH 160 1160 1160 HOH HOH A . 
J 4 HOH 161 1161 211  HOH HOH A . 
J 4 HOH 162 1162 1162 HOH HOH A . 
J 4 HOH 163 1163 1163 HOH HOH A . 
J 4 HOH 164 1164 1164 HOH HOH A . 
J 4 HOH 165 1165 1165 HOH HOH A . 
J 4 HOH 166 1166 1166 HOH HOH A . 
J 4 HOH 167 1167 1167 HOH HOH A . 
J 4 HOH 168 1168 1168 HOH HOH A . 
J 4 HOH 169 1169 1169 HOH HOH A . 
J 4 HOH 170 1170 1170 HOH HOH A . 
J 4 HOH 171 1171 1171 HOH HOH A . 
J 4 HOH 172 1172 175  HOH HOH A . 
J 4 HOH 173 1173 1173 HOH HOH A . 
J 4 HOH 174 1174 1174 HOH HOH A . 
J 4 HOH 175 1175 1175 HOH HOH A . 
J 4 HOH 176 1176 1176 HOH HOH A . 
J 4 HOH 177 1177 1177 HOH HOH A . 
J 4 HOH 178 1178 1178 HOH HOH A . 
J 4 HOH 179 1179 1179 HOH HOH A . 
J 4 HOH 180 1180 1180 HOH HOH A . 
J 4 HOH 181 1181 1181 HOH HOH A . 
J 4 HOH 182 1182 1182 HOH HOH A . 
J 4 HOH 183 1183 1183 HOH HOH A . 
J 4 HOH 184 1184 1184 HOH HOH A . 
J 4 HOH 185 1185 1185 HOH HOH A . 
J 4 HOH 186 1186 1186 HOH HOH A . 
J 4 HOH 187 1187 1187 HOH HOH A . 
J 4 HOH 188 1188 1188 HOH HOH A . 
J 4 HOH 189 1189 1189 HOH HOH A . 
J 4 HOH 190 1190 1190 HOH HOH A . 
J 4 HOH 191 1191 1191 HOH HOH A . 
J 4 HOH 192 1192 1192 HOH HOH A . 
J 4 HOH 193 1193 1193 HOH HOH A . 
J 4 HOH 194 1194 1194 HOH HOH A . 
J 4 HOH 195 1195 1195 HOH HOH A . 
J 4 HOH 196 1196 1196 HOH HOH A . 
J 4 HOH 197 1197 1197 HOH HOH A . 
J 4 HOH 198 1198 1198 HOH HOH A . 
J 4 HOH 199 1199 1199 HOH HOH A . 
J 4 HOH 200 1200 1200 HOH HOH A . 
J 4 HOH 201 1201 1201 HOH HOH A . 
J 4 HOH 202 1202 1202 HOH HOH A . 
J 4 HOH 203 1203 1203 HOH HOH A . 
J 4 HOH 204 1204 1204 HOH HOH A . 
J 4 HOH 205 1205 1205 HOH HOH A . 
J 4 HOH 206 1206 1206 HOH HOH A . 
J 4 HOH 207 1207 1207 HOH HOH A . 
J 4 HOH 208 1208 1208 HOH HOH A . 
J 4 HOH 209 1209 1209 HOH HOH A . 
J 4 HOH 210 1210 1210 HOH HOH A . 
J 4 HOH 211 1211 1211 HOH HOH A . 
J 4 HOH 212 1212 1212 HOH HOH A . 
J 4 HOH 213 1213 1213 HOH HOH A . 
J 4 HOH 214 1214 1214 HOH HOH A . 
J 4 HOH 215 1215 1215 HOH HOH A . 
J 4 HOH 216 1216 1216 HOH HOH A . 
J 4 HOH 217 1217 1217 HOH HOH A . 
J 4 HOH 218 1218 1218 HOH HOH A . 
J 4 HOH 219 1219 1219 HOH HOH A . 
J 4 HOH 220 1220 1220 HOH HOH A . 
J 4 HOH 221 1221 1221 HOH HOH A . 
J 4 HOH 222 1222 1222 HOH HOH A . 
J 4 HOH 223 1223 1223 HOH HOH A . 
J 4 HOH 224 1224 1224 HOH HOH A . 
J 4 HOH 225 1225 1225 HOH HOH A . 
J 4 HOH 226 1226 1226 HOH HOH A . 
J 4 HOH 227 1227 1227 HOH HOH A . 
J 4 HOH 228 1228 1228 HOH HOH A . 
J 4 HOH 229 1229 1229 HOH HOH A . 
J 4 HOH 230 1230 182  HOH HOH A . 
J 4 HOH 231 1231 1231 HOH HOH A . 
J 4 HOH 232 1232 1232 HOH HOH A . 
J 4 HOH 233 1233 1233 HOH HOH A . 
J 4 HOH 234 1234 1234 HOH HOH A . 
J 4 HOH 235 1235 1235 HOH HOH A . 
J 4 HOH 236 1236 1236 HOH HOH A . 
J 4 HOH 237 1237 1237 HOH HOH A . 
J 4 HOH 238 1238 1238 HOH HOH A . 
J 4 HOH 239 1239 1239 HOH HOH A . 
J 4 HOH 240 1240 1240 HOH HOH A . 
J 4 HOH 241 1241 1241 HOH HOH A . 
J 4 HOH 242 1242 1242 HOH HOH A . 
J 4 HOH 243 1243 1243 HOH HOH A . 
J 4 HOH 244 1244 1244 HOH HOH A . 
J 4 HOH 245 1245 1245 HOH HOH A . 
J 4 HOH 246 1246 1246 HOH HOH A . 
J 4 HOH 247 1247 1247 HOH HOH A . 
J 4 HOH 248 1248 1248 HOH HOH A . 
J 4 HOH 249 1249 1249 HOH HOH A . 
J 4 HOH 250 1250 1250 HOH HOH A . 
J 4 HOH 251 1251 1251 HOH HOH A . 
J 4 HOH 252 1252 1252 HOH HOH A . 
J 4 HOH 253 1253 1253 HOH HOH A . 
J 4 HOH 254 1254 1254 HOH HOH A . 
J 4 HOH 255 1255 1255 HOH HOH A . 
J 4 HOH 256 1256 1256 HOH HOH A . 
J 4 HOH 257 1257 1257 HOH HOH A . 
J 4 HOH 258 1258 1258 HOH HOH A . 
J 4 HOH 259 1259 1259 HOH HOH A . 
J 4 HOH 260 1260 1260 HOH HOH A . 
J 4 HOH 261 1261 1261 HOH HOH A . 
J 4 HOH 262 1262 1262 HOH HOH A . 
J 4 HOH 263 1263 1263 HOH HOH A . 
J 4 HOH 264 1264 1264 HOH HOH A . 
J 4 HOH 265 1265 1265 HOH HOH A . 
J 4 HOH 266 1266 1266 HOH HOH A . 
J 4 HOH 267 1267 1267 HOH HOH A . 
J 4 HOH 268 1268 1268 HOH HOH A . 
J 4 HOH 269 1269 233  HOH HOH A . 
J 4 HOH 270 1270 1270 HOH HOH A . 
J 4 HOH 271 1271 1271 HOH HOH A . 
J 4 HOH 272 1272 1272 HOH HOH A . 
J 4 HOH 273 1273 1273 HOH HOH A . 
J 4 HOH 274 1274 1274 HOH HOH A . 
J 4 HOH 275 1275 1275 HOH HOH A . 
J 4 HOH 276 1276 1276 HOH HOH A . 
J 4 HOH 277 1277 1277 HOH HOH A . 
J 4 HOH 278 1278 1278 HOH HOH A . 
J 4 HOH 279 1279 1279 HOH HOH A . 
J 4 HOH 280 1280 1280 HOH HOH A . 
J 4 HOH 281 1281 1281 HOH HOH A . 
J 4 HOH 282 1282 1282 HOH HOH A . 
J 4 HOH 283 1283 1283 HOH HOH A . 
J 4 HOH 284 1284 1284 HOH HOH A . 
J 4 HOH 285 1285 1285 HOH HOH A . 
J 4 HOH 286 1286 1286 HOH HOH A . 
J 4 HOH 287 1287 1288 HOH HOH A . 
J 4 HOH 288 1288 1289 HOH HOH A . 
J 4 HOH 289 1289 1290 HOH HOH A . 
J 4 HOH 290 1290 1292 HOH HOH A . 
J 4 HOH 291 1291 1293 HOH HOH A . 
J 4 HOH 292 1292 1294 HOH HOH A . 
J 4 HOH 293 1293 1295 HOH HOH A . 
J 4 HOH 294 1294 1296 HOH HOH A . 
J 4 HOH 295 1295 1297 HOH HOH A . 
J 4 HOH 296 1296 1298 HOH HOH A . 
J 4 HOH 297 1297 1299 HOH HOH A . 
J 4 HOH 298 1298 1300 HOH HOH A . 
J 4 HOH 299 1299 1301 HOH HOH A . 
J 4 HOH 300 1300 1302 HOH HOH A . 
J 4 HOH 301 1301 1303 HOH HOH A . 
J 4 HOH 302 1302 1304 HOH HOH A . 
J 4 HOH 303 1303 1305 HOH HOH A . 
J 4 HOH 304 1304 1306 HOH HOH A . 
J 4 HOH 305 1305 1307 HOH HOH A . 
J 4 HOH 306 1306 1308 HOH HOH A . 
J 4 HOH 307 1307 1309 HOH HOH A . 
J 4 HOH 308 1308 1310 HOH HOH A . 
J 4 HOH 309 1309 1311 HOH HOH A . 
J 4 HOH 310 1310 1312 HOH HOH A . 
J 4 HOH 311 1311 1313 HOH HOH A . 
J 4 HOH 312 1312 1314 HOH HOH A . 
J 4 HOH 313 1313 1316 HOH HOH A . 
J 4 HOH 314 1314 1317 HOH HOH A . 
J 4 HOH 315 1315 1318 HOH HOH A . 
J 4 HOH 316 1316 1319 HOH HOH A . 
J 4 HOH 317 1317 1320 HOH HOH A . 
J 4 HOH 318 1318 1321 HOH HOH A . 
J 4 HOH 319 1319 1322 HOH HOH A . 
J 4 HOH 320 1320 1323 HOH HOH A . 
J 4 HOH 321 1321 1324 HOH HOH A . 
J 4 HOH 322 1322 1325 HOH HOH A . 
J 4 HOH 323 1323 1326 HOH HOH A . 
J 4 HOH 324 1324 1327 HOH HOH A . 
J 4 HOH 325 1325 1328 HOH HOH A . 
J 4 HOH 326 1326 1329 HOH HOH A . 
J 4 HOH 327 1327 1330 HOH HOH A . 
J 4 HOH 328 1328 1331 HOH HOH A . 
J 4 HOH 329 1329 1332 HOH HOH A . 
J 4 HOH 330 1330 1333 HOH HOH A . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PQS  monomeric 1 
2 software_defined_assembly            PISA dimeric   2 
3 software_defined_assembly            PISA dimeric   2 
4 software_defined_assembly            PISA dimeric   2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1   A,B,C,D,E,F,G,H,I,J 
2 1,2 A,B,C,D,E,F,G,H,I,J 
3 1,3 A,B,C,D,E,F,G,H,I,J 
4 1,4 A,B,C,D,E,F,G,H,I,J 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
2 'ABSA (A^2)' 3670  ? 
2 MORE         -273  ? 
2 'SSA (A^2)'  13930 ? 
3 'ABSA (A^2)' 3420  ? 
3 MORE         -255  ? 
3 'SSA (A^2)'  13960 ? 
4 'ABSA (A^2)' 2850  ? 
4 MORE         -242  ? 
4 'SSA (A^2)'  14540 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555  x,y,z            1.0000000000 0.0000000000  0.0000000000 0.0000000000   0.0000000000  
1.0000000000  0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 10_665 -y+1,-x+1,-z+5/6 0.5000000000 -0.8660254038 0.0000000000 43.3000000000  -0.8660254038 
-0.5000000000 0.0000000000 74.9977999677  0.0000000000 0.0000000000 -1.0000000000 96.6916666667  
3 'crystal symmetry operation' 12_566 x,x-y+1,-z+7/6   0.5000000000 0.8660254038  0.0000000000 -43.3000000000 0.8660254038  
-0.5000000000 0.0000000000 74.9977999677  0.0000000000 0.0000000000 -1.0000000000 135.3683333333 
4 'crystal symmetry operation' 8_676  x-y+1,-y+2,-z+1  1.0000000000 0.0000000000  0.0000000000 0.0000000000   0.0000000000  
-1.0000000000 0.0000000000 149.9955999355 0.0000000000 0.0000000000 -1.0000000000 116.0300000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A CS  401  ? F CS  . 
2 1 A HOH 1233 ? J HOH . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? A ASP 114 ? A ASP 114  ? 1_555  CS ? F CS . ? A CS 401 ? 1_555 O   ? A LEU 113 ? A LEU 113  ? 1_555  67.5  ? 
2  O   ? A ASP 114 ? A ASP 114  ? 1_555  CS ? F CS . ? A CS 401 ? 1_555 O   ? A LEU 116 ? A LEU 116  ? 1_555  95.0  ? 
3  O   ? A LEU 113 ? A LEU 113  ? 1_555  CS ? F CS . ? A CS 401 ? 1_555 O   ? A LEU 116 ? A LEU 116  ? 1_555  76.8  ? 
4  O   ? A ASP 114 ? A ASP 114  ? 1_555  CS ? F CS . ? A CS 401 ? 1_555 O   ? J HOH .   ? A HOH 1037 ? 1_555  140.2 ? 
5  O   ? A LEU 113 ? A LEU 113  ? 1_555  CS ? F CS . ? A CS 401 ? 1_555 O   ? J HOH .   ? A HOH 1037 ? 1_555  84.2  ? 
6  O   ? A LEU 116 ? A LEU 116  ? 1_555  CS ? F CS . ? A CS 401 ? 1_555 O   ? J HOH .   ? A HOH 1037 ? 1_555  50.0  ? 
7  O   ? A ASP 114 ? A ASP 114  ? 1_555  CS ? F CS . ? A CS 401 ? 1_555 O   ? A LEU 116 ? A LEU 116  ? 10_665 149.4 ? 
8  O   ? A LEU 113 ? A LEU 113  ? 1_555  CS ? F CS . ? A CS 401 ? 1_555 O   ? A LEU 116 ? A LEU 116  ? 10_665 133.3 ? 
9  O   ? A LEU 116 ? A LEU 116  ? 1_555  CS ? F CS . ? A CS 401 ? 1_555 O   ? A LEU 116 ? A LEU 116  ? 10_665 110.6 ? 
10 O   ? J HOH .   ? A HOH 1037 ? 1_555  CS ? F CS . ? A CS 401 ? 1_555 O   ? A LEU 116 ? A LEU 116  ? 10_665 70.2  ? 
11 O   ? A ASP 114 ? A ASP 114  ? 1_555  CS ? F CS . ? A CS 401 ? 1_555 O   ? A LEU 113 ? A LEU 113  ? 10_665 73.4  ? 
12 O   ? A LEU 113 ? A LEU 113  ? 1_555  CS ? F CS . ? A CS 401 ? 1_555 O   ? A LEU 113 ? A LEU 113  ? 10_665 132.7 ? 
13 O   ? A LEU 116 ? A LEU 116  ? 1_555  CS ? F CS . ? A CS 401 ? 1_555 O   ? A LEU 113 ? A LEU 113  ? 10_665 133.3 ? 
14 O   ? J HOH .   ? A HOH 1037 ? 1_555  CS ? F CS . ? A CS 401 ? 1_555 O   ? A LEU 113 ? A LEU 113  ? 10_665 142.4 ? 
15 O   ? A LEU 116 ? A LEU 116  ? 10_665 CS ? F CS . ? A CS 401 ? 1_555 O   ? A LEU 113 ? A LEU 113  ? 10_665 76.8  ? 
16 O   ? A ASP 114 ? A ASP 114  ? 1_555  CS ? F CS . ? A CS 401 ? 1_555 O   ? A ASP 114 ? A ASP 114  ? 10_665 67.3  ? 
17 O   ? A LEU 113 ? A LEU 113  ? 1_555  CS ? F CS . ? A CS 401 ? 1_555 O   ? A ASP 114 ? A ASP 114  ? 10_665 73.4  ? 
18 O   ? A LEU 116 ? A LEU 116  ? 1_555  CS ? F CS . ? A CS 401 ? 1_555 O   ? A ASP 114 ? A ASP 114  ? 10_665 149.4 ? 
19 O   ? J HOH .   ? A HOH 1037 ? 1_555  CS ? F CS . ? A CS 401 ? 1_555 O   ? A ASP 114 ? A ASP 114  ? 10_665 131.8 ? 
20 O   ? A LEU 116 ? A LEU 116  ? 10_665 CS ? F CS . ? A CS 401 ? 1_555 O   ? A ASP 114 ? A ASP 114  ? 10_665 95.0  ? 
21 O   ? A LEU 113 ? A LEU 113  ? 10_665 CS ? F CS . ? A CS 401 ? 1_555 O   ? A ASP 114 ? A ASP 114  ? 10_665 67.5  ? 
22 O   ? A ASP 114 ? A ASP 114  ? 1_555  CS ? F CS . ? A CS 401 ? 1_555 O   ? J HOH .   ? A HOH 1037 ? 10_665 131.7 ? 
23 O   ? A LEU 113 ? A LEU 113  ? 1_555  CS ? F CS . ? A CS 401 ? 1_555 O   ? J HOH .   ? A HOH 1037 ? 10_665 142.4 ? 
24 O   ? A LEU 116 ? A LEU 116  ? 1_555  CS ? F CS . ? A CS 401 ? 1_555 O   ? J HOH .   ? A HOH 1037 ? 10_665 70.2  ? 
25 O   ? J HOH .   ? A HOH 1037 ? 1_555  CS ? F CS . ? A CS 401 ? 1_555 O   ? J HOH .   ? A HOH 1037 ? 10_665 61.0  ? 
26 O   ? A LEU 116 ? A LEU 116  ? 10_665 CS ? F CS . ? A CS 401 ? 1_555 O   ? J HOH .   ? A HOH 1037 ? 10_665 50.0  ? 
27 O   ? A LEU 113 ? A LEU 113  ? 10_665 CS ? F CS . ? A CS 401 ? 1_555 O   ? J HOH .   ? A HOH 1037 ? 10_665 84.2  ? 
28 O   ? A ASP 114 ? A ASP 114  ? 10_665 CS ? F CS . ? A CS 401 ? 1_555 O   ? J HOH .   ? A HOH 1037 ? 10_665 140.2 ? 
29 OD2 ? A ASP 128 ? A ASP 128  ? 1_555  CS ? G CS . ? A CS 402 ? 1_555 O   ? J HOH .   ? A HOH 1177 ? 1_555  69.2  ? 
30 OD2 ? A ASP 128 ? A ASP 128  ? 1_555  CS ? G CS . ? A CS 402 ? 1_555 O   ? J HOH .   ? A HOH 1036 ? 1_555  120.6 ? 
31 O   ? J HOH .   ? A HOH 1177 ? 1_555  CS ? G CS . ? A CS 402 ? 1_555 O   ? J HOH .   ? A HOH 1036 ? 1_555  148.5 ? 
32 OD2 ? A ASP 128 ? A ASP 128  ? 1_555  CS ? G CS . ? A CS 402 ? 1_555 O   ? J HOH .   ? A HOH 1075 ? 1_555  56.0  ? 
33 O   ? J HOH .   ? A HOH 1177 ? 1_555  CS ? G CS . ? A CS 402 ? 1_555 O   ? J HOH .   ? A HOH 1075 ? 1_555  93.1  ? 
34 O   ? J HOH .   ? A HOH 1036 ? 1_555  CS ? G CS . ? A CS 402 ? 1_555 O   ? J HOH .   ? A HOH 1075 ? 1_555  73.7  ? 
35 OD2 ? A ASP 128 ? A ASP 128  ? 1_555  CS ? G CS . ? A CS 402 ? 1_555 O   ? J HOH .   ? A HOH 1055 ? 12_566 105.0 ? 
36 O   ? J HOH .   ? A HOH 1177 ? 1_555  CS ? G CS . ? A CS 402 ? 1_555 O   ? J HOH .   ? A HOH 1055 ? 12_566 79.2  ? 
37 O   ? J HOH .   ? A HOH 1036 ? 1_555  CS ? G CS . ? A CS 402 ? 1_555 O   ? J HOH .   ? A HOH 1055 ? 12_566 121.2 ? 
38 O   ? J HOH .   ? A HOH 1075 ? 1_555  CS ? G CS . ? A CS 402 ? 1_555 O   ? J HOH .   ? A HOH 1055 ? 12_566 161.0 ? 
39 OD2 ? A ASP 128 ? A ASP 128  ? 1_555  CS ? G CS . ? A CS 402 ? 1_555 OE2 ? A GLU 67  ? A GLU 67   ? 12_566 113.7 ? 
40 O   ? J HOH .   ? A HOH 1177 ? 1_555  CS ? G CS . ? A CS 402 ? 1_555 OE2 ? A GLU 67  ? A GLU 67   ? 12_566 123.4 ? 
41 O   ? J HOH .   ? A HOH 1036 ? 1_555  CS ? G CS . ? A CS 402 ? 1_555 OE2 ? A GLU 67  ? A GLU 67   ? 12_566 82.2  ? 
42 O   ? J HOH .   ? A HOH 1075 ? 1_555  CS ? G CS . ? A CS 402 ? 1_555 OE2 ? A GLU 67  ? A GLU 67   ? 12_566 137.6 ? 
43 O   ? J HOH .   ? A HOH 1055 ? 12_566 CS ? G CS . ? A CS 402 ? 1_555 OE2 ? A GLU 67  ? A GLU 67   ? 12_566 44.5  ? 
44 OD2 ? A ASP 128 ? A ASP 128  ? 1_555  CS ? G CS . ? A CS 402 ? 1_555 OE1 ? A GLU 67  ? A GLU 67   ? 12_566 70.8  ? 
45 O   ? J HOH .   ? A HOH 1177 ? 1_555  CS ? G CS . ? A CS 402 ? 1_555 OE1 ? A GLU 67  ? A GLU 67   ? 12_566 110.2 ? 
46 O   ? J HOH .   ? A HOH 1036 ? 1_555  CS ? G CS . ? A CS 402 ? 1_555 OE1 ? A GLU 67  ? A GLU 67   ? 12_566 101.1 ? 
47 O   ? J HOH .   ? A HOH 1075 ? 1_555  CS ? G CS . ? A CS 402 ? 1_555 OE1 ? A GLU 67  ? A GLU 67   ? 12_566 108.2 ? 
48 O   ? J HOH .   ? A HOH 1055 ? 12_566 CS ? G CS . ? A CS 402 ? 1_555 OE1 ? A GLU 67  ? A GLU 67   ? 12_566 59.7  ? 
49 OE2 ? A GLU 67  ? A GLU 67   ? 12_566 CS ? G CS . ? A CS 402 ? 1_555 OE1 ? A GLU 67  ? A GLU 67   ? 12_566 43.0  ? 
50 OD2 ? A ASP 128 ? A ASP 128  ? 1_555  CS ? G CS . ? A CS 402 ? 1_555 O   ? J HOH .   ? A HOH 1238 ? 12_566 166.2 ? 
51 O   ? J HOH .   ? A HOH 1177 ? 1_555  CS ? G CS . ? A CS 402 ? 1_555 O   ? J HOH .   ? A HOH 1238 ? 12_566 97.0  ? 
52 O   ? J HOH .   ? A HOH 1036 ? 1_555  CS ? G CS . ? A CS 402 ? 1_555 O   ? J HOH .   ? A HOH 1238 ? 12_566 70.9  ? 
53 O   ? J HOH .   ? A HOH 1075 ? 1_555  CS ? G CS . ? A CS 402 ? 1_555 O   ? J HOH .   ? A HOH 1238 ? 12_566 126.8 ? 
54 O   ? J HOH .   ? A HOH 1055 ? 12_566 CS ? G CS . ? A CS 402 ? 1_555 O   ? J HOH .   ? A HOH 1238 ? 12_566 71.7  ? 
55 OE2 ? A GLU 67  ? A GLU 67   ? 12_566 CS ? G CS . ? A CS 402 ? 1_555 O   ? J HOH .   ? A HOH 1238 ? 12_566 73.9  ? 
56 OE1 ? A GLU 67  ? A GLU 67   ? 12_566 CS ? G CS . ? A CS 402 ? 1_555 O   ? J HOH .   ? A HOH 1238 ? 12_566 116.5 ? 
57 N   ? A SER 40  ? A SER 40   ? 1_555  CS ? H CS . ? A CS 403 ? 1_555 O   ? A PRO 38  ? A PRO 38   ? 1_555  63.0  ? 
58 N   ? A SER 40  ? A SER 40   ? 1_555  CS ? H CS . ? A CS 403 ? 1_555 O   ? J HOH .   ? A HOH 1021 ? 1_555  100.3 ? 
59 O   ? A PRO 38  ? A PRO 38   ? 1_555  CS ? H CS . ? A CS 403 ? 1_555 O   ? J HOH .   ? A HOH 1021 ? 1_555  63.5  ? 
60 N   ? A SER 40  ? A SER 40   ? 1_555  CS ? H CS . ? A CS 403 ? 1_555 O   ? J HOH .   ? A HOH 1185 ? 1_555  67.0  ? 
61 O   ? A PRO 38  ? A PRO 38   ? 1_555  CS ? H CS . ? A CS 403 ? 1_555 O   ? J HOH .   ? A HOH 1185 ? 1_555  69.7  ? 
62 O   ? J HOH .   ? A HOH 1021 ? 1_555  CS ? H CS . ? A CS 403 ? 1_555 O   ? J HOH .   ? A HOH 1185 ? 1_555  131.8 ? 
63 N   ? A SER 40  ? A SER 40   ? 1_555  CS ? H CS . ? A CS 403 ? 1_555 O   ? J HOH .   ? A HOH 1120 ? 1_555  100.7 ? 
64 O   ? A PRO 38  ? A PRO 38   ? 1_555  CS ? H CS . ? A CS 403 ? 1_555 O   ? J HOH .   ? A HOH 1120 ? 1_555  47.7  ? 
65 O   ? J HOH .   ? A HOH 1021 ? 1_555  CS ? H CS . ? A CS 403 ? 1_555 O   ? J HOH .   ? A HOH 1120 ? 1_555  81.7  ? 
66 O   ? J HOH .   ? A HOH 1185 ? 1_555  CS ? H CS . ? A CS 403 ? 1_555 O   ? J HOH .   ? A HOH 1120 ? 1_555  57.6  ? 
67 N   ? A SER 40  ? A SER 40   ? 1_555  CS ? H CS . ? A CS 403 ? 1_555 OE1 B A GLU 43  ? A GLU 43   ? 1_555  47.3  ? 
68 O   ? A PRO 38  ? A PRO 38   ? 1_555  CS ? H CS . ? A CS 403 ? 1_555 OE1 B A GLU 43  ? A GLU 43   ? 1_555  95.3  ? 
69 O   ? J HOH .   ? A HOH 1021 ? 1_555  CS ? H CS . ? A CS 403 ? 1_555 OE1 B A GLU 43  ? A GLU 43   ? 1_555  85.8  ? 
70 O   ? J HOH .   ? A HOH 1185 ? 1_555  CS ? H CS . ? A CS 403 ? 1_555 OE1 B A GLU 43  ? A GLU 43   ? 1_555  110.2 ? 
71 O   ? J HOH .   ? A HOH 1120 ? 1_555  CS ? H CS . ? A CS 403 ? 1_555 OE1 B A GLU 43  ? A GLU 43   ? 1_555  142.6 ? 
72 O   ? J HOH .   ? A HOH 1091 ? 1_555  CS ? E CS . ? A CS 404 ? 1_555 O   ? A GLY 26  ? A GLY 26   ? 1_555  70.6  ? 
73 O   ? J HOH .   ? A HOH 1091 ? 1_555  CS ? E CS . ? A CS 404 ? 1_555 O   ? J HOH .   ? A HOH 1284 ? 1_555  141.0 ? 
74 O   ? A GLY 26  ? A GLY 26   ? 1_555  CS ? E CS . ? A CS 404 ? 1_555 O   ? J HOH .   ? A HOH 1284 ? 1_555  71.4  ? 
75 O   ? J HOH .   ? A HOH 1072 ? 1_555  CS ? I CS . ? A CS 405 ? 1_555 O   ? J HOH .   ? A HOH 1093 ? 1_555  75.3  ? 
76 O   ? J HOH .   ? A HOH 1072 ? 1_555  CS ? I CS . ? A CS 405 ? 1_555 OE2 ? A GLU 64  ? A GLU 64   ? 1_555  80.1  ? 
77 O   ? J HOH .   ? A HOH 1093 ? 1_555  CS ? I CS . ? A CS 405 ? 1_555 OE2 ? A GLU 64  ? A GLU 64   ? 1_555  59.2  ? 
78 O   ? J HOH .   ? A HOH 1072 ? 1_555  CS ? I CS . ? A CS 405 ? 1_555 NE2 ? A GLN 87  ? A GLN 87   ? 8_676  74.9  ? 
79 O   ? J HOH .   ? A HOH 1093 ? 1_555  CS ? I CS . ? A CS 405 ? 1_555 NE2 ? A GLN 87  ? A GLN 87   ? 8_676  78.9  ? 
80 OE2 ? A GLU 64  ? A GLU 64   ? 1_555  CS ? I CS . ? A CS 405 ? 1_555 NE2 ? A GLN 87  ? A GLN 87   ? 8_676  135.4 ? 
81 O   ? J HOH .   ? A HOH 1072 ? 1_555  CS ? I CS . ? A CS 405 ? 1_555 O   ? J HOH .   ? A HOH 1251 ? 12_566 117.2 ? 
82 O   ? J HOH .   ? A HOH 1093 ? 1_555  CS ? I CS . ? A CS 405 ? 1_555 O   ? J HOH .   ? A HOH 1251 ? 12_566 43.2  ? 
83 OE2 ? A GLU 64  ? A GLU 64   ? 1_555  CS ? I CS . ? A CS 405 ? 1_555 O   ? J HOH .   ? A HOH 1251 ? 12_566 60.8  ? 
84 NE2 ? A GLN 87  ? A GLN 87   ? 8_676  CS ? I CS . ? A CS 405 ? 1_555 O   ? J HOH .   ? A HOH 1251 ? 12_566 99.5  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-02-15 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2013-05-22 
5 'Structure model' 1 4 2017-10-11 
6 'Structure model' 1 5 2018-04-04 
7 'Structure model' 1 6 2018-08-29 
8 'Structure model' 1 7 2019-07-24 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' 'Version format compliance' 
2  3 'Structure model' 'Derived calculations'      
3  3 'Structure model' 'Version format compliance' 
4  4 'Structure model' 'Structure summary'         
5  5 'Structure model' 'Refinement description'    
6  6 'Structure model' 'Data collection'           
7  7 'Structure model' 'Data collection'           
8  7 'Structure model' 'Source and taxonomy'       
9  7 'Structure model' 'Structure summary'         
10 8 'Structure model' 'Data collection'           
11 8 'Structure model' 'Refinement description'    
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 5 'Structure model' software       
2 6 'Structure model' diffrn_source  
3 7 'Structure model' entity         
4 7 'Structure model' entity_src_gen 
5 7 'Structure model' entity_src_nat 
6 8 'Structure model' software       
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 6 'Structure model' '_diffrn_source.type'      
2 7 'Structure model' '_entity.src_method'       
3 8 'Structure model' '_software.classification' 
4 8 'Structure model' '_software.name'           
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
SHELXL-97 refinement       .            ? 1 
XTALVIEW  refinement       'XGEN SHELX' ? 2 
X-GEN     'data reduction' .            ? 3 
X-GEN     'data scaling'   .            ? 4 
SHELX     phasing          .            ? 5 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 C  A HIS 8   ? ? N   A ASN 9   ? ? CA  A ASN 9   ? ? 137.73 121.70 16.03  2.50 Y 
2 1 CG A TYR 34  ? ? CD2 A TYR 34  ? ? CE2 A TYR 34  ? ? 116.46 121.30 -4.84  0.80 N 
3 1 NE A ARG 41  ? ? CZ  A ARG 41  ? ? NH1 A ARG 41  ? ? 123.35 120.30 3.05   0.50 N 
4 1 NE A ARG 56  ? ? CZ  A ARG 56  ? ? NH2 A ARG 56  ? ? 124.60 120.30 4.30   0.50 N 
5 1 O  A ASP 79  ? ? C   A ASP 79  ? ? N   A GLN 80  ? ? 112.09 122.70 -10.61 1.60 Y 
6 1 NE A ARG 94  ? ? CZ  A ARG 94  ? ? NH2 A ARG 94  ? ? 115.40 120.30 -4.90  0.50 N 
7 1 NE A ARG 139 ? ? CZ  A ARG 139 ? ? NH1 A ARG 139 ? ? 123.51 120.30 3.21   0.50 N 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MET 1   ? A MET 1   
2 1 Y 1 A SER 2   ? A SER 2   
3 1 Y 1 A LYS 141 ? A LYS 141 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SULFATE ION' SO4 
3 'CESIUM ION'  CS  
4 water         HOH 
#