data_1SD9
# 
_entry.id   1SD9 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.351 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1SD9         pdb_00001sd9 10.2210/pdb1sd9/pdb 
RCSB  RCSB021612   ?            ?                   
WWPDB D_1000021612 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1s3c . unspecified 
PDB 1s3d . unspecified 
PDB 1sd8 . unspecified 
PDB 1SJZ . unspecified 
PDB 1SK0 . unspecified 
PDB 1SK1 . unspecified 
PDB 1SK2 . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1SD9 
_pdbx_database_status.recvd_initial_deposition_date   2004-02-13 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'DeMel, S.'     1 
'Edwards, B.F.' 2 
# 
_citation.id                        primary 
_citation.title                     
'Arginine 60 in the ArsC arsenate reductase of E. coli plasmid R773 determines the chemical nature of the bound As(III) product.' 
_citation.journal_abbrev            'Protein Sci.' 
_citation.journal_volume            13 
_citation.page_first                2330 
_citation.page_last                 2340 
_citation.year                      2004 
_citation.journal_id_ASTM           PRCIEI 
_citation.country                   US 
_citation.journal_id_ISSN           0961-8368 
_citation.journal_id_CSD            0795 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15295115 
_citation.pdbx_database_id_DOI      10.1110/ps.04787204 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'DeMel, S.'     1 ? 
primary 'Shi, J.'       2 ? 
primary 'Martin, P.'    3 ? 
primary 'Rosen, B.P.'   4 ? 
primary 'Edwards, B.F.' 5 ? 
# 
_cell.entry_id           1SD9 
_cell.length_a           86.590 
_cell.length_b           86.590 
_cell.length_c           115.670 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1SD9 
_symmetry.space_group_name_H-M             'P 61 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                178 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Arsenate reductase' 15833.175 1   1.20.4.1 C12S ? ? 
2 non-polymer syn 'SULFATE ION'        96.063    3   ?        ?    ? ? 
3 non-polymer syn 'CESIUM ION'         132.905   2   ?        ?    ? ? 
4 water       nat water                18.015    305 ?        ?    ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Arsenical pump modifier' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSNITIYHNPASGTSRNTLEMIRNSGTEPTIILYLENPPSRDELVKLIADMGISVRALLRKNVEPYEQLGLAEDKFTDDQ
LIDFMLQHPILINRPIVVTPLGTRLCRPSEVVLDILQDAQKGAFTKEDGEKVVDEAGKRLK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSNITIYHNPASGTSRNTLEMIRNSGTEPTIILYLENPPSRDELVKLIADMGISVRALLRKNVEPYEQLGLAEDKFTDDQ
LIDFMLQHPILINRPIVVTPLGTRLCRPSEVVLDILQDAQKGAFTKEDGEKVVDEAGKRLK
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   ASN n 
1 4   ILE n 
1 5   THR n 
1 6   ILE n 
1 7   TYR n 
1 8   HIS n 
1 9   ASN n 
1 10  PRO n 
1 11  ALA n 
1 12  SER n 
1 13  GLY n 
1 14  THR n 
1 15  SER n 
1 16  ARG n 
1 17  ASN n 
1 18  THR n 
1 19  LEU n 
1 20  GLU n 
1 21  MET n 
1 22  ILE n 
1 23  ARG n 
1 24  ASN n 
1 25  SER n 
1 26  GLY n 
1 27  THR n 
1 28  GLU n 
1 29  PRO n 
1 30  THR n 
1 31  ILE n 
1 32  ILE n 
1 33  LEU n 
1 34  TYR n 
1 35  LEU n 
1 36  GLU n 
1 37  ASN n 
1 38  PRO n 
1 39  PRO n 
1 40  SER n 
1 41  ARG n 
1 42  ASP n 
1 43  GLU n 
1 44  LEU n 
1 45  VAL n 
1 46  LYS n 
1 47  LEU n 
1 48  ILE n 
1 49  ALA n 
1 50  ASP n 
1 51  MET n 
1 52  GLY n 
1 53  ILE n 
1 54  SER n 
1 55  VAL n 
1 56  ARG n 
1 57  ALA n 
1 58  LEU n 
1 59  LEU n 
1 60  ARG n 
1 61  LYS n 
1 62  ASN n 
1 63  VAL n 
1 64  GLU n 
1 65  PRO n 
1 66  TYR n 
1 67  GLU n 
1 68  GLN n 
1 69  LEU n 
1 70  GLY n 
1 71  LEU n 
1 72  ALA n 
1 73  GLU n 
1 74  ASP n 
1 75  LYS n 
1 76  PHE n 
1 77  THR n 
1 78  ASP n 
1 79  ASP n 
1 80  GLN n 
1 81  LEU n 
1 82  ILE n 
1 83  ASP n 
1 84  PHE n 
1 85  MET n 
1 86  LEU n 
1 87  GLN n 
1 88  HIS n 
1 89  PRO n 
1 90  ILE n 
1 91  LEU n 
1 92  ILE n 
1 93  ASN n 
1 94  ARG n 
1 95  PRO n 
1 96  ILE n 
1 97  VAL n 
1 98  VAL n 
1 99  THR n 
1 100 PRO n 
1 101 LEU n 
1 102 GLY n 
1 103 THR n 
1 104 ARG n 
1 105 LEU n 
1 106 CYS n 
1 107 ARG n 
1 108 PRO n 
1 109 SER n 
1 110 GLU n 
1 111 VAL n 
1 112 VAL n 
1 113 LEU n 
1 114 ASP n 
1 115 ILE n 
1 116 LEU n 
1 117 GLN n 
1 118 ASP n 
1 119 ALA n 
1 120 GLN n 
1 121 LYS n 
1 122 GLY n 
1 123 ALA n 
1 124 PHE n 
1 125 THR n 
1 126 LYS n 
1 127 GLU n 
1 128 ASP n 
1 129 GLY n 
1 130 GLU n 
1 131 LYS n 
1 132 VAL n 
1 133 VAL n 
1 134 ASP n 
1 135 GLU n 
1 136 ALA n 
1 137 GLY n 
1 138 LYS n 
1 139 ARG n 
1 140 LEU n 
1 141 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli ' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     562 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ARSC1_ECOLI 
_struct_ref.pdbx_db_accession          P08692 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSNITIYHNPACGTSRNTLEMIRNSGTEPTIILYLENPPSRDELVKLIADMGISVRALLRKNVEPYEQLGLAEDKFTDDQ
LIDFMLQHPILINRPIVVTPLGTRLCRPSEVVLDILQDAQKGAFTKEDGEKVVDEAGKRLK
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1SD9 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 141 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P08692 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  141 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       141 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1SD9 
_struct_ref_seq_dif.mon_id                       SER 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      12 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P08692 
_struct_ref_seq_dif.db_mon_id                    CYS 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          12 
_struct_ref_seq_dif.details                      'engineered mutation' 
_struct_ref_seq_dif.pdbx_auth_seq_num            12 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CS  non-polymer         . 'CESIUM ION'    ? 'Cs 1'           132.905 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1SD9 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   58.0 
_exptl_crystal.description           ? 
_exptl_crystal.density_Matthews      2.93 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            278 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.80 
_exptl_crystal_grow.pdbx_details    
'50% saturated Cesium Sulfate, 100mM sodium acetate,5mM DTT, pH 4.80, VAPOR DIFFUSION, HANGING DROP, temperature 278K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           93.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2002-01-28 
_diffrn_detector.details                'OSMIC MIRRORS' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'OSMIC MIRRORS' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1SD9 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.000 
_reflns.d_resolution_high            1.64 
_reflns.number_obs                   27713 
_reflns.number_all                   29169 
_reflns.percent_possible_obs         90.8 
_reflns.pdbx_Rmerge_I_obs            0.166 
_reflns.pdbx_Rsym_value              0.166 
_reflns.pdbx_netI_over_sigmaI        7.7 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              17.9 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.64 
_reflns_shell.d_res_low              1.698 
_reflns_shell.percent_possible_all   54.1 
_reflns_shell.Rmerge_I_obs           0.6117 
_reflns_shell.pdbx_Rsym_value        0.6117 
_reflns_shell.meanI_over_sigI_obs    1.306 
_reflns_shell.pdbx_redundancy        6.8 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1SD9 
_refine.ls_number_reflns_obs                     27713 
_refine.ls_number_reflns_all                     27713 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            1.65 
_refine.ls_percent_reflns_obs                    87.7 
_refine.ls_R_factor_obs                          0.1701 
_refine.ls_R_factor_all                          0.1701 
_refine.ls_R_factor_R_work                       0.1701 
_refine.ls_R_factor_R_free                       0.2138 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     5908 
_refine.ls_number_restraints                     4595 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'MOEWS & KRETSINGER, J.MOL.BIOL.91(1973)201-228' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R' 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'NATIVE STRUCTURE' 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1SD9 
_refine_analyze.Luzzati_coordinate_error_obs    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      5 
_refine_analyze.occupancy_sum_hydrogen          0.00 
_refine_analyze.occupancy_sum_non_hydrogen      1442.23 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1085 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         17 
_refine_hist.number_atoms_solvent             305 
_refine_hist.number_atoms_total               1407 
_refine_hist.d_res_high                       1.65 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
s_bond_d               0.009  ? ? ? 'X-RAY DIFFRACTION' ? 
s_angle_d              0.026  ? ? ? 'X-RAY DIFFRACTION' ? 
s_similar_dist         0.000  ? ? ? 'X-RAY DIFFRACTION' ? 
s_from_restr_planes    0.0291 ? ? ? 'X-RAY DIFFRACTION' ? 
s_zero_chiral_vol      0.048  ? ? ? 'X-RAY DIFFRACTION' ? 
s_non_zero_chiral_vol  0.064  ? ? ? 'X-RAY DIFFRACTION' ? 
s_anti_bump_dis_restr  0.012  ? ? ? 'X-RAY DIFFRACTION' ? 
s_rigid_bond_adp_cmpnt 0.000  ? ? ? 'X-RAY DIFFRACTION' ? 
s_similar_adp_cmpnt    0.073  ? ? ? 'X-RAY DIFFRACTION' ? 
s_approx_iso_adps      0.000  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_pdbx_refine.entry_id                                    1SD9 
_pdbx_refine.R_factor_all_no_cutoff                      0.1701 
_pdbx_refine.R_factor_obs_no_cutoff                      0.1701 
_pdbx_refine.free_R_factor_no_cutoff                     0.2138 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     ? 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            ? 
_pdbx_refine.R_factor_all_4sig_cutoff                    0.1613 
_pdbx_refine.R_factor_obs_4sig_cutoff                    ? 
_pdbx_refine.free_R_factor_4sig_cutoff                   ? 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   ? 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          ? 
_pdbx_refine.number_reflns_obs_4sig_cutoff               25647 
_pdbx_refine.number_reflns_obs_no_cutoff                 27713 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.free_R_error_no_cutoff                      ? 
# 
_struct.entry_id                  1SD9 
_struct.title                     'ARSENATE REDUCTASE C12S MUTANT +0.4M ARSENATE FROM E. COLI' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1SD9 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            'ARSC, REDUCTASE, ARSENITE, ARSENATE, OXIDOREDUCTASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 12  ? SER A 25  ? SER A 12  SER A 25  1 ? 14 
HELX_P HELX_P2 2 SER A 40  ? GLY A 52  ? SER A 40  GLY A 52  1 ? 13 
HELX_P HELX_P3 3 SER A 54  ? LEU A 59  ? SER A 54  LEU A 59  1 ? 6  
HELX_P HELX_P4 4 VAL A 63  ? LEU A 69  ? VAL A 63  LEU A 69  1 ? 7  
HELX_P HELX_P5 5 THR A 77  ? HIS A 88  ? THR A 77  HIS A 88  1 ? 12 
HELX_P HELX_P6 6 PRO A 89  ? ILE A 92  ? PRO A 89  ILE A 92  5 ? 4  
HELX_P HELX_P7 7 PRO A 108 ? ILE A 115 ? PRO A 108 ILE A 115 5 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1  metalc ? ? A PRO 38  O  ? ? ? 1_555  F CS  . CS ? ? A PRO 38  A CS  402  1_555  ? ? ? ? ? ? ? 3.188 ? ? 
metalc2  metalc ? ? A SER 40  N  ? ? ? 1_555  F CS  . CS ? ? A SER 40  A CS  402  1_555  ? ? ? ? ? ? ? 3.726 ? ? 
metalc3  metalc ? ? A LEU 113 O  ? ? ? 1_555  E CS  . CS ? ? A LEU 113 A CS  401  1_555  ? ? ? ? ? ? ? 3.205 ? ? 
metalc4  metalc ? ? A LEU 113 O  ? ? ? 10_665 E CS  . CS ? ? A LEU 113 A CS  401  1_555  ? ? ? ? ? ? ? 3.205 ? ? 
metalc5  metalc ? ? A ASP 114 O  ? ? ? 1_555  E CS  . CS ? ? A ASP 114 A CS  401  1_555  ? ? ? ? ? ? ? 3.284 ? ? 
metalc6  metalc ? ? A ASP 114 O  ? ? ? 10_665 E CS  . CS ? ? A ASP 114 A CS  401  1_555  ? ? ? ? ? ? ? 3.283 ? ? 
metalc7  metalc ? ? A LEU 116 O  ? ? ? 1_555  E CS  . CS ? ? A LEU 116 A CS  401  1_555  ? ? ? ? ? ? ? 3.101 ? ? 
metalc8  metalc ? ? A LEU 116 O  ? ? ? 10_665 E CS  . CS ? ? A LEU 116 A CS  401  1_555  ? ? ? ? ? ? ? 3.100 ? ? 
metalc9  metalc ? ? E CS  .   CS ? ? ? 1_555  G HOH . O  ? ? A CS  401 A HOH 1039 1_555  ? ? ? ? ? ? ? 3.311 ? ? 
metalc10 metalc ? ? E CS  .   CS ? ? ? 1_555  G HOH . O  ? ? A CS  401 A HOH 1039 10_665 ? ? ? ? ? ? ? 3.311 ? ? 
metalc11 metalc ? ? F CS  .   CS ? ? ? 1_555  G HOH . O  ? ? A CS  402 A HOH 1034 1_555  ? ? ? ? ? ? ? 3.152 ? ? 
metalc12 metalc ? ? F CS  .   CS ? ? ? 1_555  G HOH . O  ? ? A CS  402 A HOH 1120 1_555  ? ? ? ? ? ? ? 3.565 ? ? 
metalc13 metalc ? ? F CS  .   CS ? ? ? 1_555  G HOH . O  ? ? A CS  402 A HOH 1232 1_555  ? ? ? ? ? ? ? 3.154 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ARG 94  A . ? ARG 94  A PRO 95  A ? PRO 95  A 1 -8.39 
2 ARG 107 A . ? ARG 107 A PRO 108 A ? PRO 108 A 1 3.54  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 30  ? ILE A 32  ? THR A 30  ILE A 32  
A 2 THR A 5   ? TYR A 7   ? THR A 5   TYR A 7   
A 3 ILE A 96  ? THR A 99  ? ILE A 96  THR A 99  
A 4 GLY A 102 ? LEU A 105 ? GLY A 102 LEU A 105 
B 1 PHE A 124 ? THR A 125 ? PHE A 124 THR A 125 
B 2 LYS A 131 ? VAL A 133 ? LYS A 131 VAL A 133 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ILE A 32  ? O ILE A 32  N ILE A 6   ? N ILE A 6   
A 2 3 N THR A 5   ? N THR A 5   O VAL A 98  ? O VAL A 98  
A 3 4 N THR A 99  ? N THR A 99  O GLY A 102 ? O GLY A 102 
B 1 2 N PHE A 124 ? N PHE A 124 O VAL A 132 ? O VAL A 132 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A SO4 201 ? 10 'BINDING SITE FOR RESIDUE SO4 A 201' 
AC2 Software A SO4 202 ? 4  'BINDING SITE FOR RESIDUE SO4 A 202' 
AC3 Software A SO4 203 ? 12 'BINDING SITE FOR RESIDUE SO4 A 203' 
AC4 Software A CS  401 ? 6  'BINDING SITE FOR RESIDUE CS A 401'  
AC5 Software A CS  402 ? 2  'BINDING SITE FOR RESIDUE CS A 402'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 10 SER A 12  ? SER A 12   . ? 1_555  ? 
2  AC1 10 GLY A 13  ? GLY A 13   . ? 1_555  ? 
3  AC1 10 THR A 14  ? THR A 14   . ? 1_555  ? 
4  AC1 10 ARG A 60  ? ARG A 60   . ? 1_555  ? 
5  AC1 10 ASN A 62  ? ASN A 62   . ? 12_566 ? 
6  AC1 10 ARG A 94  ? ARG A 94   . ? 1_555  ? 
7  AC1 10 ARG A 107 ? ARG A 107  . ? 1_555  ? 
8  AC1 10 HOH G .   ? HOH A 1008 . ? 1_555  ? 
9  AC1 10 HOH G .   ? HOH A 1076 . ? 12_566 ? 
10 AC1 10 HOH G .   ? HOH A 1090 . ? 12_566 ? 
11 AC2 4  ARG A 107 ? ARG A 107  . ? 1_555  ? 
12 AC2 4  HOH G .   ? HOH A 1062 . ? 1_555  ? 
13 AC2 4  HOH G .   ? HOH A 1101 . ? 1_555  ? 
14 AC2 4  HOH G .   ? HOH A 1223 . ? 1_555  ? 
15 AC3 12 THR A 14  ? THR A 14   . ? 1_555  ? 
16 AC3 12 ASN A 17  ? ASN A 17   . ? 1_555  ? 
17 AC3 12 PRO A 108 ? PRO A 108  . ? 1_555  ? 
18 AC3 12 SER A 109 ? SER A 109  . ? 1_555  ? 
19 AC3 12 GLU A 110 ? GLU A 110  . ? 1_555  ? 
20 AC3 12 LYS A 126 ? LYS A 126  . ? 1_555  ? 
21 AC3 12 HOH G .   ? HOH A 1008 . ? 1_555  ? 
22 AC3 12 HOH G .   ? HOH A 1023 . ? 12_566 ? 
23 AC3 12 HOH G .   ? HOH A 1087 . ? 1_555  ? 
24 AC3 12 HOH G .   ? HOH A 1093 . ? 1_555  ? 
25 AC3 12 HOH G .   ? HOH A 1193 . ? 1_555  ? 
26 AC3 12 HOH G .   ? HOH A 1213 . ? 1_555  ? 
27 AC4 6  LEU A 113 ? LEU A 113  . ? 10_665 ? 
28 AC4 6  LEU A 113 ? LEU A 113  . ? 1_555  ? 
29 AC4 6  ASP A 114 ? ASP A 114  . ? 1_555  ? 
30 AC4 6  ASP A 114 ? ASP A 114  . ? 10_665 ? 
31 AC4 6  LEU A 116 ? LEU A 116  . ? 1_555  ? 
32 AC4 6  LEU A 116 ? LEU A 116  . ? 10_665 ? 
33 AC5 2  PRO A 38  ? PRO A 38   . ? 1_555  ? 
34 AC5 2  GLU A 43  ? GLU A 43   . ? 1_555  ? 
# 
_database_PDB_matrix.entry_id          1SD9 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.000000 
_database_PDB_matrix.origx_vector[2]   0.000000 
_database_PDB_matrix.origx_vector[3]   0.000000 
# 
_atom_sites.entry_id                    1SD9 
_atom_sites.fract_transf_matrix[1][1]   0.011549 
_atom_sites.fract_transf_matrix[1][2]   0.006668 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013335 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008645 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
CS 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ASN A 1 3   ? 31.904 45.520 45.218 1.00 30.57  ? 3    ASN A N   1 
ATOM   2    C  CA  . ASN A 1 3   ? 31.891 46.971 45.340 1.00 27.75  ? 3    ASN A CA  1 
ATOM   3    C  C   . ASN A 1 3   ? 30.605 47.462 46.004 1.00 13.69  ? 3    ASN A C   1 
ATOM   4    O  O   . ASN A 1 3   ? 29.524 47.513 45.421 1.00 16.87  ? 3    ASN A O   1 
ATOM   5    C  CB  . ASN A 1 3   ? 32.020 47.664 43.984 1.00 51.07  ? 3    ASN A CB  1 
ATOM   6    C  CG  . ASN A 1 3   ? 32.549 49.076 44.238 1.00 80.48  ? 3    ASN A CG  1 
ATOM   7    O  OD1 . ASN A 1 3   ? 32.470 49.934 43.357 1.00 132.57 ? 3    ASN A OD1 1 
ATOM   8    N  ND2 . ASN A 1 3   ? 33.081 49.280 45.448 1.00 55.00  ? 3    ASN A ND2 1 
ATOM   9    N  N   . ILE A 1 4   ? 30.764 47.824 47.266 1.00 13.07  ? 4    ILE A N   1 
ATOM   10   C  CA  . ILE A 1 4   ? 29.602 48.164 48.074 1.00 12.34  ? 4    ILE A CA  1 
ATOM   11   C  C   . ILE A 1 4   ? 29.776 49.537 48.712 1.00 17.05  ? 4    ILE A C   1 
ATOM   12   O  O   . ILE A 1 4   ? 30.860 49.872 49.183 1.00 13.10  ? 4    ILE A O   1 
ATOM   13   C  CB  . ILE A 1 4   ? 29.421 47.123 49.207 1.00 13.91  ? 4    ILE A CB  1 
ATOM   14   C  CG1 . ILE A 1 4   ? 29.333 45.691 48.640 1.00 11.47  ? 4    ILE A CG1 1 
ATOM   15   C  CG2 . ILE A 1 4   ? 28.272 47.524 50.119 1.00 12.40  ? 4    ILE A CG2 1 
ATOM   16   C  CD1 . ILE A 1 4   ? 29.187 44.626 49.694 1.00 16.51  ? 4    ILE A CD1 1 
ATOM   17   N  N   . THR A 1 5   ? 28.687 50.280 48.711 1.00 11.68  ? 5    THR A N   1 
ATOM   18   C  CA  . THR A 1 5   ? 28.638 51.561 49.387 1.00 14.68  ? 5    THR A CA  1 
ATOM   19   C  C   . THR A 1 5   ? 27.510 51.604 50.403 1.00 14.06  ? 5    THR A C   1 
ATOM   20   O  O   . THR A 1 5   ? 26.392 51.145 50.136 1.00 12.23  ? 5    THR A O   1 
ATOM   21   C  CB  . THR A 1 5   ? 28.433 52.669 48.328 1.00 19.87  ? 5    THR A CB  1 
ATOM   22   O  OG1 . THR A 1 5   ? 29.563 52.650 47.454 1.00 17.78  ? 5    THR A OG1 1 
ATOM   23   C  CG2 . THR A 1 5   ? 28.351 54.031 49.006 1.00 17.68  ? 5    THR A CG2 1 
ATOM   24   N  N   . ILE A 1 6   ? 27.825 52.151 51.580 1.00 12.20  ? 6    ILE A N   1 
ATOM   25   C  CA  . ILE A 1 6   ? 26.792 52.357 52.590 1.00 8.05   ? 6    ILE A CA  1 
ATOM   26   C  C   . ILE A 1 6   ? 26.779 53.841 52.976 1.00 11.25  ? 6    ILE A C   1 
ATOM   27   O  O   . ILE A 1 6   ? 27.828 54.396 53.313 1.00 14.90  ? 6    ILE A O   1 
ATOM   28   C  CB  . ILE A 1 6   ? 26.980 51.473 53.845 1.00 9.39   ? 6    ILE A CB  1 
ATOM   29   C  CG1 . ILE A 1 6   ? 25.934 51.740 54.932 1.00 13.94  ? 6    ILE A CG1 1 
ATOM   30   C  CG2 . ILE A 1 6   ? 28.376 51.623 54.421 1.00 12.61  ? 6    ILE A CG2 1 
ATOM   31   C  CD1 . ILE A 1 6   ? 25.898 50.764 56.094 1.00 14.72  ? 6    ILE A CD1 1 
ATOM   32   N  N   . TYR A 1 7   ? 25.615 54.472 52.914 1.00 10.80  ? 7    TYR A N   1 
ATOM   33   C  CA  . TYR A 1 7   ? 25.391 55.813 53.460 1.00 15.15  ? 7    TYR A CA  1 
ATOM   34   C  C   . TYR A 1 7   ? 25.089 55.615 54.948 1.00 13.77  ? 7    TYR A C   1 
ATOM   35   O  O   . TYR A 1 7   ? 24.010 55.163 55.352 1.00 13.10  ? 7    TYR A O   1 
ATOM   36   C  CB  . TYR A 1 7   ? 24.264 56.512 52.691 1.00 9.46   ? 7    TYR A CB  1 
ATOM   37   C  CG  . TYR A 1 7   ? 24.658 56.810 51.262 1.00 11.37  ? 7    TYR A CG  1 
ATOM   38   C  CD1 . TYR A 1 7   ? 24.470 55.848 50.270 1.00 12.22  ? 7    TYR A CD1 1 
ATOM   39   C  CD2 . TYR A 1 7   ? 25.221 58.053 50.943 1.00 14.58  ? 7    TYR A CD2 1 
ATOM   40   C  CE1 . TYR A 1 7   ? 24.854 56.164 48.962 1.00 12.00  ? 7    TYR A CE1 1 
ATOM   41   C  CE2 . TYR A 1 7   ? 25.600 58.353 49.629 1.00 15.25  ? 7    TYR A CE2 1 
ATOM   42   C  CZ  . TYR A 1 7   ? 25.406 57.393 48.651 1.00 17.58  ? 7    TYR A CZ  1 
ATOM   43   O  OH  . TYR A 1 7   ? 25.762 57.644 47.334 1.00 16.14  ? 7    TYR A OH  1 
ATOM   44   N  N   . HIS A 1 8   ? 26.072 55.865 55.791 1.00 9.63   ? 8    HIS A N   1 
ATOM   45   C  CA  . HIS A 1 8   ? 26.142 55.427 57.163 1.00 11.42  ? 8    HIS A CA  1 
ATOM   46   C  C   . HIS A 1 8   ? 25.982 56.568 58.159 1.00 16.69  ? 8    HIS A C   1 
ATOM   47   O  O   . HIS A 1 8   ? 26.476 57.672 57.912 1.00 12.35  ? 8    HIS A O   1 
ATOM   48   C  CB  . HIS A 1 8   ? 27.512 54.740 57.376 1.00 13.36  ? 8    HIS A CB  1 
ATOM   49   C  CG  . HIS A 1 8   ? 27.758 54.192 58.745 1.00 15.30  ? 8    HIS A CG  1 
ATOM   50   N  ND1 . HIS A 1 8   ? 26.896 53.383 59.463 1.00 13.79  ? 8    HIS A ND1 1 
ATOM   51   C  CD2 . HIS A 1 8   ? 28.854 54.364 59.536 1.00 14.34  ? 8    HIS A CD2 1 
ATOM   52   C  CE1 . HIS A 1 8   ? 27.468 53.104 60.629 1.00 16.40  ? 8    HIS A CE1 1 
ATOM   53   N  NE2 . HIS A 1 8   ? 28.659 53.682 60.697 1.00 11.27  ? 8    HIS A NE2 1 
ATOM   54   N  N   . ASN A 1 9   ? 25.294 56.270 59.255 1.00 12.15  ? 9    ASN A N   1 
ATOM   55   C  CA  . ASN A 1 9   ? 25.228 57.198 60.387 1.00 10.17  ? 9    ASN A CA  1 
ATOM   56   C  C   . ASN A 1 9   ? 25.686 56.408 61.607 1.00 13.49  ? 9    ASN A C   1 
ATOM   57   O  O   . ASN A 1 9   ? 24.949 55.537 62.059 1.00 12.87  ? 9    ASN A O   1 
ATOM   58   C  CB  . ASN A 1 9   ? 23.814 57.728 60.622 1.00 10.65  ? 9    ASN A CB  1 
ATOM   59   C  CG  . ASN A 1 9   ? 23.689 58.697 61.761 1.00 16.19  ? 9    ASN A CG  1 
ATOM   60   O  OD1 . ASN A 1 9   ? 24.624 58.848 62.548 1.00 14.63  ? 9    ASN A OD1 1 
ATOM   61   N  ND2 . ASN A 1 9   ? 22.552 59.399 61.901 1.00 13.94  ? 9    ASN A ND2 1 
ATOM   62   N  N   . PRO A 1 10  ? 26.881 56.657 62.121 1.00 13.14  ? 10   PRO A N   1 
ATOM   63   C  CA  . PRO A 1 10  ? 27.364 55.920 63.280 1.00 10.76  ? 10   PRO A CA  1 
ATOM   64   C  C   . PRO A 1 10  ? 26.467 56.037 64.502 1.00 13.81  ? 10   PRO A C   1 
ATOM   65   O  O   . PRO A 1 10  ? 26.620 55.221 65.426 1.00 15.64  ? 10   PRO A O   1 
ATOM   66   C  CB  . PRO A 1 10  ? 28.684 56.653 63.608 1.00 16.62  ? 10   PRO A CB  1 
ATOM   67   C  CG  . PRO A 1 10  ? 29.098 57.368 62.372 1.00 22.00  ? 10   PRO A CG  1 
ATOM   68   C  CD  . PRO A 1 10  ? 27.849 57.646 61.586 1.00 16.13  ? 10   PRO A CD  1 
ATOM   69   N  N   . ALA A 1 11  ? 25.581 57.034 64.536 1.00 13.66  ? 11   ALA A N   1 
ATOM   70   C  CA  . ALA A 1 11  ? 24.703 57.194 65.688 1.00 19.75  ? 11   ALA A CA  1 
ATOM   71   C  C   . ALA A 1 11  ? 23.368 56.455 65.524 1.00 16.42  ? 11   ALA A C   1 
ATOM   72   O  O   . ALA A 1 11  ? 22.419 56.712 66.273 1.00 17.10  ? 11   ALA A O   1 
ATOM   73   C  CB  . ALA A 1 11  ? 24.426 58.671 65.919 1.00 13.55  ? 11   ALA A CB  1 
ATOM   74   N  N   . SER A 1 12  ? 23.300 55.567 64.539 1.00 12.83  ? 12   SER A N   1 
ATOM   75   C  CA  . SER A 1 12  ? 22.120 54.798 64.177 1.00 13.16  ? 12   SER A CA  1 
ATOM   76   C  C   . SER A 1 12  ? 22.321 53.306 64.471 1.00 12.35  ? 12   SER A C   1 
ATOM   77   O  O   . SER A 1 12  ? 23.236 52.802 63.823 1.00 12.71  ? 12   SER A O   1 
ATOM   78   C  CB  . SER A 1 12  ? 21.826 54.981 62.664 1.00 13.37  ? 12   SER A CB  1 
ATOM   79   O  OG  . SER A 1 12  ? 20.891 53.977 62.241 1.00 12.24  ? 12   SER A OG  1 
ATOM   80   N  N   . GLY A 1 13  ? 21.569 52.668 65.351 1.00 10.60  ? 13   GLY A N   1 
ATOM   81   C  CA  . GLY A 1 13  ? 21.661 51.239 65.611 1.00 10.33  ? 13   GLY A CA  1 
ATOM   82   C  C   . GLY A 1 13  ? 21.420 50.475 64.314 1.00 15.80  ? 13   GLY A C   1 
ATOM   83   O  O   . GLY A 1 13  ? 22.106 49.495 63.992 1.00 13.82  ? 13   GLY A O   1 
ATOM   84   N  N   . THR A 1 14  ? 20.421 50.914 63.538 1.00 11.32  ? 14   THR A N   1 
ATOM   85   C  CA  . THR A 1 14  ? 20.108 50.220 62.286 1.00 11.51  ? 14   THR A CA  1 
ATOM   86   C  C   . THR A 1 14  ? 21.297 50.275 61.338 1.00 16.67  ? 14   THR A C   1 
ATOM   87   O  O   . THR A 1 14  ? 21.656 49.264 60.720 1.00 12.30  ? 14   THR A O   1 
ATOM   88   C  CB  . THR A 1 14  ? 18.854 50.837 61.615 1.00 13.06  ? 14   THR A CB  1 
ATOM   89   O  OG1 . THR A 1 14  ? 17.753 50.751 62.550 1.00 14.07  ? 14   THR A OG1 1 
ATOM   90   C  CG2 . THR A 1 14  ? 18.524 50.099 60.345 1.00 10.39  ? 14   THR A CG2 1 
ATOM   91   N  N   . SER A 1 15  ? 21.910 51.460 61.253 1.00 7.87   ? 15   SER A N   1 
ATOM   92   C  CA  . SER A 1 15  ? 23.068 51.625 60.384 1.00 9.71   ? 15   SER A CA  1 
ATOM   93   C  C   . SER A 1 15  ? 24.265 50.830 60.906 1.00 11.23  ? 15   SER A C   1 
ATOM   94   O  O   . SER A 1 15  ? 24.971 50.222 60.069 1.00 11.28  ? 15   SER A O   1 
ATOM   95   C  CB  . SER A 1 15  ? 23.432 53.110 60.252 1.00 11.79  ? 15   SER A CB  1 
ATOM   96   O  OG  . SER A 1 15  ? 24.209 53.401 59.099 1.00 10.62  ? 15   SER A OG  1 
ATOM   97   N  N   . ARG A 1 16  ? 24.484 50.825 62.219 1.00 10.00  ? 16   ARG A N   1 
ATOM   98   C  CA  . ARG A 1 16  ? 25.568 50.000 62.769 1.00 11.09  ? 16   ARG A CA  1 
ATOM   99   C  C   . ARG A 1 16  ? 25.325 48.519 62.459 1.00 12.53  ? 16   ARG A C   1 
ATOM   100  O  O   . ARG A 1 16  ? 26.234 47.833 61.971 1.00 12.11  ? 16   ARG A O   1 
ATOM   101  C  CB  . ARG A 1 16  ? 25.714 50.214 64.276 1.00 10.92  ? 16   ARG A CB  1 
ATOM   102  C  CG  . ARG A 1 16  ? 26.286 51.579 64.635 1.00 12.81  ? 16   ARG A CG  1 
ATOM   103  C  CD  . ARG A 1 16  ? 26.655 51.713 66.102 1.00 12.13  ? 16   ARG A CD  1 
ATOM   104  N  NE  . ARG A 1 16  ? 25.502 51.426 66.974 1.00 10.17  ? 16   ARG A NE  1 
ATOM   105  C  CZ  . ARG A 1 16  ? 24.589 52.300 67.351 1.00 11.18  ? 16   ARG A CZ  1 
ATOM   106  N  NH1 . ARG A 1 16  ? 24.656 53.562 66.953 1.00 12.45  ? 16   ARG A NH1 1 
ATOM   107  N  NH2 . ARG A 1 16  ? 23.588 51.921 68.147 1.00 11.82  ? 16   ARG A NH2 1 
ATOM   108  N  N   . ASN A 1 17  ? 24.113 48.006 62.699 1.00 10.54  ? 17   ASN A N   1 
ATOM   109  C  CA  . ASN A 1 17  ? 23.884 46.590 62.424 1.00 9.58   ? 17   ASN A CA  1 
ATOM   110  C  C   . ASN A 1 17  ? 24.100 46.271 60.941 1.00 14.55  ? 17   ASN A C   1 
ATOM   111  O  O   . ASN A 1 17  ? 24.625 45.215 60.623 1.00 11.31  ? 17   ASN A O   1 
ATOM   112  C  CB  . ASN A 1 17  ? 22.460 46.191 62.838 1.00 11.38  ? 17   ASN A CB  1 
ATOM   113  C  CG  . ASN A 1 17  ? 22.292 45.932 64.327 1.00 12.75  ? 17   ASN A CG  1 
ATOM   114  O  OD1 . ASN A 1 17  ? 23.187 45.377 64.973 1.00 10.07  ? 17   ASN A OD1 1 
ATOM   115  N  ND2 . ASN A 1 17  ? 21.134 46.343 64.844 1.00 10.15  ? 17   ASN A ND2 1 
ATOM   116  N  N   . THR A 1 18  ? 23.682 47.156 60.033 1.00 9.73   ? 18   THR A N   1 
ATOM   117  C  CA  . THR A 1 18  ? 23.807 46.918 58.599 1.00 10.40  ? 18   THR A CA  1 
ATOM   118  C  C   . THR A 1 18  ? 25.275 46.814 58.197 1.00 11.73  ? 18   THR A C   1 
ATOM   119  O  O   . THR A 1 18  ? 25.678 45.920 57.453 1.00 11.60  ? 18   THR A O   1 
ATOM   120  C  CB  . THR A 1 18  ? 23.109 48.030 57.793 1.00 11.59  ? 18   THR A CB  1 
ATOM   121  O  OG1 . THR A 1 18  ? 21.716 48.092 58.184 1.00 12.04  ? 18   THR A OG1 1 
ATOM   122  C  CG2 . THR A 1 18  ? 23.171 47.727 56.300 1.00 10.50  ? 18   THR A CG2 1 
ATOM   123  N  N   . LEU A 1 19  ? 26.032 47.783 58.727 1.00 11.86  ? 19   LEU A N   1 
ATOM   124  C  CA  . LEU A 1 19  ? 27.469 47.837 58.415 1.00 13.32  ? 19   LEU A CA  1 
ATOM   125  C  C   . LEU A 1 19  ? 28.115 46.534 58.874 1.00 10.53  ? 19   LEU A C   1 
ATOM   126  O  O   . LEU A 1 19  ? 28.925 45.949 58.137 1.00 11.17  ? 19   LEU A O   1 
ATOM   127  C  CB  . LEU A 1 19  ? 28.122 49.064 59.069 1.00 9.82   ? 19   LEU A CB  1 
ATOM   128  C  CG  . LEU A 1 19  ? 29.639 49.223 58.899 1.00 10.56  ? 19   LEU A CG  1 
ATOM   129  C  CD1 . LEU A 1 19  ? 30.023 49.062 57.428 1.00 8.73   ? 19   LEU A CD1 1 
ATOM   130  C  CD2 . LEU A 1 19  ? 30.099 50.574 59.464 1.00 13.61  ? 19   LEU A CD2 1 
ATOM   131  N  N   . GLU A 1 20  ? 27.764 46.072 60.093 1.00 10.95  ? 20   GLU A N   1 
ATOM   132  C  CA  . GLU A 1 20  ? 28.425 44.823 60.545 1.00 12.00  ? 20   GLU A CA  1 
ATOM   133  C  C   . GLU A 1 20  ? 27.936 43.653 59.701 1.00 11.59  ? 20   GLU A C   1 
ATOM   134  O  O   . GLU A 1 20  ? 28.693 42.697 59.426 1.00 10.93  ? 20   GLU A O   1 
ATOM   135  C  CB  . GLU A 1 20  ? 28.225 44.575 62.034 1.00 9.65   ? 20   GLU A CB  1 
ATOM   136  C  CG  . GLU A 1 20  ? 28.679 45.735 62.917 1.00 9.74   ? 20   GLU A CG  1 
ATOM   137  C  CD  . GLU A 1 20  ? 30.167 46.068 62.931 1.00 13.39  ? 20   GLU A CD  1 
ATOM   138  O  OE1 . GLU A 1 20  ? 30.819 46.128 61.854 1.00 16.54  ? 20   GLU A OE1 1 
ATOM   139  O  OE2 . GLU A 1 20  ? 30.668 46.326 64.066 1.00 13.40  ? 20   GLU A OE2 1 
ATOM   140  N  N   . MET A 1 21  ? 26.687 43.652 59.232 1.00 9.91   ? 21   MET A N   1 
ATOM   141  C  CA  . MET A 1 21  ? 26.312 42.525 58.367 1.00 10.58  ? 21   MET A CA  1 
ATOM   142  C  C   . MET A 1 21  ? 27.049 42.583 57.034 1.00 9.86   ? 21   MET A C   1 
ATOM   143  O  O   . MET A 1 21  ? 27.436 41.535 56.498 1.00 12.34  ? 21   MET A O   1 
ATOM   144  C  CB  . MET A 1 21  ? 24.797 42.459 58.097 1.00 10.81  ? 21   MET A CB  1 
ATOM   145  C  CG  . MET A 1 21  ? 24.085 41.627 59.162 1.00 14.36  ? 21   MET A CG  1 
ATOM   146  S  SD  . MET A 1 21  ? 22.298 41.552 58.853 1.00 15.87  ? 21   MET A SD  1 
ATOM   147  C  CE  . MET A 1 21  ? 21.740 43.126 59.514 1.00 16.51  ? 21   MET A CE  1 
ATOM   148  N  N   . ILE A 1 22  ? 27.281 43.797 56.498 1.00 10.55  ? 22   ILE A N   1 
ATOM   149  C  CA  . ILE A 1 22  ? 28.075 43.874 55.272 1.00 10.43  ? 22   ILE A CA  1 
ATOM   150  C  C   . ILE A 1 22  ? 29.461 43.264 55.521 1.00 14.52  ? 22   ILE A C   1 
ATOM   151  O  O   . ILE A 1 22  ? 29.927 42.423 54.741 1.00 11.64  ? 22   ILE A O   1 
ATOM   152  C  CB  . ILE A 1 22  ? 28.213 45.312 54.778 1.00 8.97   ? 22   ILE A CB  1 
ATOM   153  C  CG1 . ILE A 1 22  ? 26.875 45.959 54.373 1.00 13.70  ? 22   ILE A CG1 1 
ATOM   154  C  CG2 . ILE A 1 22  ? 29.179 45.361 53.608 1.00 8.25   ? 22   ILE A CG2 1 
ATOM   155  C  CD1 . ILE A 1 22  ? 26.943 47.479 54.266 1.00 14.96  ? 22   ILE A CD1 1 
ATOM   156  N  N   . ARG A 1 23  ? 30.087 43.686 56.625 1.00 12.10  ? 23   ARG A N   1 
ATOM   157  C  CA  . ARG A 1 23  ? 31.401 43.127 56.948 1.00 9.16   ? 23   ARG A CA  1 
ATOM   158  C  C   . ARG A 1 23  ? 31.357 41.627 57.169 1.00 11.39  ? 23   ARG A C   1 
ATOM   159  O  O   . ARG A 1 23  ? 32.339 40.970 56.810 1.00 14.26  ? 23   ARG A O   1 
ATOM   160  C  CB  . ARG A 1 23  ? 31.971 43.837 58.184 1.00 11.75  ? 23   ARG A CB  1 
ATOM   161  C  CG  . ARG A 1 23  ? 32.244 45.315 57.853 1.00 12.40  ? 23   ARG A CG  1 
ATOM   162  C  CD  . ARG A 1 23  ? 32.699 46.023 59.127 1.00 13.88  ? 23   ARG A CD  1 
ATOM   163  N  NE  . ARG A 1 23  ? 33.267 47.327 58.775 1.00 11.92  ? 23   ARG A NE  1 
ATOM   164  C  CZ  . ARG A 1 23  ? 33.235 48.373 59.590 1.00 11.63  ? 23   ARG A CZ  1 
ATOM   165  N  NH1 . ARG A 1 23  ? 32.675 48.337 60.796 1.00 13.18  ? 23   ARG A NH1 1 
ATOM   166  N  NH2 . ARG A 1 23  ? 33.803 49.483 59.129 1.00 13.04  ? 23   ARG A NH2 1 
ATOM   167  N  N   . ASN A 1 24  ? 30.276 41.098 57.737 1.00 9.17   ? 24   ASN A N   1 
ATOM   168  C  CA  . ASN A 1 24  ? 30.198 39.656 57.993 1.00 9.77   ? 24   ASN A CA  1 
ATOM   169  C  C   . ASN A 1 24  ? 30.014 38.874 56.693 1.00 13.28  ? 24   ASN A C   1 
ATOM   170  O  O   . ASN A 1 24  ? 30.132 37.635 56.691 1.00 15.39  ? 24   ASN A O   1 
ATOM   171  C  CB  . ASN A 1 24  ? 29.068 39.337 58.978 1.00 16.41  ? 24   ASN A CB  1 
ATOM   172  C  CG  . ASN A 1 24  ? 29.096 37.917 59.525 1.00 17.44  ? 24   ASN A CG  1 
ATOM   173  O  OD1 . ASN A 1 24  ? 28.024 37.304 59.655 1.00 18.99  ? 24   ASN A OD1 1 
ATOM   174  N  ND2 . ASN A 1 24  ? 30.293 37.424 59.842 1.00 8.87   ? 24   ASN A ND2 1 
ATOM   175  N  N   . SER A 1 25  ? 29.752 39.531 55.575 1.00 11.38  ? 25   SER A N   1 
ATOM   176  C  CA  . SER A 1 25  ? 29.711 38.826 54.291 1.00 13.58  ? 25   SER A CA  1 
ATOM   177  C  C   . SER A 1 25  ? 31.087 38.800 53.641 1.00 16.51  ? 25   SER A C   1 
ATOM   178  O  O   . SER A 1 25  ? 31.243 38.197 52.568 1.00 15.61  ? 25   SER A O   1 
ATOM   179  C  CB  . SER A 1 25  ? 28.732 39.455 53.307 1.00 10.46  ? 25   SER A CB  1 
ATOM   180  O  OG  . SER A 1 25  ? 29.254 40.661 52.733 1.00 13.82  ? 25   SER A OG  1 
ATOM   181  N  N   . GLY A 1 26  ? 32.060 39.444 54.265 1.00 13.14  ? 26   GLY A N   1 
ATOM   182  C  CA  . GLY A 1 26  ? 33.439 39.386 53.786 1.00 13.74  ? 26   GLY A CA  1 
ATOM   183  C  C   . GLY A 1 26  ? 33.876 40.596 53.007 1.00 19.83  ? 26   GLY A C   1 
ATOM   184  O  O   . GLY A 1 26  ? 34.975 40.582 52.411 1.00 18.97  ? 26   GLY A O   1 
ATOM   185  N  N   . THR A 1 27  ? 33.089 41.679 52.946 1.00 18.17  ? 27   THR A N   1 
ATOM   186  C  CA  . THR A 1 27  ? 33.744 42.856 52.338 1.00 24.01  ? 27   THR A CA  1 
ATOM   187  C  C   . THR A 1 27  ? 33.567 44.104 53.212 1.00 19.76  ? 27   THR A C   1 
ATOM   188  O  O   . THR A 1 27  ? 32.614 44.280 53.950 1.00 16.98  ? 27   THR A O   1 
ATOM   189  C  CB  . THR A 1 27  ? 33.403 43.186 50.872 1.00 38.00  ? 27   THR A CB  1 
ATOM   190  O  OG1 . THR A 1 27  ? 32.600 44.367 50.704 1.00 36.65  ? 27   THR A OG1 1 
ATOM   191  C  CG2 . THR A 1 27  ? 32.634 42.079 50.194 1.00 13.01  ? 27   THR A CG2 1 
ATOM   192  N  N   . GLU A 1 28  ? 34.591 44.944 53.128 1.00 14.85  ? 28   GLU A N   1 
ATOM   193  C  CA  . GLU A 1 28  ? 34.612 46.269 53.729 1.00 11.89  ? 28   GLU A CA  1 
ATOM   194  C  C   . GLU A 1 28  ? 34.068 47.265 52.706 1.00 17.20  ? 28   GLU A C   1 
ATOM   195  O  O   . GLU A 1 28  ? 34.665 47.496 51.635 1.00 17.29  ? 28   GLU A O   1 
ATOM   196  C  CB  . GLU A 1 28  ? 36.040 46.639 54.143 1.00 20.03  ? 28   GLU A CB  1 
ATOM   197  C  CG  . GLU A 1 28  ? 36.153 48.053 54.710 1.00 17.93  ? 28   GLU A CG  1 
ATOM   198  C  CD  . GLU A 1 28  ? 35.476 48.141 56.077 1.00 22.25  ? 28   GLU A CD  1 
ATOM   199  O  OE1 . GLU A 1 28  ? 35.301 49.273 56.596 1.00 20.22  ? 28   GLU A OE1 1 
ATOM   200  O  OE2 . GLU A 1 28  ? 35.107 47.098 56.653 1.00 14.94  ? 28   GLU A OE2 1 
ATOM   201  N  N   . PRO A 1 29  ? 32.908 47.855 53.000 1.00 15.03  ? 29   PRO A N   1 
ATOM   202  C  CA  . PRO A 1 29  ? 32.278 48.762 52.027 1.00 11.40  ? 29   PRO A CA  1 
ATOM   203  C  C   . PRO A 1 29  ? 32.939 50.139 52.041 1.00 15.73  ? 29   PRO A C   1 
ATOM   204  O  O   . PRO A 1 29  ? 33.642 50.502 52.998 1.00 14.81  ? 29   PRO A O   1 
ATOM   205  C  CB  . PRO A 1 29  ? 30.852 48.865 52.584 1.00 12.00  ? 29   PRO A CB  1 
ATOM   206  C  CG  . PRO A 1 29  ? 31.078 48.804 54.093 1.00 10.31  ? 29   PRO A CG  1 
ATOM   207  C  CD  . PRO A 1 29  ? 32.139 47.733 54.257 1.00 12.75  ? 29   PRO A CD  1 
ATOM   208  N  N   . THR A 1 30  ? 32.701 50.924 50.998 1.00 15.35  ? 30   THR A N   1 
ATOM   209  C  CA  . THR A 1 30  ? 32.987 52.353 51.031 1.00 14.41  ? 30   THR A CA  1 
ATOM   210  C  C   . THR A 1 30  ? 31.975 52.964 52.007 1.00 14.33  ? 30   THR A C   1 
ATOM   211  O  O   . THR A 1 30  ? 30.797 52.606 51.863 1.00 14.07  ? 30   THR A O   1 
ATOM   212  C  CB  . THR A 1 30  ? 32.824 52.995 49.651 1.00 18.40  ? 30   THR A CB  1 
ATOM   213  O  OG1 . THR A 1 30  ? 33.866 52.496 48.798 1.00 18.68  ? 30   THR A OG1 1 
ATOM   214  C  CG2 . THR A 1 30  ? 32.938 54.511 49.748 1.00 17.07  ? 30   THR A CG2 1 
ATOM   215  N  N   . ILE A 1 31  ? 32.416 53.769 52.949 1.00 13.06  ? 31   ILE A N   1 
ATOM   216  C  CA  . ILE A 1 31  ? 31.495 54.341 53.941 1.00 9.78   ? 31   ILE A CA  1 
ATOM   217  C  C   . ILE A 1 31  ? 31.342 55.824 53.656 1.00 18.43  ? 31   ILE A C   1 
ATOM   218  O  O   . ILE A 1 31  ? 32.346 56.537 53.707 1.00 16.70  ? 31   ILE A O   1 
ATOM   219  C  CB  . ILE A 1 31  ? 32.006 54.087 55.351 1.00 13.43  ? 31   ILE A CB  1 
ATOM   220  C  CG1 . ILE A 1 31  ? 32.133 52.593 55.700 1.00 16.10  ? 31   ILE A CG1 1 
ATOM   221  C  CG2 . ILE A 1 31  ? 31.132 54.806 56.383 1.00 14.44  ? 31   ILE A CG2 1 
ATOM   222  C  CD1 . ILE A 1 31  ? 32.818 52.306 57.032 1.00 17.50  ? 31   ILE A CD1 1 
ATOM   223  N  N   . ILE A 1 32  ? 30.116 56.236 53.357 1.00 12.65  ? 32   ILE A N   1 
ATOM   224  C  CA  . ILE A 1 32  ? 29.842 57.660 53.136 1.00 9.24   ? 32   ILE A CA  1 
ATOM   225  C  C   . ILE A 1 32  ? 29.037 58.193 54.310 1.00 12.41  ? 32   ILE A C   1 
ATOM   226  O  O   . ILE A 1 32  ? 27.933 57.695 54.583 1.00 13.40  ? 32   ILE A O   1 
ATOM   227  C  CB  . ILE A 1 32  ? 29.110 57.929 51.810 1.00 11.51  ? 32   ILE A CB  1 
ATOM   228  C  CG1 . ILE A 1 32  ? 29.906 57.466 50.584 1.00 12.93  ? 32   ILE A CG1 1 
ATOM   229  C  CG2 . ILE A 1 32  ? 28.735 59.399 51.684 1.00 14.00  ? 32   ILE A CG2 1 
ATOM   230  C  CD1 . ILE A 1 32  ? 29.187 57.499 49.258 1.00 17.85  ? 32   ILE A CD1 1 
ATOM   231  N  N   . LEU A 1 33  ? 29.603 59.184 54.994 1.00 11.05  ? 33   LEU A N   1 
ATOM   232  C  CA  . LEU A 1 33  ? 28.913 59.781 56.123 1.00 14.01  ? 33   LEU A CA  1 
ATOM   233  C  C   . LEU A 1 33  ? 27.926 60.823 55.587 1.00 15.41  ? 33   LEU A C   1 
ATOM   234  O  O   . LEU A 1 33  ? 28.355 61.972 55.465 1.00 15.15  ? 33   LEU A O   1 
ATOM   235  C  CB  . LEU A 1 33  ? 29.929 60.383 57.115 1.00 16.56  ? 33   LEU A CB  1 
ATOM   236  C  CG  . LEU A 1 33  ? 30.876 59.344 57.736 1.00 16.45  ? 33   LEU A CG  1 
ATOM   237  C  CD1 . LEU A 1 33  ? 31.983 60.033 58.526 1.00 16.60  ? 33   LEU A CD1 1 
ATOM   238  C  CD2 . LEU A 1 33  ? 30.098 58.380 58.630 1.00 19.60  ? 33   LEU A CD2 1 
ATOM   239  N  N   . TYR A 1 34  ? 26.701 60.389 55.258 1.00 12.92  ? 34   TYR A N   1 
ATOM   240  C  CA  . TYR A 1 34  ? 25.791 61.211 54.445 1.00 13.71  ? 34   TYR A CA  1 
ATOM   241  C  C   . TYR A 1 34  ? 25.431 62.519 55.136 1.00 16.79  ? 34   TYR A C   1 
ATOM   242  O  O   . TYR A 1 34  ? 25.046 63.503 54.470 1.00 14.18  ? 34   TYR A O   1 
ATOM   243  C  CB  . TYR A 1 34  ? 24.510 60.442 54.018 1.00 13.12  ? 34   TYR A CB  1 
ATOM   244  C  CG  . TYR A 1 34  ? 23.648 60.135 55.226 1.00 11.49  ? 34   TYR A CG  1 
ATOM   245  C  CD1 . TYR A 1 34  ? 22.576 60.965 55.580 1.00 13.01  ? 34   TYR A CD1 1 
ATOM   246  C  CD2 . TYR A 1 34  ? 23.935 59.018 55.992 1.00 11.23  ? 34   TYR A CD2 1 
ATOM   247  C  CE1 . TYR A 1 34  ? 21.797 60.666 56.703 1.00 12.47  ? 34   TYR A CE1 1 
ATOM   248  C  CE2 . TYR A 1 34  ? 23.166 58.723 57.108 1.00 14.61  ? 34   TYR A CE2 1 
ATOM   249  C  CZ  . TYR A 1 34  ? 22.106 59.549 57.440 1.00 14.26  ? 34   TYR A CZ  1 
ATOM   250  O  OH  . TYR A 1 34  ? 21.329 59.268 58.566 1.00 11.32  ? 34   TYR A OH  1 
ATOM   251  N  N   . LEU A 1 35  ? 25.521 62.557 56.471 1.00 15.91  ? 35   LEU A N   1 
ATOM   252  C  CA  . LEU A 1 35  ? 25.187 63.794 57.173 1.00 17.76  ? 35   LEU A CA  1 
ATOM   253  C  C   . LEU A 1 35  ? 26.169 64.898 56.787 1.00 15.99  ? 35   LEU A C   1 
ATOM   254  O  O   . LEU A 1 35  ? 25.782 66.059 56.763 1.00 17.42  ? 35   LEU A O   1 
ATOM   255  C  CB  . LEU A 1 35  ? 25.148 63.589 58.694 1.00 16.73  ? 35   LEU A CB  1 
ATOM   256  C  CG  . LEU A 1 35  ? 23.982 62.735 59.215 1.00 18.72  ? 35   LEU A CG  1 
ATOM   257  C  CD1 . LEU A 1 35  ? 24.141 62.455 60.713 1.00 18.32  ? 35   LEU A CD1 1 
ATOM   258  C  CD2 . LEU A 1 35  ? 22.624 63.374 58.960 1.00 13.38  ? 35   LEU A CD2 1 
ATOM   259  N  N   . GLU A 1 36  ? 27.393 64.512 56.495 1.00 15.58  ? 36   GLU A N   1 
ATOM   260  C  CA  . GLU A 1 36  ? 28.441 65.460 56.137 1.00 19.01  ? 36   GLU A CA  1 
ATOM   261  C  C   . GLU A 1 36  ? 28.702 65.547 54.642 1.00 21.19  ? 36   GLU A C   1 
ATOM   262  O  O   . GLU A 1 36  ? 29.095 66.598 54.128 1.00 22.76  ? 36   GLU A O   1 
ATOM   263  C  CB  . GLU A 1 36  ? 29.773 65.031 56.765 1.00 24.25  ? 36   GLU A CB  1 
ATOM   264  C  CG  . GLU A 1 36  ? 29.625 64.454 58.159 1.00 45.45  ? 36   GLU A CG  1 
ATOM   265  C  CD  . GLU A 1 36  ? 30.992 64.244 58.799 1.00 51.98  ? 36   GLU A CD  1 
ATOM   266  O  OE1 . GLU A 1 36  ? 31.036 64.219 60.043 1.00 48.08  ? 36   GLU A OE1 1 
ATOM   267  O  OE2 . GLU A 1 36  ? 31.979 64.114 58.039 1.00 48.29  ? 36   GLU A OE2 1 
ATOM   268  N  N   . ASN A 1 37  ? 28.508 64.422 53.968 1.00 13.98  ? 37   ASN A N   1 
ATOM   269  C  CA  . ASN A 1 37  ? 28.755 64.311 52.537 1.00 13.60  ? 37   ASN A CA  1 
ATOM   270  C  C   . ASN A 1 37  ? 27.533 63.695 51.877 1.00 16.98  ? 37   ASN A C   1 
ATOM   271  O  O   . ASN A 1 37  ? 27.585 62.521 51.469 1.00 16.13  ? 37   ASN A O   1 
ATOM   272  C  CB  . ASN A 1 37  ? 29.979 63.436 52.279 1.00 20.31  ? 37   ASN A CB  1 
ATOM   273  C  CG  . ASN A 1 37  ? 31.254 64.020 52.850 1.00 41.28  ? 37   ASN A CG  1 
ATOM   274  O  OD1 . ASN A 1 37  ? 31.680 65.103 52.439 1.00 32.55  ? 37   ASN A OD1 1 
ATOM   275  N  ND2 . ASN A 1 37  ? 31.891 63.335 53.796 1.00 42.04  ? 37   ASN A ND2 1 
ATOM   276  N  N   . PRO A 1 38  ? 26.434 64.433 51.801 1.00 15.21  ? 38   PRO A N   1 
ATOM   277  C  CA  . PRO A 1 38  ? 25.223 63.828 51.224 1.00 14.17  ? 38   PRO A CA  1 
ATOM   278  C  C   . PRO A 1 38  ? 25.424 63.576 49.740 1.00 17.99  ? 38   PRO A C   1 
ATOM   279  O  O   . PRO A 1 38  ? 26.272 64.201 49.102 1.00 16.23  ? 38   PRO A O   1 
ATOM   280  C  CB  . PRO A 1 38  ? 24.152 64.907 51.412 1.00 15.44  ? 38   PRO A CB  1 
ATOM   281  C  CG  . PRO A 1 38  ? 24.908 66.186 51.532 1.00 18.73  ? 38   PRO A CG  1 
ATOM   282  C  CD  . PRO A 1 38  ? 26.202 65.817 52.224 1.00 16.15  ? 38   PRO A CD  1 
ATOM   283  N  N   . PRO A 1 39  ? 24.632 62.687 49.164 1.00 15.98  ? 39   PRO A N   1 
ATOM   284  C  CA  . PRO A 1 39  ? 24.738 62.467 47.718 1.00 14.80  ? 39   PRO A CA  1 
ATOM   285  C  C   . PRO A 1 39  ? 24.331 63.757 47.004 1.00 18.54  ? 39   PRO A C   1 
ATOM   286  O  O   . PRO A 1 39  ? 23.622 64.599 47.548 1.00 16.20  ? 39   PRO A O   1 
ATOM   287  C  CB  . PRO A 1 39  ? 23.690 61.390 47.455 1.00 15.76  ? 39   PRO A CB  1 
ATOM   288  C  CG  . PRO A 1 39  ? 22.681 61.649 48.553 1.00 18.61  ? 39   PRO A CG  1 
ATOM   289  C  CD  . PRO A 1 39  ? 23.557 61.886 49.776 1.00 15.65  ? 39   PRO A CD  1 
ATOM   290  N  N   . SER A 1 40  ? 24.785 63.890 45.773 1.00 18.91  ? 40   SER A N   1 
ATOM   291  C  CA  . SER A 1 40  ? 24.314 64.910 44.848 1.00 17.54  ? 40   SER A CA  1 
ATOM   292  C  C   . SER A 1 40  ? 22.845 64.670 44.506 1.00 17.56  ? 40   SER A C   1 
ATOM   293  O  O   . SER A 1 40  ? 22.308 63.573 44.713 1.00 14.09  ? 40   SER A O   1 
ATOM   294  C  CB  . SER A 1 40  ? 25.146 64.842 43.556 1.00 15.60  ? 40   SER A CB  1 
ATOM   295  O  OG  . SER A 1 40  ? 24.710 63.740 42.741 1.00 16.10  ? 40   SER A OG  1 
ATOM   296  N  N   . ARG A 1 41  ? 22.213 65.699 43.938 1.00 14.25  ? 41   ARG A N   1 
ATOM   297  C  CA  . ARG A 1 41  ? 20.811 65.542 43.563 1.00 16.37  ? 41   ARG A CA  1 
ATOM   298  C  C   . ARG A 1 41  ? 20.637 64.384 42.579 1.00 16.84  ? 41   ARG A C   1 
ATOM   299  O  O   . ARG A 1 41  ? 19.759 63.533 42.706 1.00 14.07  ? 41   ARG A O   1 
ATOM   300  C  CB  . ARG A 1 41  ? 20.280 66.875 42.986 1.00 13.75  ? 41   ARG A CB  1 
ATOM   301  C  CG  . ARG A 1 41  ? 18.790 66.824 42.717 1.00 15.38  ? 41   ARG A CG  1 
ATOM   302  C  CD  . ARG A 1 41  ? 18.210 68.167 42.296 1.00 14.81  ? 41   ARG A CD  1 
ATOM   303  N  NE  . ARG A 1 41  ? 16.827 68.303 42.779 1.00 16.91  ? 41   ARG A NE  1 
ATOM   304  C  CZ  . ARG A 1 41  ? 15.785 67.660 42.262 1.00 15.12  ? 41   ARG A CZ  1 
ATOM   305  N  NH1 . ARG A 1 41  ? 15.945 66.831 41.224 1.00 16.69  ? 41   ARG A NH1 1 
ATOM   306  N  NH2 . ARG A 1 41  ? 14.562 67.828 42.753 1.00 14.08  ? 41   ARG A NH2 1 
ATOM   307  N  N   . ASP A 1 42  ? 21.491 64.363 41.551 1.00 15.69  ? 42   ASP A N   1 
ATOM   308  C  CA  . ASP A 1 42  ? 21.419 63.290 40.567 1.00 19.79  ? 42   ASP A CA  1 
ATOM   309  C  C   . ASP A 1 42  ? 21.572 61.926 41.230 1.00 19.33  ? 42   ASP A C   1 
ATOM   310  O  O   . ASP A 1 42  ? 20.852 60.975 40.907 1.00 16.56  ? 42   ASP A O   1 
ATOM   311  C  CB  . ASP A 1 42  ? 22.512 63.457 39.516 1.00 21.89  ? 42   ASP A CB  1 
ATOM   312  C  CG  . ASP A 1 42  ? 22.189 64.527 38.487 1.00 33.30  ? 42   ASP A CG  1 
ATOM   313  O  OD1 . ASP A 1 42  ? 21.041 65.004 38.446 1.00 28.02  ? 42   ASP A OD1 1 
ATOM   314  O  OD2 . ASP A 1 42  ? 23.085 64.906 37.703 1.00 36.06  ? 42   ASP A OD2 1 
ATOM   315  N  N   . GLU A 1 43  ? 22.516 61.852 42.160 1.00 15.58  ? 43   GLU A N   1 
ATOM   316  C  CA  . GLU A 1 43  ? 22.750 60.553 42.808 1.00 15.56  ? 43   GLU A CA  1 
ATOM   317  C  C   . GLU A 1 43  ? 21.536 60.180 43.669 1.00 17.88  ? 43   GLU A C   1 
ATOM   318  O  O   . GLU A 1 43  ? 21.150 59.010 43.678 1.00 13.45  ? 43   GLU A O   1 
ATOM   319  C  CB  A GLU A 1 43  ? 24.039 60.478 43.607 0.46 18.71  ? 43   GLU A CB  1 
ATOM   320  C  CB  B GLU A 1 43  ? 24.020 60.652 43.666 0.54 17.53  ? 43   GLU A CB  1 
ATOM   321  C  CG  A GLU A 1 43  ? 24.365 59.100 44.138 0.46 11.34  ? 43   GLU A CG  1 
ATOM   322  C  CG  B GLU A 1 43  ? 25.338 61.030 43.050 0.54 31.15  ? 43   GLU A CG  1 
ATOM   323  C  CD  A GLU A 1 43  ? 24.267 57.908 43.227 0.46 10.92  ? 43   GLU A CD  1 
ATOM   324  C  CD  B GLU A 1 43  ? 26.566 61.377 43.847 0.54 25.25  ? 43   GLU A CD  1 
ATOM   325  O  OE1 A GLU A 1 43  ? 24.151 56.770 43.751 0.46 19.14  ? 43   GLU A OE1 1 
ATOM   326  O  OE1 B GLU A 1 43  ? 26.605 61.724 45.036 0.54 5.89   ? 43   GLU A OE1 1 
ATOM   327  O  OE2 A GLU A 1 43  ? 24.315 58.006 41.994 0.46 18.51  ? 43   GLU A OE2 1 
ATOM   328  O  OE2 B GLU A 1 43  ? 27.710 61.351 43.316 0.54 23.53  ? 43   GLU A OE2 1 
ATOM   329  N  N   . LEU A 1 44  ? 20.948 61.134 44.388 1.00 14.61  ? 44   LEU A N   1 
ATOM   330  C  CA  . LEU A 1 44  ? 19.818 60.835 45.281 1.00 14.50  ? 44   LEU A CA  1 
ATOM   331  C  C   . LEU A 1 44  ? 18.609 60.356 44.482 1.00 13.67  ? 44   LEU A C   1 
ATOM   332  O  O   . LEU A 1 44  ? 17.868 59.439 44.843 1.00 13.75  ? 44   LEU A O   1 
ATOM   333  C  CB  . LEU A 1 44  ? 19.466 62.056 46.135 1.00 14.05  ? 44   LEU A CB  1 
ATOM   334  C  CG  . LEU A 1 44  ? 18.301 61.871 47.128 1.00 12.32  ? 44   LEU A CG  1 
ATOM   335  C  CD1 . LEU A 1 44  ? 18.478 60.637 47.999 1.00 13.48  ? 44   LEU A CD1 1 
ATOM   336  C  CD2 . LEU A 1 44  ? 18.154 63.143 47.971 1.00 14.15  ? 44   LEU A CD2 1 
ATOM   337  N  N   . VAL A 1 45  ? 18.402 61.008 43.323 1.00 13.12  ? 45   VAL A N   1 
ATOM   338  C  CA  . VAL A 1 45  ? 17.306 60.593 42.450 1.00 16.84  ? 45   VAL A CA  1 
ATOM   339  C  C   . VAL A 1 45  ? 17.491 59.153 41.992 1.00 18.10  ? 45   VAL A C   1 
ATOM   340  O  O   . VAL A 1 45  ? 16.592 58.308 41.984 1.00 15.18  ? 45   VAL A O   1 
ATOM   341  C  CB  . VAL A 1 45  ? 17.218 61.568 41.250 1.00 16.21  ? 45   VAL A CB  1 
ATOM   342  C  CG1 . VAL A 1 45  ? 16.340 60.986 40.142 1.00 15.17  ? 45   VAL A CG1 1 
ATOM   343  C  CG2 . VAL A 1 45  ? 16.695 62.936 41.684 1.00 16.59  ? 45   VAL A CG2 1 
ATOM   344  N  N   . LYS A 1 46  ? 18.738 58.835 41.614 1.00 15.94  ? 46   LYS A N   1 
ATOM   345  C  CA  . LYS A 1 46  ? 19.045 57.465 41.213 1.00 15.30  ? 46   LYS A CA  1 
ATOM   346  C  C   . LYS A 1 46  ? 18.866 56.461 42.348 1.00 18.76  ? 46   LYS A C   1 
ATOM   347  O  O   . LYS A 1 46  ? 18.317 55.365 42.162 1.00 16.73  ? 46   LYS A O   1 
ATOM   348  C  CB  . LYS A 1 46  ? 20.475 57.395 40.673 1.00 16.21  ? 46   LYS A CB  1 
ATOM   349  C  CG  . LYS A 1 46  ? 20.769 55.990 40.153 1.00 25.85  ? 46   LYS A CG  1 
ATOM   350  C  CD  . LYS A 1 46  ? 22.110 55.949 39.426 1.00 40.33  ? 46   LYS A CD  1 
ATOM   351  C  CE  . LYS A 1 46  ? 22.465 54.514 39.053 1.00 47.85  ? 46   LYS A CE  1 
ATOM   352  N  NZ  . LYS A 1 46  ? 23.930 54.271 39.201 1.00 85.10  ? 46   LYS A NZ  1 
ATOM   353  N  N   . LEU A 1 47  ? 19.323 56.845 43.540 1.00 13.29  ? 47   LEU A N   1 
ATOM   354  C  CA  . LEU A 1 47  ? 19.182 55.930 44.684 1.00 12.49  ? 47   LEU A CA  1 
ATOM   355  C  C   . LEU A 1 47  ? 17.720 55.587 44.922 1.00 14.01  ? 47   LEU A C   1 
ATOM   356  O  O   . LEU A 1 47  ? 17.318 54.441 45.146 1.00 13.52  ? 47   LEU A O   1 
ATOM   357  C  CB  . LEU A 1 47  ? 19.793 56.551 45.944 1.00 10.45  ? 47   LEU A CB  1 
ATOM   358  C  CG  . LEU A 1 47  ? 21.324 56.721 45.920 1.00 12.61  ? 47   LEU A CG  1 
ATOM   359  C  CD1 . LEU A 1 47  ? 21.775 57.541 47.132 1.00 14.34  ? 47   LEU A CD1 1 
ATOM   360  C  CD2 . LEU A 1 47  ? 22.049 55.386 45.916 1.00 17.92  ? 47   LEU A CD2 1 
ATOM   361  N  N   . ILE A 1 48  ? 16.926 56.674 44.881 1.00 12.76  ? 48   ILE A N   1 
ATOM   362  C  CA  . ILE A 1 48  ? 15.514 56.462 45.197 1.00 14.76  ? 48   ILE A CA  1 
ATOM   363  C  C   . ILE A 1 48  ? 14.867 55.539 44.179 1.00 14.78  ? 48   ILE A C   1 
ATOM   364  O  O   . ILE A 1 48  ? 14.147 54.601 44.503 1.00 16.14  ? 48   ILE A O   1 
ATOM   365  C  CB  . ILE A 1 48  ? 14.794 57.818 45.306 1.00 16.17  ? 48   ILE A CB  1 
ATOM   366  C  CG1 . ILE A 1 48  ? 15.204 58.580 46.571 1.00 13.74  ? 48   ILE A CG1 1 
ATOM   367  C  CG2 . ILE A 1 48  ? 13.276 57.604 45.233 1.00 19.67  ? 48   ILE A CG2 1 
ATOM   368  C  CD1 . ILE A 1 48  ? 14.837 60.054 46.537 1.00 12.17  ? 48   ILE A CD1 1 
ATOM   369  N  N   . ALA A 1 49  ? 15.156 55.792 42.918 1.00 16.92  ? 49   ALA A N   1 
ATOM   370  C  CA  . ALA A 1 49  ? 14.644 54.955 41.831 1.00 19.26  ? 49   ALA A CA  1 
ATOM   371  C  C   . ALA A 1 49  ? 15.057 53.505 42.039 1.00 16.15  ? 49   ALA A C   1 
ATOM   372  O  O   . ALA A 1 49  ? 14.268 52.574 41.899 1.00 21.25  ? 49   ALA A O   1 
ATOM   373  C  CB  . ALA A 1 49  ? 15.126 55.484 40.477 1.00 21.32  ? 49   ALA A CB  1 
ATOM   374  N  N   . ASP A 1 50  ? 16.333 53.297 42.385 1.00 17.01  ? 50   ASP A N   1 
ATOM   375  C  CA  . ASP A 1 50  ? 16.784 51.901 42.478 1.00 18.87  ? 50   ASP A CA  1 
ATOM   376  C  C   . ASP A 1 50  ? 16.208 51.231 43.718 1.00 27.05  ? 50   ASP A C   1 
ATOM   377  O  O   . ASP A 1 50  ? 16.009 50.021 43.662 1.00 19.10  ? 50   ASP A O   1 
ATOM   378  C  CB  . ASP A 1 50  ? 18.307 51.834 42.476 1.00 16.04  ? 50   ASP A CB  1 
ATOM   379  C  CG  . ASP A 1 50  ? 18.923 52.222 41.151 1.00 25.74  ? 50   ASP A CG  1 
ATOM   380  O  OD1 . ASP A 1 50  ? 20.158 52.383 41.103 1.00 22.25  ? 50   ASP A OD1 1 
ATOM   381  O  OD2 . ASP A 1 50  ? 18.186 52.364 40.137 1.00 25.30  ? 50   ASP A OD2 1 
ATOM   382  N  N   . MET A 1 51  ? 15.934 51.968 44.797 1.00 16.82  ? 51   MET A N   1 
ATOM   383  C  CA  . MET A 1 51  ? 15.378 51.411 46.004 1.00 16.76  ? 51   MET A CA  1 
ATOM   384  C  C   . MET A 1 51  ? 13.926 50.946 45.849 1.00 17.04  ? 51   MET A C   1 
ATOM   385  O  O   . MET A 1 51  ? 13.469 50.199 46.716 1.00 24.08  ? 51   MET A O   1 
ATOM   386  C  CB  . MET A 1 51  ? 15.402 52.409 47.194 1.00 12.85  ? 51   MET A CB  1 
ATOM   387  C  CG  . MET A 1 51  ? 16.823 52.530 47.719 1.00 15.60  ? 51   MET A CG  1 
ATOM   388  S  SD  . MET A 1 51  ? 16.896 53.537 49.225 1.00 22.55  ? 51   MET A SD  1 
ATOM   389  C  CE  . MET A 1 51  ? 16.849 55.186 48.521 1.00 20.86  ? 51   MET A CE  1 
ATOM   390  N  N   . GLY A 1 52  ? 13.260 51.417 44.799 1.00 18.38  ? 52   GLY A N   1 
ATOM   391  C  CA  . GLY A 1 52  ? 11.883 50.979 44.634 1.00 27.15  ? 52   GLY A CA  1 
ATOM   392  C  C   . GLY A 1 52  ? 10.935 51.455 45.710 1.00 29.13  ? 52   GLY A C   1 
ATOM   393  O  O   . GLY A 1 52  ? 9.909  50.829 45.993 1.00 26.21  ? 52   GLY A O   1 
ATOM   394  N  N   . ILE A 1 53  ? 11.247 52.581 46.345 1.00 22.56  ? 53   ILE A N   1 
ATOM   395  C  CA  . ILE A 1 53  ? 10.346 53.192 47.325 1.00 15.39  ? 53   ILE A CA  1 
ATOM   396  C  C   . ILE A 1 53  ? 10.002 54.627 46.907 1.00 14.42  ? 53   ILE A C   1 
ATOM   397  O  O   . ILE A 1 53  ? 10.693 55.188 46.045 1.00 16.57  ? 53   ILE A O   1 
ATOM   398  C  CB  . ILE A 1 53  ? 10.992 53.223 48.718 1.00 18.64  ? 53   ILE A CB  1 
ATOM   399  C  CG1 . ILE A 1 53  ? 12.217 54.146 48.778 1.00 19.99  ? 53   ILE A CG1 1 
ATOM   400  C  CG2 . ILE A 1 53  ? 11.351 51.816 49.184 1.00 20.39  ? 53   ILE A CG2 1 
ATOM   401  C  CD1 . ILE A 1 53  ? 12.822 54.230 50.165 1.00 16.92  ? 53   ILE A CD1 1 
ATOM   402  N  N   . SER A 1 54  ? 8.949  55.180 47.531 1.00 14.67  ? 54   SER A N   1 
ATOM   403  C  CA  . SER A 1 54  ? 8.590  56.557 47.197 1.00 17.19  ? 54   SER A CA  1 
ATOM   404  C  C   . SER A 1 54  ? 9.565  57.539 47.835 1.00 15.20  ? 54   SER A C   1 
ATOM   405  O  O   . SER A 1 54  ? 10.248 57.230 48.800 1.00 14.94  ? 54   SER A O   1 
ATOM   406  C  CB  . SER A 1 54  ? 7.179  56.913 47.694 1.00 13.65  ? 54   SER A CB  1 
ATOM   407  O  OG  . SER A 1 54  ? 7.166  56.980 49.115 1.00 14.72  ? 54   SER A OG  1 
ATOM   408  N  N   . VAL A 1 55  ? 9.603  58.752 47.293 1.00 12.11  ? 55   VAL A N   1 
ATOM   409  C  CA  . VAL A 1 55  ? 10.456 59.751 47.915 1.00 12.18  ? 55   VAL A CA  1 
ATOM   410  C  C   . VAL A 1 55  ? 10.058 59.966 49.356 1.00 14.59  ? 55   VAL A C   1 
ATOM   411  O  O   . VAL A 1 55  ? 10.868 60.023 50.279 1.00 15.28  ? 55   VAL A O   1 
ATOM   412  C  CB  . VAL A 1 55  ? 10.353 61.071 47.130 1.00 13.76  ? 55   VAL A CB  1 
ATOM   413  C  CG1 . VAL A 1 55  ? 11.146 62.141 47.861 1.00 14.22  ? 55   VAL A CG1 1 
ATOM   414  C  CG2 . VAL A 1 55  ? 10.824 60.839 45.707 1.00 14.74  ? 55   VAL A CG2 1 
ATOM   415  N  N   . ARG A 1 56  ? 8.741  60.070 49.593 1.00 14.74  ? 56   ARG A N   1 
ATOM   416  C  CA  . ARG A 1 56  ? 8.302  60.292 50.964 1.00 12.99  ? 56   ARG A CA  1 
ATOM   417  C  C   . ARG A 1 56  ? 8.722  59.144 51.880 1.00 13.92  ? 56   ARG A C   1 
ATOM   418  O  O   . ARG A 1 56  ? 9.025  59.374 53.070 1.00 13.86  ? 56   ARG A O   1 
ATOM   419  C  CB  . ARG A 1 56  ? 6.778  60.513 50.999 1.00 10.18  ? 56   ARG A CB  1 
ATOM   420  C  CG  . ARG A 1 56  ? 6.289  60.584 52.460 1.00 11.74  ? 56   ARG A CG  1 
ATOM   421  C  CD  . ARG A 1 56  ? 4.835  61.032 52.474 1.00 15.78  ? 56   ARG A CD  1 
ATOM   422  N  NE  . ARG A 1 56  ? 4.656  62.449 52.151 1.00 16.56  ? 56   ARG A NE  1 
ATOM   423  C  CZ  . ARG A 1 56  ? 4.809  63.415 53.060 1.00 18.92  ? 56   ARG A CZ  1 
ATOM   424  N  NH1 . ARG A 1 56  ? 4.625  64.701 52.716 1.00 12.81  ? 56   ARG A NH1 1 
ATOM   425  N  NH2 . ARG A 1 56  ? 5.151  63.140 54.323 1.00 16.23  ? 56   ARG A NH2 1 
ATOM   426  N  N   . ALA A 1 57  ? 8.749  57.914 51.346 1.00 14.64  ? 57   ALA A N   1 
ATOM   427  C  CA  . ALA A 1 57  ? 9.081  56.791 52.238 1.00 17.33  ? 57   ALA A CA  1 
ATOM   428  C  C   . ALA A 1 57  ? 10.531 56.892 52.696 1.00 15.11  ? 57   ALA A C   1 
ATOM   429  O  O   . ALA A 1 57  ? 10.937 56.218 53.653 1.00 17.86  ? 57   ALA A O   1 
ATOM   430  C  CB  . ALA A 1 57  ? 8.780  55.459 51.572 1.00 14.16  ? 57   ALA A CB  1 
ATOM   431  N  N   . LEU A 1 58  ? 11.348 57.707 52.027 1.00 13.05  ? 58   LEU A N   1 
ATOM   432  C  CA  . LEU A 1 58  ? 12.742 57.844 52.487 1.00 12.60  ? 58   LEU A CA  1 
ATOM   433  C  C   . LEU A 1 58  ? 12.870 58.880 53.594 1.00 16.16  ? 58   LEU A C   1 
ATOM   434  O  O   . LEU A 1 58  ? 13.884 58.925 54.317 1.00 12.49  ? 58   LEU A O   1 
ATOM   435  C  CB  . LEU A 1 58  ? 13.635 58.164 51.286 1.00 13.38  ? 58   LEU A CB  1 
ATOM   436  C  CG  . LEU A 1 58  ? 15.147 58.272 51.534 1.00 11.35  ? 58   LEU A CG  1 
ATOM   437  C  CD1 . LEU A 1 58  ? 15.643 56.958 52.137 1.00 10.82  ? 58   LEU A CD1 1 
ATOM   438  C  CD2 . LEU A 1 58  ? 15.874 58.618 50.251 1.00 15.25  ? 58   LEU A CD2 1 
ATOM   439  N  N   . LEU A 1 59  ? 11.873 59.748 53.803 1.00 14.14  ? 59   LEU A N   1 
ATOM   440  C  CA  . LEU A 1 59  ? 11.989 60.750 54.862 1.00 11.57  ? 59   LEU A CA  1 
ATOM   441  C  C   . LEU A 1 59  ? 12.006 60.202 56.289 1.00 13.44  ? 59   LEU A C   1 
ATOM   442  O  O   . LEU A 1 59  ? 11.104 59.460 56.704 1.00 13.19  ? 59   LEU A O   1 
ATOM   443  C  CB  . LEU A 1 59  ? 10.785 61.714 54.806 1.00 14.48  ? 59   LEU A CB  1 
ATOM   444  C  CG  . LEU A 1 59  ? 10.686 62.626 53.580 1.00 15.82  ? 59   LEU A CG  1 
ATOM   445  C  CD1 . LEU A 1 59  ? 9.340  63.345 53.583 1.00 12.88  ? 59   LEU A CD1 1 
ATOM   446  C  CD2 . LEU A 1 59  ? 11.820 63.647 53.552 1.00 13.08  ? 59   LEU A CD2 1 
ATOM   447  N  N   . ARG A 1 60  ? 13.006 60.573 57.089 1.00 10.62  ? 60   ARG A N   1 
ATOM   448  C  CA  . ARG A 1 60  ? 13.096 60.178 58.479 1.00 13.39  ? 60   ARG A CA  1 
ATOM   449  C  C   . ARG A 1 60  ? 12.253 61.133 59.335 1.00 11.74  ? 60   ARG A C   1 
ATOM   450  O  O   . ARG A 1 60  ? 12.371 62.356 59.215 1.00 14.95  ? 60   ARG A O   1 
ATOM   451  C  CB  . ARG A 1 60  ? 14.552 60.148 58.972 1.00 14.26  ? 60   ARG A CB  1 
ATOM   452  C  CG  . ARG A 1 60  ? 14.665 59.592 60.383 1.00 10.18  ? 60   ARG A CG  1 
ATOM   453  C  CD  . ARG A 1 60  ? 16.096 59.205 60.739 1.00 16.48  ? 60   ARG A CD  1 
ATOM   454  N  NE  . ARG A 1 60  ? 16.071 58.832 62.178 1.00 16.56  ? 60   ARG A NE  1 
ATOM   455  C  CZ  . ARG A 1 60  ? 15.800 57.582 62.554 1.00 21.02  ? 60   ARG A CZ  1 
ATOM   456  N  NH1 . ARG A 1 60  ? 15.571 56.632 61.661 1.00 15.86  ? 60   ARG A NH1 1 
ATOM   457  N  NH2 . ARG A 1 60  ? 15.788 57.319 63.854 1.00 14.92  ? 60   ARG A NH2 1 
ATOM   458  N  N   . LYS A 1 61  ? 11.378 60.545 60.153 1.00 12.13  ? 61   LYS A N   1 
ATOM   459  C  CA  . LYS A 1 61  ? 10.516 61.371 61.006 1.00 13.70  ? 61   LYS A CA  1 
ATOM   460  C  C   . LYS A 1 61  ? 11.228 61.694 62.311 1.00 18.54  ? 61   LYS A C   1 
ATOM   461  O  O   . LYS A 1 61  ? 12.295 61.150 62.612 1.00 21.10  ? 61   LYS A O   1 
ATOM   462  C  CB  . LYS A 1 61  ? 9.194  60.635 61.226 1.00 14.24  ? 61   LYS A CB  1 
ATOM   463  C  CG  . LYS A 1 61  ? 8.495  60.181 59.944 1.00 12.84  ? 61   LYS A CG  1 
ATOM   464  C  CD  . LYS A 1 61  ? 7.157  59.514 60.288 1.00 23.25  ? 61   LYS A CD  1 
ATOM   465  C  CE  . LYS A 1 61  ? 6.433  59.038 59.043 1.00 31.16  ? 61   LYS A CE  1 
ATOM   466  N  NZ  . LYS A 1 61  ? 5.154  58.346 59.388 1.00 39.50  ? 61   LYS A NZ  1 
ATOM   467  N  N   . ASN A 1 62  ? 10.705 62.575 63.160 1.00 21.58  ? 62   ASN A N   1 
ATOM   468  C  CA  . ASN A 1 62  ? 11.259 62.774 64.496 1.00 17.41  ? 62   ASN A CA  1 
ATOM   469  C  C   . ASN A 1 62  ? 12.660 63.382 64.420 1.00 17.74  ? 62   ASN A C   1 
ATOM   470  O  O   . ASN A 1 62  ? 13.498 63.138 65.276 1.00 18.36  ? 62   ASN A O   1 
ATOM   471  C  CB  . ASN A 1 62  ? 11.341 61.486 65.335 1.00 17.28  ? 62   ASN A CB  1 
ATOM   472  C  CG  . ASN A 1 62  ? 11.389 61.872 66.799 1.00 19.65  ? 62   ASN A CG  1 
ATOM   473  O  OD1 . ASN A 1 62  ? 12.026 61.249 67.666 1.00 23.07  ? 62   ASN A OD1 1 
ATOM   474  N  ND2 . ASN A 1 62  ? 10.680 62.959 67.073 1.00 12.77  ? 62   ASN A ND2 1 
ATOM   475  N  N   . VAL A 1 63  ? 12.876 64.185 63.373 1.00 11.86  ? 63   VAL A N   1 
ATOM   476  C  CA  . VAL A 1 63  ? 14.076 65.006 63.304 1.00 10.09  ? 63   VAL A CA  1 
ATOM   477  C  C   . VAL A 1 63  ? 13.637 66.461 63.067 1.00 14.60  ? 63   VAL A C   1 
ATOM   478  O  O   . VAL A 1 63  ? 12.570 66.680 62.495 1.00 11.90  ? 63   VAL A O   1 
ATOM   479  C  CB  . VAL A 1 63  ? 15.059 64.566 62.204 1.00 14.06  ? 63   VAL A CB  1 
ATOM   480  C  CG1 . VAL A 1 63  ? 15.560 63.153 62.515 1.00 17.14  ? 63   VAL A CG1 1 
ATOM   481  C  CG2 . VAL A 1 63  ? 14.430 64.641 60.824 1.00 10.86  ? 63   VAL A CG2 1 
ATOM   482  N  N   . GLU A 1 64  ? 14.459 67.390 63.489 1.00 12.19  ? 64   GLU A N   1 
ATOM   483  C  CA  . GLU A 1 64  ? 14.135 68.820 63.474 1.00 12.01  ? 64   GLU A CA  1 
ATOM   484  C  C   . GLU A 1 64  ? 13.595 69.351 62.157 1.00 13.91  ? 64   GLU A C   1 
ATOM   485  O  O   . GLU A 1 64  ? 12.548 70.024 62.181 1.00 14.48  ? 64   GLU A O   1 
ATOM   486  C  CB  . GLU A 1 64  ? 15.394 69.610 63.904 1.00 10.17  ? 64   GLU A CB  1 
ATOM   487  C  CG  . GLU A 1 64  ? 15.083 71.088 64.100 1.00 13.50  ? 64   GLU A CG  1 
ATOM   488  C  CD  . GLU A 1 64  ? 16.115 71.869 64.883 1.00 22.79  ? 64   GLU A CD  1 
ATOM   489  O  OE1 . GLU A 1 64  ? 15.910 73.088 65.076 1.00 19.79  ? 64   GLU A OE1 1 
ATOM   490  O  OE2 . GLU A 1 64  ? 17.136 71.270 65.292 1.00 21.36  ? 64   GLU A OE2 1 
ATOM   491  N  N   . PRO A 1 65  ? 14.220 69.166 60.997 1.00 13.38  ? 65   PRO A N   1 
ATOM   492  C  CA  . PRO A 1 65  ? 13.621 69.716 59.761 1.00 12.15  ? 65   PRO A CA  1 
ATOM   493  C  C   . PRO A 1 65  ? 12.281 69.085 59.396 1.00 12.01  ? 65   PRO A C   1 
ATOM   494  O  O   . PRO A 1 65  ? 11.385 69.732 58.832 1.00 11.82  ? 65   PRO A O   1 
ATOM   495  C  CB  . PRO A 1 65  ? 14.635 69.406 58.662 1.00 16.60  ? 65   PRO A CB  1 
ATOM   496  C  CG  . PRO A 1 65  ? 15.746 68.650 59.302 1.00 17.83  ? 65   PRO A CG  1 
ATOM   497  C  CD  . PRO A 1 65  ? 15.517 68.534 60.777 1.00 14.33  ? 65   PRO A CD  1 
ATOM   498  N  N   . TYR A 1 66  ? 12.095 67.803 59.722 1.00 10.50  ? 66   TYR A N   1 
ATOM   499  C  CA  . TYR A 1 66  ? 10.796 67.195 59.370 1.00 13.66  ? 66   TYR A CA  1 
ATOM   500  C  C   . TYR A 1 66  ? 9.695  67.894 60.179 1.00 15.10  ? 66   TYR A C   1 
ATOM   501  O  O   . TYR A 1 66  ? 8.604  68.190 59.667 1.00 13.02  ? 66   TYR A O   1 
ATOM   502  C  CB  . TYR A 1 66  ? 10.817 65.706 59.666 1.00 14.01  ? 66   TYR A CB  1 
ATOM   503  C  CG  . TYR A 1 66  ? 9.602  64.907 59.231 1.00 12.78  ? 66   TYR A CG  1 
ATOM   504  C  CD1 . TYR A 1 66  ? 8.468  64.839 60.038 1.00 14.89  ? 66   TYR A CD1 1 
ATOM   505  C  CD2 . TYR A 1 66  ? 9.617  64.217 58.034 1.00 11.00  ? 66   TYR A CD2 1 
ATOM   506  C  CE1 . TYR A 1 66  ? 7.373  64.086 59.613 1.00 17.05  ? 66   TYR A CE1 1 
ATOM   507  C  CE2 . TYR A 1 66  ? 8.531  63.468 57.594 1.00 15.62  ? 66   TYR A CE2 1 
ATOM   508  C  CZ  . TYR A 1 66  ? 7.405  63.409 58.406 1.00 15.62  ? 66   TYR A CZ  1 
ATOM   509  O  OH  . TYR A 1 66  ? 6.303  62.678 57.996 1.00 17.18  ? 66   TYR A OH  1 
ATOM   510  N  N   . GLU A 1 67  ? 9.988  68.126 61.450 1.00 12.49  ? 67   GLU A N   1 
ATOM   511  C  CA  . GLU A 1 67  ? 9.050  68.794 62.353 1.00 12.42  ? 67   GLU A CA  1 
ATOM   512  C  C   . GLU A 1 67  ? 8.844  70.234 61.915 1.00 12.82  ? 67   GLU A C   1 
ATOM   513  O  O   . GLU A 1 67  ? 7.708  70.678 61.666 1.00 13.39  ? 67   GLU A O   1 
ATOM   514  C  CB  . GLU A 1 67  ? 9.584  68.691 63.793 1.00 14.10  ? 67   GLU A CB  1 
ATOM   515  C  CG  . GLU A 1 67  ? 9.649  67.235 64.258 1.00 11.60  ? 67   GLU A CG  1 
ATOM   516  C  CD  . GLU A 1 67  ? 10.655 66.858 65.316 1.00 29.22  ? 67   GLU A CD  1 
ATOM   517  O  OE1 . GLU A 1 67  ? 10.467 65.838 66.045 1.00 29.63  ? 67   GLU A OE1 1 
ATOM   518  O  OE2 . GLU A 1 67  ? 11.685 67.549 65.497 1.00 24.29  ? 67   GLU A OE2 1 
ATOM   519  N  N   . GLN A 1 68  ? 9.914  71.005 61.782 1.00 11.05  ? 68   GLN A N   1 
ATOM   520  C  CA  . GLN A 1 68  ? 9.709  72.454 61.572 1.00 12.18  ? 68   GLN A CA  1 
ATOM   521  C  C   . GLN A 1 68  ? 9.254  72.824 60.173 1.00 14.27  ? 68   GLN A C   1 
ATOM   522  O  O   . GLN A 1 68  ? 8.587  73.862 60.002 1.00 13.52  ? 68   GLN A O   1 
ATOM   523  C  CB  . GLN A 1 68  ? 11.021 73.185 61.861 1.00 11.25  ? 68   GLN A CB  1 
ATOM   524  C  CG  . GLN A 1 68  ? 11.397 73.061 63.337 1.00 12.57  ? 68   GLN A CG  1 
ATOM   525  C  CD  . GLN A 1 68  ? 12.738 73.716 63.664 1.00 16.23  ? 68   GLN A CD  1 
ATOM   526  O  OE1 . GLN A 1 68  ? 13.498 74.011 62.728 1.00 16.91  ? 68   GLN A OE1 1 
ATOM   527  N  NE2 . GLN A 1 68  ? 13.030 73.944 64.938 1.00 15.38  ? 68   GLN A NE2 1 
ATOM   528  N  N   . LEU A 1 69  ? 9.612  72.031 59.171 1.00 10.01  ? 69   LEU A N   1 
ATOM   529  C  CA  . LEU A 1 69  ? 9.150  72.246 57.814 1.00 9.75   ? 69   LEU A CA  1 
ATOM   530  C  C   . LEU A 1 69  ? 7.756  71.652 57.613 1.00 12.51  ? 69   LEU A C   1 
ATOM   531  O  O   . LEU A 1 69  ? 7.176  71.794 56.535 1.00 14.35  ? 69   LEU A O   1 
ATOM   532  C  CB  . LEU A 1 69  ? 10.123 71.628 56.782 1.00 13.69  ? 69   LEU A CB  1 
ATOM   533  C  CG  . LEU A 1 69  ? 11.516 72.271 56.773 1.00 12.68  ? 69   LEU A CG  1 
ATOM   534  C  CD1 . LEU A 1 69  ? 12.527 71.432 56.002 1.00 12.44  ? 69   LEU A CD1 1 
ATOM   535  C  CD2 . LEU A 1 69  ? 11.416 73.692 56.216 1.00 16.34  ? 69   LEU A CD2 1 
ATOM   536  N  N   . GLY A 1 70  ? 7.163  71.015 58.602 1.00 14.18  ? 70   GLY A N   1 
ATOM   537  C  CA  . GLY A 1 70  ? 5.801  70.501 58.469 1.00 13.65  ? 70   GLY A CA  1 
ATOM   538  C  C   . GLY A 1 70  ? 5.647  69.389 57.452 1.00 14.65  ? 70   GLY A C   1 
ATOM   539  O  O   . GLY A 1 70  ? 4.590  69.235 56.838 1.00 13.05  ? 70   GLY A O   1 
ATOM   540  N  N   . LEU A 1 71  ? 6.702  68.594 57.262 1.00 11.63  ? 71   LEU A N   1 
ATOM   541  C  CA  . LEU A 1 71  ? 6.686  67.594 56.191 1.00 13.39  ? 71   LEU A CA  1 
ATOM   542  C  C   . LEU A 1 71  ? 5.698  66.453 56.417 1.00 15.38  ? 71   LEU A C   1 
ATOM   543  O  O   . LEU A 1 71  ? 5.431  65.634 55.517 1.00 15.36  ? 71   LEU A O   1 
ATOM   544  C  CB  . LEU A 1 71  ? 8.107  67.024 56.036 1.00 14.20  ? 71   LEU A CB  1 
ATOM   545  C  CG  . LEU A 1 71  ? 9.188  68.037 55.645 1.00 14.54  ? 71   LEU A CG  1 
ATOM   546  C  CD1 . LEU A 1 71  ? 10.477 67.331 55.231 1.00 10.74  ? 71   LEU A CD1 1 
ATOM   547  C  CD2 . LEU A 1 71  ? 8.731  68.962 54.507 1.00 11.65  ? 71   LEU A CD2 1 
ATOM   548  N  N   . ALA A 1 72  ? 5.135  66.321 57.604 1.00 11.30  ? 72   ALA A N   1 
ATOM   549  C  CA  . ALA A 1 72  ? 4.095  65.327 57.852 1.00 13.92  ? 72   ALA A CA  1 
ATOM   550  C  C   . ALA A 1 72  ? 2.851  65.587 57.008 1.00 17.04  ? 72   ALA A C   1 
ATOM   551  O  O   . ALA A 1 72  ? 2.110  64.655 56.687 1.00 16.76  ? 72   ALA A O   1 
ATOM   552  C  CB  . ALA A 1 72  ? 3.688  65.315 59.326 1.00 14.89  ? 72   ALA A CB  1 
ATOM   553  N  N   . GLU A 1 73  ? 2.594  66.840 56.650 1.00 15.62  ? 73   GLU A N   1 
ATOM   554  C  CA  . GLU A 1 73  ? 1.449  67.196 55.820 1.00 12.69  ? 73   GLU A CA  1 
ATOM   555  C  C   . GLU A 1 73  ? 1.653  66.921 54.347 1.00 16.76  ? 73   GLU A C   1 
ATOM   556  O  O   . GLU A 1 73  ? 2.752  67.069 53.819 1.00 15.75  ? 73   GLU A O   1 
ATOM   557  C  CB  . GLU A 1 73  ? 1.166  68.703 55.963 1.00 15.71  ? 73   GLU A CB  1 
ATOM   558  C  CG  . GLU A 1 73  ? 1.144  69.049 57.463 1.00 27.63  ? 73   GLU A CG  1 
ATOM   559  C  CD  . GLU A 1 73  ? 0.639  70.476 57.615 1.00 51.88  ? 73   GLU A CD  1 
ATOM   560  O  OE1 . GLU A 1 73  ? 1.450  71.417 57.511 1.00 45.13  ? 73   GLU A OE1 1 
ATOM   561  O  OE2 . GLU A 1 73  ? -0.580 70.637 57.834 1.00 98.80  ? 73   GLU A OE2 1 
ATOM   562  N  N   . ASP A 1 74  ? 0.577  66.523 53.671 1.00 13.40  ? 74   ASP A N   1 
ATOM   563  C  CA  . ASP A 1 74  ? 0.718  66.141 52.266 1.00 14.23  ? 74   ASP A CA  1 
ATOM   564  C  C   . ASP A 1 74  ? 0.633  67.366 51.370 1.00 18.87  ? 74   ASP A C   1 
ATOM   565  O  O   . ASP A 1 74  ? -0.345 67.574 50.637 1.00 19.90  ? 74   ASP A O   1 
ATOM   566  C  CB  . ASP A 1 74  ? -0.380 65.132 51.920 1.00 19.09  ? 74   ASP A CB  1 
ATOM   567  C  CG  . ASP A 1 74  ? -0.276 64.544 50.529 1.00 26.21  ? 74   ASP A CG  1 
ATOM   568  O  OD1 . ASP A 1 74  ? -1.264 63.905 50.086 1.00 27.90  ? 74   ASP A OD1 1 
ATOM   569  O  OD2 . ASP A 1 74  ? 0.772  64.703 49.861 1.00 21.44  ? 74   ASP A OD2 1 
ATOM   570  N  N   . LYS A 1 75  ? 1.650  68.216 51.470 1.00 16.31  ? 75   LYS A N   1 
ATOM   571  C  CA  . LYS A 1 75  ? 1.630  69.493 50.756 1.00 14.77  ? 75   LYS A CA  1 
ATOM   572  C  C   . LYS A 1 75  ? 2.901  69.613 49.925 1.00 16.85  ? 75   LYS A C   1 
ATOM   573  O  O   . LYS A 1 75  ? 3.233  70.749 49.569 1.00 15.00  ? 75   LYS A O   1 
ATOM   574  C  CB  . LYS A 1 75  ? 1.579  70.669 51.739 1.00 19.05  ? 75   LYS A CB  1 
ATOM   575  C  CG  . LYS A 1 75  ? 0.203  70.829 52.391 1.00 32.71  ? 75   LYS A CG  1 
ATOM   576  C  CD  . LYS A 1 75  ? 0.314  71.782 53.580 1.00 29.81  ? 75   LYS A CD  1 
ATOM   577  C  CE  . LYS A 1 75  ? 1.717  72.380 53.556 1.00 37.55  ? 75   LYS A CE  1 
ATOM   578  N  NZ  . LYS A 1 75  ? 1.986  73.145 54.804 1.00 71.97  ? 75   LYS A NZ  1 
ATOM   579  N  N   . PHE A 1 76  ? 3.587  68.476 49.669 1.00 10.78  ? 76   PHE A N   1 
ATOM   580  C  CA  . PHE A 1 76  ? 4.878  68.613 48.990 1.00 10.75  ? 76   PHE A CA  1 
ATOM   581  C  C   . PHE A 1 76  ? 5.029  67.682 47.804 1.00 15.64  ? 76   PHE A C   1 
ATOM   582  O  O   . PHE A 1 76  ? 4.728  66.483 47.925 1.00 15.07  ? 76   PHE A O   1 
ATOM   583  C  CB  . PHE A 1 76  ? 6.015  68.284 49.982 1.00 13.08  ? 76   PHE A CB  1 
ATOM   584  C  CG  . PHE A 1 76  ? 5.914  69.144 51.247 1.00 15.75  ? 76   PHE A CG  1 
ATOM   585  C  CD1 . PHE A 1 76  ? 5.199  68.702 52.353 1.00 16.22  ? 76   PHE A CD1 1 
ATOM   586  C  CD2 . PHE A 1 76  ? 6.522  70.383 51.290 1.00 12.29  ? 76   PHE A CD2 1 
ATOM   587  C  CE1 . PHE A 1 76  ? 5.106  69.512 53.479 1.00 13.26  ? 76   PHE A CE1 1 
ATOM   588  C  CE2 . PHE A 1 76  ? 6.434  71.214 52.403 1.00 13.63  ? 76   PHE A CE2 1 
ATOM   589  C  CZ  . PHE A 1 76  ? 5.702  70.764 53.499 1.00 12.50  ? 76   PHE A CZ  1 
ATOM   590  N  N   . THR A 1 77  ? 5.507  68.170 46.660 1.00 13.64  ? 77   THR A N   1 
ATOM   591  C  CA  . THR A 1 77  ? 5.809  67.268 45.558 1.00 10.44  ? 77   THR A CA  1 
ATOM   592  C  C   . THR A 1 77  ? 7.045  66.431 45.858 1.00 17.53  ? 77   THR A C   1 
ATOM   593  O  O   . THR A 1 77  ? 7.853  66.722 46.756 1.00 11.86  ? 77   THR A O   1 
ATOM   594  C  CB  . THR A 1 77  ? 6.108  68.033 44.242 1.00 10.67  ? 77   THR A CB  1 
ATOM   595  O  OG1 . THR A 1 77  ? 7.267  68.849 44.492 1.00 11.85  ? 77   THR A OG1 1 
ATOM   596  C  CG2 . THR A 1 77  ? 4.938  68.924 43.871 1.00 13.82  ? 77   THR A CG2 1 
ATOM   597  N  N   . ASP A 1 78  ? 7.225  65.359 45.082 1.00 15.87  ? 78   ASP A N   1 
ATOM   598  C  CA  . ASP A 1 78  ? 8.433  64.567 45.277 1.00 15.21  ? 78   ASP A CA  1 
ATOM   599  C  C   . ASP A 1 78  ? 9.702  65.402 45.120 1.00 15.74  ? 78   ASP A C   1 
ATOM   600  O  O   . ASP A 1 78  ? 10.647 65.236 45.903 1.00 12.94  ? 78   ASP A O   1 
ATOM   601  C  CB  . ASP A 1 78  ? 8.487  63.398 44.301 1.00 12.81  ? 78   ASP A CB  1 
ATOM   602  C  CG  . ASP A 1 78  ? 7.538  62.274 44.671 1.00 14.03  ? 78   ASP A CG  1 
ATOM   603  O  OD1 . ASP A 1 78  ? 7.463  61.319 43.876 1.00 19.49  ? 78   ASP A OD1 1 
ATOM   604  O  OD2 . ASP A 1 78  ? 6.884  62.282 45.717 1.00 14.36  ? 78   ASP A OD2 1 
ATOM   605  N  N   . ASP A 1 79  ? 9.736  66.282 44.125 1.00 12.65  ? 79   ASP A N   1 
ATOM   606  C  CA  . ASP A 1 79  ? 10.954 67.084 43.970 1.00 12.18  ? 79   ASP A CA  1 
ATOM   607  C  C   . ASP A 1 79  ? 11.165 68.075 45.099 1.00 10.96  ? 79   ASP A C   1 
ATOM   608  O  O   . ASP A 1 79  ? 12.297 68.371 45.495 1.00 11.81  ? 79   ASP A O   1 
ATOM   609  C  CB  . ASP A 1 79  ? 10.912 67.779 42.593 1.00 11.01  ? 79   ASP A CB  1 
ATOM   610  C  CG  . ASP A 1 79  ? 11.314 66.749 41.551 1.00 14.50  ? 79   ASP A CG  1 
ATOM   611  O  OD1 . ASP A 1 79  ? 10.430 66.270 40.823 1.00 16.11  ? 79   ASP A OD1 1 
ATOM   612  O  OD2 . ASP A 1 79  ? 12.510 66.390 41.511 1.00 17.07  ? 79   ASP A OD2 1 
ATOM   613  N  N   . GLN A 1 80  ? 10.107 68.656 45.653 1.00 10.86  ? 80   GLN A N   1 
ATOM   614  C  CA  . GLN A 1 80  ? 10.279 69.524 46.825 1.00 9.95   ? 80   GLN A CA  1 
ATOM   615  C  C   . GLN A 1 80  ? 10.913 68.734 47.968 1.00 14.98  ? 80   GLN A C   1 
ATOM   616  O  O   . GLN A 1 80  ? 11.837 69.218 48.628 1.00 12.41  ? 80   GLN A O   1 
ATOM   617  C  CB  . GLN A 1 80  ? 8.940  70.120 47.291 1.00 11.00  ? 80   GLN A CB  1 
ATOM   618  C  CG  . GLN A 1 80  ? 8.463  71.233 46.344 1.00 11.17  ? 80   GLN A CG  1 
ATOM   619  C  CD  . GLN A 1 80  ? 7.045  71.691 46.638 1.00 13.52  ? 80   GLN A CD  1 
ATOM   620  O  OE1 . GLN A 1 80  ? 6.152  70.933 47.043 1.00 14.38  ? 80   GLN A OE1 1 
ATOM   621  N  NE2 . GLN A 1 80  ? 6.803  72.992 46.402 1.00 10.40  ? 80   GLN A NE2 1 
ATOM   622  N  N   . LEU A 1 81  ? 10.424 67.504 48.192 1.00 13.58  ? 81   LEU A N   1 
ATOM   623  C  CA  . LEU A 1 81  ? 11.004 66.642 49.230 1.00 13.86  ? 81   LEU A CA  1 
ATOM   624  C  C   . LEU A 1 81  ? 12.462 66.272 48.956 1.00 12.30  ? 81   LEU A C   1 
ATOM   625  O  O   . LEU A 1 81  ? 13.296 66.286 49.864 1.00 14.51  ? 81   LEU A O   1 
ATOM   626  C  CB  . LEU A 1 81  ? 10.144 65.380 49.367 1.00 11.20  ? 81   LEU A CB  1 
ATOM   627  C  CG  . LEU A 1 81  ? 8.696  65.670 49.809 1.00 12.60  ? 81   LEU A CG  1 
ATOM   628  C  CD1 . LEU A 1 81  ? 7.927  64.347 49.912 1.00 11.17  ? 81   LEU A CD1 1 
ATOM   629  C  CD2 . LEU A 1 81  ? 8.656  66.448 51.123 1.00 12.15  ? 81   LEU A CD2 1 
ATOM   630  N  N   . ILE A 1 82  ? 12.806 65.943 47.718 1.00 9.92   ? 82   ILE A N   1 
ATOM   631  C  CA  . ILE A 1 82  ? 14.200 65.641 47.367 1.00 15.86  ? 82   ILE A CA  1 
ATOM   632  C  C   . ILE A 1 82  ? 15.089 66.833 47.682 1.00 14.78  ? 82   ILE A C   1 
ATOM   633  O  O   . ILE A 1 82  ? 16.153 66.690 48.277 1.00 13.87  ? 82   ILE A O   1 
ATOM   634  C  CB  A ILE A 1 82  ? 14.334 65.236 45.888 0.86 16.58  ? 82   ILE A CB  1 
ATOM   635  C  CB  B ILE A 1 82  ? 14.334 65.249 45.887 0.14 15.01  ? 82   ILE A CB  1 
ATOM   636  C  CG1 A ILE A 1 82  ? 13.813 63.811 45.598 0.86 10.99  ? 82   ILE A CG1 1 
ATOM   637  C  CG1 B ILE A 1 82  ? 13.820 63.838 45.584 0.14 13.96  ? 82   ILE A CG1 1 
ATOM   638  C  CG2 A ILE A 1 82  ? 15.762 65.386 45.391 0.86 15.46  ? 82   ILE A CG2 1 
ATOM   639  C  CG2 B ILE A 1 82  ? 15.766 65.415 45.407 0.14 15.55  ? 82   ILE A CG2 1 
ATOM   640  C  CD1 A ILE A 1 82  ? 13.585 63.571 44.110 0.86 13.89  ? 82   ILE A CD1 1 
ATOM   641  C  CD1 B ILE A 1 82  ? 14.854 62.941 44.941 0.14 17.23  ? 82   ILE A CD1 1 
ATOM   642  N  N   . ASP A 1 83  ? 14.678 68.039 47.321 1.00 12.61  ? 83   ASP A N   1 
ATOM   643  C  CA  . ASP A 1 83  ? 15.489 69.218 47.641 1.00 11.45  ? 83   ASP A CA  1 
ATOM   644  C  C   . ASP A 1 83  ? 15.571 69.427 49.138 1.00 12.85  ? 83   ASP A C   1 
ATOM   645  O  O   . ASP A 1 83  ? 16.627 69.861 49.626 1.00 11.66  ? 83   ASP A O   1 
ATOM   646  C  CB  . ASP A 1 83  ? 14.922 70.424 46.852 1.00 11.81  ? 83   ASP A CB  1 
ATOM   647  C  CG  . ASP A 1 83  ? 15.322 70.240 45.388 1.00 19.67  ? 83   ASP A CG  1 
ATOM   648  O  OD1 . ASP A 1 83  ? 14.437 70.303 44.499 1.00 16.35  ? 83   ASP A OD1 1 
ATOM   649  O  OD2 . ASP A 1 83  ? 16.533 70.010 45.114 1.00 16.45  ? 83   ASP A OD2 1 
ATOM   650  N  N   . PHE A 1 84  ? 14.518 69.150 49.919 1.00 9.83   ? 84   PHE A N   1 
ATOM   651  C  CA  . PHE A 1 84  ? 14.684 69.293 51.352 1.00 11.73  ? 84   PHE A CA  1 
ATOM   652  C  C   . PHE A 1 84  ? 15.744 68.313 51.853 1.00 11.61  ? 84   PHE A C   1 
ATOM   653  O  O   . PHE A 1 84  ? 16.535 68.647 52.739 1.00 12.92  ? 84   PHE A O   1 
ATOM   654  C  CB  . PHE A 1 84  ? 13.350 69.059 52.083 1.00 12.13  ? 84   PHE A CB  1 
ATOM   655  C  CG  . PHE A 1 84  ? 12.446 70.291 52.049 1.00 14.79  ? 84   PHE A CG  1 
ATOM   656  C  CD1 . PHE A 1 84  ? 12.955 71.535 52.397 1.00 13.19  ? 84   PHE A CD1 1 
ATOM   657  C  CD2 . PHE A 1 84  ? 11.112 70.169 51.678 1.00 13.42  ? 84   PHE A CD2 1 
ATOM   658  C  CE1 . PHE A 1 84  ? 12.133 72.641 52.391 1.00 11.14  ? 84   PHE A CE1 1 
ATOM   659  C  CE2 . PHE A 1 84  ? 10.284 71.289 51.680 1.00 12.13  ? 84   PHE A CE2 1 
ATOM   660  C  CZ  . PHE A 1 84  ? 10.801 72.504 52.045 1.00 12.47  ? 84   PHE A CZ  1 
ATOM   661  N  N   . MET A 1 85  ? 15.690 67.090 51.293 1.00 11.68  ? 85   MET A N   1 
ATOM   662  C  CA  . MET A 1 85  ? 16.659 66.089 51.775 1.00 15.15  ? 85   MET A CA  1 
ATOM   663  C  C   . MET A 1 85  ? 18.073 66.554 51.537 1.00 16.03  ? 85   MET A C   1 
ATOM   664  O  O   . MET A 1 85  ? 18.966 66.368 52.365 1.00 14.12  ? 85   MET A O   1 
ATOM   665  C  CB  . MET A 1 85  ? 16.434 64.708 51.105 1.00 10.25  ? 85   MET A CB  1 
ATOM   666  C  CG  . MET A 1 85  ? 15.298 63.959 51.812 1.00 12.71  ? 85   MET A CG  1 
ATOM   667  S  SD  . MET A 1 85  ? 14.999 62.333 51.037 1.00 25.06  ? 85   MET A SD  1 
ATOM   668  C  CE  . MET A 1 85  ? 13.580 62.659 50.024 1.00 35.17  ? 85   MET A CE  1 
ATOM   669  N  N   . LEU A 1 86  ? 18.325 67.170 50.372 1.00 14.89  ? 86   LEU A N   1 
ATOM   670  C  CA  . LEU A 1 86  ? 19.714 67.573 50.070 1.00 9.17   ? 86   LEU A CA  1 
ATOM   671  C  C   . LEU A 1 86  ? 20.152 68.724 50.957 1.00 14.67  ? 86   LEU A C   1 
ATOM   672  O  O   . LEU A 1 86  ? 21.319 68.876 51.324 1.00 17.16  ? 86   LEU A O   1 
ATOM   673  C  CB  . LEU A 1 86  ? 19.777 68.009 48.610 1.00 12.65  ? 86   LEU A CB  1 
ATOM   674  C  CG  . LEU A 1 86  ? 19.607 66.888 47.575 1.00 16.70  ? 86   LEU A CG  1 
ATOM   675  C  CD1 . LEU A 1 86  ? 19.324 67.451 46.182 1.00 20.57  ? 86   LEU A CD1 1 
ATOM   676  C  CD2 . LEU A 1 86  ? 20.852 66.017 47.528 1.00 14.42  ? 86   LEU A CD2 1 
ATOM   677  N  N   . GLN A 1 87  ? 19.207 69.594 51.282 1.00 12.93  ? 87   GLN A N   1 
ATOM   678  C  CA  . GLN A 1 87  ? 19.527 70.771 52.087 1.00 13.65  ? 87   GLN A CA  1 
ATOM   679  C  C   . GLN A 1 87  ? 19.550 70.422 53.578 1.00 14.27  ? 87   GLN A C   1 
ATOM   680  O  O   . GLN A 1 87  ? 20.063 71.201 54.403 1.00 14.62  ? 87   GLN A O   1 
ATOM   681  C  CB  . GLN A 1 87  ? 18.508 71.880 51.823 1.00 17.05  ? 87   GLN A CB  1 
ATOM   682  C  CG  . GLN A 1 87  ? 18.574 72.466 50.411 1.00 26.19  ? 87   GLN A CG  1 
ATOM   683  C  CD  . GLN A 1 87  ? 19.980 72.898 50.019 1.00 35.73  ? 87   GLN A CD  1 
ATOM   684  O  OE1 . GLN A 1 87  ? 20.565 72.385 49.061 1.00 58.91  ? 87   GLN A OE1 1 
ATOM   685  N  NE2 . GLN A 1 87  ? 20.543 73.850 50.766 1.00 39.27  ? 87   GLN A NE2 1 
ATOM   686  N  N   . HIS A 1 88  ? 18.954 69.285 53.946 1.00 10.26  ? 88   HIS A N   1 
ATOM   687  C  CA  . HIS A 1 88  ? 18.858 68.891 55.360 1.00 12.38  ? 88   HIS A CA  1 
ATOM   688  C  C   . HIS A 1 88  ? 19.087 67.386 55.442 1.00 14.48  ? 88   HIS A C   1 
ATOM   689  O  O   . HIS A 1 88  ? 18.100 66.672 55.612 1.00 12.74  ? 88   HIS A O   1 
ATOM   690  C  CB  . HIS A 1 88  ? 17.490 69.237 55.969 1.00 14.26  ? 88   HIS A CB  1 
ATOM   691  C  CG  . HIS A 1 88  ? 17.146 70.702 55.785 1.00 16.78  ? 88   HIS A CG  1 
ATOM   692  N  ND1 . HIS A 1 88  ? 17.632 71.699 56.600 1.00 19.97  ? 88   HIS A ND1 1 
ATOM   693  C  CD2 . HIS A 1 88  ? 16.427 71.320 54.809 1.00 15.21  ? 88   HIS A CD2 1 
ATOM   694  C  CE1 . HIS A 1 88  ? 17.189 72.877 56.160 1.00 24.77  ? 88   HIS A CE1 1 
ATOM   695  N  NE2 . HIS A 1 88  ? 16.455 72.675 55.078 1.00 18.46  ? 88   HIS A NE2 1 
ATOM   696  N  N   . PRO A 1 89  ? 20.302 66.894 55.259 1.00 13.85  ? 89   PRO A N   1 
ATOM   697  C  CA  . PRO A 1 89  ? 20.520 65.464 55.024 1.00 12.56  ? 89   PRO A CA  1 
ATOM   698  C  C   . PRO A 1 89  ? 20.086 64.561 56.178 1.00 15.66  ? 89   PRO A C   1 
ATOM   699  O  O   . PRO A 1 89  ? 19.942 63.350 55.915 1.00 13.42  ? 89   PRO A O   1 
ATOM   700  C  CB  . PRO A 1 89  ? 22.057 65.352 54.859 1.00 13.11  ? 89   PRO A CB  1 
ATOM   701  C  CG  . PRO A 1 89  ? 22.492 66.726 54.485 1.00 23.52  ? 89   PRO A CG  1 
ATOM   702  C  CD  . PRO A 1 89  ? 21.566 67.665 55.223 1.00 13.42  ? 89   PRO A CD  1 
ATOM   703  N  N   . ILE A 1 90  ? 19.892 65.066 57.397 1.00 11.84  ? 90   ILE A N   1 
ATOM   704  C  CA  . ILE A 1 90  ? 19.322 64.221 58.459 1.00 12.33  ? 90   ILE A CA  1 
ATOM   705  C  C   . ILE A 1 90  ? 17.922 63.721 58.074 1.00 13.30  ? 90   ILE A C   1 
ATOM   706  O  O   . ILE A 1 90  ? 17.419 62.709 58.569 1.00 12.71  ? 90   ILE A O   1 
ATOM   707  C  CB  A ILE A 1 90  ? 19.246 65.014 59.772 0.63 10.92  ? 90   ILE A CB  1 
ATOM   708  C  CB  B ILE A 1 90  ? 19.244 64.937 59.814 0.37 11.32  ? 90   ILE A CB  1 
ATOM   709  C  CG1 A ILE A 1 90  ? 19.003 64.152 61.011 0.63 13.84  ? 90   ILE A CG1 1 
ATOM   710  C  CG1 B ILE A 1 90  ? 18.752 64.034 60.952 0.37 11.60  ? 90   ILE A CG1 1 
ATOM   711  C  CG2 A ILE A 1 90  ? 18.190 66.110 59.658 0.63 14.35  ? 90   ILE A CG2 1 
ATOM   712  C  CG2 B ILE A 1 90  ? 18.387 66.192 59.723 0.37 16.17  ? 90   ILE A CG2 1 
ATOM   713  C  CD1 A ILE A 1 90  ? 20.003 63.023 61.134 0.63 11.98  ? 90   ILE A CD1 1 
ATOM   714  C  CD1 B ILE A 1 90  ? 19.015 64.594 62.333 0.37 8.06   ? 90   ILE A CD1 1 
ATOM   715  N  N   . LEU A 1 91  ? 17.230 64.376 57.128 1.00 9.93   ? 91   LEU A N   1 
ATOM   716  C  CA  . LEU A 1 91  ? 15.969 63.837 56.630 1.00 12.44  ? 91   LEU A CA  1 
ATOM   717  C  C   . LEU A 1 91  ? 16.091 62.548 55.833 1.00 14.00  ? 91   LEU A C   1 
ATOM   718  O  O   . LEU A 1 91  ? 15.101 61.835 55.615 1.00 13.11  ? 91   LEU A O   1 
ATOM   719  C  CB  . LEU A 1 91  ? 15.342 64.838 55.646 1.00 8.55   ? 91   LEU A CB  1 
ATOM   720  C  CG  . LEU A 1 91  ? 14.753 66.114 56.235 1.00 10.67  ? 91   LEU A CG  1 
ATOM   721  C  CD1 . LEU A 1 91  ? 14.354 67.067 55.104 1.00 13.99  ? 91   LEU A CD1 1 
ATOM   722  C  CD2 . LEU A 1 91  ? 13.566 65.778 57.144 1.00 16.30  ? 91   LEU A CD2 1 
ATOM   723  N  N   . ILE A 1 92  ? 17.288 62.232 55.329 1.00 10.48  ? 92   ILE A N   1 
ATOM   724  C  CA  . ILE A 1 92  ? 17.450 61.010 54.521 1.00 11.01  ? 92   ILE A CA  1 
ATOM   725  C  C   . ILE A 1 92  ? 17.510 59.805 55.455 1.00 12.25  ? 92   ILE A C   1 
ATOM   726  O  O   . ILE A 1 92  ? 18.476 59.675 56.229 1.00 12.33  ? 92   ILE A O   1 
ATOM   727  C  CB  . ILE A 1 92  ? 18.717 61.076 53.663 1.00 11.49  ? 92   ILE A CB  1 
ATOM   728  C  CG1 . ILE A 1 92  ? 18.762 62.290 52.720 1.00 11.86  ? 92   ILE A CG1 1 
ATOM   729  C  CG2 . ILE A 1 92  ? 18.881 59.781 52.864 1.00 13.06  ? 92   ILE A CG2 1 
ATOM   730  C  CD1 . ILE A 1 92  ? 20.107 62.533 52.068 1.00 18.66  ? 92   ILE A CD1 1 
ATOM   731  N  N   . ASN A 1 93  ? 16.502 58.921 55.450 1.00 12.63  ? 93   ASN A N   1 
ATOM   732  C  CA  . ASN A 1 93  ? 16.577 57.796 56.392 1.00 14.64  ? 93   ASN A CA  1 
ATOM   733  C  C   . ASN A 1 93  ? 17.732 56.847 56.029 1.00 11.55  ? 93   ASN A C   1 
ATOM   734  O  O   . ASN A 1 93  ? 18.293 56.915 54.924 1.00 11.96  ? 93   ASN A O   1 
ATOM   735  C  CB  . ASN A 1 93  ? 15.251 57.028 56.465 1.00 15.02  ? 93   ASN A CB  1 
ATOM   736  C  CG  . ASN A 1 93  ? 14.944 56.570 57.873 1.00 15.44  ? 93   ASN A CG  1 
ATOM   737  O  OD1 . ASN A 1 93  ? 15.819 56.530 58.743 1.00 14.95  ? 93   ASN A OD1 1 
ATOM   738  N  ND2 . ASN A 1 93  ? 13.685 56.202 58.112 1.00 12.28  ? 93   ASN A ND2 1 
ATOM   739  N  N   . ARG A 1 94  ? 18.075 55.971 56.983 1.00 9.06   ? 94   ARG A N   1 
ATOM   740  C  CA  . ARG A 1 94  ? 19.375 55.317 56.914 1.00 10.48  ? 94   ARG A CA  1 
ATOM   741  C  C   . ARG A 1 94  ? 19.329 53.876 57.394 1.00 12.05  ? 94   ARG A C   1 
ATOM   742  O  O   . ARG A 1 94  ? 18.477 53.534 58.232 1.00 14.05  ? 94   ARG A O   1 
ATOM   743  C  CB  . ARG A 1 94  ? 20.363 56.121 57.784 1.00 9.31   ? 94   ARG A CB  1 
ATOM   744  C  CG  . ARG A 1 94  ? 20.214 56.041 59.302 1.00 8.60   ? 94   ARG A CG  1 
ATOM   745  C  CD  . ARG A 1 94  ? 18.992 56.798 59.812 1.00 11.38  ? 94   ARG A CD  1 
ATOM   746  N  NE  . ARG A 1 94  ? 18.953 56.840 61.295 1.00 11.29  ? 94   ARG A NE  1 
ATOM   747  C  CZ  . ARG A 1 94  ? 19.140 57.966 61.974 1.00 18.81  ? 94   ARG A CZ  1 
ATOM   748  N  NH1 . ARG A 1 94  ? 19.380 59.144 61.401 1.00 11.42  ? 94   ARG A NH1 1 
ATOM   749  N  NH2 . ARG A 1 94  ? 19.088 57.927 63.309 1.00 15.53  ? 94   ARG A NH2 1 
ATOM   750  N  N   . PRO A 1 95  ? 20.250 53.034 56.954 1.00 11.26  ? 95   PRO A N   1 
ATOM   751  C  CA  . PRO A 1 95  ? 21.224 53.312 55.904 1.00 10.83  ? 95   PRO A CA  1 
ATOM   752  C  C   . PRO A 1 95  ? 20.743 52.902 54.521 1.00 10.22  ? 95   PRO A C   1 
ATOM   753  O  O   . PRO A 1 95  ? 19.955 51.957 54.332 1.00 13.01  ? 95   PRO A O   1 
ATOM   754  C  CB  . PRO A 1 95  ? 22.392 52.390 56.310 1.00 11.04  ? 95   PRO A CB  1 
ATOM   755  C  CG  . PRO A 1 95  ? 21.676 51.169 56.812 1.00 10.87  ? 95   PRO A CG  1 
ATOM   756  C  CD  . PRO A 1 95  ? 20.445 51.686 57.523 1.00 11.17  ? 95   PRO A CD  1 
ATOM   757  N  N   . ILE A 1 96  ? 21.247 53.664 53.542 1.00 11.07  ? 96   ILE A N   1 
ATOM   758  C  CA  . ILE A 1 96  ? 21.089 53.222 52.149 1.00 11.50  ? 96   ILE A CA  1 
ATOM   759  C  C   . ILE A 1 96  ? 22.319 52.408 51.783 1.00 12.75  ? 96   ILE A C   1 
ATOM   760  O  O   . ILE A 1 96  ? 23.441 52.860 52.024 1.00 12.94  ? 96   ILE A O   1 
ATOM   761  C  CB  . ILE A 1 96  ? 20.937 54.427 51.209 1.00 9.20   ? 96   ILE A CB  1 
ATOM   762  C  CG1 . ILE A 1 96  ? 19.643 55.196 51.525 1.00 12.36  ? 96   ILE A CG1 1 
ATOM   763  C  CG2 . ILE A 1 96  ? 20.997 54.019 49.743 1.00 9.63   ? 96   ILE A CG2 1 
ATOM   764  C  CD1 . ILE A 1 96  ? 19.639 56.600 50.930 1.00 12.36  ? 96   ILE A CD1 1 
ATOM   765  N  N   . VAL A 1 97  ? 22.132 51.233 51.204 1.00 11.73  ? 97   VAL A N   1 
ATOM   766  C  CA  . VAL A 1 97  ? 23.280 50.440 50.781 1.00 9.48   ? 97   VAL A CA  1 
ATOM   767  C  C   . VAL A 1 97  ? 23.204 50.166 49.286 1.00 13.73  ? 97   VAL A C   1 
ATOM   768  O  O   . VAL A 1 97  ? 22.113 49.805 48.822 1.00 12.93  ? 97   VAL A O   1 
ATOM   769  C  CB  . VAL A 1 97  ? 23.337 49.098 51.535 1.00 9.93   ? 97   VAL A CB  1 
ATOM   770  C  CG1 . VAL A 1 97  ? 24.506 48.237 51.010 1.00 13.24  ? 97   VAL A CG1 1 
ATOM   771  C  CG2 . VAL A 1 97  ? 23.472 49.334 53.025 1.00 9.49   ? 97   VAL A CG2 1 
ATOM   772  N  N   . VAL A 1 98  ? 24.318 50.308 48.582 1.00 11.81  ? 98   VAL A N   1 
ATOM   773  C  CA  . VAL A 1 98  ? 24.436 49.985 47.166 1.00 10.98  ? 98   VAL A CA  1 
ATOM   774  C  C   . VAL A 1 98  ? 25.390 48.802 46.971 1.00 14.68  ? 98   VAL A C   1 
ATOM   775  O  O   . VAL A 1 98  ? 26.525 48.886 47.453 1.00 11.20  ? 98   VAL A O   1 
ATOM   776  C  CB  . VAL A 1 98  ? 24.973 51.179 46.350 1.00 14.01  ? 98   VAL A CB  1 
ATOM   777  C  CG1 . VAL A 1 98  ? 25.079 50.850 44.865 1.00 16.92  ? 98   VAL A CG1 1 
ATOM   778  C  CG2 . VAL A 1 98  ? 24.061 52.397 46.552 1.00 13.84  ? 98   VAL A CG2 1 
ATOM   779  N  N   . THR A 1 99  ? 24.965 47.747 46.276 1.00 14.54  ? 99   THR A N   1 
ATOM   780  C  CA  . THR A 1 99  ? 25.907 46.682 45.930 1.00 14.80  ? 99   THR A CA  1 
ATOM   781  C  C   . THR A 1 99  ? 25.775 46.345 44.443 1.00 15.42  ? 99   THR A C   1 
ATOM   782  O  O   . THR A 1 99  ? 24.859 46.883 43.774 1.00 12.73  ? 99   THR A O   1 
ATOM   783  C  CB  . THR A 1 99  ? 25.658 45.370 46.704 1.00 18.00  ? 99   THR A CB  1 
ATOM   784  O  OG1 . THR A 1 99  ? 24.541 44.724 46.040 1.00 15.18  ? 99   THR A OG1 1 
ATOM   785  C  CG2 . THR A 1 99  ? 25.367 45.601 48.170 1.00 14.74  ? 99   THR A CG2 1 
ATOM   786  N  N   . PRO A 1 100 ? 26.597 45.485 43.861 1.00 16.84  ? 100  PRO A N   1 
ATOM   787  C  CA  . PRO A 1 100 ? 26.330 45.120 42.442 1.00 18.62  ? 100  PRO A CA  1 
ATOM   788  C  C   . PRO A 1 100 ? 24.943 44.542 42.220 1.00 16.29  ? 100  PRO A C   1 
ATOM   789  O  O   . PRO A 1 100 ? 24.488 44.562 41.052 1.00 15.92  ? 100  PRO A O   1 
ATOM   790  C  CB  . PRO A 1 100 ? 27.384 44.045 42.133 1.00 18.49  ? 100  PRO A CB  1 
ATOM   791  C  CG  . PRO A 1 100 ? 28.522 44.484 43.012 1.00 20.18  ? 100  PRO A CG  1 
ATOM   792  C  CD  . PRO A 1 100 ? 27.835 44.825 44.328 1.00 15.96  ? 100  PRO A CD  1 
ATOM   793  N  N   . LEU A 1 101 ? 24.295 44.027 43.260 1.00 13.07  ? 101  LEU A N   1 
ATOM   794  C  CA  . LEU A 1 101 ? 22.986 43.417 43.003 1.00 15.33  ? 101  LEU A CA  1 
ATOM   795  C  C   . LEU A 1 101 ? 21.841 44.414 43.096 1.00 18.28  ? 101  LEU A C   1 
ATOM   796  O  O   . LEU A 1 101 ? 20.719 44.147 42.647 1.00 16.43  ? 101  LEU A O   1 
ATOM   797  C  CB  . LEU A 1 101 ? 22.725 42.286 44.003 1.00 13.55  ? 101  LEU A CB  1 
ATOM   798  C  CG  . LEU A 1 101 ? 23.504 40.990 43.802 1.00 15.53  ? 101  LEU A CG  1 
ATOM   799  C  CD1 . LEU A 1 101 ? 23.116 39.971 44.868 1.00 15.91  ? 101  LEU A CD1 1 
ATOM   800  C  CD2 . LEU A 1 101 ? 23.293 40.423 42.406 1.00 17.35  ? 101  LEU A CD2 1 
ATOM   801  N  N   . GLY A 1 102 ? 22.070 45.575 43.711 1.00 16.83  ? 102  GLY A N   1 
ATOM   802  C  CA  . GLY A 1 102 ? 20.952 46.491 43.896 1.00 17.52  ? 102  GLY A CA  1 
ATOM   803  C  C   . GLY A 1 102 ? 21.166 47.489 45.019 1.00 18.38  ? 102  GLY A C   1 
ATOM   804  O  O   . GLY A 1 102 ? 22.241 47.549 45.614 1.00 14.02  ? 102  GLY A O   1 
ATOM   805  N  N   . THR A 1 103 ? 20.102 48.263 45.247 1.00 12.71  ? 103  THR A N   1 
ATOM   806  C  CA  . THR A 1 103 ? 20.167 49.317 46.273 1.00 12.72  ? 103  THR A CA  1 
ATOM   807  C  C   . THR A 1 103 ? 18.975 49.181 47.205 1.00 14.07  ? 103  THR A C   1 
ATOM   808  O  O   . THR A 1 103 ? 17.856 48.989 46.701 1.00 12.95  ? 103  THR A O   1 
ATOM   809  C  CB  . THR A 1 103 ? 20.161 50.724 45.639 1.00 13.15  ? 103  THR A CB  1 
ATOM   810  O  OG1 . THR A 1 103 ? 21.227 50.840 44.679 1.00 15.19  ? 103  THR A OG1 1 
ATOM   811  C  CG2 . THR A 1 103 ? 20.356 51.788 46.703 1.00 15.80  ? 103  THR A CG2 1 
ATOM   812  N  N   . ARG A 1 104 ? 19.160 49.279 48.525 1.00 10.50  ? 104  ARG A N   1 
ATOM   813  C  CA  . ARG A 1 104 ? 18.012 49.189 49.415 1.00 8.85   ? 104  ARG A CA  1 
ATOM   814  C  C   . ARG A 1 104 ? 18.130 50.179 50.565 1.00 16.98  ? 104  ARG A C   1 
ATOM   815  O  O   . ARG A 1 104 ? 19.209 50.469 51.082 1.00 13.15  ? 104  ARG A O   1 
ATOM   816  C  CB  . ARG A 1 104 ? 17.871 47.825 50.105 1.00 13.15  ? 104  ARG A CB  1 
ATOM   817  C  CG  . ARG A 1 104 ? 17.644 46.673 49.152 1.00 14.53  ? 104  ARG A CG  1 
ATOM   818  C  CD  . ARG A 1 104 ? 16.223 46.741 48.536 1.00 19.94  ? 104  ARG A CD  1 
ATOM   819  N  NE  . ARG A 1 104 ? 16.047 45.418 47.895 1.00 26.97  ? 104  ARG A NE  1 
ATOM   820  C  CZ  . ARG A 1 104 ? 16.514 45.141 46.686 1.00 29.06  ? 104  ARG A CZ  1 
ATOM   821  N  NH1 . ARG A 1 104 ? 17.148 46.076 45.991 1.00 24.60  ? 104  ARG A NH1 1 
ATOM   822  N  NH2 . ARG A 1 104 ? 16.342 43.930 46.170 1.00 26.97  ? 104  ARG A NH2 1 
ATOM   823  N  N   . LEU A 1 105 ? 16.967 50.662 51.010 1.00 11.75  ? 105  LEU A N   1 
ATOM   824  C  CA  . LEU A 1 105 ? 16.969 51.318 52.329 1.00 11.12  ? 105  LEU A CA  1 
ATOM   825  C  C   . LEU A 1 105 ? 16.955 50.176 53.325 1.00 18.33  ? 105  LEU A C   1 
ATOM   826  O  O   . LEU A 1 105 ? 15.940 49.449 53.356 1.00 13.67  ? 105  LEU A O   1 
ATOM   827  C  CB  . LEU A 1 105 ? 15.757 52.238 52.471 1.00 10.83  ? 105  LEU A CB  1 
ATOM   828  C  CG  . LEU A 1 105 ? 15.441 52.758 53.883 1.00 14.76  ? 105  LEU A CG  1 
ATOM   829  C  CD1 . LEU A 1 105 ? 16.581 53.612 54.438 1.00 15.40  ? 105  LEU A CD1 1 
ATOM   830  C  CD2 . LEU A 1 105 ? 14.131 53.553 53.889 1.00 15.46  ? 105  LEU A CD2 1 
ATOM   831  N  N   . CYS A 1 106 ? 18.029 49.963 54.089 1.00 12.76  ? 106  CYS A N   1 
ATOM   832  C  CA  . CYS A 1 106 ? 18.041 48.748 54.916 1.00 11.12  ? 106  CYS A CA  1 
ATOM   833  C  C   . CYS A 1 106 ? 17.424 48.986 56.281 1.00 11.57  ? 106  CYS A C   1 
ATOM   834  O  O   . CYS A 1 106 ? 18.077 49.071 57.336 1.00 13.32  ? 106  CYS A O   1 
ATOM   835  C  CB  . CYS A 1 106 ? 19.479 48.236 55.044 1.00 13.97  ? 106  CYS A CB  1 
ATOM   836  S  SG  . CYS A 1 106 ? 20.181 47.806 53.431 1.00 15.06  ? 106  CYS A SG  1 
ATOM   837  N  N   . ARG A 1 107 ? 16.084 49.090 56.261 1.00 11.47  ? 107  ARG A N   1 
ATOM   838  C  CA  . ARG A 1 107 ? 15.313 49.228 57.498 1.00 13.01  ? 107  ARG A CA  1 
ATOM   839  C  C   . ARG A 1 107 ? 14.209 48.187 57.422 1.00 14.89  ? 107  ARG A C   1 
ATOM   840  O  O   . ARG A 1 107 ? 13.332 48.392 56.552 1.00 13.65  ? 107  ARG A O   1 
ATOM   841  C  CB  . ARG A 1 107 ? 14.770 50.640 57.662 1.00 15.86  ? 107  ARG A CB  1 
ATOM   842  C  CG  . ARG A 1 107 ? 15.896 51.679 57.868 1.00 13.35  ? 107  ARG A CG  1 
ATOM   843  C  CD  . ARG A 1 107 ? 15.206 53.035 58.139 1.00 13.10  ? 107  ARG A CD  1 
ATOM   844  N  NE  . ARG A 1 107 ? 14.749 53.114 59.533 1.00 16.13  ? 107  ARG A NE  1 
ATOM   845  C  CZ  . ARG A 1 107 ? 15.474 53.308 60.617 1.00 19.40  ? 107  ARG A CZ  1 
ATOM   846  N  NH1 . ARG A 1 107 ? 16.795 53.464 60.604 1.00 12.60  ? 107  ARG A NH1 1 
ATOM   847  N  NH2 . ARG A 1 107 ? 14.893 53.355 61.819 1.00 15.52  ? 107  ARG A NH2 1 
ATOM   848  N  N   . PRO A 1 108 ? 14.222 47.096 58.168 1.00 14.81  ? 108  PRO A N   1 
ATOM   849  C  CA  . PRO A 1 108 ? 15.220 46.775 59.192 1.00 13.58  ? 108  PRO A CA  1 
ATOM   850  C  C   . PRO A 1 108 ? 16.547 46.377 58.543 1.00 12.25  ? 108  PRO A C   1 
ATOM   851  O  O   . PRO A 1 108 ? 16.618 46.169 57.342 1.00 10.93  ? 108  PRO A O   1 
ATOM   852  C  CB  . PRO A 1 108 ? 14.573 45.596 59.949 1.00 16.22  ? 108  PRO A CB  1 
ATOM   853  C  CG  . PRO A 1 108 ? 13.775 44.901 58.883 1.00 16.00  ? 108  PRO A CG  1 
ATOM   854  C  CD  . PRO A 1 108 ? 13.207 46.006 58.028 1.00 15.72  ? 108  PRO A CD  1 
ATOM   855  N  N   . SER A 1 109 ? 17.611 46.314 59.338 1.00 14.79  ? 109  SER A N   1 
ATOM   856  C  CA  . SER A 1 109 ? 18.956 46.125 58.807 1.00 13.16  ? 109  SER A CA  1 
ATOM   857  C  C   . SER A 1 109 ? 19.063 44.864 57.952 1.00 12.62  ? 109  SER A C   1 
ATOM   858  O  O   . SER A 1 109 ? 19.808 44.887 56.975 1.00 13.90  ? 109  SER A O   1 
ATOM   859  C  CB  . SER A 1 109 ? 19.961 46.074 59.964 1.00 12.40  ? 109  SER A CB  1 
ATOM   860  O  OG  . SER A 1 109 ? 19.602 45.130 60.948 1.00 13.44  ? 109  SER A OG  1 
ATOM   861  N  N   . GLU A 1 110 ? 18.332 43.802 58.332 1.00 11.39  ? 110  GLU A N   1 
ATOM   862  C  CA  . GLU A 1 110 ? 18.520 42.520 57.623 1.00 13.11  ? 110  GLU A CA  1 
ATOM   863  C  C   . GLU A 1 110 ? 18.040 42.526 56.181 1.00 10.88  ? 110  GLU A C   1 
ATOM   864  O  O   . GLU A 1 110 ? 18.344 41.612 55.406 1.00 13.29  ? 110  GLU A O   1 
ATOM   865  C  CB  . GLU A 1 110 ? 17.915 41.376 58.450 1.00 12.33  ? 110  GLU A CB  1 
ATOM   866  C  CG  . GLU A 1 110 ? 16.408 41.397 58.574 1.00 15.01  ? 110  GLU A CG  1 
ATOM   867  C  CD  . GLU A 1 110 ? 15.900 42.091 59.820 1.00 16.05  ? 110  GLU A CD  1 
ATOM   868  O  OE1 . GLU A 1 110 ? 14.718 41.863 60.172 1.00 19.36  ? 110  GLU A OE1 1 
ATOM   869  O  OE2 . GLU A 1 110 ? 16.646 42.879 60.452 1.00 14.58  ? 110  GLU A OE2 1 
ATOM   870  N  N   . VAL A 1 111 ? 17.335 43.589 55.772 1.00 11.05  ? 111  VAL A N   1 
ATOM   871  C  CA  . VAL A 1 111 ? 17.068 43.785 54.348 1.00 9.91   ? 111  VAL A CA  1 
ATOM   872  C  C   . VAL A 1 111 ? 18.354 43.737 53.530 1.00 12.74  ? 111  VAL A C   1 
ATOM   873  O  O   . VAL A 1 111 ? 18.349 43.338 52.376 1.00 13.08  ? 111  VAL A O   1 
ATOM   874  C  CB  . VAL A 1 111 ? 16.346 45.134 54.158 1.00 13.19  ? 111  VAL A CB  1 
ATOM   875  C  CG1 . VAL A 1 111 ? 16.325 45.574 52.699 1.00 13.26  ? 111  VAL A CG1 1 
ATOM   876  C  CG2 . VAL A 1 111 ? 14.935 45.010 54.743 1.00 17.10  ? 111  VAL A CG2 1 
ATOM   877  N  N   . VAL A 1 112 ? 19.498 44.116 54.099 1.00 12.42  ? 112  VAL A N   1 
ATOM   878  C  CA  . VAL A 1 112 ? 20.752 44.105 53.334 1.00 11.63  ? 112  VAL A CA  1 
ATOM   879  C  C   . VAL A 1 112 ? 21.115 42.715 52.827 1.00 10.62  ? 112  VAL A C   1 
ATOM   880  O  O   . VAL A 1 112 ? 21.875 42.594 51.841 1.00 11.04  ? 112  VAL A O   1 
ATOM   881  C  CB  . VAL A 1 112 ? 21.911 44.704 54.175 1.00 15.16  ? 112  VAL A CB  1 
ATOM   882  C  CG1 . VAL A 1 112 ? 22.418 43.801 55.292 1.00 11.20  ? 112  VAL A CG1 1 
ATOM   883  C  CG2 . VAL A 1 112 ? 23.072 45.086 53.251 1.00 15.15  ? 112  VAL A CG2 1 
ATOM   884  N  N   . LEU A 1 113 ? 20.601 41.688 53.503 1.00 11.48  ? 113  LEU A N   1 
ATOM   885  C  CA  . LEU A 1 113 ? 20.904 40.317 53.069 1.00 13.73  ? 113  LEU A CA  1 
ATOM   886  C  C   . LEU A 1 113 ? 20.407 40.069 51.642 1.00 16.39  ? 113  LEU A C   1 
ATOM   887  O  O   . LEU A 1 113 ? 20.951 39.204 50.936 1.00 14.19  ? 113  LEU A O   1 
ATOM   888  C  CB  . LEU A 1 113 ? 20.296 39.255 54.002 1.00 10.81  ? 113  LEU A CB  1 
ATOM   889  C  CG  . LEU A 1 113 ? 20.849 39.316 55.432 1.00 14.38  ? 113  LEU A CG  1 
ATOM   890  C  CD1 . LEU A 1 113 ? 20.054 38.407 56.349 1.00 15.96  ? 113  LEU A CD1 1 
ATOM   891  C  CD2 . LEU A 1 113 ? 22.346 38.985 55.389 1.00 12.72  ? 113  LEU A CD2 1 
ATOM   892  N  N   . ASP A 1 114 ? 19.392 40.817 51.195 1.00 12.89  ? 114  ASP A N   1 
ATOM   893  C  CA  . ASP A 1 114 ? 18.919 40.631 49.804 1.00 17.06  ? 114  ASP A CA  1 
ATOM   894  C  C   . ASP A 1 114 ? 19.963 40.946 48.740 1.00 17.24  ? 114  ASP A C   1 
ATOM   895  O  O   . ASP A 1 114 ? 19.929 40.469 47.594 1.00 14.53  ? 114  ASP A O   1 
ATOM   896  C  CB  . ASP A 1 114 ? 17.721 41.551 49.519 1.00 16.53  ? 114  ASP A CB  1 
ATOM   897  C  CG  . ASP A 1 114 ? 16.440 41.135 50.207 1.00 27.02  ? 114  ASP A CG  1 
ATOM   898  O  OD1 . ASP A 1 114 ? 15.407 41.771 49.911 1.00 60.10  ? 114  ASP A OD1 1 
ATOM   899  O  OD2 . ASP A 1 114 ? 16.479 40.194 51.024 1.00 28.17  ? 114  ASP A OD2 1 
ATOM   900  N  N   . ILE A 1 115 ? 20.751 42.012 49.024 1.00 12.85  ? 115  ILE A N   1 
ATOM   901  C  CA  . ILE A 1 115 ? 21.629 42.574 48.004 1.00 10.60  ? 115  ILE A CA  1 
ATOM   902  C  C   . ILE A 1 115 ? 23.104 42.255 48.217 1.00 8.68   ? 115  ILE A C   1 
ATOM   903  O  O   . ILE A 1 115 ? 23.916 42.551 47.338 1.00 13.02  ? 115  ILE A O   1 
ATOM   904  C  CB  . ILE A 1 115 ? 21.392 44.098 47.908 1.00 15.64  ? 115  ILE A CB  1 
ATOM   905  C  CG1 . ILE A 1 115 ? 21.522 44.808 49.265 1.00 15.82  ? 115  ILE A CG1 1 
ATOM   906  C  CG2 . ILE A 1 115 ? 20.034 44.403 47.266 1.00 12.97  ? 115  ILE A CG2 1 
ATOM   907  C  CD1 . ILE A 1 115 ? 21.450 46.329 49.100 1.00 18.76  ? 115  ILE A CD1 1 
ATOM   908  N  N   . LEU A 1 116 ? 23.442 41.610 49.349 1.00 14.01  ? 116  LEU A N   1 
ATOM   909  C  CA  . LEU A 1 116 ? 24.815 41.099 49.492 1.00 11.56  ? 116  LEU A CA  1 
ATOM   910  C  C   . LEU A 1 116 ? 25.010 39.834 48.651 1.00 13.46  ? 116  LEU A C   1 
ATOM   911  O  O   . LEU A 1 116 ? 24.198 38.906 48.770 1.00 13.85  ? 116  LEU A O   1 
ATOM   912  C  CB  . LEU A 1 116 ? 25.083 40.840 50.972 1.00 16.52  ? 116  LEU A CB  1 
ATOM   913  C  CG  . LEU A 1 116 ? 25.154 42.083 51.871 1.00 12.77  ? 116  LEU A CG  1 
ATOM   914  C  CD1 . LEU A 1 116 ? 25.266 41.720 53.356 1.00 10.83  ? 116  LEU A CD1 1 
ATOM   915  C  CD2 . LEU A 1 116 ? 26.340 42.949 51.484 1.00 9.90   ? 116  LEU A CD2 1 
ATOM   916  N  N   . GLN A 1 117 ? 26.045 39.808 47.820 1.00 16.06  ? 117  GLN A N   1 
ATOM   917  C  CA  . GLN A 1 117 ? 26.356 38.726 46.881 1.00 13.56  ? 117  GLN A CA  1 
ATOM   918  C  C   . GLN A 1 117 ? 26.826 37.474 47.583 1.00 17.41  ? 117  GLN A C   1 
ATOM   919  O  O   . GLN A 1 117 ? 26.489 36.355 47.208 1.00 16.63  ? 117  GLN A O   1 
ATOM   920  C  CB  . GLN A 1 117 ? 27.482 39.184 45.930 1.00 15.97  ? 117  GLN A CB  1 
ATOM   921  C  CG  . GLN A 1 117 ? 27.020 40.293 44.992 1.00 19.80  ? 117  GLN A CG  1 
ATOM   922  C  CD  . GLN A 1 117 ? 28.171 40.853 44.173 1.00 26.66  ? 117  GLN A CD  1 
ATOM   923  O  OE1 . GLN A 1 117 ? 29.051 41.499 44.739 1.00 23.70  ? 117  GLN A OE1 1 
ATOM   924  N  NE2 . GLN A 1 117 ? 28.174 40.628 42.862 1.00 25.49  ? 117  GLN A NE2 1 
ATOM   925  N  N   . ASP A 1 118 ? 27.625 37.671 48.635 1.00 15.63  ? 118  ASP A N   1 
ATOM   926  C  CA  . ASP A 1 118 ? 28.183 36.527 49.350 1.00 13.67  ? 118  ASP A CA  1 
ATOM   927  C  C   . ASP A 1 118 ? 27.488 36.318 50.676 1.00 17.34  ? 118  ASP A C   1 
ATOM   928  O  O   . ASP A 1 118 ? 27.136 37.293 51.347 1.00 16.38  ? 118  ASP A O   1 
ATOM   929  C  CB  . ASP A 1 118 ? 29.689 36.742 49.565 1.00 16.82  ? 118  ASP A CB  1 
ATOM   930  C  CG  . ASP A 1 118 ? 30.360 37.080 48.245 1.00 28.20  ? 118  ASP A CG  1 
ATOM   931  O  OD1 . ASP A 1 118 ? 30.047 36.412 47.231 1.00 24.20  ? 118  ASP A OD1 1 
ATOM   932  O  OD2 . ASP A 1 118 ? 31.188 38.017 48.205 1.00 27.83  ? 118  ASP A OD2 1 
ATOM   933  N  N   . ALA A 1 119 ? 27.286 35.048 51.022 1.00 16.65  ? 119  ALA A N   1 
ATOM   934  C  CA  . ALA A 1 119 ? 26.563 34.695 52.229 1.00 13.28  ? 119  ALA A CA  1 
ATOM   935  C  C   . ALA A 1 119 ? 27.276 35.171 53.502 1.00 15.36  ? 119  ALA A C   1 
ATOM   936  O  O   . ALA A 1 119 ? 28.502 35.323 53.533 1.00 16.29  ? 119  ALA A O   1 
ATOM   937  C  CB  . ALA A 1 119 ? 26.376 33.167 52.281 1.00 14.63  ? 119  ALA A CB  1 
ATOM   938  N  N   . GLN A 1 120 ? 26.494 35.361 54.557 1.00 11.08  ? 120  GLN A N   1 
ATOM   939  C  CA  . GLN A 1 120 ? 27.099 35.634 55.863 1.00 11.29  ? 120  GLN A CA  1 
ATOM   940  C  C   . GLN A 1 120 ? 28.092 34.515 56.179 1.00 15.40  ? 120  GLN A C   1 
ATOM   941  O  O   . GLN A 1 120 ? 27.771 33.332 55.949 1.00 15.12  ? 120  GLN A O   1 
ATOM   942  C  CB  . GLN A 1 120 ? 26.004 35.697 56.923 1.00 12.09  ? 120  GLN A CB  1 
ATOM   943  C  CG  . GLN A 1 120 ? 24.995 36.839 56.754 1.00 10.63  ? 120  GLN A CG  1 
ATOM   944  C  CD  . GLN A 1 120 ? 25.666 38.176 57.077 1.00 13.34  ? 120  GLN A CD  1 
ATOM   945  O  OE1 . GLN A 1 120 ? 25.927 38.499 58.251 1.00 12.12  ? 120  GLN A OE1 1 
ATOM   946  N  NE2 . GLN A 1 120 ? 25.926 38.902 55.983 1.00 12.96  ? 120  GLN A NE2 1 
ATOM   947  N  N   . LYS A 1 121 ? 29.265 34.857 56.687 1.00 15.48  ? 121  LYS A N   1 
ATOM   948  C  CA  . LYS A 1 121 ? 30.342 33.916 56.958 1.00 19.42  ? 121  LYS A CA  1 
ATOM   949  C  C   . LYS A 1 121 ? 30.115 33.117 58.232 1.00 19.71  ? 121  LYS A C   1 
ATOM   950  O  O   . LYS A 1 121 ? 30.834 32.143 58.477 1.00 20.70  ? 121  LYS A O   1 
ATOM   951  C  CB  . LYS A 1 121 ? 31.705 34.650 57.032 1.00 19.02  ? 121  LYS A CB  1 
ATOM   952  C  CG  . LYS A 1 121 ? 32.149 35.058 55.619 1.00 23.98  ? 121  LYS A CG  1 
ATOM   953  C  CD  . LYS A 1 121 ? 33.199 36.132 55.558 1.00 30.87  ? 121  LYS A CD  1 
ATOM   954  C  CE  . LYS A 1 121 ? 34.479 35.808 56.295 1.00 42.43  ? 121  LYS A CE  1 
ATOM   955  N  NZ  . LYS A 1 121 ? 35.492 36.907 56.158 1.00 44.43  ? 121  LYS A NZ  1 
ATOM   956  N  N   . GLY A 1 122 ? 29.157 33.494 59.047 1.00 16.48  ? 122  GLY A N   1 
ATOM   957  C  CA  . GLY A 1 122 ? 28.869 32.851 60.331 1.00 17.89  ? 122  GLY A CA  1 
ATOM   958  C  C   . GLY A 1 122 ? 27.611 33.491 60.922 1.00 16.86  ? 122  GLY A C   1 
ATOM   959  O  O   . GLY A 1 122 ? 27.110 34.429 60.295 1.00 17.83  ? 122  GLY A O   1 
ATOM   960  N  N   . ALA A 1 123 ? 27.150 33.017 62.075 1.00 14.39  ? 123  ALA A N   1 
ATOM   961  C  CA  . ALA A 1 123 ? 25.905 33.525 62.662 1.00 16.59  ? 123  ALA A CA  1 
ATOM   962  C  C   . ALA A 1 123 ? 25.993 35.038 62.824 1.00 15.14  ? 123  ALA A C   1 
ATOM   963  O  O   . ALA A 1 123 ? 27.102 35.570 63.007 1.00 14.78  ? 123  ALA A O   1 
ATOM   964  C  CB  . ALA A 1 123 ? 25.625 32.853 64.003 1.00 14.03  ? 123  ALA A CB  1 
ATOM   965  N  N   . PHE A 1 124 ? 24.868 35.726 62.738 1.00 12.69  ? 124  PHE A N   1 
ATOM   966  C  CA  . PHE A 1 124 ? 24.793 37.154 62.990 1.00 12.09  ? 124  PHE A CA  1 
ATOM   967  C  C   . PHE A 1 124 ? 23.672 37.442 63.983 1.00 14.72  ? 124  PHE A C   1 
ATOM   968  O  O   . PHE A 1 124 ? 22.543 37.025 63.762 1.00 15.18  ? 124  PHE A O   1 
ATOM   969  C  CB  . PHE A 1 124 ? 24.555 37.984 61.702 1.00 13.29  ? 124  PHE A CB  1 
ATOM   970  C  CG  . PHE A 1 124 ? 24.750 39.482 61.997 1.00 11.99  ? 124  PHE A CG  1 
ATOM   971  C  CD1 . PHE A 1 124 ? 23.704 40.301 62.379 1.00 16.38  ? 124  PHE A CD1 1 
ATOM   972  C  CD2 . PHE A 1 124 ? 26.029 40.015 61.893 1.00 11.65  ? 124  PHE A CD2 1 
ATOM   973  C  CE1 . PHE A 1 124 ? 23.904 41.638 62.683 1.00 13.09  ? 124  PHE A CE1 1 
ATOM   974  C  CE2 . PHE A 1 124 ? 26.240 41.364 62.175 1.00 14.45  ? 124  PHE A CE2 1 
ATOM   975  C  CZ  . PHE A 1 124 ? 25.189 42.167 62.575 1.00 12.87  ? 124  PHE A CZ  1 
ATOM   976  N  N   . THR A 1 125 ? 24.030 38.191 65.022 1.00 10.71  ? 125  THR A N   1 
ATOM   977  C  CA  . THR A 1 125 ? 23.139 38.678 66.050 1.00 10.84  ? 125  THR A CA  1 
ATOM   978  C  C   . THR A 1 125 ? 23.251 40.200 66.132 1.00 15.68  ? 125  THR A C   1 
ATOM   979  O  O   . THR A 1 125 ? 24.367 40.710 66.274 1.00 12.16  ? 125  THR A O   1 
ATOM   980  C  CB  . THR A 1 125 ? 23.502 38.028 67.395 1.00 13.20  ? 125  THR A CB  1 
ATOM   981  O  OG1 . THR A 1 125 ? 23.322 36.595 67.289 1.00 13.17  ? 125  THR A OG1 1 
ATOM   982  C  CG2 . THR A 1 125 ? 22.604 38.544 68.524 1.00 12.63  ? 125  THR A CG2 1 
ATOM   983  N  N   . LYS A 1 126 ? 22.135 40.908 66.031 1.00 10.87  ? 126  LYS A N   1 
ATOM   984  C  CA  . LYS A 1 126 ? 22.163 42.362 66.165 1.00 11.23  ? 126  LYS A CA  1 
ATOM   985  C  C   . LYS A 1 126 ? 22.715 42.824 67.509 1.00 14.50  ? 126  LYS A C   1 
ATOM   986  O  O   . LYS A 1 126 ? 22.808 42.051 68.469 1.00 12.05  ? 126  LYS A O   1 
ATOM   987  C  CB  . LYS A 1 126 ? 20.736 42.924 66.020 1.00 13.74  ? 126  LYS A CB  1 
ATOM   988  C  CG  . LYS A 1 126 ? 20.175 42.659 64.620 1.00 13.89  ? 126  LYS A CG  1 
ATOM   989  C  CD  . LYS A 1 126 ? 18.728 43.185 64.594 1.00 14.69  ? 126  LYS A CD  1 
ATOM   990  C  CE  . LYS A 1 126 ? 18.071 42.841 63.262 1.00 14.43  ? 126  LYS A CE  1 
ATOM   991  N  NZ  . LYS A 1 126 ? 16.744 43.533 63.160 1.00 16.74  ? 126  LYS A NZ  1 
ATOM   992  N  N   . GLU A 1 127 ? 23.047 44.131 67.593 1.00 10.87  ? 127  GLU A N   1 
ATOM   993  C  CA  . GLU A 1 127 ? 23.524 44.642 68.886 1.00 10.15  ? 127  GLU A CA  1 
ATOM   994  C  C   . GLU A 1 127 ? 22.659 44.329 70.077 1.00 11.99  ? 127  GLU A C   1 
ATOM   995  O  O   . GLU A 1 127 ? 23.146 44.019 71.179 1.00 13.13  ? 127  GLU A O   1 
ATOM   996  C  CB  . GLU A 1 127 ? 23.534 46.187 68.815 1.00 18.05  ? 127  GLU A CB  1 
ATOM   997  C  CG  . GLU A 1 127 ? 24.553 46.773 67.889 1.00 15.82  ? 127  GLU A CG  1 
ATOM   998  C  CD  . GLU A 1 127 ? 24.568 48.305 67.956 1.00 15.41  ? 127  GLU A CD  1 
ATOM   999  O  OE1 . GLU A 1 127 ? 23.531 48.950 68.224 1.00 16.50  ? 127  GLU A OE1 1 
ATOM   1000 O  OE2 . GLU A 1 127 ? 25.680 48.812 67.699 1.00 17.02  ? 127  GLU A OE2 1 
ATOM   1001 N  N   . ASP A 1 128 ? 21.329 44.388 69.909 1.00 10.74  ? 128  ASP A N   1 
ATOM   1002 C  CA  . ASP A 1 128 ? 20.453 44.171 71.057 1.00 16.18  ? 128  ASP A CA  1 
ATOM   1003 C  C   . ASP A 1 128 ? 20.180 42.697 71.341 1.00 15.51  ? 128  ASP A C   1 
ATOM   1004 O  O   . ASP A 1 128 ? 19.340 42.389 72.204 1.00 16.29  ? 128  ASP A O   1 
ATOM   1005 C  CB  . ASP A 1 128 ? 19.133 44.938 70.837 1.00 15.62  ? 128  ASP A CB  1 
ATOM   1006 C  CG  . ASP A 1 128 ? 18.246 44.278 69.793 1.00 25.97  ? 128  ASP A CG  1 
ATOM   1007 O  OD1 . ASP A 1 128 ? 18.680 43.351 69.073 1.00 15.35  ? 128  ASP A OD1 1 
ATOM   1008 O  OD2 . ASP A 1 128 ? 17.069 44.694 69.668 1.00 21.35  ? 128  ASP A OD2 1 
ATOM   1009 N  N   . GLY A 1 129 ? 20.878 41.797 70.645 1.00 12.60  ? 129  GLY A N   1 
ATOM   1010 C  CA  . GLY A 1 129 ? 20.756 40.365 70.908 1.00 11.63  ? 129  GLY A CA  1 
ATOM   1011 C  C   . GLY A 1 129 ? 19.763 39.668 70.000 1.00 18.73  ? 129  GLY A C   1 
ATOM   1012 O  O   . GLY A 1 129 ? 19.569 38.444 70.134 1.00 16.39  ? 129  GLY A O   1 
ATOM   1013 N  N   . GLU A 1 130 ? 19.109 40.387 69.088 1.00 12.80  ? 130  GLU A N   1 
ATOM   1014 C  CA  . GLU A 1 130 ? 18.176 39.773 68.142 1.00 9.66   ? 130  GLU A CA  1 
ATOM   1015 C  C   . GLU A 1 130 ? 18.936 38.883 67.178 1.00 16.75  ? 130  GLU A C   1 
ATOM   1016 O  O   . GLU A 1 130 ? 19.797 39.346 66.430 1.00 15.53  ? 130  GLU A O   1 
ATOM   1017 C  CB  . GLU A 1 130 ? 17.414 40.834 67.338 1.00 14.53  ? 130  GLU A CB  1 
ATOM   1018 C  CG  . GLU A 1 130 ? 16.369 40.264 66.399 1.00 26.54  ? 130  GLU A CG  1 
ATOM   1019 C  CD  . GLU A 1 130 ? 15.733 41.276 65.464 1.00 30.16  ? 130  GLU A CD  1 
ATOM   1020 O  OE1 . GLU A 1 130 ? 15.637 42.467 65.798 1.00 28.40  ? 130  GLU A OE1 1 
ATOM   1021 O  OE2 . GLU A 1 130 ? 15.314 40.892 64.346 1.00 47.01  ? 130  GLU A OE2 1 
ATOM   1022 N  N   . LYS A 1 131 ? 18.641 37.585 67.150 1.00 14.83  ? 131  LYS A N   1 
ATOM   1023 C  CA  . LYS A 1 131 ? 19.389 36.744 66.210 1.00 16.59  ? 131  LYS A CA  1 
ATOM   1024 C  C   . LYS A 1 131 ? 18.845 36.923 64.798 1.00 19.57  ? 131  LYS A C   1 
ATOM   1025 O  O   . LYS A 1 131 ? 17.630 36.908 64.552 1.00 21.52  ? 131  LYS A O   1 
ATOM   1026 C  CB  . LYS A 1 131 ? 19.310 35.287 66.657 1.00 16.46  ? 131  LYS A CB  1 
ATOM   1027 C  CG  . LYS A 1 131 ? 19.690 35.023 68.111 1.00 20.95  ? 131  LYS A CG  1 
ATOM   1028 C  CD  . LYS A 1 131 ? 19.667 33.521 68.389 1.00 33.05  ? 131  LYS A CD  1 
ATOM   1029 C  CE  . LYS A 1 131 ? 19.117 33.184 69.762 1.00 42.41  ? 131  LYS A CE  1 
ATOM   1030 N  NZ  . LYS A 1 131 ? 20.094 33.394 70.856 1.00 54.13  ? 131  LYS A NZ  1 
ATOM   1031 N  N   . VAL A 1 132 ? 19.748 37.100 63.831 1.00 12.72  ? 132  VAL A N   1 
ATOM   1032 C  CA  . VAL A 1 132 ? 19.345 37.312 62.446 1.00 14.61  ? 132  VAL A CA  1 
ATOM   1033 C  C   . VAL A 1 132 ? 19.606 36.097 61.574 1.00 15.75  ? 132  VAL A C   1 
ATOM   1034 O  O   . VAL A 1 132 ? 18.673 35.674 60.898 1.00 16.17  ? 132  VAL A O   1 
ATOM   1035 C  CB  . VAL A 1 132 ? 20.109 38.493 61.801 1.00 12.56  ? 132  VAL A CB  1 
ATOM   1036 C  CG1 . VAL A 1 132 ? 19.720 38.563 60.325 1.00 13.03  ? 132  VAL A CG1 1 
ATOM   1037 C  CG2 . VAL A 1 132 ? 19.791 39.749 62.579 1.00 17.58  ? 132  VAL A CG2 1 
ATOM   1038 N  N   . VAL A 1 133 ? 20.827 35.569 61.563 1.00 10.54  ? 133  VAL A N   1 
ATOM   1039 C  CA  . VAL A 1 133 ? 21.098 34.328 60.853 1.00 15.18  ? 133  VAL A CA  1 
ATOM   1040 C  C   . VAL A 1 133 ? 21.834 33.386 61.797 1.00 17.67  ? 133  VAL A C   1 
ATOM   1041 O  O   . VAL A 1 133 ? 22.672 33.862 62.574 1.00 15.32  ? 133  VAL A O   1 
ATOM   1042 C  CB  . VAL A 1 133 ? 21.868 34.472 59.528 1.00 22.71  ? 133  VAL A CB  1 
ATOM   1043 C  CG1 . VAL A 1 133 ? 21.166 35.571 58.717 1.00 30.80  ? 133  VAL A CG1 1 
ATOM   1044 C  CG2 . VAL A 1 133 ? 23.328 34.780 59.698 1.00 30.62  ? 133  VAL A CG2 1 
ATOM   1045 N  N   . ASP A 1 134 ? 21.502 32.092 61.734 1.00 18.80  ? 134  ASP A N   1 
ATOM   1046 C  CA  . ASP A 1 134 ? 22.243 31.183 62.632 1.00 19.86  ? 134  ASP A CA  1 
ATOM   1047 C  C   . ASP A 1 134 ? 23.521 30.667 62.003 1.00 19.61  ? 134  ASP A C   1 
ATOM   1048 O  O   . ASP A 1 134 ? 23.926 31.062 60.918 1.00 16.92  ? 134  ASP A O   1 
ATOM   1049 C  CB  . ASP A 1 134 ? 21.349 30.026 63.059 1.00 18.91  ? 134  ASP A CB  1 
ATOM   1050 C  CG  . ASP A 1 134 ? 20.842 29.192 61.900 1.00 32.09  ? 134  ASP A CG  1 
ATOM   1051 O  OD1 . ASP A 1 134 ? 19.719 28.652 62.017 1.00 32.29  ? 134  ASP A OD1 1 
ATOM   1052 O  OD2 . ASP A 1 134 ? 21.547 29.063 60.874 1.00 24.49  ? 134  ASP A OD2 1 
ATOM   1053 N  N   . GLU A 1 135 ? 24.214 29.716 62.634 1.00 19.53  ? 135  GLU A N   1 
ATOM   1054 C  CA  . GLU A 1 135 ? 25.527 29.337 62.128 1.00 22.26  ? 135  GLU A CA  1 
ATOM   1055 C  C   . GLU A 1 135 ? 25.454 28.603 60.803 1.00 22.01  ? 135  GLU A C   1 
ATOM   1056 O  O   . GLU A 1 135 ? 26.341 28.698 59.947 1.00 31.09  ? 135  GLU A O   1 
ATOM   1057 C  CB  . GLU A 1 135 ? 26.256 28.501 63.193 1.00 33.68  ? 135  GLU A CB  1 
ATOM   1058 C  CG  . GLU A 1 135 ? 27.259 29.371 63.953 1.00 55.97  ? 135  GLU A CG  1 
ATOM   1059 C  CD  . GLU A 1 135 ? 28.375 29.911 63.076 1.00 60.37  ? 135  GLU A CD  1 
ATOM   1060 O  OE1 . GLU A 1 135 ? 28.603 29.331 61.989 1.00 59.59  ? 135  GLU A OE1 1 
ATOM   1061 O  OE2 . GLU A 1 135 ? 29.041 30.900 63.468 1.00 31.71  ? 135  GLU A OE2 1 
ATOM   1062 N  N   . ALA A 1 136 ? 24.369 27.881 60.594 1.00 28.52  ? 136  ALA A N   1 
ATOM   1063 C  CA  . ALA A 1 136 ? 24.115 27.260 59.295 1.00 35.05  ? 136  ALA A CA  1 
ATOM   1064 C  C   . ALA A 1 136 ? 23.793 28.261 58.188 1.00 32.50  ? 136  ALA A C   1 
ATOM   1065 O  O   . ALA A 1 136 ? 23.891 27.956 56.988 1.00 33.71  ? 136  ALA A O   1 
ATOM   1066 C  CB  . ALA A 1 136 ? 22.970 26.260 59.467 1.00 27.69  ? 136  ALA A CB  1 
ATOM   1067 N  N   . GLY A 1 137 ? 23.395 29.487 58.520 1.00 20.92  ? 137  GLY A N   1 
ATOM   1068 C  CA  . GLY A 1 137 ? 23.060 30.486 57.528 1.00 15.12  ? 137  GLY A CA  1 
ATOM   1069 C  C   . GLY A 1 137 ? 21.576 30.702 57.324 1.00 19.02  ? 137  GLY A C   1 
ATOM   1070 O  O   . GLY A 1 137 ? 21.153 31.443 56.414 1.00 19.12  ? 137  GLY A O   1 
ATOM   1071 N  N   . LYS A 1 138 ? 20.734 30.068 58.145 1.00 15.60  ? 138  LYS A N   1 
ATOM   1072 C  CA  . LYS A 1 138 ? 19.301 30.249 58.017 1.00 18.51  ? 138  LYS A CA  1 
ATOM   1073 C  C   . LYS A 1 138 ? 18.876 31.588 58.635 1.00 28.28  ? 138  LYS A C   1 
ATOM   1074 O  O   . LYS A 1 138 ? 19.359 31.793 59.756 1.00 22.50  ? 138  LYS A O   1 
ATOM   1075 C  CB  . LYS A 1 138 ? 18.505 29.132 58.718 1.00 22.45  ? 138  LYS A CB  1 
ATOM   1076 C  CG  . LYS A 1 138 ? 17.008 29.359 58.529 1.00 33.48  ? 138  LYS A CG  1 
ATOM   1077 C  CD  . LYS A 1 138 ? 16.204 28.188 59.059 1.00 47.53  ? 138  LYS A CD  1 
ATOM   1078 C  CE  . LYS A 1 138 ? 16.130 28.214 60.576 1.00 62.74  ? 138  LYS A CE  1 
ATOM   1079 N  NZ  . LYS A 1 138 ? 16.228 26.841 61.151 1.00 84.35  ? 138  LYS A NZ  1 
ATOM   1080 N  N   . ARG A 1 139 ? 18.069 32.355 57.932 1.00 21.59  ? 139  ARG A N   1 
ATOM   1081 C  CA  . ARG A 1 139 ? 17.392 33.568 58.375 1.00 25.75  ? 139  ARG A CA  1 
ATOM   1082 C  C   . ARG A 1 139 ? 16.294 33.247 59.381 1.00 34.76  ? 139  ARG A C   1 
ATOM   1083 O  O   . ARG A 1 139 ? 15.337 32.575 59.023 1.00 39.23  ? 139  ARG A O   1 
ATOM   1084 C  CB  A ARG A 1 139 ? 16.806 34.326 57.187 0.42 22.95  ? 139  ARG A CB  1 
ATOM   1085 C  CB  B ARG A 1 139 ? 16.776 34.293 57.182 0.58 22.88  ? 139  ARG A CB  1 
ATOM   1086 C  CG  A ARG A 1 139 ? 17.130 35.808 57.195 0.42 25.93  ? 139  ARG A CG  1 
ATOM   1087 C  CG  B ARG A 1 139 ? 17.659 35.424 56.678 0.58 24.78  ? 139  ARG A CG  1 
ATOM   1088 C  CD  A ARG A 1 139 ? 16.700 36.451 58.496 0.42 30.98  ? 139  ARG A CD  1 
ATOM   1089 C  CD  B ARG A 1 139 ? 17.481 36.602 57.632 0.58 24.14  ? 139  ARG A CD  1 
ATOM   1090 N  NE  A ARG A 1 139 ? 15.459 37.201 58.321 0.42 40.99  ? 139  ARG A NE  1 
ATOM   1091 N  NE  B ARG A 1 139 ? 16.060 36.881 57.838 0.58 35.91  ? 139  ARG A NE  1 
ATOM   1092 C  CZ  A ARG A 1 139 ? 14.851 37.866 59.294 0.42 37.59  ? 139  ARG A CZ  1 
ATOM   1093 C  CZ  B ARG A 1 139 ? 15.395 37.699 57.024 0.58 44.78  ? 139  ARG A CZ  1 
ATOM   1094 N  NH1 A ARG A 1 139 ? 15.385 37.861 60.507 0.42 47.65  ? 139  ARG A NH1 1 
ATOM   1095 N  NH1 B ARG A 1 139 ? 16.055 38.252 56.020 0.58 23.04  ? 139  ARG A NH1 1 
ATOM   1096 N  NH2 A ARG A 1 139 ? 13.726 38.517 59.039 0.42 21.91  ? 139  ARG A NH2 1 
ATOM   1097 N  NH2 B ARG A 1 139 ? 14.109 37.965 57.197 0.58 63.16  ? 139  ARG A NH2 1 
ATOM   1098 N  N   . LEU A 1 140 ? 16.476 33.707 60.623 1.00 29.39  ? 140  LEU A N   1 
ATOM   1099 C  CA  . LEU A 1 140 ? 15.551 33.319 61.685 1.00 30.40  ? 140  LEU A CA  1 
ATOM   1100 C  C   . LEU A 1 140 ? 14.296 34.186 61.633 1.00 42.86  ? 140  LEU A C   1 
ATOM   1101 O  O   . LEU A 1 140 ? 14.404 35.339 61.218 1.00 39.95  ? 140  LEU A O   1 
ATOM   1102 C  CB  . LEU A 1 140 ? 16.245 33.380 63.038 1.00 33.27  ? 140  LEU A CB  1 
ATOM   1103 C  CG  . LEU A 1 140 ? 17.221 32.200 63.250 1.00 44.84  ? 140  LEU A CG  1 
ATOM   1104 C  CD1 . LEU A 1 140 ? 18.159 32.538 64.384 1.00 30.95  ? 140  LEU A CD1 1 
ATOM   1105 C  CD2 . LEU A 1 140 ? 16.471 30.899 63.428 1.00 59.96  ? 140  LEU A CD2 1 
HETATM 1106 S  S   . SO4 B 2 .   ? 17.951 54.345 64.155 0.85 11.19  ? 201  SO4 A S   1 
HETATM 1107 O  O1  . SO4 B 2 .   ? 18.278 54.458 62.725 0.85 13.49  ? 201  SO4 A O1  1 
HETATM 1108 O  O2  . SO4 B 2 .   ? 18.586 55.518 64.819 0.85 10.20  ? 201  SO4 A O2  1 
HETATM 1109 O  O3  . SO4 B 2 .   ? 16.591 54.359 64.277 0.85 12.32  ? 201  SO4 A O3  1 
HETATM 1110 O  O4  . SO4 B 2 .   ? 18.586 53.052 64.707 0.85 12.37  ? 201  SO4 A O4  1 
HETATM 1111 S  S   . SO4 C 2 .   ? 10.678 52.846 60.354 0.57 51.38  ? 202  SO4 A S   1 
HETATM 1112 O  O1  . SO4 C 2 .   ? 10.726 51.384 60.383 0.57 70.41  ? 202  SO4 A O1  1 
HETATM 1113 O  O2  . SO4 C 2 .   ? 11.161 53.487 61.553 0.57 59.45  ? 202  SO4 A O2  1 
HETATM 1114 O  O3  . SO4 C 2 .   ? 11.334 53.325 59.098 0.57 65.06  ? 202  SO4 A O3  1 
HETATM 1115 O  O4  . SO4 C 2 .   ? 9.275  53.341 60.108 0.57 71.69  ? 202  SO4 A O4  1 
HETATM 1116 S  S   A SO4 D 2 .   ? 17.429 47.181 63.257 0.43 21.31  ? 203  SO4 A S   1 
HETATM 1117 S  S   B SO4 D 2 .   ? 17.460 47.118 63.223 0.57 22.95  ? 203  SO4 A S   1 
HETATM 1118 O  O1  A SO4 D 2 .   ? 16.514 48.565 62.675 0.43 10.06  ? 203  SO4 A O1  1 
HETATM 1119 O  O1  B SO4 D 2 .   ? 17.349 48.718 63.745 0.57 16.86  ? 203  SO4 A O1  1 
HETATM 1120 O  O2  A SO4 D 2 .   ? 17.740 46.029 62.035 0.43 16.88  ? 203  SO4 A O2  1 
HETATM 1121 O  O2  B SO4 D 2 .   ? 16.688 47.127 61.825 0.57 17.84  ? 203  SO4 A O2  1 
HETATM 1122 O  O3  A SO4 D 2 .   ? 18.625 47.673 64.038 0.43 10.61  ? 203  SO4 A O3  1 
HETATM 1123 O  O3  B SO4 D 2 .   ? 19.007 46.908 62.956 0.57 18.28  ? 203  SO4 A O3  1 
HETATM 1124 O  O4  . SO4 D 2 .   ? 16.652 46.290 64.242 1.00 16.83  ? 203  SO4 A O4  1 
HETATM 1125 CS CS  . CS  E 3 .   ? 21.438 37.615 48.196 0.50 15.00  ? 401  CS  A CS  1 
HETATM 1126 CS CS  . CS  F 3 .   ? 28.386 63.945 46.729 0.21 25.41  ? 402  CS  A CS  1 
HETATM 1127 O  O   . HOH G 4 .   ? 20.732 48.465 67.778 1.00 17.72  ? 1001 HOH A O   1 
HETATM 1128 O  O   . HOH G 4 .   ? 4.967  73.016 49.554 1.00 16.10  ? 1002 HOH A O   1 
HETATM 1129 O  O   . HOH G 4 .   ? 25.959 45.111 64.880 1.00 10.67  ? 1003 HOH A O   1 
HETATM 1130 O  O   . HOH G 4 .   ? 25.311 38.134 53.353 1.00 14.06  ? 1004 HOH A O   1 
HETATM 1131 O  O   . HOH G 4 .   ? 18.192 43.729 74.320 1.00 18.52  ? 1005 HOH A O   1 
HETATM 1132 O  O   . HOH G 4 .   ? 26.527 60.497 58.404 1.00 12.28  ? 1006 HOH A O   1 
HETATM 1133 O  O   . HOH G 4 .   ? 22.829 37.306 52.108 1.00 13.47  ? 1007 HOH A O   1 
HETATM 1134 O  O   . HOH G 4 .   ? 16.323 51.254 65.141 1.00 10.24  ? 1008 HOH A O   1 
HETATM 1135 O  O   . HOH G 4 .   ? 18.896 60.329 58.729 1.00 12.58  ? 1009 HOH A O   1 
HETATM 1136 O  O   . HOH G 4 .   ? 7.901  63.648 63.265 1.00 19.49  ? 1010 HOH A O   1 
HETATM 1137 O  O   . HOH G 4 .   ? 29.024 33.965 46.938 1.00 16.64  ? 1011 HOH A O   1 
HETATM 1138 O  O   . HOH G 4 .   ? 5.940  67.463 60.309 1.00 13.72  ? 1012 HOH A O   1 
HETATM 1139 O  O   . HOH G 4 .   ? 33.395 47.557 48.753 1.00 17.14  ? 1013 HOH A O   1 
HETATM 1140 O  O   . HOH G 4 .   ? 8.523  59.059 55.687 1.00 17.28  ? 1014 HOH A O   1 
HETATM 1141 O  O   . HOH G 4 .   ? 6.406  60.957 55.979 1.00 18.37  ? 1015 HOH A O   1 
HETATM 1142 O  O   . HOH G 4 .   ? 7.754  73.271 49.884 1.00 13.32  ? 1016 HOH A O   1 
HETATM 1143 O  O   . HOH G 4 .   ? 10.065 73.266 48.383 1.00 15.88  ? 1017 HOH A O   1 
HETATM 1144 O  O   . HOH G 4 .   ? 20.068 45.882 67.648 1.00 13.64  ? 1018 HOH A O   1 
HETATM 1145 O  O   . HOH G 4 .   ? 16.157 58.368 66.678 1.00 33.68  ? 1019 HOH A O   1 
HETATM 1146 O  O   . HOH G 4 .   ? 14.715 57.483 68.216 1.00 23.94  ? 1020 HOH A O   1 
HETATM 1147 O  O   . HOH G 4 .   ? 7.534  76.166 60.995 1.00 14.23  ? 1021 HOH A O   1 
HETATM 1148 O  O   . HOH G 4 .   ? 5.119  63.919 47.255 1.00 19.42  ? 1022 HOH A O   1 
HETATM 1149 O  O   . HOH G 4 .   ? 8.687  66.571 68.811 1.00 16.87  ? 1023 HOH A O   1 
HETATM 1150 O  O   . HOH G 4 .   ? 25.837 44.427 71.465 1.00 13.75  ? 1024 HOH A O   1 
HETATM 1151 O  O   . HOH G 4 .   ? 27.962 61.276 60.864 1.00 14.75  ? 1025 HOH A O   1 
HETATM 1152 O  O   . HOH G 4 .   ? 3.971  62.369 49.332 1.00 18.45  ? 1026 HOH A O   1 
HETATM 1153 O  O   . HOH G 4 .   ? 31.859 60.572 53.993 1.00 19.09  ? 1027 HOH A O   1 
HETATM 1154 O  O   . HOH G 4 .   ? 28.849 40.452 49.830 1.00 17.45  ? 1028 HOH A O   1 
HETATM 1155 O  O   . HOH G 4 .   ? 14.574 49.809 49.607 1.00 17.05  ? 1029 HOH A O   1 
HETATM 1156 O  O   . HOH G 4 .   ? 23.647 35.304 54.163 1.00 18.68  ? 1030 HOH A O   1 
HETATM 1157 O  O   . HOH G 4 .   ? 6.612  60.328 47.560 1.00 15.53  ? 1031 HOH A O   1 
HETATM 1158 O  O   . HOH G 4 .   ? 24.188 40.896 71.089 1.00 15.25  ? 1032 HOH A O   1 
HETATM 1159 O  O   . HOH G 4 .   ? 7.953  69.433 42.086 1.00 13.93  ? 1033 HOH A O   1 
HETATM 1160 O  O   . HOH G 4 .   ? 28.371 61.593 48.827 1.00 19.48  ? 1034 HOH A O   1 
HETATM 1161 O  O   . HOH G 4 .   ? 23.211 66.412 40.738 1.00 21.31  ? 1035 HOH A O   1 
HETATM 1162 O  O   . HOH G 4 .   ? 27.153 47.310 65.996 1.00 16.63  ? 1036 HOH A O   1 
HETATM 1163 O  O   . HOH G 4 .   ? 22.700 35.278 69.646 1.00 18.29  ? 1037 HOH A O   1 
HETATM 1164 O  O   . HOH G 4 .   ? 21.226 56.662 54.302 1.00 18.00  ? 1038 HOH A O   1 
HETATM 1165 O  O   . HOH G 4 .   ? 24.055 36.387 49.810 1.00 15.71  ? 1039 HOH A O   1 
HETATM 1166 O  O   . HOH G 4 .   ? 17.132 72.037 42.997 1.00 22.79  ? 1040 HOH A O   1 
HETATM 1167 O  O   . HOH G 4 .   ? 7.927  66.742 41.595 1.00 12.90  ? 1041 HOH A O   1 
HETATM 1168 O  O   . HOH G 4 .   ? 15.608 74.053 52.830 1.00 16.65  ? 1042 HOH A O   1 
HETATM 1169 O  O   . HOH G 4 .   ? 35.124 54.365 53.159 1.00 22.61  ? 1043 HOH A O   1 
HETATM 1170 O  O   . HOH G 4 .   ? 17.765 74.190 66.480 1.00 27.30  ? 1044 HOH A O   1 
HETATM 1171 O  O   . HOH G 4 .   ? 27.305 59.920 46.964 1.00 17.79  ? 1045 HOH A O   1 
HETATM 1172 O  O   . HOH G 4 .   ? 27.798 42.092 47.754 1.00 18.84  ? 1046 HOH A O   1 
HETATM 1173 O  O   . HOH G 4 .   ? 3.525  71.011 46.334 1.00 14.19  ? 1047 HOH A O   1 
HETATM 1174 O  O   . HOH G 4 .   ? 7.256  53.320 49.122 1.00 20.88  ? 1048 HOH A O   1 
HETATM 1175 O  O   . HOH G 4 .   ? 8.045  58.834 44.729 1.00 15.83  ? 1049 HOH A O   1 
HETATM 1176 O  O   . HOH G 4 .   ? 10.828 57.784 60.352 1.00 20.80  ? 1050 HOH A O   1 
HETATM 1177 O  O   . HOH G 4 .   ? 24.300 67.145 47.700 1.00 24.88  ? 1051 HOH A O   1 
HETATM 1178 O  O   . HOH G 4 .   ? 20.929 67.657 58.463 1.00 18.35  ? 1052 HOH A O   1 
HETATM 1179 O  O   . HOH G 4 .   ? 25.517 35.233 66.631 1.00 20.86  ? 1053 HOH A O   1 
HETATM 1180 O  O   . HOH G 4 .   ? 22.995 32.606 54.811 1.00 16.67  ? 1054 HOH A O   1 
HETATM 1181 O  O   . HOH G 4 .   ? 11.344 56.711 56.348 1.00 20.53  ? 1055 HOH A O   1 
HETATM 1182 O  O   . HOH G 4 .   ? 32.773 37.773 59.740 1.00 21.27  ? 1056 HOH A O   1 
HETATM 1183 O  O   . HOH G 4 .   ? 6.058  65.897 62.514 1.00 20.12  ? 1057 HOH A O   1 
HETATM 1184 O  O   . HOH G 4 .   ? 5.186  64.343 43.429 1.00 18.50  ? 1058 HOH A O   1 
HETATM 1185 O  O   . HOH G 4 .   ? 25.442 32.167 55.876 1.00 23.21  ? 1059 HOH A O   1 
HETATM 1186 O  O   . HOH G 4 .   ? 28.114 36.049 65.926 1.00 16.43  ? 1060 HOH A O   1 
HETATM 1187 O  O   . HOH G 4 .   ? -2.028 66.203 55.120 1.00 29.11  ? 1061 HOH A O   1 
HETATM 1188 O  O   . HOH G 4 .   ? 12.505 55.559 60.817 1.00 18.41  ? 1062 HOH A O   1 
HETATM 1189 O  O   . HOH G 4 .   ? 19.429 70.929 59.311 1.00 32.22  ? 1063 HOH A O   1 
HETATM 1190 O  O   . HOH G 4 .   ? 26.224 61.001 63.402 1.00 14.84  ? 1064 HOH A O   1 
HETATM 1191 O  O   . HOH G 4 .   ? 3.366  65.567 50.248 1.00 14.90  ? 1065 HOH A O   1 
HETATM 1192 O  O   . HOH G 4 .   ? 23.871 67.263 58.143 1.00 32.21  ? 1066 HOH A O   1 
HETATM 1193 O  O   . HOH G 4 .   ? 21.678 53.058 43.154 1.00 20.34  ? 1067 HOH A O   1 
HETATM 1194 O  O   . HOH G 4 .   ? 21.076 49.748 42.294 1.00 23.12  ? 1068 HOH A O   1 
HETATM 1195 O  O   . HOH G 4 .   ? 32.576 60.382 51.454 1.00 26.41  ? 1069 HOH A O   1 
HETATM 1196 O  O   . HOH G 4 .   ? 20.937 36.700 71.352 1.00 22.73  ? 1070 HOH A O   1 
HETATM 1197 O  O   . HOH G 4 .   ? 12.418 72.077 48.946 1.00 18.41  ? 1071 HOH A O   1 
HETATM 1198 O  O   . HOH G 4 .   ? 21.904 61.222 64.030 1.00 24.61  ? 1072 HOH A O   1 
HETATM 1199 O  O   . HOH G 4 .   ? 13.480 42.944 62.459 1.00 28.08  ? 1073 HOH A O   1 
HETATM 1200 O  O   . HOH G 4 .   ? 16.434 75.767 55.861 1.00 33.94  ? 1074 HOH A O   1 
HETATM 1201 O  O   . HOH G 4 .   ? 31.049 35.472 61.589 1.00 25.37  ? 1075 HOH A O   1 
HETATM 1202 O  O   . HOH G 4 .   ? 15.504 63.075 67.458 1.00 20.19  ? 1076 HOH A O   1 
HETATM 1203 O  O   . HOH G 4 .   ? 22.064 54.592 68.313 1.00 19.31  ? 1077 HOH A O   1 
HETATM 1204 O  O   . HOH G 4 .   ? 22.433 43.175 73.875 1.00 20.85  ? 1078 HOH A O   1 
HETATM 1205 O  O   . HOH G 4 .   ? 17.028 66.618 64.683 1.00 21.64  ? 1079 HOH A O   1 
HETATM 1206 O  O   . HOH G 4 .   ? 30.106 53.136 63.211 1.00 29.27  ? 1080 HOH A O   1 
HETATM 1207 O  O   . HOH G 4 .   ? 33.916 57.506 55.716 1.00 25.09  ? 1081 HOH A O   1 
HETATM 1208 O  O   . HOH G 4 .   ? 2.644  72.228 60.079 1.00 27.64  ? 1082 HOH A O   1 
HETATM 1209 O  O   . HOH G 4 .   ? 3.533  58.984 48.701 1.00 26.36  ? 1083 HOH A O   1 
HETATM 1210 O  O   . HOH G 4 .   ? 25.120 63.268 64.288 1.00 27.07  ? 1084 HOH A O   1 
HETATM 1211 O  O   . HOH G 4 .   ? 13.625 48.911 51.760 1.00 27.02  ? 1085 HOH A O   1 
HETATM 1212 O  O   . HOH G 4 .   ? 17.773 47.826 43.545 1.00 21.21  ? 1086 HOH A O   1 
HETATM 1213 O  O   . HOH G 4 .   ? 17.501 45.850 66.772 1.00 20.97  ? 1087 HOH A O   1 
HETATM 1214 O  O   . HOH G 4 .   ? 18.185 74.330 62.486 1.00 26.54  ? 1088 HOH A O   1 
HETATM 1215 O  O   . HOH G 4 .   ? 32.086 39.341 50.377 1.00 29.64  ? 1089 HOH A O   1 
HETATM 1216 O  O   . HOH G 4 .   ? 12.808 65.149 67.531 1.00 22.02  ? 1090 HOH A O   1 
HETATM 1217 O  O   . HOH G 4 .   ? 12.276 58.254 63.177 1.00 37.48  ? 1091 HOH A O   1 
HETATM 1218 O  O   . HOH G 4 .   ? 17.540 37.729 51.464 1.00 23.56  ? 1092 HOH A O   1 
HETATM 1219 O  O   . HOH G 4 .   ? 15.015 48.670 65.632 1.00 32.72  ? 1093 HOH A O   1 
HETATM 1220 O  O   . HOH G 4 .   ? 21.977 27.813 55.077 1.00 27.05  ? 1094 HOH A O   1 
HETATM 1221 O  O   . HOH G 4 .   ? 10.253 53.909 54.621 1.00 29.76  ? 1095 HOH A O   1 
HETATM 1222 O  O   . HOH G 4 .   ? 35.840 51.408 55.076 1.00 33.42  ? 1096 HOH A O   1 
HETATM 1223 O  O   . HOH G 4 .   ? 18.640 71.652 46.505 1.00 37.39  ? 1097 HOH A O   1 
HETATM 1224 O  O   . HOH G 4 .   ? 30.446 50.868 64.774 1.00 28.08  ? 1098 HOH A O   1 
HETATM 1225 O  O   . HOH G 4 .   ? 20.754 58.854 66.326 1.00 28.28  ? 1099 HOH A O   1 
HETATM 1226 O  O   . HOH G 4 .   ? 18.119 71.730 61.570 1.00 33.96  ? 1100 HOH A O   1 
HETATM 1227 O  O   . HOH G 4 .   ? 11.596 52.856 56.946 1.00 27.94  ? 1101 HOH A O   1 
HETATM 1228 O  O   . HOH G 4 .   ? 22.045 34.503 65.474 1.00 26.43  ? 1102 HOH A O   1 
HETATM 1229 O  O   . HOH G 4 .   ? 13.914 58.862 41.607 1.00 23.39  ? 1103 HOH A O   1 
HETATM 1230 O  O   . HOH G 4 .   ? 16.330 36.503 68.706 1.00 26.85  ? 1104 HOH A O   1 
HETATM 1231 O  O   . HOH G 4 .   ? 14.227 31.422 56.582 1.00 34.62  ? 1105 HOH A O   1 
HETATM 1232 O  O   . HOH G 4 .   ? 34.034 56.183 58.248 1.00 40.10  ? 1106 HOH A O   1 
HETATM 1233 O  O   . HOH G 4 .   ? 34.012 59.788 55.207 1.00 43.02  ? 1107 HOH A O   1 
HETATM 1234 O  O   . HOH G 4 .   ? 8.390  59.629 67.507 1.00 47.37  ? 1108 HOH A O   1 
HETATM 1235 O  O   . HOH G 4 .   ? 13.084 55.430 63.525 1.00 27.04  ? 1109 HOH A O   1 
HETATM 1236 O  O   . HOH G 4 .   ? 11.582 57.087 41.753 1.00 25.52  ? 1110 HOH A O   1 
HETATM 1237 O  O   . HOH G 4 .   ? 29.304 49.042 65.533 1.00 23.34  ? 1111 HOH A O   1 
HETATM 1238 O  O   . HOH G 4 .   ? 12.460 61.041 42.228 1.00 32.43  ? 1112 HOH A O   1 
HETATM 1239 O  O   . HOH G 4 .   ? 24.138 54.467 42.929 1.00 25.87  ? 1113 HOH A O   1 
HETATM 1240 O  O   . HOH G 4 .   ? 16.363 39.900 54.185 1.00 40.01  ? 1114 HOH A O   1 
HETATM 1241 O  O   . HOH G 4 .   ? 23.918 30.090 65.749 1.00 30.93  ? 1115 HOH A O   1 
HETATM 1242 O  O   . HOH G 4 .   ? 22.837 64.184 64.036 1.00 29.88  ? 1116 HOH A O   1 
HETATM 1243 O  O   . HOH G 4 .   ? 4.264  61.806 59.695 1.00 28.31  ? 1117 HOH A O   1 
HETATM 1244 O  O   . HOH G 4 .   ? 1.422  62.537 48.633 1.00 54.03  ? 1118 HOH A O   1 
HETATM 1245 O  O   . HOH G 4 .   ? 21.663 61.129 66.905 1.00 30.14  ? 1119 HOH A O   1 
HETATM 1246 O  O   . HOH G 4 .   ? 28.259 66.110 49.559 1.00 27.72  ? 1120 HOH A O   1 
HETATM 1247 O  O   . HOH G 4 .   ? 3.946  59.770 56.177 1.00 30.45  ? 1121 HOH A O   1 
HETATM 1248 O  O   . HOH G 4 .   ? 19.134 26.177 60.509 1.00 38.75  ? 1123 HOH A O   1 
HETATM 1249 O  O   . HOH G 4 .   ? 29.712 58.893 45.664 1.00 30.27  ? 1124 HOH A O   1 
HETATM 1250 O  O   . HOH G 4 .   ? 18.125 66.510 39.353 1.00 29.11  ? 1125 HOH A O   1 
HETATM 1251 O  O   . HOH G 4 .   ? 28.097 60.270 65.133 1.00 37.47  ? 1126 HOH A O   1 
HETATM 1252 O  O   . HOH G 4 .   ? 23.410 69.016 49.570 1.00 26.98  ? 1127 HOH A O   1 
HETATM 1253 O  O   . HOH G 4 .   ? 22.071 32.032 66.383 1.00 28.65  ? 1128 HOH A O   1 
HETATM 1254 O  O   . HOH G 4 .   ? 11.142 50.355 53.065 1.00 40.89  ? 1129 HOH A O   1 
HETATM 1255 O  O   . HOH G 4 .   ? 34.450 38.794 57.480 1.00 32.02  ? 1130 HOH A O   1 
HETATM 1256 O  O   . HOH G 4 .   ? 11.327 54.575 43.602 1.00 28.64  ? 1131 HOH A O   1 
HETATM 1257 O  O   . HOH G 4 .   ? 30.707 37.258 44.746 1.00 34.55  ? 1132 HOH A O   1 
HETATM 1258 O  O   . HOH G 4 .   ? 0.691  66.424 47.473 1.00 28.63  ? 1133 HOH A O   1 
HETATM 1259 O  O   . HOH G 4 .   ? 23.506 68.190 43.671 1.00 26.74  ? 1134 HOH A O   1 
HETATM 1260 O  O   . HOH G 4 .   ? 16.534 47.850 68.549 1.00 35.06  ? 1135 HOH A O   1 
HETATM 1261 O  O   . HOH G 4 .   ? 29.771 34.572 63.553 1.00 32.26  ? 1136 HOH A O   1 
HETATM 1262 O  O   . HOH G 4 .   ? 19.513 60.697 38.367 1.00 29.45  ? 1137 HOH A O   1 
HETATM 1263 O  O   . HOH G 4 .   ? 33.642 52.140 60.599 1.00 29.37  ? 1138 HOH A O   1 
HETATM 1264 O  O   . HOH G 4 .   ? 27.817 30.075 57.503 1.00 34.36  ? 1139 HOH A O   1 
HETATM 1265 O  O   . HOH G 4 .   ? 36.854 44.360 51.171 1.00 29.44  ? 1140 HOH A O   1 
HETATM 1266 O  O   . HOH G 4 .   ? 15.383 73.049 50.297 1.00 38.31  ? 1141 HOH A O   1 
HETATM 1267 O  O   . HOH G 4 .   ? 27.714 58.083 67.668 1.00 51.24  ? 1142 HOH A O   1 
HETATM 1268 O  O   . HOH G 4 .   ? 28.542 50.899 45.394 1.00 32.08  ? 1143 HOH A O   1 
HETATM 1269 O  O   . HOH G 4 .   ? 32.171 54.770 60.203 1.00 31.06  ? 1144 HOH A O   1 
HETATM 1270 O  O   . HOH G 4 .   ? 33.571 57.755 51.360 1.00 26.17  ? 1145 HOH A O   1 
HETATM 1271 O  O   . HOH G 4 .   ? 16.918 73.631 47.830 1.00 42.39  ? 1146 HOH A O   1 
HETATM 1272 O  O   . HOH G 4 .   ? -1.961 69.023 48.743 1.00 24.06  ? 1147 HOH A O   1 
HETATM 1273 O  O   . HOH G 4 .   ? 5.237  63.050 40.906 1.00 40.63  ? 1148 HOH A O   1 
HETATM 1274 O  O   . HOH G 4 .   ? 36.006 56.817 51.129 1.00 54.35  ? 1149 HOH A O   1 
HETATM 1275 O  O   . HOH G 4 .   ? 33.450 33.354 60.897 1.00 66.14  ? 1150 HOH A O   1 
HETATM 1276 O  O   . HOH G 4 .   ? 24.115 48.666 41.885 1.00 38.65  ? 1151 HOH A O   1 
HETATM 1277 O  O   . HOH G 4 .   ? 19.051 68.829 62.614 1.00 45.60  ? 1152 HOH A O   1 
HETATM 1278 O  O   . HOH G 4 .   ? 11.565 46.805 54.891 1.00 27.96  ? 1153 HOH A O   1 
HETATM 1279 O  O   . HOH G 4 .   ? 25.897 31.512 58.902 1.00 30.60  ? 1155 HOH A O   1 
HETATM 1280 O  O   . HOH G 4 .   ? 18.224 68.988 65.872 1.00 34.81  ? 1156 HOH A O   1 
HETATM 1281 O  O   . HOH G 4 .   ? 35.186 40.253 49.073 1.00 40.57  ? 1157 HOH A O   1 
HETATM 1282 O  O   . HOH G 4 .   ? 21.755 70.649 42.780 1.00 54.59  ? 1158 HOH A O   1 
HETATM 1283 O  O   . HOH G 4 .   ? 1.636  62.564 54.390 1.00 44.06  ? 1159 HOH A O   1 
HETATM 1284 O  O   . HOH G 4 .   ? 30.450 34.145 52.446 1.00 33.84  ? 1160 HOH A O   1 
HETATM 1285 O  O   . HOH G 4 .   ? 23.792 61.358 68.532 1.00 40.80  ? 1161 HOH A O   1 
HETATM 1286 O  O   . HOH G 4 .   ? 26.497 55.138 45.076 1.00 44.23  ? 1162 HOH A O   1 
HETATM 1287 O  O   . HOH G 4 .   ? 3.329  71.580 56.216 1.00 30.93  ? 1163 HOH A O   1 
HETATM 1288 O  O   . HOH G 4 .   ? 3.561  62.168 45.220 1.00 41.10  ? 1164 HOH A O   1 
HETATM 1289 O  O   . HOH G 4 .   ? 26.383 30.412 66.864 1.00 36.12  ? 1165 HOH A O   1 
HETATM 1290 O  O   . HOH G 4 .   ? 15.153 60.499 64.588 1.00 47.42  ? 1166 HOH A O   1 
HETATM 1291 O  O   . HOH G 4 .   ? 4.812  74.235 54.421 1.00 34.45  ? 1167 HOH A O   1 
HETATM 1292 O  O   . HOH G 4 .   ? 28.869 30.790 54.944 1.00 54.96  ? 1168 HOH A O   1 
HETATM 1293 O  O   . HOH G 4 .   ? 9.952  60.678 42.007 1.00 49.83  ? 1169 HOH A O   1 
HETATM 1294 O  O   . HOH G 4 .   ? 9.690  56.108 58.312 1.00 35.82  ? 1170 HOH A O   1 
HETATM 1295 O  O   . HOH G 4 .   ? 29.614 49.350 63.281 1.00 30.06  ? 1171 HOH A O   1 
HETATM 1296 O  O   . HOH G 4 .   ? 23.248 26.724 62.927 1.00 51.85  ? 1172 HOH A O   1 
HETATM 1297 O  O   . HOH G 4 .   ? 13.413 64.604 40.185 1.00 40.27  ? 1173 HOH A O   1 
HETATM 1298 O  O   . HOH G 4 .   ? 30.370 60.921 61.852 1.00 27.97  ? 1174 HOH A O   1 
HETATM 1299 O  O   . HOH G 4 .   ? 2.604  64.534 46.247 1.00 38.69  ? 1175 HOH A O   1 
HETATM 1300 O  O   . HOH G 4 .   ? -0.967 63.039 47.381 1.00 41.55  ? 1176 HOH A O   1 
HETATM 1301 O  O   . HOH G 4 .   ? 34.055 49.635 47.815 1.00 46.12  ? 1177 HOH A O   1 
HETATM 1302 O  O   . HOH G 4 .   ? 23.644 32.573 69.642 1.00 36.16  ? 1178 HOH A O   1 
HETATM 1303 O  O   . HOH G 4 .   ? 13.513 53.160 65.075 1.00 42.91  ? 1179 HOH A O   1 
HETATM 1304 O  O   . HOH G 4 .   ? 19.860 26.062 56.585 1.00 45.47  ? 1180 HOH A O   1 
HETATM 1305 O  O   . HOH G 4 .   ? 24.064 50.995 41.264 1.00 39.56  ? 1181 HOH A O   1 
HETATM 1306 O  O   . HOH G 4 .   ? 18.861 48.381 40.784 1.00 31.02  ? 1183 HOH A O   1 
HETATM 1307 O  O   . HOH G 4 .   ? 31.008 61.089 49.246 1.00 35.78  ? 1184 HOH A O   1 
HETATM 1308 O  O   . HOH G 4 .   ? 11.702 50.457 55.871 1.00 33.24  ? 1185 HOH A O   1 
HETATM 1309 O  O   . HOH G 4 .   ? 30.252 43.174 46.353 1.00 43.10  ? 1186 HOH A O   1 
HETATM 1310 O  O   . HOH G 4 .   ? -0.965 64.234 57.350 1.00 58.23  ? 1187 HOH A O   1 
HETATM 1311 O  O   . HOH G 4 .   ? 35.984 53.925 56.801 1.00 44.99  ? 1188 HOH A O   1 
HETATM 1312 O  O   . HOH G 4 .   ? 9.840  63.234 39.935 1.00 39.38  ? 1189 HOH A O   1 
HETATM 1313 O  O   . HOH G 4 .   ? 4.366  57.369 50.082 1.00 45.24  ? 1190 HOH A O   1 
HETATM 1314 O  O   . HOH G 4 .   ? 26.092 68.434 55.252 1.00 31.36  ? 1191 HOH A O   1 
HETATM 1315 O  O   . HOH G 4 .   ? 17.893 64.439 37.881 1.00 48.21  ? 1192 HOH A O   1 
HETATM 1316 O  O   . HOH G 4 .   ? 14.025 45.634 63.729 1.00 35.01  ? 1193 HOH A O   1 
HETATM 1317 O  O   . HOH G 4 .   ? 28.227 48.406 43.170 1.00 50.25  ? 1194 HOH A O   1 
HETATM 1318 O  O   . HOH G 4 .   ? 33.348 57.883 48.593 1.00 39.75  ? 1195 HOH A O   1 
HETATM 1319 O  O   . HOH G 4 .   ? 32.513 58.422 61.926 1.00 36.76  ? 1196 HOH A O   1 
HETATM 1320 O  O   . HOH G 4 .   ? 7.479  52.007 51.074 1.00 46.35  ? 1197 HOH A O   1 
HETATM 1321 O  O   . HOH G 4 .   ? 17.703 44.171 43.865 1.00 39.12  ? 1198 HOH A O   1 
HETATM 1322 O  O   . HOH G 4 .   ? 19.648 41.620 42.373 1.00 32.25  ? 1199 HOH A O   1 
HETATM 1323 O  O   . HOH G 4 .   ? 23.246 70.408 52.756 1.00 37.73  ? 1200 HOH A O   1 
HETATM 1324 O  O   . HOH G 4 .   ? 5.175  56.411 52.793 1.00 46.11  ? 1201 HOH A O   1 
HETATM 1325 O  O   . HOH G 4 .   ? 19.908 46.625 39.254 1.00 80.07  ? 1203 HOH A O   1 
HETATM 1326 O  O   . HOH G 4 .   ? 20.677 70.123 40.213 1.00 39.27  ? 1204 HOH A O   1 
HETATM 1327 O  O   . HOH G 4 .   ? 31.976 52.013 46.404 1.00 40.47  ? 1205 HOH A O   1 
HETATM 1328 O  O   . HOH G 4 .   ? 15.143 36.200 65.911 1.00 40.22  ? 1206 HOH A O   1 
HETATM 1329 O  O   . HOH G 4 .   ? 12.737 40.962 58.169 1.00 45.54  ? 1207 HOH A O   1 
HETATM 1330 O  O   . HOH G 4 .   ? 14.412 47.514 44.692 1.00 53.12  ? 1208 HOH A O   1 
HETATM 1331 O  O   . HOH G 4 .   ? 17.467 61.067 65.146 1.00 47.84  ? 1209 HOH A O   1 
HETATM 1332 O  O   . HOH G 4 .   ? 13.867 49.752 41.439 1.00 41.90  ? 1210 HOH A O   1 
HETATM 1333 O  O   . HOH G 4 .   ? 37.028 49.231 51.235 1.00 38.52  ? 1211 HOH A O   1 
HETATM 1334 O  O   . HOH G 4 .   ? 35.870 49.669 45.689 1.00 44.98  ? 1212 HOH A O   1 
HETATM 1335 O  O   . HOH G 4 .   ? 14.758 49.499 61.527 1.00 28.95  ? 1213 HOH A O   1 
HETATM 1336 O  O   . HOH G 4 .   ? 22.707 66.305 62.381 1.00 47.20  ? 1214 HOH A O   1 
HETATM 1337 O  O   . HOH G 4 .   ? 32.182 57.141 46.588 1.00 42.36  ? 1215 HOH A O   1 
HETATM 1338 O  O   . HOH G 4 .   ? 29.416 54.131 66.014 1.00 44.21  ? 1216 HOH A O   1 
HETATM 1339 O  O   . HOH G 4 .   ? 12.805 57.415 65.419 1.00 49.29  ? 1217 HOH A O   1 
HETATM 1340 O  O   . HOH G 4 .   ? 12.082 46.793 48.142 1.00 53.88  ? 1219 HOH A O   1 
HETATM 1341 O  O   . HOH G 4 .   ? 12.347 42.655 56.377 1.00 60.00  ? 1220 HOH A O   1 
HETATM 1342 O  O   . HOH G 4 .   ? 13.529 45.535 50.436 1.00 36.79  ? 1221 HOH A O   1 
HETATM 1343 O  O   . HOH G 4 .   ? 12.693 49.051 60.431 1.00 33.10  ? 1223 HOH A O   1 
HETATM 1344 O  O   . HOH G 4 .   ? 26.066 29.522 53.974 1.00 35.91  ? 1224 HOH A O   1 
HETATM 1345 O  O   . HOH G 4 .   ? 18.905 54.027 37.638 1.00 58.46  ? 1225 HOH A O   1 
HETATM 1346 O  O   . HOH G 4 .   ? 11.105 52.371 40.836 1.00 54.59  ? 1227 HOH A O   1 
HETATM 1347 O  O   . HOH G 4 .   ? 14.910 38.898 62.728 1.00 63.75  ? 1228 HOH A O   1 
HETATM 1348 O  O   . HOH G 4 .   ? 25.567 69.244 53.111 1.00 56.34  ? 1229 HOH A O   1 
HETATM 1349 O  O   . HOH G 4 .   ? 30.942 54.773 46.330 1.00 43.14  ? 1230 HOH A O   1 
HETATM 1350 O  O   . HOH G 4 .   ? 8.506  58.952 64.829 1.00 50.01  ? 1231 HOH A O   1 
HETATM 1351 O  O   . HOH G 4 .   ? 27.049 66.787 46.444 1.00 44.09  ? 1232 HOH A O   1 
HETATM 1352 O  O   . HOH G 4 .   ? 32.102 57.206 64.610 1.00 50.98  ? 1233 HOH A O   1 
HETATM 1353 O  O   . HOH G 4 .   ? 28.025 52.541 43.537 1.00 59.37  ? 1234 HOH A O   1 
HETATM 1354 O  O   . HOH G 4 .   ? 7.257  56.878 56.581 1.00 43.15  ? 1237 HOH A O   1 
HETATM 1355 O  O   . HOH G 4 .   ? 13.591 46.904 69.329 1.00 64.04  ? 1241 HOH A O   1 
HETATM 1356 O  O   . HOH G 4 .   ? 0.830  60.483 49.556 1.00 61.78  ? 1242 HOH A O   1 
HETATM 1357 O  O   . HOH G 4 .   ? 32.756 42.910 46.610 1.00 50.91  ? 1243 HOH A O   1 
HETATM 1358 O  O   . HOH G 4 .   ? 4.717  60.587 44.017 1.00 38.80  ? 1244 HOH A O   1 
HETATM 1359 O  O   . HOH G 4 .   ? 1.202  61.578 52.360 1.00 45.17  ? 1245 HOH A O   1 
HETATM 1360 O  O   . HOH G 4 .   ? 13.840 41.824 52.874 1.00 48.81  ? 1246 HOH A O   1 
HETATM 1361 O  O   . HOH G 4 .   ? 13.992 58.273 38.664 1.00 40.40  ? 1248 HOH A O   1 
HETATM 1362 O  O   . HOH G 4 .   ? 19.249 75.894 56.907 1.00 58.30  ? 1249 HOH A O   1 
HETATM 1363 O  O   . HOH G 4 .   ? 18.451 27.902 64.656 1.00 53.13  ? 1250 HOH A O   1 
HETATM 1364 O  O   . HOH G 4 .   ? 30.169 68.362 52.073 1.00 40.08  ? 1251 HOH A O   1 
HETATM 1365 O  O   . HOH G 4 .   ? 26.053 69.749 50.805 1.00 41.58  ? 1252 HOH A O   1 
HETATM 1366 O  O   . HOH G 4 .   ? 25.824 63.146 67.126 1.00 69.67  ? 1253 HOH A O   1 
HETATM 1367 O  O   . HOH G 4 .   ? 32.617 35.588 52.346 1.00 55.20  ? 1254 HOH A O   1 
HETATM 1368 O  O   . HOH G 4 .   ? 25.712 52.711 41.662 1.00 52.72  ? 1257 HOH A O   1 
HETATM 1369 O  O   . HOH G 4 .   ? 26.548 64.407 39.794 1.00 58.30  ? 1258 HOH A O   1 
HETATM 1370 O  O   . HOH G 4 .   ? 19.651 65.541 35.501 1.00 39.89  ? 1259 HOH A O   1 
HETATM 1371 O  O   . HOH G 4 .   ? 20.611 71.253 63.915 1.00 46.35  ? 1260 HOH A O   1 
HETATM 1372 O  O   . HOH G 4 .   ? 8.161  61.685 40.760 1.00 60.65  ? 1261 HOH A O   1 
HETATM 1373 O  O   . HOH G 4 .   ? -0.144 75.126 54.548 1.00 55.79  ? 1263 HOH A O   1 
HETATM 1374 O  O   . HOH G 4 .   ? 9.639  49.054 42.465 1.00 99.99  ? 1264 HOH A O   1 
HETATM 1375 O  O   . HOH G 4 .   ? 12.285 44.660 66.506 1.00 81.66  ? 1269 HOH A O   1 
HETATM 1376 O  O   . HOH G 4 .   ? 14.324 75.988 67.182 1.00 53.91  ? 1271 HOH A O   1 
HETATM 1377 O  O   . HOH G 4 .   ? 28.669 31.130 65.932 1.00 35.95  ? 1272 HOH A O   1 
HETATM 1378 O  O   . HOH G 4 .   ? 23.057 27.934 65.528 1.00 56.92  ? 1274 HOH A O   1 
HETATM 1379 O  O   . HOH G 4 .   ? 17.352 58.048 37.808 1.00 48.10  ? 1280 HOH A O   1 
HETATM 1380 O  O   . HOH G 4 .   ? 4.529  73.841 57.891 1.00 43.38  ? 1281 HOH A O   1 
HETATM 1381 O  O   . HOH G 4 .   ? 30.105 63.801 65.142 1.00 72.59  ? 1282 HOH A O   1 
HETATM 1382 O  O   . HOH G 4 .   ? 9.100  57.141 62.892 1.00 55.07  ? 1283 HOH A O   1 
HETATM 1383 O  O   . HOH G 4 .   ? 20.171 25.041 62.210 1.00 51.48  ? 1284 HOH A O   1 
HETATM 1384 O  O   . HOH G 4 .   ? 18.622 45.412 40.870 1.00 59.81  ? 1286 HOH A O   1 
HETATM 1385 O  O   . HOH G 4 .   ? 24.169 59.534 39.577 1.00 48.05  ? 1288 HOH A O   1 
HETATM 1386 O  O   . HOH G 4 .   ? 32.304 62.865 61.365 1.00 66.53  ? 1290 HOH A O   1 
HETATM 1387 O  O   . HOH G 4 .   ? 10.102 57.159 43.822 1.00 35.27  ? 1291 HOH A O   1 
HETATM 1388 O  O   . HOH G 4 .   ? 22.533 59.404 37.388 1.00 53.13  ? 1292 HOH A O   1 
HETATM 1389 O  O   . HOH G 4 .   ? 24.032 70.129 55.005 1.00 54.97  ? 1294 HOH A O   1 
HETATM 1390 O  O   . HOH G 4 .   ? 10.921 44.393 55.903 1.00 58.09  ? 1295 HOH A O   1 
HETATM 1391 O  O   . HOH G 4 .   ? 7.493  52.969 44.692 1.00 55.39  ? 1296 HOH A O   1 
HETATM 1392 O  O   . HOH G 4 .   ? 19.210 60.871 63.683 1.00 25.67  ? 1297 HOH A O   1 
HETATM 1393 O  O   . HOH G 4 .   ? 28.133 63.833 60.442 1.00 54.57  ? 1298 HOH A O   1 
HETATM 1394 O  O   . HOH G 4 .   ? 13.693 66.336 37.841 1.00 46.74  ? 1299 HOH A O   1 
HETATM 1395 O  O   . HOH G 4 .   ? 14.210 73.696 59.910 1.00 39.06  ? 1300 HOH A O   1 
HETATM 1396 O  O   . HOH G 4 .   ? 15.768 72.155 60.551 1.00 27.59  ? 1302 HOH A O   1 
HETATM 1397 O  O   . HOH G 4 .   ? 14.495 40.130 55.504 1.00 44.19  ? 1305 HOH A O   1 
HETATM 1398 O  O   . HOH G 4 .   ? 8.348  63.533 66.176 1.00 38.46  ? 1307 HOH A O   1 
HETATM 1399 O  O   . HOH G 4 .   ? 16.071 51.551 39.088 1.00 62.70  ? 1310 HOH A O   1 
HETATM 1400 O  O   . HOH G 4 .   ? 35.351 42.095 56.052 1.00 57.39  ? 1311 HOH A O   1 
HETATM 1401 O  O   . HOH G 4 .   ? 19.858 67.977 38.992 1.00 43.06  ? 1317 HOH A O   1 
HETATM 1402 O  O   . HOH G 4 .   ? 8.393  55.214 66.380 1.00 72.56  ? 1319 HOH A O   1 
HETATM 1403 O  O   . HOH G 4 .   ? 25.800 24.590 61.908 1.00 56.14  ? 1320 HOH A O   1 
HETATM 1404 O  O   . HOH G 4 .   ? 11.251 45.996 62.332 1.00 59.29  ? 1321 HOH A O   1 
HETATM 1405 O  O   . HOH G 4 .   ? 15.547 43.709 67.730 1.00 31.68  ? 1322 HOH A O   1 
HETATM 1406 O  O   . HOH G 4 .   ? 16.130 33.836 70.710 1.00 54.77  ? 1324 HOH A O   1 
HETATM 1407 O  O   . HOH G 4 .   ? 17.428 37.319 71.938 1.00 45.99  ? 1325 HOH A O   1 
HETATM 1408 O  O   . HOH G 4 .   ? 13.178 61.455 37.417 1.00 58.68  ? 1326 HOH A O   1 
HETATM 1409 O  O   . HOH G 4 .   ? 24.582 66.924 60.565 1.00 54.36  ? 1327 HOH A O   1 
HETATM 1410 O  O   . HOH G 4 .   ? 21.764 21.051 52.598 1.00 62.90  ? 1328 HOH A O   1 
HETATM 1411 O  O   . HOH G 4 .   ? 35.860 59.967 53.036 1.00 66.38  ? 1333 HOH A O   1 
HETATM 1412 O  O   . HOH G 4 .   ? 36.704 41.717 49.937 1.00 72.45  ? 1334 HOH A O   1 
HETATM 1413 O  O   . HOH G 4 .   ? 26.761 27.913 66.285 1.00 52.76  ? 1340 HOH A O   1 
HETATM 1414 O  O   . HOH G 4 .   ? 5.919  56.188 66.743 1.00 78.20  ? 1342 HOH A O   1 
HETATM 1415 O  O   . HOH G 4 .   ? 4.659  58.366 41.421 1.00 67.20  ? 1343 HOH A O   1 
HETATM 1416 O  O   . HOH G 4 .   ? 19.918 73.330 64.785 1.00 50.00  ? 1345 HOH A O   1 
HETATM 1417 O  O   . HOH G 4 .   ? 2.590  62.246 57.687 1.00 50.00  ? 1346 HOH A O   1 
HETATM 1418 O  O   . HOH G 4 .   ? 20.861 31.655 72.940 1.00 50.00  ? 1348 HOH A O   1 
HETATM 1419 O  O   . HOH G 4 .   ? 32.158 34.728 45.860 1.00 50.00  ? 1352 HOH A O   1 
HETATM 1420 O  O   . HOH G 4 .   ? 33.459 38.457 46.631 1.00 50.00  ? 1356 HOH A O   1 
HETATM 1421 O  O   . HOH G 4 .   ? 23.851 71.893 49.213 1.00 50.00  ? 1359 HOH A O   1 
HETATM 1422 O  O   . HOH G 4 .   ? 34.791 61.604 51.544 1.00 50.00  ? 1364 HOH A O   1 
HETATM 1423 O  O   . HOH G 4 .   ? 12.358 41.853 64.218 1.00 50.00  ? 1365 HOH A O   1 
HETATM 1424 O  O   . HOH G 4 .   ? 13.870 29.402 62.926 1.00 50.00  ? 1368 HOH A O   1 
HETATM 1425 O  O   . HOH G 4 .   ? 37.331 53.998 51.635 1.00 50.00  ? 1376 HOH A O   1 
HETATM 1426 O  O   . HOH G 4 .   ? 2.800  59.167 61.443 1.00 50.00  ? 1378 HOH A O   1 
HETATM 1427 O  O   . HOH G 4 .   ? -4.945 71.195 57.300 1.00 50.00  ? 1387 HOH A O   1 
HETATM 1428 O  O   . HOH G 4 .   ? 31.678 58.087 42.305 1.00 50.00  ? 1389 HOH A O   1 
HETATM 1429 O  O   . HOH G 4 .   ? 31.642 59.623 46.904 1.00 50.00  ? 1392 HOH A O   1 
HETATM 1430 O  O   . HOH G 4 .   ? 26.735 25.343 68.699 1.00 50.00  ? 1394 HOH A O   1 
HETATM 1431 O  O   . HOH G 4 .   ? 6.869  60.197 38.818 1.00 50.00  ? 1396 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   SER 2   2   ?   ?   ?   A . n 
A 1 3   ASN 3   3   3   ASN ASN A . n 
A 1 4   ILE 4   4   4   ILE ILE A . n 
A 1 5   THR 5   5   5   THR THR A . n 
A 1 6   ILE 6   6   6   ILE ILE A . n 
A 1 7   TYR 7   7   7   TYR TYR A . n 
A 1 8   HIS 8   8   8   HIS HIS A . n 
A 1 9   ASN 9   9   9   ASN ASN A . n 
A 1 10  PRO 10  10  10  PRO PRO A . n 
A 1 11  ALA 11  11  11  ALA ALA A . n 
A 1 12  SER 12  12  12  SER SER A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  THR 14  14  14  THR THR A . n 
A 1 15  SER 15  15  15  SER SER A . n 
A 1 16  ARG 16  16  16  ARG ARG A . n 
A 1 17  ASN 17  17  17  ASN ASN A . n 
A 1 18  THR 18  18  18  THR THR A . n 
A 1 19  LEU 19  19  19  LEU LEU A . n 
A 1 20  GLU 20  20  20  GLU GLU A . n 
A 1 21  MET 21  21  21  MET MET A . n 
A 1 22  ILE 22  22  22  ILE ILE A . n 
A 1 23  ARG 23  23  23  ARG ARG A . n 
A 1 24  ASN 24  24  24  ASN ASN A . n 
A 1 25  SER 25  25  25  SER SER A . n 
A 1 26  GLY 26  26  26  GLY GLY A . n 
A 1 27  THR 27  27  27  THR THR A . n 
A 1 28  GLU 28  28  28  GLU GLU A . n 
A 1 29  PRO 29  29  29  PRO PRO A . n 
A 1 30  THR 30  30  30  THR THR A . n 
A 1 31  ILE 31  31  31  ILE ILE A . n 
A 1 32  ILE 32  32  32  ILE ILE A . n 
A 1 33  LEU 33  33  33  LEU LEU A . n 
A 1 34  TYR 34  34  34  TYR TYR A . n 
A 1 35  LEU 35  35  35  LEU LEU A . n 
A 1 36  GLU 36  36  36  GLU GLU A . n 
A 1 37  ASN 37  37  37  ASN ASN A . n 
A 1 38  PRO 38  38  38  PRO PRO A . n 
A 1 39  PRO 39  39  39  PRO PRO A . n 
A 1 40  SER 40  40  40  SER SER A . n 
A 1 41  ARG 41  41  41  ARG ARG A . n 
A 1 42  ASP 42  42  42  ASP ASP A . n 
A 1 43  GLU 43  43  43  GLU GLU A . n 
A 1 44  LEU 44  44  44  LEU LEU A . n 
A 1 45  VAL 45  45  45  VAL VAL A . n 
A 1 46  LYS 46  46  46  LYS LYS A . n 
A 1 47  LEU 47  47  47  LEU LEU A . n 
A 1 48  ILE 48  48  48  ILE ILE A . n 
A 1 49  ALA 49  49  49  ALA ALA A . n 
A 1 50  ASP 50  50  50  ASP ASP A . n 
A 1 51  MET 51  51  51  MET MET A . n 
A 1 52  GLY 52  52  52  GLY GLY A . n 
A 1 53  ILE 53  53  53  ILE ILE A . n 
A 1 54  SER 54  54  54  SER SER A . n 
A 1 55  VAL 55  55  55  VAL VAL A . n 
A 1 56  ARG 56  56  56  ARG ARG A . n 
A 1 57  ALA 57  57  57  ALA ALA A . n 
A 1 58  LEU 58  58  58  LEU LEU A . n 
A 1 59  LEU 59  59  59  LEU LEU A . n 
A 1 60  ARG 60  60  60  ARG ARG A . n 
A 1 61  LYS 61  61  61  LYS LYS A . n 
A 1 62  ASN 62  62  62  ASN ASN A . n 
A 1 63  VAL 63  63  63  VAL VAL A . n 
A 1 64  GLU 64  64  64  GLU GLU A . n 
A 1 65  PRO 65  65  65  PRO PRO A . n 
A 1 66  TYR 66  66  66  TYR TYR A . n 
A 1 67  GLU 67  67  67  GLU GLU A . n 
A 1 68  GLN 68  68  68  GLN GLN A . n 
A 1 69  LEU 69  69  69  LEU LEU A . n 
A 1 70  GLY 70  70  70  GLY GLY A . n 
A 1 71  LEU 71  71  71  LEU LEU A . n 
A 1 72  ALA 72  72  72  ALA ALA A . n 
A 1 73  GLU 73  73  73  GLU GLU A . n 
A 1 74  ASP 74  74  74  ASP ASP A . n 
A 1 75  LYS 75  75  75  LYS LYS A . n 
A 1 76  PHE 76  76  76  PHE PHE A . n 
A 1 77  THR 77  77  77  THR THR A . n 
A 1 78  ASP 78  78  78  ASP ASP A . n 
A 1 79  ASP 79  79  79  ASP ASP A . n 
A 1 80  GLN 80  80  80  GLN GLN A . n 
A 1 81  LEU 81  81  81  LEU LEU A . n 
A 1 82  ILE 82  82  82  ILE ILE A . n 
A 1 83  ASP 83  83  83  ASP ASP A . n 
A 1 84  PHE 84  84  84  PHE PHE A . n 
A 1 85  MET 85  85  85  MET MET A . n 
A 1 86  LEU 86  86  86  LEU LEU A . n 
A 1 87  GLN 87  87  87  GLN GLN A . n 
A 1 88  HIS 88  88  88  HIS HIS A . n 
A 1 89  PRO 89  89  89  PRO PRO A . n 
A 1 90  ILE 90  90  90  ILE ILE A . n 
A 1 91  LEU 91  91  91  LEU LEU A . n 
A 1 92  ILE 92  92  92  ILE ILE A . n 
A 1 93  ASN 93  93  93  ASN ASN A . n 
A 1 94  ARG 94  94  94  ARG ARG A . n 
A 1 95  PRO 95  95  95  PRO PRO A . n 
A 1 96  ILE 96  96  96  ILE ILE A . n 
A 1 97  VAL 97  97  97  VAL VAL A . n 
A 1 98  VAL 98  98  98  VAL VAL A . n 
A 1 99  THR 99  99  99  THR THR A . n 
A 1 100 PRO 100 100 100 PRO PRO A . n 
A 1 101 LEU 101 101 101 LEU LEU A . n 
A 1 102 GLY 102 102 102 GLY GLY A . n 
A 1 103 THR 103 103 103 THR THR A . n 
A 1 104 ARG 104 104 104 ARG ARG A . n 
A 1 105 LEU 105 105 105 LEU LEU A . n 
A 1 106 CYS 106 106 106 CYS CYS A . n 
A 1 107 ARG 107 107 107 ARG ARG A . n 
A 1 108 PRO 108 108 108 PRO PRO A . n 
A 1 109 SER 109 109 109 SER SER A . n 
A 1 110 GLU 110 110 110 GLU GLU A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 VAL 112 112 112 VAL VAL A . n 
A 1 113 LEU 113 113 113 LEU LEU A . n 
A 1 114 ASP 114 114 114 ASP ASP A . n 
A 1 115 ILE 115 115 115 ILE ILE A . n 
A 1 116 LEU 116 116 116 LEU LEU A . n 
A 1 117 GLN 117 117 117 GLN GLN A . n 
A 1 118 ASP 118 118 118 ASP ASP A . n 
A 1 119 ALA 119 119 119 ALA ALA A . n 
A 1 120 GLN 120 120 120 GLN GLN A . n 
A 1 121 LYS 121 121 121 LYS LYS A . n 
A 1 122 GLY 122 122 122 GLY GLY A . n 
A 1 123 ALA 123 123 123 ALA ALA A . n 
A 1 124 PHE 124 124 124 PHE PHE A . n 
A 1 125 THR 125 125 125 THR THR A . n 
A 1 126 LYS 126 126 126 LYS LYS A . n 
A 1 127 GLU 127 127 127 GLU GLU A . n 
A 1 128 ASP 128 128 128 ASP ASP A . n 
A 1 129 GLY 129 129 129 GLY GLY A . n 
A 1 130 GLU 130 130 130 GLU GLU A . n 
A 1 131 LYS 131 131 131 LYS LYS A . n 
A 1 132 VAL 132 132 132 VAL VAL A . n 
A 1 133 VAL 133 133 133 VAL VAL A . n 
A 1 134 ASP 134 134 134 ASP ASP A . n 
A 1 135 GLU 135 135 135 GLU GLU A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 GLY 137 137 137 GLY GLY A . n 
A 1 138 LYS 138 138 138 LYS LYS A . n 
A 1 139 ARG 139 139 139 ARG ARG A . n 
A 1 140 LEU 140 140 140 LEU LEU A . n 
A 1 141 LYS 141 141 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 SO4 1   201  201  SO4 SO4 A . 
C 2 SO4 1   202  202  SO4 SO4 A . 
D 2 SO4 1   203  203  SO4 SO4 A . 
E 3 CS  1   401  401  CS  CS  A . 
F 3 CS  1   402  402  CS  CS  A . 
G 4 HOH 1   1001 1001 HOH HOH A . 
G 4 HOH 2   1002 1002 HOH HOH A . 
G 4 HOH 3   1003 1003 HOH HOH A . 
G 4 HOH 4   1004 1004 HOH HOH A . 
G 4 HOH 5   1005 1005 HOH HOH A . 
G 4 HOH 6   1006 1006 HOH HOH A . 
G 4 HOH 7   1007 1007 HOH HOH A . 
G 4 HOH 8   1008 1008 HOH HOH A . 
G 4 HOH 9   1009 1009 HOH HOH A . 
G 4 HOH 10  1010 1010 HOH HOH A . 
G 4 HOH 11  1011 1011 HOH HOH A . 
G 4 HOH 12  1012 1012 HOH HOH A . 
G 4 HOH 13  1013 1013 HOH HOH A . 
G 4 HOH 14  1014 1014 HOH HOH A . 
G 4 HOH 15  1015 1015 HOH HOH A . 
G 4 HOH 16  1016 1016 HOH HOH A . 
G 4 HOH 17  1017 1017 HOH HOH A . 
G 4 HOH 18  1018 1018 HOH HOH A . 
G 4 HOH 19  1019 1019 HOH HOH A . 
G 4 HOH 20  1020 1020 HOH HOH A . 
G 4 HOH 21  1021 1021 HOH HOH A . 
G 4 HOH 22  1022 1022 HOH HOH A . 
G 4 HOH 23  1023 1023 HOH HOH A . 
G 4 HOH 24  1024 1024 HOH HOH A . 
G 4 HOH 25  1025 1025 HOH HOH A . 
G 4 HOH 26  1026 1026 HOH HOH A . 
G 4 HOH 27  1027 1027 HOH HOH A . 
G 4 HOH 28  1028 1028 HOH HOH A . 
G 4 HOH 29  1029 1029 HOH HOH A . 
G 4 HOH 30  1030 1030 HOH HOH A . 
G 4 HOH 31  1031 1031 HOH HOH A . 
G 4 HOH 32  1032 1032 HOH HOH A . 
G 4 HOH 33  1033 1033 HOH HOH A . 
G 4 HOH 34  1034 1034 HOH HOH A . 
G 4 HOH 35  1035 1035 HOH HOH A . 
G 4 HOH 36  1036 1036 HOH HOH A . 
G 4 HOH 37  1037 1037 HOH HOH A . 
G 4 HOH 38  1038 1038 HOH HOH A . 
G 4 HOH 39  1039 1039 HOH HOH A . 
G 4 HOH 40  1040 1040 HOH HOH A . 
G 4 HOH 41  1041 1041 HOH HOH A . 
G 4 HOH 42  1042 1042 HOH HOH A . 
G 4 HOH 43  1043 1043 HOH HOH A . 
G 4 HOH 44  1044 1044 HOH HOH A . 
G 4 HOH 45  1045 1045 HOH HOH A . 
G 4 HOH 46  1046 1046 HOH HOH A . 
G 4 HOH 47  1047 1047 HOH HOH A . 
G 4 HOH 48  1048 1048 HOH HOH A . 
G 4 HOH 49  1049 1049 HOH HOH A . 
G 4 HOH 50  1050 1050 HOH HOH A . 
G 4 HOH 51  1051 1051 HOH HOH A . 
G 4 HOH 52  1052 1052 HOH HOH A . 
G 4 HOH 53  1053 1053 HOH HOH A . 
G 4 HOH 54  1054 1054 HOH HOH A . 
G 4 HOH 55  1055 1055 HOH HOH A . 
G 4 HOH 56  1056 1056 HOH HOH A . 
G 4 HOH 57  1057 1057 HOH HOH A . 
G 4 HOH 58  1058 1058 HOH HOH A . 
G 4 HOH 59  1059 1059 HOH HOH A . 
G 4 HOH 60  1060 1060 HOH HOH A . 
G 4 HOH 61  1061 1061 HOH HOH A . 
G 4 HOH 62  1062 1062 HOH HOH A . 
G 4 HOH 63  1063 1063 HOH HOH A . 
G 4 HOH 64  1064 1064 HOH HOH A . 
G 4 HOH 65  1065 1065 HOH HOH A . 
G 4 HOH 66  1066 1066 HOH HOH A . 
G 4 HOH 67  1067 1067 HOH HOH A . 
G 4 HOH 68  1068 1068 HOH HOH A . 
G 4 HOH 69  1069 1069 HOH HOH A . 
G 4 HOH 70  1070 1070 HOH HOH A . 
G 4 HOH 71  1071 1071 HOH HOH A . 
G 4 HOH 72  1072 1072 HOH HOH A . 
G 4 HOH 73  1073 1073 HOH HOH A . 
G 4 HOH 74  1074 1074 HOH HOH A . 
G 4 HOH 75  1075 1075 HOH HOH A . 
G 4 HOH 76  1076 1076 HOH HOH A . 
G 4 HOH 77  1077 1077 HOH HOH A . 
G 4 HOH 78  1078 1078 HOH HOH A . 
G 4 HOH 79  1079 1079 HOH HOH A . 
G 4 HOH 80  1080 1080 HOH HOH A . 
G 4 HOH 81  1081 1081 HOH HOH A . 
G 4 HOH 82  1082 1082 HOH HOH A . 
G 4 HOH 83  1083 1083 HOH HOH A . 
G 4 HOH 84  1084 1084 HOH HOH A . 
G 4 HOH 85  1085 1085 HOH HOH A . 
G 4 HOH 86  1086 1086 HOH HOH A . 
G 4 HOH 87  1087 1087 HOH HOH A . 
G 4 HOH 88  1088 1088 HOH HOH A . 
G 4 HOH 89  1089 1089 HOH HOH A . 
G 4 HOH 90  1090 1090 HOH HOH A . 
G 4 HOH 91  1091 1091 HOH HOH A . 
G 4 HOH 92  1092 1092 HOH HOH A . 
G 4 HOH 93  1093 1093 HOH HOH A . 
G 4 HOH 94  1094 1094 HOH HOH A . 
G 4 HOH 95  1095 1095 HOH HOH A . 
G 4 HOH 96  1096 1096 HOH HOH A . 
G 4 HOH 97  1097 1097 HOH HOH A . 
G 4 HOH 98  1098 1098 HOH HOH A . 
G 4 HOH 99  1099 1099 HOH HOH A . 
G 4 HOH 100 1100 1100 HOH HOH A . 
G 4 HOH 101 1101 1101 HOH HOH A . 
G 4 HOH 102 1102 1102 HOH HOH A . 
G 4 HOH 103 1103 1103 HOH HOH A . 
G 4 HOH 104 1104 1104 HOH HOH A . 
G 4 HOH 105 1105 1105 HOH HOH A . 
G 4 HOH 106 1106 1106 HOH HOH A . 
G 4 HOH 107 1107 1107 HOH HOH A . 
G 4 HOH 108 1108 1108 HOH HOH A . 
G 4 HOH 109 1109 1109 HOH HOH A . 
G 4 HOH 110 1110 1110 HOH HOH A . 
G 4 HOH 111 1111 1111 HOH HOH A . 
G 4 HOH 112 1112 1112 HOH HOH A . 
G 4 HOH 113 1113 1113 HOH HOH A . 
G 4 HOH 114 1114 1114 HOH HOH A . 
G 4 HOH 115 1115 1115 HOH HOH A . 
G 4 HOH 116 1116 1116 HOH HOH A . 
G 4 HOH 117 1117 1117 HOH HOH A . 
G 4 HOH 118 1118 1118 HOH HOH A . 
G 4 HOH 119 1119 1119 HOH HOH A . 
G 4 HOH 120 1120 1120 HOH HOH A . 
G 4 HOH 121 1121 1121 HOH HOH A . 
G 4 HOH 122 1123 1123 HOH HOH A . 
G 4 HOH 123 1124 1124 HOH HOH A . 
G 4 HOH 124 1125 1125 HOH HOH A . 
G 4 HOH 125 1126 1126 HOH HOH A . 
G 4 HOH 126 1127 1127 HOH HOH A . 
G 4 HOH 127 1128 1128 HOH HOH A . 
G 4 HOH 128 1129 1129 HOH HOH A . 
G 4 HOH 129 1130 1130 HOH HOH A . 
G 4 HOH 130 1131 1131 HOH HOH A . 
G 4 HOH 131 1132 1132 HOH HOH A . 
G 4 HOH 132 1133 1133 HOH HOH A . 
G 4 HOH 133 1134 1134 HOH HOH A . 
G 4 HOH 134 1135 1135 HOH HOH A . 
G 4 HOH 135 1136 1136 HOH HOH A . 
G 4 HOH 136 1137 1137 HOH HOH A . 
G 4 HOH 137 1138 1138 HOH HOH A . 
G 4 HOH 138 1139 1139 HOH HOH A . 
G 4 HOH 139 1140 1140 HOH HOH A . 
G 4 HOH 140 1141 1141 HOH HOH A . 
G 4 HOH 141 1142 1142 HOH HOH A . 
G 4 HOH 142 1143 1143 HOH HOH A . 
G 4 HOH 143 1144 1144 HOH HOH A . 
G 4 HOH 144 1145 1145 HOH HOH A . 
G 4 HOH 145 1146 1146 HOH HOH A . 
G 4 HOH 146 1147 1147 HOH HOH A . 
G 4 HOH 147 1148 1148 HOH HOH A . 
G 4 HOH 148 1149 1149 HOH HOH A . 
G 4 HOH 149 1150 1150 HOH HOH A . 
G 4 HOH 150 1151 1151 HOH HOH A . 
G 4 HOH 151 1152 1152 HOH HOH A . 
G 4 HOH 152 1153 1153 HOH HOH A . 
G 4 HOH 153 1155 1155 HOH HOH A . 
G 4 HOH 154 1156 1156 HOH HOH A . 
G 4 HOH 155 1157 1157 HOH HOH A . 
G 4 HOH 156 1158 1158 HOH HOH A . 
G 4 HOH 157 1159 1159 HOH HOH A . 
G 4 HOH 158 1160 1160 HOH HOH A . 
G 4 HOH 159 1161 1161 HOH HOH A . 
G 4 HOH 160 1162 1162 HOH HOH A . 
G 4 HOH 161 1163 1163 HOH HOH A . 
G 4 HOH 162 1164 1164 HOH HOH A . 
G 4 HOH 163 1165 1165 HOH HOH A . 
G 4 HOH 164 1166 1166 HOH HOH A . 
G 4 HOH 165 1167 1167 HOH HOH A . 
G 4 HOH 166 1168 1168 HOH HOH A . 
G 4 HOH 167 1169 1169 HOH HOH A . 
G 4 HOH 168 1170 1170 HOH HOH A . 
G 4 HOH 169 1171 1171 HOH HOH A . 
G 4 HOH 170 1172 1172 HOH HOH A . 
G 4 HOH 171 1173 1173 HOH HOH A . 
G 4 HOH 172 1174 1174 HOH HOH A . 
G 4 HOH 173 1175 1175 HOH HOH A . 
G 4 HOH 174 1176 1176 HOH HOH A . 
G 4 HOH 175 1177 1177 HOH HOH A . 
G 4 HOH 176 1178 1178 HOH HOH A . 
G 4 HOH 177 1179 1179 HOH HOH A . 
G 4 HOH 178 1180 1180 HOH HOH A . 
G 4 HOH 179 1181 1181 HOH HOH A . 
G 4 HOH 180 1183 1183 HOH HOH A . 
G 4 HOH 181 1184 1184 HOH HOH A . 
G 4 HOH 182 1185 1185 HOH HOH A . 
G 4 HOH 183 1186 1186 HOH HOH A . 
G 4 HOH 184 1187 1187 HOH HOH A . 
G 4 HOH 185 1188 1188 HOH HOH A . 
G 4 HOH 186 1189 1189 HOH HOH A . 
G 4 HOH 187 1190 1190 HOH HOH A . 
G 4 HOH 188 1191 1191 HOH HOH A . 
G 4 HOH 189 1192 1192 HOH HOH A . 
G 4 HOH 190 1193 1193 HOH HOH A . 
G 4 HOH 191 1194 1194 HOH HOH A . 
G 4 HOH 192 1195 1195 HOH HOH A . 
G 4 HOH 193 1196 1196 HOH HOH A . 
G 4 HOH 194 1197 1197 HOH HOH A . 
G 4 HOH 195 1198 1198 HOH HOH A . 
G 4 HOH 196 1199 1199 HOH HOH A . 
G 4 HOH 197 1200 1200 HOH HOH A . 
G 4 HOH 198 1201 1201 HOH HOH A . 
G 4 HOH 199 1203 1203 HOH HOH A . 
G 4 HOH 200 1204 1204 HOH HOH A . 
G 4 HOH 201 1205 1205 HOH HOH A . 
G 4 HOH 202 1206 1206 HOH HOH A . 
G 4 HOH 203 1207 1207 HOH HOH A . 
G 4 HOH 204 1208 1208 HOH HOH A . 
G 4 HOH 205 1209 1209 HOH HOH A . 
G 4 HOH 206 1210 1210 HOH HOH A . 
G 4 HOH 207 1211 1211 HOH HOH A . 
G 4 HOH 208 1212 1212 HOH HOH A . 
G 4 HOH 209 1213 1213 HOH HOH A . 
G 4 HOH 210 1214 1214 HOH HOH A . 
G 4 HOH 211 1215 1215 HOH HOH A . 
G 4 HOH 212 1216 1216 HOH HOH A . 
G 4 HOH 213 1217 1217 HOH HOH A . 
G 4 HOH 214 1219 1219 HOH HOH A . 
G 4 HOH 215 1220 1220 HOH HOH A . 
G 4 HOH 216 1221 1221 HOH HOH A . 
G 4 HOH 217 1223 1223 HOH HOH A . 
G 4 HOH 218 1224 1224 HOH HOH A . 
G 4 HOH 219 1225 1225 HOH HOH A . 
G 4 HOH 220 1227 1227 HOH HOH A . 
G 4 HOH 221 1228 1228 HOH HOH A . 
G 4 HOH 222 1229 1229 HOH HOH A . 
G 4 HOH 223 1230 1230 HOH HOH A . 
G 4 HOH 224 1231 1231 HOH HOH A . 
G 4 HOH 225 1232 1232 HOH HOH A . 
G 4 HOH 226 1233 1233 HOH HOH A . 
G 4 HOH 227 1234 1234 HOH HOH A . 
G 4 HOH 228 1237 1237 HOH HOH A . 
G 4 HOH 229 1241 1241 HOH HOH A . 
G 4 HOH 230 1242 1242 HOH HOH A . 
G 4 HOH 231 1243 1243 HOH HOH A . 
G 4 HOH 232 1244 1244 HOH HOH A . 
G 4 HOH 233 1245 1245 HOH HOH A . 
G 4 HOH 234 1246 1246 HOH HOH A . 
G 4 HOH 235 1248 1248 HOH HOH A . 
G 4 HOH 236 1249 1249 HOH HOH A . 
G 4 HOH 237 1250 1250 HOH HOH A . 
G 4 HOH 238 1251 1251 HOH HOH A . 
G 4 HOH 239 1252 1252 HOH HOH A . 
G 4 HOH 240 1253 1253 HOH HOH A . 
G 4 HOH 241 1254 1254 HOH HOH A . 
G 4 HOH 242 1257 1257 HOH HOH A . 
G 4 HOH 243 1258 1258 HOH HOH A . 
G 4 HOH 244 1259 1259 HOH HOH A . 
G 4 HOH 245 1260 1260 HOH HOH A . 
G 4 HOH 246 1261 1261 HOH HOH A . 
G 4 HOH 247 1263 1263 HOH HOH A . 
G 4 HOH 248 1264 1264 HOH HOH A . 
G 4 HOH 249 1269 1269 HOH HOH A . 
G 4 HOH 250 1271 1271 HOH HOH A . 
G 4 HOH 251 1272 1272 HOH HOH A . 
G 4 HOH 252 1274 1274 HOH HOH A . 
G 4 HOH 253 1280 1280 HOH HOH A . 
G 4 HOH 254 1281 1281 HOH HOH A . 
G 4 HOH 255 1282 1282 HOH HOH A . 
G 4 HOH 256 1283 1283 HOH HOH A . 
G 4 HOH 257 1284 1284 HOH HOH A . 
G 4 HOH 258 1286 1286 HOH HOH A . 
G 4 HOH 259 1288 1288 HOH HOH A . 
G 4 HOH 260 1290 1290 HOH HOH A . 
G 4 HOH 261 1291 1291 HOH HOH A . 
G 4 HOH 262 1292 1292 HOH HOH A . 
G 4 HOH 263 1294 1294 HOH HOH A . 
G 4 HOH 264 1295 1295 HOH HOH A . 
G 4 HOH 265 1296 1296 HOH HOH A . 
G 4 HOH 266 1297 1297 HOH HOH A . 
G 4 HOH 267 1298 1298 HOH HOH A . 
G 4 HOH 268 1299 1299 HOH HOH A . 
G 4 HOH 269 1300 1300 HOH HOH A . 
G 4 HOH 270 1302 1302 HOH HOH A . 
G 4 HOH 271 1305 1305 HOH HOH A . 
G 4 HOH 272 1307 1307 HOH HOH A . 
G 4 HOH 273 1310 1310 HOH HOH A . 
G 4 HOH 274 1311 1311 HOH HOH A . 
G 4 HOH 275 1317 1317 HOH HOH A . 
G 4 HOH 276 1319 1319 HOH HOH A . 
G 4 HOH 277 1320 1320 HOH HOH A . 
G 4 HOH 278 1321 1321 HOH HOH A . 
G 4 HOH 279 1322 1322 HOH HOH A . 
G 4 HOH 280 1324 1324 HOH HOH A . 
G 4 HOH 281 1325 1325 HOH HOH A . 
G 4 HOH 282 1326 1326 HOH HOH A . 
G 4 HOH 283 1327 1327 HOH HOH A . 
G 4 HOH 284 1328 1328 HOH HOH A . 
G 4 HOH 285 1333 1333 HOH HOH A . 
G 4 HOH 286 1334 1334 HOH HOH A . 
G 4 HOH 287 1340 1340 HOH HOH A . 
G 4 HOH 288 1342 1342 HOH HOH A . 
G 4 HOH 289 1343 1343 HOH HOH A . 
G 4 HOH 290 1345 1345 HOH HOH A . 
G 4 HOH 291 1346 1346 HOH HOH A . 
G 4 HOH 292 1348 1348 HOH HOH A . 
G 4 HOH 293 1352 1352 HOH HOH A . 
G 4 HOH 294 1356 1356 HOH HOH A . 
G 4 HOH 295 1359 1359 HOH HOH A . 
G 4 HOH 296 1364 1364 HOH HOH A . 
G 4 HOH 297 1365 1365 HOH HOH A . 
G 4 HOH 298 1368 1368 HOH HOH A . 
G 4 HOH 299 1376 1376 HOH HOH A . 
G 4 HOH 300 1378 1378 HOH HOH A . 
G 4 HOH 301 1387 1387 HOH HOH A . 
G 4 HOH 302 1389 1389 HOH HOH A . 
G 4 HOH 303 1392 1392 HOH HOH A . 
G 4 HOH 304 1394 1394 HOH HOH A . 
G 4 HOH 305 1396 1396 HOH HOH A . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PQS  monomeric 1 
2 software_defined_assembly            PISA dimeric   2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1   A,B,C,D,E,F,G 
2 1,2 A,B,C,D,E,F,G 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
2 'ABSA (A^2)' 2790  ? 
2 MORE         -176  ? 
2 'SSA (A^2)'  13610 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555  x,y,z            1.0000000000 0.0000000000  0.0000000000 0.0000000000  0.0000000000  
1.0000000000  0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 10_665 -y+1,-x+1,-z+5/6 0.5000000000 -0.8660254038 0.0000000000 43.2950000000 -0.8660254038 
-0.5000000000 0.0000000000 74.9891397137 0.0000000000 0.0000000000 -1.0000000000 96.3916666667 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    CS 
_pdbx_struct_special_symmetry.auth_seq_id     401 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   E 
_pdbx_struct_special_symmetry.label_comp_id   CS 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O ? A PRO 38  ? A PRO 38   ? 1_555  CS ? F CS . ? A CS 402 ? 1_555 N ? A SER 40  ? A SER 40   ? 1_555  63.3  ? 
2  O ? A PRO 38  ? A PRO 38   ? 1_555  CS ? F CS . ? A CS 402 ? 1_555 O ? G HOH .   ? A HOH 1034 ? 1_555  64.0  ? 
3  N ? A SER 40  ? A SER 40   ? 1_555  CS ? F CS . ? A CS 402 ? 1_555 O ? G HOH .   ? A HOH 1034 ? 1_555  98.9  ? 
4  O ? A PRO 38  ? A PRO 38   ? 1_555  CS ? F CS . ? A CS 402 ? 1_555 O ? G HOH .   ? A HOH 1120 ? 1_555  48.5  ? 
5  N ? A SER 40  ? A SER 40   ? 1_555  CS ? F CS . ? A CS 402 ? 1_555 O ? G HOH .   ? A HOH 1120 ? 1_555  100.3 ? 
6  O ? G HOH .   ? A HOH 1034 ? 1_555  CS ? F CS . ? A CS 402 ? 1_555 O ? G HOH .   ? A HOH 1120 ? 1_555  85.7  ? 
7  O ? A PRO 38  ? A PRO 38   ? 1_555  CS ? F CS . ? A CS 402 ? 1_555 O ? G HOH .   ? A HOH 1232 ? 1_555  73.4  ? 
8  N ? A SER 40  ? A SER 40   ? 1_555  CS ? F CS . ? A CS 402 ? 1_555 O ? G HOH .   ? A HOH 1232 ? 1_555  65.2  ? 
9  O ? G HOH .   ? A HOH 1034 ? 1_555  CS ? F CS . ? A CS 402 ? 1_555 O ? G HOH .   ? A HOH 1232 ? 1_555  136.9 ? 
10 O ? G HOH .   ? A HOH 1120 ? 1_555  CS ? F CS . ? A CS 402 ? 1_555 O ? G HOH .   ? A HOH 1232 ? 1_555  60.6  ? 
11 O ? A LEU 113 ? A LEU 113  ? 1_555  CS ? E CS . ? A CS 401 ? 1_555 O ? A LEU 113 ? A LEU 113  ? 10_665 135.4 ? 
12 O ? A LEU 113 ? A LEU 113  ? 1_555  CS ? E CS . ? A CS 401 ? 1_555 O ? A ASP 114 ? A ASP 114  ? 1_555  69.9  ? 
13 O ? A LEU 113 ? A LEU 113  ? 10_665 CS ? E CS . ? A CS 401 ? 1_555 O ? A ASP 114 ? A ASP 114  ? 1_555  73.3  ? 
14 O ? A LEU 113 ? A LEU 113  ? 1_555  CS ? E CS . ? A CS 401 ? 1_555 O ? A ASP 114 ? A ASP 114  ? 10_665 73.3  ? 
15 O ? A LEU 113 ? A LEU 113  ? 10_665 CS ? E CS . ? A CS 401 ? 1_555 O ? A ASP 114 ? A ASP 114  ? 10_665 69.9  ? 
16 O ? A ASP 114 ? A ASP 114  ? 1_555  CS ? E CS . ? A CS 401 ? 1_555 O ? A ASP 114 ? A ASP 114  ? 10_665 67.3  ? 
17 O ? A LEU 113 ? A LEU 113  ? 1_555  CS ? E CS . ? A CS 401 ? 1_555 O ? A LEU 116 ? A LEU 116  ? 1_555  76.7  ? 
18 O ? A LEU 113 ? A LEU 113  ? 10_665 CS ? E CS . ? A CS 401 ? 1_555 O ? A LEU 116 ? A LEU 116  ? 1_555  131.0 ? 
19 O ? A ASP 114 ? A ASP 114  ? 1_555  CS ? E CS . ? A CS 401 ? 1_555 O ? A LEU 116 ? A LEU 116  ? 1_555  94.7  ? 
20 O ? A ASP 114 ? A ASP 114  ? 10_665 CS ? E CS . ? A CS 401 ? 1_555 O ? A LEU 116 ? A LEU 116  ? 1_555  148.8 ? 
21 O ? A LEU 113 ? A LEU 113  ? 1_555  CS ? E CS . ? A CS 401 ? 1_555 O ? A LEU 116 ? A LEU 116  ? 10_665 131.1 ? 
22 O ? A LEU 113 ? A LEU 113  ? 10_665 CS ? E CS . ? A CS 401 ? 1_555 O ? A LEU 116 ? A LEU 116  ? 10_665 76.7  ? 
23 O ? A ASP 114 ? A ASP 114  ? 1_555  CS ? E CS . ? A CS 401 ? 1_555 O ? A LEU 116 ? A LEU 116  ? 10_665 148.8 ? 
24 O ? A ASP 114 ? A ASP 114  ? 10_665 CS ? E CS . ? A CS 401 ? 1_555 O ? A LEU 116 ? A LEU 116  ? 10_665 94.7  ? 
25 O ? A LEU 116 ? A LEU 116  ? 1_555  CS ? E CS . ? A CS 401 ? 1_555 O ? A LEU 116 ? A LEU 116  ? 10_665 111.5 ? 
26 O ? A LEU 113 ? A LEU 113  ? 1_555  CS ? E CS . ? A CS 401 ? 1_555 O ? G HOH .   ? A HOH 1039 ? 1_555  83.5  ? 
27 O ? A LEU 113 ? A LEU 113  ? 10_665 CS ? E CS . ? A CS 401 ? 1_555 O ? G HOH .   ? A HOH 1039 ? 1_555  140.6 ? 
28 O ? A ASP 114 ? A ASP 114  ? 1_555  CS ? E CS . ? A CS 401 ? 1_555 O ? G HOH .   ? A HOH 1039 ? 1_555  140.8 ? 
29 O ? A ASP 114 ? A ASP 114  ? 10_665 CS ? E CS . ? A CS 401 ? 1_555 O ? G HOH .   ? A HOH 1039 ? 1_555  132.4 ? 
30 O ? A LEU 116 ? A LEU 116  ? 1_555  CS ? E CS . ? A CS 401 ? 1_555 O ? G HOH .   ? A HOH 1039 ? 1_555  50.3  ? 
31 O ? A LEU 116 ? A LEU 116  ? 10_665 CS ? E CS . ? A CS 401 ? 1_555 O ? G HOH .   ? A HOH 1039 ? 1_555  70.1  ? 
32 O ? A LEU 113 ? A LEU 113  ? 1_555  CS ? E CS . ? A CS 401 ? 1_555 O ? G HOH .   ? A HOH 1039 ? 10_665 140.6 ? 
33 O ? A LEU 113 ? A LEU 113  ? 10_665 CS ? E CS . ? A CS 401 ? 1_555 O ? G HOH .   ? A HOH 1039 ? 10_665 83.5  ? 
34 O ? A ASP 114 ? A ASP 114  ? 1_555  CS ? E CS . ? A CS 401 ? 1_555 O ? G HOH .   ? A HOH 1039 ? 10_665 132.3 ? 
35 O ? A ASP 114 ? A ASP 114  ? 10_665 CS ? E CS . ? A CS 401 ? 1_555 O ? G HOH .   ? A HOH 1039 ? 10_665 140.8 ? 
36 O ? A LEU 116 ? A LEU 116  ? 1_555  CS ? E CS . ? A CS 401 ? 1_555 O ? G HOH .   ? A HOH 1039 ? 10_665 70.1  ? 
37 O ? A LEU 116 ? A LEU 116  ? 10_665 CS ? E CS . ? A CS 401 ? 1_555 O ? G HOH .   ? A HOH 1039 ? 10_665 50.3  ? 
38 O ? G HOH .   ? A HOH 1039 ? 1_555  CS ? E CS . ? A CS 401 ? 1_555 O ? G HOH .   ? A HOH 1039 ? 10_665 59.1  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-02-15 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-11 
5 'Structure model' 1 4 2018-04-04 
6 'Structure model' 1 5 2018-08-29 
7 'Structure model' 1 6 2019-07-24 
8 'Structure model' 1 7 2021-10-27 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' 'Version format compliance' 
2  3 'Structure model' 'Derived calculations'      
3  3 'Structure model' 'Version format compliance' 
4  4 'Structure model' 'Refinement description'    
5  5 'Structure model' 'Data collection'           
6  6 'Structure model' 'Data collection'           
7  6 'Structure model' 'Source and taxonomy'       
8  6 'Structure model' 'Structure summary'         
9  7 'Structure model' 'Data collection'           
10 7 'Structure model' 'Refinement description'    
11 8 'Structure model' 'Database references'       
12 8 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' software               
2  5 'Structure model' diffrn_source          
3  6 'Structure model' entity                 
4  6 'Structure model' entity_src_gen         
5  6 'Structure model' entity_src_nat         
6  7 'Structure model' software               
7  8 'Structure model' database_2             
8  8 'Structure model' pdbx_struct_conn_angle 
9  8 'Structure model' struct_conn            
10 8 'Structure model' struct_ref_seq_dif     
11 8 'Structure model' struct_site            
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  5 'Structure model' '_diffrn_source.type'                         
2  6 'Structure model' '_entity.src_method'                          
3  7 'Structure model' '_software.classification'                    
4  7 'Structure model' '_software.name'                              
5  8 'Structure model' '_database_2.pdbx_DOI'                        
6  8 'Structure model' '_database_2.pdbx_database_accession'         
7  8 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
8  8 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
9  8 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 
10 8 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
11 8 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
12 8 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id'  
13 8 'Structure model' '_pdbx_struct_conn_angle.ptnr1_symmetry'      
14 8 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id'   
15 8 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 
16 8 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
17 8 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
18 8 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 
19 8 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
20 8 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
21 8 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id'  
22 8 'Structure model' '_pdbx_struct_conn_angle.ptnr3_symmetry'      
23 8 'Structure model' '_pdbx_struct_conn_angle.value'               
24 8 'Structure model' '_struct_conn.pdbx_dist_value'                
25 8 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
26 8 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
27 8 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
28 8 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
29 8 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
30 8 'Structure model' '_struct_conn.ptnr1_label_seq_id'             
31 8 'Structure model' '_struct_conn.ptnr1_symmetry'                 
32 8 'Structure model' '_struct_conn.ptnr2_auth_comp_id'             
33 8 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
34 8 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
35 8 'Structure model' '_struct_conn.ptnr2_label_atom_id'            
36 8 'Structure model' '_struct_conn.ptnr2_label_comp_id'            
37 8 'Structure model' '_struct_conn.ptnr2_label_seq_id'             
38 8 'Structure model' '_struct_conn.ptnr2_symmetry'                 
39 8 'Structure model' '_struct_ref_seq_dif.details'                 
40 8 'Structure model' '_struct_site.pdbx_auth_asym_id'              
41 8 'Structure model' '_struct_site.pdbx_auth_comp_id'              
42 8 'Structure model' '_struct_site.pdbx_auth_seq_id'               
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
SHELXL-97 refinement       .     ? 1 
XTALVIEW  refinement       SHELX ? 2 
X-GEN     'data reduction' .     ? 3 
X-GEN     'data scaling'   .     ? 4 
SHELX     phasing          .     ? 5 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE  A ARG 23  ? ? CZ A ARG 23  ? ? NH2 A ARG 23  ? ? 115.79 120.30 -4.51  0.50 N 
2 1 OE1 A GLU 43  ? B CD A GLU 43  ? B OE2 A GLU 43  ? B 112.40 123.30 -10.90 1.20 N 
3 1 NE  A ARG 94  ? ? CZ A ARG 94  ? ? NH1 A ARG 94  ? ? 123.73 120.30 3.43   0.50 N 
4 1 NE  A ARG 107 ? ? CZ A ARG 107 ? ? NH1 A ARG 107 ? ? 123.73 120.30 3.43   0.50 N 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MET 1   ? A MET 1   
2 1 Y 1 A SER 2   ? A SER 2   
3 1 Y 1 A LYS 141 ? A LYS 141 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SULFATE ION' SO4 
3 'CESIUM ION'  CS  
4 water         HOH 
#