data_1SDW
# 
_entry.id   1SDW 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1SDW         
RCSB  RCSB021626   
WWPDB D_1000021626 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1phm 'Oxidized (Cu2+) PHM'                              unspecified 
PDB 1opm 'Oxidized (Cu2+) PHM with bound peptide substrate' unspecified 
PDB 3phm 'Reduced (Cu+) PHM'                                unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1SDW 
_pdbx_database_status.recvd_initial_deposition_date   2004-02-14 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Prigge, S.T.' 1 
'Eipper, B.A.' 2 
'Mains, R.E.'  3 
'Amzel, L.M.'  4 
# 
_citation.id                        primary 
_citation.title                     'Dioxygen binds end-on to mononuclear copper in a precatalytic enzyme complex.' 
_citation.journal_abbrev            Science 
_citation.journal_volume            304 
_citation.page_first                864 
_citation.page_last                 867 
_citation.year                      2004 
_citation.journal_id_ASTM           SCIEAS 
_citation.country                   US 
_citation.journal_id_ISSN           0036-8075 
_citation.journal_id_CSD            0038 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15131304 
_citation.pdbx_database_id_DOI      10.1126/science.1094583 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Prigge, S.T.' 1 
primary 'Eipper, B.A.' 2 
primary 'Mains, R.E.'  3 
primary 'Amzel, L.M.'  4 
# 
_cell.entry_id           1SDW 
_cell.length_a           69.478 
_cell.length_b           68.979 
_cell.length_c           82.108 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1SDW 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Peptidyl-glycine alpha-amidating monooxygenase' 35008.133 1   1.14.17.3 ? 
'PHM catalytic core (residues 43-356 of rat PAM)' ? 
2 non-polymer syn 'COPPER (II) ION'                                63.546    2   ?         ? ? ? 
3 non-polymer syn 'NICKEL (II) ION'                                58.693    1   ?         ? ? ? 
4 non-polymer syn 'OXYGEN MOLECULE'                                31.999    1   ?         ? ? ? 
5 non-polymer syn N-ALPHA-ACETYL-3,5-DIIODOTYROSYL-D-THREONINE     576.122   3   ?         ? ? ? 
6 non-polymer syn GLYCEROL                                         92.094    6   ?         ? ? ? 
7 water       nat water                                            18.015    180 ?         ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        PAM 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;FSNECLGTIGPVTPLDASDFALDIRMPGVTPKESDTYFCMSMRLPVDEEAFVIDFKPRASMDTVHHMLLFGCNMPSSTGS
YWFCDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNHKDCSGVSVHLTRVPQPLIA
GMYLMMSVDTVIPPGEKVVNADISCQYKMYPMHVFAYRVHTHHLGKVVSGYRVRNGQWTLIGRQNPQLPQAFYPVEHPVD
VTFGDILAARCVFTGEGRTEATHIGGTSSDEMCNLYIMYYMEAKYALSFMTCTKNVAPDMFRTIPAEANIPIPV
;
_entity_poly.pdbx_seq_one_letter_code_can   
;FSNECLGTIGPVTPLDASDFALDIRMPGVTPKESDTYFCMSMRLPVDEEAFVIDFKPRASMDTVHHMLLFGCNMPSSTGS
YWFCDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNHKDCSGVSVHLTRVPQPLIA
GMYLMMSVDTVIPPGEKVVNADISCQYKMYPMHVFAYRVHTHHLGKVVSGYRVRNGQWTLIGRQNPQLPQAFYPVEHPVD
VTFGDILAARCVFTGEGRTEATHIGGTSSDEMCNLYIMYYMEAKYALSFMTCTKNVAPDMFRTIPAEANIPIPV
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   PHE n 
1 2   SER n 
1 3   ASN n 
1 4   GLU n 
1 5   CYS n 
1 6   LEU n 
1 7   GLY n 
1 8   THR n 
1 9   ILE n 
1 10  GLY n 
1 11  PRO n 
1 12  VAL n 
1 13  THR n 
1 14  PRO n 
1 15  LEU n 
1 16  ASP n 
1 17  ALA n 
1 18  SER n 
1 19  ASP n 
1 20  PHE n 
1 21  ALA n 
1 22  LEU n 
1 23  ASP n 
1 24  ILE n 
1 25  ARG n 
1 26  MET n 
1 27  PRO n 
1 28  GLY n 
1 29  VAL n 
1 30  THR n 
1 31  PRO n 
1 32  LYS n 
1 33  GLU n 
1 34  SER n 
1 35  ASP n 
1 36  THR n 
1 37  TYR n 
1 38  PHE n 
1 39  CYS n 
1 40  MET n 
1 41  SER n 
1 42  MET n 
1 43  ARG n 
1 44  LEU n 
1 45  PRO n 
1 46  VAL n 
1 47  ASP n 
1 48  GLU n 
1 49  GLU n 
1 50  ALA n 
1 51  PHE n 
1 52  VAL n 
1 53  ILE n 
1 54  ASP n 
1 55  PHE n 
1 56  LYS n 
1 57  PRO n 
1 58  ARG n 
1 59  ALA n 
1 60  SER n 
1 61  MET n 
1 62  ASP n 
1 63  THR n 
1 64  VAL n 
1 65  HIS n 
1 66  HIS n 
1 67  MET n 
1 68  LEU n 
1 69  LEU n 
1 70  PHE n 
1 71  GLY n 
1 72  CYS n 
1 73  ASN n 
1 74  MET n 
1 75  PRO n 
1 76  SER n 
1 77  SER n 
1 78  THR n 
1 79  GLY n 
1 80  SER n 
1 81  TYR n 
1 82  TRP n 
1 83  PHE n 
1 84  CYS n 
1 85  ASP n 
1 86  GLU n 
1 87  GLY n 
1 88  THR n 
1 89  CYS n 
1 90  THR n 
1 91  ASP n 
1 92  LYS n 
1 93  ALA n 
1 94  ASN n 
1 95  ILE n 
1 96  LEU n 
1 97  TYR n 
1 98  ALA n 
1 99  TRP n 
1 100 ALA n 
1 101 ARG n 
1 102 ASN n 
1 103 ALA n 
1 104 PRO n 
1 105 PRO n 
1 106 THR n 
1 107 ARG n 
1 108 LEU n 
1 109 PRO n 
1 110 LYS n 
1 111 GLY n 
1 112 VAL n 
1 113 GLY n 
1 114 PHE n 
1 115 ARG n 
1 116 VAL n 
1 117 GLY n 
1 118 GLY n 
1 119 GLU n 
1 120 THR n 
1 121 GLY n 
1 122 SER n 
1 123 LYS n 
1 124 TYR n 
1 125 PHE n 
1 126 VAL n 
1 127 LEU n 
1 128 GLN n 
1 129 VAL n 
1 130 HIS n 
1 131 TYR n 
1 132 GLY n 
1 133 ASP n 
1 134 ILE n 
1 135 SER n 
1 136 ALA n 
1 137 PHE n 
1 138 ARG n 
1 139 ASP n 
1 140 ASN n 
1 141 HIS n 
1 142 LYS n 
1 143 ASP n 
1 144 CYS n 
1 145 SER n 
1 146 GLY n 
1 147 VAL n 
1 148 SER n 
1 149 VAL n 
1 150 HIS n 
1 151 LEU n 
1 152 THR n 
1 153 ARG n 
1 154 VAL n 
1 155 PRO n 
1 156 GLN n 
1 157 PRO n 
1 158 LEU n 
1 159 ILE n 
1 160 ALA n 
1 161 GLY n 
1 162 MET n 
1 163 TYR n 
1 164 LEU n 
1 165 MET n 
1 166 MET n 
1 167 SER n 
1 168 VAL n 
1 169 ASP n 
1 170 THR n 
1 171 VAL n 
1 172 ILE n 
1 173 PRO n 
1 174 PRO n 
1 175 GLY n 
1 176 GLU n 
1 177 LYS n 
1 178 VAL n 
1 179 VAL n 
1 180 ASN n 
1 181 ALA n 
1 182 ASP n 
1 183 ILE n 
1 184 SER n 
1 185 CYS n 
1 186 GLN n 
1 187 TYR n 
1 188 LYS n 
1 189 MET n 
1 190 TYR n 
1 191 PRO n 
1 192 MET n 
1 193 HIS n 
1 194 VAL n 
1 195 PHE n 
1 196 ALA n 
1 197 TYR n 
1 198 ARG n 
1 199 VAL n 
1 200 HIS n 
1 201 THR n 
1 202 HIS n 
1 203 HIS n 
1 204 LEU n 
1 205 GLY n 
1 206 LYS n 
1 207 VAL n 
1 208 VAL n 
1 209 SER n 
1 210 GLY n 
1 211 TYR n 
1 212 ARG n 
1 213 VAL n 
1 214 ARG n 
1 215 ASN n 
1 216 GLY n 
1 217 GLN n 
1 218 TRP n 
1 219 THR n 
1 220 LEU n 
1 221 ILE n 
1 222 GLY n 
1 223 ARG n 
1 224 GLN n 
1 225 ASN n 
1 226 PRO n 
1 227 GLN n 
1 228 LEU n 
1 229 PRO n 
1 230 GLN n 
1 231 ALA n 
1 232 PHE n 
1 233 TYR n 
1 234 PRO n 
1 235 VAL n 
1 236 GLU n 
1 237 HIS n 
1 238 PRO n 
1 239 VAL n 
1 240 ASP n 
1 241 VAL n 
1 242 THR n 
1 243 PHE n 
1 244 GLY n 
1 245 ASP n 
1 246 ILE n 
1 247 LEU n 
1 248 ALA n 
1 249 ALA n 
1 250 ARG n 
1 251 CYS n 
1 252 VAL n 
1 253 PHE n 
1 254 THR n 
1 255 GLY n 
1 256 GLU n 
1 257 GLY n 
1 258 ARG n 
1 259 THR n 
1 260 GLU n 
1 261 ALA n 
1 262 THR n 
1 263 HIS n 
1 264 ILE n 
1 265 GLY n 
1 266 GLY n 
1 267 THR n 
1 268 SER n 
1 269 SER n 
1 270 ASP n 
1 271 GLU n 
1 272 MET n 
1 273 CYS n 
1 274 ASN n 
1 275 LEU n 
1 276 TYR n 
1 277 ILE n 
1 278 MET n 
1 279 TYR n 
1 280 TYR n 
1 281 MET n 
1 282 GLU n 
1 283 ALA n 
1 284 LYS n 
1 285 TYR n 
1 286 ALA n 
1 287 LEU n 
1 288 SER n 
1 289 PHE n 
1 290 MET n 
1 291 THR n 
1 292 CYS n 
1 293 THR n 
1 294 LYS n 
1 295 ASN n 
1 296 VAL n 
1 297 ALA n 
1 298 PRO n 
1 299 ASP n 
1 300 MET n 
1 301 PHE n 
1 302 ARG n 
1 303 THR n 
1 304 ILE n 
1 305 PRO n 
1 306 ALA n 
1 307 GLU n 
1 308 ALA n 
1 309 ASN n 
1 310 ILE n 
1 311 PRO n 
1 312 ILE n 
1 313 PRO n 
1 314 VAL n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'Norway rat' 
_entity_src_gen.gene_src_genus                     Rattus 
_entity_src_gen.pdbx_gene_src_gene                 PAM 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    Sprague-Dawley 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Rattus norvegicus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10116 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'Chinese hamster' 
_entity_src_gen.pdbx_host_org_scientific_name      'Cricetulus griseus' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     10029 
_entity_src_gen.host_org_genus                     Cricetulus 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ovary 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'CHO DG44' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            'Chinese hamster ovary (CHO)' 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          virus 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pCIS 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    AMD_RAT 
_struct_ref.pdbx_db_accession          P14925 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;FSNECLGTIGPVTPLDASDFALDIRMPGVTPKESDTYFCMSMRLPVDEEAFVIDFKPRASMDTVHHMLLFGCNMPSSTGS
YWFCDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNHKDCSGVSVHLTRVPQPLIA
GMYLMMSVDTVIPPGEKVVNADISCQYKMYPMHVFAYRVHTHHLGKVVSGYRVRNGQWTLIGRQNPQLPQAFYPVEHPVD
VTFGDILAARCVFTGEGRTEATHIGGTSSDEMCNLYIMYYMEAKYALSFMTCTKNVAPDMFRTIPAEANIPIPV
;
_struct_ref.pdbx_align_begin           43 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1SDW 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 314 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P14925 
_struct_ref_seq.db_align_beg                  43 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  356 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       43 
_struct_ref_seq.pdbx_auth_seq_align_end       356 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                      ?                               'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                                     ?                               'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                                   ?                               'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                              ?                               'C4 H7 N O4'       133.103 
CU  non-polymer         . 'COPPER (II) ION'                            ?                               'Cu 2'             63.546  
CYS 'L-peptide linking' y CYSTEINE                                     ?                               'C3 H7 N O2 S'     121.158 
GLN 'L-peptide linking' y GLUTAMINE                                    ?                               'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                              ?                               'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                                      ?                               'C2 H5 N O2'       75.067  
GOL non-polymer         . GLYCEROL                                     'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'         92.094  
HIS 'L-peptide linking' y HISTIDINE                                    ?                               'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                                        ?                               'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                   ?                               'C6 H13 N O2'      131.173 
IYT 'D-peptide linking' . N-ALPHA-ACETYL-3,5-DIIODOTYROSYL-D-THREONINE 'THREONINE DERIVATIVE'          'C15 H18 I2 N2 O6' 576.122 
LEU 'L-peptide linking' y LEUCINE                                      ?                               'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                                       ?                               'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                                   ?                               'C5 H11 N O2 S'    149.211 
NI  non-polymer         . 'NICKEL (II) ION'                            ?                               'Ni 2'             58.693  
OXY non-polymer         . 'OXYGEN MOLECULE'                            ?                               O2                 31.999  
PHE 'L-peptide linking' y PHENYLALANINE                                ?                               'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                                      ?                               'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                                       ?                               'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                                    ?                               'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                   ?                               'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                                     ?                               'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                                       ?                               'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          1SDW 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   56.20 
_exptl_crystal.description           ? 
_exptl_crystal.density_Matthews      2.81 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.pdbx_details    
'0.8mM Nickle chloride, 100mM sodium cacodylate, 3mM sodium azide, pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'double Si crystal' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9763 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X4A' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X4A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9763 
# 
_reflns.entry_id                     1SDW 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   -3 
_reflns.d_resolution_high            1.85 
_reflns.d_resolution_low             19.69 
_reflns.number_all                   ? 
_reflns.number_obs                   34131 
_reflns.percent_possible_obs         97.6 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.079 
_reflns.pdbx_netI_over_sigmaI        14.9 
_reflns.B_iso_Wilson_estimate        21.9 
_reflns.pdbx_redundancy              5.42 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.85 
_reflns_shell.d_res_low              1.98 
_reflns_shell.percent_possible_all   89.4 
_reflns_shell.Rmerge_I_obs           0.36 
_reflns_shell.pdbx_Rsym_value        0.36 
_reflns_shell.meanI_over_sigI_obs    2.1 
_reflns_shell.pdbx_redundancy        2.9 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      6163 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1SDW 
_refine.ls_d_res_high                            1.85 
_refine.ls_d_res_low                             19.69 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     31900 
_refine.ls_number_reflns_obs                     31900 
_refine.ls_number_reflns_R_free                  1599 
_refine.ls_percent_reflns_obs                    92.8 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.197 
_refine.ls_R_factor_R_work                       0.197 
_refine.ls_R_factor_R_free                       0.226 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      1PHM 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.B_iso_mean                               44.6 
_refine.aniso_B[1][1]                            5.76 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][2]                            -5.54 
_refine.aniso_B[2][3]                            0.00 
_refine.aniso_B[3][3]                            -0.21 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1SDW 
_refine_analyze.Luzzati_coordinate_error_obs    0.22 
_refine_analyze.Luzzati_sigma_a_obs             0.21 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.26 
_refine_analyze.Luzzati_sigma_a_free            0.26 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2433 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         116 
_refine_hist.number_atoms_solvent             180 
_refine_hist.number_atoms_total               2729 
_refine_hist.d_res_high                       1.85 
_refine_hist.d_res_low                        19.69 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.013 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.6   ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 26.7  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.91  ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        2.26  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.d_res_high                       1.85 
_refine_ls_shell.d_res_low                        1.97 
_refine_ls_shell.number_reflns_R_work             ? 
_refine_ls_shell.R_factor_R_work                  0.32 
_refine_ls_shell.percent_reflns_obs               77.4 
_refine_ls_shell.R_factor_R_free                  0.374 
_refine_ls_shell.R_factor_R_free_error            0.026 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             213 
_refine_ls_shell.number_reflns_obs                4151 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1SDW 
_struct.title                     'Reduced (Cu+) peptidylglycine alpha-hydroxylating monooxygenase with bound peptide and dioxygen' 
_struct.pdbx_descriptor           'Peptidyl-glycine alpha-amidating monooxygenase (E.C.1.14.17.3)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1SDW 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            'beta jelly-roll, OXIDOREDUCTASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
G N N 5 ? 
H N N 5 ? 
I N N 6 ? 
J N N 6 ? 
K N N 6 ? 
L N N 6 ? 
M N N 6 ? 
N N N 6 ? 
O N N 7 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASP A 85  ? GLY A 87  ? ASP A 127 GLY A 129 5 ? 3 
HELX_P HELX_P2 2 SER A 135 ? ASN A 140 ? SER A 177 ASN A 182 5 ? 6 
HELX_P HELX_P3 3 LYS A 284 ? ALA A 286 ? LYS A 326 ALA A 328 5 ? 3 
HELX_P HELX_P4 4 ALA A 297 ? ILE A 304 ? ALA A 339 ILE A 346 5 ? 8 
HELX_P HELX_P5 5 PRO A 305 ? ILE A 310 ? PRO A 347 ILE A 352 5 ? 6 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 5   SG ? ? ? 1_555 A CYS 144 SG  ? ? A CYS 47  A CYS 186 1_555 ? ? ? ? ? ? ? 2.042 ? 
disulf2  disulf ? ? A CYS 39  SG ? ? ? 1_555 A CYS 84  SG  ? ? A CYS 81  A CYS 126 1_555 ? ? ? ? ? ? ? 2.048 ? 
disulf3  disulf ? ? A CYS 72  SG ? ? ? 1_555 A CYS 89  SG  ? ? A CYS 114 A CYS 131 1_555 ? ? ? ? ? ? ? 2.042 ? 
disulf4  disulf ? ? A CYS 185 SG A ? ? 1_555 A CYS 292 SG  ? ? A CYS 227 A CYS 334 1_555 ? ? ? ? ? ? ? 2.038 ? 
disulf5  disulf ? ? A CYS 251 SG A ? ? 1_555 A CYS 273 SG  ? ? A CYS 293 A CYS 315 1_555 ? ? ? ? ? ? ? 2.023 ? 
metalc1  metalc ? ? B CU  .   CU ? ? ? 1_555 A HIS 66  ND1 ? ? A CU  357 A HIS 108 1_555 ? ? ? ? ? ? ? 1.995 ? 
metalc2  metalc ? ? B CU  .   CU ? ? ? 1_555 A HIS 65  ND1 ? ? A CU  357 A HIS 107 1_555 ? ? ? ? ? ? ? 1.820 ? 
metalc3  metalc ? ? B CU  .   CU ? ? ? 1_555 A HIS 130 ND1 ? ? A CU  357 A HIS 172 1_555 ? ? ? ? ? ? ? 2.092 ? 
metalc4  metalc ? ? C CU  .   CU ? ? ? 1_555 A HIS 200 NE2 ? ? A CU  358 A HIS 242 1_555 ? ? ? ? ? ? ? 2.110 ? 
metalc5  metalc ? ? C CU  .   CU ? ? ? 1_555 A HIS 202 NE2 ? ? A CU  358 A HIS 244 1_555 ? ? ? ? ? ? ? 2.125 ? 
metalc6  metalc ? ? C CU  .   CU ? ? ? 1_555 A MET 272 SD  ? ? A CU  358 A MET 314 1_555 ? ? ? ? ? ? ? 2.270 ? 
metalc7  metalc ? ? C CU  .   CU ? ? ? 1_555 E OXY .   O1  ? ? A CU  358 A OXY 360 1_555 ? ? ? ? ? ? ? 2.106 ? 
metalc8  metalc ? ? D NI  .   NI ? ? ? 1_555 I GOL .   O1  ? ? A NI  359 A GOL 363 1_555 ? ? ? ? ? ? ? 2.284 ? 
metalc9  metalc ? ? D NI  .   NI ? ? ? 1_555 I GOL .   O2  ? ? A NI  359 A GOL 363 1_555 ? ? ? ? ? ? ? 1.985 ? 
metalc10 metalc ? ? D NI  .   NI ? ? ? 1_555 O HOH .   O   ? ? A NI  359 A HOH 361 1_555 ? ? ? ? ? ? ? 1.987 ? 
metalc11 metalc ? ? D NI  .   NI ? ? ? 1_555 O HOH .   O   ? ? A NI  359 A HOH 362 1_555 ? ? ? ? ? ? ? 1.975 ? 
metalc12 metalc ? ? D NI  .   NI ? ? ? 1_555 A HIS 193 NE2 ? ? A NI  359 A HIS 235 1_555 ? ? ? ? ? ? ? 2.031 ? 
metalc13 metalc ? ? D NI  .   NI ? ? ? 1_555 A HIS 263 NE2 ? ? A NI  359 A HIS 305 4_456 ? ? ? ? ? ? ? 2.039 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 9 ? 
B ? 7 ? 
C ? 5 ? 
D ? 2 ? 
E ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? parallel      
A 6 7 ? anti-parallel 
A 7 8 ? anti-parallel 
A 8 9 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? parallel      
B 6 7 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 12  ? ASP A 16  ? VAL A 54  ASP A 58  
A 2 ASP A 19  ? ARG A 25  ? ASP A 61  ARG A 67  
A 3 GLY A 146 ? THR A 152 ? GLY A 188 THR A 194 
A 4 ALA A 50  ? ARG A 58  ? ALA A 92  ARG A 100 
A 5 VAL A 112 ? VAL A 116 ? VAL A 154 VAL A 158 
A 6 LEU A 158 ? MET A 166 ? LEU A 200 MET A 208 
A 7 ASN A 274 ? GLU A 282 ? ASN A 316 GLU A 324 
A 8 MET A 192 ? HIS A 200 ? MET A 234 HIS A 242 
A 9 TYR A 233 ? VAL A 241 ? TYR A 275 VAL A 283 
B 1 VAL A 12  ? ASP A 16  ? VAL A 54  ASP A 58  
B 2 ASP A 19  ? ARG A 25  ? ASP A 61  ARG A 67  
B 3 GLY A 146 ? THR A 152 ? GLY A 188 THR A 194 
B 4 ALA A 50  ? ARG A 58  ? ALA A 92  ARG A 100 
B 5 VAL A 112 ? VAL A 116 ? VAL A 154 VAL A 158 
B 6 LEU A 158 ? MET A 166 ? LEU A 200 MET A 208 
B 7 PHE A 289 ? CYS A 292 ? PHE A 331 CYS A 334 
C 1 TRP A 82  ? PHE A 83  ? TRP A 124 PHE A 125 
C 2 THR A 36  ? ARG A 43  ? THR A 78  ARG A 85  
C 3 TYR A 124 ? TYR A 131 ? TYR A 166 TYR A 173 
C 4 VAL A 64  ? CYS A 72  ? VAL A 106 CYS A 114 
C 5 ASN A 94  ? ALA A 100 ? ASN A 136 ALA A 142 
D 1 VAL A 171 ? ILE A 172 ? VAL A 213 ILE A 214 
D 2 THR A 262 ? HIS A 263 ? THR A 304 HIS A 305 
E 1 VAL A 179 ? GLN A 186 ? VAL A 221 GLN A 228 
E 2 ILE A 246 ? PHE A 253 ? ILE A 288 PHE A 295 
E 3 GLY A 205 ? ARG A 214 ? GLY A 247 ARG A 256 
E 4 GLN A 217 ? GLN A 224 ? GLN A 259 GLN A 266 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N THR A 13  ? N THR A 55  O ALA A 21  ? O ALA A 63  
A 2 3 N PHE A 20  ? N PHE A 62  O LEU A 151 ? O LEU A 193 
A 3 4 O THR A 152 ? O THR A 194 N PHE A 51  ? N PHE A 93  
A 4 5 N VAL A 52  ? N VAL A 94  O PHE A 114 ? O PHE A 156 
A 5 6 N GLY A 113 ? N GLY A 155 O ALA A 160 ? O ALA A 202 
A 6 7 N TYR A 163 ? N TYR A 205 O ILE A 277 ? O ILE A 319 
A 7 8 O TYR A 276 ? O TYR A 318 N ARG A 198 ? N ARG A 240 
A 8 9 N TYR A 197 ? N TYR A 239 O TYR A 233 ? O TYR A 275 
B 1 2 N THR A 13  ? N THR A 55  O ALA A 21  ? O ALA A 63  
B 2 3 N PHE A 20  ? N PHE A 62  O LEU A 151 ? O LEU A 193 
B 3 4 O THR A 152 ? O THR A 194 N PHE A 51  ? N PHE A 93  
B 4 5 N VAL A 52  ? N VAL A 94  O PHE A 114 ? O PHE A 156 
B 5 6 N GLY A 113 ? N GLY A 155 O ALA A 160 ? O ALA A 202 
B 6 7 N LEU A 164 ? N LEU A 206 O MET A 290 ? O MET A 332 
C 1 2 O TRP A 82  ? O TRP A 124 N CYS A 39  ? N CYS A 81  
C 2 3 N THR A 36  ? N THR A 78  O TYR A 131 ? O TYR A 173 
C 3 4 O HIS A 130 ? O HIS A 172 N HIS A 66  ? N HIS A 108 
C 4 5 N LEU A 69  ? N LEU A 111 O LEU A 96  ? O LEU A 138 
D 1 2 N ILE A 172 ? N ILE A 214 O THR A 262 ? O THR A 304 
E 1 2 N VAL A 179 ? N VAL A 221 O PHE A 253 ? O PHE A 295 
E 2 3 O ALA A 248 ? O ALA A 290 N TYR A 211 ? N TYR A 253 
E 3 4 N ARG A 214 ? N ARG A 256 O GLN A 217 ? O GLN A 259 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CU A 357'  
AC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CU A 358'  
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NI A 359'  
AC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE OXY A 360' 
AC5 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE IYT A 701' 
AC6 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE IYT A 702' 
AC7 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE IYT A 703' 
AC8 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE GOL A 363' 
AC9 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE GOL A 364' 
BC1 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE GOL A 365' 
BC2 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE GOL A 366' 
BC3 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE GOL A 367' 
BC4 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE GOL A 368' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 3  HIS A 65  ? HIS A 107 . ? 1_555 ? 
2  AC1 3  HIS A 66  ? HIS A 108 . ? 1_555 ? 
3  AC1 3  HIS A 130 ? HIS A 172 . ? 1_555 ? 
4  AC2 4  HIS A 200 ? HIS A 242 . ? 1_555 ? 
5  AC2 4  HIS A 202 ? HIS A 244 . ? 1_555 ? 
6  AC2 4  MET A 272 ? MET A 314 . ? 1_555 ? 
7  AC2 4  OXY E .   ? OXY A 360 . ? 1_555 ? 
8  AC3 5  HIS A 193 ? HIS A 235 . ? 1_555 ? 
9  AC3 5  HIS A 263 ? HIS A 305 . ? 4_456 ? 
10 AC3 5  HOH O .   ? HOH A 361 . ? 1_555 ? 
11 AC3 5  HOH O .   ? HOH A 362 . ? 1_555 ? 
12 AC3 5  GOL I .   ? GOL A 363 . ? 1_555 ? 
13 AC4 4  HIS A 200 ? HIS A 242 . ? 1_555 ? 
14 AC4 4  HIS A 202 ? HIS A 244 . ? 1_555 ? 
15 AC4 4  MET A 272 ? MET A 314 . ? 1_555 ? 
16 AC4 4  CU  C .   ? CU  A 358 . ? 1_555 ? 
17 AC5 12 ALA A 93  ? ALA A 135 . ? 1_555 ? 
18 AC5 12 MET A 166 ? MET A 208 . ? 1_555 ? 
19 AC5 12 ARG A 198 ? ARG A 240 . ? 1_555 ? 
20 AC5 12 HIS A 200 ? HIS A 242 . ? 1_555 ? 
21 AC5 12 MET A 272 ? MET A 314 . ? 1_555 ? 
22 AC5 12 ASN A 274 ? ASN A 316 . ? 1_555 ? 
23 AC5 12 TYR A 276 ? TYR A 318 . ? 1_555 ? 
24 AC5 12 GOL N .   ? GOL A 368 . ? 1_555 ? 
25 AC5 12 HOH O .   ? HOH A 406 . ? 1_555 ? 
26 AC5 12 HOH O .   ? HOH A 479 . ? 1_555 ? 
27 AC5 12 HOH O .   ? HOH A 491 . ? 1_555 ? 
28 AC5 12 HOH O .   ? HOH A 540 . ? 1_555 ? 
29 AC6 6  ASP A 19  ? ASP A 61  . ? 1_555 ? 
30 AC6 6  ALA A 21  ? ALA A 63  . ? 1_555 ? 
31 AC6 6  LYS A 56  ? LYS A 98  . ? 1_555 ? 
32 AC6 6  ARG A 58  ? ARG A 100 . ? 1_555 ? 
33 AC6 6  SER A 148 ? SER A 190 . ? 1_555 ? 
34 AC6 6  HIS A 150 ? HIS A 192 . ? 1_555 ? 
35 AC7 12 ALA A 17  ? ALA A 59  . ? 1_555 ? 
36 AC7 12 SER A 18  ? SER A 60  . ? 1_555 ? 
37 AC7 12 ASP A 19  ? ASP A 61  . ? 1_555 ? 
38 AC7 12 PHE A 20  ? PHE A 62  . ? 1_555 ? 
39 AC7 12 GLU A 48  ? GLU A 90  . ? 1_555 ? 
40 AC7 12 GLU A 49  ? GLU A 91  . ? 1_555 ? 
41 AC7 12 ARG A 153 ? ARG A 195 . ? 1_555 ? 
42 AC7 12 GLN A 186 ? GLN A 228 . ? 3_656 ? 
43 AC7 12 LYS A 188 ? LYS A 230 . ? 3_656 ? 
44 AC7 12 PHE A 243 ? PHE A 285 . ? 3_656 ? 
45 AC7 12 GLY A 244 ? GLY A 286 . ? 3_656 ? 
46 AC7 12 HOH O .   ? HOH A 486 . ? 3_656 ? 
47 AC8 8  HIS A 193 ? HIS A 235 . ? 1_555 ? 
48 AC8 8  HIS A 263 ? HIS A 305 . ? 4_456 ? 
49 AC8 8  ASP A 270 ? ASP A 312 . ? 4_456 ? 
50 AC8 8  NI  D .   ? NI  A 359 . ? 1_555 ? 
51 AC8 8  HOH O .   ? HOH A 361 . ? 1_555 ? 
52 AC8 8  HOH O .   ? HOH A 362 . ? 1_555 ? 
53 AC8 8  HOH O .   ? HOH A 427 . ? 1_555 ? 
54 AC8 8  HOH O .   ? HOH A 564 . ? 1_555 ? 
55 AC9 8  LEU A 96  ? LEU A 138 . ? 1_555 ? 
56 AC9 8  TYR A 97  ? TYR A 139 . ? 1_555 ? 
57 AC9 8  THR A 106 ? THR A 148 . ? 1_555 ? 
58 AC9 8  MET A 278 ? MET A 320 . ? 1_555 ? 
59 AC9 8  HOH O .   ? HOH A 401 . ? 1_555 ? 
60 AC9 8  HOH O .   ? HOH A 415 . ? 1_555 ? 
61 AC9 8  HOH O .   ? HOH A 423 . ? 1_555 ? 
62 AC9 8  HOH O .   ? HOH A 430 . ? 1_555 ? 
63 BC1 9  ASN A 94  ? ASN A 136 . ? 1_555 ? 
64 BC1 9  LEU A 96  ? LEU A 138 . ? 1_555 ? 
65 BC1 9  PHE A 114 ? PHE A 156 . ? 1_555 ? 
66 BC1 9  ARG A 115 ? ARG A 157 . ? 1_555 ? 
67 BC1 9  GLY A 121 ? GLY A 163 . ? 1_555 ? 
68 BC1 9  SER A 122 ? SER A 164 . ? 1_555 ? 
69 BC1 9  SER A 288 ? SER A 330 . ? 1_555 ? 
70 BC1 9  HOH O .   ? HOH A 403 . ? 1_555 ? 
71 BC1 9  HOH O .   ? HOH A 411 . ? 1_555 ? 
72 BC2 7  TYR A 163 ? TYR A 205 . ? 1_555 ? 
73 BC2 7  CYS A 185 ? CYS A 227 . ? 1_555 ? 
74 BC2 7  GLN A 186 ? GLN A 228 . ? 1_555 ? 
75 BC2 7  LYS A 188 ? LYS A 230 . ? 1_555 ? 
76 BC2 7  MET A 189 ? MET A 231 . ? 1_555 ? 
77 BC2 7  THR A 291 ? THR A 333 . ? 1_555 ? 
78 BC2 7  HOH O .   ? HOH A 487 . ? 1_555 ? 
79 BC3 11 THR A 106 ? THR A 148 . ? 1_555 ? 
80 BC3 11 PRO A 109 ? PRO A 151 . ? 1_555 ? 
81 BC3 11 ASP A 169 ? ASP A 211 . ? 4_456 ? 
82 BC3 11 VAL A 171 ? VAL A 213 . ? 4_456 ? 
83 BC3 11 PHE A 195 ? PHE A 237 . ? 1_555 ? 
84 BC3 11 PRO A 234 ? PRO A 276 . ? 1_555 ? 
85 BC3 11 HOH O .   ? HOH A 452 . ? 1_555 ? 
86 BC3 11 HOH O .   ? HOH A 468 . ? 1_555 ? 
87 BC3 11 HOH O .   ? HOH A 488 . ? 1_555 ? 
88 BC3 11 HOH O .   ? HOH A 537 . ? 1_555 ? 
89 BC3 11 HOH O .   ? HOH A 551 . ? 1_555 ? 
90 BC4 9  ASN A 94  ? ASN A 136 . ? 1_555 ? 
91 BC4 9  ILE A 95  ? ILE A 137 . ? 1_555 ? 
92 BC4 9  MET A 162 ? MET A 204 . ? 1_555 ? 
93 BC4 9  TYR A 276 ? TYR A 318 . ? 1_555 ? 
94 BC4 9  PHE A 289 ? PHE A 331 . ? 1_555 ? 
95 BC4 9  MET A 290 ? MET A 332 . ? 1_555 ? 
96 BC4 9  THR A 291 ? THR A 333 . ? 1_555 ? 
97 BC4 9  HOH O .   ? HOH A 422 . ? 1_555 ? 
98 BC4 9  IYT F .   ? IYT A 701 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1SDW 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1SDW 
_atom_sites.fract_transf_matrix[1][1]   0.014393 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014497 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012179 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CU 
I  
N  
NI 
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ASN A 1 3   ? 31.136 52.237 48.025 1.00 80.18  ? 45  ASN A N   1 
ATOM   2    C  CA  . ASN A 1 3   ? 29.814 52.055 48.699 1.00 80.53  ? 45  ASN A CA  1 
ATOM   3    C  C   . ASN A 1 3   ? 29.748 50.661 49.329 1.00 79.36  ? 45  ASN A C   1 
ATOM   4    O  O   . ASN A 1 3   ? 30.582 49.797 49.033 1.00 79.61  ? 45  ASN A O   1 
ATOM   5    C  CB  . ASN A 1 3   ? 28.675 52.227 47.685 1.00 81.93  ? 45  ASN A CB  1 
ATOM   6    C  CG  . ASN A 1 3   ? 27.353 52.606 48.343 1.00 83.91  ? 45  ASN A CG  1 
ATOM   7    O  OD1 . ASN A 1 3   ? 26.819 51.872 49.176 1.00 83.16  ? 45  ASN A OD1 1 
ATOM   8    N  ND2 . ASN A 1 3   ? 26.819 53.764 47.964 1.00 84.86  ? 45  ASN A ND2 1 
ATOM   9    N  N   . GLU A 1 4   ? 28.756 50.450 50.192 1.00 77.20  ? 46  GLU A N   1 
ATOM   10   C  CA  . GLU A 1 4   ? 28.583 49.177 50.886 1.00 74.37  ? 46  GLU A CA  1 
ATOM   11   C  C   . GLU A 1 4   ? 29.804 48.905 51.752 1.00 71.94  ? 46  GLU A C   1 
ATOM   12   O  O   . GLU A 1 4   ? 29.904 47.856 52.393 1.00 70.48  ? 46  GLU A O   1 
ATOM   13   C  CB  . GLU A 1 4   ? 28.412 48.032 49.887 1.00 75.63  ? 46  GLU A CB  1 
ATOM   14   C  CG  . GLU A 1 4   ? 26.986 47.541 49.732 1.00 78.52  ? 46  GLU A CG  1 
ATOM   15   C  CD  . GLU A 1 4   ? 26.911 46.266 48.915 1.00 81.13  ? 46  GLU A CD  1 
ATOM   16   O  OE1 . GLU A 1 4   ? 27.245 46.313 47.711 1.00 82.96  ? 46  GLU A OE1 1 
ATOM   17   O  OE2 . GLU A 1 4   ? 26.527 45.216 49.479 1.00 81.51  ? 46  GLU A OE2 1 
ATOM   18   N  N   . CYS A 1 5   ? 30.730 49.859 51.768 1.00 68.49  ? 47  CYS A N   1 
ATOM   19   C  CA  . CYS A 1 5   ? 31.947 49.706 52.536 1.00 65.85  ? 47  CYS A CA  1 
ATOM   20   C  C   . CYS A 1 5   ? 31.735 49.603 54.038 1.00 63.49  ? 47  CYS A C   1 
ATOM   21   O  O   . CYS A 1 5   ? 30.700 49.982 54.589 1.00 60.10  ? 47  CYS A O   1 
ATOM   22   C  CB  . CYS A 1 5   ? 32.948 50.825 52.212 1.00 66.46  ? 47  CYS A CB  1 
ATOM   23   S  SG  . CYS A 1 5   ? 33.823 50.597 50.619 1.00 68.25  ? 47  CYS A SG  1 
ATOM   24   N  N   . LEU A 1 6   ? 32.756 49.055 54.675 1.00 61.23  ? 48  LEU A N   1 
ATOM   25   C  CA  . LEU A 1 6   ? 32.789 48.808 56.097 1.00 59.04  ? 48  LEU A CA  1 
ATOM   26   C  C   . LEU A 1 6   ? 32.598 50.089 56.916 1.00 57.50  ? 48  LEU A C   1 
ATOM   27   O  O   . LEU A 1 6   ? 33.415 51.015 56.845 1.00 55.69  ? 48  LEU A O   1 
ATOM   28   C  CB  . LEU A 1 6   ? 34.114 48.105 56.384 1.00 60.98  ? 48  LEU A CB  1 
ATOM   29   C  CG  . LEU A 1 6   ? 34.202 47.025 55.277 1.00 63.81  ? 48  LEU A CG  1 
ATOM   30   C  CD1 . LEU A 1 6   ? 35.511 47.147 54.464 1.00 57.21  ? 48  LEU A CD1 1 
ATOM   31   C  CD2 . LEU A 1 6   ? 34.039 45.636 55.912 1.00 64.24  ? 48  LEU A CD2 1 
ATOM   32   N  N   . GLY A 1 7   ? 31.506 50.125 57.683 1.00 50.93  ? 49  GLY A N   1 
ATOM   33   C  CA  . GLY A 1 7   ? 31.194 51.294 58.486 1.00 49.58  ? 49  GLY A CA  1 
ATOM   34   C  C   . GLY A 1 7   ? 31.442 51.194 59.982 1.00 47.42  ? 49  GLY A C   1 
ATOM   35   O  O   . GLY A 1 7   ? 32.114 50.269 60.473 1.00 44.19  ? 49  GLY A O   1 
ATOM   36   N  N   . THR A 1 8   ? 30.869 52.142 60.721 1.00 40.42  ? 50  THR A N   1 
ATOM   37   C  CA  . THR A 1 8   ? 31.056 52.173 62.157 1.00 41.06  ? 50  THR A CA  1 
ATOM   38   C  C   . THR A 1 8   ? 30.459 50.993 62.912 1.00 38.99  ? 50  THR A C   1 
ATOM   39   O  O   . THR A 1 8   ? 30.773 50.814 64.081 1.00 38.76  ? 50  THR A O   1 
ATOM   40   C  CB  . THR A 1 8   ? 30.511 53.486 62.765 1.00 40.43  ? 50  THR A CB  1 
ATOM   41   O  OG1 . THR A 1 8   ? 29.120 53.609 62.448 1.00 39.26  ? 50  THR A OG1 1 
ATOM   42   C  CG2 . THR A 1 8   ? 31.276 54.690 62.205 1.00 41.55  ? 50  THR A CG2 1 
ATOM   43   N  N   . ILE A 1 9   ? 29.619 50.181 62.265 1.00 38.60  ? 51  ILE A N   1 
ATOM   44   C  CA  . ILE A 1 9   ? 29.028 49.031 62.962 1.00 38.65  ? 51  ILE A CA  1 
ATOM   45   C  C   . ILE A 1 9   ? 29.914 47.788 62.896 1.00 35.44  ? 51  ILE A C   1 
ATOM   46   O  O   . ILE A 1 9   ? 29.646 46.777 63.540 1.00 36.36  ? 51  ILE A O   1 
ATOM   47   C  CB  . ILE A 1 9   ? 27.618 48.675 62.406 1.00 43.74  ? 51  ILE A CB  1 
ATOM   48   C  CG1 . ILE A 1 9   ? 27.726 48.151 60.974 1.00 48.44  ? 51  ILE A CG1 1 
ATOM   49   C  CG2 . ILE A 1 9   ? 26.723 49.919 62.458 1.00 48.51  ? 51  ILE A CG2 1 
ATOM   50   C  CD1 . ILE A 1 9   ? 26.371 47.715 60.365 1.00 53.06  ? 51  ILE A CD1 1 
ATOM   51   N  N   . GLY A 1 10  ? 30.985 47.851 62.129 1.00 34.50  ? 52  GLY A N   1 
ATOM   52   C  CA  . GLY A 1 10  ? 31.861 46.696 62.088 1.00 36.55  ? 52  GLY A CA  1 
ATOM   53   C  C   . GLY A 1 10  ? 31.349 45.551 61.240 1.00 35.21  ? 52  GLY A C   1 
ATOM   54   O  O   . GLY A 1 10  ? 30.240 45.608 60.716 1.00 34.95  ? 52  GLY A O   1 
ATOM   55   N  N   . PRO A 1 11  ? 32.132 44.467 61.138 1.00 34.00  ? 53  PRO A N   1 
ATOM   56   C  CA  . PRO A 1 11  ? 31.833 43.272 60.350 1.00 31.60  ? 53  PRO A CA  1 
ATOM   57   C  C   . PRO A 1 11  ? 31.030 42.154 60.984 1.00 32.20  ? 53  PRO A C   1 
ATOM   58   O  O   . PRO A 1 11  ? 30.679 41.208 60.288 1.00 33.98  ? 53  PRO A O   1 
ATOM   59   C  CB  . PRO A 1 11  ? 33.227 42.789 59.970 1.00 32.51  ? 53  PRO A CB  1 
ATOM   60   C  CG  . PRO A 1 11  ? 33.958 42.979 61.306 1.00 31.94  ? 53  PRO A CG  1 
ATOM   61   C  CD  . PRO A 1 11  ? 33.453 44.346 61.788 1.00 30.62  ? 53  PRO A CD  1 
ATOM   62   N  N   . VAL A 1 12  ? 30.753 42.231 62.284 1.00 31.73  ? 54  VAL A N   1 
ATOM   63   C  CA  . VAL A 1 12  ? 30.016 41.165 62.953 1.00 32.49  ? 54  VAL A CA  1 
ATOM   64   C  C   . VAL A 1 12  ? 28.589 41.580 63.276 1.00 37.08  ? 54  VAL A C   1 
ATOM   65   O  O   . VAL A 1 12  ? 28.371 42.605 63.940 1.00 37.49  ? 54  VAL A O   1 
ATOM   66   C  CB  . VAL A 1 12  ? 30.691 40.745 64.282 1.00 35.36  ? 54  VAL A CB  1 
ATOM   67   C  CG1 . VAL A 1 12  ? 29.811 39.731 65.013 1.00 36.28  ? 54  VAL A CG1 1 
ATOM   68   C  CG2 . VAL A 1 12  ? 32.065 40.134 64.010 1.00 33.67  ? 54  VAL A CG2 1 
ATOM   69   N  N   . THR A 1 13  ? 27.625 40.791 62.809 1.00 36.96  ? 55  THR A N   1 
ATOM   70   C  CA  . THR A 1 13  ? 26.209 41.067 63.064 1.00 39.83  ? 55  THR A CA  1 
ATOM   71   C  C   . THR A 1 13  ? 25.640 39.972 63.955 1.00 40.95  ? 55  THR A C   1 
ATOM   72   O  O   . THR A 1 13  ? 25.527 38.813 63.544 1.00 41.57  ? 55  THR A O   1 
ATOM   73   C  CB  . THR A 1 13  ? 25.378 41.063 61.783 1.00 42.24  ? 55  THR A CB  1 
ATOM   74   O  OG1 . THR A 1 13  ? 25.945 41.964 60.825 1.00 44.16  ? 55  THR A OG1 1 
ATOM   75   C  CG2 . THR A 1 13  ? 23.942 41.469 62.100 1.00 44.94  ? 55  THR A CG2 1 
ATOM   76   N  N   . PRO A 1 14  ? 25.262 40.315 65.188 1.00 45.25  ? 56  PRO A N   1 
ATOM   77   C  CA  . PRO A 1 14  ? 24.711 39.281 66.065 1.00 46.57  ? 56  PRO A CA  1 
ATOM   78   C  C   . PRO A 1 14  ? 23.379 38.857 65.454 1.00 46.28  ? 56  PRO A C   1 
ATOM   79   O  O   . PRO A 1 14  ? 22.673 39.690 64.897 1.00 45.31  ? 56  PRO A O   1 
ATOM   80   C  CB  . PRO A 1 14  ? 24.519 40.014 67.399 1.00 48.72  ? 56  PRO A CB  1 
ATOM   81   C  CG  . PRO A 1 14  ? 25.324 41.314 67.238 1.00 49.15  ? 56  PRO A CG  1 
ATOM   82   C  CD  . PRO A 1 14  ? 25.121 41.645 65.797 1.00 46.87  ? 56  PRO A CD  1 
ATOM   83   N  N   . LEU A 1 15  ? 23.047 37.573 65.535 1.00 50.62  ? 57  LEU A N   1 
ATOM   84   C  CA  . LEU A 1 15  ? 21.787 37.081 64.967 1.00 55.78  ? 57  LEU A CA  1 
ATOM   85   C  C   . LEU A 1 15  ? 20.857 36.498 66.031 1.00 59.67  ? 57  LEU A C   1 
ATOM   86   O  O   . LEU A 1 15  ? 19.630 36.611 65.939 1.00 61.62  ? 57  LEU A O   1 
ATOM   87   C  CB  . LEU A 1 15  ? 22.061 36.028 63.894 1.00 54.40  ? 57  LEU A CB  1 
ATOM   88   C  CG  . LEU A 1 15  ? 22.726 36.538 62.613 1.00 55.89  ? 57  LEU A CG  1 
ATOM   89   C  CD1 . LEU A 1 15  ? 22.904 35.378 61.645 1.00 52.87  ? 57  LEU A CD1 1 
ATOM   90   C  CD2 . LEU A 1 15  ? 21.878 37.628 61.978 1.00 55.27  ? 57  LEU A CD2 1 
ATOM   91   N  N   . ASP A 1 16  ? 21.450 35.868 67.036 1.00 61.55  ? 58  ASP A N   1 
ATOM   92   C  CA  . ASP A 1 16  ? 20.697 35.283 68.132 1.00 63.85  ? 58  ASP A CA  1 
ATOM   93   C  C   . ASP A 1 16  ? 21.745 34.718 69.084 1.00 64.13  ? 58  ASP A C   1 
ATOM   94   O  O   . ASP A 1 16  ? 22.942 34.870 68.847 1.00 65.03  ? 58  ASP A O   1 
ATOM   95   C  CB  . ASP A 1 16  ? 19.788 34.171 67.623 1.00 66.88  ? 58  ASP A CB  1 
ATOM   96   C  CG  . ASP A 1 16  ? 20.497 32.848 67.547 1.00 71.61  ? 58  ASP A CG  1 
ATOM   97   O  OD1 . ASP A 1 16  ? 20.616 32.177 68.596 1.00 75.28  ? 58  ASP A OD1 1 
ATOM   98   O  OD2 . ASP A 1 16  ? 20.955 32.491 66.444 1.00 74.64  ? 58  ASP A OD2 1 
ATOM   99   N  N   . ALA A 1 17  ? 21.301 34.054 70.143 1.00 63.27  ? 59  ALA A N   1 
ATOM   100  C  CA  . ALA A 1 17  ? 22.205 33.499 71.143 1.00 62.92  ? 59  ALA A CA  1 
ATOM   101  C  C   . ALA A 1 17  ? 23.459 32.804 70.601 1.00 62.80  ? 59  ALA A C   1 
ATOM   102  O  O   . ALA A 1 17  ? 24.563 32.992 71.126 1.00 61.79  ? 59  ALA A O   1 
ATOM   103  C  CB  . ALA A 1 17  ? 21.437 32.536 72.051 1.00 63.19  ? 59  ALA A CB  1 
ATOM   104  N  N   . SER A 1 18  ? 23.301 32.010 69.549 1.00 60.69  ? 60  SER A N   1 
ATOM   105  C  CA  . SER A 1 18  ? 24.445 31.274 69.023 1.00 59.60  ? 60  SER A CA  1 
ATOM   106  C  C   . SER A 1 18  ? 24.772 31.470 67.545 1.00 56.10  ? 60  SER A C   1 
ATOM   107  O  O   . SER A 1 18  ? 25.502 30.667 66.972 1.00 56.89  ? 60  SER A O   1 
ATOM   108  C  CB  . SER A 1 18  ? 24.249 29.781 69.304 1.00 61.38  ? 60  SER A CB  1 
ATOM   109  O  OG  . SER A 1 18  ? 22.968 29.356 68.859 1.00 62.26  ? 60  SER A OG  1 
ATOM   110  N  N   . ASP A 1 19  ? 24.253 32.529 66.932 1.00 49.94  ? 61  ASP A N   1 
ATOM   111  C  CA  . ASP A 1 19  ? 24.518 32.781 65.514 1.00 44.73  ? 61  ASP A CA  1 
ATOM   112  C  C   . ASP A 1 19  ? 24.923 34.216 65.237 1.00 41.95  ? 61  ASP A C   1 
ATOM   113  O  O   . ASP A 1 19  ? 24.452 35.147 65.897 1.00 42.36  ? 61  ASP A O   1 
ATOM   114  C  CB  . ASP A 1 19  ? 23.274 32.485 64.674 1.00 44.30  ? 61  ASP A CB  1 
ATOM   115  C  CG  . ASP A 1 19  ? 22.990 31.000 64.540 1.00 48.03  ? 61  ASP A CG  1 
ATOM   116  O  OD1 . ASP A 1 19  ? 23.302 30.235 65.484 1.00 44.94  ? 61  ASP A OD1 1 
ATOM   117  O  OD2 . ASP A 1 19  ? 22.436 30.605 63.487 1.00 48.42  ? 61  ASP A OD2 1 
ATOM   118  N  N   . PHE A 1 20  ? 25.808 34.399 64.266 1.00 35.86  ? 62  PHE A N   1 
ATOM   119  C  CA  . PHE A 1 20  ? 26.199 35.744 63.878 1.00 33.15  ? 62  PHE A CA  1 
ATOM   120  C  C   . PHE A 1 20  ? 26.665 35.695 62.443 1.00 34.86  ? 62  PHE A C   1 
ATOM   121  O  O   . PHE A 1 20  ? 27.054 34.623 61.951 1.00 32.42  ? 62  PHE A O   1 
ATOM   122  C  CB  . PHE A 1 20  ? 27.277 36.310 64.828 1.00 34.15  ? 62  PHE A CB  1 
ATOM   123  C  CG  . PHE A 1 20  ? 28.609 35.633 64.739 1.00 34.54  ? 62  PHE A CG  1 
ATOM   124  C  CD1 . PHE A 1 20  ? 29.537 36.028 63.794 1.00 33.60  ? 62  PHE A CD1 1 
ATOM   125  C  CD2 . PHE A 1 20  ? 28.937 34.606 65.617 1.00 37.70  ? 62  PHE A CD2 1 
ATOM   126  C  CE1 . PHE A 1 20  ? 30.782 35.408 63.724 1.00 39.00  ? 62  PHE A CE1 1 
ATOM   127  C  CE2 . PHE A 1 20  ? 30.170 33.980 65.562 1.00 38.92  ? 62  PHE A CE2 1 
ATOM   128  C  CZ  . PHE A 1 20  ? 31.101 34.380 64.611 1.00 37.21  ? 62  PHE A CZ  1 
ATOM   129  N  N   . ALA A 1 21  ? 26.561 36.822 61.751 1.00 31.63  ? 63  ALA A N   1 
ATOM   130  C  CA  . ALA A 1 21  ? 27.012 36.899 60.380 1.00 31.76  ? 63  ALA A CA  1 
ATOM   131  C  C   . ALA A 1 21  ? 28.311 37.674 60.396 1.00 34.37  ? 63  ALA A C   1 
ATOM   132  O  O   . ALA A 1 21  ? 28.470 38.645 61.155 1.00 33.78  ? 63  ALA A O   1 
ATOM   133  C  CB  . ALA A 1 21  ? 25.986 37.615 59.517 1.00 32.34  ? 63  ALA A CB  1 
ATOM   134  N  N   . LEU A 1 22  ? 29.242 37.247 59.560 1.00 31.88  ? 64  LEU A N   1 
ATOM   135  C  CA  . LEU A 1 22  ? 30.541 37.904 59.480 1.00 30.62  ? 64  LEU A CA  1 
ATOM   136  C  C   . LEU A 1 22  ? 30.755 38.384 58.035 1.00 32.98  ? 64  LEU A C   1 
ATOM   137  O  O   . LEU A 1 22  ? 30.752 37.575 57.100 1.00 30.68  ? 64  LEU A O   1 
ATOM   138  C  CB  . LEU A 1 22  ? 31.635 36.912 59.872 1.00 28.51  ? 64  LEU A CB  1 
ATOM   139  C  CG  . LEU A 1 22  ? 33.095 37.393 59.713 1.00 30.55  ? 64  LEU A CG  1 
ATOM   140  C  CD1 . LEU A 1 22  ? 33.377 38.527 60.699 1.00 31.25  ? 64  LEU A CD1 1 
ATOM   141  C  CD2 . LEU A 1 22  ? 34.042 36.221 59.974 1.00 29.28  ? 64  LEU A CD2 1 
ATOM   142  N  N   . ASP A 1 23  ? 30.881 39.696 57.849 1.00 29.58  ? 65  ASP A N   1 
ATOM   143  C  CA  . ASP A 1 23  ? 31.141 40.265 56.535 1.00 31.54  ? 65  ASP A CA  1 
ATOM   144  C  C   . ASP A 1 23  ? 32.636 40.298 56.260 1.00 34.54  ? 65  ASP A C   1 
ATOM   145  O  O   . ASP A 1 23  ? 33.416 40.872 57.025 1.00 36.09  ? 65  ASP A O   1 
ATOM   146  C  CB  . ASP A 1 23  ? 30.549 41.670 56.445 1.00 40.53  ? 65  ASP A CB  1 
ATOM   147  C  CG  . ASP A 1 23  ? 29.080 41.650 56.024 1.00 50.06  ? 65  ASP A CG  1 
ATOM   148  O  OD1 . ASP A 1 23  ? 28.757 42.267 54.980 1.00 57.51  ? 65  ASP A OD1 1 
ATOM   149  O  OD2 . ASP A 1 23  ? 28.249 41.012 56.720 1.00 52.10  ? 65  ASP A OD2 1 
ATOM   150  N  N   . ILE A 1 24  ? 33.035 39.659 55.168 1.00 30.70  ? 66  ILE A N   1 
ATOM   151  C  CA  . ILE A 1 24  ? 34.443 39.573 54.772 1.00 33.68  ? 66  ILE A CA  1 
ATOM   152  C  C   . ILE A 1 24  ? 34.531 40.396 53.497 1.00 35.34  ? 66  ILE A C   1 
ATOM   153  O  O   . ILE A 1 24  ? 34.145 39.931 52.422 1.00 35.36  ? 66  ILE A O   1 
ATOM   154  C  CB  . ILE A 1 24  ? 34.838 38.092 54.513 1.00 33.88  ? 66  ILE A CB  1 
ATOM   155  C  CG1 . ILE A 1 24  ? 34.459 37.245 55.746 1.00 33.05  ? 66  ILE A CG1 1 
ATOM   156  C  CG2 . ILE A 1 24  ? 36.338 37.992 54.217 1.00 36.46  ? 66  ILE A CG2 1 
ATOM   157  C  CD1 . ILE A 1 24  ? 34.432 35.744 55.524 1.00 32.95  ? 66  ILE A CD1 1 
ATOM   158  N  N   . ARG A 1 25  ? 35.049 41.619 53.618 1.00 34.67  ? 67  ARG A N   1 
ATOM   159  C  CA  . ARG A 1 25  ? 35.114 42.548 52.480 1.00 40.02  ? 67  ARG A CA  1 
ATOM   160  C  C   . ARG A 1 25  ? 36.485 43.133 52.234 1.00 40.38  ? 67  ARG A C   1 
ATOM   161  O  O   . ARG A 1 25  ? 37.268 43.285 53.167 1.00 38.71  ? 67  ARG A O   1 
ATOM   162  C  CB  . ARG A 1 25  ? 34.208 43.754 52.721 1.00 44.52  ? 67  ARG A CB  1 
ATOM   163  C  CG  . ARG A 1 25  ? 32.847 43.467 53.287 1.00 49.24  ? 67  ARG A CG  1 
ATOM   164  C  CD  . ARG A 1 25  ? 31.944 42.828 52.262 1.00 56.23  ? 67  ARG A CD  1 
ATOM   165  N  NE  . ARG A 1 25  ? 30.552 43.109 52.593 1.00 62.19  ? 67  ARG A NE  1 
ATOM   166  C  CZ  . ARG A 1 25  ? 29.943 44.258 52.324 1.00 63.81  ? 67  ARG A CZ  1 
ATOM   167  N  NH1 . ARG A 1 25  ? 30.602 45.232 51.706 1.00 65.99  ? 67  ARG A NH1 1 
ATOM   168  N  NH2 . ARG A 1 25  ? 28.684 44.442 52.694 1.00 64.35  ? 67  ARG A NH2 1 
ATOM   169  N  N   . MET A 1 26  ? 36.748 43.503 50.981 1.00 40.70  ? 68  MET A N   1 
ATOM   170  C  CA  . MET A 1 26  ? 38.013 44.149 50.632 1.00 41.49  ? 68  MET A CA  1 
ATOM   171  C  C   . MET A 1 26  ? 38.028 45.500 51.379 1.00 42.77  ? 68  MET A C   1 
ATOM   172  O  O   . MET A 1 26  ? 36.994 46.151 51.524 1.00 42.41  ? 68  MET A O   1 
ATOM   173  C  CB  . MET A 1 26  ? 38.100 44.354 49.118 1.00 40.96  ? 68  MET A CB  1 
ATOM   174  C  CG  . MET A 1 26  ? 38.565 43.112 48.355 1.00 39.80  ? 68  MET A CG  1 
ATOM   175  S  SD  . MET A 1 26  ? 40.255 42.582 48.815 1.00 43.67  ? 68  MET A SD  1 
ATOM   176  C  CE  . MET A 1 26  ? 40.235 40.850 48.334 1.00 36.58  ? 68  MET A CE  1 
ATOM   177  N  N   . PRO A 1 27  ? 39.197 45.923 51.880 1.00 44.34  ? 69  PRO A N   1 
ATOM   178  C  CA  . PRO A 1 27  ? 39.274 47.193 52.611 1.00 47.94  ? 69  PRO A CA  1 
ATOM   179  C  C   . PRO A 1 27  ? 39.340 48.437 51.726 1.00 52.38  ? 69  PRO A C   1 
ATOM   180  O  O   . PRO A 1 27  ? 40.193 49.298 51.925 1.00 54.48  ? 69  PRO A O   1 
ATOM   181  C  CB  . PRO A 1 27  ? 40.530 47.010 53.450 1.00 47.04  ? 69  PRO A CB  1 
ATOM   182  C  CG  . PRO A 1 27  ? 41.433 46.257 52.491 1.00 45.59  ? 69  PRO A CG  1 
ATOM   183  C  CD  . PRO A 1 27  ? 40.492 45.211 51.911 1.00 45.31  ? 69  PRO A CD  1 
ATOM   184  N  N   . GLY A 1 28  ? 38.444 48.529 50.750 1.00 54.28  ? 70  GLY A N   1 
ATOM   185  C  CA  . GLY A 1 28  ? 38.446 49.673 49.855 1.00 56.99  ? 70  GLY A CA  1 
ATOM   186  C  C   . GLY A 1 28  ? 39.701 49.709 49.004 1.00 59.82  ? 70  GLY A C   1 
ATOM   187  O  O   . GLY A 1 28  ? 40.546 50.579 49.179 1.00 60.98  ? 70  GLY A O   1 
ATOM   188  N  N   . VAL A 1 29  ? 39.836 48.756 48.087 1.00 61.10  ? 71  VAL A N   1 
ATOM   189  C  CA  . VAL A 1 29  ? 41.004 48.704 47.220 1.00 61.30  ? 71  VAL A CA  1 
ATOM   190  C  C   . VAL A 1 29  ? 40.672 49.255 45.842 1.00 63.32  ? 71  VAL A C   1 
ATOM   191  O  O   . VAL A 1 29  ? 39.500 49.442 45.502 1.00 62.71  ? 71  VAL A O   1 
ATOM   192  C  CB  . VAL A 1 29  ? 41.535 47.266 47.065 1.00 60.29  ? 71  VAL A CB  1 
ATOM   193  C  CG1 . VAL A 1 29  ? 41.937 46.711 48.430 1.00 57.49  ? 71  VAL A CG1 1 
ATOM   194  C  CG2 . VAL A 1 29  ? 40.481 46.391 46.411 1.00 58.63  ? 71  VAL A CG2 1 
ATOM   195  N  N   . THR A 1 30  ? 41.711 49.523 45.058 1.00 65.28  ? 72  THR A N   1 
ATOM   196  C  CA  . THR A 1 30  ? 41.536 50.060 43.716 1.00 68.29  ? 72  THR A CA  1 
ATOM   197  C  C   . THR A 1 30  ? 42.501 49.420 42.721 1.00 70.13  ? 72  THR A C   1 
ATOM   198  O  O   . THR A 1 30  ? 43.714 49.652 42.775 1.00 71.42  ? 72  THR A O   1 
ATOM   199  C  CB  . THR A 1 30  ? 41.756 51.588 43.695 1.00 67.93  ? 72  THR A CB  1 
ATOM   200  O  OG1 . THR A 1 30  ? 40.793 52.228 44.545 1.00 66.36  ? 72  THR A OG1 1 
ATOM   201  C  CG2 . THR A 1 30  ? 41.610 52.124 42.279 1.00 69.17  ? 72  THR A CG2 1 
ATOM   202  N  N   . PRO A 1 31  ? 41.975 48.593 41.804 1.00 70.63  ? 73  PRO A N   1 
ATOM   203  C  CA  . PRO A 1 31  ? 42.821 47.937 40.807 1.00 72.44  ? 73  PRO A CA  1 
ATOM   204  C  C   . PRO A 1 31  ? 43.362 49.006 39.866 1.00 73.61  ? 73  PRO A C   1 
ATOM   205  O  O   . PRO A 1 31  ? 42.670 49.973 39.563 1.00 72.98  ? 73  PRO A O   1 
ATOM   206  C  CB  . PRO A 1 31  ? 41.852 46.993 40.092 1.00 70.97  ? 73  PRO A CB  1 
ATOM   207  C  CG  . PRO A 1 31  ? 40.781 46.762 41.088 1.00 71.44  ? 73  PRO A CG  1 
ATOM   208  C  CD  . PRO A 1 31  ? 40.588 48.124 41.687 1.00 70.61  ? 73  PRO A CD  1 
ATOM   209  N  N   . LYS A 1 32  ? 44.594 48.827 39.409 1.00 75.61  ? 74  LYS A N   1 
ATOM   210  C  CA  . LYS A 1 32  ? 45.213 49.778 38.498 1.00 77.59  ? 74  LYS A CA  1 
ATOM   211  C  C   . LYS A 1 32  ? 45.480 49.076 37.169 1.00 79.06  ? 74  LYS A C   1 
ATOM   212  O  O   . LYS A 1 32  ? 45.988 49.674 36.219 1.00 79.00  ? 74  LYS A O   1 
ATOM   213  C  CB  . LYS A 1 32  ? 46.516 50.288 39.111 1.00 77.65  ? 74  LYS A CB  1 
ATOM   214  C  CG  . LYS A 1 32  ? 46.317 50.883 40.493 1.00 78.18  ? 74  LYS A CG  1 
ATOM   215  C  CD  . LYS A 1 32  ? 47.610 50.884 41.283 1.00 79.29  ? 74  LYS A CD  1 
ATOM   216  C  CE  . LYS A 1 32  ? 47.345 51.143 42.761 1.00 78.94  ? 74  LYS A CE  1 
ATOM   217  N  NZ  . LYS A 1 32  ? 48.597 51.111 43.566 1.00 79.00  ? 74  LYS A NZ  1 
ATOM   218  N  N   . GLU A 1 33  ? 45.120 47.796 37.116 1.00 79.81  ? 75  GLU A N   1 
ATOM   219  C  CA  . GLU A 1 33  ? 45.306 46.975 35.926 1.00 79.48  ? 75  GLU A CA  1 
ATOM   220  C  C   . GLU A 1 33  ? 44.165 45.973 35.879 1.00 78.69  ? 75  GLU A C   1 
ATOM   221  O  O   . GLU A 1 33  ? 43.683 45.524 36.921 1.00 78.93  ? 75  GLU A O   1 
ATOM   222  C  CB  . GLU A 1 33  ? 46.633 46.225 36.012 1.00 80.16  ? 75  GLU A CB  1 
ATOM   223  C  CG  . GLU A 1 33  ? 47.783 47.091 36.494 1.00 83.74  ? 75  GLU A CG  1 
ATOM   224  C  CD  . GLU A 1 33  ? 49.020 46.287 36.813 1.00 85.18  ? 75  GLU A CD  1 
ATOM   225  O  OE1 . GLU A 1 33  ? 49.571 45.655 35.887 1.00 86.37  ? 75  GLU A OE1 1 
ATOM   226  O  OE2 . GLU A 1 33  ? 49.438 46.283 37.993 1.00 87.20  ? 75  GLU A OE2 1 
ATOM   227  N  N   . SER A 1 34  ? 43.724 45.624 34.678 1.00 77.32  ? 76  SER A N   1 
ATOM   228  C  CA  . SER A 1 34  ? 42.641 44.659 34.547 1.00 75.55  ? 76  SER A CA  1 
ATOM   229  C  C   . SER A 1 34  ? 43.130 43.288 34.996 1.00 73.18  ? 76  SER A C   1 
ATOM   230  O  O   . SER A 1 34  ? 44.339 43.043 35.080 1.00 71.93  ? 76  SER A O   1 
ATOM   231  C  CB  . SER A 1 34  ? 42.149 44.605 33.099 1.00 76.62  ? 76  SER A CB  1 
ATOM   232  O  OG  . SER A 1 34  ? 41.489 45.811 32.746 1.00 77.28  ? 76  SER A OG  1 
ATOM   233  N  N   . ASP A 1 35  ? 42.191 42.397 35.292 1.00 70.27  ? 77  ASP A N   1 
ATOM   234  C  CA  . ASP A 1 35  ? 42.538 41.060 35.743 1.00 67.75  ? 77  ASP A CA  1 
ATOM   235  C  C   . ASP A 1 35  ? 43.488 41.086 36.931 1.00 65.23  ? 77  ASP A C   1 
ATOM   236  O  O   . ASP A 1 35  ? 44.517 40.404 36.945 1.00 64.07  ? 77  ASP A O   1 
ATOM   237  C  CB  . ASP A 1 35  ? 43.155 40.242 34.606 1.00 71.18  ? 77  ASP A CB  1 
ATOM   238  C  CG  . ASP A 1 35  ? 42.105 39.586 33.728 1.00 74.22  ? 77  ASP A CG  1 
ATOM   239  O  OD1 . ASP A 1 35  ? 42.478 38.765 32.860 1.00 76.19  ? 77  ASP A OD1 1 
ATOM   240  O  OD2 . ASP A 1 35  ? 40.905 39.893 33.909 1.00 76.41  ? 77  ASP A OD2 1 
ATOM   241  N  N   . THR A 1 36  ? 43.144 41.892 37.924 1.00 61.20  ? 78  THR A N   1 
ATOM   242  C  CA  . THR A 1 36  ? 43.945 41.981 39.133 1.00 59.33  ? 78  THR A CA  1 
ATOM   243  C  C   . THR A 1 36  ? 43.285 41.076 40.179 1.00 56.57  ? 78  THR A C   1 
ATOM   244  O  O   . THR A 1 36  ? 42.065 41.074 40.317 1.00 54.14  ? 78  THR A O   1 
ATOM   245  C  CB  . THR A 1 36  ? 44.000 43.429 39.658 1.00 58.76  ? 78  THR A CB  1 
ATOM   246  O  OG1 . THR A 1 36  ? 44.976 44.163 38.910 1.00 60.70  ? 78  THR A OG1 1 
ATOM   247  C  CG2 . THR A 1 36  ? 44.383 43.462 41.126 1.00 58.84  ? 78  THR A CG2 1 
ATOM   248  N  N   . TYR A 1 37  ? 44.097 40.293 40.883 1.00 54.86  ? 79  TYR A N   1 
ATOM   249  C  CA  . TYR A 1 37  ? 43.593 39.397 41.918 1.00 51.70  ? 79  TYR A CA  1 
ATOM   250  C  C   . TYR A 1 37  ? 44.045 39.892 43.278 1.00 49.41  ? 79  TYR A C   1 
ATOM   251  O  O   . TYR A 1 37  ? 45.241 39.854 43.582 1.00 47.80  ? 79  TYR A O   1 
ATOM   252  C  CB  . TYR A 1 37  ? 44.138 37.978 41.745 1.00 55.25  ? 79  TYR A CB  1 
ATOM   253  C  CG  . TYR A 1 37  ? 43.606 37.185 40.573 1.00 60.61  ? 79  TYR A CG  1 
ATOM   254  C  CD1 . TYR A 1 37  ? 43.943 37.518 39.260 1.00 61.78  ? 79  TYR A CD1 1 
ATOM   255  C  CD2 . TYR A 1 37  ? 42.820 36.057 40.784 1.00 62.76  ? 79  TYR A CD2 1 
ATOM   256  C  CE1 . TYR A 1 37  ? 43.511 36.738 38.193 1.00 64.15  ? 79  TYR A CE1 1 
ATOM   257  C  CE2 . TYR A 1 37  ? 42.385 35.272 39.730 1.00 62.84  ? 79  TYR A CE2 1 
ATOM   258  C  CZ  . TYR A 1 37  ? 42.732 35.613 38.440 1.00 65.08  ? 79  TYR A CZ  1 
ATOM   259  O  OH  . TYR A 1 37  ? 42.310 34.812 37.403 1.00 67.89  ? 79  TYR A OH  1 
ATOM   260  N  N   . PHE A 1 38  ? 43.098 40.355 44.090 1.00 46.32  ? 80  PHE A N   1 
ATOM   261  C  CA  . PHE A 1 38  ? 43.413 40.815 45.436 1.00 43.14  ? 80  PHE A CA  1 
ATOM   262  C  C   . PHE A 1 38  ? 42.967 39.782 46.472 1.00 42.62  ? 80  PHE A C   1 
ATOM   263  O  O   . PHE A 1 38  ? 41.924 39.142 46.308 1.00 39.16  ? 80  PHE A O   1 
ATOM   264  C  CB  . PHE A 1 38  ? 42.715 42.136 45.716 1.00 46.91  ? 80  PHE A CB  1 
ATOM   265  C  CG  . PHE A 1 38  ? 43.407 43.322 45.113 1.00 49.81  ? 80  PHE A CG  1 
ATOM   266  C  CD1 . PHE A 1 38  ? 42.674 44.402 44.648 1.00 50.28  ? 80  PHE A CD1 1 
ATOM   267  C  CD2 . PHE A 1 38  ? 44.798 43.361 45.028 1.00 53.03  ? 80  PHE A CD2 1 
ATOM   268  C  CE1 . PHE A 1 38  ? 43.312 45.517 44.102 1.00 54.35  ? 80  PHE A CE1 1 
ATOM   269  C  CE2 . PHE A 1 38  ? 45.452 44.473 44.483 1.00 55.02  ? 80  PHE A CE2 1 
ATOM   270  C  CZ  . PHE A 1 38  ? 44.703 45.551 44.021 1.00 53.96  ? 80  PHE A CZ  1 
ATOM   271  N  N   . CYS A 1 39  ? 43.772 39.640 47.522 1.00 41.25  ? 81  CYS A N   1 
ATOM   272  C  CA  . CYS A 1 39  ? 43.528 38.726 48.632 1.00 39.94  ? 81  CYS A CA  1 
ATOM   273  C  C   . CYS A 1 39  ? 43.523 39.479 49.973 1.00 40.56  ? 81  CYS A C   1 
ATOM   274  O  O   . CYS A 1 39  ? 44.166 40.527 50.120 1.00 39.10  ? 81  CYS A O   1 
ATOM   275  C  CB  . CYS A 1 39  ? 44.611 37.631 48.632 1.00 46.61  ? 81  CYS A CB  1 
ATOM   276  S  SG  . CYS A 1 39  ? 44.178 36.250 47.514 1.00 50.41  ? 81  CYS A SG  1 
ATOM   277  N  N   A MET A 1 40  ? 42.775 38.958 50.940 1.00 36.50  ? 82  MET A N   1 
ATOM   278  C  CA  A MET A 1 40  ? 42.708 39.558 52.268 0.61 35.66  ? 82  MET A CA  1 
ATOM   279  C  CA  B MET A 1 40  ? 42.688 39.564 52.265 0.39 35.96  ? 82  MET A CA  1 
ATOM   280  C  C   A MET A 1 40  ? 42.247 38.484 53.236 1.00 35.49  ? 82  MET A C   1 
ATOM   281  O  O   A MET A 1 40  ? 41.693 37.470 52.824 1.00 34.99  ? 82  MET A O   1 
ATOM   282  C  CB  A MET A 1 40  ? 41.751 40.771 52.285 0.61 36.35  ? 82  MET A CB  1 
ATOM   283  C  CB  B MET A 1 40  ? 41.657 40.698 52.277 0.39 36.74  ? 82  MET A CB  1 
ATOM   284  C  CG  A MET A 1 40  ? 40.284 40.465 52.041 0.61 37.99  ? 82  MET A CG  1 
ATOM   285  C  CG  B MET A 1 40  ? 40.249 40.221 51.990 0.39 38.42  ? 82  MET A CG  1 
ATOM   286  S  SD  A MET A 1 40  ? 39.408 39.864 53.510 0.61 38.64  ? 82  MET A SD  1 
ATOM   287  S  SD  B MET A 1 40  ? 38.989 41.349 52.581 0.39 38.66  ? 82  MET A SD  1 
ATOM   288  C  CE  A MET A 1 40  ? 39.253 41.390 54.441 0.61 37.14  ? 82  MET A CE  1 
ATOM   289  C  CE  B MET A 1 40  ? 38.905 40.876 54.315 0.39 38.82  ? 82  MET A CE  1 
ATOM   290  N  N   . SER A 1 41  ? 42.485 38.694 54.522 1.00 31.66  ? 83  SER A N   1 
ATOM   291  C  CA  . SER A 1 41  ? 42.080 37.695 55.486 1.00 33.40  ? 83  SER A CA  1 
ATOM   292  C  C   . SER A 1 41  ? 41.323 38.259 56.654 1.00 31.33  ? 83  SER A C   1 
ATOM   293  O  O   . SER A 1 41  ? 41.365 39.452 56.912 1.00 34.28  ? 83  SER A O   1 
ATOM   294  C  CB  . SER A 1 41  ? 43.302 36.954 56.047 1.00 34.45  ? 83  SER A CB  1 
ATOM   295  O  OG  . SER A 1 41  ? 44.027 37.827 56.908 1.00 36.12  ? 83  SER A OG  1 
ATOM   296  N  N   A MET A 1 42  ? 40.604 37.376 57.342 1.00 32.43  ? 84  MET A N   1 
ATOM   297  C  CA  A MET A 1 42  ? 39.842 37.743 58.532 0.62 30.94  ? 84  MET A CA  1 
ATOM   298  C  CA  B MET A 1 42  ? 39.867 37.741 58.540 0.38 31.19  ? 84  MET A CA  1 
ATOM   299  C  C   A MET A 1 42  ? 39.975 36.588 59.505 1.00 32.49  ? 84  MET A C   1 
ATOM   300  O  O   A MET A 1 42  ? 39.641 35.451 59.167 1.00 27.93  ? 84  MET A O   1 
ATOM   301  C  CB  A MET A 1 42  ? 38.351 37.940 58.215 0.62 33.26  ? 84  MET A CB  1 
ATOM   302  C  CB  B MET A 1 42  ? 38.397 38.004 58.240 0.38 33.08  ? 84  MET A CB  1 
ATOM   303  C  CG  A MET A 1 42  ? 38.014 39.141 57.337 0.62 36.41  ? 84  MET A CG  1 
ATOM   304  C  CG  B MET A 1 42  ? 38.149 39.350 57.624 0.38 34.89  ? 84  MET A CG  1 
ATOM   305  S  SD  A MET A 1 42  ? 38.155 40.755 58.160 0.62 37.49  ? 84  MET A SD  1 
ATOM   306  S  SD  B MET A 1 42  ? 36.417 39.738 57.686 0.38 35.59  ? 84  MET A SD  1 
ATOM   307  C  CE  A MET A 1 42  ? 36.639 40.742 59.209 0.62 35.32  ? 84  MET A CE  1 
ATOM   308  C  CE  B MET A 1 42  ? 36.288 40.570 59.296 0.38 32.87  ? 84  MET A CE  1 
ATOM   309  N  N   . ARG A 1 43  ? 40.453 36.870 60.707 1.00 31.33  ? 85  ARG A N   1 
ATOM   310  C  CA  . ARG A 1 43  ? 40.579 35.812 61.677 1.00 34.36  ? 85  ARG A CA  1 
ATOM   311  C  C   . ARG A 1 43  ? 39.161 35.572 62.173 1.00 35.39  ? 85  ARG A C   1 
ATOM   312  O  O   . ARG A 1 43  ? 38.350 36.490 62.123 1.00 34.78  ? 85  ARG A O   1 
ATOM   313  C  CB  . ARG A 1 43  ? 41.460 36.251 62.852 1.00 35.83  ? 85  ARG A CB  1 
ATOM   314  C  CG  . ARG A 1 43  ? 41.853 35.071 63.720 1.00 44.51  ? 85  ARG A CG  1 
ATOM   315  C  CD  . ARG A 1 43  ? 42.941 35.388 64.719 1.00 53.25  ? 85  ARG A CD  1 
ATOM   316  N  NE  . ARG A 1 43  ? 43.565 34.145 65.170 1.00 61.45  ? 85  ARG A NE  1 
ATOM   317  C  CZ  . ARG A 1 43  ? 42.979 33.244 65.953 1.00 63.23  ? 85  ARG A CZ  1 
ATOM   318  N  NH1 . ARG A 1 43  ? 41.743 33.445 66.396 1.00 67.86  ? 85  ARG A NH1 1 
ATOM   319  N  NH2 . ARG A 1 43  ? 43.620 32.126 66.272 1.00 62.49  ? 85  ARG A NH2 1 
ATOM   320  N  N   . LEU A 1 44  ? 38.832 34.347 62.591 1.00 32.32  ? 86  LEU A N   1 
ATOM   321  C  CA  . LEU A 1 44  ? 37.489 34.105 63.141 1.00 35.83  ? 86  LEU A CA  1 
ATOM   322  C  C   . LEU A 1 44  ? 37.481 34.864 64.455 1.00 37.51  ? 86  LEU A C   1 
ATOM   323  O  O   . LEU A 1 44  ? 38.487 34.875 65.158 1.00 37.23  ? 86  LEU A O   1 
ATOM   324  C  CB  . LEU A 1 44  ? 37.266 32.624 63.445 1.00 35.48  ? 86  LEU A CB  1 
ATOM   325  C  CG  . LEU A 1 44  ? 36.634 31.744 62.383 1.00 40.40  ? 86  LEU A CG  1 
ATOM   326  C  CD1 . LEU A 1 44  ? 36.684 30.294 62.873 1.00 44.71  ? 86  LEU A CD1 1 
ATOM   327  C  CD2 . LEU A 1 44  ? 35.182 32.175 62.136 1.00 43.85  ? 86  LEU A CD2 1 
ATOM   328  N  N   . PRO A 1 45  ? 36.357 35.506 64.813 1.00 37.35  ? 87  PRO A N   1 
ATOM   329  C  CA  . PRO A 1 45  ? 36.334 36.253 66.082 1.00 36.66  ? 87  PRO A CA  1 
ATOM   330  C  C   . PRO A 1 45  ? 36.201 35.382 67.322 1.00 40.11  ? 87  PRO A C   1 
ATOM   331  O  O   . PRO A 1 45  ? 36.476 35.843 68.447 1.00 40.24  ? 87  PRO A O   1 
ATOM   332  C  CB  . PRO A 1 45  ? 35.144 37.194 65.907 1.00 35.65  ? 87  PRO A CB  1 
ATOM   333  C  CG  . PRO A 1 45  ? 34.194 36.361 65.083 1.00 32.11  ? 87  PRO A CG  1 
ATOM   334  C  CD  . PRO A 1 45  ? 35.101 35.687 64.057 1.00 35.21  ? 87  PRO A CD  1 
ATOM   335  N  N   . VAL A 1 46  ? 35.776 34.134 67.113 1.00 40.37  ? 88  VAL A N   1 
ATOM   336  C  CA  . VAL A 1 46  ? 35.598 33.170 68.200 1.00 43.97  ? 88  VAL A CA  1 
ATOM   337  C  C   . VAL A 1 46  ? 36.652 32.101 68.070 1.00 42.48  ? 88  VAL A C   1 
ATOM   338  O  O   . VAL A 1 46  ? 36.988 31.676 66.965 1.00 43.79  ? 88  VAL A O   1 
ATOM   339  C  CB  . VAL A 1 46  ? 34.232 32.446 68.141 1.00 46.03  ? 88  VAL A CB  1 
ATOM   340  C  CG1 . VAL A 1 46  ? 33.130 33.393 68.441 1.00 49.84  ? 88  VAL A CG1 1 
ATOM   341  C  CG2 . VAL A 1 46  ? 34.023 31.831 66.755 1.00 47.53  ? 88  VAL A CG2 1 
ATOM   342  N  N   . ASP A 1 47  ? 37.168 31.640 69.195 1.00 44.09  ? 89  ASP A N   1 
ATOM   343  C  CA  . ASP A 1 47  ? 38.184 30.612 69.137 1.00 46.93  ? 89  ASP A CA  1 
ATOM   344  C  C   . ASP A 1 47  ? 37.591 29.207 69.108 1.00 44.68  ? 89  ASP A C   1 
ATOM   345  O  O   . ASP A 1 47  ? 38.200 28.294 68.545 1.00 45.13  ? 89  ASP A O   1 
ATOM   346  C  CB  . ASP A 1 47  ? 39.136 30.752 70.323 1.00 54.60  ? 89  ASP A CB  1 
ATOM   347  C  CG  . ASP A 1 47  ? 40.578 30.798 69.889 1.00 60.94  ? 89  ASP A CG  1 
ATOM   348  O  OD1 . ASP A 1 47  ? 41.103 29.744 69.469 1.00 61.82  ? 89  ASP A OD1 1 
ATOM   349  O  OD2 . ASP A 1 47  ? 41.173 31.897 69.949 1.00 66.57  ? 89  ASP A OD2 1 
ATOM   350  N  N   . GLU A 1 48  ? 36.419 29.028 69.714 1.00 42.91  ? 90  GLU A N   1 
ATOM   351  C  CA  . GLU A 1 48  ? 35.800 27.711 69.733 1.00 44.41  ? 90  GLU A CA  1 
ATOM   352  C  C   . GLU A 1 48  ? 35.242 27.307 68.358 1.00 43.66  ? 90  GLU A C   1 
ATOM   353  O  O   . GLU A 1 48  ? 35.127 28.123 67.428 1.00 39.97  ? 90  GLU A O   1 
ATOM   354  C  CB  . GLU A 1 48  ? 34.694 27.625 70.797 1.00 48.08  ? 90  GLU A CB  1 
ATOM   355  C  CG  . GLU A 1 48  ? 33.494 28.535 70.594 1.00 57.65  ? 90  GLU A CG  1 
ATOM   356  C  CD  . GLU A 1 48  ? 32.307 28.134 71.480 1.00 64.49  ? 90  GLU A CD  1 
ATOM   357  O  OE1 . GLU A 1 48  ? 31.311 28.889 71.546 1.00 68.00  ? 90  GLU A OE1 1 
ATOM   358  O  OE2 . GLU A 1 48  ? 32.364 27.054 72.106 1.00 66.05  ? 90  GLU A OE2 1 
ATOM   359  N  N   . GLU A 1 49  ? 34.917 26.032 68.242 1.00 38.50  ? 91  GLU A N   1 
ATOM   360  C  CA  . GLU A 1 49  ? 34.394 25.497 67.001 1.00 39.97  ? 91  GLU A CA  1 
ATOM   361  C  C   . GLU A 1 49  ? 33.077 26.142 66.613 1.00 35.58  ? 91  GLU A C   1 
ATOM   362  O  O   . GLU A 1 49  ? 32.223 26.420 67.462 1.00 34.57  ? 91  GLU A O   1 
ATOM   363  C  CB  . GLU A 1 49  ? 34.195 23.994 67.143 1.00 42.51  ? 91  GLU A CB  1 
ATOM   364  C  CG  . GLU A 1 49  ? 33.685 23.317 65.890 1.00 49.75  ? 91  GLU A CG  1 
ATOM   365  C  CD  . GLU A 1 49  ? 33.636 21.809 66.052 1.00 49.34  ? 91  GLU A CD  1 
ATOM   366  O  OE1 . GLU A 1 49  ? 32.812 21.327 66.852 1.00 49.85  ? 91  GLU A OE1 1 
ATOM   367  O  OE2 . GLU A 1 49  ? 34.428 21.112 65.383 1.00 56.39  ? 91  GLU A OE2 1 
ATOM   368  N  N   . ALA A 1 50  ? 32.920 26.389 65.319 1.00 34.08  ? 92  ALA A N   1 
ATOM   369  C  CA  . ALA A 1 50  ? 31.681 26.953 64.801 1.00 30.15  ? 92  ALA A CA  1 
ATOM   370  C  C   . ALA A 1 50  ? 31.417 26.293 63.459 1.00 31.15  ? 92  ALA A C   1 
ATOM   371  O  O   . ALA A 1 50  ? 32.288 25.604 62.909 1.00 29.24  ? 92  ALA A O   1 
ATOM   372  C  CB  . ALA A 1 50  ? 31.798 28.453 64.635 1.00 28.62  ? 92  ALA A CB  1 
ATOM   373  N  N   . PHE A 1 51  ? 30.234 26.531 62.912 1.00 28.53  ? 93  PHE A N   1 
ATOM   374  C  CA  . PHE A 1 51  ? 29.881 25.933 61.645 1.00 25.01  ? 93  PHE A CA  1 
ATOM   375  C  C   . PHE A 1 51  ? 29.428 27.017 60.681 1.00 27.27  ? 93  PHE A C   1 
ATOM   376  O  O   . PHE A 1 51  ? 28.672 27.911 61.058 1.00 29.26  ? 93  PHE A O   1 
ATOM   377  C  CB  . PHE A 1 51  ? 28.774 24.893 61.869 1.00 29.05  ? 93  PHE A CB  1 
ATOM   378  C  CG  . PHE A 1 51  ? 29.162 23.808 62.843 1.00 31.24  ? 93  PHE A CG  1 
ATOM   379  C  CD1 . PHE A 1 51  ? 29.137 24.041 64.224 1.00 33.15  ? 93  PHE A CD1 1 
ATOM   380  C  CD2 . PHE A 1 51  ? 29.653 22.595 62.381 1.00 32.82  ? 93  PHE A CD2 1 
ATOM   381  C  CE1 . PHE A 1 51  ? 29.608 23.083 65.108 1.00 35.16  ? 93  PHE A CE1 1 
ATOM   382  C  CE2 . PHE A 1 51  ? 30.123 21.626 63.264 1.00 34.98  ? 93  PHE A CE2 1 
ATOM   383  C  CZ  . PHE A 1 51  ? 30.103 21.873 64.629 1.00 35.09  ? 93  PHE A CZ  1 
ATOM   384  N  N   . VAL A 1 52  ? 29.921 26.971 59.445 1.00 23.32  ? 94  VAL A N   1 
ATOM   385  C  CA  . VAL A 1 52  ? 29.516 27.949 58.448 1.00 26.84  ? 94  VAL A CA  1 
ATOM   386  C  C   . VAL A 1 52  ? 28.353 27.298 57.733 1.00 28.67  ? 94  VAL A C   1 
ATOM   387  O  O   . VAL A 1 52  ? 28.509 26.221 57.141 1.00 27.24  ? 94  VAL A O   1 
ATOM   388  C  CB  . VAL A 1 52  ? 30.615 28.239 57.439 1.00 28.07  ? 94  VAL A CB  1 
ATOM   389  C  CG1 . VAL A 1 52  ? 30.113 29.255 56.424 1.00 28.89  ? 94  VAL A CG1 1 
ATOM   390  C  CG2 . VAL A 1 52  ? 31.840 28.828 58.177 1.00 28.74  ? 94  VAL A CG2 1 
ATOM   391  N  N   . ILE A 1 53  ? 27.199 27.947 57.787 1.00 27.98  ? 95  ILE A N   1 
ATOM   392  C  CA  . ILE A 1 53  ? 25.996 27.369 57.203 1.00 27.51  ? 95  ILE A CA  1 
ATOM   393  C  C   . ILE A 1 53  ? 25.335 28.131 56.079 1.00 29.07  ? 95  ILE A C   1 
ATOM   394  O  O   . ILE A 1 53  ? 24.303 27.679 55.553 1.00 29.27  ? 95  ILE A O   1 
ATOM   395  C  CB  . ILE A 1 53  ? 24.939 27.079 58.296 1.00 27.87  ? 95  ILE A CB  1 
ATOM   396  C  CG1 . ILE A 1 53  ? 24.677 28.328 59.134 1.00 29.21  ? 95  ILE A CG1 1 
ATOM   397  C  CG2 . ILE A 1 53  ? 25.425 25.955 59.216 1.00 31.49  ? 95  ILE A CG2 1 
ATOM   398  C  CD1 . ILE A 1 53  ? 23.429 28.165 60.072 1.00 34.73  ? 95  ILE A CD1 1 
ATOM   399  N  N   . ASP A 1 54  ? 25.901 29.275 55.701 1.00 27.55  ? 96  ASP A N   1 
ATOM   400  C  CA  . ASP A 1 54  ? 25.358 30.025 54.573 1.00 29.17  ? 96  ASP A CA  1 
ATOM   401  C  C   . ASP A 1 54  ? 26.369 31.058 54.144 1.00 28.94  ? 96  ASP A C   1 
ATOM   402  O  O   . ASP A 1 54  ? 27.258 31.415 54.921 1.00 27.19  ? 96  ASP A O   1 
ATOM   403  C  CB  . ASP A 1 54  ? 24.034 30.698 54.965 1.00 32.21  ? 96  ASP A CB  1 
ATOM   404  C  CG  . ASP A 1 54  ? 23.151 31.004 53.751 1.00 38.30  ? 96  ASP A CG  1 
ATOM   405  O  OD1 . ASP A 1 54  ? 23.504 30.623 52.599 1.00 37.71  ? 96  ASP A OD1 1 
ATOM   406  O  OD2 . ASP A 1 54  ? 22.091 31.623 53.957 1.00 40.02  ? 96  ASP A OD2 1 
ATOM   407  N  N   . PHE A 1 55  ? 26.246 31.518 52.904 1.00 30.04  ? 97  PHE A N   1 
ATOM   408  C  CA  . PHE A 1 55  ? 27.147 32.510 52.326 1.00 29.87  ? 97  PHE A CA  1 
ATOM   409  C  C   . PHE A 1 55  ? 26.296 33.475 51.493 1.00 34.90  ? 97  PHE A C   1 
ATOM   410  O  O   . PHE A 1 55  ? 25.402 33.020 50.766 1.00 33.66  ? 97  PHE A O   1 
ATOM   411  C  CB  . PHE A 1 55  ? 28.140 31.854 51.339 1.00 28.20  ? 97  PHE A CB  1 
ATOM   412  C  CG  . PHE A 1 55  ? 29.021 30.771 51.933 1.00 30.91  ? 97  PHE A CG  1 
ATOM   413  C  CD1 . PHE A 1 55  ? 28.614 29.447 51.927 1.00 29.64  ? 97  PHE A CD1 1 
ATOM   414  C  CD2 . PHE A 1 55  ? 30.273 31.081 52.469 1.00 29.82  ? 97  PHE A CD2 1 
ATOM   415  C  CE1 . PHE A 1 55  ? 29.426 28.430 52.442 1.00 30.36  ? 97  PHE A CE1 1 
ATOM   416  C  CE2 . PHE A 1 55  ? 31.101 30.069 52.991 1.00 30.57  ? 97  PHE A CE2 1 
ATOM   417  C  CZ  . PHE A 1 55  ? 30.671 28.735 52.976 1.00 28.16  ? 97  PHE A CZ  1 
ATOM   418  N  N   . LYS A 1 56  ? 26.575 34.777 51.571 1.00 33.22  ? 98  LYS A N   1 
ATOM   419  C  CA  . LYS A 1 56  ? 25.871 35.765 50.739 1.00 34.19  ? 98  LYS A CA  1 
ATOM   420  C  C   . LYS A 1 56  ? 26.889 36.669 50.073 1.00 36.42  ? 98  LYS A C   1 
ATOM   421  O  O   . LYS A 1 56  ? 27.633 37.375 50.755 1.00 34.98  ? 98  LYS A O   1 
ATOM   422  C  CB  . LYS A 1 56  ? 24.903 36.604 51.568 1.00 40.79  ? 98  LYS A CB  1 
ATOM   423  C  CG  . LYS A 1 56  ? 23.756 35.780 52.136 1.00 47.97  ? 98  LYS A CG  1 
ATOM   424  C  CD  . LYS A 1 56  ? 22.791 36.642 52.946 1.00 55.02  ? 98  LYS A CD  1 
ATOM   425  C  CE  . LYS A 1 56  ? 21.754 35.773 53.665 1.00 59.47  ? 98  LYS A CE  1 
ATOM   426  N  NZ  . LYS A 1 56  ? 21.055 34.830 52.734 1.00 60.39  ? 98  LYS A NZ  1 
ATOM   427  N  N   . PRO A 1 57  ? 26.936 36.667 48.724 1.00 36.79  ? 99  PRO A N   1 
ATOM   428  C  CA  . PRO A 1 57  ? 27.885 37.500 47.984 1.00 38.48  ? 99  PRO A CA  1 
ATOM   429  C  C   . PRO A 1 57  ? 27.502 38.970 48.018 1.00 41.23  ? 99  PRO A C   1 
ATOM   430  O  O   . PRO A 1 57  ? 26.325 39.310 48.080 1.00 41.52  ? 99  PRO A O   1 
ATOM   431  C  CB  . PRO A 1 57  ? 27.813 36.922 46.575 1.00 39.59  ? 99  PRO A CB  1 
ATOM   432  C  CG  . PRO A 1 57  ? 26.344 36.597 46.454 1.00 38.49  ? 99  PRO A CG  1 
ATOM   433  C  CD  . PRO A 1 57  ? 26.015 35.972 47.801 1.00 35.72  ? 99  PRO A CD  1 
ATOM   434  N  N   . ARG A 1 58  ? 28.509 39.830 48.011 1.00 43.35  ? 100 ARG A N   1 
ATOM   435  C  CA  . ARG A 1 58  ? 28.307 41.272 47.994 1.00 48.93  ? 100 ARG A CA  1 
ATOM   436  C  C   . ARG A 1 58  ? 29.335 41.754 46.989 1.00 48.89  ? 100 ARG A C   1 
ATOM   437  O  O   . ARG A 1 58  ? 30.331 42.376 47.352 1.00 49.67  ? 100 ARG A O   1 
ATOM   438  C  CB  . ARG A 1 58  ? 28.593 41.888 49.362 1.00 51.89  ? 100 ARG A CB  1 
ATOM   439  C  CG  . ARG A 1 58  ? 27.470 41.760 50.390 1.00 59.28  ? 100 ARG A CG  1 
ATOM   440  C  CD  . ARG A 1 58  ? 27.468 40.401 51.048 1.00 64.15  ? 100 ARG A CD  1 
ATOM   441  N  NE  . ARG A 1 58  ? 26.594 40.321 52.218 1.00 67.45  ? 100 ARG A NE  1 
ATOM   442  C  CZ  . ARG A 1 58  ? 25.283 40.538 52.204 1.00 68.21  ? 100 ARG A CZ  1 
ATOM   443  N  NH1 . ARG A 1 58  ? 24.673 40.862 51.074 1.00 70.41  ? 100 ARG A NH1 1 
ATOM   444  N  NH2 . ARG A 1 58  ? 24.577 40.399 53.320 1.00 67.32  ? 100 ARG A NH2 1 
ATOM   445  N  N   . ALA A 1 59  ? 29.099 41.424 45.724 1.00 49.41  ? 101 ALA A N   1 
ATOM   446  C  CA  . ALA A 1 59  ? 30.011 41.781 44.647 1.00 53.67  ? 101 ALA A CA  1 
ATOM   447  C  C   . ALA A 1 59  ? 29.590 43.016 43.858 1.00 55.96  ? 101 ALA A C   1 
ATOM   448  O  O   . ALA A 1 59  ? 28.424 43.401 43.856 1.00 55.53  ? 101 ALA A O   1 
ATOM   449  C  CB  . ALA A 1 59  ? 30.168 40.594 43.697 1.00 51.56  ? 101 ALA A CB  1 
ATOM   450  N  N   . SER A 1 60  ? 30.565 43.641 43.204 1.00 60.81  ? 102 SER A N   1 
ATOM   451  C  CA  . SER A 1 60  ? 30.306 44.812 42.369 1.00 64.05  ? 102 SER A CA  1 
ATOM   452  C  C   . SER A 1 60  ? 30.143 44.263 40.960 1.00 65.60  ? 102 SER A C   1 
ATOM   453  O  O   . SER A 1 60  ? 31.128 43.967 40.283 1.00 66.21  ? 102 SER A O   1 
ATOM   454  C  CB  . SER A 1 60  ? 31.484 45.793 42.412 1.00 65.16  ? 102 SER A CB  1 
ATOM   455  O  OG  . SER A 1 60  ? 31.666 46.343 43.711 1.00 66.83  ? 102 SER A OG  1 
ATOM   456  N  N   . MET A 1 61  ? 28.891 44.104 40.542 1.00 68.26  ? 103 MET A N   1 
ATOM   457  C  CA  . MET A 1 61  ? 28.559 43.578 39.221 1.00 70.87  ? 103 MET A CA  1 
ATOM   458  C  C   . MET A 1 61  ? 29.329 44.252 38.079 1.00 71.62  ? 103 MET A C   1 
ATOM   459  O  O   . MET A 1 61  ? 29.489 43.668 37.003 1.00 71.39  ? 103 MET A O   1 
ATOM   460  C  CB  . MET A 1 61  ? 27.054 43.729 38.980 1.00 72.93  ? 103 MET A CB  1 
ATOM   461  C  CG  . MET A 1 61  ? 26.191 43.149 40.092 1.00 75.39  ? 103 MET A CG  1 
ATOM   462  S  SD  . MET A 1 61  ? 26.365 41.348 40.277 1.00 79.57  ? 103 MET A SD  1 
ATOM   463  C  CE  . MET A 1 61  ? 24.737 40.801 39.739 1.00 77.34  ? 103 MET A CE  1 
ATOM   464  N  N   . ASP A 1 62  ? 29.816 45.467 38.321 1.00 71.64  ? 104 ASP A N   1 
ATOM   465  C  CA  . ASP A 1 62  ? 30.548 46.214 37.298 1.00 72.62  ? 104 ASP A CA  1 
ATOM   466  C  C   . ASP A 1 62  ? 32.057 45.999 37.205 1.00 71.27  ? 104 ASP A C   1 
ATOM   467  O  O   . ASP A 1 62  ? 32.721 46.696 36.437 1.00 73.10  ? 104 ASP A O   1 
ATOM   468  C  CB  . ASP A 1 62  ? 30.299 47.721 37.451 1.00 73.71  ? 104 ASP A CB  1 
ATOM   469  C  CG  . ASP A 1 62  ? 28.922 48.142 36.972 1.00 76.12  ? 104 ASP A CG  1 
ATOM   470  O  OD1 . ASP A 1 62  ? 28.389 47.499 36.039 1.00 77.17  ? 104 ASP A OD1 1 
ATOM   471  O  OD2 . ASP A 1 62  ? 28.383 49.132 37.518 1.00 76.13  ? 104 ASP A OD2 1 
ATOM   472  N  N   . THR A 1 63  ? 32.615 45.059 37.959 1.00 67.70  ? 105 THR A N   1 
ATOM   473  C  CA  . THR A 1 63  ? 34.060 44.854 37.886 1.00 64.27  ? 105 THR A CA  1 
ATOM   474  C  C   . THR A 1 63  ? 34.550 43.494 38.376 1.00 60.55  ? 105 THR A C   1 
ATOM   475  O  O   . THR A 1 63  ? 35.541 42.954 37.866 1.00 59.62  ? 105 THR A O   1 
ATOM   476  C  CB  . THR A 1 63  ? 34.804 45.957 38.675 1.00 66.42  ? 105 THR A CB  1 
ATOM   477  O  OG1 . THR A 1 63  ? 36.221 45.780 38.537 1.00 66.67  ? 105 THR A OG1 1 
ATOM   478  C  CG2 . THR A 1 63  ? 34.417 45.915 40.157 1.00 65.34  ? 105 THR A CG2 1 
ATOM   479  N  N   . VAL A 1 64  ? 33.850 42.937 39.355 1.00 57.09  ? 106 VAL A N   1 
ATOM   480  C  CA  . VAL A 1 64  ? 34.237 41.644 39.923 1.00 51.85  ? 106 VAL A CA  1 
ATOM   481  C  C   . VAL A 1 64  ? 33.925 40.477 38.996 1.00 49.39  ? 106 VAL A C   1 
ATOM   482  O  O   . VAL A 1 64  ? 32.764 40.223 38.678 1.00 47.65  ? 106 VAL A O   1 
ATOM   483  C  CB  . VAL A 1 64  ? 33.538 41.422 41.271 1.00 50.18  ? 106 VAL A CB  1 
ATOM   484  C  CG1 . VAL A 1 64  ? 33.923 40.062 41.852 1.00 47.07  ? 106 VAL A CG1 1 
ATOM   485  C  CG2 . VAL A 1 64  ? 33.919 42.544 42.227 1.00 47.57  ? 106 VAL A CG2 1 
ATOM   486  N  N   . HIS A 1 65  ? 34.970 39.770 38.565 1.00 47.39  ? 107 HIS A N   1 
ATOM   487  C  CA  . HIS A 1 65  ? 34.799 38.618 37.689 1.00 49.17  ? 107 HIS A CA  1 
ATOM   488  C  C   . HIS A 1 65  ? 34.455 37.360 38.500 1.00 47.29  ? 107 HIS A C   1 
ATOM   489  O  O   . HIS A 1 65  ? 33.599 36.568 38.109 1.00 47.74  ? 107 HIS A O   1 
ATOM   490  C  CB  . HIS A 1 65  ? 36.063 38.382 36.867 1.00 51.35  ? 107 HIS A CB  1 
ATOM   491  C  CG  . HIS A 1 65  ? 35.959 37.214 35.942 1.00 53.80  ? 107 HIS A CG  1 
ATOM   492  N  ND1 . HIS A 1 65  ? 36.413 35.970 36.303 1.00 55.49  ? 107 HIS A ND1 1 
ATOM   493  C  CD2 . HIS A 1 65  ? 35.414 37.152 34.700 1.00 56.82  ? 107 HIS A CD2 1 
ATOM   494  C  CE1 . HIS A 1 65  ? 36.144 35.179 35.280 1.00 55.35  ? 107 HIS A CE1 1 
ATOM   495  N  NE2 . HIS A 1 65  ? 35.537 35.846 34.284 1.00 57.08  ? 107 HIS A NE2 1 
ATOM   496  N  N   . HIS A 1 66  ? 35.131 37.177 39.627 1.00 44.99  ? 108 HIS A N   1 
ATOM   497  C  CA  . HIS A 1 66  ? 34.850 36.032 40.498 1.00 42.49  ? 108 HIS A CA  1 
ATOM   498  C  C   . HIS A 1 66  ? 35.460 36.276 41.874 1.00 39.72  ? 108 HIS A C   1 
ATOM   499  O  O   . HIS A 1 66  ? 36.356 37.119 42.024 1.00 42.40  ? 108 HIS A O   1 
ATOM   500  C  CB  . HIS A 1 66  ? 35.395 34.717 39.886 1.00 41.51  ? 108 HIS A CB  1 
ATOM   501  C  CG  . HIS A 1 66  ? 36.816 34.402 40.248 1.00 41.26  ? 108 HIS A CG  1 
ATOM   502  N  ND1 . HIS A 1 66  ? 37.839 34.562 39.350 1.00 44.78  ? 108 HIS A ND1 1 
ATOM   503  C  CD2 . HIS A 1 66  ? 37.318 33.936 41.419 1.00 43.41  ? 108 HIS A CD2 1 
ATOM   504  C  CE1 . HIS A 1 66  ? 38.939 34.198 39.980 1.00 44.39  ? 108 HIS A CE1 1 
ATOM   505  N  NE2 . HIS A 1 66  ? 38.681 33.810 41.238 1.00 49.20  ? 108 HIS A NE2 1 
ATOM   506  N  N   . MET A 1 67  ? 34.950 35.558 42.873 1.00 36.53  ? 109 MET A N   1 
ATOM   507  C  CA  . MET A 1 67  ? 35.453 35.646 44.235 1.00 33.48  ? 109 MET A CA  1 
ATOM   508  C  C   . MET A 1 67  ? 35.498 34.219 44.782 1.00 32.15  ? 109 MET A C   1 
ATOM   509  O  O   . MET A 1 67  ? 34.622 33.408 44.480 1.00 33.82  ? 109 MET A O   1 
ATOM   510  C  CB  . MET A 1 67  ? 34.502 36.455 45.153 1.00 33.41  ? 109 MET A CB  1 
ATOM   511  C  CG  . MET A 1 67  ? 34.123 37.849 44.688 1.00 35.75  ? 109 MET A CG  1 
ATOM   512  S  SD  . MET A 1 67  ? 33.272 38.796 46.005 1.00 38.15  ? 109 MET A SD  1 
ATOM   513  C  CE  . MET A 1 67  ? 31.579 38.097 45.938 1.00 31.09  ? 109 MET A CE  1 
ATOM   514  N  N   . LEU A 1 68  ? 36.504 33.928 45.591 1.00 31.25  ? 110 LEU A N   1 
ATOM   515  C  CA  . LEU A 1 68  ? 36.623 32.620 46.231 1.00 32.06  ? 110 LEU A CA  1 
ATOM   516  C  C   . LEU A 1 68  ? 36.861 32.869 47.705 1.00 31.00  ? 110 LEU A C   1 
ATOM   517  O  O   . LEU A 1 68  ? 37.550 33.826 48.070 1.00 32.71  ? 110 LEU A O   1 
ATOM   518  C  CB  . LEU A 1 68  ? 37.825 31.845 45.689 1.00 32.20  ? 110 LEU A CB  1 
ATOM   519  C  CG  . LEU A 1 68  ? 37.878 31.582 44.188 1.00 33.60  ? 110 LEU A CG  1 
ATOM   520  C  CD1 . LEU A 1 68  ? 39.132 30.743 43.869 1.00 35.74  ? 110 LEU A CD1 1 
ATOM   521  C  CD2 . LEU A 1 68  ? 36.632 30.834 43.761 1.00 34.04  ? 110 LEU A CD2 1 
ATOM   522  N  N   . LEU A 1 69  ? 36.309 32.016 48.559 1.00 29.86  ? 111 LEU A N   1 
ATOM   523  C  CA  . LEU A 1 69  ? 36.541 32.169 49.980 1.00 27.45  ? 111 LEU A CA  1 
ATOM   524  C  C   . LEU A 1 69  ? 37.136 30.850 50.453 1.00 28.32  ? 111 LEU A C   1 
ATOM   525  O  O   . LEU A 1 69  ? 36.612 29.769 50.136 1.00 27.55  ? 111 LEU A O   1 
ATOM   526  C  CB  . LEU A 1 69  ? 35.234 32.459 50.732 1.00 25.88  ? 111 LEU A CB  1 
ATOM   527  C  CG  . LEU A 1 69  ? 35.373 32.752 52.242 1.00 28.86  ? 111 LEU A CG  1 
ATOM   528  C  CD1 . LEU A 1 69  ? 36.020 34.140 52.442 1.00 29.41  ? 111 LEU A CD1 1 
ATOM   529  C  CD2 . LEU A 1 69  ? 33.970 32.759 52.900 1.00 29.49  ? 111 LEU A CD2 1 
ATOM   530  N  N   . PHE A 1 70  ? 38.227 30.951 51.213 1.00 29.21  ? 112 PHE A N   1 
ATOM   531  C  CA  . PHE A 1 70  ? 38.932 29.788 51.738 1.00 27.51  ? 112 PHE A CA  1 
ATOM   532  C  C   . PHE A 1 70  ? 39.031 29.849 53.232 1.00 27.55  ? 112 PHE A C   1 
ATOM   533  O  O   . PHE A 1 70  ? 38.915 30.908 53.836 1.00 27.92  ? 112 PHE A O   1 
ATOM   534  C  CB  . PHE A 1 70  ? 40.399 29.747 51.272 1.00 27.89  ? 112 PHE A CB  1 
ATOM   535  C  CG  . PHE A 1 70  ? 40.585 29.846 49.794 1.00 28.19  ? 112 PHE A CG  1 
ATOM   536  C  CD1 . PHE A 1 70  ? 40.672 31.087 49.173 1.00 32.86  ? 112 PHE A CD1 1 
ATOM   537  C  CD2 . PHE A 1 70  ? 40.664 28.691 49.020 1.00 32.12  ? 112 PHE A CD2 1 
ATOM   538  C  CE1 . PHE A 1 70  ? 40.838 31.186 47.784 1.00 35.15  ? 112 PHE A CE1 1 
ATOM   539  C  CE2 . PHE A 1 70  ? 40.827 28.772 47.642 1.00 36.60  ? 112 PHE A CE2 1 
ATOM   540  C  CZ  . PHE A 1 70  ? 40.912 30.028 47.019 1.00 35.00  ? 112 PHE A CZ  1 
ATOM   541  N  N   . GLY A 1 71  ? 39.277 28.691 53.815 1.00 27.13  ? 113 GLY A N   1 
ATOM   542  C  CA  . GLY A 1 71  ? 39.525 28.627 55.233 1.00 28.58  ? 113 GLY A CA  1 
ATOM   543  C  C   . GLY A 1 71  ? 40.970 28.143 55.349 1.00 29.88  ? 113 GLY A C   1 
ATOM   544  O  O   . GLY A 1 71  ? 41.397 27.271 54.583 1.00 31.22  ? 113 GLY A O   1 
ATOM   545  N  N   . CYS A 1 72  ? 41.749 28.724 56.256 1.00 31.27  ? 114 CYS A N   1 
ATOM   546  C  CA  . CYS A 1 72  ? 43.104 28.250 56.455 1.00 33.97  ? 114 CYS A CA  1 
ATOM   547  C  C   . CYS A 1 72  ? 43.660 28.727 57.778 1.00 34.69  ? 114 CYS A C   1 
ATOM   548  O  O   . CYS A 1 72  ? 43.000 29.482 58.500 1.00 30.50  ? 114 CYS A O   1 
ATOM   549  C  CB  . CYS A 1 72  ? 44.013 28.664 55.296 1.00 39.12  ? 114 CYS A CB  1 
ATOM   550  S  SG  . CYS A 1 72  ? 44.668 30.357 55.272 1.00 43.01  ? 114 CYS A SG  1 
ATOM   551  N  N   . ASN A 1 73  ? 44.868 28.285 58.110 1.00 34.18  ? 115 ASN A N   1 
ATOM   552  C  CA  . ASN A 1 73  ? 45.452 28.676 59.376 1.00 36.35  ? 115 ASN A CA  1 
ATOM   553  C  C   . ASN A 1 73  ? 46.598 29.674 59.301 1.00 39.23  ? 115 ASN A C   1 
ATOM   554  O  O   . ASN A 1 73  ? 46.999 30.216 60.321 1.00 39.70  ? 115 ASN A O   1 
ATOM   555  C  CB  . ASN A 1 73  ? 45.887 27.432 60.144 1.00 42.05  ? 115 ASN A CB  1 
ATOM   556  C  CG  . ASN A 1 73  ? 44.716 26.549 60.509 1.00 45.06  ? 115 ASN A CG  1 
ATOM   557  O  OD1 . ASN A 1 73  ? 43.652 27.041 60.890 1.00 43.04  ? 115 ASN A OD1 1 
ATOM   558  N  ND2 . ASN A 1 73  ? 44.902 25.240 60.403 1.00 47.44  ? 115 ASN A ND2 1 
ATOM   559  N  N   . MET A 1 74  ? 47.120 29.930 58.110 1.00 38.14  ? 116 MET A N   1 
ATOM   560  C  CA  . MET A 1 74  ? 48.212 30.886 57.983 1.00 43.26  ? 116 MET A CA  1 
ATOM   561  C  C   . MET A 1 74  ? 48.133 31.661 56.678 1.00 39.97  ? 116 MET A C   1 
ATOM   562  O  O   . MET A 1 74  ? 48.677 31.231 55.662 1.00 42.37  ? 116 MET A O   1 
ATOM   563  C  CB  . MET A 1 74  ? 49.567 30.165 58.055 1.00 47.54  ? 116 MET A CB  1 
ATOM   564  C  CG  . MET A 1 74  ? 49.854 29.482 59.383 1.00 57.39  ? 116 MET A CG  1 
ATOM   565  S  SD  . MET A 1 74  ? 51.574 28.894 59.448 1.00 72.08  ? 116 MET A SD  1 
ATOM   566  C  CE  . MET A 1 74  ? 52.464 30.452 59.023 1.00 65.11  ? 116 MET A CE  1 
ATOM   567  N  N   . PRO A 1 75  ? 47.444 32.809 56.679 1.00 37.59  ? 117 PRO A N   1 
ATOM   568  C  CA  . PRO A 1 75  ? 47.343 33.591 55.445 1.00 36.47  ? 117 PRO A CA  1 
ATOM   569  C  C   . PRO A 1 75  ? 48.754 33.902 54.949 1.00 38.84  ? 117 PRO A C   1 
ATOM   570  O  O   . PRO A 1 75  ? 49.684 34.018 55.747 1.00 38.71  ? 117 PRO A O   1 
ATOM   571  C  CB  . PRO A 1 75  ? 46.580 34.834 55.887 1.00 36.29  ? 117 PRO A CB  1 
ATOM   572  C  CG  . PRO A 1 75  ? 45.679 34.287 56.971 1.00 34.28  ? 117 PRO A CG  1 
ATOM   573  C  CD  . PRO A 1 75  ? 46.629 33.399 57.754 1.00 36.86  ? 117 PRO A CD  1 
ATOM   574  N  N   . SER A 1 76  ? 48.911 34.046 53.642 1.00 39.17  ? 118 SER A N   1 
ATOM   575  C  CA  . SER A 1 76  ? 50.238 34.289 53.077 1.00 45.45  ? 118 SER A CA  1 
ATOM   576  C  C   . SER A 1 76  ? 50.861 35.641 53.401 1.00 49.15  ? 118 SER A C   1 
ATOM   577  O  O   . SER A 1 76  ? 52.079 35.796 53.340 1.00 49.60  ? 118 SER A O   1 
ATOM   578  C  CB  . SER A 1 76  ? 50.191 34.078 51.570 1.00 42.86  ? 118 SER A CB  1 
ATOM   579  O  OG  . SER A 1 76  ? 49.825 32.729 51.312 1.00 43.22  ? 118 SER A OG  1 
ATOM   580  N  N   . SER A 1 77  ? 50.032 36.615 53.757 1.00 49.65  ? 119 SER A N   1 
ATOM   581  C  CA  . SER A 1 77  ? 50.534 37.935 54.095 1.00 49.99  ? 119 SER A CA  1 
ATOM   582  C  C   . SER A 1 77  ? 49.870 38.458 55.354 1.00 50.99  ? 119 SER A C   1 
ATOM   583  O  O   . SER A 1 77  ? 48.746 38.080 55.675 1.00 46.56  ? 119 SER A O   1 
ATOM   584  C  CB  . SER A 1 77  ? 50.280 38.910 52.950 1.00 49.89  ? 119 SER A CB  1 
ATOM   585  O  OG  . SER A 1 77  ? 50.465 40.248 53.383 1.00 53.73  ? 119 SER A OG  1 
ATOM   586  N  N   . THR A 1 78  ? 50.571 39.326 56.074 1.00 51.06  ? 120 THR A N   1 
ATOM   587  C  CA  . THR A 1 78  ? 50.014 39.912 57.290 1.00 51.79  ? 120 THR A CA  1 
ATOM   588  C  C   . THR A 1 78  ? 49.419 41.270 56.941 1.00 52.42  ? 120 THR A C   1 
ATOM   589  O  O   . THR A 1 78  ? 48.883 41.965 57.806 1.00 54.95  ? 120 THR A O   1 
ATOM   590  C  CB  . THR A 1 78  ? 51.099 40.114 58.360 1.00 51.79  ? 120 THR A CB  1 
ATOM   591  O  OG1 . THR A 1 78  ? 52.142 40.932 57.820 1.00 44.66  ? 120 THR A OG1 1 
ATOM   592  C  CG2 . THR A 1 78  ? 51.684 38.768 58.794 1.00 52.37  ? 120 THR A CG2 1 
ATOM   593  N  N   . GLY A 1 79  ? 49.515 41.636 55.666 1.00 51.97  ? 121 GLY A N   1 
ATOM   594  C  CA  . GLY A 1 79  ? 49.006 42.920 55.212 1.00 50.26  ? 121 GLY A CA  1 
ATOM   595  C  C   . GLY A 1 79  ? 47.498 43.083 55.196 1.00 48.37  ? 121 GLY A C   1 
ATOM   596  O  O   . GLY A 1 79  ? 46.757 42.122 55.373 1.00 48.84  ? 121 GLY A O   1 
ATOM   597  N  N   . SER A 1 80  ? 47.060 44.320 54.979 1.00 47.70  ? 122 SER A N   1 
ATOM   598  C  CA  . SER A 1 80  ? 45.640 44.687 54.911 1.00 50.20  ? 122 SER A CA  1 
ATOM   599  C  C   . SER A 1 80  ? 44.985 43.909 53.778 1.00 50.30  ? 122 SER A C   1 
ATOM   600  O  O   . SER A 1 80  ? 43.830 43.480 53.872 1.00 48.39  ? 122 SER A O   1 
ATOM   601  C  CB  . SER A 1 80  ? 45.514 46.196 54.655 1.00 50.01  ? 122 SER A CB  1 
ATOM   602  O  OG  . SER A 1 80  ? 44.251 46.541 54.107 1.00 53.72  ? 122 SER A OG  1 
ATOM   603  N  N   . TYR A 1 81  ? 45.749 43.759 52.700 1.00 49.46  ? 123 TYR A N   1 
ATOM   604  C  CA  . TYR A 1 81  ? 45.344 43.012 51.512 1.00 49.18  ? 123 TYR A CA  1 
ATOM   605  C  C   . TYR A 1 81  ? 46.634 42.824 50.718 1.00 49.14  ? 123 TYR A C   1 
ATOM   606  O  O   . TYR A 1 81  ? 47.630 43.481 51.005 1.00 46.84  ? 123 TYR A O   1 
ATOM   607  C  CB  . TYR A 1 81  ? 44.277 43.768 50.709 1.00 51.80  ? 123 TYR A CB  1 
ATOM   608  C  CG  . TYR A 1 81  ? 44.764 44.982 49.957 1.00 56.04  ? 123 TYR A CG  1 
ATOM   609  C  CD1 . TYR A 1 81  ? 45.190 44.877 48.638 1.00 59.45  ? 123 TYR A CD1 1 
ATOM   610  C  CD2 . TYR A 1 81  ? 44.813 46.233 50.570 1.00 57.21  ? 123 TYR A CD2 1 
ATOM   611  C  CE1 . TYR A 1 81  ? 45.657 45.985 47.938 1.00 61.66  ? 123 TYR A CE1 1 
ATOM   612  C  CE2 . TYR A 1 81  ? 45.281 47.352 49.885 1.00 60.69  ? 123 TYR A CE2 1 
ATOM   613  C  CZ  . TYR A 1 81  ? 45.704 47.219 48.567 1.00 63.24  ? 123 TYR A CZ  1 
ATOM   614  O  OH  . TYR A 1 81  ? 46.196 48.306 47.879 1.00 66.38  ? 123 TYR A OH  1 
ATOM   615  N  N   . TRP A 1 82  ? 46.638 41.912 49.753 1.00 47.07  ? 124 TRP A N   1 
ATOM   616  C  CA  . TRP A 1 82  ? 47.841 41.673 48.983 1.00 46.13  ? 124 TRP A CA  1 
ATOM   617  C  C   . TRP A 1 82  ? 47.465 41.094 47.625 1.00 47.65  ? 124 TRP A C   1 
ATOM   618  O  O   . TRP A 1 82  ? 46.297 40.783 47.388 1.00 46.14  ? 124 TRP A O   1 
ATOM   619  C  CB  . TRP A 1 82  ? 48.764 40.724 49.770 1.00 45.09  ? 124 TRP A CB  1 
ATOM   620  C  CG  . TRP A 1 82  ? 48.236 39.315 49.970 1.00 45.03  ? 124 TRP A CG  1 
ATOM   621  C  CD1 . TRP A 1 82  ? 48.433 38.239 49.148 1.00 44.64  ? 124 TRP A CD1 1 
ATOM   622  C  CD2 . TRP A 1 82  ? 47.434 38.836 51.065 1.00 46.84  ? 124 TRP A CD2 1 
ATOM   623  N  NE1 . TRP A 1 82  ? 47.811 37.125 49.663 1.00 44.90  ? 124 TRP A NE1 1 
ATOM   624  C  CE2 . TRP A 1 82  ? 47.188 37.465 50.836 1.00 46.79  ? 124 TRP A CE2 1 
ATOM   625  C  CE3 . TRP A 1 82  ? 46.902 39.436 52.219 1.00 48.88  ? 124 TRP A CE3 1 
ATOM   626  C  CZ2 . TRP A 1 82  ? 46.428 36.683 51.714 1.00 46.35  ? 124 TRP A CZ2 1 
ATOM   627  C  CZ3 . TRP A 1 82  ? 46.149 38.658 53.093 1.00 49.13  ? 124 TRP A CZ3 1 
ATOM   628  C  CH2 . TRP A 1 82  ? 45.918 37.296 52.834 1.00 48.37  ? 124 TRP A CH2 1 
ATOM   629  N  N   . PHE A 1 83  ? 48.436 40.993 46.720 1.00 48.14  ? 125 PHE A N   1 
ATOM   630  C  CA  . PHE A 1 83  ? 48.178 40.425 45.399 1.00 50.16  ? 125 PHE A CA  1 
ATOM   631  C  C   . PHE A 1 83  ? 48.224 38.927 45.605 1.00 49.76  ? 125 PHE A C   1 
ATOM   632  O  O   . PHE A 1 83  ? 49.169 38.407 46.205 1.00 50.95  ? 125 PHE A O   1 
ATOM   633  C  CB  . PHE A 1 83  ? 49.256 40.839 44.392 1.00 55.03  ? 125 PHE A CB  1 
ATOM   634  C  CG  . PHE A 1 83  ? 49.146 42.266 43.934 1.00 59.55  ? 125 PHE A CG  1 
ATOM   635  C  CD1 . PHE A 1 83  ? 49.644 43.304 44.715 1.00 63.47  ? 125 PHE A CD1 1 
ATOM   636  C  CD2 . PHE A 1 83  ? 48.531 42.573 42.722 1.00 61.31  ? 125 PHE A CD2 1 
ATOM   637  C  CE1 . PHE A 1 83  ? 49.531 44.630 44.294 1.00 63.44  ? 125 PHE A CE1 1 
ATOM   638  C  CE2 . PHE A 1 83  ? 48.413 43.890 42.295 1.00 62.19  ? 125 PHE A CE2 1 
ATOM   639  C  CZ  . PHE A 1 83  ? 48.914 44.921 43.083 1.00 63.32  ? 125 PHE A CZ  1 
ATOM   640  N  N   . CYS A 1 84  ? 47.222 38.220 45.115 1.00 48.80  ? 126 CYS A N   1 
ATOM   641  C  CA  . CYS A 1 84  ? 47.213 36.786 45.336 1.00 52.72  ? 126 CYS A CA  1 
ATOM   642  C  C   . CYS A 1 84  ? 48.366 36.022 44.683 1.00 54.55  ? 126 CYS A C   1 
ATOM   643  O  O   . CYS A 1 84  ? 48.524 34.825 44.921 1.00 51.99  ? 126 CYS A O   1 
ATOM   644  C  CB  . CYS A 1 84  ? 45.890 36.191 44.892 1.00 52.92  ? 126 CYS A CB  1 
ATOM   645  S  SG  . CYS A 1 84  ? 44.380 36.942 45.597 1.00 52.71  ? 126 CYS A SG  1 
ATOM   646  N  N   . ASP A 1 85  ? 49.170 36.704 43.871 1.00 57.79  ? 127 ASP A N   1 
ATOM   647  C  CA  . ASP A 1 85  ? 50.318 36.057 43.232 1.00 61.45  ? 127 ASP A CA  1 
ATOM   648  C  C   . ASP A 1 85  ? 51.352 35.716 44.298 1.00 61.46  ? 127 ASP A C   1 
ATOM   649  O  O   . ASP A 1 85  ? 52.245 34.901 44.080 1.00 61.73  ? 127 ASP A O   1 
ATOM   650  C  CB  . ASP A 1 85  ? 50.960 36.979 42.193 1.00 66.62  ? 127 ASP A CB  1 
ATOM   651  C  CG  . ASP A 1 85  ? 49.978 37.436 41.137 1.00 71.88  ? 127 ASP A CG  1 
ATOM   652  O  OD1 . ASP A 1 85  ? 49.110 36.621 40.741 1.00 74.26  ? 127 ASP A OD1 1 
ATOM   653  O  OD2 . ASP A 1 85  ? 50.082 38.603 40.698 1.00 72.62  ? 127 ASP A OD2 1 
ATOM   654  N  N   . GLU A 1 86  ? 51.235 36.363 45.448 1.00 61.06  ? 128 GLU A N   1 
ATOM   655  C  CA  . GLU A 1 86  ? 52.142 36.115 46.556 1.00 62.52  ? 128 GLU A CA  1 
ATOM   656  C  C   . GLU A 1 86  ? 51.685 34.841 47.250 1.00 61.45  ? 128 GLU A C   1 
ATOM   657  O  O   . GLU A 1 86  ? 52.453 34.203 47.972 1.00 62.21  ? 128 GLU A O   1 
ATOM   658  C  CB  . GLU A 1 86  ? 52.092 37.271 47.547 1.00 65.62  ? 128 GLU A CB  1 
ATOM   659  C  CG  . GLU A 1 86  ? 52.529 38.601 46.977 1.00 69.33  ? 128 GLU A CG  1 
ATOM   660  C  CD  . GLU A 1 86  ? 52.241 39.737 47.935 1.00 71.26  ? 128 GLU A CD  1 
ATOM   661  O  OE1 . GLU A 1 86  ? 52.417 39.529 49.158 1.00 70.67  ? 128 GLU A OE1 1 
ATOM   662  O  OE2 . GLU A 1 86  ? 51.848 40.830 47.466 1.00 71.79  ? 128 GLU A OE2 1 
ATOM   663  N  N   . GLY A 1 87  ? 50.423 34.487 47.031 1.00 58.88  ? 129 GLY A N   1 
ATOM   664  C  CA  . GLY A 1 87  ? 49.873 33.285 47.630 1.00 56.78  ? 129 GLY A CA  1 
ATOM   665  C  C   . GLY A 1 87  ? 48.581 33.561 48.374 1.00 54.11  ? 129 GLY A C   1 
ATOM   666  O  O   . GLY A 1 87  ? 48.206 34.712 48.567 1.00 53.27  ? 129 GLY A O   1 
ATOM   667  N  N   . THR A 1 88  ? 47.896 32.498 48.777 1.00 51.73  ? 130 THR A N   1 
ATOM   668  C  CA  . THR A 1 88  ? 46.645 32.616 49.518 1.00 49.00  ? 130 THR A CA  1 
ATOM   669  C  C   . THR A 1 88  ? 47.003 32.329 50.964 1.00 46.45  ? 130 THR A C   1 
ATOM   670  O  O   . THR A 1 88  ? 46.903 33.200 51.825 1.00 44.76  ? 130 THR A O   1 
ATOM   671  C  CB  . THR A 1 88  ? 45.600 31.584 49.027 1.00 51.67  ? 130 THR A CB  1 
ATOM   672  O  OG1 . THR A 1 88  ? 45.264 31.862 47.662 1.00 52.96  ? 130 THR A OG1 1 
ATOM   673  C  CG2 . THR A 1 88  ? 44.329 31.663 49.867 1.00 52.98  ? 130 THR A CG2 1 
ATOM   674  N  N   . CYS A 1 89  ? 47.447 31.103 51.215 1.00 44.18  ? 131 CYS A N   1 
ATOM   675  C  CA  . CYS A 1 89  ? 47.861 30.690 52.546 1.00 45.85  ? 131 CYS A CA  1 
ATOM   676  C  C   . CYS A 1 89  ? 49.168 29.905 52.459 1.00 47.16  ? 131 CYS A C   1 
ATOM   677  O  O   . CYS A 1 89  ? 49.455 29.259 51.455 1.00 43.40  ? 131 CYS A O   1 
ATOM   678  C  CB  . CYS A 1 89  ? 46.799 29.810 53.188 1.00 47.38  ? 131 CYS A CB  1 
ATOM   679  S  SG  . CYS A 1 89  ? 45.143 30.575 53.298 1.00 48.87  ? 131 CYS A SG  1 
ATOM   680  N  N   . THR A 1 90  ? 49.951 29.973 53.526 1.00 49.17  ? 132 THR A N   1 
ATOM   681  C  CA  . THR A 1 90  ? 51.217 29.267 53.589 1.00 49.73  ? 132 THR A CA  1 
ATOM   682  C  C   . THR A 1 90  ? 50.848 27.795 53.730 1.00 49.67  ? 132 THR A C   1 
ATOM   683  O  O   . THR A 1 90  ? 51.457 26.938 53.094 1.00 49.72  ? 132 THR A O   1 
ATOM   684  C  CB  . THR A 1 90  ? 52.035 29.737 54.802 1.00 51.73  ? 132 THR A CB  1 
ATOM   685  O  OG1 . THR A 1 90  ? 51.328 29.413 56.004 1.00 57.62  ? 132 THR A OG1 1 
ATOM   686  C  CG2 . THR A 1 90  ? 52.232 31.252 54.746 1.00 51.59  ? 132 THR A CG2 1 
ATOM   687  N  N   . ASP A 1 91  ? 49.845 27.500 54.560 1.00 45.61  ? 133 ASP A N   1 
ATOM   688  C  CA  . ASP A 1 91  ? 49.401 26.120 54.716 1.00 42.24  ? 133 ASP A CA  1 
ATOM   689  C  C   . ASP A 1 91  ? 48.421 25.857 53.569 1.00 42.99  ? 133 ASP A C   1 
ATOM   690  O  O   . ASP A 1 91  ? 48.197 26.738 52.744 1.00 41.90  ? 133 ASP A O   1 
ATOM   691  C  CB  . ASP A 1 91  ? 48.757 25.892 56.100 1.00 45.25  ? 133 ASP A CB  1 
ATOM   692  C  CG  . ASP A 1 91  ? 47.519 26.763 56.346 1.00 42.81  ? 133 ASP A CG  1 
ATOM   693  O  OD1 . ASP A 1 91  ? 47.495 27.934 55.914 1.00 43.56  ? 133 ASP A OD1 1 
ATOM   694  O  OD2 . ASP A 1 91  ? 46.575 26.268 56.996 1.00 44.35  ? 133 ASP A OD2 1 
ATOM   695  N  N   . LYS A 1 92  ? 47.857 24.659 53.494 1.00 43.01  ? 134 LYS A N   1 
ATOM   696  C  CA  . LYS A 1 92  ? 46.946 24.330 52.406 1.00 44.04  ? 134 LYS A CA  1 
ATOM   697  C  C   . LYS A 1 92  ? 45.542 24.886 52.643 1.00 43.02  ? 134 LYS A C   1 
ATOM   698  O  O   . LYS A 1 92  ? 44.853 24.482 53.579 1.00 45.02  ? 134 LYS A O   1 
ATOM   699  C  CB  . LYS A 1 92  ? 46.910 22.806 52.205 1.00 49.55  ? 134 LYS A CB  1 
ATOM   700  C  CG  . LYS A 1 92  ? 48.229 22.229 51.628 1.00 55.92  ? 134 LYS A CG  1 
ATOM   701  C  CD  . LYS A 1 92  ? 49.413 22.425 52.590 1.00 61.88  ? 134 LYS A CD  1 
ATOM   702  C  CE  . LYS A 1 92  ? 50.783 22.231 51.913 1.00 65.11  ? 134 LYS A CE  1 
ATOM   703  N  NZ  . LYS A 1 92  ? 51.275 23.459 51.198 1.00 63.31  ? 134 LYS A NZ  1 
ATOM   704  N  N   . ALA A 1 93  ? 45.125 25.807 51.785 1.00 39.28  ? 135 ALA A N   1 
ATOM   705  C  CA  . ALA A 1 93  ? 43.819 26.437 51.927 1.00 39.78  ? 135 ALA A CA  1 
ATOM   706  C  C   . ALA A 1 93  ? 42.689 25.504 51.519 1.00 40.13  ? 135 ALA A C   1 
ATOM   707  O  O   . ALA A 1 93  ? 42.841 24.702 50.601 1.00 39.90  ? 135 ALA A O   1 
ATOM   708  C  CB  . ALA A 1 93  ? 43.761 27.714 51.088 1.00 41.25  ? 135 ALA A CB  1 
ATOM   709  N  N   . ASN A 1 94  ? 41.562 25.619 52.210 1.00 33.83  ? 136 ASN A N   1 
ATOM   710  C  CA  . ASN A 1 94  ? 40.388 24.810 51.927 1.00 32.45  ? 136 ASN A CA  1 
ATOM   711  C  C   . ASN A 1 94  ? 39.328 25.727 51.325 1.00 32.52  ? 136 ASN A C   1 
ATOM   712  O  O   . ASN A 1 94  ? 38.851 26.644 51.995 1.00 30.00  ? 136 ASN A O   1 
ATOM   713  C  CB  . ASN A 1 94  ? 39.866 24.197 53.224 1.00 30.46  ? 136 ASN A CB  1 
ATOM   714  C  CG  . ASN A 1 94  ? 40.871 23.248 53.849 1.00 38.59  ? 136 ASN A CG  1 
ATOM   715  O  OD1 . ASN A 1 94  ? 41.252 22.262 53.233 1.00 37.99  ? 136 ASN A OD1 1 
ATOM   716  N  ND2 . ASN A 1 94  ? 41.322 23.555 55.062 1.00 36.57  ? 136 ASN A ND2 1 
ATOM   717  N  N   . ILE A 1 95  ? 38.973 25.495 50.071 1.00 28.71  ? 137 ILE A N   1 
ATOM   718  C  CA  . ILE A 1 95  ? 37.976 26.339 49.427 1.00 29.57  ? 137 ILE A CA  1 
ATOM   719  C  C   . ILE A 1 95  ? 36.607 26.039 50.042 1.00 26.35  ? 137 ILE A C   1 
ATOM   720  O  O   . ILE A 1 95  ? 36.246 24.890 50.289 1.00 26.13  ? 137 ILE A O   1 
ATOM   721  C  CB  . ILE A 1 95  ? 37.961 26.095 47.915 1.00 31.66  ? 137 ILE A CB  1 
ATOM   722  C  CG1 . ILE A 1 95  ? 37.126 27.166 47.212 1.00 32.31  ? 137 ILE A CG1 1 
ATOM   723  C  CG2 . ILE A 1 95  ? 37.429 24.686 47.632 1.00 36.27  ? 137 ILE A CG2 1 
ATOM   724  C  CD1 . ILE A 1 95  ? 37.319 27.143 45.660 1.00 37.61  ? 137 ILE A CD1 1 
ATOM   725  N  N   . LEU A 1 96  ? 35.867 27.096 50.326 1.00 22.85  ? 138 LEU A N   1 
ATOM   726  C  CA  . LEU A 1 96  ? 34.560 26.964 50.935 1.00 22.72  ? 138 LEU A CA  1 
ATOM   727  C  C   . LEU A 1 96  ? 33.446 27.443 50.025 1.00 23.72  ? 138 LEU A C   1 
ATOM   728  O  O   . LEU A 1 96  ? 32.311 26.943 50.101 1.00 25.41  ? 138 LEU A O   1 
ATOM   729  C  CB  . LEU A 1 96  ? 34.479 27.832 52.202 1.00 24.64  ? 138 LEU A CB  1 
ATOM   730  C  CG  . LEU A 1 96  ? 35.597 27.647 53.246 1.00 27.55  ? 138 LEU A CG  1 
ATOM   731  C  CD1 . LEU A 1 96  ? 35.482 28.681 54.361 1.00 29.47  ? 138 LEU A CD1 1 
ATOM   732  C  CD2 . LEU A 1 96  ? 35.485 26.234 53.805 1.00 30.52  ? 138 LEU A CD2 1 
ATOM   733  N  N   . TYR A 1 97  ? 33.780 28.394 49.165 1.00 24.81  ? 139 TYR A N   1 
ATOM   734  C  CA  . TYR A 1 97  ? 32.755 29.059 48.377 1.00 28.46  ? 139 TYR A CA  1 
ATOM   735  C  C   . TYR A 1 97  ? 33.331 29.748 47.170 1.00 27.82  ? 139 TYR A C   1 
ATOM   736  O  O   . TYR A 1 97  ? 34.448 30.259 47.209 1.00 28.04  ? 139 TYR A O   1 
ATOM   737  C  CB  . TYR A 1 97  ? 32.095 30.097 49.307 1.00 26.09  ? 139 TYR A CB  1 
ATOM   738  C  CG  . TYR A 1 97  ? 31.029 30.989 48.678 1.00 27.53  ? 139 TYR A CG  1 
ATOM   739  C  CD1 . TYR A 1 97  ? 29.729 30.527 48.499 1.00 31.28  ? 139 TYR A CD1 1 
ATOM   740  C  CD2 . TYR A 1 97  ? 31.327 32.300 48.287 1.00 28.61  ? 139 TYR A CD2 1 
ATOM   741  C  CE1 . TYR A 1 97  ? 28.736 31.350 47.948 1.00 32.24  ? 139 TYR A CE1 1 
ATOM   742  C  CE2 . TYR A 1 97  ? 30.336 33.137 47.731 1.00 31.43  ? 139 TYR A CE2 1 
ATOM   743  C  CZ  . TYR A 1 97  ? 29.049 32.646 47.574 1.00 32.54  ? 139 TYR A CZ  1 
ATOM   744  O  OH  . TYR A 1 97  ? 28.056 33.457 47.073 1.00 36.40  ? 139 TYR A OH  1 
ATOM   745  N  N   . ALA A 1 98  ? 32.564 29.769 46.085 1.00 24.34  ? 140 ALA A N   1 
ATOM   746  C  CA  . ALA A 1 98  ? 33.029 30.433 44.878 1.00 26.79  ? 140 ALA A CA  1 
ATOM   747  C  C   . ALA A 1 98  ? 31.846 31.214 44.340 1.00 31.87  ? 140 ALA A C   1 
ATOM   748  O  O   . ALA A 1 98  ? 30.712 30.738 44.361 1.00 32.12  ? 140 ALA A O   1 
ATOM   749  C  CB  . ALA A 1 98  ? 33.483 29.397 43.845 1.00 27.88  ? 140 ALA A CB  1 
ATOM   750  N  N   . TRP A 1 99  ? 32.112 32.430 43.895 1.00 31.28  ? 141 TRP A N   1 
ATOM   751  C  CA  . TRP A 1 99  ? 31.075 33.250 43.306 1.00 34.52  ? 141 TRP A CA  1 
ATOM   752  C  C   . TRP A 1 99  ? 31.616 33.577 41.939 1.00 34.21  ? 141 TRP A C   1 
ATOM   753  O  O   . TRP A 1 99  ? 32.713 34.100 41.823 1.00 36.32  ? 141 TRP A O   1 
ATOM   754  C  CB  . TRP A 1 99  ? 30.868 34.545 44.073 1.00 36.33  ? 141 TRP A CB  1 
ATOM   755  C  CG  . TRP A 1 99  ? 29.718 35.349 43.506 1.00 37.83  ? 141 TRP A CG  1 
ATOM   756  C  CD1 . TRP A 1 99  ? 28.384 35.160 43.741 1.00 42.12  ? 141 TRP A CD1 1 
ATOM   757  C  CD2 . TRP A 1 99  ? 29.815 36.446 42.595 1.00 40.01  ? 141 TRP A CD2 1 
ATOM   758  N  NE1 . TRP A 1 99  ? 27.639 36.082 43.028 1.00 40.30  ? 141 TRP A NE1 1 
ATOM   759  C  CE2 . TRP A 1 99  ? 28.495 36.882 42.316 1.00 43.53  ? 141 TRP A CE2 1 
ATOM   760  C  CE3 . TRP A 1 99  ? 30.892 37.104 41.978 1.00 42.96  ? 141 TRP A CE3 1 
ATOM   761  C  CZ2 . TRP A 1 99  ? 28.222 37.952 41.448 1.00 43.56  ? 141 TRP A CZ2 1 
ATOM   762  C  CZ3 . TRP A 1 99  ? 30.620 38.171 41.109 1.00 46.93  ? 141 TRP A CZ3 1 
ATOM   763  C  CH2 . TRP A 1 99  ? 29.290 38.581 40.857 1.00 46.18  ? 141 TRP A CH2 1 
ATOM   764  N  N   . ALA A 1 100 ? 30.873 33.235 40.902 1.00 38.09  ? 142 ALA A N   1 
ATOM   765  C  CA  . ALA A 1 100 ? 31.344 33.526 39.562 1.00 42.26  ? 142 ALA A CA  1 
ATOM   766  C  C   . ALA A 1 100 ? 30.325 34.408 38.866 1.00 43.96  ? 142 ALA A C   1 
ATOM   767  O  O   . ALA A 1 100 ? 29.117 34.161 38.934 1.00 42.48  ? 142 ALA A O   1 
ATOM   768  C  CB  . ALA A 1 100 ? 31.567 32.226 38.781 1.00 41.30  ? 142 ALA A CB  1 
ATOM   769  N  N   . ARG A 1 101 ? 30.816 35.471 38.239 1.00 45.63  ? 143 ARG A N   1 
ATOM   770  C  CA  . ARG A 1 101 ? 29.944 36.390 37.525 1.00 50.38  ? 143 ARG A CA  1 
ATOM   771  C  C   . ARG A 1 101 ? 29.232 35.578 36.429 1.00 48.70  ? 143 ARG A C   1 
ATOM   772  O  O   . ARG A 1 101 ? 29.876 34.828 35.687 1.00 48.05  ? 143 ARG A O   1 
ATOM   773  C  CB  . ARG A 1 101 ? 30.787 37.521 36.904 1.00 53.18  ? 143 ARG A CB  1 
ATOM   774  C  CG  . ARG A 1 101 ? 29.985 38.660 36.272 1.00 61.29  ? 143 ARG A CG  1 
ATOM   775  C  CD  . ARG A 1 101 ? 30.789 39.376 35.162 1.00 66.25  ? 143 ARG A CD  1 
ATOM   776  N  NE  . ARG A 1 101 ? 31.897 40.195 35.661 1.00 73.40  ? 143 ARG A NE  1 
ATOM   777  C  CZ  . ARG A 1 101 ? 32.942 40.584 34.923 1.00 75.44  ? 143 ARG A CZ  1 
ATOM   778  N  NH1 . ARG A 1 101 ? 33.033 40.223 33.647 1.00 75.83  ? 143 ARG A NH1 1 
ATOM   779  N  NH2 . ARG A 1 101 ? 33.891 41.353 35.453 1.00 75.16  ? 143 ARG A NH2 1 
ATOM   780  N  N   . ASN A 1 102 ? 27.907 35.693 36.368 1.00 47.99  ? 144 ASN A N   1 
ATOM   781  C  CA  . ASN A 1 102 ? 27.090 35.013 35.349 1.00 51.51  ? 144 ASN A CA  1 
ATOM   782  C  C   . ASN A 1 102 ? 26.698 33.549 35.538 1.00 51.58  ? 144 ASN A C   1 
ATOM   783  O  O   . ASN A 1 102 ? 26.252 32.894 34.594 1.00 50.70  ? 144 ASN A O   1 
ATOM   784  C  CB  . ASN A 1 102 ? 27.724 35.193 33.964 1.00 56.17  ? 144 ASN A CB  1 
ATOM   785  C  CG  . ASN A 1 102 ? 27.888 36.655 33.599 1.00 59.36  ? 144 ASN A CG  1 
ATOM   786  O  OD1 . ASN A 1 102 ? 26.927 37.424 33.650 1.00 61.37  ? 144 ASN A OD1 1 
ATOM   787  N  ND2 . ASN A 1 102 ? 29.109 37.051 33.247 1.00 61.06  ? 144 ASN A ND2 1 
ATOM   788  N  N   . ALA A 1 103 ? 26.862 33.035 36.751 1.00 49.65  ? 145 ALA A N   1 
ATOM   789  C  CA  . ALA A 1 103 ? 26.469 31.666 37.073 1.00 48.63  ? 145 ALA A CA  1 
ATOM   790  C  C   . ALA A 1 103 ? 26.266 31.728 38.580 1.00 49.89  ? 145 ALA A C   1 
ATOM   791  O  O   . ALA A 1 103 ? 27.184 31.448 39.353 1.00 48.75  ? 145 ALA A O   1 
ATOM   792  C  CB  . ALA A 1 103 ? 27.575 30.693 36.712 1.00 48.95  ? 145 ALA A CB  1 
ATOM   793  N  N   . PRO A 1 104 ? 25.057 32.125 39.014 1.00 50.38  ? 146 PRO A N   1 
ATOM   794  C  CA  . PRO A 1 104 ? 24.674 32.263 40.425 1.00 48.92  ? 146 PRO A CA  1 
ATOM   795  C  C   . PRO A 1 104 ? 24.959 31.042 41.306 1.00 47.78  ? 146 PRO A C   1 
ATOM   796  O  O   . PRO A 1 104 ? 24.696 29.901 40.922 1.00 46.17  ? 146 PRO A O   1 
ATOM   797  C  CB  . PRO A 1 104 ? 23.176 32.593 40.346 1.00 52.07  ? 146 PRO A CB  1 
ATOM   798  C  CG  . PRO A 1 104 ? 23.058 33.325 39.020 1.00 51.99  ? 146 PRO A CG  1 
ATOM   799  C  CD  . PRO A 1 104 ? 23.918 32.450 38.129 1.00 51.62  ? 146 PRO A CD  1 
ATOM   800  N  N   . PRO A 1 105 ? 25.507 31.274 42.509 1.00 45.82  ? 147 PRO A N   1 
ATOM   801  C  CA  . PRO A 1 105 ? 25.797 30.139 43.390 1.00 44.86  ? 147 PRO A CA  1 
ATOM   802  C  C   . PRO A 1 105 ? 24.547 29.420 43.886 1.00 43.56  ? 147 PRO A C   1 
ATOM   803  O  O   . PRO A 1 105 ? 23.434 29.950 43.828 1.00 41.06  ? 147 PRO A O   1 
ATOM   804  C  CB  . PRO A 1 105 ? 26.605 30.775 44.527 1.00 45.27  ? 147 PRO A CB  1 
ATOM   805  C  CG  . PRO A 1 105 ? 26.100 32.201 44.559 1.00 50.41  ? 147 PRO A CG  1 
ATOM   806  C  CD  . PRO A 1 105 ? 25.987 32.541 43.091 1.00 49.23  ? 147 PRO A CD  1 
ATOM   807  N  N   . THR A 1 106 ? 24.746 28.191 44.343 1.00 40.08  ? 148 THR A N   1 
ATOM   808  C  CA  . THR A 1 106 ? 23.676 27.381 44.878 1.00 39.03  ? 148 THR A CA  1 
ATOM   809  C  C   . THR A 1 106 ? 23.903 27.304 46.390 1.00 41.58  ? 148 THR A C   1 
ATOM   810  O  O   . THR A 1 106 ? 25.036 27.183 46.864 1.00 37.98  ? 148 THR A O   1 
ATOM   811  C  CB  . THR A 1 106 ? 23.701 25.966 44.264 1.00 42.30  ? 148 THR A CB  1 
ATOM   812  O  OG1 . THR A 1 106 ? 23.464 26.069 42.851 1.00 41.00  ? 148 THR A OG1 1 
ATOM   813  C  CG2 . THR A 1 106 ? 22.613 25.069 44.894 1.00 42.50  ? 148 THR A CG2 1 
ATOM   814  N  N   . ARG A 1 107 ? 22.816 27.371 47.140 1.00 37.08  ? 149 ARG A N   1 
ATOM   815  C  CA  . ARG A 1 107 ? 22.868 27.336 48.589 1.00 38.98  ? 149 ARG A CA  1 
ATOM   816  C  C   . ARG A 1 107 ? 23.251 25.959 49.148 1.00 37.08  ? 149 ARG A C   1 
ATOM   817  O  O   . ARG A 1 107 ? 23.010 24.937 48.505 1.00 35.52  ? 149 ARG A O   1 
ATOM   818  C  CB  . ARG A 1 107 ? 21.479 27.733 49.091 1.00 45.19  ? 149 ARG A CB  1 
ATOM   819  C  CG  . ARG A 1 107 ? 21.345 28.065 50.542 1.00 55.31  ? 149 ARG A CG  1 
ATOM   820  C  CD  . ARG A 1 107 ? 19.862 28.276 50.842 1.00 59.71  ? 149 ARG A CD  1 
ATOM   821  N  NE  . ARG A 1 107 ? 19.618 28.736 52.206 1.00 67.13  ? 149 ARG A NE  1 
ATOM   822  C  CZ  . ARG A 1 107 ? 19.864 29.968 52.634 1.00 67.19  ? 149 ARG A CZ  1 
ATOM   823  N  NH1 . ARG A 1 107 ? 20.365 30.870 51.801 1.00 69.81  ? 149 ARG A NH1 1 
ATOM   824  N  NH2 . ARG A 1 107 ? 19.597 30.297 53.893 1.00 68.14  ? 149 ARG A NH2 1 
ATOM   825  N  N   . LEU A 1 108 ? 23.865 25.931 50.332 1.00 32.20  ? 150 LEU A N   1 
ATOM   826  C  CA  . LEU A 1 108 ? 24.163 24.654 50.991 1.00 32.61  ? 150 LEU A CA  1 
ATOM   827  C  C   . LEU A 1 108 ? 22.857 23.972 51.396 1.00 34.82  ? 150 LEU A C   1 
ATOM   828  O  O   . LEU A 1 108 ? 21.889 24.646 51.741 1.00 35.94  ? 150 LEU A O   1 
ATOM   829  C  CB  . LEU A 1 108 ? 24.902 24.870 52.294 1.00 31.86  ? 150 LEU A CB  1 
ATOM   830  C  CG  . LEU A 1 108 ? 26.378 25.218 52.235 1.00 32.09  ? 150 LEU A CG  1 
ATOM   831  C  CD1 . LEU A 1 108 ? 26.851 25.537 53.646 1.00 29.61  ? 150 LEU A CD1 1 
ATOM   832  C  CD2 . LEU A 1 108 ? 27.145 24.029 51.647 1.00 31.07  ? 150 LEU A CD2 1 
ATOM   833  N  N   . PRO A 1 109 ? 22.816 22.628 51.378 1.00 36.18  ? 151 PRO A N   1 
ATOM   834  C  CA  . PRO A 1 109 ? 21.590 21.929 51.786 1.00 36.99  ? 151 PRO A CA  1 
ATOM   835  C  C   . PRO A 1 109 ? 21.355 22.232 53.285 1.00 41.21  ? 151 PRO A C   1 
ATOM   836  O  O   . PRO A 1 109 ? 22.315 22.347 54.056 1.00 37.10  ? 151 PRO A O   1 
ATOM   837  C  CB  . PRO A 1 109 ? 21.939 20.457 51.542 1.00 36.18  ? 151 PRO A CB  1 
ATOM   838  C  CG  . PRO A 1 109 ? 22.936 20.506 50.428 1.00 35.79  ? 151 PRO A CG  1 
ATOM   839  C  CD  . PRO A 1 109 ? 23.805 21.686 50.826 1.00 32.03  ? 151 PRO A CD  1 
ATOM   840  N  N   . LYS A 1 110 ? 20.104 22.376 53.724 1.00 40.25  ? 152 LYS A N   1 
ATOM   841  C  CA  . LYS A 1 110 ? 19.890 22.671 55.138 1.00 40.39  ? 152 LYS A CA  1 
ATOM   842  C  C   . LYS A 1 110 ? 20.389 21.504 55.984 1.00 37.97  ? 152 LYS A C   1 
ATOM   843  O  O   . LYS A 1 110 ? 20.211 20.344 55.619 1.00 37.80  ? 152 LYS A O   1 
ATOM   844  C  CB  . LYS A 1 110 ? 18.413 22.932 55.456 1.00 46.41  ? 152 LYS A CB  1 
ATOM   845  C  CG  . LYS A 1 110 ? 18.214 23.467 56.875 1.00 49.50  ? 152 LYS A CG  1 
ATOM   846  C  CD  . LYS A 1 110 ? 16.749 23.718 57.194 1.00 55.48  ? 152 LYS A CD  1 
ATOM   847  C  CE  . LYS A 1 110 ? 16.571 24.223 58.616 1.00 55.66  ? 152 LYS A CE  1 
ATOM   848  N  NZ  . LYS A 1 110 ? 15.136 24.135 59.033 1.00 58.98  ? 152 LYS A NZ  1 
ATOM   849  N  N   . GLY A 1 111 ? 21.015 21.822 57.115 1.00 33.55  ? 153 GLY A N   1 
ATOM   850  C  CA  . GLY A 1 111 ? 21.564 20.792 57.979 1.00 30.17  ? 153 GLY A CA  1 
ATOM   851  C  C   . GLY A 1 111 ? 23.027 20.487 57.653 1.00 26.95  ? 153 GLY A C   1 
ATOM   852  O  O   . GLY A 1 111 ? 23.674 19.676 58.331 1.00 27.85  ? 153 GLY A O   1 
ATOM   853  N  N   . VAL A 1 112 ? 23.556 21.128 56.619 1.00 27.09  ? 154 VAL A N   1 
ATOM   854  C  CA  . VAL A 1 112 ? 24.953 20.914 56.228 1.00 25.82  ? 154 VAL A CA  1 
ATOM   855  C  C   . VAL A 1 112 ? 25.788 22.151 56.567 1.00 27.23  ? 154 VAL A C   1 
ATOM   856  O  O   . VAL A 1 112 ? 25.377 23.278 56.294 1.00 27.15  ? 154 VAL A O   1 
ATOM   857  C  CB  . VAL A 1 112 ? 25.083 20.692 54.701 1.00 28.74  ? 154 VAL A CB  1 
ATOM   858  C  CG1 . VAL A 1 112 ? 26.563 20.613 54.301 1.00 25.96  ? 154 VAL A CG1 1 
ATOM   859  C  CG2 . VAL A 1 112 ? 24.352 19.440 54.293 1.00 28.70  ? 154 VAL A CG2 1 
ATOM   860  N  N   . GLY A 1 113 ? 26.961 21.955 57.158 1.00 26.86  ? 155 GLY A N   1 
ATOM   861  C  CA  . GLY A 1 113 ? 27.791 23.117 57.431 1.00 26.16  ? 155 GLY A CA  1 
ATOM   862  C  C   . GLY A 1 113 ? 29.263 22.756 57.392 1.00 24.84  ? 155 GLY A C   1 
ATOM   863  O  O   . GLY A 1 113 ? 29.599 21.591 57.535 1.00 25.76  ? 155 GLY A O   1 
ATOM   864  N  N   . PHE A 1 114 ? 30.129 23.741 57.163 1.00 24.07  ? 156 PHE A N   1 
ATOM   865  C  CA  . PHE A 1 114 ? 31.565 23.492 57.181 1.00 26.81  ? 156 PHE A CA  1 
ATOM   866  C  C   . PHE A 1 114 ? 32.009 23.732 58.618 1.00 29.70  ? 156 PHE A C   1 
ATOM   867  O  O   . PHE A 1 114 ? 31.568 24.704 59.243 1.00 29.26  ? 156 PHE A O   1 
ATOM   868  C  CB  . PHE A 1 114 ? 32.309 24.498 56.319 1.00 25.82  ? 156 PHE A CB  1 
ATOM   869  C  CG  . PHE A 1 114 ? 32.188 24.255 54.849 1.00 29.40  ? 156 PHE A CG  1 
ATOM   870  C  CD1 . PHE A 1 114 ? 33.053 23.368 54.197 1.00 25.30  ? 156 PHE A CD1 1 
ATOM   871  C  CD2 . PHE A 1 114 ? 31.235 24.941 54.111 1.00 25.38  ? 156 PHE A CD2 1 
ATOM   872  C  CE1 . PHE A 1 114 ? 32.963 23.181 52.830 1.00 33.74  ? 156 PHE A CE1 1 
ATOM   873  C  CE2 . PHE A 1 114 ? 31.142 24.762 52.743 1.00 28.97  ? 156 PHE A CE2 1 
ATOM   874  C  CZ  . PHE A 1 114 ? 32.009 23.879 52.097 1.00 29.30  ? 156 PHE A CZ  1 
ATOM   875  N  N   . ARG A 1 115 ? 32.877 22.882 59.157 1.00 28.98  ? 157 ARG A N   1 
ATOM   876  C  CA  . ARG A 1 115 ? 33.325 23.149 60.517 1.00 32.13  ? 157 ARG A CA  1 
ATOM   877  C  C   . ARG A 1 115 ? 34.587 23.995 60.441 1.00 30.30  ? 157 ARG A C   1 
ATOM   878  O  O   . ARG A 1 115 ? 35.454 23.777 59.585 1.00 29.68  ? 157 ARG A O   1 
ATOM   879  C  CB  . ARG A 1 115 ? 33.543 21.857 61.312 1.00 37.28  ? 157 ARG A CB  1 
ATOM   880  C  CG  . ARG A 1 115 ? 34.327 20.795 60.637 1.00 47.54  ? 157 ARG A CG  1 
ATOM   881  C  CD  . ARG A 1 115 ? 34.135 19.462 61.371 1.00 54.15  ? 157 ARG A CD  1 
ATOM   882  N  NE  . ARG A 1 115 ? 34.442 19.549 62.799 1.00 59.36  ? 157 ARG A NE  1 
ATOM   883  C  CZ  . ARG A 1 115 ? 34.558 18.487 63.591 1.00 64.49  ? 157 ARG A CZ  1 
ATOM   884  N  NH1 . ARG A 1 115 ? 34.393 17.271 63.084 1.00 66.42  ? 157 ARG A NH1 1 
ATOM   885  N  NH2 . ARG A 1 115 ? 34.843 18.630 64.882 1.00 63.39  ? 157 ARG A NH2 1 
ATOM   886  N  N   . VAL A 1 116 ? 34.642 25.011 61.291 1.00 29.53  ? 158 VAL A N   1 
ATOM   887  C  CA  . VAL A 1 116 ? 35.785 25.914 61.328 1.00 27.43  ? 158 VAL A CA  1 
ATOM   888  C  C   . VAL A 1 116 ? 36.178 26.197 62.787 1.00 29.11  ? 158 VAL A C   1 
ATOM   889  O  O   . VAL A 1 116 ? 35.481 25.783 63.717 1.00 28.06  ? 158 VAL A O   1 
ATOM   890  C  CB  . VAL A 1 116 ? 35.467 27.255 60.647 1.00 30.45  ? 158 VAL A CB  1 
ATOM   891  C  CG1 . VAL A 1 116 ? 35.263 27.056 59.146 1.00 32.93  ? 158 VAL A CG1 1 
ATOM   892  C  CG2 . VAL A 1 116 ? 34.217 27.890 61.297 1.00 29.33  ? 158 VAL A CG2 1 
ATOM   893  N  N   . GLY A 1 117 ? 37.293 26.899 62.972 1.00 28.97  ? 159 GLY A N   1 
ATOM   894  C  CA  . GLY A 1 117 ? 37.741 27.239 64.312 1.00 30.60  ? 159 GLY A CA  1 
ATOM   895  C  C   . GLY A 1 117 ? 37.988 26.039 65.205 1.00 33.48  ? 159 GLY A C   1 
ATOM   896  O  O   . GLY A 1 117 ? 38.101 24.896 64.744 1.00 35.17  ? 159 GLY A O   1 
ATOM   897  N  N   . GLY A 1 118 ? 38.059 26.295 66.506 1.00 35.64  ? 160 GLY A N   1 
ATOM   898  C  CA  . GLY A 1 118 ? 38.286 25.210 67.440 1.00 38.64  ? 160 GLY A CA  1 
ATOM   899  C  C   . GLY A 1 118 ? 39.719 24.740 67.349 1.00 38.98  ? 160 GLY A C   1 
ATOM   900  O  O   . GLY A 1 118 ? 40.591 25.478 66.871 1.00 36.31  ? 160 GLY A O   1 
ATOM   901  N  N   . GLU A 1 119 ? 39.960 23.505 67.780 1.00 42.91  ? 161 GLU A N   1 
ATOM   902  C  CA  . GLU A 1 119 ? 41.311 22.941 67.776 1.00 46.17  ? 161 GLU A CA  1 
ATOM   903  C  C   . GLU A 1 119 ? 41.850 22.543 66.413 1.00 45.57  ? 161 GLU A C   1 
ATOM   904  O  O   . GLU A 1 119 ? 43.040 22.675 66.154 1.00 46.42  ? 161 GLU A O   1 
ATOM   905  C  CB  . GLU A 1 119 ? 41.369 21.712 68.696 1.00 50.69  ? 161 GLU A CB  1 
ATOM   906  C  CG  . GLU A 1 119 ? 40.996 21.997 70.149 1.00 63.18  ? 161 GLU A CG  1 
ATOM   907  C  CD  . GLU A 1 119 ? 41.191 20.790 71.062 1.00 68.30  ? 161 GLU A CD  1 
ATOM   908  O  OE1 . GLU A 1 119 ? 40.527 19.748 70.835 1.00 70.11  ? 161 GLU A OE1 1 
ATOM   909  O  OE2 . GLU A 1 119 ? 42.013 20.886 72.006 1.00 72.32  ? 161 GLU A OE2 1 
ATOM   910  N  N   . THR A 1 120 ? 40.989 22.045 65.534 1.00 40.76  ? 162 THR A N   1 
ATOM   911  C  CA  . THR A 1 120 ? 41.473 21.600 64.230 1.00 40.05  ? 162 THR A CA  1 
ATOM   912  C  C   . THR A 1 120 ? 40.865 22.307 63.010 1.00 39.08  ? 162 THR A C   1 
ATOM   913  O  O   . THR A 1 120 ? 41.274 22.035 61.891 1.00 40.84  ? 162 THR A O   1 
ATOM   914  C  CB  . THR A 1 120 ? 41.258 20.071 64.065 1.00 39.58  ? 162 THR A CB  1 
ATOM   915  O  OG1 . THR A 1 120 ? 39.848 19.782 64.009 1.00 39.12  ? 162 THR A OG1 1 
ATOM   916  C  CG2 . THR A 1 120 ? 41.861 19.313 65.276 1.00 42.93  ? 162 THR A CG2 1 
ATOM   917  N  N   . GLY A 1 121 ? 39.897 23.197 63.218 1.00 36.07  ? 163 GLY A N   1 
ATOM   918  C  CA  . GLY A 1 121 ? 39.294 23.882 62.079 1.00 33.13  ? 163 GLY A CA  1 
ATOM   919  C  C   . GLY A 1 121 ? 40.068 25.134 61.691 1.00 34.00  ? 163 GLY A C   1 
ATOM   920  O  O   . GLY A 1 121 ? 40.932 25.591 62.451 1.00 30.56  ? 163 GLY A O   1 
ATOM   921  N  N   . SER A 1 122 ? 39.773 25.688 60.517 1.00 30.59  ? 164 SER A N   1 
ATOM   922  C  CA  . SER A 1 122 ? 40.442 26.901 60.037 1.00 30.80  ? 164 SER A CA  1 
ATOM   923  C  C   . SER A 1 122 ? 40.293 28.028 61.025 1.00 31.68  ? 164 SER A C   1 
ATOM   924  O  O   . SER A 1 122 ? 39.213 28.225 61.578 1.00 30.77  ? 164 SER A O   1 
ATOM   925  C  CB  . SER A 1 122 ? 39.829 27.373 58.730 1.00 32.52  ? 164 SER A CB  1 
ATOM   926  O  OG  . SER A 1 122 ? 39.997 26.409 57.732 1.00 32.17  ? 164 SER A OG  1 
ATOM   927  N  N   . LYS A 1 123 ? 41.366 28.781 61.237 1.00 31.01  ? 165 LYS A N   1 
ATOM   928  C  CA  . LYS A 1 123 ? 41.315 29.914 62.165 1.00 32.46  ? 165 LYS A CA  1 
ATOM   929  C  C   . LYS A 1 123 ? 41.089 31.203 61.384 1.00 30.75  ? 165 LYS A C   1 
ATOM   930  O  O   . LYS A 1 123 ? 40.714 32.219 61.963 1.00 33.72  ? 165 LYS A O   1 
ATOM   931  C  CB  . LYS A 1 123 ? 42.621 30.042 62.972 1.00 34.95  ? 165 LYS A CB  1 
ATOM   932  C  CG  . LYS A 1 123 ? 42.990 28.796 63.788 1.00 41.55  ? 165 LYS A CG  1 
ATOM   933  C  CD  . LYS A 1 123 ? 41.827 28.284 64.663 1.00 46.62  ? 165 LYS A CD  1 
ATOM   934  C  CE  . LYS A 1 123 ? 41.746 29.000 66.001 1.00 49.58  ? 165 LYS A CE  1 
ATOM   935  N  NZ  . LYS A 1 123 ? 40.781 28.327 66.936 1.00 47.59  ? 165 LYS A NZ  1 
ATOM   936  N  N   . TYR A 1 124 ? 41.325 31.159 60.075 1.00 27.95  ? 166 TYR A N   1 
ATOM   937  C  CA  . TYR A 1 124 ? 41.135 32.332 59.211 1.00 26.21  ? 166 TYR A CA  1 
ATOM   938  C  C   . TYR A 1 124 ? 40.298 32.047 57.985 1.00 26.04  ? 166 TYR A C   1 
ATOM   939  O  O   . TYR A 1 124 ? 40.237 30.916 57.515 1.00 28.54  ? 166 TYR A O   1 
ATOM   940  C  CB  . TYR A 1 124 ? 42.458 32.838 58.633 1.00 29.82  ? 166 TYR A CB  1 
ATOM   941  C  CG  . TYR A 1 124 ? 43.414 33.434 59.635 1.00 33.03  ? 166 TYR A CG  1 
ATOM   942  C  CD1 . TYR A 1 124 ? 44.153 32.619 60.476 1.00 35.16  ? 166 TYR A CD1 1 
ATOM   943  C  CD2 . TYR A 1 124 ? 43.566 34.814 59.741 1.00 37.31  ? 166 TYR A CD2 1 
ATOM   944  C  CE1 . TYR A 1 124 ? 45.034 33.158 61.410 1.00 41.33  ? 166 TYR A CE1 1 
ATOM   945  C  CE2 . TYR A 1 124 ? 44.453 35.374 60.679 1.00 40.93  ? 166 TYR A CE2 1 
ATOM   946  C  CZ  . TYR A 1 124 ? 45.178 34.530 61.507 1.00 39.89  ? 166 TYR A CZ  1 
ATOM   947  O  OH  . TYR A 1 124 ? 46.037 35.039 62.450 1.00 48.48  ? 166 TYR A OH  1 
ATOM   948  N  N   . PHE A 1 125 ? 39.711 33.111 57.442 1.00 27.86  ? 167 PHE A N   1 
ATOM   949  C  CA  . PHE A 1 125 ? 38.993 33.068 56.188 1.00 27.86  ? 167 PHE A CA  1 
ATOM   950  C  C   . PHE A 1 125 ? 39.928 33.911 55.320 1.00 30.23  ? 167 PHE A C   1 
ATOM   951  O  O   . PHE A 1 125 ? 40.483 34.908 55.801 1.00 31.74  ? 167 PHE A O   1 
ATOM   952  C  CB  . PHE A 1 125 ? 37.650 33.824 56.247 1.00 27.04  ? 167 PHE A CB  1 
ATOM   953  C  CG  . PHE A 1 125 ? 36.547 33.048 56.904 1.00 28.64  ? 167 PHE A CG  1 
ATOM   954  C  CD1 . PHE A 1 125 ? 36.115 31.851 56.358 1.00 29.74  ? 167 PHE A CD1 1 
ATOM   955  C  CD2 . PHE A 1 125 ? 35.978 33.489 58.095 1.00 27.72  ? 167 PHE A CD2 1 
ATOM   956  C  CE1 . PHE A 1 125 ? 35.136 31.096 56.991 1.00 29.27  ? 167 PHE A CE1 1 
ATOM   957  C  CE2 . PHE A 1 125 ? 34.991 32.737 58.743 1.00 28.15  ? 167 PHE A CE2 1 
ATOM   958  C  CZ  . PHE A 1 125 ? 34.573 31.541 58.191 1.00 31.26  ? 167 PHE A CZ  1 
ATOM   959  N  N   . VAL A 1 126 ? 40.108 33.519 54.066 1.00 28.34  ? 168 VAL A N   1 
ATOM   960  C  CA  . VAL A 1 126 ? 40.915 34.302 53.132 1.00 29.05  ? 168 VAL A CA  1 
ATOM   961  C  C   . VAL A 1 126 ? 40.017 34.477 51.911 1.00 29.74  ? 168 VAL A C   1 
ATOM   962  O  O   . VAL A 1 126 ? 39.461 33.505 51.381 1.00 28.71  ? 168 VAL A O   1 
ATOM   963  C  CB  . VAL A 1 126 ? 42.236 33.589 52.729 1.00 32.08  ? 168 VAL A CB  1 
ATOM   964  C  CG1 . VAL A 1 126 ? 42.960 34.420 51.688 1.00 31.28  ? 168 VAL A CG1 1 
ATOM   965  C  CG2 . VAL A 1 126 ? 43.142 33.430 53.957 1.00 35.79  ? 168 VAL A CG2 1 
ATOM   966  N  N   . LEU A 1 127 ? 39.845 35.726 51.496 1.00 30.91  ? 169 LEU A N   1 
ATOM   967  C  CA  . LEU A 1 127 ? 38.984 36.075 50.374 1.00 29.41  ? 169 LEU A CA  1 
ATOM   968  C  C   . LEU A 1 127 ? 39.807 36.491 49.163 1.00 33.77  ? 169 LEU A C   1 
ATOM   969  O  O   . LEU A 1 127 ? 40.715 37.314 49.276 1.00 35.06  ? 169 LEU A O   1 
ATOM   970  C  CB  . LEU A 1 127 ? 38.077 37.252 50.759 1.00 27.77  ? 169 LEU A CB  1 
ATOM   971  C  CG  . LEU A 1 127 ? 37.266 37.920 49.627 1.00 33.73  ? 169 LEU A CG  1 
ATOM   972  C  CD1 . LEU A 1 127 ? 36.134 37.008 49.166 1.00 30.93  ? 169 LEU A CD1 1 
ATOM   973  C  CD2 . LEU A 1 127 ? 36.710 39.263 50.121 1.00 31.39  ? 169 LEU A CD2 1 
ATOM   974  N  N   . GLN A 1 128 ? 39.499 35.918 48.010 1.00 33.33  ? 170 GLN A N   1 
ATOM   975  C  CA  . GLN A 1 128 ? 40.198 36.297 46.780 1.00 37.17  ? 170 GLN A CA  1 
ATOM   976  C  C   . GLN A 1 128 ? 39.156 36.974 45.909 1.00 37.34  ? 170 GLN A C   1 
ATOM   977  O  O   . GLN A 1 128 ? 38.056 36.458 45.753 1.00 36.42  ? 170 GLN A O   1 
ATOM   978  C  CB  . GLN A 1 128 ? 40.741 35.067 46.061 1.00 37.92  ? 170 GLN A CB  1 
ATOM   979  C  CG  . GLN A 1 128 ? 41.192 35.344 44.648 1.00 45.62  ? 170 GLN A CG  1 
ATOM   980  C  CD  . GLN A 1 128 ? 41.649 34.083 43.938 1.00 47.77  ? 170 GLN A CD  1 
ATOM   981  O  OE1 . GLN A 1 128 ? 41.082 33.686 42.915 1.00 50.41  ? 170 GLN A OE1 1 
ATOM   982  N  NE2 . GLN A 1 128 ? 42.680 33.440 44.486 1.00 50.51  ? 170 GLN A NE2 1 
ATOM   983  N  N   . VAL A 1 129 ? 39.475 38.145 45.373 1.00 37.91  ? 171 VAL A N   1 
ATOM   984  C  CA  . VAL A 1 129 ? 38.532 38.844 44.511 1.00 41.04  ? 171 VAL A CA  1 
ATOM   985  C  C   . VAL A 1 129 ? 39.250 39.155 43.204 1.00 45.20  ? 171 VAL A C   1 
ATOM   986  O  O   . VAL A 1 129 ? 40.319 39.783 43.187 1.00 44.06  ? 171 VAL A O   1 
ATOM   987  C  CB  . VAL A 1 129 ? 38.007 40.159 45.140 1.00 42.63  ? 171 VAL A CB  1 
ATOM   988  C  CG1 . VAL A 1 129 ? 37.040 40.829 44.181 1.00 41.51  ? 171 VAL A CG1 1 
ATOM   989  C  CG2 . VAL A 1 129 ? 37.274 39.866 46.444 1.00 41.89  ? 171 VAL A CG2 1 
ATOM   990  N  N   . HIS A 1 130 ? 38.664 38.675 42.114 1.00 46.28  ? 172 HIS A N   1 
ATOM   991  C  CA  . HIS A 1 130 ? 39.234 38.873 40.790 1.00 48.13  ? 172 HIS A CA  1 
ATOM   992  C  C   . HIS A 1 130 ? 38.561 40.044 40.099 1.00 48.98  ? 172 HIS A C   1 
ATOM   993  O  O   . HIS A 1 130 ? 37.364 40.003 39.822 1.00 47.12  ? 172 HIS A O   1 
ATOM   994  C  CB  . HIS A 1 130 ? 39.051 37.612 39.948 1.00 48.82  ? 172 HIS A CB  1 
ATOM   995  C  CG  . HIS A 1 130 ? 39.613 37.718 38.564 1.00 54.07  ? 172 HIS A CG  1 
ATOM   996  N  ND1 . HIS A 1 130 ? 39.194 36.882 37.557 1.00 53.55  ? 172 HIS A ND1 1 
ATOM   997  C  CD2 . HIS A 1 130 ? 40.559 38.564 38.083 1.00 52.90  ? 172 HIS A CD2 1 
ATOM   998  C  CE1 . HIS A 1 130 ? 39.886 37.232 36.488 1.00 53.76  ? 172 HIS A CE1 1 
ATOM   999  N  NE2 . HIS A 1 130 ? 40.727 38.245 36.753 1.00 55.05  ? 172 HIS A NE2 1 
ATOM   1000 N  N   . TYR A 1 131 ? 39.333 41.097 39.843 1.00 50.98  ? 173 TYR A N   1 
ATOM   1001 C  CA  . TYR A 1 131 ? 38.804 42.265 39.155 1.00 54.30  ? 173 TYR A CA  1 
ATOM   1002 C  C   . TYR A 1 131 ? 39.120 42.154 37.674 1.00 57.18  ? 173 TYR A C   1 
ATOM   1003 O  O   . TYR A 1 131 ? 40.287 42.078 37.276 1.00 57.53  ? 173 TYR A O   1 
ATOM   1004 C  CB  . TYR A 1 131 ? 39.406 43.546 39.723 1.00 51.03  ? 173 TYR A CB  1 
ATOM   1005 C  CG  . TYR A 1 131 ? 38.963 43.816 41.133 1.00 50.83  ? 173 TYR A CG  1 
ATOM   1006 C  CD1 . TYR A 1 131 ? 39.760 43.439 42.220 1.00 50.42  ? 173 TYR A CD1 1 
ATOM   1007 C  CD2 . TYR A 1 131 ? 37.724 44.412 41.390 1.00 49.92  ? 173 TYR A CD2 1 
ATOM   1008 C  CE1 . TYR A 1 131 ? 39.337 43.647 43.525 1.00 49.15  ? 173 TYR A CE1 1 
ATOM   1009 C  CE2 . TYR A 1 131 ? 37.288 44.624 42.696 1.00 49.55  ? 173 TYR A CE2 1 
ATOM   1010 C  CZ  . TYR A 1 131 ? 38.105 44.235 43.756 1.00 48.32  ? 173 TYR A CZ  1 
ATOM   1011 O  OH  . TYR A 1 131 ? 37.693 44.426 45.044 1.00 48.81  ? 173 TYR A OH  1 
ATOM   1012 N  N   . GLY A 1 132 ? 38.073 42.126 36.860 1.00 61.60  ? 174 GLY A N   1 
ATOM   1013 C  CA  . GLY A 1 132 ? 38.267 42.018 35.427 1.00 68.71  ? 174 GLY A CA  1 
ATOM   1014 C  C   . GLY A 1 132 ? 38.344 43.372 34.747 1.00 72.43  ? 174 GLY A C   1 
ATOM   1015 O  O   . GLY A 1 132 ? 39.435 43.870 34.456 1.00 72.61  ? 174 GLY A O   1 
ATOM   1016 N  N   . ASP A 1 133 ? 37.176 43.964 34.511 1.00 76.30  ? 175 ASP A N   1 
ATOM   1017 C  CA  . ASP A 1 133 ? 37.063 45.259 33.850 1.00 81.10  ? 175 ASP A CA  1 
ATOM   1018 C  C   . ASP A 1 133 ? 37.305 46.425 34.800 1.00 83.05  ? 175 ASP A C   1 
ATOM   1019 O  O   . ASP A 1 133 ? 36.371 46.935 35.424 1.00 83.41  ? 175 ASP A O   1 
ATOM   1020 C  CB  . ASP A 1 133 ? 35.677 45.395 33.217 1.00 83.04  ? 175 ASP A CB  1 
ATOM   1021 C  CG  . ASP A 1 133 ? 35.463 46.749 32.580 1.00 85.44  ? 175 ASP A CG  1 
ATOM   1022 O  OD1 . ASP A 1 133 ? 36.295 47.135 31.731 1.00 86.26  ? 175 ASP A OD1 1 
ATOM   1023 O  OD2 . ASP A 1 133 ? 34.465 47.423 32.926 1.00 86.91  ? 175 ASP A OD2 1 
ATOM   1024 N  N   . ILE A 1 134 ? 38.557 46.858 34.886 1.00 84.86  ? 176 ILE A N   1 
ATOM   1025 C  CA  . ILE A 1 134 ? 38.930 47.956 35.770 1.00 87.15  ? 176 ILE A CA  1 
ATOM   1026 C  C   . ILE A 1 134 ? 38.558 49.329 35.227 1.00 88.38  ? 176 ILE A C   1 
ATOM   1027 O  O   . ILE A 1 134 ? 39.172 50.331 35.593 1.00 88.77  ? 176 ILE A O   1 
ATOM   1028 C  CB  . ILE A 1 134 ? 40.442 47.951 36.049 1.00 87.52  ? 176 ILE A CB  1 
ATOM   1029 C  CG1 . ILE A 1 134 ? 41.208 48.241 34.758 1.00 86.36  ? 176 ILE A CG1 1 
ATOM   1030 C  CG2 . ILE A 1 134 ? 40.857 46.602 36.631 1.00 87.36  ? 176 ILE A CG2 1 
ATOM   1031 C  CD1 . ILE A 1 134 ? 42.655 48.583 34.985 1.00 86.39  ? 176 ILE A CD1 1 
ATOM   1032 N  N   . SER A 1 135 ? 37.555 49.376 34.356 1.00 89.76  ? 177 SER A N   1 
ATOM   1033 C  CA  . SER A 1 135 ? 37.114 50.640 33.777 1.00 90.89  ? 177 SER A CA  1 
ATOM   1034 C  C   . SER A 1 135 ? 36.323 51.446 34.802 1.00 91.26  ? 177 SER A C   1 
ATOM   1035 O  O   . SER A 1 135 ? 36.525 52.651 34.950 1.00 91.46  ? 177 SER A O   1 
ATOM   1036 C  CB  . SER A 1 135 ? 36.251 50.388 32.537 1.00 91.05  ? 177 SER A CB  1 
ATOM   1037 O  OG  . SER A 1 135 ? 37.003 49.765 31.508 1.00 90.81  ? 177 SER A OG  1 
ATOM   1038 N  N   . ALA A 1 136 ? 35.430 50.768 35.516 1.00 91.04  ? 178 ALA A N   1 
ATOM   1039 C  CA  . ALA A 1 136 ? 34.608 51.416 36.527 1.00 90.89  ? 178 ALA A CA  1 
ATOM   1040 C  C   . ALA A 1 136 ? 35.459 52.128 37.574 1.00 91.47  ? 178 ALA A C   1 
ATOM   1041 O  O   . ALA A 1 136 ? 34.945 52.912 38.372 1.00 90.95  ? 178 ALA A O   1 
ATOM   1042 C  CB  . ALA A 1 136 ? 33.706 50.389 37.195 1.00 91.16  ? 178 ALA A CB  1 
ATOM   1043 N  N   . PHE A 1 137 ? 36.762 51.853 37.573 1.00 92.11  ? 179 PHE A N   1 
ATOM   1044 C  CA  . PHE A 1 137 ? 37.662 52.484 38.531 1.00 92.94  ? 179 PHE A CA  1 
ATOM   1045 C  C   . PHE A 1 137 ? 38.295 53.755 37.993 1.00 93.66  ? 179 PHE A C   1 
ATOM   1046 O  O   . PHE A 1 137 ? 39.409 54.121 38.374 1.00 92.77  ? 179 PHE A O   1 
ATOM   1047 C  CB  . PHE A 1 137 ? 38.755 51.512 38.990 1.00 93.11  ? 179 PHE A CB  1 
ATOM   1048 C  CG  . PHE A 1 137 ? 38.287 50.528 40.027 1.00 93.14  ? 179 PHE A CG  1 
ATOM   1049 C  CD1 . PHE A 1 137 ? 37.588 49.383 39.658 1.00 93.06  ? 179 PHE A CD1 1 
ATOM   1050 C  CD2 . PHE A 1 137 ? 38.501 50.775 41.379 1.00 93.49  ? 179 PHE A CD2 1 
ATOM   1051 C  CE1 . PHE A 1 137 ? 37.107 48.500 40.619 1.00 92.23  ? 179 PHE A CE1 1 
ATOM   1052 C  CE2 . PHE A 1 137 ? 38.021 49.897 42.349 1.00 93.62  ? 179 PHE A CE2 1 
ATOM   1053 C  CZ  . PHE A 1 137 ? 37.323 48.758 41.965 1.00 92.33  ? 179 PHE A CZ  1 
ATOM   1054 N  N   . ARG A 1 138 ? 37.583 54.420 37.091 1.00 94.92  ? 180 ARG A N   1 
ATOM   1055 C  CA  . ARG A 1 138 ? 38.062 55.676 36.541 1.00 95.89  ? 180 ARG A CA  1 
ATOM   1056 C  C   . ARG A 1 138 ? 37.904 56.676 37.683 1.00 95.14  ? 180 ARG A C   1 
ATOM   1057 O  O   . ARG A 1 138 ? 38.668 57.632 37.801 1.00 95.54  ? 180 ARG A O   1 
ATOM   1058 C  CB  . ARG A 1 138 ? 37.212 56.095 35.336 1.00 97.23  ? 180 ARG A CB  1 
ATOM   1059 C  CG  . ARG A 1 138 ? 37.506 55.318 34.056 1.00 99.43  ? 180 ARG A CG  1 
ATOM   1060 C  CD  . ARG A 1 138 ? 36.502 55.668 32.965 1.00 101.13 ? 180 ARG A CD  1 
ATOM   1061 N  NE  . ARG A 1 138 ? 35.152 55.228 33.315 1.00 103.42 ? 180 ARG A NE  1 
ATOM   1062 C  CZ  . ARG A 1 138 ? 34.570 54.130 32.838 1.00 104.52 ? 180 ARG A CZ  1 
ATOM   1063 N  NH1 . ARG A 1 138 ? 33.340 53.808 33.221 1.00 104.78 ? 180 ARG A NH1 1 
ATOM   1064 N  NH2 . ARG A 1 138 ? 35.210 53.362 31.964 1.00 105.31 ? 180 ARG A NH2 1 
ATOM   1065 N  N   . ASP A 1 139 ? 36.906 56.427 38.529 1.00 94.07  ? 181 ASP A N   1 
ATOM   1066 C  CA  . ASP A 1 139 ? 36.623 57.268 39.690 1.00 92.30  ? 181 ASP A CA  1 
ATOM   1067 C  C   . ASP A 1 139 ? 37.759 57.132 40.689 1.00 90.53  ? 181 ASP A C   1 
ATOM   1068 O  O   . ASP A 1 139 ? 37.890 57.934 41.614 1.00 89.50  ? 181 ASP A O   1 
ATOM   1069 C  CB  . ASP A 1 139 ? 35.337 56.815 40.378 1.00 93.76  ? 181 ASP A CB  1 
ATOM   1070 C  CG  . ASP A 1 139 ? 34.136 56.901 39.479 1.00 95.16  ? 181 ASP A CG  1 
ATOM   1071 O  OD1 . ASP A 1 139 ? 34.253 56.512 38.298 1.00 96.78  ? 181 ASP A OD1 1 
ATOM   1072 O  OD2 . ASP A 1 139 ? 33.072 57.346 39.959 1.00 95.76  ? 181 ASP A OD2 1 
ATOM   1073 N  N   . ASN A 1 140 ? 38.567 56.093 40.504 1.00 88.36  ? 182 ASN A N   1 
ATOM   1074 C  CA  . ASN A 1 140 ? 39.681 55.823 41.398 1.00 85.58  ? 182 ASN A CA  1 
ATOM   1075 C  C   . ASN A 1 140 ? 39.075 55.566 42.774 1.00 83.17  ? 182 ASN A C   1 
ATOM   1076 O  O   . ASN A 1 140 ? 39.733 55.711 43.802 1.00 82.64  ? 182 ASN A O   1 
ATOM   1077 C  CB  . ASN A 1 140 ? 40.631 57.025 41.441 1.00 86.00  ? 182 ASN A CB  1 
ATOM   1078 C  CG  . ASN A 1 140 ? 42.076 56.618 41.654 1.00 86.78  ? 182 ASN A CG  1 
ATOM   1079 O  OD1 . ASN A 1 140 ? 42.448 56.129 42.721 1.00 88.02  ? 182 ASN A OD1 1 
ATOM   1080 N  ND2 . ASN A 1 140 ? 42.899 56.811 40.629 1.00 86.36  ? 182 ASN A ND2 1 
ATOM   1081 N  N   . HIS A 1 141 ? 37.802 55.181 42.775 1.00 80.64  ? 183 HIS A N   1 
ATOM   1082 C  CA  . HIS A 1 141 ? 37.086 54.895 44.009 1.00 78.96  ? 183 HIS A CA  1 
ATOM   1083 C  C   . HIS A 1 141 ? 37.547 53.569 44.609 1.00 76.34  ? 183 HIS A C   1 
ATOM   1084 O  O   . HIS A 1 141 ? 38.194 52.762 43.943 1.00 75.05  ? 183 HIS A O   1 
ATOM   1085 C  CB  . HIS A 1 141 ? 35.574 54.860 43.753 1.00 80.38  ? 183 HIS A CB  1 
ATOM   1086 C  CG  . HIS A 1 141 ? 35.141 53.796 42.790 1.00 80.84  ? 183 HIS A CG  1 
ATOM   1087 N  ND1 . HIS A 1 141 ? 35.259 52.451 43.064 1.00 82.60  ? 183 HIS A ND1 1 
ATOM   1088 C  CD2 . HIS A 1 141 ? 34.571 53.881 41.565 1.00 81.04  ? 183 HIS A CD2 1 
ATOM   1089 C  CE1 . HIS A 1 141 ? 34.780 51.752 42.050 1.00 80.73  ? 183 HIS A CE1 1 
ATOM   1090 N  NE2 . HIS A 1 141 ? 34.356 52.597 41.127 1.00 81.35  ? 183 HIS A NE2 1 
ATOM   1091 N  N   . LYS A 1 142 ? 37.217 53.358 45.876 1.00 74.05  ? 184 LYS A N   1 
ATOM   1092 C  CA  . LYS A 1 142 ? 37.602 52.137 46.569 1.00 72.01  ? 184 LYS A CA  1 
ATOM   1093 C  C   . LYS A 1 142 ? 36.496 51.088 46.503 1.00 69.51  ? 184 LYS A C   1 
ATOM   1094 O  O   . LYS A 1 142 ? 35.306 51.413 46.604 1.00 69.26  ? 184 LYS A O   1 
ATOM   1095 C  CB  . LYS A 1 142 ? 37.932 52.449 48.030 1.00 72.50  ? 184 LYS A CB  1 
ATOM   1096 C  CG  . LYS A 1 142 ? 39.148 53.345 48.212 1.00 73.50  ? 184 LYS A CG  1 
ATOM   1097 C  CD  . LYS A 1 142 ? 39.371 53.666 49.679 1.00 76.15  ? 184 LYS A CD  1 
ATOM   1098 C  CE  . LYS A 1 142 ? 40.648 54.461 49.886 1.00 77.12  ? 184 LYS A CE  1 
ATOM   1099 N  NZ  . LYS A 1 142 ? 41.860 53.670 49.529 1.00 79.03  ? 184 LYS A NZ  1 
ATOM   1100 N  N   . ASP A 1 143 ? 36.893 49.831 46.322 1.00 64.94  ? 185 ASP A N   1 
ATOM   1101 C  CA  . ASP A 1 143 ? 35.928 48.737 46.255 1.00 60.25  ? 185 ASP A CA  1 
ATOM   1102 C  C   . ASP A 1 143 ? 35.943 47.914 47.541 1.00 55.58  ? 185 ASP A C   1 
ATOM   1103 O  O   . ASP A 1 143 ? 37.009 47.615 48.084 1.00 54.20  ? 185 ASP A O   1 
ATOM   1104 C  CB  . ASP A 1 143 ? 36.238 47.814 45.075 1.00 61.52  ? 185 ASP A CB  1 
ATOM   1105 C  CG  . ASP A 1 143 ? 35.190 46.728 44.901 1.00 63.35  ? 185 ASP A CG  1 
ATOM   1106 O  OD1 . ASP A 1 143 ? 34.056 47.059 44.496 1.00 62.91  ? 185 ASP A OD1 1 
ATOM   1107 O  OD2 . ASP A 1 143 ? 35.496 45.549 45.181 1.00 63.78  ? 185 ASP A OD2 1 
ATOM   1108 N  N   . CYS A 1 144 ? 34.756 47.564 48.028 1.00 50.75  ? 186 CYS A N   1 
ATOM   1109 C  CA  . CYS A 1 144 ? 34.635 46.759 49.234 1.00 49.93  ? 186 CYS A CA  1 
ATOM   1110 C  C   . CYS A 1 144 ? 33.840 45.467 48.976 1.00 44.67  ? 186 CYS A C   1 
ATOM   1111 O  O   . CYS A 1 144 ? 33.052 45.034 49.810 1.00 42.65  ? 186 CYS A O   1 
ATOM   1112 C  CB  . CYS A 1 144 ? 33.978 47.575 50.352 1.00 50.91  ? 186 CYS A CB  1 
ATOM   1113 S  SG  . CYS A 1 144 ? 35.016 48.968 50.924 1.00 60.77  ? 186 CYS A SG  1 
ATOM   1114 N  N   . SER A 1 145 ? 34.061 44.855 47.816 1.00 41.44  ? 187 SER A N   1 
ATOM   1115 C  CA  . SER A 1 145 ? 33.368 43.617 47.472 1.00 38.73  ? 187 SER A CA  1 
ATOM   1116 C  C   . SER A 1 145 ? 33.769 42.501 48.430 1.00 37.31  ? 187 SER A C   1 
ATOM   1117 O  O   . SER A 1 145 ? 34.889 42.484 48.953 1.00 34.47  ? 187 SER A O   1 
ATOM   1118 C  CB  . SER A 1 145 ? 33.712 43.191 46.046 1.00 40.00  ? 187 SER A CB  1 
ATOM   1119 O  OG  . SER A 1 145 ? 33.251 44.145 45.114 1.00 42.63  ? 187 SER A OG  1 
ATOM   1120 N  N   . GLY A 1 146 ? 32.862 41.562 48.644 1.00 34.62  ? 188 GLY A N   1 
ATOM   1121 C  CA  . GLY A 1 146 ? 33.175 40.467 49.525 1.00 36.83  ? 188 GLY A CA  1 
ATOM   1122 C  C   . GLY A 1 146 ? 32.025 39.499 49.670 1.00 36.96  ? 188 GLY A C   1 
ATOM   1123 O  O   . GLY A 1 146 ? 31.137 39.449 48.830 1.00 34.60  ? 188 GLY A O   1 
ATOM   1124 N  N   . VAL A 1 147 ? 32.043 38.758 50.773 1.00 34.19  ? 189 VAL A N   1 
ATOM   1125 C  CA  . VAL A 1 147 ? 31.044 37.746 51.048 1.00 35.38  ? 189 VAL A CA  1 
ATOM   1126 C  C   . VAL A 1 147 ? 30.711 37.742 52.528 1.00 35.36  ? 189 VAL A C   1 
ATOM   1127 O  O   . VAL A 1 147 ? 31.599 37.953 53.366 1.00 36.96  ? 189 VAL A O   1 
ATOM   1128 C  CB  . VAL A 1 147 ? 31.610 36.338 50.675 1.00 35.24  ? 189 VAL A CB  1 
ATOM   1129 C  CG1 . VAL A 1 147 ? 30.651 35.239 51.085 1.00 35.91  ? 189 VAL A CG1 1 
ATOM   1130 C  CG2 . VAL A 1 147 ? 31.889 36.269 49.169 1.00 36.56  ? 189 VAL A CG2 1 
ATOM   1131 N  N   A SER A 1 148 ? 29.438 37.523 52.845 1.00 32.52  ? 190 SER A N   1 
ATOM   1132 C  CA  A SER A 1 148 ? 28.993 37.443 54.232 0.60 34.58  ? 190 SER A CA  1 
ATOM   1133 C  CA  B SER A 1 148 ? 28.994 37.443 54.226 0.40 34.74  ? 190 SER A CA  1 
ATOM   1134 C  C   A SER A 1 148 ? 28.803 35.964 54.582 1.00 35.75  ? 190 SER A C   1 
ATOM   1135 O  O   A SER A 1 148 ? 28.249 35.199 53.790 1.00 36.69  ? 190 SER A O   1 
ATOM   1136 C  CB  A SER A 1 148 ? 27.657 38.172 54.425 0.60 36.84  ? 190 SER A CB  1 
ATOM   1137 C  CB  B SER A 1 148 ? 27.666 38.172 54.390 0.40 36.57  ? 190 SER A CB  1 
ATOM   1138 O  OG  A SER A 1 148 ? 27.808 39.580 54.324 0.60 35.67  ? 190 SER A OG  1 
ATOM   1139 O  OG  B SER A 1 148 ? 27.239 38.114 55.732 0.40 36.73  ? 190 SER A OG  1 
ATOM   1140 N  N   . VAL A 1 149 ? 29.274 35.543 55.754 1.00 32.02  ? 191 VAL A N   1 
ATOM   1141 C  CA  . VAL A 1 149 ? 29.080 34.150 56.135 1.00 30.71  ? 191 VAL A CA  1 
ATOM   1142 C  C   . VAL A 1 149 ? 28.258 34.067 57.406 1.00 31.04  ? 191 VAL A C   1 
ATOM   1143 O  O   . VAL A 1 149 ? 28.412 34.882 58.327 1.00 27.79  ? 191 VAL A O   1 
ATOM   1144 C  CB  . VAL A 1 149 ? 30.396 33.395 56.366 1.00 32.69  ? 191 VAL A CB  1 
ATOM   1145 C  CG1 . VAL A 1 149 ? 31.191 33.330 55.045 1.00 35.29  ? 191 VAL A CG1 1 
ATOM   1146 C  CG2 . VAL A 1 149 ? 31.204 34.087 57.438 1.00 33.28  ? 191 VAL A CG2 1 
ATOM   1147 N  N   . HIS A 1 150 ? 27.379 33.074 57.447 1.00 27.34  ? 192 HIS A N   1 
ATOM   1148 C  CA  . HIS A 1 150 ? 26.528 32.846 58.609 1.00 26.34  ? 192 HIS A CA  1 
ATOM   1149 C  C   . HIS A 1 150 ? 27.160 31.750 59.459 1.00 27.98  ? 192 HIS A C   1 
ATOM   1150 O  O   . HIS A 1 150 ? 27.246 30.593 59.039 1.00 29.88  ? 192 HIS A O   1 
ATOM   1151 C  CB  . HIS A 1 150 ? 25.125 32.447 58.110 1.00 31.09  ? 192 HIS A CB  1 
ATOM   1152 C  CG  . HIS A 1 150 ? 24.143 32.164 59.198 1.00 32.82  ? 192 HIS A CG  1 
ATOM   1153 N  ND1 . HIS A 1 150 ? 22.789 32.037 58.959 1.00 36.01  ? 192 HIS A ND1 1 
ATOM   1154 C  CD2 . HIS A 1 150 ? 24.313 31.970 60.526 1.00 31.21  ? 192 HIS A CD2 1 
ATOM   1155 C  CE1 . HIS A 1 150 ? 22.168 31.781 60.099 1.00 35.81  ? 192 HIS A CE1 1 
ATOM   1156 N  NE2 . HIS A 1 150 ? 23.069 31.737 61.064 1.00 37.96  ? 192 HIS A NE2 1 
ATOM   1157 N  N   A LEU A 1 151 ? 27.621 32.111 60.656 1.00 26.96  ? 193 LEU A N   1 
ATOM   1158 C  CA  A LEU A 1 151 ? 28.261 31.167 61.561 0.50 28.67  ? 193 LEU A CA  1 
ATOM   1159 C  CA  B LEU A 1 151 ? 28.256 31.153 61.537 0.50 27.60  ? 193 LEU A CA  1 
ATOM   1160 C  C   A LEU A 1 151 ? 27.354 30.782 62.707 1.00 30.42  ? 193 LEU A C   1 
ATOM   1161 O  O   A LEU A 1 151 ? 26.583 31.608 63.188 1.00 32.05  ? 193 LEU A O   1 
ATOM   1162 C  CB  A LEU A 1 151 ? 29.534 31.772 62.158 0.50 31.63  ? 193 LEU A CB  1 
ATOM   1163 C  CB  B LEU A 1 151 ? 29.584 31.726 62.055 0.50 28.93  ? 193 LEU A CB  1 
ATOM   1164 C  CG  A LEU A 1 151 ? 30.784 31.837 61.282 0.50 34.52  ? 193 LEU A CG  1 
ATOM   1165 C  CG  B LEU A 1 151 ? 30.745 31.824 61.046 0.50 28.08  ? 193 LEU A CG  1 
ATOM   1166 C  CD1 A LEU A 1 151 ? 31.257 30.436 60.974 0.50 36.20  ? 193 LEU A CD1 1 
ATOM   1167 C  CD1 B LEU A 1 151 ? 31.287 33.246 60.970 0.50 27.84  ? 193 LEU A CD1 1 
ATOM   1168 C  CD2 A LEU A 1 151 ? 30.487 32.582 60.029 0.50 33.89  ? 193 LEU A CD2 1 
ATOM   1169 C  CD2 B LEU A 1 151 ? 31.860 30.878 61.496 0.50 27.92  ? 193 LEU A CD2 1 
ATOM   1170 N  N   . THR A 1 152 ? 27.449 29.531 63.147 1.00 30.62  ? 194 THR A N   1 
ATOM   1171 C  CA  . THR A 1 152 ? 26.638 29.083 64.276 1.00 32.25  ? 194 THR A CA  1 
ATOM   1172 C  C   . THR A 1 152 ? 27.464 28.163 65.140 1.00 34.97  ? 194 THR A C   1 
ATOM   1173 O  O   . THR A 1 152 ? 28.398 27.489 64.660 1.00 31.79  ? 194 THR A O   1 
ATOM   1174 C  CB  . THR A 1 152 ? 25.337 28.311 63.843 1.00 34.29  ? 194 THR A CB  1 
ATOM   1175 O  OG1 . THR A 1 152 ? 24.601 27.927 65.020 1.00 33.20  ? 194 THR A OG1 1 
ATOM   1176 C  CG2 . THR A 1 152 ? 25.689 27.016 63.089 1.00 32.79  ? 194 THR A CG2 1 
ATOM   1177 N  N   . ARG A 1 153 ? 27.118 28.139 66.423 1.00 36.42  ? 195 ARG A N   1 
ATOM   1178 C  CA  . ARG A 1 153 ? 27.791 27.288 67.398 1.00 40.04  ? 195 ARG A CA  1 
ATOM   1179 C  C   . ARG A 1 153 ? 27.054 25.953 67.422 1.00 37.39  ? 195 ARG A C   1 
ATOM   1180 O  O   . ARG A 1 153 ? 27.568 24.952 67.906 1.00 37.10  ? 195 ARG A O   1 
ATOM   1181 C  CB  . ARG A 1 153 ? 27.717 27.923 68.805 1.00 47.56  ? 195 ARG A CB  1 
ATOM   1182 C  CG  . ARG A 1 153 ? 28.862 27.515 69.743 1.00 59.60  ? 195 ARG A CG  1 
ATOM   1183 C  CD  . ARG A 1 153 ? 28.574 27.736 71.249 1.00 67.98  ? 195 ARG A CD  1 
ATOM   1184 N  NE  . ARG A 1 153 ? 27.480 28.669 71.533 1.00 75.49  ? 195 ARG A NE  1 
ATOM   1185 C  CZ  . ARG A 1 153 ? 27.116 29.047 72.759 1.00 79.46  ? 195 ARG A CZ  1 
ATOM   1186 N  NH1 . ARG A 1 153 ? 27.762 28.582 73.826 1.00 80.82  ? 195 ARG A NH1 1 
ATOM   1187 N  NH2 . ARG A 1 153 ? 26.095 29.881 72.925 1.00 81.21  ? 195 ARG A NH2 1 
ATOM   1188 N  N   . VAL A 1 154 ? 25.838 25.948 66.899 1.00 34.80  ? 196 VAL A N   1 
ATOM   1189 C  CA  . VAL A 1 154 ? 25.021 24.746 66.900 1.00 37.16  ? 196 VAL A CA  1 
ATOM   1190 C  C   . VAL A 1 154 ? 25.599 23.675 65.996 1.00 35.59  ? 196 VAL A C   1 
ATOM   1191 O  O   . VAL A 1 154 ? 25.749 23.896 64.810 1.00 33.07  ? 196 VAL A O   1 
ATOM   1192 C  CB  . VAL A 1 154 ? 23.586 25.064 66.429 1.00 37.95  ? 196 VAL A CB  1 
ATOM   1193 C  CG1 . VAL A 1 154 ? 22.730 23.784 66.455 1.00 42.46  ? 196 VAL A CG1 1 
ATOM   1194 C  CG2 . VAL A 1 154 ? 22.977 26.166 67.324 1.00 37.74  ? 196 VAL A CG2 1 
ATOM   1195 N  N   . PRO A 1 155 ? 25.925 22.492 66.551 1.00 38.63  ? 197 PRO A N   1 
ATOM   1196 C  CA  . PRO A 1 155 ? 26.486 21.417 65.720 1.00 36.64  ? 197 PRO A CA  1 
ATOM   1197 C  C   . PRO A 1 155 ? 25.517 21.015 64.603 1.00 37.09  ? 197 PRO A C   1 
ATOM   1198 O  O   . PRO A 1 155 ? 24.317 20.868 64.827 1.00 37.23  ? 197 PRO A O   1 
ATOM   1199 C  CB  . PRO A 1 155 ? 26.708 20.271 66.717 1.00 38.92  ? 197 PRO A CB  1 
ATOM   1200 C  CG  . PRO A 1 155 ? 26.914 20.999 68.048 1.00 42.64  ? 197 PRO A CG  1 
ATOM   1201 C  CD  . PRO A 1 155 ? 25.847 22.084 67.973 1.00 40.02  ? 197 PRO A CD  1 
ATOM   1202 N  N   . GLN A 1 156 ? 26.048 20.843 63.402 1.00 33.74  ? 198 GLN A N   1 
ATOM   1203 C  CA  . GLN A 1 156 ? 25.252 20.457 62.245 1.00 30.48  ? 198 GLN A CA  1 
ATOM   1204 C  C   . GLN A 1 156 ? 25.285 18.923 62.114 1.00 31.11  ? 198 GLN A C   1 
ATOM   1205 O  O   . GLN A 1 156 ? 26.296 18.282 62.410 1.00 31.68  ? 198 GLN A O   1 
ATOM   1206 C  CB  . GLN A 1 156 ? 25.829 21.140 61.003 1.00 32.93  ? 198 GLN A CB  1 
ATOM   1207 C  CG  . GLN A 1 156 ? 25.733 22.687 61.073 1.00 30.45  ? 198 GLN A CG  1 
ATOM   1208 C  CD  . GLN A 1 156 ? 24.300 23.155 61.317 1.00 36.29  ? 198 GLN A CD  1 
ATOM   1209 O  OE1 . GLN A 1 156 ? 23.424 22.988 60.455 1.00 32.89  ? 198 GLN A OE1 1 
ATOM   1210 N  NE2 . GLN A 1 156 ? 24.053 23.737 62.493 1.00 30.16  ? 198 GLN A NE2 1 
ATOM   1211 N  N   . PRO A 1 157 ? 24.172 18.305 61.687 1.00 29.71  ? 199 PRO A N   1 
ATOM   1212 C  CA  . PRO A 1 157 ? 24.148 16.845 61.548 1.00 27.53  ? 199 PRO A CA  1 
ATOM   1213 C  C   . PRO A 1 157 ? 24.964 16.348 60.359 1.00 28.39  ? 199 PRO A C   1 
ATOM   1214 O  O   . PRO A 1 157 ? 25.420 15.204 60.337 1.00 26.78  ? 199 PRO A O   1 
ATOM   1215 C  CB  . PRO A 1 157 ? 22.657 16.540 61.407 1.00 29.68  ? 199 PRO A CB  1 
ATOM   1216 C  CG  . PRO A 1 157 ? 22.135 17.760 60.733 1.00 30.84  ? 199 PRO A CG  1 
ATOM   1217 C  CD  . PRO A 1 157 ? 22.829 18.874 61.456 1.00 31.90  ? 199 PRO A CD  1 
ATOM   1218 N  N   . LEU A 1 158 ? 25.174 17.211 59.373 1.00 27.77  ? 200 LEU A N   1 
ATOM   1219 C  CA  . LEU A 1 158 ? 25.961 16.819 58.194 1.00 27.70  ? 200 LEU A CA  1 
ATOM   1220 C  C   . LEU A 1 158 ? 27.075 17.845 58.065 1.00 24.74  ? 200 LEU A C   1 
ATOM   1221 O  O   . LEU A 1 158 ? 26.845 19.029 58.248 1.00 29.72  ? 200 LEU A O   1 
ATOM   1222 C  CB  . LEU A 1 158 ? 25.079 16.832 56.935 1.00 27.25  ? 200 LEU A CB  1 
ATOM   1223 C  CG  . LEU A 1 158 ? 23.879 15.868 57.034 1.00 29.12  ? 200 LEU A CG  1 
ATOM   1224 C  CD1 . LEU A 1 158 ? 22.898 16.110 55.878 1.00 28.75  ? 200 LEU A CD1 1 
ATOM   1225 C  CD2 . LEU A 1 158 ? 24.404 14.413 56.988 1.00 26.08  ? 200 LEU A CD2 1 
ATOM   1226 N  N   . ILE A 1 159 ? 28.277 17.390 57.739 1.00 26.09  ? 201 ILE A N   1 
ATOM   1227 C  CA  . ILE A 1 159 ? 29.427 18.275 57.648 1.00 23.50  ? 201 ILE A CA  1 
ATOM   1228 C  C   . ILE A 1 159 ? 29.893 18.284 56.225 1.00 22.44  ? 201 ILE A C   1 
ATOM   1229 O  O   . ILE A 1 159 ? 30.058 17.220 55.643 1.00 27.44  ? 201 ILE A O   1 
ATOM   1230 C  CB  . ILE A 1 159 ? 30.568 17.765 58.547 1.00 25.97  ? 201 ILE A CB  1 
ATOM   1231 C  CG1 . ILE A 1 159 ? 30.062 17.657 59.983 1.00 28.61  ? 201 ILE A CG1 1 
ATOM   1232 C  CG2 . ILE A 1 159 ? 31.803 18.697 58.467 1.00 26.67  ? 201 ILE A CG2 1 
ATOM   1233 C  CD1 . ILE A 1 159 ? 29.639 18.982 60.600 1.00 32.64  ? 201 ILE A CD1 1 
ATOM   1234 N  N   . ALA A 1 160 ? 30.084 19.481 55.665 1.00 23.93  ? 202 ALA A N   1 
ATOM   1235 C  CA  . ALA A 1 160 ? 30.533 19.607 54.277 1.00 24.30  ? 202 ALA A CA  1 
ATOM   1236 C  C   . ALA A 1 160 ? 32.052 19.534 54.247 1.00 26.77  ? 202 ALA A C   1 
ATOM   1237 O  O   . ALA A 1 160 ? 32.705 19.930 55.199 1.00 24.86  ? 202 ALA A O   1 
ATOM   1238 C  CB  . ALA A 1 160 ? 30.078 20.940 53.675 1.00 27.40  ? 202 ALA A CB  1 
ATOM   1239 N  N   . GLY A 1 161 ? 32.580 19.011 53.153 1.00 26.75  ? 203 GLY A N   1 
ATOM   1240 C  CA  . GLY A 1 161 ? 34.017 18.874 52.997 1.00 27.69  ? 203 GLY A CA  1 
ATOM   1241 C  C   . GLY A 1 161 ? 34.329 19.028 51.524 1.00 27.20  ? 203 GLY A C   1 
ATOM   1242 O  O   . GLY A 1 161 ? 33.432 19.236 50.694 1.00 24.97  ? 203 GLY A O   1 
ATOM   1243 N  N   . MET A 1 162 ? 35.602 18.908 51.186 1.00 25.32  ? 204 MET A N   1 
ATOM   1244 C  CA  . MET A 1 162 ? 36.031 19.085 49.807 1.00 26.27  ? 204 MET A CA  1 
ATOM   1245 C  C   . MET A 1 162 ? 36.993 17.993 49.419 1.00 28.29  ? 204 MET A C   1 
ATOM   1246 O  O   . MET A 1 162 ? 37.916 17.679 50.187 1.00 27.33  ? 204 MET A O   1 
ATOM   1247 C  CB  . MET A 1 162 ? 36.755 20.417 49.674 1.00 27.91  ? 204 MET A CB  1 
ATOM   1248 C  CG  . MET A 1 162 ? 37.078 20.805 48.256 1.00 29.52  ? 204 MET A CG  1 
ATOM   1249 S  SD  . MET A 1 162 ? 35.556 21.166 47.318 1.00 33.48  ? 204 MET A SD  1 
ATOM   1250 C  CE  . MET A 1 162 ? 34.655 22.148 48.440 1.00 25.98  ? 204 MET A CE  1 
ATOM   1251 N  N   . TYR A 1 163 ? 36.764 17.388 48.260 1.00 25.53  ? 205 TYR A N   1 
ATOM   1252 C  CA  . TYR A 1 163 ? 37.692 16.364 47.786 1.00 26.36  ? 205 TYR A CA  1 
ATOM   1253 C  C   . TYR A 1 163 ? 38.281 16.991 46.541 1.00 28.71  ? 205 TYR A C   1 
ATOM   1254 O  O   . TYR A 1 163 ? 37.562 17.217 45.567 1.00 28.50  ? 205 TYR A O   1 
ATOM   1255 C  CB  . TYR A 1 163 ? 36.961 15.056 47.450 1.00 26.61  ? 205 TYR A CB  1 
ATOM   1256 C  CG  . TYR A 1 163 ? 37.908 13.906 47.187 1.00 32.38  ? 205 TYR A CG  1 
ATOM   1257 C  CD1 . TYR A 1 163 ? 37.951 12.797 48.043 1.00 31.52  ? 205 TYR A CD1 1 
ATOM   1258 C  CD2 . TYR A 1 163 ? 38.783 13.939 46.107 1.00 32.78  ? 205 TYR A CD2 1 
ATOM   1259 C  CE1 . TYR A 1 163 ? 38.847 11.756 47.829 1.00 35.03  ? 205 TYR A CE1 1 
ATOM   1260 C  CE2 . TYR A 1 163 ? 39.684 12.897 45.880 1.00 40.40  ? 205 TYR A CE2 1 
ATOM   1261 C  CZ  . TYR A 1 163 ? 39.712 11.814 46.744 1.00 41.49  ? 205 TYR A CZ  1 
ATOM   1262 O  OH  . TYR A 1 163 ? 40.614 10.799 46.526 1.00 41.06  ? 205 TYR A OH  1 
ATOM   1263 N  N   . LEU A 1 164 ? 39.572 17.326 46.585 1.00 25.91  ? 206 LEU A N   1 
ATOM   1264 C  CA  . LEU A 1 164 ? 40.239 17.939 45.440 1.00 25.39  ? 206 LEU A CA  1 
ATOM   1265 C  C   . LEU A 1 164 ? 41.063 16.929 44.626 1.00 28.25  ? 206 LEU A C   1 
ATOM   1266 O  O   . LEU A 1 164 ? 41.948 16.266 45.181 1.00 29.23  ? 206 LEU A O   1 
ATOM   1267 C  CB  . LEU A 1 164 ? 41.182 19.043 45.934 1.00 25.91  ? 206 LEU A CB  1 
ATOM   1268 C  CG  . LEU A 1 164 ? 42.158 19.585 44.874 1.00 28.83  ? 206 LEU A CG  1 
ATOM   1269 C  CD1 . LEU A 1 164 ? 41.372 20.184 43.684 1.00 30.13  ? 206 LEU A CD1 1 
ATOM   1270 C  CD2 . LEU A 1 164 ? 43.054 20.628 45.493 1.00 28.80  ? 206 LEU A CD2 1 
ATOM   1271 N  N   . MET A 1 165 ? 40.767 16.810 43.333 1.00 24.79  ? 207 MET A N   1 
ATOM   1272 C  CA  . MET A 1 165 ? 41.530 15.941 42.421 1.00 28.30  ? 207 MET A CA  1 
ATOM   1273 C  C   . MET A 1 165 ? 42.363 16.903 41.567 1.00 28.59  ? 207 MET A C   1 
ATOM   1274 O  O   . MET A 1 165 ? 41.817 17.814 40.944 1.00 26.98  ? 207 MET A O   1 
ATOM   1275 C  CB  . MET A 1 165 ? 40.568 15.129 41.563 1.00 27.97  ? 207 MET A CB  1 
ATOM   1276 C  CG  . MET A 1 165 ? 39.720 14.205 42.442 1.00 32.89  ? 207 MET A CG  1 
ATOM   1277 S  SD  . MET A 1 165 ? 38.681 13.127 41.484 1.00 40.84  ? 207 MET A SD  1 
ATOM   1278 C  CE  . MET A 1 165 ? 39.934 11.810 40.957 1.00 39.44  ? 207 MET A CE  1 
ATOM   1279 N  N   . MET A 1 166 ? 43.687 16.749 41.567 1.00 27.22  ? 208 MET A N   1 
ATOM   1280 C  CA  . MET A 1 166 ? 44.509 17.659 40.784 1.00 26.30  ? 208 MET A CA  1 
ATOM   1281 C  C   . MET A 1 166 ? 45.718 16.963 40.156 1.00 31.90  ? 208 MET A C   1 
ATOM   1282 O  O   . MET A 1 166 ? 46.191 15.941 40.654 1.00 33.39  ? 208 MET A O   1 
ATOM   1283 C  CB  . MET A 1 166 ? 44.996 18.832 41.645 1.00 31.63  ? 208 MET A CB  1 
ATOM   1284 C  CG  . MET A 1 166 ? 45.795 18.449 42.876 1.00 36.33  ? 208 MET A CG  1 
ATOM   1285 S  SD  . MET A 1 166 ? 46.485 19.925 43.699 1.00 44.39  ? 208 MET A SD  1 
ATOM   1286 C  CE  . MET A 1 166 ? 47.755 20.381 42.534 1.00 47.72  ? 208 MET A CE  1 
ATOM   1287 N  N   . SER A 1 167 ? 46.189 17.519 39.047 1.00 30.00  ? 209 SER A N   1 
ATOM   1288 C  CA  . SER A 1 167 ? 47.343 16.962 38.341 1.00 36.71  ? 209 SER A CA  1 
ATOM   1289 C  C   . SER A 1 167 ? 48.562 17.766 38.712 1.00 36.99  ? 209 SER A C   1 
ATOM   1290 O  O   . SER A 1 167 ? 48.469 18.967 38.957 1.00 33.04  ? 209 SER A O   1 
ATOM   1291 C  CB  . SER A 1 167 ? 47.174 17.073 36.819 1.00 38.79  ? 209 SER A CB  1 
ATOM   1292 O  OG  . SER A 1 167 ? 45.978 16.458 36.394 1.00 50.92  ? 209 SER A OG  1 
ATOM   1293 N  N   . VAL A 1 168 ? 49.715 17.108 38.729 1.00 39.36  ? 210 VAL A N   1 
ATOM   1294 C  CA  . VAL A 1 168 ? 50.954 17.794 39.042 1.00 40.46  ? 210 VAL A CA  1 
ATOM   1295 C  C   . VAL A 1 168 ? 52.017 17.557 37.966 1.00 39.03  ? 210 VAL A C   1 
ATOM   1296 O  O   . VAL A 1 168 ? 52.893 18.391 37.767 1.00 39.86  ? 210 VAL A O   1 
ATOM   1297 C  CB  . VAL A 1 168 ? 51.514 17.334 40.421 1.00 44.25  ? 210 VAL A CB  1 
ATOM   1298 C  CG1 . VAL A 1 168 ? 50.566 17.758 41.535 1.00 45.80  ? 210 VAL A CG1 1 
ATOM   1299 C  CG2 . VAL A 1 168 ? 51.690 15.821 40.437 1.00 47.51  ? 210 VAL A CG2 1 
ATOM   1300 N  N   . ASP A 1 169 ? 51.900 16.464 37.219 1.00 41.47  ? 211 ASP A N   1 
ATOM   1301 C  CA  . ASP A 1 169 ? 52.931 16.140 36.232 1.00 42.98  ? 211 ASP A CA  1 
ATOM   1302 C  C   . ASP A 1 169 ? 52.611 16.322 34.760 1.00 40.74  ? 211 ASP A C   1 
ATOM   1303 O  O   . ASP A 1 169 ? 53.410 15.948 33.892 1.00 39.81  ? 211 ASP A O   1 
ATOM   1304 C  CB  . ASP A 1 169 ? 53.376 14.700 36.470 1.00 47.82  ? 211 ASP A CB  1 
ATOM   1305 C  CG  . ASP A 1 169 ? 52.273 13.692 36.174 1.00 54.75  ? 211 ASP A CG  1 
ATOM   1306 O  OD1 . ASP A 1 169 ? 52.353 12.561 36.706 1.00 56.88  ? 211 ASP A OD1 1 
ATOM   1307 O  OD2 . ASP A 1 169 ? 51.335 14.022 35.406 1.00 54.72  ? 211 ASP A OD2 1 
ATOM   1308 N  N   . THR A 1 170 ? 51.445 16.874 34.461 1.00 36.44  ? 212 THR A N   1 
ATOM   1309 C  CA  . THR A 1 170 ? 51.052 17.060 33.070 1.00 33.67  ? 212 THR A CA  1 
ATOM   1310 C  C   . THR A 1 170 ? 52.008 17.889 32.224 1.00 31.89  ? 212 THR A C   1 
ATOM   1311 O  O   . THR A 1 170 ? 52.557 18.890 32.687 1.00 31.51  ? 212 THR A O   1 
ATOM   1312 C  CB  . THR A 1 170 ? 49.694 17.724 32.998 1.00 33.18  ? 212 THR A CB  1 
ATOM   1313 O  OG1 . THR A 1 170 ? 48.808 17.027 33.868 1.00 36.52  ? 212 THR A OG1 1 
ATOM   1314 C  CG2 . THR A 1 170 ? 49.141 17.670 31.571 1.00 35.53  ? 212 THR A CG2 1 
ATOM   1315 N  N   . VAL A 1 171 ? 52.204 17.474 30.974 1.00 31.12  ? 213 VAL A N   1 
ATOM   1316 C  CA  . VAL A 1 171 ? 53.036 18.239 30.051 1.00 30.70  ? 213 VAL A CA  1 
ATOM   1317 C  C   . VAL A 1 171 ? 52.278 18.238 28.741 1.00 31.97  ? 213 VAL A C   1 
ATOM   1318 O  O   . VAL A 1 171 ? 51.881 17.182 28.240 1.00 32.38  ? 213 VAL A O   1 
ATOM   1319 C  CB  . VAL A 1 171 ? 54.434 17.625 29.847 1.00 36.72  ? 213 VAL A CB  1 
ATOM   1320 C  CG1 . VAL A 1 171 ? 55.195 18.427 28.800 1.00 36.66  ? 213 VAL A CG1 1 
ATOM   1321 C  CG2 . VAL A 1 171 ? 55.204 17.640 31.157 1.00 37.01  ? 213 VAL A CG2 1 
ATOM   1322 N  N   . ILE A 1 172 ? 52.050 19.431 28.208 1.00 30.34  ? 214 ILE A N   1 
ATOM   1323 C  CA  . ILE A 1 172 ? 51.285 19.617 26.984 1.00 30.89  ? 214 ILE A CA  1 
ATOM   1324 C  C   . ILE A 1 172 ? 52.220 20.106 25.876 1.00 32.37  ? 214 ILE A C   1 
ATOM   1325 O  O   . ILE A 1 172 ? 52.565 21.284 25.831 1.00 35.25  ? 214 ILE A O   1 
ATOM   1326 C  CB  . ILE A 1 172 ? 50.172 20.675 27.226 1.00 33.14  ? 214 ILE A CB  1 
ATOM   1327 C  CG1 . ILE A 1 172 ? 49.196 20.183 28.320 1.00 31.44  ? 214 ILE A CG1 1 
ATOM   1328 C  CG2 . ILE A 1 172 ? 49.402 20.954 25.930 1.00 35.00  ? 214 ILE A CG2 1 
ATOM   1329 C  CD1 . ILE A 1 172 ? 48.331 21.327 28.877 1.00 30.65  ? 214 ILE A CD1 1 
ATOM   1330 N  N   . PRO A 1 173 ? 52.662 19.198 24.986 1.00 34.60  ? 215 PRO A N   1 
ATOM   1331 C  CA  . PRO A 1 173 ? 53.565 19.601 23.896 1.00 36.09  ? 215 PRO A CA  1 
ATOM   1332 C  C   . PRO A 1 173 ? 52.889 20.652 23.024 1.00 37.02  ? 215 PRO A C   1 
ATOM   1333 O  O   . PRO A 1 173 ? 51.679 20.597 22.813 1.00 37.62  ? 215 PRO A O   1 
ATOM   1334 C  CB  . PRO A 1 173 ? 53.816 18.288 23.147 1.00 35.38  ? 215 PRO A CB  1 
ATOM   1335 C  CG  . PRO A 1 173 ? 53.670 17.243 24.230 1.00 36.07  ? 215 PRO A CG  1 
ATOM   1336 C  CD  . PRO A 1 173 ? 52.438 17.739 24.973 1.00 33.47  ? 215 PRO A CD  1 
ATOM   1337 N  N   . PRO A 1 174 ? 53.661 21.621 22.495 1.00 39.77  ? 216 PRO A N   1 
ATOM   1338 C  CA  . PRO A 1 174 ? 53.048 22.656 21.653 1.00 40.79  ? 216 PRO A CA  1 
ATOM   1339 C  C   . PRO A 1 174 ? 52.349 22.140 20.396 1.00 43.57  ? 216 PRO A C   1 
ATOM   1340 O  O   . PRO A 1 174 ? 52.831 21.230 19.727 1.00 43.77  ? 216 PRO A O   1 
ATOM   1341 C  CB  . PRO A 1 174 ? 54.217 23.612 21.351 1.00 43.09  ? 216 PRO A CB  1 
ATOM   1342 C  CG  . PRO A 1 174 ? 55.439 22.764 21.525 1.00 42.96  ? 216 PRO A CG  1 
ATOM   1343 C  CD  . PRO A 1 174 ? 55.103 21.870 22.692 1.00 39.83  ? 216 PRO A CD  1 
ATOM   1344 N  N   . GLY A 1 175 ? 51.199 22.722 20.087 1.00 44.37  ? 217 GLY A N   1 
ATOM   1345 C  CA  . GLY A 1 175 ? 50.456 22.311 18.909 1.00 48.43  ? 217 GLY A CA  1 
ATOM   1346 C  C   . GLY A 1 175 ? 49.767 20.963 19.045 1.00 50.97  ? 217 GLY A C   1 
ATOM   1347 O  O   . GLY A 1 175 ? 48.950 20.602 18.203 1.00 51.66  ? 217 GLY A O   1 
ATOM   1348 N  N   . GLU A 1 176 ? 50.092 20.215 20.098 1.00 52.50  ? 218 GLU A N   1 
ATOM   1349 C  CA  . GLU A 1 176 ? 49.476 18.908 20.316 1.00 53.16  ? 218 GLU A CA  1 
ATOM   1350 C  C   . GLU A 1 176 ? 47.952 19.046 20.311 1.00 53.15  ? 218 GLU A C   1 
ATOM   1351 O  O   . GLU A 1 176 ? 47.383 19.833 21.069 1.00 50.00  ? 218 GLU A O   1 
ATOM   1352 C  CB  . GLU A 1 176 ? 49.930 18.318 21.645 1.00 55.98  ? 218 GLU A CB  1 
ATOM   1353 C  CG  . GLU A 1 176 ? 49.634 16.832 21.778 1.00 63.10  ? 218 GLU A CG  1 
ATOM   1354 C  CD  . GLU A 1 176 ? 50.507 15.972 20.871 1.00 67.89  ? 218 GLU A CD  1 
ATOM   1355 O  OE1 . GLU A 1 176 ? 50.052 14.876 20.475 1.00 69.67  ? 218 GLU A OE1 1 
ATOM   1356 O  OE2 . GLU A 1 176 ? 51.650 16.382 20.563 1.00 70.55  ? 218 GLU A OE2 1 
ATOM   1357 N  N   . LYS A 1 177 ? 47.300 18.273 19.453 1.00 50.58  ? 219 LYS A N   1 
ATOM   1358 C  CA  . LYS A 1 177 ? 45.851 18.312 19.320 1.00 52.46  ? 219 LYS A CA  1 
ATOM   1359 C  C   . LYS A 1 177 ? 45.111 17.925 20.608 1.00 50.56  ? 219 LYS A C   1 
ATOM   1360 O  O   . LYS A 1 177 ? 44.184 18.617 21.029 1.00 50.85  ? 219 LYS A O   1 
ATOM   1361 C  CB  . LYS A 1 177 ? 45.429 17.388 18.176 1.00 53.96  ? 219 LYS A CB  1 
ATOM   1362 C  CG  . LYS A 1 177 ? 43.990 17.560 17.706 1.00 62.53  ? 219 LYS A CG  1 
ATOM   1363 C  CD  . LYS A 1 177 ? 43.722 16.655 16.498 1.00 66.31  ? 219 LYS A CD  1 
ATOM   1364 C  CE  . LYS A 1 177 ? 42.279 16.754 16.012 1.00 69.32  ? 219 LYS A CE  1 
ATOM   1365 N  NZ  . LYS A 1 177 ? 42.031 15.877 14.821 1.00 70.37  ? 219 LYS A NZ  1 
ATOM   1366 N  N   . VAL A 1 178 ? 45.515 16.822 21.232 1.00 48.33  ? 220 VAL A N   1 
ATOM   1367 C  CA  . VAL A 1 178 ? 44.850 16.381 22.451 1.00 43.36  ? 220 VAL A CA  1 
ATOM   1368 C  C   . VAL A 1 178 ? 45.770 15.788 23.484 1.00 41.34  ? 220 VAL A C   1 
ATOM   1369 O  O   . VAL A 1 178 ? 46.542 14.873 23.195 1.00 41.19  ? 220 VAL A O   1 
ATOM   1370 C  CB  . VAL A 1 178 ? 43.753 15.313 22.164 1.00 46.32  ? 220 VAL A CB  1 
ATOM   1371 C  CG1 . VAL A 1 178 ? 43.107 14.864 23.485 1.00 46.37  ? 220 VAL A CG1 1 
ATOM   1372 C  CG2 . VAL A 1 178 ? 42.685 15.882 21.241 1.00 47.69  ? 220 VAL A CG2 1 
ATOM   1373 N  N   . VAL A 1 179 ? 45.691 16.319 24.700 1.00 38.04  ? 221 VAL A N   1 
ATOM   1374 C  CA  . VAL A 1 179 ? 46.467 15.794 25.811 1.00 35.86  ? 221 VAL A CA  1 
ATOM   1375 C  C   . VAL A 1 179 ? 45.505 15.581 26.983 1.00 34.90  ? 221 VAL A C   1 
ATOM   1376 O  O   . VAL A 1 179 ? 44.832 16.512 27.406 1.00 32.00  ? 221 VAL A O   1 
ATOM   1377 C  CB  . VAL A 1 179 ? 47.567 16.757 26.272 1.00 36.37  ? 221 VAL A CB  1 
ATOM   1378 C  CG1 . VAL A 1 179 ? 48.219 16.200 27.504 1.00 34.21  ? 221 VAL A CG1 1 
ATOM   1379 C  CG2 . VAL A 1 179 ? 48.610 16.955 25.160 1.00 41.82  ? 221 VAL A CG2 1 
ATOM   1380 N  N   . ASN A 1 180 ? 45.447 14.363 27.501 1.00 34.71  ? 222 ASN A N   1 
ATOM   1381 C  CA  . ASN A 1 180 ? 44.575 14.052 28.630 1.00 36.32  ? 222 ASN A CA  1 
ATOM   1382 C  C   . ASN A 1 180 ? 45.378 14.071 29.912 1.00 37.77  ? 222 ASN A C   1 
ATOM   1383 O  O   . ASN A 1 180 ? 46.507 13.607 29.933 1.00 34.88  ? 222 ASN A O   1 
ATOM   1384 C  CB  . ASN A 1 180 ? 43.992 12.660 28.476 1.00 37.72  ? 222 ASN A CB  1 
ATOM   1385 C  CG  . ASN A 1 180 ? 43.163 12.516 27.230 1.00 41.75  ? 222 ASN A CG  1 
ATOM   1386 O  OD1 . ASN A 1 180 ? 43.236 11.496 26.538 1.00 49.71  ? 222 ASN A OD1 1 
ATOM   1387 N  ND2 . ASN A 1 180 ? 42.366 13.525 26.933 1.00 38.03  ? 222 ASN A ND2 1 
ATOM   1388 N  N   . ALA A 1 181 ? 44.812 14.642 30.968 1.00 34.64  ? 223 ALA A N   1 
ATOM   1389 C  CA  . ALA A 1 181 ? 45.465 14.617 32.266 1.00 35.45  ? 223 ALA A CA  1 
ATOM   1390 C  C   . ALA A 1 181 ? 44.516 13.718 33.065 1.00 36.32  ? 223 ALA A C   1 
ATOM   1391 O  O   . ALA A 1 181 ? 43.355 14.073 33.267 1.00 33.81  ? 223 ALA A O   1 
ATOM   1392 C  CB  . ALA A 1 181 ? 45.524 16.010 32.882 1.00 37.27  ? 223 ALA A CB  1 
ATOM   1393 N  N   . ASP A 1 182 ? 45.003 12.564 33.511 1.00 34.36  ? 224 ASP A N   1 
ATOM   1394 C  CA  . ASP A 1 182 ? 44.160 11.615 34.254 1.00 37.23  ? 224 ASP A CA  1 
ATOM   1395 C  C   . ASP A 1 182 ? 44.528 11.566 35.726 1.00 34.85  ? 224 ASP A C   1 
ATOM   1396 O  O   . ASP A 1 182 ? 45.709 11.587 36.089 1.00 32.19  ? 224 ASP A O   1 
ATOM   1397 C  CB  . ASP A 1 182 ? 44.266 10.204 33.631 1.00 36.64  ? 224 ASP A CB  1 
ATOM   1398 C  CG  . ASP A 1 182 ? 43.671 10.131 32.211 1.00 42.98  ? 224 ASP A CG  1 
ATOM   1399 O  OD1 . ASP A 1 182 ? 42.854 11.008 31.851 1.00 41.30  ? 224 ASP A OD1 1 
ATOM   1400 O  OD2 . ASP A 1 182 ? 44.004 9.184  31.450 1.00 45.68  ? 224 ASP A OD2 1 
ATOM   1401 N  N   . ILE A 1 183 ? 43.515 11.479 36.584 1.00 32.64  ? 225 ILE A N   1 
ATOM   1402 C  CA  . ILE A 1 183 ? 43.746 11.468 38.020 1.00 32.12  ? 225 ILE A CA  1 
ATOM   1403 C  C   . ILE A 1 183 ? 42.861 10.366 38.582 1.00 32.46  ? 225 ILE A C   1 
ATOM   1404 O  O   . ILE A 1 183 ? 41.707 10.237 38.169 1.00 34.05  ? 225 ILE A O   1 
ATOM   1405 C  CB  . ILE A 1 183 ? 43.292 12.836 38.663 1.00 31.91  ? 225 ILE A CB  1 
ATOM   1406 C  CG1 . ILE A 1 183 ? 43.923 14.010 37.923 1.00 35.61  ? 225 ILE A CG1 1 
ATOM   1407 C  CG2 . ILE A 1 183 ? 43.621 12.861 40.151 1.00 33.18  ? 225 ILE A CG2 1 
ATOM   1408 C  CD1 . ILE A 1 183 ? 43.240 15.387 38.252 1.00 32.97  ? 225 ILE A CD1 1 
ATOM   1409 N  N   . SER A 1 184 ? 43.378 9.578  39.519 1.00 32.58  ? 226 SER A N   1 
ATOM   1410 C  CA  . SER A 1 184 ? 42.566 8.515  40.115 1.00 33.61  ? 226 SER A CA  1 
ATOM   1411 C  C   . SER A 1 184 ? 43.149 8.041  41.437 1.00 36.65  ? 226 SER A C   1 
ATOM   1412 O  O   . SER A 1 184 ? 44.368 7.925  41.606 1.00 36.76  ? 226 SER A O   1 
ATOM   1413 C  CB  . SER A 1 184 ? 42.414 7.324  39.154 1.00 37.29  ? 226 SER A CB  1 
ATOM   1414 O  OG  . SER A 1 184 ? 43.650 6.650  38.959 1.00 36.05  ? 226 SER A OG  1 
ATOM   1415 N  N   A CYS A 1 185 ? 42.252 7.775  42.372 1.00 36.22  ? 227 CYS A N   1 
ATOM   1416 C  CA  A CYS A 1 185 ? 42.612 7.326  43.711 0.65 36.62  ? 227 CYS A CA  1 
ATOM   1417 C  CA  B CYS A 1 185 ? 42.624 7.309  43.699 0.35 37.48  ? 227 CYS A CA  1 
ATOM   1418 C  C   A CYS A 1 185 ? 41.525 6.420  44.227 1.00 38.57  ? 227 CYS A C   1 
ATOM   1419 O  O   A CYS A 1 185 ? 40.362 6.529  43.796 1.00 34.90  ? 227 CYS A O   1 
ATOM   1420 C  CB  A CYS A 1 185 ? 42.713 8.508  44.682 0.65 35.28  ? 227 CYS A CB  1 
ATOM   1421 C  CB  B CYS A 1 185 ? 42.792 8.480  44.666 0.35 37.82  ? 227 CYS A CB  1 
ATOM   1422 S  SG  A CYS A 1 185 ? 44.257 9.469  44.606 0.65 38.12  ? 227 CYS A SG  1 
ATOM   1423 S  SG  B CYS A 1 185 ? 43.211 7.973  46.352 0.35 43.47  ? 227 CYS A SG  1 
ATOM   1424 N  N   . GLN A 1 186 ? 41.886 5.548  45.162 1.00 37.29  ? 228 GLN A N   1 
ATOM   1425 C  CA  . GLN A 1 186 ? 40.872 4.685  45.717 1.00 38.17  ? 228 GLN A CA  1 
ATOM   1426 C  C   . GLN A 1 186 ? 40.366 5.419  46.951 1.00 36.17  ? 228 GLN A C   1 
ATOM   1427 O  O   . GLN A 1 186 ? 41.138 6.059  47.688 1.00 35.87  ? 228 GLN A O   1 
ATOM   1428 C  CB  . GLN A 1 186 ? 41.435 3.319  46.099 1.00 43.76  ? 228 GLN A CB  1 
ATOM   1429 C  CG  . GLN A 1 186 ? 40.314 2.319  46.320 1.00 49.10  ? 228 GLN A CG  1 
ATOM   1430 C  CD  . GLN A 1 186 ? 40.806 0.908  46.550 1.00 55.62  ? 228 GLN A CD  1 
ATOM   1431 O  OE1 . GLN A 1 186 ? 41.721 0.682  47.344 1.00 58.37  ? 228 GLN A OE1 1 
ATOM   1432 N  NE2 . GLN A 1 186 ? 40.184 -0.058 45.866 1.00 56.42  ? 228 GLN A NE2 1 
ATOM   1433 N  N   . TYR A 1 187 ? 39.068 5.321  47.184 1.00 33.50  ? 229 TYR A N   1 
ATOM   1434 C  CA  . TYR A 1 187 ? 38.454 6.003  48.313 1.00 33.24  ? 229 TYR A CA  1 
ATOM   1435 C  C   . TYR A 1 187 ? 38.429 5.048  49.509 1.00 34.55  ? 229 TYR A C   1 
ATOM   1436 O  O   . TYR A 1 187 ? 37.960 3.923  49.380 1.00 34.89  ? 229 TYR A O   1 
ATOM   1437 C  CB  . TYR A 1 187 ? 37.037 6.427  47.923 1.00 30.85  ? 229 TYR A CB  1 
ATOM   1438 C  CG  . TYR A 1 187 ? 36.363 7.277  48.970 1.00 34.17  ? 229 TYR A CG  1 
ATOM   1439 C  CD1 . TYR A 1 187 ? 36.543 8.661  48.988 1.00 31.73  ? 229 TYR A CD1 1 
ATOM   1440 C  CD2 . TYR A 1 187 ? 35.559 6.693  49.958 1.00 30.01  ? 229 TYR A CD2 1 
ATOM   1441 C  CE1 . TYR A 1 187 ? 35.937 9.444  49.964 1.00 31.86  ? 229 TYR A CE1 1 
ATOM   1442 C  CE2 . TYR A 1 187 ? 34.942 7.469  50.948 1.00 31.28  ? 229 TYR A CE2 1 
ATOM   1443 C  CZ  . TYR A 1 187 ? 35.134 8.841  50.942 1.00 27.76  ? 229 TYR A CZ  1 
ATOM   1444 O  OH  . TYR A 1 187 ? 34.543 9.625  51.901 1.00 27.07  ? 229 TYR A OH  1 
ATOM   1445 N  N   . LYS A 1 188 ? 38.922 5.504  50.663 1.00 33.72  ? 230 LYS A N   1 
ATOM   1446 C  CA  . LYS A 1 188 ? 38.992 4.667  51.858 1.00 36.84  ? 230 LYS A CA  1 
ATOM   1447 C  C   . LYS A 1 188 ? 38.487 5.282  53.153 1.00 38.53  ? 230 LYS A C   1 
ATOM   1448 O  O   . LYS A 1 188 ? 39.073 5.057  54.225 1.00 36.96  ? 230 LYS A O   1 
ATOM   1449 C  CB  . LYS A 1 188 ? 40.437 4.207  52.080 1.00 41.91  ? 230 LYS A CB  1 
ATOM   1450 C  CG  . LYS A 1 188 ? 40.944 3.153  51.092 1.00 46.96  ? 230 LYS A CG  1 
ATOM   1451 C  CD  . LYS A 1 188 ? 42.366 2.732  51.484 1.00 52.29  ? 230 LYS A CD  1 
ATOM   1452 C  CE  . LYS A 1 188 ? 42.765 1.404  50.856 1.00 56.82  ? 230 LYS A CE  1 
ATOM   1453 N  NZ  . LYS A 1 188 ? 43.912 0.779  51.590 1.00 56.09  ? 230 LYS A NZ  1 
ATOM   1454 N  N   . MET A 1 189 ? 37.396 6.039  53.080 1.00 34.73  ? 231 MET A N   1 
ATOM   1455 C  CA  . MET A 1 189 ? 36.846 6.671  54.271 1.00 32.92  ? 231 MET A CA  1 
ATOM   1456 C  C   . MET A 1 189 ? 35.378 6.307  54.348 1.00 30.24  ? 231 MET A C   1 
ATOM   1457 O  O   . MET A 1 189 ? 34.914 5.500  53.562 1.00 29.02  ? 231 MET A O   1 
ATOM   1458 C  CB  . MET A 1 189 ? 36.996 8.180  54.147 1.00 35.51  ? 231 MET A CB  1 
ATOM   1459 C  CG  . MET A 1 189 ? 38.440 8.633  54.113 1.00 36.22  ? 231 MET A CG  1 
ATOM   1460 S  SD  . MET A 1 189 ? 39.143 8.423  55.750 1.00 37.44  ? 231 MET A SD  1 
ATOM   1461 C  CE  . MET A 1 189 ? 40.825 9.137  55.449 1.00 36.57  ? 231 MET A CE  1 
ATOM   1462 N  N   . TYR A 1 190 ? 34.656 6.895  55.301 1.00 30.39  ? 232 TYR A N   1 
ATOM   1463 C  CA  . TYR A 1 190 ? 33.232 6.631  55.408 1.00 28.99  ? 232 TYR A CA  1 
ATOM   1464 C  C   . TYR A 1 190 ? 32.612 7.253  54.166 1.00 29.42  ? 232 TYR A C   1 
ATOM   1465 O  O   . TYR A 1 190 ? 33.228 8.106  53.517 1.00 29.34  ? 232 TYR A O   1 
ATOM   1466 C  CB  . TYR A 1 190 ? 32.675 7.274  56.673 1.00 28.48  ? 232 TYR A CB  1 
ATOM   1467 C  CG  . TYR A 1 190 ? 32.732 6.354  57.871 1.00 32.04  ? 232 TYR A CG  1 
ATOM   1468 C  CD1 . TYR A 1 190 ? 31.762 5.364  58.061 1.00 30.45  ? 232 TYR A CD1 1 
ATOM   1469 C  CD2 . TYR A 1 190 ? 33.765 6.455  58.798 1.00 30.67  ? 232 TYR A CD2 1 
ATOM   1470 C  CE1 . TYR A 1 190 ? 31.825 4.504  59.159 1.00 31.27  ? 232 TYR A CE1 1 
ATOM   1471 C  CE2 . TYR A 1 190 ? 33.841 5.597  59.889 1.00 33.36  ? 232 TYR A CE2 1 
ATOM   1472 C  CZ  . TYR A 1 190 ? 32.873 4.633  60.070 1.00 34.22  ? 232 TYR A CZ  1 
ATOM   1473 O  OH  . TYR A 1 190 ? 32.933 3.842  61.203 1.00 33.36  ? 232 TYR A OH  1 
ATOM   1474 N  N   . PRO A 1 191 ? 31.379 6.852  53.823 1.00 32.89  ? 233 PRO A N   1 
ATOM   1475 C  CA  . PRO A 1 191 ? 30.697 7.385  52.640 1.00 30.36  ? 233 PRO A CA  1 
ATOM   1476 C  C   . PRO A 1 191 ? 30.586 8.912  52.608 1.00 28.19  ? 233 PRO A C   1 
ATOM   1477 O  O   . PRO A 1 191 ? 30.352 9.553  53.634 1.00 31.84  ? 233 PRO A O   1 
ATOM   1478 C  CB  . PRO A 1 191 ? 29.297 6.746  52.717 1.00 32.99  ? 233 PRO A CB  1 
ATOM   1479 C  CG  . PRO A 1 191 ? 29.507 5.496  53.557 1.00 34.45  ? 233 PRO A CG  1 
ATOM   1480 C  CD  . PRO A 1 191 ? 30.471 5.996  54.613 1.00 31.98  ? 233 PRO A CD  1 
ATOM   1481 N  N   . MET A 1 192 ? 30.768 9.489  51.430 1.00 28.22  ? 234 MET A N   1 
ATOM   1482 C  CA  . MET A 1 192 ? 30.576 10.928 51.264 1.00 26.85  ? 234 MET A CA  1 
ATOM   1483 C  C   . MET A 1 192 ? 29.520 11.051 50.162 1.00 25.92  ? 234 MET A C   1 
ATOM   1484 O  O   . MET A 1 192 ? 29.448 10.194 49.279 1.00 27.98  ? 234 MET A O   1 
ATOM   1485 C  CB  . MET A 1 192 ? 31.869 11.634 50.827 1.00 26.26  ? 234 MET A CB  1 
ATOM   1486 C  CG  . MET A 1 192 ? 32.316 11.375 49.384 1.00 30.09  ? 234 MET A CG  1 
ATOM   1487 S  SD  . MET A 1 192 ? 33.773 12.403 48.931 1.00 39.50  ? 234 MET A SD  1 
ATOM   1488 C  CE  . MET A 1 192 ? 34.022 11.886 47.251 1.00 39.15  ? 234 MET A CE  1 
ATOM   1489 N  N   . HIS A 1 193 ? 28.669 12.070 50.241 1.00 25.83  ? 235 HIS A N   1 
ATOM   1490 C  CA  . HIS A 1 193 ? 27.678 12.301 49.187 1.00 25.76  ? 235 HIS A CA  1 
ATOM   1491 C  C   . HIS A 1 193 ? 28.042 13.601 48.510 1.00 26.29  ? 235 HIS A C   1 
ATOM   1492 O  O   . HIS A 1 193 ? 28.097 14.670 49.149 1.00 24.74  ? 235 HIS A O   1 
ATOM   1493 C  CB  . HIS A 1 193 ? 26.261 12.386 49.755 1.00 28.93  ? 235 HIS A CB  1 
ATOM   1494 C  CG  . HIS A 1 193 ? 25.655 11.047 50.010 1.00 27.83  ? 235 HIS A CG  1 
ATOM   1495 N  ND1 . HIS A 1 193 ? 25.918 10.275 51.124 1.00 25.68  ? 235 HIS A ND1 1 
ATOM   1496 C  CD2 . HIS A 1 193 ? 24.789 10.324 49.250 1.00 28.61  ? 235 HIS A CD2 1 
ATOM   1497 C  CE1 . HIS A 1 193 ? 25.208 9.133  51.010 1.00 28.93  ? 235 HIS A CE1 1 
ATOM   1498 N  NE2 . HIS A 1 193 ? 24.516 9.125  49.890 1.00 29.67  ? 235 HIS A NE2 1 
ATOM   1499 N  N   . VAL A 1 194 ? 28.289 13.520 47.211 1.00 24.40  ? 236 VAL A N   1 
ATOM   1500 C  CA  . VAL A 1 194 ? 28.679 14.698 46.474 1.00 25.17  ? 236 VAL A CA  1 
ATOM   1501 C  C   . VAL A 1 194 ? 27.461 15.544 46.142 1.00 29.99  ? 236 VAL A C   1 
ATOM   1502 O  O   . VAL A 1 194 ? 26.464 15.019 45.663 1.00 31.63  ? 236 VAL A O   1 
ATOM   1503 C  CB  . VAL A 1 194 ? 29.364 14.309 45.164 1.00 28.27  ? 236 VAL A CB  1 
ATOM   1504 C  CG1 . VAL A 1 194 ? 29.714 15.572 44.374 1.00 30.95  ? 236 VAL A CG1 1 
ATOM   1505 C  CG2 . VAL A 1 194 ? 30.580 13.439 45.468 1.00 26.09  ? 236 VAL A CG2 1 
ATOM   1506 N  N   . PHE A 1 195 ? 27.522 16.843 46.412 1.00 25.69  ? 237 PHE A N   1 
ATOM   1507 C  CA  . PHE A 1 195 ? 26.376 17.671 46.056 1.00 28.62  ? 237 PHE A CA  1 
ATOM   1508 C  C   . PHE A 1 195 ? 26.713 18.834 45.157 1.00 29.52  ? 237 PHE A C   1 
ATOM   1509 O  O   . PHE A 1 195 ? 25.813 19.451 44.599 1.00 26.90  ? 237 PHE A O   1 
ATOM   1510 C  CB  . PHE A 1 195 ? 25.597 18.123 47.315 1.00 24.55  ? 237 PHE A CB  1 
ATOM   1511 C  CG  . PHE A 1 195 ? 26.336 19.075 48.220 1.00 26.14  ? 237 PHE A CG  1 
ATOM   1512 C  CD1 . PHE A 1 195 ? 26.275 20.450 48.007 1.00 29.91  ? 237 PHE A CD1 1 
ATOM   1513 C  CD2 . PHE A 1 195 ? 27.071 18.590 49.312 1.00 27.46  ? 237 PHE A CD2 1 
ATOM   1514 C  CE1 . PHE A 1 195 ? 26.925 21.344 48.865 1.00 32.24  ? 237 PHE A CE1 1 
ATOM   1515 C  CE2 . PHE A 1 195 ? 27.730 19.473 50.180 1.00 28.90  ? 237 PHE A CE2 1 
ATOM   1516 C  CZ  . PHE A 1 195 ? 27.658 20.852 49.960 1.00 29.46  ? 237 PHE A CZ  1 
ATOM   1517 N  N   . ALA A 1 196 ? 28.004 19.143 44.976 1.00 23.41  ? 238 ALA A N   1 
ATOM   1518 C  CA  . ALA A 1 196 ? 28.352 20.265 44.097 1.00 23.06  ? 238 ALA A CA  1 
ATOM   1519 C  C   . ALA A 1 196 ? 29.767 20.026 43.576 1.00 26.41  ? 238 ALA A C   1 
ATOM   1520 O  O   . ALA A 1 196 ? 30.516 19.256 44.186 1.00 26.42  ? 238 ALA A O   1 
ATOM   1521 C  CB  . ALA A 1 196 ? 28.302 21.621 44.858 1.00 22.34  ? 238 ALA A CB  1 
ATOM   1522 N  N   . TYR A 1 197 ? 30.138 20.671 42.472 1.00 24.76  ? 239 TYR A N   1 
ATOM   1523 C  CA  . TYR A 1 197 ? 31.516 20.490 41.957 1.00 27.14  ? 239 TYR A CA  1 
ATOM   1524 C  C   . TYR A 1 197 ? 31.964 21.732 41.226 1.00 27.15  ? 239 TYR A C   1 
ATOM   1525 O  O   . TYR A 1 197 ? 31.141 22.521 40.760 1.00 26.66  ? 239 TYR A O   1 
ATOM   1526 C  CB  . TYR A 1 197 ? 31.613 19.263 41.025 1.00 27.40  ? 239 TYR A CB  1 
ATOM   1527 C  CG  . TYR A 1 197 ? 30.917 19.465 39.689 1.00 30.81  ? 239 TYR A CG  1 
ATOM   1528 C  CD1 . TYR A 1 197 ? 31.590 20.045 38.611 1.00 34.41  ? 239 TYR A CD1 1 
ATOM   1529 C  CD2 . TYR A 1 197 ? 29.544 19.201 39.548 1.00 34.12  ? 239 TYR A CD2 1 
ATOM   1530 C  CE1 . TYR A 1 197 ? 30.925 20.369 37.438 1.00 35.45  ? 239 TYR A CE1 1 
ATOM   1531 C  CE2 . TYR A 1 197 ? 28.868 19.524 38.365 1.00 35.10  ? 239 TYR A CE2 1 
ATOM   1532 C  CZ  . TYR A 1 197 ? 29.567 20.108 37.327 1.00 38.34  ? 239 TYR A CZ  1 
ATOM   1533 O  OH  . TYR A 1 197 ? 28.921 20.458 36.174 1.00 44.85  ? 239 TYR A OH  1 
ATOM   1534 N  N   . ARG A 1 198 ? 33.274 21.953 41.169 1.00 24.94  ? 240 ARG A N   1 
ATOM   1535 C  CA  . ARG A 1 198 ? 33.810 23.116 40.459 1.00 24.72  ? 240 ARG A CA  1 
ATOM   1536 C  C   . ARG A 1 198 ? 35.010 22.606 39.681 1.00 28.65  ? 240 ARG A C   1 
ATOM   1537 O  O   . ARG A 1 198 ? 35.712 21.704 40.157 1.00 25.88  ? 240 ARG A O   1 
ATOM   1538 C  CB  . ARG A 1 198 ? 34.277 24.200 41.437 1.00 25.89  ? 240 ARG A CB  1 
ATOM   1539 C  CG  . ARG A 1 198 ? 35.110 25.358 40.800 1.00 23.49  ? 240 ARG A CG  1 
ATOM   1540 C  CD  . ARG A 1 198 ? 35.376 26.476 41.812 1.00 28.01  ? 240 ARG A CD  1 
ATOM   1541 N  NE  . ARG A 1 198 ? 36.168 27.548 41.218 1.00 28.68  ? 240 ARG A NE  1 
ATOM   1542 C  CZ  . ARG A 1 198 ? 37.489 27.617 41.246 1.00 31.14  ? 240 ARG A CZ  1 
ATOM   1543 N  NH1 . ARG A 1 198 ? 38.203 26.680 41.858 1.00 31.07  ? 240 ARG A NH1 1 
ATOM   1544 N  NH2 . ARG A 1 198 ? 38.100 28.620 40.642 1.00 32.62  ? 240 ARG A NH2 1 
ATOM   1545 N  N   . VAL A 1 199 ? 35.242 23.166 38.495 1.00 26.89  ? 241 VAL A N   1 
ATOM   1546 C  CA  . VAL A 1 199 ? 36.402 22.755 37.713 1.00 28.24  ? 241 VAL A CA  1 
ATOM   1547 C  C   . VAL A 1 199 ? 37.289 23.960 37.509 1.00 28.36  ? 241 VAL A C   1 
ATOM   1548 O  O   . VAL A 1 199 ? 36.850 25.107 37.541 1.00 26.84  ? 241 VAL A O   1 
ATOM   1549 C  CB  . VAL A 1 199 ? 36.017 22.175 36.316 1.00 28.97  ? 241 VAL A CB  1 
ATOM   1550 C  CG1 . VAL A 1 199 ? 35.079 21.015 36.475 1.00 26.32  ? 241 VAL A CG1 1 
ATOM   1551 C  CG2 . VAL A 1 199 ? 35.387 23.267 35.431 1.00 30.10  ? 241 VAL A CG2 1 
ATOM   1552 N  N   . HIS A 1 200 ? 38.575 23.715 37.355 1.00 29.23  ? 242 HIS A N   1 
ATOM   1553 C  CA  . HIS A 1 200 ? 39.460 24.820 37.116 1.00 27.75  ? 242 HIS A CA  1 
ATOM   1554 C  C   . HIS A 1 200 ? 40.634 24.383 36.237 1.00 30.16  ? 242 HIS A C   1 
ATOM   1555 O  O   . HIS A 1 200 ? 41.258 23.356 36.502 1.00 28.64  ? 242 HIS A O   1 
ATOM   1556 C  CB  . HIS A 1 200 ? 39.998 25.363 38.438 1.00 27.21  ? 242 HIS A CB  1 
ATOM   1557 C  CG  . HIS A 1 200 ? 41.025 26.428 38.263 1.00 28.07  ? 242 HIS A CG  1 
ATOM   1558 N  ND1 . HIS A 1 200 ? 40.754 27.674 37.739 1.00 27.85  ? 242 HIS A ND1 1 
ATOM   1559 C  CD2 . HIS A 1 200 ? 42.373 26.394 38.461 1.00 30.67  ? 242 HIS A CD2 1 
ATOM   1560 C  CE1 . HIS A 1 200 ? 41.922 28.350 37.644 1.00 29.32  ? 242 HIS A CE1 1 
ATOM   1561 N  NE2 . HIS A 1 200 ? 42.922 27.602 38.066 1.00 28.66  ? 242 HIS A NE2 1 
ATOM   1562 N  N   . THR A 1 201 ? 40.894 25.160 35.184 1.00 26.54  ? 243 THR A N   1 
ATOM   1563 C  CA  . THR A 1 201 ? 42.041 24.949 34.283 1.00 30.97  ? 243 THR A CA  1 
ATOM   1564 C  C   . THR A 1 201 ? 42.293 26.343 33.768 1.00 30.01  ? 243 THR A C   1 
ATOM   1565 O  O   . THR A 1 201 ? 41.530 27.270 34.069 1.00 29.84  ? 243 THR A O   1 
ATOM   1566 C  CB  . THR A 1 201 ? 41.763 24.113 32.999 1.00 30.48  ? 243 THR A CB  1 
ATOM   1567 O  OG1 . THR A 1 201 ? 40.964 24.889 32.083 1.00 30.65  ? 243 THR A OG1 1 
ATOM   1568 C  CG2 . THR A 1 201 ? 41.094 22.778 33.326 1.00 31.33  ? 243 THR A CG2 1 
ATOM   1569 N  N   . HIS A 1 202 ? 43.352 26.514 32.998 1.00 27.32  ? 244 HIS A N   1 
ATOM   1570 C  CA  . HIS A 1 202 ? 43.593 27.824 32.428 1.00 28.26  ? 244 HIS A CA  1 
ATOM   1571 C  C   . HIS A 1 202 ? 43.083 27.807 30.991 1.00 30.91  ? 244 HIS A C   1 
ATOM   1572 O  O   . HIS A 1 202 ? 42.218 26.978 30.648 1.00 29.40  ? 244 HIS A O   1 
ATOM   1573 C  CB  . HIS A 1 202 ? 45.080 28.183 32.549 1.00 30.49  ? 244 HIS A CB  1 
ATOM   1574 C  CG  . HIS A 1 202 ? 45.535 28.307 33.970 1.00 33.57  ? 244 HIS A CG  1 
ATOM   1575 N  ND1 . HIS A 1 202 ? 46.849 28.455 34.357 1.00 33.51  ? 244 HIS A ND1 1 
ATOM   1576 C  CD2 . HIS A 1 202 ? 44.807 28.326 35.119 1.00 32.05  ? 244 HIS A CD2 1 
ATOM   1577 C  CE1 . HIS A 1 202 ? 46.878 28.567 35.699 1.00 33.92  ? 244 HIS A CE1 1 
ATOM   1578 N  NE2 . HIS A 1 202 ? 45.664 28.496 36.206 1.00 35.32  ? 244 HIS A NE2 1 
ATOM   1579 N  N   . HIS A 1 203 ? 43.612 28.666 30.124 1.00 34.43  ? 245 HIS A N   1 
ATOM   1580 C  CA  . HIS A 1 203 ? 43.073 28.728 28.762 1.00 36.01  ? 245 HIS A CA  1 
ATOM   1581 C  C   . HIS A 1 203 ? 43.098 27.524 27.835 1.00 35.91  ? 245 HIS A C   1 
ATOM   1582 O  O   . HIS A 1 203 ? 42.301 27.480 26.889 1.00 33.67  ? 245 HIS A O   1 
ATOM   1583 C  CB  . HIS A 1 203 ? 43.639 29.949 28.033 1.00 44.97  ? 245 HIS A CB  1 
ATOM   1584 C  CG  . HIS A 1 203 ? 42.997 31.236 28.452 1.00 53.49  ? 245 HIS A CG  1 
ATOM   1585 N  ND1 . HIS A 1 203 ? 43.418 32.467 27.997 1.00 58.04  ? 245 HIS A ND1 1 
ATOM   1586 C  CD2 . HIS A 1 203 ? 41.967 31.481 29.298 1.00 56.53  ? 245 HIS A CD2 1 
ATOM   1587 C  CE1 . HIS A 1 203 ? 42.676 33.414 28.546 1.00 58.28  ? 245 HIS A CE1 1 
ATOM   1588 N  NE2 . HIS A 1 203 ? 41.788 32.842 29.340 1.00 57.41  ? 245 HIS A NE2 1 
ATOM   1589 N  N   . LEU A 1 204 ? 43.966 26.542 28.088 1.00 31.68  ? 246 LEU A N   1 
ATOM   1590 C  CA  . LEU A 1 204 ? 44.032 25.362 27.219 1.00 31.13  ? 246 LEU A CA  1 
ATOM   1591 C  C   . LEU A 1 204 ? 43.038 24.262 27.568 1.00 32.09  ? 246 LEU A C   1 
ATOM   1592 O  O   . LEU A 1 204 ? 42.919 23.272 26.837 1.00 33.63  ? 246 LEU A O   1 
ATOM   1593 C  CB  . LEU A 1 204 ? 45.449 24.753 27.231 1.00 31.02  ? 246 LEU A CB  1 
ATOM   1594 C  CG  . LEU A 1 204 ? 46.617 25.678 26.864 1.00 34.25  ? 246 LEU A CG  1 
ATOM   1595 C  CD1 . LEU A 1 204 ? 47.917 24.873 26.905 1.00 34.23  ? 246 LEU A CD1 1 
ATOM   1596 C  CD2 . LEU A 1 204 ? 46.395 26.295 25.474 1.00 36.71  ? 246 LEU A CD2 1 
ATOM   1597 N  N   . GLY A 1 205 ? 42.333 24.410 28.686 1.00 30.56  ? 247 GLY A N   1 
ATOM   1598 C  CA  . GLY A 1 205 ? 41.389 23.381 29.084 1.00 28.95  ? 247 GLY A CA  1 
ATOM   1599 C  C   . GLY A 1 205 ? 40.132 23.352 28.221 1.00 34.22  ? 247 GLY A C   1 
ATOM   1600 O  O   . GLY A 1 205 ? 39.536 24.399 27.957 1.00 32.59  ? 247 GLY A O   1 
ATOM   1601 N  N   . LYS A 1 206 ? 39.723 22.160 27.798 1.00 32.49  ? 248 LYS A N   1 
ATOM   1602 C  CA  . LYS A 1 206 ? 38.532 22.006 26.953 1.00 36.56  ? 248 LYS A CA  1 
ATOM   1603 C  C   . LYS A 1 206 ? 37.364 21.367 27.709 1.00 34.29  ? 248 LYS A C   1 
ATOM   1604 O  O   . LYS A 1 206 ? 36.213 21.793 27.582 1.00 35.06  ? 248 LYS A O   1 
ATOM   1605 C  CB  . LYS A 1 206 ? 38.879 21.150 25.725 1.00 41.21  ? 248 LYS A CB  1 
ATOM   1606 C  CG  . LYS A 1 206 ? 39.864 21.808 24.757 1.00 46.88  ? 248 LYS A CG  1 
ATOM   1607 C  CD  . LYS A 1 206 ? 39.283 23.109 24.208 1.00 53.36  ? 248 LYS A CD  1 
ATOM   1608 C  CE  . LYS A 1 206 ? 40.140 23.742 23.099 1.00 57.72  ? 248 LYS A CE  1 
ATOM   1609 N  NZ  . LYS A 1 206 ? 41.372 24.425 23.587 1.00 64.44  ? 248 LYS A NZ  1 
ATOM   1610 N  N   . VAL A 1 207 ? 37.654 20.342 28.495 1.00 33.73  ? 249 VAL A N   1 
ATOM   1611 C  CA  . VAL A 1 207 ? 36.609 19.672 29.259 1.00 34.91  ? 249 VAL A CA  1 
ATOM   1612 C  C   . VAL A 1 207 ? 37.230 19.024 30.485 1.00 35.73  ? 249 VAL A C   1 
ATOM   1613 O  O   . VAL A 1 207 ? 38.369 18.554 30.439 1.00 34.91  ? 249 VAL A O   1 
ATOM   1614 C  CB  . VAL A 1 207 ? 35.893 18.591 28.403 1.00 39.16  ? 249 VAL A CB  1 
ATOM   1615 C  CG1 . VAL A 1 207 ? 36.892 17.569 27.937 1.00 43.71  ? 249 VAL A CG1 1 
ATOM   1616 C  CG2 . VAL A 1 207 ? 34.783 17.908 29.211 1.00 43.70  ? 249 VAL A CG2 1 
ATOM   1617 N  N   . VAL A 1 208 ? 36.491 19.029 31.591 1.00 30.54  ? 250 VAL A N   1 
ATOM   1618 C  CA  . VAL A 1 208 ? 36.952 18.416 32.837 1.00 31.42  ? 250 VAL A CA  1 
ATOM   1619 C  C   . VAL A 1 208 ? 35.790 17.576 33.350 1.00 33.38  ? 250 VAL A C   1 
ATOM   1620 O  O   . VAL A 1 208 ? 34.676 18.086 33.491 1.00 32.53  ? 250 VAL A O   1 
ATOM   1621 C  CB  . VAL A 1 208 ? 37.316 19.490 33.906 1.00 31.14  ? 250 VAL A CB  1 
ATOM   1622 C  CG1 . VAL A 1 208 ? 37.729 18.807 35.232 1.00 30.18  ? 250 VAL A CG1 1 
ATOM   1623 C  CG2 . VAL A 1 208 ? 38.440 20.392 33.371 1.00 30.27  ? 250 VAL A CG2 1 
ATOM   1624 N  N   . SER A 1 209 ? 36.045 16.296 33.594 1.00 31.55  ? 251 SER A N   1 
ATOM   1625 C  CA  . SER A 1 209 ? 35.023 15.375 34.088 1.00 33.95  ? 251 SER A CA  1 
ATOM   1626 C  C   . SER A 1 209 ? 35.541 14.537 35.242 1.00 35.00  ? 251 SER A C   1 
ATOM   1627 O  O   . SER A 1 209 ? 36.718 14.190 35.284 1.00 34.61  ? 251 SER A O   1 
ATOM   1628 C  CB  . SER A 1 209 ? 34.600 14.395 32.981 1.00 33.37  ? 251 SER A CB  1 
ATOM   1629 O  OG  . SER A 1 209 ? 34.350 15.076 31.775 1.00 41.56  ? 251 SER A OG  1 
ATOM   1630 N  N   . GLY A 1 210 ? 34.646 14.179 36.161 1.00 32.03  ? 252 GLY A N   1 
ATOM   1631 C  CA  . GLY A 1 210 ? 35.028 13.343 37.284 1.00 29.73  ? 252 GLY A CA  1 
ATOM   1632 C  C   . GLY A 1 210 ? 33.974 12.244 37.428 1.00 33.48  ? 252 GLY A C   1 
ATOM   1633 O  O   . GLY A 1 210 ? 32.796 12.494 37.170 1.00 30.69  ? 252 GLY A O   1 
ATOM   1634 N  N   . TYR A 1 211 ? 34.389 11.051 37.851 1.00 28.58  ? 253 TYR A N   1 
ATOM   1635 C  CA  . TYR A 1 211 ? 33.488 9.910  38.014 1.00 31.83  ? 253 TYR A CA  1 
ATOM   1636 C  C   . TYR A 1 211 ? 33.790 9.099  39.265 1.00 32.10  ? 253 TYR A C   1 
ATOM   1637 O  O   . TYR A 1 211 ? 34.894 9.147  39.811 1.00 33.60  ? 253 TYR A O   1 
ATOM   1638 C  CB  . TYR A 1 211 ? 33.655 8.919  36.838 1.00 32.58  ? 253 TYR A CB  1 
ATOM   1639 C  CG  . TYR A 1 211 ? 33.325 9.481  35.475 1.00 34.96  ? 253 TYR A CG  1 
ATOM   1640 C  CD1 . TYR A 1 211 ? 34.249 10.251 34.770 1.00 35.61  ? 253 TYR A CD1 1 
ATOM   1641 C  CD2 . TYR A 1 211 ? 32.068 9.279  34.910 1.00 35.53  ? 253 TYR A CD2 1 
ATOM   1642 C  CE1 . TYR A 1 211 ? 33.923 10.814 33.530 1.00 35.71  ? 253 TYR A CE1 1 
ATOM   1643 C  CE2 . TYR A 1 211 ? 31.730 9.833  33.661 1.00 38.39  ? 253 TYR A CE2 1 
ATOM   1644 C  CZ  . TYR A 1 211 ? 32.666 10.597 32.988 1.00 37.70  ? 253 TYR A CZ  1 
ATOM   1645 O  OH  . TYR A 1 211 ? 32.346 11.147 31.776 1.00 44.37  ? 253 TYR A OH  1 
ATOM   1646 N  N   . ARG A 1 212 ? 32.796 8.340  39.701 1.00 31.77  ? 254 ARG A N   1 
ATOM   1647 C  CA  . ARG A 1 212 ? 32.977 7.393  40.784 1.00 32.56  ? 254 ARG A CA  1 
ATOM   1648 C  C   . ARG A 1 212 ? 32.945 6.084  39.982 1.00 34.63  ? 254 ARG A C   1 
ATOM   1649 O  O   . ARG A 1 212 ? 32.051 5.880  39.156 1.00 34.70  ? 254 ARG A O   1 
ATOM   1650 C  CB  . ARG A 1 212 ? 31.806 7.375  41.750 1.00 34.99  ? 254 ARG A CB  1 
ATOM   1651 C  CG  . ARG A 1 212 ? 31.833 6.179  42.708 1.00 35.89  ? 254 ARG A CG  1 
ATOM   1652 C  CD  . ARG A 1 212 ? 30.449 5.962  43.328 1.00 41.84  ? 254 ARG A CD  1 
ATOM   1653 N  NE  . ARG A 1 212 ? 29.529 5.326  42.401 1.00 43.09  ? 254 ARG A NE  1 
ATOM   1654 C  CZ  . ARG A 1 212 ? 28.224 5.179  42.617 1.00 46.04  ? 254 ARG A CZ  1 
ATOM   1655 N  NH1 . ARG A 1 212 ? 27.655 5.637  43.732 1.00 38.66  ? 254 ARG A NH1 1 
ATOM   1656 N  NH2 . ARG A 1 212 ? 27.487 4.531  41.728 1.00 46.64  ? 254 ARG A NH2 1 
ATOM   1657 N  N   . VAL A 1 213 ? 33.918 5.217  40.207 1.00 34.87  ? 255 VAL A N   1 
ATOM   1658 C  CA  . VAL A 1 213 ? 33.979 3.947  39.481 1.00 38.27  ? 255 VAL A CA  1 
ATOM   1659 C  C   . VAL A 1 213 ? 33.818 2.827  40.489 1.00 34.44  ? 255 VAL A C   1 
ATOM   1660 O  O   . VAL A 1 213 ? 34.585 2.721  41.427 1.00 36.29  ? 255 VAL A O   1 
ATOM   1661 C  CB  . VAL A 1 213 ? 35.325 3.809  38.734 1.00 38.85  ? 255 VAL A CB  1 
ATOM   1662 C  CG1 . VAL A 1 213 ? 35.377 2.472  37.984 1.00 42.49  ? 255 VAL A CG1 1 
ATOM   1663 C  CG2 . VAL A 1 213 ? 35.478 4.962  37.752 1.00 36.84  ? 255 VAL A CG2 1 
ATOM   1664 N  N   . ARG A 1 214 ? 32.800 1.997  40.296 1.00 37.65  ? 256 ARG A N   1 
ATOM   1665 C  CA  . ARG A 1 214 ? 32.509 0.903  41.218 1.00 38.09  ? 256 ARG A CA  1 
ATOM   1666 C  C   . ARG A 1 214 ? 32.228 -0.370 40.398 1.00 41.52  ? 256 ARG A C   1 
ATOM   1667 O  O   . ARG A 1 214 ? 31.426 -0.341 39.474 1.00 40.61  ? 256 ARG A O   1 
ATOM   1668 C  CB  . ARG A 1 214 ? 31.273 1.266  42.042 1.00 35.23  ? 256 ARG A CB  1 
ATOM   1669 C  CG  . ARG A 1 214 ? 30.837 0.224  43.073 1.00 37.61  ? 256 ARG A CG  1 
ATOM   1670 C  CD  . ARG A 1 214 ? 29.561 0.675  43.791 1.00 41.28  ? 256 ARG A CD  1 
ATOM   1671 N  NE  . ARG A 1 214 ? 29.828 1.845  44.632 1.00 37.06  ? 256 ARG A NE  1 
ATOM   1672 C  CZ  . ARG A 1 214 ? 28.894 2.559  45.248 1.00 41.38  ? 256 ARG A CZ  1 
ATOM   1673 N  NH1 . ARG A 1 214 ? 27.611 2.233  45.123 1.00 36.70  ? 256 ARG A NH1 1 
ATOM   1674 N  NH2 . ARG A 1 214 ? 29.249 3.602  45.999 1.00 35.80  ? 256 ARG A NH2 1 
ATOM   1675 N  N   . ASN A 1 215 ? 32.878 -1.471 40.749 1.00 47.78  ? 257 ASN A N   1 
ATOM   1676 C  CA  . ASN A 1 215 ? 32.690 -2.727 40.017 1.00 51.02  ? 257 ASN A CA  1 
ATOM   1677 C  C   . ASN A 1 215 ? 32.819 -2.433 38.528 1.00 51.65  ? 257 ASN A C   1 
ATOM   1678 O  O   . ASN A 1 215 ? 31.998 -2.869 37.723 1.00 54.42  ? 257 ASN A O   1 
ATOM   1679 C  CB  . ASN A 1 215 ? 31.307 -3.322 40.313 1.00 53.31  ? 257 ASN A CB  1 
ATOM   1680 C  CG  . ASN A 1 215 ? 31.111 -3.649 41.791 1.00 58.46  ? 257 ASN A CG  1 
ATOM   1681 O  OD1 . ASN A 1 215 ? 31.987 -4.242 42.425 1.00 60.83  ? 257 ASN A OD1 1 
ATOM   1682 N  ND2 . ASN A 1 215 ? 29.954 -3.267 42.345 1.00 57.92  ? 257 ASN A ND2 1 
ATOM   1683 N  N   . GLY A 1 216 ? 33.834 -1.648 38.179 1.00 52.86  ? 258 GLY A N   1 
ATOM   1684 C  CA  . GLY A 1 216 ? 34.073 -1.298 36.790 1.00 50.80  ? 258 GLY A CA  1 
ATOM   1685 C  C   . GLY A 1 216 ? 33.073 -0.356 36.146 1.00 50.46  ? 258 GLY A C   1 
ATOM   1686 O  O   . GLY A 1 216 ? 33.280 0.045  35.010 1.00 50.54  ? 258 GLY A O   1 
ATOM   1687 N  N   . GLN A 1 217 ? 31.998 0.007  36.847 1.00 48.55  ? 259 GLN A N   1 
ATOM   1688 C  CA  . GLN A 1 217 ? 30.998 0.899  36.267 1.00 46.56  ? 259 GLN A CA  1 
ATOM   1689 C  C   . GLN A 1 217 ? 31.264 2.365  36.638 1.00 46.04  ? 259 GLN A C   1 
ATOM   1690 O  O   . GLN A 1 217 ? 31.529 2.688  37.806 1.00 39.27  ? 259 GLN A O   1 
ATOM   1691 C  CB  . GLN A 1 217 ? 29.598 0.503  36.731 1.00 53.29  ? 259 GLN A CB  1 
ATOM   1692 C  CG  . GLN A 1 217 ? 28.490 1.319  36.085 1.00 61.90  ? 259 GLN A CG  1 
ATOM   1693 C  CD  . GLN A 1 217 ? 27.128 1.060  36.710 1.00 68.80  ? 259 GLN A CD  1 
ATOM   1694 O  OE1 . GLN A 1 217 ? 26.632 -0.073 36.719 1.00 71.60  ? 259 GLN A OE1 1 
ATOM   1695 N  NE2 . GLN A 1 217 ? 26.517 2.114  37.242 1.00 71.34  ? 259 GLN A NE2 1 
ATOM   1696 N  N   . TRP A 1 218 ? 31.167 3.230  35.630 1.00 41.99  ? 260 TRP A N   1 
ATOM   1697 C  CA  . TRP A 1 218 ? 31.419 4.647  35.772 1.00 42.54  ? 260 TRP A CA  1 
ATOM   1698 C  C   . TRP A 1 218 ? 30.161 5.461  35.987 1.00 43.53  ? 260 TRP A C   1 
ATOM   1699 O  O   . TRP A 1 218 ? 29.246 5.426  35.160 1.00 42.31  ? 260 TRP A O   1 
ATOM   1700 C  CB  . TRP A 1 218 ? 32.133 5.184  34.527 1.00 42.78  ? 260 TRP A CB  1 
ATOM   1701 C  CG  . TRP A 1 218 ? 33.494 4.590  34.259 1.00 42.83  ? 260 TRP A CG  1 
ATOM   1702 C  CD1 . TRP A 1 218 ? 33.780 3.295  33.896 1.00 45.41  ? 260 TRP A CD1 1 
ATOM   1703 C  CD2 . TRP A 1 218 ? 34.749 5.283  34.288 1.00 43.59  ? 260 TRP A CD2 1 
ATOM   1704 N  NE1 . TRP A 1 218 ? 35.140 3.148  33.695 1.00 43.94  ? 260 TRP A NE1 1 
ATOM   1705 C  CE2 . TRP A 1 218 ? 35.755 4.351  33.927 1.00 45.21  ? 260 TRP A CE2 1 
ATOM   1706 C  CE3 . TRP A 1 218 ? 35.122 6.602  34.580 1.00 40.97  ? 260 TRP A CE3 1 
ATOM   1707 C  CZ2 . TRP A 1 218 ? 37.106 4.702  33.850 1.00 44.31  ? 260 TRP A CZ2 1 
ATOM   1708 C  CZ3 . TRP A 1 218 ? 36.464 6.951  34.504 1.00 41.82  ? 260 TRP A CZ3 1 
ATOM   1709 C  CH2 . TRP A 1 218 ? 37.440 6.003  34.141 1.00 44.90  ? 260 TRP A CH2 1 
ATOM   1710 N  N   . THR A 1 219 ? 30.120 6.201  37.096 1.00 38.55  ? 261 THR A N   1 
ATOM   1711 C  CA  . THR A 1 219 ? 28.984 7.068  37.405 1.00 36.27  ? 261 THR A CA  1 
ATOM   1712 C  C   . THR A 1 219 ? 29.495 8.503  37.409 1.00 36.43  ? 261 THR A C   1 
ATOM   1713 O  O   . THR A 1 219 ? 30.433 8.848  38.146 1.00 30.70  ? 261 THR A O   1 
ATOM   1714 C  CB  . THR A 1 219 ? 28.387 6.746  38.779 1.00 39.41  ? 261 THR A CB  1 
ATOM   1715 O  OG1 . THR A 1 219 ? 27.928 5.392  38.785 1.00 37.53  ? 261 THR A OG1 1 
ATOM   1716 C  CG2 . THR A 1 219 ? 27.224 7.669  39.093 1.00 36.94  ? 261 THR A CG2 1 
ATOM   1717 N  N   . LEU A 1 220 ? 28.883 9.336  36.577 1.00 34.05  ? 262 LEU A N   1 
ATOM   1718 C  CA  . LEU A 1 220 ? 29.300 10.713 36.460 1.00 35.90  ? 262 LEU A CA  1 
ATOM   1719 C  C   . LEU A 1 220 ? 29.075 11.539 37.726 1.00 36.86  ? 262 LEU A C   1 
ATOM   1720 O  O   . LEU A 1 220 ? 28.005 11.499 38.340 1.00 33.78  ? 262 LEU A O   1 
ATOM   1721 C  CB  . LEU A 1 220 ? 28.571 11.389 35.302 1.00 36.43  ? 262 LEU A CB  1 
ATOM   1722 C  CG  . LEU A 1 220 ? 28.898 12.867 35.066 1.00 36.77  ? 262 LEU A CG  1 
ATOM   1723 C  CD1 . LEU A 1 220 ? 30.283 13.004 34.415 1.00 39.41  ? 262 LEU A CD1 1 
ATOM   1724 C  CD2 . LEU A 1 220 ? 27.831 13.478 34.151 1.00 42.58  ? 262 LEU A CD2 1 
ATOM   1725 N  N   . ILE A 1 221 ? 30.093 12.291 38.123 1.00 33.40  ? 263 ILE A N   1 
ATOM   1726 C  CA  . ILE A 1 221 ? 29.935 13.165 39.275 1.00 35.50  ? 263 ILE A CA  1 
ATOM   1727 C  C   . ILE A 1 221 ? 29.661 14.543 38.676 1.00 34.04  ? 263 ILE A C   1 
ATOM   1728 O  O   . ILE A 1 221 ? 28.681 15.206 39.023 1.00 38.52  ? 263 ILE A O   1 
ATOM   1729 C  CB  . ILE A 1 221 ? 31.209 13.189 40.163 1.00 34.11  ? 263 ILE A CB  1 
ATOM   1730 C  CG1 . ILE A 1 221 ? 31.408 11.813 40.803 1.00 38.15  ? 263 ILE A CG1 1 
ATOM   1731 C  CG2 . ILE A 1 221 ? 31.056 14.270 41.247 1.00 32.75  ? 263 ILE A CG2 1 
ATOM   1732 C  CD1 . ILE A 1 221 ? 32.710 11.643 41.611 1.00 38.15  ? 263 ILE A CD1 1 
ATOM   1733 N  N   . GLY A 1 222 ? 30.518 14.965 37.756 1.00 31.80  ? 264 GLY A N   1 
ATOM   1734 C  CA  . GLY A 1 222 ? 30.332 16.250 37.108 1.00 33.44  ? 264 GLY A CA  1 
ATOM   1735 C  C   . GLY A 1 222 ? 31.158 16.340 35.838 1.00 34.72  ? 264 GLY A C   1 
ATOM   1736 O  O   . GLY A 1 222 ? 32.208 15.688 35.720 1.00 30.25  ? 264 GLY A O   1 
ATOM   1737 N  N   . ARG A 1 223 ? 30.710 17.171 34.905 1.00 33.53  ? 265 ARG A N   1 
ATOM   1738 C  CA  . ARG A 1 223 ? 31.393 17.354 33.615 1.00 36.08  ? 265 ARG A CA  1 
ATOM   1739 C  C   . ARG A 1 223 ? 31.156 18.795 33.222 1.00 35.64  ? 265 ARG A C   1 
ATOM   1740 O  O   . ARG A 1 223 ? 30.008 19.238 33.156 1.00 34.56  ? 265 ARG A O   1 
ATOM   1741 C  CB  . ARG A 1 223 ? 30.773 16.406 32.593 1.00 41.59  ? 265 ARG A CB  1 
ATOM   1742 C  CG  . ARG A 1 223 ? 31.242 16.565 31.169 1.00 50.60  ? 265 ARG A CG  1 
ATOM   1743 C  CD  . ARG A 1 223 ? 30.713 15.386 30.346 1.00 54.58  ? 265 ARG A CD  1 
ATOM   1744 N  NE  . ARG A 1 223 ? 30.974 15.534 28.918 1.00 58.56  ? 265 ARG A NE  1 
ATOM   1745 C  CZ  . ARG A 1 223 ? 30.185 16.195 28.079 1.00 60.13  ? 265 ARG A CZ  1 
ATOM   1746 N  NH1 . ARG A 1 223 ? 29.078 16.774 28.524 1.00 58.81  ? 265 ARG A NH1 1 
ATOM   1747 N  NH2 . ARG A 1 223 ? 30.497 16.266 26.791 1.00 63.63  ? 265 ARG A NH2 1 
ATOM   1748 N  N   A GLN A 1 224 ? 32.216 19.543 32.932 1.00 35.10  ? 266 GLN A N   1 
ATOM   1749 C  CA  A GLN A 1 224 ? 32.046 20.950 32.603 0.52 33.98  ? 266 GLN A CA  1 
ATOM   1750 C  CA  B GLN A 1 224 ? 32.039 20.946 32.577 0.48 33.94  ? 266 GLN A CA  1 
ATOM   1751 C  C   A GLN A 1 224 ? 33.160 21.533 31.734 1.00 36.36  ? 266 GLN A C   1 
ATOM   1752 O  O   A GLN A 1 224 ? 34.292 21.051 31.756 1.00 33.95  ? 266 GLN A O   1 
ATOM   1753 C  CB  A GLN A 1 224 ? 31.956 21.735 33.916 0.52 35.38  ? 266 GLN A CB  1 
ATOM   1754 C  CB  B GLN A 1 224 ? 31.900 21.788 33.843 0.48 35.07  ? 266 GLN A CB  1 
ATOM   1755 C  CG  A GLN A 1 224 ? 31.602 23.204 33.772 0.52 35.98  ? 266 GLN A CG  1 
ATOM   1756 C  CG  B GLN A 1 224 ? 31.690 23.272 33.561 0.48 35.17  ? 266 GLN A CG  1 
ATOM   1757 C  CD  A GLN A 1 224 ? 30.238 23.397 33.144 0.52 36.30  ? 266 GLN A CD  1 
ATOM   1758 C  CD  B GLN A 1 224 ? 31.967 24.136 34.762 0.48 33.71  ? 266 GLN A CD  1 
ATOM   1759 O  OE1 A GLN A 1 224 ? 30.045 23.122 31.963 0.52 37.20  ? 266 GLN A OE1 1 
ATOM   1760 O  OE1 B GLN A 1 224 ? 31.528 23.833 35.867 0.48 37.59  ? 266 GLN A OE1 1 
ATOM   1761 N  NE2 A GLN A 1 224 ? 29.280 23.852 33.940 0.52 35.23  ? 266 GLN A NE2 1 
ATOM   1762 N  NE2 B GLN A 1 224 ? 32.697 25.223 34.556 0.48 32.83  ? 266 GLN A NE2 1 
ATOM   1763 N  N   . ASN A 1 225 ? 32.830 22.585 30.987 1.00 34.87  ? 267 ASN A N   1 
ATOM   1764 C  CA  . ASN A 1 225 ? 33.793 23.274 30.145 1.00 37.03  ? 267 ASN A CA  1 
ATOM   1765 C  C   . ASN A 1 225 ? 34.425 24.249 31.125 1.00 36.43  ? 267 ASN A C   1 
ATOM   1766 O  O   . ASN A 1 225 ? 33.721 25.085 31.699 1.00 37.43  ? 267 ASN A O   1 
ATOM   1767 C  CB  . ASN A 1 225 ? 33.079 24.060 29.037 1.00 40.59  ? 267 ASN A CB  1 
ATOM   1768 C  CG  . ASN A 1 225 ? 34.040 24.903 28.196 1.00 45.98  ? 267 ASN A CG  1 
ATOM   1769 O  OD1 . ASN A 1 225 ? 35.207 25.098 28.558 1.00 42.21  ? 267 ASN A OD1 1 
ATOM   1770 N  ND2 . ASN A 1 225 ? 33.538 25.428 27.072 1.00 46.68  ? 267 ASN A ND2 1 
ATOM   1771 N  N   . PRO A 1 226 ? 35.755 24.151 31.348 1.00 33.57  ? 268 PRO A N   1 
ATOM   1772 C  CA  . PRO A 1 226 ? 36.411 25.070 32.289 1.00 29.21  ? 268 PRO A CA  1 
ATOM   1773 C  C   . PRO A 1 226 ? 36.469 26.517 31.799 1.00 31.77  ? 268 PRO A C   1 
ATOM   1774 O  O   . PRO A 1 226 ? 36.872 27.420 32.545 1.00 31.24  ? 268 PRO A O   1 
ATOM   1775 C  CB  . PRO A 1 226 ? 37.804 24.448 32.478 1.00 31.61  ? 268 PRO A CB  1 
ATOM   1776 C  CG  . PRO A 1 226 ? 38.084 23.823 31.107 1.00 30.91  ? 268 PRO A CG  1 
ATOM   1777 C  CD  . PRO A 1 226 ? 36.719 23.228 30.718 1.00 31.67  ? 268 PRO A CD  1 
ATOM   1778 N  N   . GLN A 1 227 ? 36.074 26.751 30.548 1.00 31.67  ? 269 GLN A N   1 
ATOM   1779 C  CA  . GLN A 1 227 ? 36.093 28.120 30.028 1.00 33.85  ? 269 GLN A CA  1 
ATOM   1780 C  C   . GLN A 1 227 ? 34.787 28.835 30.423 1.00 36.80  ? 269 GLN A C   1 
ATOM   1781 O  O   . GLN A 1 227 ? 34.663 30.054 30.289 1.00 38.17  ? 269 GLN A O   1 
ATOM   1782 C  CB  . GLN A 1 227 ? 36.290 28.111 28.506 1.00 33.94  ? 269 GLN A CB  1 
ATOM   1783 C  CG  . GLN A 1 227 ? 37.641 27.506 28.053 1.00 32.42  ? 269 GLN A CG  1 
ATOM   1784 C  CD  . GLN A 1 227 ? 38.823 27.880 28.960 1.00 32.46  ? 269 GLN A CD  1 
ATOM   1785 O  OE1 . GLN A 1 227 ? 38.978 29.033 29.376 1.00 36.63  ? 269 GLN A OE1 1 
ATOM   1786 N  NE2 . GLN A 1 227 ? 39.673 26.899 29.249 1.00 34.51  ? 269 GLN A NE2 1 
ATOM   1787 N  N   . LEU A 1 228 ? 33.820 28.063 30.913 1.00 37.53  ? 270 LEU A N   1 
ATOM   1788 C  CA  . LEU A 1 228 ? 32.559 28.621 31.406 1.00 40.07  ? 270 LEU A CA  1 
ATOM   1789 C  C   . LEU A 1 228 ? 32.847 29.129 32.833 1.00 41.65  ? 270 LEU A C   1 
ATOM   1790 O  O   . LEU A 1 228 ? 33.888 28.786 33.432 1.00 39.66  ? 270 LEU A O   1 
ATOM   1791 C  CB  . LEU A 1 228 ? 31.486 27.532 31.438 1.00 43.98  ? 270 LEU A CB  1 
ATOM   1792 C  CG  . LEU A 1 228 ? 30.488 27.486 30.277 1.00 46.56  ? 270 LEU A CG  1 
ATOM   1793 C  CD1 . LEU A 1 228 ? 31.141 27.898 28.983 1.00 51.89  ? 270 LEU A CD1 1 
ATOM   1794 C  CD2 . LEU A 1 228 ? 29.907 26.088 30.175 1.00 50.00  ? 270 LEU A CD2 1 
ATOM   1795 N  N   . PRO A 1 229 ? 31.951 29.958 33.398 1.00 39.24  ? 271 PRO A N   1 
ATOM   1796 C  CA  . PRO A 1 229 ? 32.189 30.473 34.756 1.00 36.67  ? 271 PRO A CA  1 
ATOM   1797 C  C   . PRO A 1 229 ? 32.502 29.334 35.731 1.00 32.58  ? 271 PRO A C   1 
ATOM   1798 O  O   . PRO A 1 229 ? 31.793 28.334 35.768 1.00 32.45  ? 271 PRO A O   1 
ATOM   1799 C  CB  . PRO A 1 229 ? 30.887 31.207 35.074 1.00 39.78  ? 271 PRO A CB  1 
ATOM   1800 C  CG  . PRO A 1 229 ? 30.434 31.697 33.685 1.00 38.92  ? 271 PRO A CG  1 
ATOM   1801 C  CD  . PRO A 1 229 ? 30.676 30.462 32.848 1.00 41.85  ? 271 PRO A CD  1 
ATOM   1802 N  N   . GLN A 1 230 ? 33.585 29.487 36.488 1.00 30.32  ? 272 GLN A N   1 
ATOM   1803 C  CA  . GLN A 1 230 ? 34.034 28.450 37.421 1.00 32.03  ? 272 GLN A CA  1 
ATOM   1804 C  C   . GLN A 1 230 ? 33.405 28.523 38.805 1.00 29.26  ? 272 GLN A C   1 
ATOM   1805 O  O   . GLN A 1 230 ? 34.062 28.778 39.821 1.00 28.29  ? 272 GLN A O   1 
ATOM   1806 C  CB  . GLN A 1 230 ? 35.573 28.482 37.487 1.00 30.72  ? 272 GLN A CB  1 
ATOM   1807 C  CG  . GLN A 1 230 ? 36.206 28.119 36.123 1.00 31.46  ? 272 GLN A CG  1 
ATOM   1808 C  CD  . GLN A 1 230 ? 37.739 28.209 36.119 1.00 33.67  ? 272 GLN A CD  1 
ATOM   1809 O  OE1 . GLN A 1 230 ? 38.349 28.575 37.125 1.00 32.09  ? 272 GLN A OE1 1 
ATOM   1810 N  NE2 . GLN A 1 230 ? 38.360 27.873 34.982 1.00 29.25  ? 272 GLN A NE2 1 
ATOM   1811 N  N   . ALA A 1 231 ? 32.092 28.320 38.824 1.00 32.63  ? 273 ALA A N   1 
ATOM   1812 C  CA  . ALA A 1 231 ? 31.330 28.320 40.063 1.00 30.87  ? 273 ALA A CA  1 
ATOM   1813 C  C   . ALA A 1 231 ? 31.208 26.884 40.544 1.00 28.32  ? 273 ALA A C   1 
ATOM   1814 O  O   . ALA A 1 231 ? 31.615 25.940 39.859 1.00 27.93  ? 273 ALA A O   1 
ATOM   1815 C  CB  . ALA A 1 231 ? 29.918 28.857 39.793 1.00 36.37  ? 273 ALA A CB  1 
ATOM   1816 N  N   . PHE A 1 232 ? 30.636 26.705 41.723 1.00 25.93  ? 274 PHE A N   1 
ATOM   1817 C  CA  . PHE A 1 232 ? 30.347 25.351 42.132 1.00 28.67  ? 274 PHE A CA  1 
ATOM   1818 C  C   . PHE A 1 232 ? 28.977 25.124 41.504 1.00 31.02  ? 274 PHE A C   1 
ATOM   1819 O  O   . PHE A 1 232 ? 28.055 25.945 41.711 1.00 32.05  ? 274 PHE A O   1 
ATOM   1820 C  CB  . PHE A 1 232 ? 30.233 25.204 43.655 1.00 27.70  ? 274 PHE A CB  1 
ATOM   1821 C  CG  . PHE A 1 232 ? 31.541 24.842 44.310 1.00 27.47  ? 274 PHE A CG  1 
ATOM   1822 C  CD1 . PHE A 1 232 ? 32.355 25.829 44.836 1.00 28.16  ? 274 PHE A CD1 1 
ATOM   1823 C  CD2 . PHE A 1 232 ? 32.008 23.523 44.269 1.00 24.59  ? 274 PHE A CD2 1 
ATOM   1824 C  CE1 . PHE A 1 232 ? 33.637 25.526 45.312 1.00 29.14  ? 274 PHE A CE1 1 
ATOM   1825 C  CE2 . PHE A 1 232 ? 33.287 23.211 44.746 1.00 25.91  ? 274 PHE A CE2 1 
ATOM   1826 C  CZ  . PHE A 1 232 ? 34.095 24.218 45.265 1.00 28.54  ? 274 PHE A CZ  1 
ATOM   1827 N  N   . TYR A 1 233 ? 28.847 24.047 40.733 1.00 29.31  ? 275 TYR A N   1 
ATOM   1828 C  CA  . TYR A 1 233 ? 27.559 23.707 40.104 1.00 30.41  ? 275 TYR A CA  1 
ATOM   1829 C  C   . TYR A 1 233 ? 26.967 22.526 40.855 1.00 32.74  ? 275 TYR A C   1 
ATOM   1830 O  O   . TYR A 1 233 ? 27.695 21.618 41.294 1.00 29.82  ? 275 TYR A O   1 
ATOM   1831 C  CB  . TYR A 1 233 ? 27.749 23.316 38.623 1.00 28.70  ? 275 TYR A CB  1 
ATOM   1832 C  CG  . TYR A 1 233 ? 28.147 24.489 37.738 1.00 34.76  ? 275 TYR A CG  1 
ATOM   1833 C  CD1 . TYR A 1 233 ? 29.485 24.794 37.513 1.00 33.33  ? 275 TYR A CD1 1 
ATOM   1834 C  CD2 . TYR A 1 233 ? 27.174 25.332 37.171 1.00 34.68  ? 275 TYR A CD2 1 
ATOM   1835 C  CE1 . TYR A 1 233 ? 29.864 25.909 36.746 1.00 32.62  ? 275 TYR A CE1 1 
ATOM   1836 C  CE2 . TYR A 1 233 ? 27.539 26.454 36.404 1.00 36.53  ? 275 TYR A CE2 1 
ATOM   1837 C  CZ  . TYR A 1 233 ? 28.884 26.736 36.197 1.00 36.82  ? 275 TYR A CZ  1 
ATOM   1838 O  OH  . TYR A 1 233 ? 29.259 27.848 35.477 1.00 33.71  ? 275 TYR A OH  1 
ATOM   1839 N  N   . PRO A 1 234 ? 25.629 22.505 41.020 1.00 33.34  ? 276 PRO A N   1 
ATOM   1840 C  CA  . PRO A 1 234 ? 25.047 21.370 41.735 1.00 35.58  ? 276 PRO A CA  1 
ATOM   1841 C  C   . PRO A 1 234 ? 25.210 20.089 40.922 1.00 36.98  ? 276 PRO A C   1 
ATOM   1842 O  O   . PRO A 1 234 ? 25.274 20.116 39.688 1.00 36.78  ? 276 PRO A O   1 
ATOM   1843 C  CB  . PRO A 1 234 ? 23.571 21.779 41.904 1.00 37.01  ? 276 PRO A CB  1 
ATOM   1844 C  CG  . PRO A 1 234 ? 23.326 22.645 40.687 1.00 38.52  ? 276 PRO A CG  1 
ATOM   1845 C  CD  . PRO A 1 234 ? 24.590 23.469 40.604 1.00 36.34  ? 276 PRO A CD  1 
ATOM   1846 N  N   . VAL A 1 235 ? 25.308 18.960 41.609 1.00 35.73  ? 277 VAL A N   1 
ATOM   1847 C  CA  . VAL A 1 235 ? 25.422 17.697 40.905 1.00 41.08  ? 277 VAL A CA  1 
ATOM   1848 C  C   . VAL A 1 235 ? 24.035 17.375 40.335 1.00 44.55  ? 277 VAL A C   1 
ATOM   1849 O  O   . VAL A 1 235 ? 23.025 17.693 40.959 1.00 44.25  ? 277 VAL A O   1 
ATOM   1850 C  CB  . VAL A 1 235 ? 25.877 16.576 41.865 1.00 39.15  ? 277 VAL A CB  1 
ATOM   1851 C  CG1 . VAL A 1 235 ? 25.686 15.238 41.229 1.00 42.68  ? 277 VAL A CG1 1 
ATOM   1852 C  CG2 . VAL A 1 235 ? 27.344 16.752 42.192 1.00 35.63  ? 277 VAL A CG2 1 
ATOM   1853 N  N   . GLU A 1 236 ? 23.991 16.773 39.146 1.00 47.79  ? 278 GLU A N   1 
ATOM   1854 C  CA  . GLU A 1 236 ? 22.722 16.403 38.520 1.00 51.41  ? 278 GLU A CA  1 
ATOM   1855 C  C   . GLU A 1 236 ? 21.932 15.463 39.430 1.00 52.02  ? 278 GLU A C   1 
ATOM   1856 O  O   . GLU A 1 236 ? 20.742 15.674 39.680 1.00 51.13  ? 278 GLU A O   1 
ATOM   1857 C  CB  . GLU A 1 236 ? 22.970 15.719 37.171 1.00 57.45  ? 278 GLU A CB  1 
ATOM   1858 C  CG  . GLU A 1 236 ? 24.349 15.030 37.020 1.00 65.40  ? 278 GLU A CG  1 
ATOM   1859 C  CD  . GLU A 1 236 ? 24.607 13.901 38.024 1.00 69.22  ? 278 GLU A CD  1 
ATOM   1860 O  OE1 . GLU A 1 236 ? 23.800 12.949 38.084 1.00 73.13  ? 278 GLU A OE1 1 
ATOM   1861 O  OE2 . GLU A 1 236 ? 25.627 13.960 38.747 1.00 67.70  ? 278 GLU A OE2 1 
ATOM   1862 N  N   . HIS A 1 237 ? 22.606 14.432 39.924 1.00 50.40  ? 279 HIS A N   1 
ATOM   1863 C  CA  . HIS A 1 237 ? 21.989 13.454 40.813 1.00 55.11  ? 279 HIS A CA  1 
ATOM   1864 C  C   . HIS A 1 237 ? 22.904 13.180 42.008 1.00 53.67  ? 279 HIS A C   1 
ATOM   1865 O  O   . HIS A 1 237 ? 24.111 13.056 41.855 1.00 51.39  ? 279 HIS A O   1 
ATOM   1866 C  CB  . HIS A 1 237 ? 21.747 12.140 40.067 1.00 59.16  ? 279 HIS A CB  1 
ATOM   1867 C  CG  . HIS A 1 237 ? 20.915 12.287 38.829 1.00 65.80  ? 279 HIS A CG  1 
ATOM   1868 N  ND1 . HIS A 1 237 ? 21.317 13.036 37.744 1.00 68.04  ? 279 HIS A ND1 1 
ATOM   1869 C  CD2 . HIS A 1 237 ? 19.710 11.764 38.496 1.00 66.91  ? 279 HIS A CD2 1 
ATOM   1870 C  CE1 . HIS A 1 237 ? 20.399 12.967 36.795 1.00 67.93  ? 279 HIS A CE1 1 
ATOM   1871 N  NE2 . HIS A 1 237 ? 19.414 12.200 37.227 1.00 69.51  ? 279 HIS A NE2 1 
ATOM   1872 N  N   . PRO A 1 238 ? 22.339 13.081 43.216 1.00 54.01  ? 280 PRO A N   1 
ATOM   1873 C  CA  . PRO A 1 238 ? 23.188 12.811 44.382 1.00 53.46  ? 280 PRO A CA  1 
ATOM   1874 C  C   . PRO A 1 238 ? 24.024 11.552 44.089 1.00 51.40  ? 280 PRO A C   1 
ATOM   1875 O  O   . PRO A 1 238 ? 23.521 10.608 43.477 1.00 53.73  ? 280 PRO A O   1 
ATOM   1876 C  CB  . PRO A 1 238 ? 22.175 12.570 45.500 1.00 56.00  ? 280 PRO A CB  1 
ATOM   1877 C  CG  . PRO A 1 238 ? 20.979 13.362 45.062 1.00 58.28  ? 280 PRO A CG  1 
ATOM   1878 C  CD  . PRO A 1 238 ? 20.913 13.071 43.583 1.00 56.97  ? 280 PRO A CD  1 
ATOM   1879 N  N   . VAL A 1 239 ? 25.290 11.542 44.496 1.00 43.87  ? 281 VAL A N   1 
ATOM   1880 C  CA  . VAL A 1 239 ? 26.149 10.381 44.247 1.00 41.55  ? 281 VAL A CA  1 
ATOM   1881 C  C   . VAL A 1 239 ? 26.987 10.081 45.485 1.00 38.34  ? 281 VAL A C   1 
ATOM   1882 O  O   . VAL A 1 239 ? 27.697 10.961 45.952 1.00 36.92  ? 281 VAL A O   1 
ATOM   1883 C  CB  . VAL A 1 239 ? 27.162 10.645 43.092 1.00 44.52  ? 281 VAL A CB  1 
ATOM   1884 C  CG1 . VAL A 1 239 ? 28.076 9.431  42.912 1.00 42.22  ? 281 VAL A CG1 1 
ATOM   1885 C  CG2 . VAL A 1 239 ? 26.436 10.968 41.802 1.00 44.79  ? 281 VAL A CG2 1 
ATOM   1886 N  N   . ASP A 1 240 ? 26.892 8.872  46.034 1.00 32.40  ? 282 ASP A N   1 
ATOM   1887 C  CA  . ASP A 1 240 ? 27.737 8.533  47.181 1.00 31.35  ? 282 ASP A CA  1 
ATOM   1888 C  C   . ASP A 1 240 ? 29.044 7.925  46.681 1.00 30.24  ? 282 ASP A C   1 
ATOM   1889 O  O   . ASP A 1 240 ? 29.070 7.281  45.649 1.00 31.38  ? 282 ASP A O   1 
ATOM   1890 C  CB  . ASP A 1 240 ? 27.073 7.493  48.080 1.00 31.41  ? 282 ASP A CB  1 
ATOM   1891 C  CG  . ASP A 1 240 ? 26.809 6.189  47.352 1.00 38.56  ? 282 ASP A CG  1 
ATOM   1892 O  OD1 . ASP A 1 240 ? 27.542 5.192  47.573 1.00 39.55  ? 282 ASP A OD1 1 
ATOM   1893 O  OD2 . ASP A 1 240 ? 25.872 6.172  46.532 1.00 35.46  ? 282 ASP A OD2 1 
ATOM   1894 N  N   . VAL A 1 241 ? 30.126 8.152  47.422 1.00 29.88  ? 283 VAL A N   1 
ATOM   1895 C  CA  . VAL A 1 241 ? 31.420 7.547  47.122 1.00 30.82  ? 283 VAL A CA  1 
ATOM   1896 C  C   . VAL A 1 241 ? 31.728 6.791  48.418 1.00 32.12  ? 283 VAL A C   1 
ATOM   1897 O  O   . VAL A 1 241 ? 31.737 7.368  49.504 1.00 32.29  ? 283 VAL A O   1 
ATOM   1898 C  CB  . VAL A 1 241 ? 32.477 8.595  46.806 1.00 31.72  ? 283 VAL A CB  1 
ATOM   1899 C  CG1 . VAL A 1 241 ? 33.825 7.915  46.567 1.00 30.91  ? 283 VAL A CG1 1 
ATOM   1900 C  CG2 . VAL A 1 241 ? 32.055 9.367  45.550 1.00 27.12  ? 283 VAL A CG2 1 
ATOM   1901 N  N   . THR A 1 242 ? 31.945 5.486  48.293 1.00 33.50  ? 284 THR A N   1 
ATOM   1902 C  CA  . THR A 1 242 ? 32.155 4.623  49.437 1.00 34.45  ? 284 THR A CA  1 
ATOM   1903 C  C   . THR A 1 242 ? 33.458 3.842  49.374 1.00 34.80  ? 284 THR A C   1 
ATOM   1904 O  O   . THR A 1 242 ? 34.042 3.672  48.297 1.00 32.06  ? 284 THR A O   1 
ATOM   1905 C  CB  . THR A 1 242 ? 30.959 3.638  49.547 1.00 41.06  ? 284 THR A CB  1 
ATOM   1906 O  OG1 . THR A 1 242 ? 29.757 4.396  49.774 1.00 45.90  ? 284 THR A OG1 1 
ATOM   1907 C  CG2 . THR A 1 242 ? 31.160 2.636  50.680 1.00 46.11  ? 284 THR A CG2 1 
ATOM   1908 N  N   . PHE A 1 243 ? 33.895 3.392  50.549 1.00 37.06  ? 285 PHE A N   1 
ATOM   1909 C  CA  . PHE A 1 243 ? 35.131 2.634  50.733 1.00 38.24  ? 285 PHE A CA  1 
ATOM   1910 C  C   . PHE A 1 243 ? 35.213 1.591  49.640 1.00 40.07  ? 285 PHE A C   1 
ATOM   1911 O  O   . PHE A 1 243 ? 34.290 0.790  49.466 1.00 36.94  ? 285 PHE A O   1 
ATOM   1912 C  CB  . PHE A 1 243 ? 35.112 1.968  52.113 1.00 41.46  ? 285 PHE A CB  1 
ATOM   1913 C  CG  . PHE A 1 243 ? 36.465 1.515  52.602 1.00 46.59  ? 285 PHE A CG  1 
ATOM   1914 C  CD1 . PHE A 1 243 ? 37.052 2.121  53.711 1.00 47.22  ? 285 PHE A CD1 1 
ATOM   1915 C  CD2 . PHE A 1 243 ? 37.131 0.458  51.979 1.00 49.51  ? 285 PHE A CD2 1 
ATOM   1916 C  CE1 . PHE A 1 243 ? 38.284 1.682  54.204 1.00 49.42  ? 285 PHE A CE1 1 
ATOM   1917 C  CE2 . PHE A 1 243 ? 38.362 0.008  52.456 1.00 51.24  ? 285 PHE A CE2 1 
ATOM   1918 C  CZ  . PHE A 1 243 ? 38.939 0.622  53.573 1.00 50.58  ? 285 PHE A CZ  1 
ATOM   1919 N  N   . GLY A 1 244 ? 36.315 1.610  48.896 1.00 39.54  ? 286 GLY A N   1 
ATOM   1920 C  CA  . GLY A 1 244 ? 36.478 0.665  47.810 1.00 37.83  ? 286 GLY A CA  1 
ATOM   1921 C  C   . GLY A 1 244 ? 36.301 1.289  46.434 1.00 39.07  ? 286 GLY A C   1 
ATOM   1922 O  O   . GLY A 1 244 ? 36.895 0.819  45.464 1.00 39.81  ? 286 GLY A O   1 
ATOM   1923 N  N   . ASP A 1 245 ? 35.503 2.351  46.330 1.00 34.25  ? 287 ASP A N   1 
ATOM   1924 C  CA  . ASP A 1 245 ? 35.276 2.984  45.033 1.00 33.75  ? 287 ASP A CA  1 
ATOM   1925 C  C   . ASP A 1 245 ? 36.557 3.666  44.560 1.00 33.19  ? 287 ASP A C   1 
ATOM   1926 O  O   . ASP A 1 245 ? 37.466 3.933  45.344 1.00 33.17  ? 287 ASP A O   1 
ATOM   1927 C  CB  . ASP A 1 245 ? 34.194 4.082  45.116 1.00 33.77  ? 287 ASP A CB  1 
ATOM   1928 C  CG  . ASP A 1 245 ? 32.793 3.534  45.388 1.00 41.36  ? 287 ASP A CG  1 
ATOM   1929 O  OD1 . ASP A 1 245 ? 31.921 4.337  45.790 1.00 38.11  ? 287 ASP A OD1 1 
ATOM   1930 O  OD2 . ASP A 1 245 ? 32.552 2.323  45.185 1.00 38.15  ? 287 ASP A OD2 1 
ATOM   1931 N  N   . ILE A 1 246 ? 36.626 3.952  43.273 1.00 33.84  ? 288 ILE A N   1 
ATOM   1932 C  CA  . ILE A 1 246 ? 37.782 4.688  42.758 1.00 35.93  ? 288 ILE A CA  1 
ATOM   1933 C  C   . ILE A 1 246 ? 37.228 5.987  42.191 1.00 34.49  ? 288 ILE A C   1 
ATOM   1934 O  O   . ILE A 1 246 ? 36.207 5.979  41.519 1.00 36.44  ? 288 ILE A O   1 
ATOM   1935 C  CB  . ILE A 1 246 ? 38.502 3.908  41.638 1.00 38.77  ? 288 ILE A CB  1 
ATOM   1936 C  CG1 . ILE A 1 246 ? 39.266 2.733  42.258 1.00 39.32  ? 288 ILE A CG1 1 
ATOM   1937 C  CG2 . ILE A 1 246 ? 39.463 4.824  40.871 1.00 38.37  ? 288 ILE A CG2 1 
ATOM   1938 C  CD1 . ILE A 1 246 ? 39.702 1.719  41.240 1.00 47.47  ? 288 ILE A CD1 1 
ATOM   1939 N  N   . LEU A 1 247 ? 37.864 7.105  42.520 1.00 34.23  ? 289 LEU A N   1 
ATOM   1940 C  CA  . LEU A 1 247 ? 37.462 8.399  41.969 1.00 33.81  ? 289 LEU A CA  1 
ATOM   1941 C  C   . LEU A 1 247 ? 38.403 8.579  40.793 1.00 34.77  ? 289 LEU A C   1 
ATOM   1942 O  O   . LEU A 1 247 ? 39.616 8.349  40.917 1.00 34.22  ? 289 LEU A O   1 
ATOM   1943 C  CB  . LEU A 1 247 ? 37.676 9.535  42.969 1.00 30.30  ? 289 LEU A CB  1 
ATOM   1944 C  CG  . LEU A 1 247 ? 36.607 9.588  44.071 1.00 36.31  ? 289 LEU A CG  1 
ATOM   1945 C  CD1 . LEU A 1 247 ? 37.032 10.553 45.151 1.00 35.05  ? 289 LEU A CD1 1 
ATOM   1946 C  CD2 . LEU A 1 247 ? 35.281 10.012 43.481 1.00 35.33  ? 289 LEU A CD2 1 
ATOM   1947 N  N   . ALA A 1 248 ? 37.843 8.983  39.665 1.00 32.68  ? 290 ALA A N   1 
ATOM   1948 C  CA  . ALA A 1 248 ? 38.622 9.183  38.455 1.00 32.20  ? 290 ALA A CA  1 
ATOM   1949 C  C   . ALA A 1 248 ? 38.202 10.468 37.782 1.00 33.27  ? 290 ALA A C   1 
ATOM   1950 O  O   . ALA A 1 248 ? 36.995 10.749 37.638 1.00 33.97  ? 290 ALA A O   1 
ATOM   1951 C  CB  . ALA A 1 248 ? 38.395 8.021  37.502 1.00 33.71  ? 290 ALA A CB  1 
ATOM   1952 N  N   . ALA A 1 249 ? 39.193 11.254 37.368 1.00 28.24  ? 291 ALA A N   1 
ATOM   1953 C  CA  . ALA A 1 249 ? 38.925 12.501 36.683 1.00 30.47  ? 291 ALA A CA  1 
ATOM   1954 C  C   . ALA A 1 249 ? 39.875 12.672 35.499 1.00 31.86  ? 291 ALA A C   1 
ATOM   1955 O  O   . ALA A 1 249 ? 41.005 12.194 35.515 1.00 33.13  ? 291 ALA A O   1 
ATOM   1956 C  CB  . ALA A 1 249 ? 39.099 13.674 37.634 1.00 31.34  ? 291 ALA A CB  1 
ATOM   1957 N  N   . ARG A 1 250 ? 39.395 13.365 34.483 1.00 29.27  ? 292 ARG A N   1 
ATOM   1958 C  CA  . ARG A 1 250 ? 40.191 13.638 33.313 1.00 29.83  ? 292 ARG A CA  1 
ATOM   1959 C  C   . ARG A 1 250 ? 39.948 15.047 32.831 1.00 32.85  ? 292 ARG A C   1 
ATOM   1960 O  O   . ARG A 1 250 ? 38.800 15.520 32.780 1.00 33.04  ? 292 ARG A O   1 
ATOM   1961 C  CB  . ARG A 1 250 ? 39.828 12.669 32.175 1.00 32.13  ? 292 ARG A CB  1 
ATOM   1962 C  CG  . ARG A 1 250 ? 40.203 13.186 30.775 1.00 30.36  ? 292 ARG A CG  1 
ATOM   1963 C  CD  . ARG A 1 250 ? 40.016 12.126 29.668 1.00 35.30  ? 292 ARG A CD  1 
ATOM   1964 N  NE  . ARG A 1 250 ? 40.972 11.036 29.809 1.00 37.72  ? 292 ARG A NE  1 
ATOM   1965 C  CZ  . ARG A 1 250 ? 41.071 9.995  28.979 1.00 41.62  ? 292 ARG A CZ  1 
ATOM   1966 N  NH1 . ARG A 1 250 ? 40.268 9.889  27.925 1.00 42.39  ? 292 ARG A NH1 1 
ATOM   1967 N  NH2 . ARG A 1 250 ? 41.975 9.055  29.208 1.00 37.00  ? 292 ARG A NH2 1 
ATOM   1968 N  N   A CYS A 1 251 ? 41.039 15.736 32.538 1.00 32.65  ? 293 CYS A N   1 
ATOM   1969 C  CA  A CYS A 1 251 ? 40.990 17.086 31.982 0.80 32.42  ? 293 CYS A CA  1 
ATOM   1970 C  CA  B CYS A 1 251 ? 40.961 17.068 31.977 0.20 33.55  ? 293 CYS A CA  1 
ATOM   1971 C  C   A CYS A 1 251 ? 41.530 16.912 30.581 1.00 33.25  ? 293 CYS A C   1 
ATOM   1972 O  O   A CYS A 1 251 ? 42.564 16.266 30.399 1.00 32.44  ? 293 CYS A O   1 
ATOM   1973 C  CB  A CYS A 1 251 ? 41.946 18.052 32.680 0.80 33.28  ? 293 CYS A CB  1 
ATOM   1974 C  CB  B CYS A 1 251 ? 41.819 18.054 32.744 0.20 34.62  ? 293 CYS A CB  1 
ATOM   1975 S  SG  A CYS A 1 251 ? 41.502 18.621 34.350 0.80 33.12  ? 293 CYS A SG  1 
ATOM   1976 S  SG  B CYS A 1 251 ? 41.938 19.621 31.890 0.20 37.65  ? 293 CYS A SG  1 
ATOM   1977 N  N   . VAL A 1 252 ? 40.854 17.491 29.607 1.00 34.49  ? 294 VAL A N   1 
ATOM   1978 C  CA  . VAL A 1 252 ? 41.304 17.397 28.228 1.00 33.49  ? 294 VAL A CA  1 
ATOM   1979 C  C   . VAL A 1 252 ? 41.870 18.739 27.829 1.00 34.06  ? 294 VAL A C   1 
ATOM   1980 O  O   . VAL A 1 252 ? 41.173 19.755 27.899 1.00 34.03  ? 294 VAL A O   1 
ATOM   1981 C  CB  . VAL A 1 252 ? 40.123 17.037 27.304 1.00 35.64  ? 294 VAL A CB  1 
ATOM   1982 C  CG1 . VAL A 1 252 ? 40.587 16.969 25.843 1.00 35.88  ? 294 VAL A CG1 1 
ATOM   1983 C  CG2 . VAL A 1 252 ? 39.530 15.701 27.738 1.00 35.77  ? 294 VAL A CG2 1 
ATOM   1984 N  N   . PHE A 1 253 ? 43.136 18.744 27.411 1.00 32.69  ? 295 PHE A N   1 
ATOM   1985 C  CA  . PHE A 1 253 ? 43.813 19.959 26.986 1.00 33.84  ? 295 PHE A CA  1 
ATOM   1986 C  C   . PHE A 1 253 ? 44.219 19.884 25.507 1.00 36.67  ? 295 PHE A C   1 
ATOM   1987 O  O   . PHE A 1 253 ? 44.196 18.821 24.896 1.00 33.44  ? 295 PHE A O   1 
ATOM   1988 C  CB  . PHE A 1 253 ? 45.121 20.165 27.756 1.00 32.29  ? 295 PHE A CB  1 
ATOM   1989 C  CG  . PHE A 1 253 ? 44.961 20.336 29.235 1.00 31.74  ? 295 PHE A CG  1 
ATOM   1990 C  CD1 . PHE A 1 253 ? 45.201 19.268 30.099 1.00 31.33  ? 295 PHE A CD1 1 
ATOM   1991 C  CD2 . PHE A 1 253 ? 44.622 21.574 29.769 1.00 33.01  ? 295 PHE A CD2 1 
ATOM   1992 C  CE1 . PHE A 1 253 ? 45.117 19.426 31.468 1.00 32.43  ? 295 PHE A CE1 1 
ATOM   1993 C  CE2 . PHE A 1 253 ? 44.531 21.752 31.161 1.00 33.95  ? 295 PHE A CE2 1 
ATOM   1994 C  CZ  . PHE A 1 253 ? 44.780 20.681 32.006 1.00 33.52  ? 295 PHE A CZ  1 
ATOM   1995 N  N   . THR A 1 254 ? 44.592 21.035 24.954 1.00 38.74  ? 296 THR A N   1 
ATOM   1996 C  CA  . THR A 1 254 ? 45.122 21.108 23.602 1.00 41.46  ? 296 THR A CA  1 
ATOM   1997 C  C   . THR A 1 254 ? 46.359 21.981 23.757 1.00 40.37  ? 296 THR A C   1 
ATOM   1998 O  O   . THR A 1 254 ? 46.423 22.825 24.649 1.00 37.97  ? 296 THR A O   1 
ATOM   1999 C  CB  . THR A 1 254 ? 44.174 21.813 22.590 1.00 44.05  ? 296 THR A CB  1 
ATOM   2000 O  OG1 . THR A 1 254 ? 44.810 21.843 21.305 1.00 46.82  ? 296 THR A OG1 1 
ATOM   2001 C  CG2 . THR A 1 254 ? 43.902 23.266 23.007 1.00 46.99  ? 296 THR A CG2 1 
ATOM   2002 N  N   . GLY A 1 255 ? 47.347 21.769 22.903 1.00 42.49  ? 297 GLY A N   1 
ATOM   2003 C  CA  . GLY A 1 255 ? 48.539 22.586 22.945 1.00 43.49  ? 297 GLY A CA  1 
ATOM   2004 C  C   . GLY A 1 255 ? 48.470 23.580 21.789 1.00 46.93  ? 297 GLY A C   1 
ATOM   2005 O  O   . GLY A 1 255 ? 49.364 24.397 21.597 1.00 45.64  ? 297 GLY A O   1 
ATOM   2006 N  N   . GLU A 1 256 ? 47.392 23.535 21.016 1.00 49.35  ? 298 GLU A N   1 
ATOM   2007 C  CA  . GLU A 1 256 ? 47.274 24.444 19.877 1.00 51.83  ? 298 GLU A CA  1 
ATOM   2008 C  C   . GLU A 1 256 ? 47.331 25.921 20.248 1.00 51.13  ? 298 GLU A C   1 
ATOM   2009 O  O   . GLU A 1 256 ? 46.674 26.379 21.186 1.00 51.65  ? 298 GLU A O   1 
ATOM   2010 C  CB  . GLU A 1 256 ? 46.006 24.122 19.076 1.00 55.27  ? 298 GLU A CB  1 
ATOM   2011 C  CG  . GLU A 1 256 ? 46.118 22.782 18.353 1.00 63.30  ? 298 GLU A CG  1 
ATOM   2012 C  CD  . GLU A 1 256 ? 44.890 22.433 17.535 1.00 68.78  ? 298 GLU A CD  1 
ATOM   2013 O  OE1 . GLU A 1 256 ? 44.904 21.366 16.876 1.00 70.92  ? 298 GLU A OE1 1 
ATOM   2014 O  OE2 . GLU A 1 256 ? 43.916 23.223 17.552 1.00 72.04  ? 298 GLU A OE2 1 
ATOM   2015 N  N   . GLY A 1 257 ? 48.153 26.663 19.511 1.00 49.70  ? 299 GLY A N   1 
ATOM   2016 C  CA  . GLY A 1 257 ? 48.307 28.081 19.769 1.00 46.93  ? 299 GLY A CA  1 
ATOM   2017 C  C   . GLY A 1 257 ? 49.536 28.415 20.605 1.00 46.65  ? 299 GLY A C   1 
ATOM   2018 O  O   . GLY A 1 257 ? 49.911 29.583 20.712 1.00 46.31  ? 299 GLY A O   1 
ATOM   2019 N  N   . ARG A 1 258 ? 50.167 27.406 21.206 1.00 43.83  ? 300 ARG A N   1 
ATOM   2020 C  CA  . ARG A 1 258 ? 51.352 27.649 22.030 1.00 43.90  ? 300 ARG A CA  1 
ATOM   2021 C  C   . ARG A 1 258 ? 52.606 27.295 21.246 1.00 45.21  ? 300 ARG A C   1 
ATOM   2022 O  O   . ARG A 1 258 ? 52.592 26.393 20.415 1.00 45.68  ? 300 ARG A O   1 
ATOM   2023 C  CB  . ARG A 1 258 ? 51.303 26.816 23.320 1.00 42.72  ? 300 ARG A CB  1 
ATOM   2024 C  CG  . ARG A 1 258 ? 50.166 27.194 24.253 1.00 39.08  ? 300 ARG A CG  1 
ATOM   2025 C  CD  . ARG A 1 258 ? 50.339 28.609 24.809 1.00 40.36  ? 300 ARG A CD  1 
ATOM   2026 N  NE  . ARG A 1 258 ? 49.151 29.081 25.526 1.00 41.12  ? 300 ARG A NE  1 
ATOM   2027 C  CZ  . ARG A 1 258 ? 48.869 28.789 26.796 1.00 41.68  ? 300 ARG A CZ  1 
ATOM   2028 N  NH1 . ARG A 1 258 ? 49.685 28.024 27.505 1.00 40.33  ? 300 ARG A NH1 1 
ATOM   2029 N  NH2 . ARG A 1 258 ? 47.766 29.270 27.361 1.00 41.09  ? 300 ARG A NH2 1 
ATOM   2030 N  N   . THR A 1 259 ? 53.693 28.000 21.519 1.00 44.15  ? 301 THR A N   1 
ATOM   2031 C  CA  . THR A 1 259 ? 54.917 27.722 20.800 1.00 46.07  ? 301 THR A CA  1 
ATOM   2032 C  C   . THR A 1 259 ? 55.819 26.789 21.595 1.00 44.21  ? 301 THR A C   1 
ATOM   2033 O  O   . THR A 1 259 ? 56.688 26.132 21.027 1.00 43.58  ? 301 THR A O   1 
ATOM   2034 C  CB  . THR A 1 259 ? 55.667 29.021 20.450 1.00 47.87  ? 301 THR A CB  1 
ATOM   2035 O  OG1 . THR A 1 259 ? 56.600 28.752 19.392 1.00 50.75  ? 301 THR A OG1 1 
ATOM   2036 C  CG2 . THR A 1 259 ? 56.413 29.555 21.670 1.00 49.61  ? 301 THR A CG2 1 
ATOM   2037 N  N   . GLU A 1 260 ? 55.603 26.716 22.906 1.00 41.04  ? 302 GLU A N   1 
ATOM   2038 C  CA  . GLU A 1 260 ? 56.398 25.834 23.743 1.00 40.79  ? 302 GLU A CA  1 
ATOM   2039 C  C   . GLU A 1 260 ? 55.486 24.924 24.568 1.00 40.18  ? 302 GLU A C   1 
ATOM   2040 O  O   . GLU A 1 260 ? 54.265 25.081 24.550 1.00 36.44  ? 302 GLU A O   1 
ATOM   2041 C  CB  . GLU A 1 260 ? 57.306 26.676 24.634 1.00 44.18  ? 302 GLU A CB  1 
ATOM   2042 C  CG  . GLU A 1 260 ? 58.123 27.675 23.792 1.00 52.82  ? 302 GLU A CG  1 
ATOM   2043 C  CD  . GLU A 1 260 ? 59.131 28.468 24.587 1.00 60.75  ? 302 GLU A CD  1 
ATOM   2044 O  OE1 . GLU A 1 260 ? 58.731 29.116 25.582 1.00 64.71  ? 302 GLU A OE1 1 
ATOM   2045 O  OE2 . GLU A 1 260 ? 60.325 28.452 24.209 1.00 64.93  ? 302 GLU A OE2 1 
ATOM   2046 N  N   . ALA A 1 261 ? 56.077 23.958 25.262 1.00 36.77  ? 303 ALA A N   1 
ATOM   2047 C  CA  . ALA A 1 261 ? 55.310 23.038 26.092 1.00 35.08  ? 303 ALA A CA  1 
ATOM   2048 C  C   . ALA A 1 261 ? 54.708 23.779 27.284 1.00 33.98  ? 303 ALA A C   1 
ATOM   2049 O  O   . ALA A 1 261 ? 55.286 24.749 27.788 1.00 34.15  ? 303 ALA A O   1 
ATOM   2050 C  CB  . ALA A 1 261 ? 56.188 21.918 26.595 1.00 32.47  ? 303 ALA A CB  1 
ATOM   2051 N  N   . THR A 1 262 ? 53.551 23.306 27.728 1.00 31.95  ? 304 THR A N   1 
ATOM   2052 C  CA  . THR A 1 262 ? 52.868 23.888 28.884 1.00 32.59  ? 304 THR A CA  1 
ATOM   2053 C  C   . THR A 1 262 ? 52.814 22.832 29.985 1.00 29.77  ? 304 THR A C   1 
ATOM   2054 O  O   . THR A 1 262 ? 52.397 21.691 29.735 1.00 31.31  ? 304 THR A O   1 
ATOM   2055 C  CB  . THR A 1 262 ? 51.429 24.278 28.534 1.00 33.41  ? 304 THR A CB  1 
ATOM   2056 O  OG1 . THR A 1 262 ? 51.437 25.185 27.422 1.00 39.01  ? 304 THR A OG1 1 
ATOM   2057 C  CG2 . THR A 1 262 ? 50.757 24.950 29.742 1.00 33.55  ? 304 THR A CG2 1 
ATOM   2058 N  N   . HIS A 1 263 ? 53.256 23.189 31.193 1.00 25.91  ? 305 HIS A N   1 
ATOM   2059 C  CA  . HIS A 1 263 ? 53.241 22.251 32.314 1.00 27.47  ? 305 HIS A CA  1 
ATOM   2060 C  C   . HIS A 1 263 ? 52.362 22.846 33.425 1.00 28.18  ? 305 HIS A C   1 
ATOM   2061 O  O   . HIS A 1 263 ? 51.808 23.924 33.258 1.00 29.53  ? 305 HIS A O   1 
ATOM   2062 C  CB  . HIS A 1 263 ? 54.663 22.021 32.842 1.00 30.18  ? 305 HIS A CB  1 
ATOM   2063 C  CG  . HIS A 1 263 ? 55.332 23.270 33.313 1.00 30.32  ? 305 HIS A CG  1 
ATOM   2064 N  ND1 . HIS A 1 263 ? 55.080 23.866 34.531 1.00 27.17  ? 305 HIS A ND1 1 
ATOM   2065 C  CD2 . HIS A 1 263 ? 56.243 24.064 32.693 1.00 29.82  ? 305 HIS A CD2 1 
ATOM   2066 C  CE1 . HIS A 1 263 ? 55.829 24.980 34.614 1.00 27.32  ? 305 HIS A CE1 1 
ATOM   2067 N  NE2 . HIS A 1 263 ? 56.547 25.145 33.527 1.00 27.88  ? 305 HIS A NE2 1 
ATOM   2068 N  N   . ILE A 1 264 ? 52.243 22.142 34.547 1.00 30.93  ? 306 ILE A N   1 
ATOM   2069 C  CA  . ILE A 1 264 ? 51.407 22.601 35.664 1.00 29.32  ? 306 ILE A CA  1 
ATOM   2070 C  C   . ILE A 1 264 ? 52.094 23.762 36.353 1.00 31.75  ? 306 ILE A C   1 
ATOM   2071 O  O   . ILE A 1 264 ? 53.304 23.710 36.599 1.00 30.57  ? 306 ILE A O   1 
ATOM   2072 C  CB  . ILE A 1 264 ? 51.176 21.453 36.670 1.00 29.14  ? 306 ILE A CB  1 
ATOM   2073 C  CG1 . ILE A 1 264 ? 50.443 20.310 35.964 1.00 30.45  ? 306 ILE A CG1 1 
ATOM   2074 C  CG2 . ILE A 1 264 ? 50.354 21.945 37.899 1.00 30.08  ? 306 ILE A CG2 1 
ATOM   2075 C  CD1 . ILE A 1 264 ? 49.063 20.695 35.437 1.00 30.32  ? 306 ILE A CD1 1 
ATOM   2076 N  N   . GLY A 1 265 ? 51.340 24.822 36.651 1.00 31.16  ? 307 GLY A N   1 
ATOM   2077 C  CA  . GLY A 1 265 ? 51.941 25.974 37.318 1.00 33.52  ? 307 GLY A CA  1 
ATOM   2078 C  C   . GLY A 1 265 ? 50.934 27.076 37.581 1.00 36.69  ? 307 GLY A C   1 
ATOM   2079 O  O   . GLY A 1 265 ? 49.780 26.978 37.147 1.00 34.19  ? 307 GLY A O   1 
ATOM   2080 N  N   . GLY A 1 266 ? 51.361 28.143 38.254 1.00 37.81  ? 308 GLY A N   1 
ATOM   2081 C  CA  . GLY A 1 266 ? 50.429 29.216 38.578 1.00 41.28  ? 308 GLY A CA  1 
ATOM   2082 C  C   . GLY A 1 266 ? 50.263 30.402 37.641 1.00 44.20  ? 308 GLY A C   1 
ATOM   2083 O  O   . GLY A 1 266 ? 49.490 31.309 37.942 1.00 45.77  ? 308 GLY A O   1 
ATOM   2084 N  N   . THR A 1 267 ? 50.957 30.430 36.511 1.00 42.77  ? 309 THR A N   1 
ATOM   2085 C  CA  . THR A 1 267 ? 50.805 31.559 35.606 1.00 41.08  ? 309 THR A CA  1 
ATOM   2086 C  C   . THR A 1 267 ? 49.899 31.219 34.431 1.00 42.48  ? 309 THR A C   1 
ATOM   2087 O  O   . THR A 1 267 ? 49.552 30.059 34.214 1.00 40.30  ? 309 THR A O   1 
ATOM   2088 C  CB  . THR A 1 267 ? 52.164 32.025 35.077 1.00 43.81  ? 309 THR A CB  1 
ATOM   2089 O  OG1 . THR A 1 267 ? 52.634 31.105 34.087 1.00 41.43  ? 309 THR A OG1 1 
ATOM   2090 C  CG2 . THR A 1 267 ? 53.190 32.101 36.236 1.00 40.25  ? 309 THR A CG2 1 
ATOM   2091 N  N   . SER A 1 268 ? 49.514 32.240 33.677 1.00 43.78  ? 310 SER A N   1 
ATOM   2092 C  CA  . SER A 1 268 ? 48.648 32.074 32.514 1.00 44.76  ? 310 SER A CA  1 
ATOM   2093 C  C   . SER A 1 268 ? 49.315 31.248 31.410 1.00 45.16  ? 310 SER A C   1 
ATOM   2094 O  O   . SER A 1 268 ? 48.634 30.702 30.532 1.00 44.36  ? 310 SER A O   1 
ATOM   2095 C  CB  . SER A 1 268 ? 48.265 33.445 31.954 1.00 47.19  ? 310 SER A CB  1 
ATOM   2096 O  OG  . SER A 1 268 ? 49.438 34.156 31.572 1.00 52.04  ? 310 SER A OG  1 
ATOM   2097 N  N   . SER A 1 269 ? 50.642 31.158 31.441 1.00 43.24  ? 311 SER A N   1 
ATOM   2098 C  CA  . SER A 1 269 ? 51.346 30.377 30.432 1.00 43.35  ? 311 SER A CA  1 
ATOM   2099 C  C   . SER A 1 269 ? 51.484 28.913 30.898 1.00 41.20  ? 311 SER A C   1 
ATOM   2100 O  O   . SER A 1 269 ? 52.001 28.060 30.163 1.00 42.50  ? 311 SER A O   1 
ATOM   2101 C  CB  . SER A 1 269 ? 52.723 30.993 30.143 1.00 45.20  ? 311 SER A CB  1 
ATOM   2102 O  OG  . SER A 1 269 ? 53.575 30.823 31.256 1.00 50.91  ? 311 SER A OG  1 
ATOM   2103 N  N   . ASP A 1 270 ? 51.020 28.634 32.119 1.00 34.35  ? 312 ASP A N   1 
ATOM   2104 C  CA  . ASP A 1 270 ? 51.025 27.276 32.684 1.00 32.65  ? 312 ASP A CA  1 
ATOM   2105 C  C   . ASP A 1 270 ? 49.579 26.794 32.726 1.00 32.19  ? 312 ASP A C   1 
ATOM   2106 O  O   . ASP A 1 270 ? 48.662 27.568 32.437 1.00 34.21  ? 312 ASP A O   1 
ATOM   2107 C  CB  . ASP A 1 270 ? 51.505 27.262 34.128 1.00 32.00  ? 312 ASP A CB  1 
ATOM   2108 C  CG  . ASP A 1 270 ? 52.855 27.848 34.297 1.00 39.80  ? 312 ASP A CG  1 
ATOM   2109 O  OD1 . ASP A 1 270 ? 53.757 27.453 33.525 1.00 34.66  ? 312 ASP A OD1 1 
ATOM   2110 O  OD2 . ASP A 1 270 ? 53.013 28.691 35.212 1.00 39.21  ? 312 ASP A OD2 1 
ATOM   2111 N  N   . GLU A 1 271 ? 49.378 25.527 33.096 1.00 30.35  ? 313 GLU A N   1 
ATOM   2112 C  CA  . GLU A 1 271 ? 48.036 24.981 33.224 1.00 31.37  ? 313 GLU A CA  1 
ATOM   2113 C  C   . GLU A 1 271 ? 47.769 24.397 34.603 1.00 30.00  ? 313 GLU A C   1 
ATOM   2114 O  O   . GLU A 1 271 ? 48.664 24.267 35.449 1.00 30.96  ? 313 GLU A O   1 
ATOM   2115 C  CB  . GLU A 1 271 ? 47.787 23.902 32.159 1.00 32.77  ? 313 GLU A CB  1 
ATOM   2116 C  CG  . GLU A 1 271 ? 47.245 24.494 30.864 1.00 35.61  ? 313 GLU A CG  1 
ATOM   2117 C  CD  . GLU A 1 271 ? 45.884 25.151 31.078 1.00 36.07  ? 313 GLU A CD  1 
ATOM   2118 O  OE1 . GLU A 1 271 ? 45.516 26.039 30.281 1.00 34.86  ? 313 GLU A OE1 1 
ATOM   2119 O  OE2 . GLU A 1 271 ? 45.189 24.767 32.053 1.00 35.19  ? 313 GLU A OE2 1 
ATOM   2120 N  N   . MET A 1 272 ? 46.507 24.070 34.837 1.00 30.20  ? 314 MET A N   1 
ATOM   2121 C  CA  . MET A 1 272 ? 46.095 23.415 36.062 1.00 25.88  ? 314 MET A CA  1 
ATOM   2122 C  C   . MET A 1 272 ? 44.964 22.510 35.648 1.00 27.21  ? 314 MET A C   1 
ATOM   2123 O  O   . MET A 1 272 ? 44.257 22.795 34.682 1.00 26.50  ? 314 MET A O   1 
ATOM   2124 C  CB  . MET A 1 272 ? 45.606 24.421 37.116 1.00 26.77  ? 314 MET A CB  1 
ATOM   2125 C  CG  . MET A 1 272 ? 46.743 25.168 37.801 1.00 28.76  ? 314 MET A CG  1 
ATOM   2126 S  SD  . MET A 1 272 ? 46.074 26.254 39.084 1.00 32.72  ? 314 MET A SD  1 
ATOM   2127 C  CE  . MET A 1 272 ? 47.632 26.899 39.825 1.00 37.22  ? 314 MET A CE  1 
ATOM   2128 N  N   . CYS A 1 273 ? 44.815 21.399 36.360 1.00 26.81  ? 315 CYS A N   1 
ATOM   2129 C  CA  . CYS A 1 273 ? 43.743 20.486 36.103 1.00 28.17  ? 315 CYS A CA  1 
ATOM   2130 C  C   . CYS A 1 273 ? 43.167 20.203 37.491 1.00 28.89  ? 315 CYS A C   1 
ATOM   2131 O  O   . CYS A 1 273 ? 43.728 19.401 38.237 1.00 29.97  ? 315 CYS A O   1 
ATOM   2132 C  CB  . CYS A 1 273 ? 44.266 19.197 35.454 1.00 31.22  ? 315 CYS A CB  1 
ATOM   2133 S  SG  . CYS A 1 273 ? 43.008 17.885 35.483 1.00 39.31  ? 315 CYS A SG  1 
ATOM   2134 N  N   . ASN A 1 274 ? 42.066 20.878 37.841 1.00 26.43  ? 316 ASN A N   1 
ATOM   2135 C  CA  . ASN A 1 274 ? 41.433 20.703 39.153 1.00 25.58  ? 316 ASN A CA  1 
ATOM   2136 C  C   . ASN A 1 274 ? 39.971 20.336 39.046 1.00 27.48  ? 316 ASN A C   1 
ATOM   2137 O  O   . ASN A 1 274 ? 39.246 20.907 38.232 1.00 28.01  ? 316 ASN A O   1 
ATOM   2138 C  CB  . ASN A 1 274 ? 41.395 22.009 39.965 1.00 27.27  ? 316 ASN A CB  1 
ATOM   2139 C  CG  . ASN A 1 274 ? 42.733 22.601 40.246 1.00 31.34  ? 316 ASN A CG  1 
ATOM   2140 O  OD1 . ASN A 1 274 ? 42.807 23.784 40.571 1.00 28.40  ? 316 ASN A OD1 1 
ATOM   2141 N  ND2 . ASN A 1 274 ? 43.798 21.809 40.147 1.00 28.55  ? 316 ASN A ND2 1 
ATOM   2142 N  N   . LEU A 1 275 ? 39.542 19.416 39.894 1.00 29.03  ? 317 LEU A N   1 
ATOM   2143 C  CA  . LEU A 1 275 ? 38.132 19.073 40.017 1.00 28.71  ? 317 LEU A CA  1 
ATOM   2144 C  C   . LEU A 1 275 ? 37.891 19.091 41.528 1.00 28.89  ? 317 LEU A C   1 
ATOM   2145 O  O   . LEU A 1 275 ? 38.440 18.270 42.268 1.00 28.20  ? 317 LEU A O   1 
ATOM   2146 C  CB  . LEU A 1 275 ? 37.803 17.692 39.458 1.00 27.76  ? 317 LEU A CB  1 
ATOM   2147 C  CG  . LEU A 1 275 ? 36.377 17.244 39.806 1.00 31.77  ? 317 LEU A CG  1 
ATOM   2148 C  CD1 . LEU A 1 275 ? 35.363 18.201 39.201 1.00 31.99  ? 317 LEU A CD1 1 
ATOM   2149 C  CD2 . LEU A 1 275 ? 36.130 15.820 39.270 1.00 33.90  ? 317 LEU A CD2 1 
ATOM   2150 N  N   . TYR A 1 276 ? 37.076 20.040 41.977 1.00 24.03  ? 318 TYR A N   1 
ATOM   2151 C  CA  . TYR A 1 276 ? 36.748 20.193 43.385 1.00 24.62  ? 318 TYR A CA  1 
ATOM   2152 C  C   . TYR A 1 276 ? 35.397 19.506 43.576 1.00 26.76  ? 318 TYR A C   1 
ATOM   2153 O  O   . TYR A 1 276 ? 34.401 19.904 42.950 1.00 26.69  ? 318 TYR A O   1 
ATOM   2154 C  CB  . TYR A 1 276 ? 36.584 21.677 43.723 1.00 21.40  ? 318 TYR A CB  1 
ATOM   2155 C  CG  . TYR A 1 276 ? 37.835 22.467 43.690 1.00 25.15  ? 318 TYR A CG  1 
ATOM   2156 C  CD1 . TYR A 1 276 ? 38.297 23.033 42.503 1.00 27.65  ? 318 TYR A CD1 1 
ATOM   2157 C  CD2 . TYR A 1 276 ? 38.584 22.647 44.847 1.00 28.68  ? 318 TYR A CD2 1 
ATOM   2158 C  CE1 . TYR A 1 276 ? 39.470 23.764 42.463 1.00 30.34  ? 318 TYR A CE1 1 
ATOM   2159 C  CE2 . TYR A 1 276 ? 39.769 23.380 44.816 1.00 30.70  ? 318 TYR A CE2 1 
ATOM   2160 C  CZ  . TYR A 1 276 ? 40.197 23.936 43.618 1.00 33.26  ? 318 TYR A CZ  1 
ATOM   2161 O  OH  . TYR A 1 276 ? 41.329 24.697 43.589 1.00 36.11  ? 318 TYR A OH  1 
ATOM   2162 N  N   . ILE A 1 277 ? 35.357 18.479 44.410 1.00 23.67  ? 319 ILE A N   1 
ATOM   2163 C  CA  . ILE A 1 277 ? 34.118 17.742 44.663 1.00 25.28  ? 319 ILE A CA  1 
ATOM   2164 C  C   . ILE A 1 277 ? 33.643 18.119 46.057 1.00 28.23  ? 319 ILE A C   1 
ATOM   2165 O  O   . ILE A 1 277 ? 34.281 17.755 47.043 1.00 27.84  ? 319 ILE A O   1 
ATOM   2166 C  CB  . ILE A 1 277 ? 34.396 16.221 44.587 1.00 29.09  ? 319 ILE A CB  1 
ATOM   2167 C  CG1 . ILE A 1 277 ? 34.826 15.852 43.165 1.00 30.45  ? 319 ILE A CG1 1 
ATOM   2168 C  CG2 . ILE A 1 277 ? 33.181 15.406 44.990 1.00 31.39  ? 319 ILE A CG2 1 
ATOM   2169 C  CD1 . ILE A 1 277 ? 35.241 14.397 43.048 1.00 36.00  ? 319 ILE A CD1 1 
ATOM   2170 N  N   . MET A 1 278 ? 32.530 18.850 46.152 1.00 25.16  ? 320 MET A N   1 
ATOM   2171 C  CA  . MET A 1 278 ? 32.034 19.266 47.452 1.00 25.71  ? 320 MET A CA  1 
ATOM   2172 C  C   . MET A 1 278 ? 31.038 18.226 47.942 1.00 25.40  ? 320 MET A C   1 
ATOM   2173 O  O   . MET A 1 278 ? 30.099 17.833 47.229 1.00 25.17  ? 320 MET A O   1 
ATOM   2174 C  CB  . MET A 1 278 ? 31.391 20.670 47.375 1.00 25.29  ? 320 MET A CB  1 
ATOM   2175 C  CG  . MET A 1 278 ? 31.069 21.235 48.765 1.00 26.58  ? 320 MET A CG  1 
ATOM   2176 S  SD  . MET A 1 278 ? 30.227 22.849 48.683 1.00 30.88  ? 320 MET A SD  1 
ATOM   2177 C  CE  . MET A 1 278 ? 31.548 23.881 48.088 1.00 28.36  ? 320 MET A CE  1 
ATOM   2178 N  N   . TYR A 1 279 ? 31.221 17.782 49.177 1.00 22.71  ? 321 TYR A N   1 
ATOM   2179 C  CA  . TYR A 1 279 ? 30.392 16.705 49.701 1.00 21.13  ? 321 TYR A CA  1 
ATOM   2180 C  C   . TYR A 1 279 ? 29.946 16.922 51.126 1.00 22.57  ? 321 TYR A C   1 
ATOM   2181 O  O   . TYR A 1 279 ? 30.408 17.841 51.784 1.00 26.22  ? 321 TYR A O   1 
ATOM   2182 C  CB  . TYR A 1 279 ? 31.222 15.416 49.661 1.00 23.23  ? 321 TYR A CB  1 
ATOM   2183 C  CG  . TYR A 1 279 ? 32.483 15.486 50.549 1.00 23.41  ? 321 TYR A CG  1 
ATOM   2184 C  CD1 . TYR A 1 279 ? 32.389 15.407 51.939 1.00 24.13  ? 321 TYR A CD1 1 
ATOM   2185 C  CD2 . TYR A 1 279 ? 33.759 15.625 49.983 1.00 23.75  ? 321 TYR A CD2 1 
ATOM   2186 C  CE1 . TYR A 1 279 ? 33.561 15.458 52.781 1.00 26.37  ? 321 TYR A CE1 1 
ATOM   2187 C  CE2 . TYR A 1 279 ? 34.926 15.680 50.802 1.00 24.76  ? 321 TYR A CE2 1 
ATOM   2188 C  CZ  . TYR A 1 279 ? 34.812 15.599 52.187 1.00 24.79  ? 321 TYR A CZ  1 
ATOM   2189 O  OH  . TYR A 1 279 ? 35.938 15.718 52.983 1.00 26.65  ? 321 TYR A OH  1 
ATOM   2190 N  N   . TYR A 1 280 ? 29.029 16.080 51.592 1.00 24.33  ? 322 TYR A N   1 
ATOM   2191 C  CA  . TYR A 1 280 ? 28.636 16.130 52.980 1.00 26.37  ? 322 TYR A CA  1 
ATOM   2192 C  C   . TYR A 1 280 ? 28.794 14.720 53.519 1.00 24.41  ? 322 TYR A C   1 
ATOM   2193 O  O   . TYR A 1 280 ? 28.752 13.730 52.767 1.00 25.69  ? 322 TYR A O   1 
ATOM   2194 C  CB  . TYR A 1 280 ? 27.193 16.665 53.180 1.00 28.13  ? 322 TYR A CB  1 
ATOM   2195 C  CG  . TYR A 1 280 ? 26.074 15.783 52.668 1.00 29.43  ? 322 TYR A CG  1 
ATOM   2196 C  CD1 . TYR A 1 280 ? 25.745 14.596 53.315 1.00 33.15  ? 322 TYR A CD1 1 
ATOM   2197 C  CD2 . TYR A 1 280 ? 25.326 16.157 51.549 1.00 32.49  ? 322 TYR A CD2 1 
ATOM   2198 C  CE1 . TYR A 1 280 ? 24.689 13.789 52.859 1.00 32.92  ? 322 TYR A CE1 1 
ATOM   2199 C  CE2 . TYR A 1 280 ? 24.272 15.362 51.090 1.00 31.29  ? 322 TYR A CE2 1 
ATOM   2200 C  CZ  . TYR A 1 280 ? 23.969 14.184 51.751 1.00 34.09  ? 322 TYR A CZ  1 
ATOM   2201 O  OH  . TYR A 1 280 ? 22.955 13.372 51.301 1.00 40.76  ? 322 TYR A OH  1 
ATOM   2202 N  N   . MET A 1 281 ? 29.007 14.627 54.825 1.00 26.11  ? 323 MET A N   1 
ATOM   2203 C  CA  . MET A 1 281 ? 29.173 13.329 55.507 1.00 24.94  ? 323 MET A CA  1 
ATOM   2204 C  C   . MET A 1 281 ? 28.461 13.445 56.837 1.00 24.08  ? 323 MET A C   1 
ATOM   2205 O  O   . MET A 1 281 ? 28.315 14.547 57.353 1.00 23.41  ? 323 MET A O   1 
ATOM   2206 C  CB  . MET A 1 281 ? 30.664 13.041 55.785 1.00 24.92  ? 323 MET A CB  1 
ATOM   2207 C  CG  . MET A 1 281 ? 31.461 12.745 54.531 1.00 27.23  ? 323 MET A CG  1 
ATOM   2208 S  SD  . MET A 1 281 ? 33.245 12.466 54.833 1.00 28.48  ? 323 MET A SD  1 
ATOM   2209 C  CE  . MET A 1 281 ? 33.252 10.702 55.361 1.00 28.81  ? 323 MET A CE  1 
ATOM   2210 N  N   . GLU A 1 282 ? 27.995 12.321 57.375 1.00 23.85  ? 324 GLU A N   1 
ATOM   2211 C  CA  . GLU A 1 282 ? 27.368 12.332 58.685 1.00 29.01  ? 324 GLU A CA  1 
ATOM   2212 C  C   . GLU A 1 282 ? 28.415 12.894 59.652 1.00 26.85  ? 324 GLU A C   1 
ATOM   2213 O  O   . GLU A 1 282 ? 29.588 12.556 59.554 1.00 28.12  ? 324 GLU A O   1 
ATOM   2214 C  CB  . GLU A 1 282 ? 26.999 10.919 59.107 1.00 30.78  ? 324 GLU A CB  1 
ATOM   2215 C  CG  . GLU A 1 282 ? 26.109 10.221 58.110 1.00 38.63  ? 324 GLU A CG  1 
ATOM   2216 C  CD  . GLU A 1 282 ? 24.693 10.744 58.160 1.00 40.84  ? 324 GLU A CD  1 
ATOM   2217 O  OE1 . GLU A 1 282 ? 24.004 10.703 57.113 1.00 41.65  ? 324 GLU A OE1 1 
ATOM   2218 O  OE2 . GLU A 1 282 ? 24.268 11.186 59.257 1.00 43.10  ? 324 GLU A OE2 1 
ATOM   2219 N  N   . ALA A 1 283 ? 27.977 13.710 60.600 1.00 26.42  ? 325 ALA A N   1 
ATOM   2220 C  CA  . ALA A 1 283 ? 28.904 14.351 61.527 1.00 29.84  ? 325 ALA A CA  1 
ATOM   2221 C  C   . ALA A 1 283 ? 29.885 13.420 62.231 1.00 32.19  ? 325 ALA A C   1 
ATOM   2222 O  O   . ALA A 1 283 ? 31.097 13.727 62.299 1.00 31.63  ? 325 ALA A O   1 
ATOM   2223 C  CB  . ALA A 1 283 ? 28.129 15.181 62.545 1.00 30.80  ? 325 ALA A CB  1 
ATOM   2224 N  N   . LYS A 1 284 ? 29.410 12.281 62.738 1.00 30.15  ? 326 LYS A N   1 
ATOM   2225 C  CA  . LYS A 1 284 ? 30.348 11.395 63.439 1.00 34.98  ? 326 LYS A CA  1 
ATOM   2226 C  C   . LYS A 1 284 ? 31.356 10.654 62.552 1.00 33.49  ? 326 LYS A C   1 
ATOM   2227 O  O   . LYS A 1 284 ? 32.279 10.037 63.062 1.00 35.73  ? 326 LYS A O   1 
ATOM   2228 C  CB  . LYS A 1 284 ? 29.603 10.390 64.339 1.00 34.55  ? 326 LYS A CB  1 
ATOM   2229 C  CG  . LYS A 1 284 ? 28.715 9.399  63.625 1.00 39.30  ? 326 LYS A CG  1 
ATOM   2230 C  CD  . LYS A 1 284 ? 28.075 8.446  64.656 1.00 41.25  ? 326 LYS A CD  1 
ATOM   2231 C  CE  . LYS A 1 284 ? 27.182 7.450  63.964 1.00 41.08  ? 326 LYS A CE  1 
ATOM   2232 N  NZ  . LYS A 1 284 ? 26.364 6.685  64.941 1.00 42.45  ? 326 LYS A NZ  1 
ATOM   2233 N  N   . TYR A 1 285 ? 31.200 10.720 61.235 1.00 29.47  ? 327 TYR A N   1 
ATOM   2234 C  CA  . TYR A 1 285 ? 32.130 10.054 60.333 1.00 28.90  ? 327 TYR A CA  1 
ATOM   2235 C  C   . TYR A 1 285 ? 32.929 11.018 59.487 1.00 30.80  ? 327 TYR A C   1 
ATOM   2236 O  O   . TYR A 1 285 ? 33.842 10.605 58.768 1.00 28.79  ? 327 TYR A O   1 
ATOM   2237 C  CB  . TYR A 1 285 ? 31.394 9.169  59.334 1.00 29.30  ? 327 TYR A CB  1 
ATOM   2238 C  CG  . TYR A 1 285 ? 30.511 8.100  59.950 1.00 33.33  ? 327 TYR A CG  1 
ATOM   2239 C  CD1 . TYR A 1 285 ? 30.941 7.355  61.044 1.00 33.08  ? 327 TYR A CD1 1 
ATOM   2240 C  CD2 . TYR A 1 285 ? 29.261 7.819  59.416 1.00 34.31  ? 327 TYR A CD2 1 
ATOM   2241 C  CE1 . TYR A 1 285 ? 30.135 6.342  61.597 1.00 34.13  ? 327 TYR A CE1 1 
ATOM   2242 C  CE2 . TYR A 1 285 ? 28.449 6.816  59.960 1.00 36.66  ? 327 TYR A CE2 1 
ATOM   2243 C  CZ  . TYR A 1 285 ? 28.897 6.085  61.047 1.00 37.83  ? 327 TYR A CZ  1 
ATOM   2244 O  OH  . TYR A 1 285 ? 28.112 5.089  61.569 1.00 38.13  ? 327 TYR A OH  1 
ATOM   2245 N  N   . ALA A 1 286 ? 32.585 12.294 59.579 1.00 27.42  ? 328 ALA A N   1 
ATOM   2246 C  CA  . ALA A 1 286 ? 33.166 13.313 58.721 1.00 29.64  ? 328 ALA A CA  1 
ATOM   2247 C  C   . ALA A 1 286 ? 34.605 13.737 58.854 1.00 29.07  ? 328 ALA A C   1 
ATOM   2248 O  O   . ALA A 1 286 ? 35.143 13.832 59.962 1.00 29.54  ? 328 ALA A O   1 
ATOM   2249 C  CB  . ALA A 1 286 ? 32.304 14.575 58.800 1.00 28.08  ? 328 ALA A CB  1 
ATOM   2250 N  N   . LEU A 1 287 ? 35.215 14.007 57.701 1.00 28.51  ? 329 LEU A N   1 
ATOM   2251 C  CA  . LEU A 1 287 ? 36.543 14.607 57.666 1.00 31.33  ? 329 LEU A CA  1 
ATOM   2252 C  C   . LEU A 1 287 ? 36.308 15.753 56.678 1.00 31.18  ? 329 LEU A C   1 
ATOM   2253 O  O   . LEU A 1 287 ? 35.507 15.630 55.738 1.00 31.43  ? 329 LEU A O   1 
ATOM   2254 C  CB  . LEU A 1 287 ? 37.646 13.659 57.199 1.00 32.53  ? 329 LEU A CB  1 
ATOM   2255 C  CG  . LEU A 1 287 ? 37.758 13.148 55.784 1.00 32.82  ? 329 LEU A CG  1 
ATOM   2256 C  CD1 . LEU A 1 287 ? 39.184 12.578 55.602 1.00 32.65  ? 329 LEU A CD1 1 
ATOM   2257 C  CD2 . LEU A 1 287 ? 36.713 12.089 55.534 1.00 34.07  ? 329 LEU A CD2 1 
ATOM   2258 N  N   . SER A 1 288 ? 36.994 16.862 56.881 1.00 26.49  ? 330 SER A N   1 
ATOM   2259 C  CA  . SER A 1 288 ? 36.745 18.051 56.076 1.00 31.18  ? 330 SER A CA  1 
ATOM   2260 C  C   . SER A 1 288 ? 37.423 18.188 54.719 1.00 30.22  ? 330 SER A C   1 
ATOM   2261 O  O   . SER A 1 288 ? 37.002 19.000 53.873 1.00 27.24  ? 330 SER A O   1 
ATOM   2262 C  CB  . SER A 1 288 ? 37.032 19.285 56.949 1.00 29.63  ? 330 SER A CB  1 
ATOM   2263 O  OG  . SER A 1 288 ? 36.144 19.284 58.073 1.00 32.49  ? 330 SER A OG  1 
ATOM   2264 N  N   . PHE A 1 289 ? 38.461 17.395 54.481 1.00 29.29  ? 331 PHE A N   1 
ATOM   2265 C  CA  . PHE A 1 289 ? 39.142 17.526 53.216 1.00 31.46  ? 331 PHE A CA  1 
ATOM   2266 C  C   . PHE A 1 289 ? 39.995 16.338 52.854 1.00 34.64  ? 331 PHE A C   1 
ATOM   2267 O  O   . PHE A 1 289 ? 40.600 15.695 53.719 1.00 30.88  ? 331 PHE A O   1 
ATOM   2268 C  CB  . PHE A 1 289 ? 39.976 18.807 53.212 1.00 37.40  ? 331 PHE A CB  1 
ATOM   2269 C  CG  . PHE A 1 289 ? 40.753 19.038 54.479 1.00 44.55  ? 331 PHE A CG  1 
ATOM   2270 C  CD1 . PHE A 1 289 ? 41.970 18.402 54.693 1.00 47.40  ? 331 PHE A CD1 1 
ATOM   2271 C  CD2 . PHE A 1 289 ? 40.252 19.893 55.473 1.00 47.59  ? 331 PHE A CD2 1 
ATOM   2272 C  CE1 . PHE A 1 289 ? 42.688 18.615 55.888 1.00 51.01  ? 331 PHE A CE1 1 
ATOM   2273 C  CE2 . PHE A 1 289 ? 40.951 20.114 56.663 1.00 45.95  ? 331 PHE A CE2 1 
ATOM   2274 C  CZ  . PHE A 1 289 ? 42.172 19.475 56.872 1.00 52.35  ? 331 PHE A CZ  1 
ATOM   2275 N  N   . MET A 1 290 ? 40.030 16.060 51.560 1.00 30.86  ? 332 MET A N   1 
ATOM   2276 C  CA  . MET A 1 290 ? 40.809 14.958 51.003 1.00 31.74  ? 332 MET A CA  1 
ATOM   2277 C  C   . MET A 1 290 ? 41.367 15.463 49.682 1.00 34.57  ? 332 MET A C   1 
ATOM   2278 O  O   . MET A 1 290 ? 40.809 16.391 49.058 1.00 29.81  ? 332 MET A O   1 
ATOM   2279 C  CB  . MET A 1 290 ? 39.920 13.728 50.742 1.00 30.78  ? 332 MET A CB  1 
ATOM   2280 C  CG  . MET A 1 290 ? 39.373 13.086 52.019 1.00 31.07  ? 332 MET A CG  1 
ATOM   2281 S  SD  . MET A 1 290 ? 38.170 11.824 51.687 1.00 34.80  ? 332 MET A SD  1 
ATOM   2282 C  CE  . MET A 1 290 ? 36.630 12.769 51.928 1.00 35.35  ? 332 MET A CE  1 
ATOM   2283 N  N   . THR A 1 291 ? 42.454 14.844 49.239 1.00 31.43  ? 333 THR A N   1 
ATOM   2284 C  CA  . THR A 1 291 ? 43.074 15.248 47.994 1.00 34.33  ? 333 THR A CA  1 
ATOM   2285 C  C   . THR A 1 291 ? 43.614 14.025 47.281 1.00 35.58  ? 333 THR A C   1 
ATOM   2286 O  O   . THR A 1 291 ? 43.993 13.030 47.912 1.00 35.41  ? 333 THR A O   1 
ATOM   2287 C  CB  . THR A 1 291 ? 44.252 16.229 48.244 1.00 39.44  ? 333 THR A CB  1 
ATOM   2288 O  OG1 . THR A 1 291 ? 43.798 17.360 49.003 1.00 47.09  ? 333 THR A OG1 1 
ATOM   2289 C  CG2 . THR A 1 291 ? 44.815 16.738 46.932 1.00 42.21  ? 333 THR A CG2 1 
ATOM   2290 N  N   . CYS A 1 292 ? 43.602 14.081 45.958 1.00 32.62  ? 334 CYS A N   1 
ATOM   2291 C  CA  . CYS A 1 292 ? 44.162 13.015 45.152 1.00 33.35  ? 334 CYS A CA  1 
ATOM   2292 C  C   . CYS A 1 292 ? 45.057 13.743 44.155 1.00 36.66  ? 334 CYS A C   1 
ATOM   2293 O  O   . CYS A 1 292 ? 44.600 14.636 43.445 1.00 31.51  ? 334 CYS A O   1 
ATOM   2294 C  CB  . CYS A 1 292 ? 43.085 12.236 44.402 1.00 35.55  ? 334 CYS A CB  1 
ATOM   2295 S  SG  . CYS A 1 292 ? 43.789 10.964 43.302 1.00 40.43  ? 334 CYS A SG  1 
ATOM   2296 N  N   . THR A 1 293 ? 46.336 13.386 44.124 1.00 32.98  ? 335 THR A N   1 
ATOM   2297 C  CA  . THR A 1 293 ? 47.261 14.002 43.188 1.00 38.35  ? 335 THR A CA  1 
ATOM   2298 C  C   . THR A 1 293 ? 47.937 12.913 42.353 1.00 42.86  ? 335 THR A C   1 
ATOM   2299 O  O   . THR A 1 293 ? 48.930 13.170 41.671 1.00 44.28  ? 335 THR A O   1 
ATOM   2300 C  CB  . THR A 1 293 ? 48.355 14.769 43.934 1.00 42.08  ? 335 THR A CB  1 
ATOM   2301 O  OG1 . THR A 1 293 ? 48.982 13.884 44.886 1.00 44.80  ? 335 THR A OG1 1 
ATOM   2302 C  CG2 . THR A 1 293 ? 47.758 15.968 44.670 1.00 40.71  ? 335 THR A CG2 1 
ATOM   2303 N  N   . LYS A 1 294 ? 47.396 11.700 42.408 1.00 41.82  ? 336 LYS A N   1 
ATOM   2304 C  CA  . LYS A 1 294 ? 47.981 10.580 41.685 1.00 43.53  ? 336 LYS A CA  1 
ATOM   2305 C  C   . LYS A 1 294 ? 47.046 9.999  40.665 1.00 42.47  ? 336 LYS A C   1 
ATOM   2306 O  O   . LYS A 1 294 ? 45.941 10.488 40.455 1.00 38.67  ? 336 LYS A O   1 
ATOM   2307 C  CB  . LYS A 1 294 ? 48.351 9.454  42.642 1.00 47.29  ? 336 LYS A CB  1 
ATOM   2308 C  CG  . LYS A 1 294 ? 49.171 9.865  43.836 1.00 55.39  ? 336 LYS A CG  1 
ATOM   2309 C  CD  . LYS A 1 294 ? 49.221 8.710  44.825 1.00 59.90  ? 336 LYS A CD  1 
ATOM   2310 C  CE  . LYS A 1 294 ? 47.807 8.226  45.146 1.00 62.55  ? 336 LYS A CE  1 
ATOM   2311 N  NZ  . LYS A 1 294 ? 47.797 7.037  46.035 1.00 65.85  ? 336 LYS A NZ  1 
ATOM   2312 N  N   . ASN A 1 295 ? 47.520 8.930  40.033 1.00 40.73  ? 337 ASN A N   1 
ATOM   2313 C  CA  . ASN A 1 295 ? 46.765 8.201  39.039 1.00 40.89  ? 337 ASN A CA  1 
ATOM   2314 C  C   . ASN A 1 295 ? 47.107 6.740  39.333 1.00 44.60  ? 337 ASN A C   1 
ATOM   2315 O  O   . ASN A 1 295 ? 47.994 6.156  38.688 1.00 43.31  ? 337 ASN A O   1 
ATOM   2316 C  CB  . ASN A 1 295 ? 47.216 8.594  37.623 1.00 40.54  ? 337 ASN A CB  1 
ATOM   2317 C  CG  . ASN A 1 295 ? 46.364 7.958  36.556 1.00 39.76  ? 337 ASN A CG  1 
ATOM   2318 O  OD1 . ASN A 1 295 ? 45.310 7.397  36.858 1.00 38.36  ? 337 ASN A OD1 1 
ATOM   2319 N  ND2 . ASN A 1 295 ? 46.799 8.044  35.296 1.00 37.04  ? 337 ASN A ND2 1 
ATOM   2320 N  N   . VAL A 1 296 ? 46.414 6.164  40.317 1.00 42.63  ? 338 VAL A N   1 
ATOM   2321 C  CA  . VAL A 1 296 ? 46.651 4.783  40.744 1.00 46.55  ? 338 VAL A CA  1 
ATOM   2322 C  C   . VAL A 1 296 ? 46.229 3.699  39.759 1.00 48.50  ? 338 VAL A C   1 
ATOM   2323 O  O   . VAL A 1 296 ? 46.864 2.645  39.683 1.00 52.25  ? 338 VAL A O   1 
ATOM   2324 C  CB  . VAL A 1 296 ? 45.930 4.462  42.077 1.00 45.99  ? 338 VAL A CB  1 
ATOM   2325 C  CG1 . VAL A 1 296 ? 46.435 5.363  43.181 1.00 49.75  ? 338 VAL A CG1 1 
ATOM   2326 C  CG2 . VAL A 1 296 ? 44.434 4.615  41.900 1.00 45.25  ? 338 VAL A CG2 1 
ATOM   2327 N  N   . ALA A 1 297 ? 45.157 3.930  39.018 1.00 47.56  ? 339 ALA A N   1 
ATOM   2328 C  CA  . ALA A 1 297 ? 44.686 2.917  38.078 1.00 47.89  ? 339 ALA A CA  1 
ATOM   2329 C  C   . ALA A 1 297 ? 44.679 3.477  36.668 1.00 46.05  ? 339 ALA A C   1 
ATOM   2330 O  O   . ALA A 1 297 ? 43.633 3.628  36.056 1.00 46.84  ? 339 ALA A O   1 
ATOM   2331 C  CB  . ALA A 1 297 ? 43.294 2.462  38.473 1.00 47.88  ? 339 ALA A CB  1 
ATOM   2332 N  N   . PRO A 1 298 ? 45.865 3.761  36.125 1.00 47.11  ? 340 PRO A N   1 
ATOM   2333 C  CA  . PRO A 1 298 ? 46.025 4.321  34.783 1.00 48.63  ? 340 PRO A CA  1 
ATOM   2334 C  C   . PRO A 1 298 ? 45.263 3.592  33.696 1.00 50.54  ? 340 PRO A C   1 
ATOM   2335 O  O   . PRO A 1 298 ? 44.636 4.213  32.836 1.00 48.41  ? 340 PRO A O   1 
ATOM   2336 C  CB  . PRO A 1 298 ? 47.534 4.240  34.546 1.00 50.03  ? 340 PRO A CB  1 
ATOM   2337 C  CG  . PRO A 1 298 ? 48.109 4.235  35.921 1.00 50.43  ? 340 PRO A CG  1 
ATOM   2338 C  CD  . PRO A 1 298 ? 47.165 3.350  36.673 1.00 48.08  ? 340 PRO A CD  1 
ATOM   2339 N  N   . ASP A 1 299 ? 45.314 2.265  33.739 1.00 51.49  ? 341 ASP A N   1 
ATOM   2340 C  CA  . ASP A 1 299 ? 44.669 1.463  32.709 1.00 54.91  ? 341 ASP A CA  1 
ATOM   2341 C  C   . ASP A 1 299 ? 43.151 1.496  32.723 1.00 53.80  ? 341 ASP A C   1 
ATOM   2342 O  O   . ASP A 1 299 ? 42.499 1.204  31.720 1.00 53.39  ? 341 ASP A O   1 
ATOM   2343 C  CB  . ASP A 1 299 ? 45.179 0.021  32.795 1.00 59.65  ? 341 ASP A CB  1 
ATOM   2344 C  CG  . ASP A 1 299 ? 46.691 -0.065 32.612 1.00 64.72  ? 341 ASP A CG  1 
ATOM   2345 O  OD1 . ASP A 1 299 ? 47.224 0.677  31.751 1.00 65.53  ? 341 ASP A OD1 1 
ATOM   2346 O  OD2 . ASP A 1 299 ? 47.343 -0.867 33.319 1.00 67.55  ? 341 ASP A OD2 1 
ATOM   2347 N  N   . MET A 1 300 ? 42.589 1.864  33.861 1.00 51.72  ? 342 MET A N   1 
ATOM   2348 C  CA  . MET A 1 300 ? 41.146 1.935  33.994 1.00 50.16  ? 342 MET A CA  1 
ATOM   2349 C  C   . MET A 1 300 ? 40.529 2.912  32.997 1.00 47.13  ? 342 MET A C   1 
ATOM   2350 O  O   . MET A 1 300 ? 39.391 2.732  32.570 1.00 44.66  ? 342 MET A O   1 
ATOM   2351 C  CB  . MET A 1 300 ? 40.814 2.341  35.428 1.00 53.02  ? 342 MET A CB  1 
ATOM   2352 C  CG  . MET A 1 300 ? 39.365 2.665  35.704 1.00 56.74  ? 342 MET A CG  1 
ATOM   2353 S  SD  . MET A 1 300 ? 39.231 3.235  37.421 1.00 62.78  ? 342 MET A SD  1 
ATOM   2354 C  CE  . MET A 1 300 ? 40.401 4.609  37.384 1.00 55.11  ? 342 MET A CE  1 
ATOM   2355 N  N   . PHE A 1 301 ? 41.281 3.934  32.594 1.00 47.99  ? 343 PHE A N   1 
ATOM   2356 C  CA  . PHE A 1 301 ? 40.732 4.921  31.677 1.00 49.62  ? 343 PHE A CA  1 
ATOM   2357 C  C   . PHE A 1 301 ? 40.398 4.443  30.271 1.00 52.74  ? 343 PHE A C   1 
ATOM   2358 O  O   . PHE A 1 301 ? 39.824 5.191  29.477 1.00 51.95  ? 343 PHE A O   1 
ATOM   2359 C  CB  . PHE A 1 301 ? 41.631 6.150  31.623 1.00 48.90  ? 343 PHE A CB  1 
ATOM   2360 C  CG  . PHE A 1 301 ? 41.584 6.970  32.880 1.00 42.95  ? 343 PHE A CG  1 
ATOM   2361 C  CD1 . PHE A 1 301 ? 42.249 6.548  34.023 1.00 41.01  ? 343 PHE A CD1 1 
ATOM   2362 C  CD2 . PHE A 1 301 ? 40.855 8.148  32.925 1.00 41.87  ? 343 PHE A CD2 1 
ATOM   2363 C  CE1 . PHE A 1 301 ? 42.192 7.293  35.202 1.00 37.71  ? 343 PHE A CE1 1 
ATOM   2364 C  CE2 . PHE A 1 301 ? 40.794 8.896  34.096 1.00 39.86  ? 343 PHE A CE2 1 
ATOM   2365 C  CZ  . PHE A 1 301 ? 41.463 8.466  35.233 1.00 35.86  ? 343 PHE A CZ  1 
ATOM   2366 N  N   . ARG A 1 302 ? 40.743 3.201  29.954 1.00 55.39  ? 344 ARG A N   1 
ATOM   2367 C  CA  . ARG A 1 302 ? 40.398 2.681  28.641 1.00 57.57  ? 344 ARG A CA  1 
ATOM   2368 C  C   . ARG A 1 302 ? 38.884 2.504  28.564 1.00 56.33  ? 344 ARG A C   1 
ATOM   2369 O  O   . ARG A 1 302 ? 38.324 2.383  27.478 1.00 57.80  ? 344 ARG A O   1 
ATOM   2370 C  CB  . ARG A 1 302 ? 41.123 1.359  28.381 1.00 60.71  ? 344 ARG A CB  1 
ATOM   2371 C  CG  . ARG A 1 302 ? 42.595 1.580  28.061 1.00 65.33  ? 344 ARG A CG  1 
ATOM   2372 C  CD  . ARG A 1 302 ? 43.367 0.289  27.839 1.00 71.00  ? 344 ARG A CD  1 
ATOM   2373 N  NE  . ARG A 1 302 ? 43.562 -0.469 29.073 1.00 73.86  ? 344 ARG A NE  1 
ATOM   2374 C  CZ  . ARG A 1 302 ? 44.680 -1.128 29.371 1.00 76.03  ? 344 ARG A CZ  1 
ATOM   2375 N  NH1 . ARG A 1 302 ? 45.707 -1.118 28.526 1.00 74.80  ? 344 ARG A NH1 1 
ATOM   2376 N  NH2 . ARG A 1 302 ? 44.770 -1.805 30.510 1.00 76.47  ? 344 ARG A NH2 1 
ATOM   2377 N  N   . THR A 1 303 ? 38.212 2.511  29.713 1.00 53.93  ? 345 THR A N   1 
ATOM   2378 C  CA  . THR A 1 303 ? 36.757 2.364  29.712 1.00 52.36  ? 345 THR A CA  1 
ATOM   2379 C  C   . THR A 1 303 ? 36.006 3.635  30.114 1.00 50.49  ? 345 THR A C   1 
ATOM   2380 O  O   . THR A 1 303 ? 34.802 3.593  30.365 1.00 50.93  ? 345 THR A O   1 
ATOM   2381 C  CB  . THR A 1 303 ? 36.296 1.210  30.635 1.00 54.26  ? 345 THR A CB  1 
ATOM   2382 O  OG1 . THR A 1 303 ? 36.857 1.377  31.945 1.00 56.50  ? 345 THR A OG1 1 
ATOM   2383 C  CG2 . THR A 1 303 ? 36.739 -0.139 30.069 1.00 55.27  ? 345 THR A CG2 1 
ATOM   2384 N  N   . ILE A 1 304 ? 36.703 4.764  30.170 1.00 48.54  ? 346 ILE A N   1 
ATOM   2385 C  CA  . ILE A 1 304 ? 36.051 6.021  30.546 1.00 46.57  ? 346 ILE A CA  1 
ATOM   2386 C  C   . ILE A 1 304 ? 34.987 6.366  29.506 1.00 48.54  ? 346 ILE A C   1 
ATOM   2387 O  O   . ILE A 1 304 ? 35.205 6.197  28.309 1.00 48.59  ? 346 ILE A O   1 
ATOM   2388 C  CB  . ILE A 1 304 ? 37.086 7.185  30.641 1.00 45.41  ? 346 ILE A CB  1 
ATOM   2389 C  CG1 . ILE A 1 304 ? 36.458 8.413  31.300 1.00 41.24  ? 346 ILE A CG1 1 
ATOM   2390 C  CG2 . ILE A 1 304 ? 37.568 7.590  29.253 1.00 42.46  ? 346 ILE A CG2 1 
ATOM   2391 C  CD1 . ILE A 1 304 ? 37.504 9.471  31.654 1.00 35.75  ? 346 ILE A CD1 1 
ATOM   2392 N  N   . PRO A 1 305 ? 33.805 6.825  29.950 1.00 48.60  ? 347 PRO A N   1 
ATOM   2393 C  CA  . PRO A 1 305 ? 32.743 7.179  29.005 1.00 48.37  ? 347 PRO A CA  1 
ATOM   2394 C  C   . PRO A 1 305 ? 33.215 8.178  27.947 1.00 50.21  ? 347 PRO A C   1 
ATOM   2395 O  O   . PRO A 1 305 ? 34.032 9.061  28.234 1.00 46.68  ? 347 PRO A O   1 
ATOM   2396 C  CB  . PRO A 1 305 ? 31.662 7.747  29.913 1.00 46.46  ? 347 PRO A CB  1 
ATOM   2397 C  CG  . PRO A 1 305 ? 31.809 6.914  31.129 1.00 43.96  ? 347 PRO A CG  1 
ATOM   2398 C  CD  . PRO A 1 305 ? 33.300 6.851  31.335 1.00 46.60  ? 347 PRO A CD  1 
ATOM   2399 N  N   . ALA A 1 306 ? 32.685 8.036  26.730 1.00 49.47  ? 348 ALA A N   1 
ATOM   2400 C  CA  . ALA A 1 306 ? 33.054 8.892  25.598 1.00 48.44  ? 348 ALA A CA  1 
ATOM   2401 C  C   . ALA A 1 306 ? 32.845 10.386 25.823 1.00 48.76  ? 348 ALA A C   1 
ATOM   2402 O  O   . ALA A 1 306 ? 33.565 11.211 25.261 1.00 49.66  ? 348 ALA A O   1 
ATOM   2403 C  CB  . ALA A 1 306 ? 32.286 8.449  24.342 1.00 47.12  ? 348 ALA A CB  1 
ATOM   2404 N  N   . GLU A 1 307 ? 31.854 10.745 26.628 1.00 46.67  ? 349 GLU A N   1 
ATOM   2405 C  CA  . GLU A 1 307 ? 31.579 12.155 26.886 1.00 48.78  ? 349 GLU A CA  1 
ATOM   2406 C  C   . GLU A 1 307 ? 32.773 12.871 27.533 1.00 45.93  ? 349 GLU A C   1 
ATOM   2407 O  O   . GLU A 1 307 ? 32.904 14.087 27.427 1.00 46.44  ? 349 GLU A O   1 
ATOM   2408 C  CB  . GLU A 1 307 ? 30.361 12.288 27.798 1.00 51.74  ? 349 GLU A CB  1 
ATOM   2409 C  CG  . GLU A 1 307 ? 30.558 11.612 29.141 1.00 57.78  ? 349 GLU A CG  1 
ATOM   2410 C  CD  . GLU A 1 307 ? 29.324 11.677 30.018 1.00 61.81  ? 349 GLU A CD  1 
ATOM   2411 O  OE1 . GLU A 1 307 ? 29.341 11.079 31.121 1.00 62.88  ? 349 GLU A OE1 1 
ATOM   2412 O  OE2 . GLU A 1 307 ? 28.337 12.327 29.606 1.00 63.68  ? 349 GLU A OE2 1 
ATOM   2413 N  N   . ALA A 1 308 ? 33.632 12.109 28.204 1.00 43.42  ? 350 ALA A N   1 
ATOM   2414 C  CA  . ALA A 1 308 ? 34.802 12.666 28.881 1.00 44.03  ? 350 ALA A CA  1 
ATOM   2415 C  C   . ALA A 1 308 ? 35.791 13.299 27.906 1.00 46.21  ? 350 ALA A C   1 
ATOM   2416 O  O   . ALA A 1 308 ? 36.679 14.052 28.309 1.00 44.07  ? 350 ALA A O   1 
ATOM   2417 C  CB  . ALA A 1 308 ? 35.494 11.584 29.668 1.00 38.55  ? 350 ALA A CB  1 
ATOM   2418 N  N   . ASN A 1 309 ? 35.640 12.972 26.626 1.00 47.93  ? 351 ASN A N   1 
ATOM   2419 C  CA  . ASN A 1 309 ? 36.521 13.485 25.585 1.00 52.45  ? 351 ASN A CA  1 
ATOM   2420 C  C   . ASN A 1 309 ? 35.735 14.370 24.627 1.00 55.83  ? 351 ASN A C   1 
ATOM   2421 O  O   . ASN A 1 309 ? 36.295 14.939 23.684 1.00 55.43  ? 351 ASN A O   1 
ATOM   2422 C  CB  . ASN A 1 309 ? 37.150 12.319 24.815 1.00 52.14  ? 351 ASN A CB  1 
ATOM   2423 C  CG  . ASN A 1 309 ? 37.762 11.277 25.736 1.00 56.37  ? 351 ASN A CG  1 
ATOM   2424 O  OD1 . ASN A 1 309 ? 38.761 11.542 26.413 1.00 52.76  ? 351 ASN A OD1 1 
ATOM   2425 N  ND2 . ASN A 1 309 ? 37.154 10.083 25.780 1.00 54.18  ? 351 ASN A ND2 1 
ATOM   2426 N  N   . ILE A 1 310 ? 34.436 14.490 24.882 1.00 57.72  ? 352 ILE A N   1 
ATOM   2427 C  CA  . ILE A 1 310 ? 33.571 15.288 24.029 1.00 61.57  ? 352 ILE A CA  1 
ATOM   2428 C  C   . ILE A 1 310 ? 33.381 16.706 24.559 1.00 63.37  ? 352 ILE A C   1 
ATOM   2429 O  O   . ILE A 1 310 ? 32.977 16.915 25.705 1.00 62.32  ? 352 ILE A O   1 
ATOM   2430 C  CB  . ILE A 1 310 ? 32.182 14.612 23.857 1.00 62.42  ? 352 ILE A CB  1 
ATOM   2431 C  CG1 . ILE A 1 310 ? 32.366 13.173 23.359 1.00 63.15  ? 352 ILE A CG1 1 
ATOM   2432 C  CG2 . ILE A 1 310 ? 31.312 15.418 22.891 1.00 62.14  ? 352 ILE A CG2 1 
ATOM   2433 C  CD1 . ILE A 1 310 ? 33.353 13.022 22.198 1.00 64.52  ? 352 ILE A CD1 1 
ATOM   2434 N  N   . PRO A 1 311 ? 33.683 17.706 23.722 1.00 65.07  ? 353 PRO A N   1 
ATOM   2435 C  CA  . PRO A 1 311 ? 33.538 19.108 24.114 1.00 66.51  ? 353 PRO A CA  1 
ATOM   2436 C  C   . PRO A 1 311 ? 32.080 19.370 24.481 1.00 67.34  ? 353 PRO A C   1 
ATOM   2437 O  O   . PRO A 1 311 ? 31.179 18.765 23.903 1.00 66.41  ? 353 PRO A O   1 
ATOM   2438 C  CB  . PRO A 1 311 ? 33.953 19.863 22.853 1.00 66.75  ? 353 PRO A CB  1 
ATOM   2439 C  CG  . PRO A 1 311 ? 34.909 18.908 22.183 1.00 66.75  ? 353 PRO A CG  1 
ATOM   2440 C  CD  . PRO A 1 311 ? 34.216 17.591 22.355 1.00 65.91  ? 353 PRO A CD  1 
ATOM   2441 N  N   . ILE A 1 312 ? 31.840 20.246 25.447 1.00 70.30  ? 354 ILE A N   1 
ATOM   2442 C  CA  . ILE A 1 312 ? 30.462 20.544 25.814 1.00 73.85  ? 354 ILE A CA  1 
ATOM   2443 C  C   . ILE A 1 312 ? 29.918 21.614 24.874 1.00 76.58  ? 354 ILE A C   1 
ATOM   2444 O  O   . ILE A 1 312 ? 30.487 22.701 24.758 1.00 75.88  ? 354 ILE A O   1 
ATOM   2445 C  CB  . ILE A 1 312 ? 30.350 21.039 27.265 1.00 73.24  ? 354 ILE A CB  1 
ATOM   2446 C  CG1 . ILE A 1 312 ? 30.821 19.933 28.219 1.00 73.57  ? 354 ILE A CG1 1 
ATOM   2447 C  CG2 . ILE A 1 312 ? 28.898 21.434 27.578 1.00 73.59  ? 354 ILE A CG2 1 
ATOM   2448 C  CD1 . ILE A 1 312 ? 30.649 20.259 29.673 1.00 73.35  ? 354 ILE A CD1 1 
ATOM   2449 N  N   . PRO A 1 313 ? 28.810 21.309 24.176 1.00 79.27  ? 355 PRO A N   1 
ATOM   2450 C  CA  . PRO A 1 313 ? 28.196 22.258 23.239 1.00 81.72  ? 355 PRO A CA  1 
ATOM   2451 C  C   . PRO A 1 313 ? 27.698 23.501 23.970 1.00 83.75  ? 355 PRO A C   1 
ATOM   2452 O  O   . PRO A 1 313 ? 27.093 23.389 25.042 1.00 84.19  ? 355 PRO A O   1 
ATOM   2453 C  CB  . PRO A 1 313 ? 27.054 21.445 22.631 1.00 81.24  ? 355 PRO A CB  1 
ATOM   2454 C  CG  . PRO A 1 313 ? 26.643 20.553 23.754 1.00 79.79  ? 355 PRO A CG  1 
ATOM   2455 C  CD  . PRO A 1 313 ? 27.973 20.103 24.329 1.00 79.95  ? 355 PRO A CD  1 
ATOM   2456 N  N   . VAL A 1 314 ? 27.963 24.677 23.403 1.00 85.24  ? 356 VAL A N   1 
ATOM   2457 C  CA  . VAL A 1 314 ? 27.525 25.928 24.014 1.00 86.92  ? 356 VAL A CA  1 
ATOM   2458 C  C   . VAL A 1 314 ? 25.996 26.033 23.984 1.00 87.47  ? 356 VAL A C   1 
ATOM   2459 O  O   . VAL A 1 314 ? 25.397 26.297 25.053 1.00 87.10  ? 356 VAL A O   1 
ATOM   2460 C  CB  . VAL A 1 314 ? 28.169 27.172 23.302 1.00 86.91  ? 356 VAL A CB  1 
ATOM   2461 C  CG1 . VAL A 1 314 ? 29.677 27.214 23.579 1.00 87.08  ? 356 VAL A CG1 1 
ATOM   2462 C  CG2 . VAL A 1 314 ? 27.914 27.119 21.797 1.00 86.62  ? 356 VAL A CG2 1 
ATOM   2463 O  OXT . VAL A 1 314 ? 25.410 25.830 22.894 1.00 87.70  ? 356 VAL A OXT 1 
HETATM 2464 CU CU  . CU  B 2 .   ? 37.574 35.561 37.644 1.00 52.09  ? 357 CU  A CU  1 
HETATM 2465 CU CU  . CU  C 2 .   ? 44.987 28.022 38.164 1.00 33.96  ? 358 CU  A CU  1 
HETATM 2466 NI NI  . NI  D 3 .   ? 23.037 7.874  49.278 1.00 32.72  ? 359 NI  A NI  1 
HETATM 2467 O  O1  . OXY E 4 .   ? 45.243 29.834 39.206 1.00 39.91  ? 360 OXY A O1  1 
HETATM 2468 O  O2  . OXY E 4 .   ? 46.420 29.968 39.545 1.00 45.94  ? 360 OXY A O2  1 
HETATM 2469 C  CAN A IYT F 5 .   ? 48.785 23.335 41.353 1.00 38.35  ? 701 IYT A CAN 1 
HETATM 2470 C  CN  A IYT F 5 .   ? 47.270 23.489 41.330 1.00 38.91  ? 701 IYT A CN  1 
HETATM 2471 O  ON  A IYT F 5 .   ? 46.600 22.787 40.558 1.00 32.87  ? 701 IYT A ON  1 
HETATM 2472 N  N   A IYT F 5 .   ? 46.718 24.363 42.182 1.00 38.02  ? 701 IYT A N   1 
HETATM 2473 C  CA  A IYT F 5 .   ? 45.282 24.575 42.154 0.55 39.76  ? 701 IYT A CA  1 
HETATM 2474 C  CA  B IYT F 5 .   ? 45.271 24.572 42.235 0.45 40.31  ? 701 IYT A CA  1 
HETATM 2475 C  CB  A IYT F 5 .   ? 44.566 23.629 43.129 0.55 41.80  ? 701 IYT A CB  1 
HETATM 2476 C  CB  B IYT F 5 .   ? 44.658 23.814 43.413 0.45 43.62  ? 701 IYT A CB  1 
HETATM 2477 C  CG  A IYT F 5 .   ? 44.713 23.893 44.605 0.55 48.39  ? 701 IYT A CG  1 
HETATM 2478 C  CG  B IYT F 5 .   ? 45.147 24.248 44.784 0.45 49.84  ? 701 IYT A CG  1 
HETATM 2479 C  CD1 A IYT F 5 .   ? 43.627 24.362 45.343 0.55 49.89  ? 701 IYT A CD1 1 
HETATM 2480 C  CD1 B IYT F 5 .   ? 44.950 25.558 45.254 0.45 52.38  ? 701 IYT A CD1 1 
HETATM 2481 C  CE1 A IYT F 5 .   ? 43.685 24.497 46.717 0.55 52.34  ? 701 IYT A CE1 1 
HETATM 2482 C  CE1 B IYT F 5 .   ? 45.375 25.953 46.534 0.45 55.79  ? 701 IYT A CE1 1 
HETATM 2483 C  CD2 A IYT F 5 .   ? 45.888 23.574 45.286 0.55 49.85  ? 701 IYT A CD2 1 
HETATM 2484 C  CD2 B IYT F 5 .   ? 45.775 23.333 45.616 0.45 51.70  ? 701 IYT A CD2 1 
HETATM 2485 C  CE2 A IYT F 5 .   ? 45.972 23.707 46.673 0.55 53.03  ? 701 IYT A CE2 1 
HETATM 2486 C  CE2 B IYT F 5 .   ? 46.203 23.670 46.885 0.45 55.65  ? 701 IYT A CE2 1 
HETATM 2487 C  CZ  A IYT F 5 .   ? 44.854 24.164 47.393 0.55 52.56  ? 701 IYT A CZ  1 
HETATM 2488 C  CZ  B IYT F 5 .   ? 46.015 24.997 47.360 0.45 55.87  ? 701 IYT A CZ  1 
HETATM 2489 O  OH  A IYT F 5 .   ? 44.868 24.241 48.767 0.55 48.71  ? 701 IYT A OH  1 
HETATM 2490 O  OH  B IYT F 5 .   ? 46.477 25.356 48.607 0.45 56.70  ? 701 IYT A OH  1 
HETATM 2491 I  I1  A IYT F 5 .   ? 42.044 25.215 47.741 0.29 55.42  ? 701 IYT A I1  1 
HETATM 2492 I  I1  B IYT F 5 .   ? 45.028 27.921 47.189 0.31 60.06  ? 701 IYT A I1  1 
HETATM 2493 I  I2  A IYT F 5 .   ? 47.744 23.264 47.639 0.16 58.95  ? 701 IYT A I2  1 
HETATM 2494 I  I2  B IYT F 5 .   ? 47.057 22.195 48.073 0.19 59.03  ? 701 IYT A I2  1 
HETATM 2495 C  C   A IYT F 5 .   ? 44.878 26.038 42.341 1.00 40.08  ? 701 IYT A C   1 
HETATM 2496 O  O   A IYT F 5 .   ? 45.677 26.872 42.789 1.00 42.12  ? 701 IYT A O   1 
HETATM 2497 N  NT  A IYT F 5 .   ? 43.637 26.336 41.947 1.00 38.33  ? 701 IYT A NT  1 
HETATM 2498 C  CAT A IYT F 5 .   ? 43.058 27.681 41.964 1.00 40.03  ? 701 IYT A CAT 1 
HETATM 2499 C  CBT A IYT F 5 .   ? 43.211 28.390 43.327 1.00 40.45  ? 701 IYT A CBT 1 
HETATM 2500 O  OGT A IYT F 5 .   ? 42.393 27.741 44.307 1.00 51.91  ? 701 IYT A OGT 1 
HETATM 2501 C  CGT A IYT F 5 .   ? 42.776 29.850 43.206 1.00 43.60  ? 701 IYT A CGT 1 
HETATM 2502 C  CT  A IYT F 5 .   ? 41.570 27.591 41.592 1.00 36.25  ? 701 IYT A CT  1 
HETATM 2503 O  OX1 A IYT F 5 .   ? 41.004 28.606 41.134 1.00 34.97  ? 701 IYT A OX1 1 
HETATM 2504 O  OX2 A IYT F 5 .   ? 40.997 26.484 41.749 1.00 35.74  ? 701 IYT A OX2 1 
HETATM 2505 C  CAN . IYT G 5 .   ? 17.513 37.902 56.476 0.95 80.48  ? 702 IYT A CAN 1 
HETATM 2506 C  CN  . IYT G 5 .   ? 18.677 36.928 56.548 0.95 80.63  ? 702 IYT A CN  1 
HETATM 2507 O  ON  . IYT G 5 .   ? 19.671 37.091 55.837 0.95 81.36  ? 702 IYT A ON  1 
HETATM 2508 N  N   . IYT G 5 .   ? 18.546 35.912 57.399 0.95 78.42  ? 702 IYT A N   1 
HETATM 2509 C  CA  . IYT G 5 .   ? 19.585 34.898 57.586 0.95 76.08  ? 702 IYT A CA  1 
HETATM 2510 C  CB  . IYT G 5 .   ? 20.645 35.409 58.555 0.95 69.96  ? 702 IYT A CB  1 
HETATM 2511 C  CG  . IYT G 5 .   ? 21.761 36.172 57.913 0.95 64.80  ? 702 IYT A CG  1 
HETATM 2512 C  CD1 . IYT G 5 .   ? 22.721 35.522 57.129 0.95 60.39  ? 702 IYT A CD1 1 
HETATM 2513 C  CE1 . IYT G 5 .   ? 23.766 36.227 56.534 0.95 57.98  ? 702 IYT A CE1 1 
HETATM 2514 C  CD2 . IYT G 5 .   ? 21.863 37.541 58.096 0.95 60.69  ? 702 IYT A CD2 1 
HETATM 2515 C  CE2 . IYT G 5 .   ? 22.881 38.268 57.532 0.95 59.62  ? 702 IYT A CE2 1 
HETATM 2516 C  CZ  . IYT G 5 .   ? 23.844 37.621 56.738 0.95 58.35  ? 702 IYT A CZ  1 
HETATM 2517 O  OH  . IYT G 5 .   ? 24.838 38.361 56.142 0.95 60.68  ? 702 IYT A OH  1 
HETATM 2518 I  I1  . IYT G 5 .   ? 25.181 35.216 55.380 0.95 47.93  ? 702 IYT A I1  1 
HETATM 2519 I  I2  . IYT G 5 .   ? 22.994 40.293 57.907 0.16 57.88  ? 702 IYT A I2  1 
HETATM 2520 C  C   . IYT G 5 .   ? 19.042 33.589 58.148 0.95 77.94  ? 702 IYT A C   1 
HETATM 2521 O  O   . IYT G 5 .   ? 18.539 32.729 57.422 0.95 79.08  ? 702 IYT A O   1 
HETATM 2522 N  NT  . IYT G 5 .   ? 19.184 33.467 59.465 0.95 79.63  ? 702 IYT A NT  1 
HETATM 2523 C  CAT . IYT G 5 .   ? 18.762 32.311 60.244 0.95 81.07  ? 702 IYT A CAT 1 
HETATM 2524 C  CBT . IYT G 5 .   ? 17.342 31.833 59.851 0.95 82.18  ? 702 IYT A CBT 1 
HETATM 2525 O  OGT . IYT G 5 .   ? 16.382 32.851 60.168 0.95 82.94  ? 702 IYT A OGT 1 
HETATM 2526 C  CGT . IYT G 5 .   ? 16.991 30.545 60.589 0.95 82.24  ? 702 IYT A CGT 1 
HETATM 2527 C  CT  . IYT G 5 .   ? 18.768 32.761 61.705 0.95 81.15  ? 702 IYT A CT  1 
HETATM 2528 O  OX1 . IYT G 5 .   ? 19.358 32.049 62.548 0.95 80.15  ? 702 IYT A OX1 1 
HETATM 2529 O  OX2 . IYT G 5 .   ? 18.189 33.836 61.984 0.95 81.51  ? 702 IYT A OX2 1 
HETATM 2530 C  CAN . IYT H 5 .   ? 33.596 31.450 72.182 0.59 69.42  ? 703 IYT A CAN 1 
HETATM 2531 C  CN  . IYT H 5 .   ? 32.532 31.755 73.219 0.59 69.15  ? 703 IYT A CN  1 
HETATM 2532 O  ON  . IYT H 5 .   ? 32.848 31.946 74.393 0.59 69.74  ? 703 IYT A ON  1 
HETATM 2533 N  N   . IYT H 5 .   ? 31.272 31.797 72.783 0.59 69.57  ? 703 IYT A N   1 
HETATM 2534 C  CA  . IYT H 5 .   ? 30.138 32.080 73.667 0.59 68.84  ? 703 IYT A CA  1 
HETATM 2535 C  CB  . IYT H 5 .   ? 28.811 31.673 73.023 0.59 67.14  ? 703 IYT A CB  1 
HETATM 2536 C  CG  . IYT H 5 .   ? 28.775 31.701 71.518 0.59 63.94  ? 703 IYT A CG  1 
HETATM 2537 C  CD1 . IYT H 5 .   ? 29.597 30.867 70.764 0.59 62.22  ? 703 IYT A CD1 1 
HETATM 2538 C  CE1 . IYT H 5 .   ? 29.552 30.867 69.379 0.59 61.19  ? 703 IYT A CE1 1 
HETATM 2539 C  CD2 . IYT H 5 .   ? 27.904 32.545 70.850 0.59 63.37  ? 703 IYT A CD2 1 
HETATM 2540 C  CE2 . IYT H 5 .   ? 27.842 32.567 69.473 0.59 62.81  ? 703 IYT A CE2 1 
HETATM 2541 C  CZ  . IYT H 5 .   ? 28.662 31.722 68.726 0.59 61.94  ? 703 IYT A CZ  1 
HETATM 2542 O  OH  . IYT H 5 .   ? 28.575 31.724 67.353 0.59 64.42  ? 703 IYT A OH  1 
HETATM 2543 I  I1  . IYT H 5 .   ? 30.819 29.633 68.308 0.40 57.86  ? 703 IYT A I1  1 
HETATM 2544 I  I2  . IYT H 5 .   ? 26.577 33.875 68.546 0.13 64.50  ? 703 IYT A I2  1 
HETATM 2545 C  C   . IYT H 5 .   ? 30.261 31.305 74.967 0.59 70.00  ? 703 IYT A C   1 
HETATM 2546 O  O   . IYT H 5 .   ? 30.762 30.181 74.974 0.59 70.11  ? 703 IYT A O   1 
HETATM 2547 N  NT  . IYT H 5 .   ? 29.777 31.918 76.046 0.59 71.03  ? 703 IYT A NT  1 
HETATM 2548 C  CAT . IYT H 5 .   ? 29.773 31.357 77.400 0.59 73.10  ? 703 IYT A CAT 1 
HETATM 2549 C  CBT . IYT H 5 .   ? 30.677 30.103 77.546 0.59 74.16  ? 703 IYT A CBT 1 
HETATM 2550 O  OGT . IYT H 5 .   ? 30.085 28.993 76.858 0.59 74.92  ? 703 IYT A OGT 1 
HETATM 2551 C  CGT . IYT H 5 .   ? 30.853 29.744 79.017 0.59 74.76  ? 703 IYT A CGT 1 
HETATM 2552 C  CT  . IYT H 5 .   ? 28.349 30.965 77.782 0.59 73.54  ? 703 IYT A CT  1 
HETATM 2553 O  OX1 . IYT H 5 .   ? 27.901 31.370 78.874 0.59 73.05  ? 703 IYT A OX1 1 
HETATM 2554 O  OX2 . IYT H 5 .   ? 27.698 30.256 76.985 0.59 75.15  ? 703 IYT A OX2 1 
HETATM 2555 C  C1  . GOL I 6 .   ? 21.778 5.450  49.473 1.00 43.84  ? 363 GOL A C1  1 
HETATM 2556 O  O1  . GOL I 6 .   ? 21.545 6.367  48.430 1.00 33.58  ? 363 GOL A O1  1 
HETATM 2557 C  C2  . GOL I 6 .   ? 23.266 5.087  49.592 1.00 48.97  ? 363 GOL A C2  1 
HETATM 2558 O  O2  . GOL I 6 .   ? 24.039 6.267  49.872 1.00 35.94  ? 363 GOL A O2  1 
HETATM 2559 C  C3  . GOL I 6 .   ? 23.424 4.070  50.734 1.00 54.25  ? 363 GOL A C3  1 
HETATM 2560 O  O3  . GOL I 6 .   ? 24.743 3.546  50.797 1.00 61.78  ? 363 GOL A O3  1 
HETATM 2561 C  C1  . GOL J 6 .   ? 28.790 26.464 49.262 1.00 31.82  ? 364 GOL A C1  1 
HETATM 2562 O  O1  . GOL J 6 .   ? 29.977 26.994 48.716 1.00 30.63  ? 364 GOL A O1  1 
HETATM 2563 C  C2  . GOL J 6 .   ? 27.736 26.308 48.150 1.00 34.62  ? 364 GOL A C2  1 
HETATM 2564 O  O2  . GOL J 6 .   ? 27.549 27.583 47.533 1.00 35.27  ? 364 GOL A O2  1 
HETATM 2565 C  C3  . GOL J 6 .   ? 28.193 25.319 47.067 1.00 37.96  ? 364 GOL A C3  1 
HETATM 2566 O  O3  . GOL J 6 .   ? 27.220 25.206 46.033 1.00 37.59  ? 364 GOL A O3  1 
HETATM 2567 C  C1  . GOL K 6 .   ? 36.496 23.792 56.324 1.00 41.34  ? 365 GOL A C1  1 
HETATM 2568 O  O1  . GOL K 6 .   ? 35.912 22.523 56.118 1.00 36.66  ? 365 GOL A O1  1 
HETATM 2569 C  C2  . GOL K 6 .   ? 38.020 23.680 56.464 1.00 41.08  ? 365 GOL A C2  1 
HETATM 2570 O  O2  . GOL K 6 .   ? 38.567 24.993 56.320 1.00 44.25  ? 365 GOL A O2  1 
HETATM 2571 C  C3  . GOL K 6 .   ? 38.435 23.091 57.833 1.00 37.56  ? 365 GOL A C3  1 
HETATM 2572 O  O3  . GOL K 6 .   ? 38.038 23.921 58.929 1.00 30.78  ? 365 GOL A O3  1 
HETATM 2573 C  C1  . GOL L 6 .   ? 40.760 9.274  50.719 1.00 51.46  ? 366 GOL A C1  1 
HETATM 2574 O  O1  . GOL L 6 .   ? 40.375 7.998  51.200 1.00 45.16  ? 366 GOL A O1  1 
HETATM 2575 C  C2  . GOL L 6 .   ? 41.633 9.141  49.464 1.00 51.88  ? 366 GOL A C2  1 
HETATM 2576 O  O2  . GOL L 6 .   ? 40.800 8.911  48.316 1.00 41.78  ? 366 GOL A O2  1 
HETATM 2577 C  C3  . GOL L 6 .   ? 42.459 10.415 49.249 1.00 55.25  ? 366 GOL A C3  1 
HETATM 2578 O  O3  . GOL L 6 .   ? 43.432 10.227 48.228 1.00 58.35  ? 366 GOL A O3  1 
HETATM 2579 C  C1  . GOL M 6 .   ? 22.056 21.252 46.442 1.00 58.51  ? 367 GOL A C1  1 
HETATM 2580 O  O1  . GOL M 6 .   ? 21.884 21.881 45.189 1.00 60.11  ? 367 GOL A O1  1 
HETATM 2581 C  C2  . GOL M 6 .   ? 21.700 19.768 46.379 1.00 59.78  ? 367 GOL A C2  1 
HETATM 2582 O  O2  . GOL M 6 .   ? 22.576 19.098 45.450 1.00 58.25  ? 367 GOL A O2  1 
HETATM 2583 C  C3  . GOL M 6 .   ? 21.845 19.190 47.789 1.00 57.58  ? 367 GOL A C3  1 
HETATM 2584 O  O3  . GOL M 6 .   ? 21.408 17.853 47.871 1.00 57.05  ? 367 GOL A O3  1 
HETATM 2585 C  C1  . GOL N 6 .   ? 41.444 19.943 49.644 1.00 49.17  ? 368 GOL A C1  1 
HETATM 2586 O  O1  . GOL N 6 .   ? 40.916 18.880 50.405 1.00 60.51  ? 368 GOL A O1  1 
HETATM 2587 C  C2  . GOL N 6 .   ? 40.414 21.060 49.537 1.00 49.91  ? 368 GOL A C2  1 
HETATM 2588 O  O2  . GOL N 6 .   ? 40.163 21.643 50.828 1.00 43.92  ? 368 GOL A O2  1 
HETATM 2589 C  C3  . GOL N 6 .   ? 40.930 22.122 48.587 1.00 45.19  ? 368 GOL A C3  1 
HETATM 2590 O  O3  . GOL N 6 .   ? 39.994 23.147 48.486 1.00 34.93  ? 368 GOL A O3  1 
HETATM 2591 O  O   . HOH O 7 .   ? 23.812 7.812  47.449 1.00 31.68  ? 361 HOH A O   1 
HETATM 2592 O  O   . HOH O 7 .   ? 22.143 7.864  51.039 1.00 27.16  ? 362 HOH A O   1 
HETATM 2593 O  O   . HOH O 7 .   ? 33.371 26.105 34.791 0.52 25.66  ? 400 HOH A O   1 
HETATM 2594 O  O   . HOH O 7 .   ? 30.063 28.181 46.127 1.00 27.48  ? 401 HOH A O   1 
HETATM 2595 O  O   . HOH O 7 .   ? 23.285 25.049 55.841 1.00 27.52  ? 402 HOH A O   1 
HETATM 2596 O  O   . HOH O 7 .   ? 34.095 21.024 57.344 1.00 28.30  ? 403 HOH A O   1 
HETATM 2597 O  O   . HOH O 7 .   ? 33.201 25.010 37.552 1.00 28.36  ? 404 HOH A O   1 
HETATM 2598 O  O   . HOH O 7 .   ? 54.101 26.023 31.318 1.00 28.61  ? 405 HOH A O   1 
HETATM 2599 O  O   . HOH O 7 .   ? 46.846 21.054 38.628 1.00 28.81  ? 406 HOH A O   1 
HETATM 2600 O  O   . HOH O 7 .   ? 35.662 8.977  57.365 1.00 30.12  ? 407 HOH A O   1 
HETATM 2601 O  O   . HOH O 7 .   ? 53.659 19.518 34.970 1.00 30.15  ? 408 HOH A O   1 
HETATM 2602 O  O   . HOH O 7 .   ? 51.875 23.845 25.036 1.00 31.64  ? 409 HOH A O   1 
HETATM 2603 O  O   . HOH O 7 .   ? 27.346 10.986 53.452 1.00 33.10  ? 410 HOH A O   1 
HETATM 2604 O  O   . HOH O 7 .   ? 36.334 21.649 53.771 1.00 33.21  ? 411 HOH A O   1 
HETATM 2605 O  O   . HOH O 7 .   ? 28.893 9.707  56.032 1.00 33.78  ? 412 HOH A O   1 
HETATM 2606 O  O   . HOH O 7 .   ? 24.650 28.439 51.431 1.00 33.83  ? 413 HOH A O   1 
HETATM 2607 O  O   . HOH O 7 .   ? 29.341 28.998 43.099 1.00 33.83  ? 414 HOH A O   1 
HETATM 2608 O  O   . HOH O 7 .   ? 25.262 23.720 47.133 1.00 34.27  ? 415 HOH A O   1 
HETATM 2609 O  O   . HOH O 7 .   ? 26.524 11.814 62.924 1.00 34.72  ? 416 HOH A O   1 
HETATM 2610 O  O   . HOH O 7 .   ? 31.093 44.286 64.495 1.00 34.98  ? 417 HOH A O   1 
HETATM 2611 O  O   . HOH O 7 .   ? 28.196 18.292 64.130 1.00 35.38  ? 418 HOH A O   1 
HETATM 2612 O  O   . HOH O 7 .   ? 36.713 15.114 30.729 1.00 35.64  ? 419 HOH A O   1 
HETATM 2613 O  O   . HOH O 7 .   ? 27.453 7.355  56.358 1.00 36.64  ? 420 HOH A O   1 
HETATM 2614 O  O   . HOH O 7 .   ? 47.603 27.749 29.905 1.00 36.79  ? 421 HOH A O   1 
HETATM 2615 O  O   . HOH O 7 .   ? 37.628 22.837 51.654 1.00 36.85  ? 422 HOH A O   1 
HETATM 2616 O  O   . HOH O 7 .   ? 26.021 29.445 49.244 1.00 37.02  ? 423 HOH A O   1 
HETATM 2617 O  O   . HOH O 7 .   ? 22.159 24.324 58.319 1.00 37.18  ? 424 HOH A O   1 
HETATM 2618 O  O   . HOH O 7 .   ? 27.947 41.302 59.474 1.00 37.67  ? 425 HOH A O   1 
HETATM 2619 O  O   . HOH O 7 .   ? 24.870 10.167 54.634 1.00 38.31  ? 426 HOH A O   1 
HETATM 2620 O  O   . HOH O 7 .   ? 25.922 5.663  51.998 1.00 39.28  ? 427 HOH A O   1 
HETATM 2621 O  O   . HOH O 7 .   ? 45.529 7.219  32.605 1.00 39.43  ? 428 HOH A O   1 
HETATM 2622 O  O   . HOH O 7 .   ? 27.727 17.596 35.313 1.00 39.53  ? 429 HOH A O   1 
HETATM 2623 O  O   . HOH O 7 .   ? 27.293 27.317 44.246 1.00 39.70  ? 430 HOH A O   1 
HETATM 2624 O  O   . HOH O 7 .   ? 35.998 30.423 33.118 1.00 39.87  ? 431 HOH A O   1 
HETATM 2625 O  O   . HOH O 7 .   ? 45.958 30.577 30.266 1.00 40.02  ? 432 HOH A O   1 
HETATM 2626 O  O   . HOH O 7 .   ? 43.783 41.090 55.579 1.00 40.30  ? 433 HOH A O   1 
HETATM 2627 O  O   . HOH O 7 .   ? 21.393 25.460 54.043 1.00 40.38  ? 434 HOH A O   1 
HETATM 2628 O  O   . HOH O 7 .   ? 29.836 3.503  39.732 1.00 40.61  ? 435 HOH A O   1 
HETATM 2629 O  O   . HOH O 7 .   ? 51.194 14.732 30.448 1.00 40.63  ? 436 HOH A O   1 
HETATM 2630 O  O   . HOH O 7 .   ? 42.272 24.944 57.772 1.00 40.75  ? 437 HOH A O   1 
HETATM 2631 O  O   . HOH O 7 .   ? 39.079 30.053 65.810 1.00 40.98  ? 438 HOH A O   1 
HETATM 2632 O  O   . HOH O 7 .   ? 28.660 31.550 41.542 1.00 41.09  ? 439 HOH A O   1 
HETATM 2633 O  O   . HOH O 7 .   ? 43.655 13.141 51.105 1.00 41.86  ? 440 HOH A O   1 
HETATM 2634 O  O   . HOH O 7 .   ? 32.753 4.078  53.158 1.00 42.10  ? 441 HOH A O   1 
HETATM 2635 O  O   . HOH O 7 .   ? 48.869 14.442 33.804 1.00 42.70  ? 442 HOH A O   1 
HETATM 2636 O  O   . HOH O 7 .   ? 25.539 32.501 47.792 1.00 43.13  ? 443 HOH A O   1 
HETATM 2637 O  O   . HOH O 7 .   ? 32.104 16.032 62.722 1.00 43.22  ? 444 HOH A O   1 
HETATM 2638 O  O   . HOH O 7 .   ? 40.159 13.222 25.184 1.00 43.48  ? 445 HOH A O   1 
HETATM 2639 O  O   . HOH O 7 .   ? 24.386 13.118 61.421 1.00 44.59  ? 446 HOH A O   1 
HETATM 2640 O  O   . HOH O 7 .   ? 43.655 5.879  48.940 1.00 45.02  ? 447 HOH A O   1 
HETATM 2641 O  O   . HOH O 7 .   ? 25.502 5.069  60.966 1.00 45.33  ? 448 HOH A O   1 
HETATM 2642 O  O   . HOH O 7 .   ? 22.240 13.814 63.114 1.00 45.73  ? 449 HOH A O   1 
HETATM 2643 O  O   . HOH O 7 .   ? 38.418 21.279 65.597 1.00 45.76  ? 450 HOH A O   1 
HETATM 2644 O  O   . HOH O 7 .   ? 25.331 27.050 41.123 1.00 45.82  ? 451 HOH A O   1 
HETATM 2645 O  O   . HOH O 7 .   ? 20.925 23.279 47.995 1.00 45.83  ? 452 HOH A O   1 
HETATM 2646 O  O   . HOH O 7 .   ? 41.911 44.036 55.560 1.00 45.89  ? 453 HOH A O   1 
HETATM 2647 O  O   . HOH O 7 .   ? 22.314 7.558  45.168 1.00 45.91  ? 454 HOH A O   1 
HETATM 2648 O  O   . HOH O 7 .   ? 55.225 29.163 36.841 1.00 46.03  ? 455 HOH A O   1 
HETATM 2649 O  O   . HOH O 7 .   ? 47.090 11.756 46.278 1.00 46.05  ? 456 HOH A O   1 
HETATM 2650 O  O   . HOH O 7 .   ? 41.886 5.107  54.990 1.00 46.10  ? 457 HOH A O   1 
HETATM 2651 O  O   . HOH O 7 .   ? 36.512 22.494 64.217 1.00 46.37  ? 458 HOH A O   1 
HETATM 2652 O  O   . HOH O 7 .   ? 26.707 16.460 37.817 1.00 46.51  ? 459 HOH A O   1 
HETATM 2653 O  O   . HOH O 7 .   ? 38.971 44.473 55.041 1.00 46.54  ? 460 HOH A O   1 
HETATM 2654 O  O   . HOH O 7 .   ? 27.976 1.470  39.998 1.00 46.54  ? 461 HOH A O   1 
HETATM 2655 O  O   . HOH O 7 .   ? 27.968 45.301 64.520 1.00 47.41  ? 462 HOH A O   1 
HETATM 2656 O  O   . HOH O 7 .   ? 35.991 24.115 70.206 1.00 47.42  ? 463 HOH A O   1 
HETATM 2657 O  O   . HOH O 7 .   ? 24.761 7.036  43.938 1.00 47.96  ? 464 HOH A O   1 
HETATM 2658 O  O   . HOH O 7 .   ? 40.584 31.993 64.931 1.00 48.03  ? 465 HOH A O   1 
HETATM 2659 O  O   . HOH O 7 .   ? 21.467 25.385 62.948 1.00 48.06  ? 466 HOH A O   1 
HETATM 2660 O  O   . HOH O 7 .   ? 47.522 12.523 26.553 1.00 48.15  ? 467 HOH A O   1 
HETATM 2661 O  O   . HOH O 7 .   ? 24.504 21.751 45.174 1.00 48.29  ? 468 HOH A O   1 
HETATM 2662 O  O   . HOH O 7 .   ? 39.230 14.766 23.313 1.00 48.41  ? 469 HOH A O   1 
HETATM 2663 O  O   . HOH O 7 .   ? 44.516 24.861 56.302 1.00 48.49  ? 470 HOH A O   1 
HETATM 2664 O  O   . HOH O 7 .   ? 22.810 10.405 52.757 1.00 48.67  ? 471 HOH A O   1 
HETATM 2665 O  O   . HOH O 7 .   ? 36.021 31.204 39.683 1.00 48.72  ? 472 HOH A O   1 
HETATM 2666 O  O   . HOH O 7 .   ? 21.055 22.186 61.331 1.00 48.75  ? 473 HOH A O   1 
HETATM 2667 O  O   . HOH O 7 .   ? 47.745 11.749 32.921 1.00 49.07  ? 474 HOH A O   1 
HETATM 2668 O  O   . HOH O 7 .   ? 42.643 14.095 54.228 1.00 49.16  ? 475 HOH A O   1 
HETATM 2669 O  O   . HOH O 7 .   ? 54.631 19.422 19.735 1.00 49.23  ? 476 HOH A O   1 
HETATM 2670 O  O   . HOH O 7 .   ? 22.428 31.958 50.641 1.00 49.27  ? 477 HOH A O   1 
HETATM 2671 O  O   . HOH O 7 .   ? 53.277 39.768 54.925 1.00 49.80  ? 478 HOH A O   1 
HETATM 2672 O  O   . HOH O 7 .   ? 48.958 25.857 43.631 1.00 49.81  ? 479 HOH A O   1 
HETATM 2673 O  O   . HOH O 7 .   ? 25.128 21.367 37.268 1.00 50.01  ? 480 HOH A O   1 
HETATM 2674 O  O   . HOH O 7 .   ? 25.065 9.191  61.445 1.00 50.12  ? 481 HOH A O   1 
HETATM 2675 O  O   . HOH O 7 .   ? 44.795 5.384  46.014 1.00 50.35  ? 482 HOH A O   1 
HETATM 2676 O  O   . HOH O 7 .   ? 42.535 23.283 59.843 1.00 50.40  ? 483 HOH A O   1 
HETATM 2677 O  O   . HOH O 7 .   ? 30.499 45.426 56.518 1.00 50.44  ? 484 HOH A O   1 
HETATM 2678 O  O   . HOH O 7 .   ? 25.473 10.722 37.666 1.00 50.49  ? 485 HOH A O   1 
HETATM 2679 O  O   . HOH O 7 .   ? 43.095 2.249  54.586 1.00 50.70  ? 486 HOH A O   1 
HETATM 2680 O  O   . HOH O 7 .   ? 42.755 6.995  52.914 1.00 50.71  ? 487 HOH A O   1 
HETATM 2681 O  O   . HOH O 7 .   ? 21.734 15.332 47.767 1.00 50.92  ? 488 HOH A O   1 
HETATM 2682 O  O   . HOH O 7 .   ? 29.698 24.082 68.898 1.00 50.94  ? 489 HOH A O   1 
HETATM 2683 O  O   . HOH O 7 .   ? 52.574 14.690 27.360 1.00 51.14  ? 490 HOH A O   1 
HETATM 2684 O  O   . HOH O 7 .   ? 40.541 31.432 40.142 1.00 51.41  ? 491 HOH A O   1 
HETATM 2685 O  O   . HOH O 7 .   ? 21.446 32.320 56.288 1.00 51.44  ? 492 HOH A O   1 
HETATM 2686 O  O   . HOH O 7 .   ? 53.450 13.958 22.213 1.00 51.60  ? 493 HOH A O   1 
HETATM 2687 O  O   . HOH O 7 .   ? 49.846 34.824 34.560 1.00 51.78  ? 494 HOH A O   1 
HETATM 2688 O  O   . HOH O 7 .   ? 28.372 43.976 59.774 1.00 51.89  ? 495 HOH A O   1 
HETATM 2689 O  O   . HOH O 7 .   ? 42.566 46.326 56.797 1.00 52.15  ? 496 HOH A O   1 
HETATM 2690 O  O   . HOH O 7 .   ? 38.656 31.537 28.266 1.00 52.17  ? 497 HOH A O   1 
HETATM 2691 O  O   . HOH O 7 .   ? 23.834 2.763  59.464 1.00 52.19  ? 498 HOH A O   1 
HETATM 2692 O  O   . HOH O 7 .   ? 35.031 31.927 36.510 1.00 52.23  ? 499 HOH A O   1 
HETATM 2693 O  O   . HOH O 7 .   ? 48.750 13.895 30.958 1.00 52.30  ? 500 HOH A O   1 
HETATM 2694 O  O   . HOH O 7 .   ? 53.827 13.263 32.570 1.00 52.36  ? 501 HOH A O   1 
HETATM 2695 O  O   . HOH O 7 .   ? 51.820 25.645 18.064 1.00 52.69  ? 502 HOH A O   1 
HETATM 2696 O  O   . HOH O 7 .   ? 21.217 21.272 63.878 1.00 52.85  ? 503 HOH A O   1 
HETATM 2697 O  O   . HOH O 7 .   ? 35.480 42.532 56.205 1.00 52.89  ? 504 HOH A O   1 
HETATM 2698 O  O   . HOH O 7 .   ? 47.431 13.845 36.123 1.00 52.89  ? 505 HOH A O   1 
HETATM 2699 O  O   . HOH O 7 .   ? 54.133 28.658 24.679 1.00 52.90  ? 506 HOH A O   1 
HETATM 2700 O  O   . HOH O 7 .   ? 20.103 20.583 41.804 1.00 53.15  ? 507 HOH A O   1 
HETATM 2701 O  O   . HOH O 7 .   ? 47.157 14.762 19.890 1.00 53.57  ? 508 HOH A O   1 
HETATM 2702 O  O   . HOH O 7 .   ? 28.681 -0.988 40.408 1.00 53.59  ? 509 HOH A O   1 
HETATM 2703 O  O   . HOH O 7 .   ? 40.169 37.289 67.006 1.00 53.86  ? 510 HOH A O   1 
HETATM 2704 O  O   . HOH O 7 .   ? 55.536 25.046 37.990 1.00 53.97  ? 511 HOH A O   1 
HETATM 2705 O  O   . HOH O 7 .   ? 41.516 38.993 66.005 1.00 54.27  ? 512 HOH A O   1 
HETATM 2706 O  O   . HOH O 7 .   ? 36.061 -0.692 39.681 1.00 54.31  ? 513 HOH A O   1 
HETATM 2707 O  O   . HOH O 7 .   ? 26.552 8.607  35.094 1.00 54.74  ? 514 HOH A O   1 
HETATM 2708 O  O   . HOH O 7 .   ? 33.729 34.034 36.527 1.00 54.94  ? 515 HOH A O   1 
HETATM 2709 O  O   . HOH O 7 .   ? 31.530 25.547 69.905 1.00 55.07  ? 516 HOH A O   1 
HETATM 2710 O  O   . HOH O 7 .   ? 21.464 28.035 63.665 1.00 55.14  ? 517 HOH A O   1 
HETATM 2711 O  O   . HOH O 7 .   ? 49.601 13.790 38.166 1.00 55.18  ? 518 HOH A O   1 
HETATM 2712 O  O   . HOH O 7 .   ? 33.491 10.232 65.455 1.00 55.77  ? 519 HOH A O   1 
HETATM 2713 O  O   . HOH O 7 .   ? 34.188 14.078 62.455 1.00 55.81  ? 520 HOH A O   1 
HETATM 2714 O  O   . HOH O 7 .   ? 35.052 16.922 60.444 1.00 55.97  ? 521 HOH A O   1 
HETATM 2715 O  O   . HOH O 7 .   ? 24.908 36.096 43.075 1.00 56.22  ? 522 HOH A O   1 
HETATM 2716 O  O   . HOH O 7 .   ? 20.887 24.952 42.017 1.00 56.34  ? 523 HOH A O   1 
HETATM 2717 O  O   . HOH O 7 .   ? 48.739 10.002 34.534 1.00 56.56  ? 524 HOH A O   1 
HETATM 2718 O  O   . HOH O 7 .   ? 34.418 -1.471 42.846 1.00 56.61  ? 525 HOH A O   1 
HETATM 2719 O  O   . HOH O 7 .   ? 23.603 38.424 48.289 1.00 56.70  ? 526 HOH A O   1 
HETATM 2720 O  O   . HOH O 7 .   ? 29.914 47.719 58.119 1.00 56.86  ? 527 HOH A O   1 
HETATM 2721 O  O   . HOH O 7 .   ? 46.339 39.590 56.563 1.00 56.87  ? 528 HOH A O   1 
HETATM 2722 O  O   . HOH O 7 .   ? 31.882 11.844 66.941 1.00 57.02  ? 529 HOH A O   1 
HETATM 2723 O  O   . HOH O 7 .   ? 24.959 3.882  45.468 1.00 57.23  ? 530 HOH A O   1 
HETATM 2724 O  O   . HOH O 7 .   ? 48.897 29.703 48.293 1.00 57.54  ? 531 HOH A O   1 
HETATM 2725 O  O   . HOH O 7 .   ? 54.006 28.229 39.200 1.00 57.56  ? 532 HOH A O   1 
HETATM 2726 O  O   . HOH O 7 .   ? 35.500 23.451 24.264 1.00 57.56  ? 533 HOH A O   1 
HETATM 2727 O  O   . HOH O 7 .   ? 49.304 25.637 17.295 1.00 57.72  ? 534 HOH A O   1 
HETATM 2728 O  O   . HOH O 7 .   ? 24.059 28.942 38.083 1.00 57.80  ? 535 HOH A O   1 
HETATM 2729 O  O   . HOH O 7 .   ? 20.205 25.532 60.041 1.00 57.84  ? 536 HOH A O   1 
HETATM 2730 O  O   . HOH O 7 .   ? 20.165 22.645 43.270 1.00 58.19  ? 537 HOH A O   1 
HETATM 2731 O  O   . HOH O 7 .   ? 43.775 21.432 53.494 1.00 58.27  ? 538 HOH A O   1 
HETATM 2732 O  O   . HOH O 7 .   ? 50.997 42.998 48.063 1.00 58.38  ? 539 HOH A O   1 
HETATM 2733 O  O   . HOH O 7 .   ? 47.157 27.567 49.690 1.00 58.74  ? 540 HOH A O   1 
HETATM 2734 O  O   . HOH O 7 .   ? 37.772 22.162 69.121 1.00 58.99  ? 541 HOH A O   1 
HETATM 2735 O  O   . HOH O 7 .   ? 23.969 23.839 36.842 1.00 59.02  ? 542 HOH A O   1 
HETATM 2736 O  O   . HOH O 7 .   ? 43.730 38.607 59.265 1.00 59.41  ? 543 HOH A O   1 
HETATM 2737 O  O   . HOH O 7 .   ? 42.974 24.838 63.947 1.00 59.52  ? 544 HOH A O   1 
HETATM 2738 O  O   . HOH O 7 .   ? 43.532 49.526 52.302 1.00 59.81  ? 545 HOH A O   1 
HETATM 2739 O  O   . HOH O 7 .   ? 21.688 28.011 54.047 1.00 59.90  ? 546 HOH A O   1 
HETATM 2740 O  O   . HOH O 7 .   ? 45.965 0.394  36.032 1.00 60.05  ? 547 HOH A O   1 
HETATM 2741 O  O   . HOH O 7 .   ? 19.946 27.393 45.850 1.00 60.14  ? 548 HOH A O   1 
HETATM 2742 O  O   . HOH O 7 .   ? 50.372 43.627 51.396 1.00 60.17  ? 549 HOH A O   1 
HETATM 2743 O  O   . HOH O 7 .   ? 23.570 16.228 65.129 1.00 60.18  ? 550 HOH A O   1 
HETATM 2744 O  O   . HOH O 7 .   ? 21.399 18.412 42.869 1.00 60.44  ? 551 HOH A O   1 
HETATM 2745 O  O   . HOH O 7 .   ? 39.496 25.994 25.684 1.00 60.51  ? 552 HOH A O   1 
HETATM 2746 O  O   . HOH O 7 .   ? 40.257 29.486 32.081 1.00 60.55  ? 553 HOH A O   1 
HETATM 2747 O  O   . HOH O 7 .   ? 27.836 50.951 60.132 1.00 60.61  ? 554 HOH A O   1 
HETATM 2748 O  O   . HOH O 7 .   ? 44.230 21.787 56.093 1.00 60.86  ? 555 HOH A O   1 
HETATM 2749 O  O   . HOH O 7 .   ? 47.254 40.311 40.048 1.00 60.86  ? 556 HOH A O   1 
HETATM 2750 O  O   . HOH O 7 .   ? 25.466 7.173  54.260 1.00 60.97  ? 557 HOH A O   1 
HETATM 2751 O  O   . HOH O 7 .   ? 45.506 8.966  29.352 1.00 61.23  ? 558 HOH A O   1 
HETATM 2752 O  O   . HOH O 7 .   ? 30.569 21.520 68.581 1.00 61.25  ? 559 HOH A O   1 
HETATM 2753 O  O   . HOH O 7 .   ? 26.385 40.353 44.731 1.00 61.36  ? 560 HOH A O   1 
HETATM 2754 O  O   . HOH O 7 .   ? 23.905 26.513 38.667 1.00 61.47  ? 561 HOH A O   1 
HETATM 2755 O  O   . HOH O 7 .   ? 50.551 8.391  40.070 1.00 61.84  ? 562 HOH A O   1 
HETATM 2756 O  O   . HOH O 7 .   ? 39.104 35.081 70.088 1.00 62.09  ? 563 HOH A O   1 
HETATM 2757 O  O   . HOH O 7 .   ? 26.569 2.753  48.587 1.00 62.41  ? 564 HOH A O   1 
HETATM 2758 O  O   . HOH O 7 .   ? 53.891 24.016 17.585 1.00 62.50  ? 565 HOH A O   1 
HETATM 2759 O  O   . HOH O 7 .   ? 42.110 51.866 54.044 1.00 63.18  ? 566 HOH A O   1 
HETATM 2760 O  O   . HOH O 7 .   ? 24.429 39.681 43.660 1.00 63.96  ? 567 HOH A O   1 
HETATM 2761 O  O   . HOH O 7 .   ? 26.794 13.312 27.819 1.00 65.39  ? 568 HOH A O   1 
HETATM 2762 O  O   . HOH O 7 .   ? 26.495 20.182 35.771 1.00 65.42  ? 569 HOH A O   1 
HETATM 2763 O  O   . HOH O 7 .   ? 26.675 37.250 38.291 1.00 65.89  ? 570 HOH A O   1 
HETATM 2764 O  O   . HOH O 7 .   ? 27.418 19.561 31.755 1.00 66.51  ? 571 HOH A O   1 
HETATM 2765 O  O   . HOH O 7 .   ? 36.187 0.343  41.916 1.00 67.02  ? 572 HOH A O   1 
HETATM 2766 O  O   . HOH O 7 .   ? 24.239 4.457  42.495 1.00 68.70  ? 573 HOH A O   1 
HETATM 2767 O  O   . HOH O 7 .   ? 53.070 30.663 22.995 1.00 69.85  ? 574 HOH A O   1 
HETATM 2768 O  O   . HOH O 7 .   ? 44.286 49.703 46.476 1.00 70.45  ? 575 HOH A O   1 
HETATM 2769 O  O   . HOH O 7 .   ? 35.813 12.859 64.086 1.00 71.13  ? 576 HOH A O   1 
HETATM 2770 O  O   . HOH O 7 .   ? 40.225 6.609  27.120 1.00 71.99  ? 577 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   PHE 1   43  ?   ?   ?   A . n 
A 1 2   SER 2   44  ?   ?   ?   A . n 
A 1 3   ASN 3   45  45  ASN ASN A . n 
A 1 4   GLU 4   46  46  GLU GLU A . n 
A 1 5   CYS 5   47  47  CYS CYS A . n 
A 1 6   LEU 6   48  48  LEU LEU A . n 
A 1 7   GLY 7   49  49  GLY GLY A . n 
A 1 8   THR 8   50  50  THR THR A . n 
A 1 9   ILE 9   51  51  ILE ILE A . n 
A 1 10  GLY 10  52  52  GLY GLY A . n 
A 1 11  PRO 11  53  53  PRO PRO A . n 
A 1 12  VAL 12  54  54  VAL VAL A . n 
A 1 13  THR 13  55  55  THR THR A . n 
A 1 14  PRO 14  56  56  PRO PRO A . n 
A 1 15  LEU 15  57  57  LEU LEU A . n 
A 1 16  ASP 16  58  58  ASP ASP A . n 
A 1 17  ALA 17  59  59  ALA ALA A . n 
A 1 18  SER 18  60  60  SER SER A . n 
A 1 19  ASP 19  61  61  ASP ASP A . n 
A 1 20  PHE 20  62  62  PHE PHE A . n 
A 1 21  ALA 21  63  63  ALA ALA A . n 
A 1 22  LEU 22  64  64  LEU LEU A . n 
A 1 23  ASP 23  65  65  ASP ASP A . n 
A 1 24  ILE 24  66  66  ILE ILE A . n 
A 1 25  ARG 25  67  67  ARG ARG A . n 
A 1 26  MET 26  68  68  MET MET A . n 
A 1 27  PRO 27  69  69  PRO PRO A . n 
A 1 28  GLY 28  70  70  GLY GLY A . n 
A 1 29  VAL 29  71  71  VAL VAL A . n 
A 1 30  THR 30  72  72  THR THR A . n 
A 1 31  PRO 31  73  73  PRO PRO A . n 
A 1 32  LYS 32  74  74  LYS LYS A . n 
A 1 33  GLU 33  75  75  GLU GLU A . n 
A 1 34  SER 34  76  76  SER SER A . n 
A 1 35  ASP 35  77  77  ASP ASP A . n 
A 1 36  THR 36  78  78  THR THR A . n 
A 1 37  TYR 37  79  79  TYR TYR A . n 
A 1 38  PHE 38  80  80  PHE PHE A . n 
A 1 39  CYS 39  81  81  CYS CYS A . n 
A 1 40  MET 40  82  82  MET MET A . n 
A 1 41  SER 41  83  83  SER SER A . n 
A 1 42  MET 42  84  84  MET MET A . n 
A 1 43  ARG 43  85  85  ARG ARG A . n 
A 1 44  LEU 44  86  86  LEU LEU A . n 
A 1 45  PRO 45  87  87  PRO PRO A . n 
A 1 46  VAL 46  88  88  VAL VAL A . n 
A 1 47  ASP 47  89  89  ASP ASP A . n 
A 1 48  GLU 48  90  90  GLU GLU A . n 
A 1 49  GLU 49  91  91  GLU GLU A . n 
A 1 50  ALA 50  92  92  ALA ALA A . n 
A 1 51  PHE 51  93  93  PHE PHE A . n 
A 1 52  VAL 52  94  94  VAL VAL A . n 
A 1 53  ILE 53  95  95  ILE ILE A . n 
A 1 54  ASP 54  96  96  ASP ASP A . n 
A 1 55  PHE 55  97  97  PHE PHE A . n 
A 1 56  LYS 56  98  98  LYS LYS A . n 
A 1 57  PRO 57  99  99  PRO PRO A . n 
A 1 58  ARG 58  100 100 ARG ARG A . n 
A 1 59  ALA 59  101 101 ALA ALA A . n 
A 1 60  SER 60  102 102 SER SER A . n 
A 1 61  MET 61  103 103 MET MET A . n 
A 1 62  ASP 62  104 104 ASP ASP A . n 
A 1 63  THR 63  105 105 THR THR A . n 
A 1 64  VAL 64  106 106 VAL VAL A . n 
A 1 65  HIS 65  107 107 HIS HIS A . n 
A 1 66  HIS 66  108 108 HIS HIS A . n 
A 1 67  MET 67  109 109 MET MET A . n 
A 1 68  LEU 68  110 110 LEU LEU A . n 
A 1 69  LEU 69  111 111 LEU LEU A . n 
A 1 70  PHE 70  112 112 PHE PHE A . n 
A 1 71  GLY 71  113 113 GLY GLY A . n 
A 1 72  CYS 72  114 114 CYS CYS A . n 
A 1 73  ASN 73  115 115 ASN ASN A . n 
A 1 74  MET 74  116 116 MET MET A . n 
A 1 75  PRO 75  117 117 PRO PRO A . n 
A 1 76  SER 76  118 118 SER SER A . n 
A 1 77  SER 77  119 119 SER SER A . n 
A 1 78  THR 78  120 120 THR THR A . n 
A 1 79  GLY 79  121 121 GLY GLY A . n 
A 1 80  SER 80  122 122 SER SER A . n 
A 1 81  TYR 81  123 123 TYR TYR A . n 
A 1 82  TRP 82  124 124 TRP TRP A . n 
A 1 83  PHE 83  125 125 PHE PHE A . n 
A 1 84  CYS 84  126 126 CYS CYS A . n 
A 1 85  ASP 85  127 127 ASP ASP A . n 
A 1 86  GLU 86  128 128 GLU GLU A . n 
A 1 87  GLY 87  129 129 GLY GLY A . n 
A 1 88  THR 88  130 130 THR THR A . n 
A 1 89  CYS 89  131 131 CYS CYS A . n 
A 1 90  THR 90  132 132 THR THR A . n 
A 1 91  ASP 91  133 133 ASP ASP A . n 
A 1 92  LYS 92  134 134 LYS LYS A . n 
A 1 93  ALA 93  135 135 ALA ALA A . n 
A 1 94  ASN 94  136 136 ASN ASN A . n 
A 1 95  ILE 95  137 137 ILE ILE A . n 
A 1 96  LEU 96  138 138 LEU LEU A . n 
A 1 97  TYR 97  139 139 TYR TYR A . n 
A 1 98  ALA 98  140 140 ALA ALA A . n 
A 1 99  TRP 99  141 141 TRP TRP A . n 
A 1 100 ALA 100 142 142 ALA ALA A . n 
A 1 101 ARG 101 143 143 ARG ARG A . n 
A 1 102 ASN 102 144 144 ASN ASN A . n 
A 1 103 ALA 103 145 145 ALA ALA A . n 
A 1 104 PRO 104 146 146 PRO PRO A . n 
A 1 105 PRO 105 147 147 PRO PRO A . n 
A 1 106 THR 106 148 148 THR THR A . n 
A 1 107 ARG 107 149 149 ARG ARG A . n 
A 1 108 LEU 108 150 150 LEU LEU A . n 
A 1 109 PRO 109 151 151 PRO PRO A . n 
A 1 110 LYS 110 152 152 LYS LYS A . n 
A 1 111 GLY 111 153 153 GLY GLY A . n 
A 1 112 VAL 112 154 154 VAL VAL A . n 
A 1 113 GLY 113 155 155 GLY GLY A . n 
A 1 114 PHE 114 156 156 PHE PHE A . n 
A 1 115 ARG 115 157 157 ARG ARG A . n 
A 1 116 VAL 116 158 158 VAL VAL A . n 
A 1 117 GLY 117 159 159 GLY GLY A . n 
A 1 118 GLY 118 160 160 GLY GLY A . n 
A 1 119 GLU 119 161 161 GLU GLU A . n 
A 1 120 THR 120 162 162 THR THR A . n 
A 1 121 GLY 121 163 163 GLY GLY A . n 
A 1 122 SER 122 164 164 SER SER A . n 
A 1 123 LYS 123 165 165 LYS LYS A . n 
A 1 124 TYR 124 166 166 TYR TYR A . n 
A 1 125 PHE 125 167 167 PHE PHE A . n 
A 1 126 VAL 126 168 168 VAL VAL A . n 
A 1 127 LEU 127 169 169 LEU LEU A . n 
A 1 128 GLN 128 170 170 GLN GLN A . n 
A 1 129 VAL 129 171 171 VAL VAL A . n 
A 1 130 HIS 130 172 172 HIS HIS A . n 
A 1 131 TYR 131 173 173 TYR TYR A . n 
A 1 132 GLY 132 174 174 GLY GLY A . n 
A 1 133 ASP 133 175 175 ASP ASP A . n 
A 1 134 ILE 134 176 176 ILE ILE A . n 
A 1 135 SER 135 177 177 SER SER A . n 
A 1 136 ALA 136 178 178 ALA ALA A . n 
A 1 137 PHE 137 179 179 PHE PHE A . n 
A 1 138 ARG 138 180 180 ARG ARG A . n 
A 1 139 ASP 139 181 181 ASP ASP A . n 
A 1 140 ASN 140 182 182 ASN ASN A . n 
A 1 141 HIS 141 183 183 HIS HIS A . n 
A 1 142 LYS 142 184 184 LYS LYS A . n 
A 1 143 ASP 143 185 185 ASP ASP A . n 
A 1 144 CYS 144 186 186 CYS CYS A . n 
A 1 145 SER 145 187 187 SER SER A . n 
A 1 146 GLY 146 188 188 GLY GLY A . n 
A 1 147 VAL 147 189 189 VAL VAL A . n 
A 1 148 SER 148 190 190 SER SER A . n 
A 1 149 VAL 149 191 191 VAL VAL A . n 
A 1 150 HIS 150 192 192 HIS HIS A . n 
A 1 151 LEU 151 193 193 LEU LEU A . n 
A 1 152 THR 152 194 194 THR THR A . n 
A 1 153 ARG 153 195 195 ARG ARG A . n 
A 1 154 VAL 154 196 196 VAL VAL A . n 
A 1 155 PRO 155 197 197 PRO PRO A . n 
A 1 156 GLN 156 198 198 GLN GLN A . n 
A 1 157 PRO 157 199 199 PRO PRO A . n 
A 1 158 LEU 158 200 200 LEU LEU A . n 
A 1 159 ILE 159 201 201 ILE ILE A . n 
A 1 160 ALA 160 202 202 ALA ALA A . n 
A 1 161 GLY 161 203 203 GLY GLY A . n 
A 1 162 MET 162 204 204 MET MET A . n 
A 1 163 TYR 163 205 205 TYR TYR A . n 
A 1 164 LEU 164 206 206 LEU LEU A . n 
A 1 165 MET 165 207 207 MET MET A . n 
A 1 166 MET 166 208 208 MET MET A . n 
A 1 167 SER 167 209 209 SER SER A . n 
A 1 168 VAL 168 210 210 VAL VAL A . n 
A 1 169 ASP 169 211 211 ASP ASP A . n 
A 1 170 THR 170 212 212 THR THR A . n 
A 1 171 VAL 171 213 213 VAL VAL A . n 
A 1 172 ILE 172 214 214 ILE ILE A . n 
A 1 173 PRO 173 215 215 PRO PRO A . n 
A 1 174 PRO 174 216 216 PRO PRO A . n 
A 1 175 GLY 175 217 217 GLY GLY A . n 
A 1 176 GLU 176 218 218 GLU GLU A . n 
A 1 177 LYS 177 219 219 LYS LYS A . n 
A 1 178 VAL 178 220 220 VAL VAL A . n 
A 1 179 VAL 179 221 221 VAL VAL A . n 
A 1 180 ASN 180 222 222 ASN ASN A . n 
A 1 181 ALA 181 223 223 ALA ALA A . n 
A 1 182 ASP 182 224 224 ASP ASP A . n 
A 1 183 ILE 183 225 225 ILE ILE A . n 
A 1 184 SER 184 226 226 SER SER A . n 
A 1 185 CYS 185 227 227 CYS CYS A . n 
A 1 186 GLN 186 228 228 GLN GLN A . n 
A 1 187 TYR 187 229 229 TYR TYR A . n 
A 1 188 LYS 188 230 230 LYS LYS A . n 
A 1 189 MET 189 231 231 MET MET A . n 
A 1 190 TYR 190 232 232 TYR TYR A . n 
A 1 191 PRO 191 233 233 PRO PRO A . n 
A 1 192 MET 192 234 234 MET MET A . n 
A 1 193 HIS 193 235 235 HIS HIS A . n 
A 1 194 VAL 194 236 236 VAL VAL A . n 
A 1 195 PHE 195 237 237 PHE PHE A . n 
A 1 196 ALA 196 238 238 ALA ALA A . n 
A 1 197 TYR 197 239 239 TYR TYR A . n 
A 1 198 ARG 198 240 240 ARG ARG A . n 
A 1 199 VAL 199 241 241 VAL VAL A . n 
A 1 200 HIS 200 242 242 HIS HIS A . n 
A 1 201 THR 201 243 243 THR THR A . n 
A 1 202 HIS 202 244 244 HIS HIS A . n 
A 1 203 HIS 203 245 245 HIS HIS A . n 
A 1 204 LEU 204 246 246 LEU LEU A . n 
A 1 205 GLY 205 247 247 GLY GLY A . n 
A 1 206 LYS 206 248 248 LYS LYS A . n 
A 1 207 VAL 207 249 249 VAL VAL A . n 
A 1 208 VAL 208 250 250 VAL VAL A . n 
A 1 209 SER 209 251 251 SER SER A . n 
A 1 210 GLY 210 252 252 GLY GLY A . n 
A 1 211 TYR 211 253 253 TYR TYR A . n 
A 1 212 ARG 212 254 254 ARG ARG A . n 
A 1 213 VAL 213 255 255 VAL VAL A . n 
A 1 214 ARG 214 256 256 ARG ARG A . n 
A 1 215 ASN 215 257 257 ASN ASN A . n 
A 1 216 GLY 216 258 258 GLY GLY A . n 
A 1 217 GLN 217 259 259 GLN GLN A . n 
A 1 218 TRP 218 260 260 TRP TRP A . n 
A 1 219 THR 219 261 261 THR THR A . n 
A 1 220 LEU 220 262 262 LEU LEU A . n 
A 1 221 ILE 221 263 263 ILE ILE A . n 
A 1 222 GLY 222 264 264 GLY GLY A . n 
A 1 223 ARG 223 265 265 ARG ARG A . n 
A 1 224 GLN 224 266 266 GLN GLN A . n 
A 1 225 ASN 225 267 267 ASN ASN A . n 
A 1 226 PRO 226 268 268 PRO PRO A . n 
A 1 227 GLN 227 269 269 GLN GLN A . n 
A 1 228 LEU 228 270 270 LEU LEU A . n 
A 1 229 PRO 229 271 271 PRO PRO A . n 
A 1 230 GLN 230 272 272 GLN GLN A . n 
A 1 231 ALA 231 273 273 ALA ALA A . n 
A 1 232 PHE 232 274 274 PHE PHE A . n 
A 1 233 TYR 233 275 275 TYR TYR A . n 
A 1 234 PRO 234 276 276 PRO PRO A . n 
A 1 235 VAL 235 277 277 VAL VAL A . n 
A 1 236 GLU 236 278 278 GLU GLU A . n 
A 1 237 HIS 237 279 279 HIS HIS A . n 
A 1 238 PRO 238 280 280 PRO PRO A . n 
A 1 239 VAL 239 281 281 VAL VAL A . n 
A 1 240 ASP 240 282 282 ASP ASP A . n 
A 1 241 VAL 241 283 283 VAL VAL A . n 
A 1 242 THR 242 284 284 THR THR A . n 
A 1 243 PHE 243 285 285 PHE PHE A . n 
A 1 244 GLY 244 286 286 GLY GLY A . n 
A 1 245 ASP 245 287 287 ASP ASP A . n 
A 1 246 ILE 246 288 288 ILE ILE A . n 
A 1 247 LEU 247 289 289 LEU LEU A . n 
A 1 248 ALA 248 290 290 ALA ALA A . n 
A 1 249 ALA 249 291 291 ALA ALA A . n 
A 1 250 ARG 250 292 292 ARG ARG A . n 
A 1 251 CYS 251 293 293 CYS CYS A . n 
A 1 252 VAL 252 294 294 VAL VAL A . n 
A 1 253 PHE 253 295 295 PHE PHE A . n 
A 1 254 THR 254 296 296 THR THR A . n 
A 1 255 GLY 255 297 297 GLY GLY A . n 
A 1 256 GLU 256 298 298 GLU GLU A . n 
A 1 257 GLY 257 299 299 GLY GLY A . n 
A 1 258 ARG 258 300 300 ARG ARG A . n 
A 1 259 THR 259 301 301 THR THR A . n 
A 1 260 GLU 260 302 302 GLU GLU A . n 
A 1 261 ALA 261 303 303 ALA ALA A . n 
A 1 262 THR 262 304 304 THR THR A . n 
A 1 263 HIS 263 305 305 HIS HIS A . n 
A 1 264 ILE 264 306 306 ILE ILE A . n 
A 1 265 GLY 265 307 307 GLY GLY A . n 
A 1 266 GLY 266 308 308 GLY GLY A . n 
A 1 267 THR 267 309 309 THR THR A . n 
A 1 268 SER 268 310 310 SER SER A . n 
A 1 269 SER 269 311 311 SER SER A . n 
A 1 270 ASP 270 312 312 ASP ASP A . n 
A 1 271 GLU 271 313 313 GLU GLU A . n 
A 1 272 MET 272 314 314 MET MET A . n 
A 1 273 CYS 273 315 315 CYS CYS A . n 
A 1 274 ASN 274 316 316 ASN ASN A . n 
A 1 275 LEU 275 317 317 LEU LEU A . n 
A 1 276 TYR 276 318 318 TYR TYR A . n 
A 1 277 ILE 277 319 319 ILE ILE A . n 
A 1 278 MET 278 320 320 MET MET A . n 
A 1 279 TYR 279 321 321 TYR TYR A . n 
A 1 280 TYR 280 322 322 TYR TYR A . n 
A 1 281 MET 281 323 323 MET MET A . n 
A 1 282 GLU 282 324 324 GLU GLU A . n 
A 1 283 ALA 283 325 325 ALA ALA A . n 
A 1 284 LYS 284 326 326 LYS LYS A . n 
A 1 285 TYR 285 327 327 TYR TYR A . n 
A 1 286 ALA 286 328 328 ALA ALA A . n 
A 1 287 LEU 287 329 329 LEU LEU A . n 
A 1 288 SER 288 330 330 SER SER A . n 
A 1 289 PHE 289 331 331 PHE PHE A . n 
A 1 290 MET 290 332 332 MET MET A . n 
A 1 291 THR 291 333 333 THR THR A . n 
A 1 292 CYS 292 334 334 CYS CYS A . n 
A 1 293 THR 293 335 335 THR THR A . n 
A 1 294 LYS 294 336 336 LYS LYS A . n 
A 1 295 ASN 295 337 337 ASN ASN A . n 
A 1 296 VAL 296 338 338 VAL VAL A . n 
A 1 297 ALA 297 339 339 ALA ALA A . n 
A 1 298 PRO 298 340 340 PRO PRO A . n 
A 1 299 ASP 299 341 341 ASP ASP A . n 
A 1 300 MET 300 342 342 MET MET A . n 
A 1 301 PHE 301 343 343 PHE PHE A . n 
A 1 302 ARG 302 344 344 ARG ARG A . n 
A 1 303 THR 303 345 345 THR THR A . n 
A 1 304 ILE 304 346 346 ILE ILE A . n 
A 1 305 PRO 305 347 347 PRO PRO A . n 
A 1 306 ALA 306 348 348 ALA ALA A . n 
A 1 307 GLU 307 349 349 GLU GLU A . n 
A 1 308 ALA 308 350 350 ALA ALA A . n 
A 1 309 ASN 309 351 351 ASN ASN A . n 
A 1 310 ILE 310 352 352 ILE ILE A . n 
A 1 311 PRO 311 353 353 PRO PRO A . n 
A 1 312 ILE 312 354 354 ILE ILE A . n 
A 1 313 PRO 313 355 355 PRO PRO A . n 
A 1 314 VAL 314 356 356 VAL VAL A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  ND1 ? A HIS 66  ? A HIS 108 ? 1_555 CU ? B CU . ? A CU 357 ? 1_555 ND1 ? A HIS 65  ? A HIS 107 ? 1_555 145.8 ? 
2  ND1 ? A HIS 66  ? A HIS 108 ? 1_555 CU ? B CU . ? A CU 357 ? 1_555 ND1 ? A HIS 130 ? A HIS 172 ? 1_555 104.4 ? 
3  ND1 ? A HIS 65  ? A HIS 107 ? 1_555 CU ? B CU . ? A CU 357 ? 1_555 ND1 ? A HIS 130 ? A HIS 172 ? 1_555 108.7 ? 
4  NE2 ? A HIS 200 ? A HIS 242 ? 1_555 CU ? C CU . ? A CU 358 ? 1_555 NE2 ? A HIS 202 ? A HIS 244 ? 1_555 108.3 ? 
5  NE2 ? A HIS 200 ? A HIS 242 ? 1_555 CU ? C CU . ? A CU 358 ? 1_555 SD  ? A MET 272 ? A MET 314 ? 1_555 109.4 ? 
6  NE2 ? A HIS 202 ? A HIS 244 ? 1_555 CU ? C CU . ? A CU 358 ? 1_555 SD  ? A MET 272 ? A MET 314 ? 1_555 113.2 ? 
7  NE2 ? A HIS 200 ? A HIS 242 ? 1_555 CU ? C CU . ? A CU 358 ? 1_555 O1  ? E OXY .   ? A OXY 360 ? 1_555 108.3 ? 
8  NE2 ? A HIS 202 ? A HIS 244 ? 1_555 CU ? C CU . ? A CU 358 ? 1_555 O1  ? E OXY .   ? A OXY 360 ? 1_555 103.0 ? 
9  SD  ? A MET 272 ? A MET 314 ? 1_555 CU ? C CU . ? A CU 358 ? 1_555 O1  ? E OXY .   ? A OXY 360 ? 1_555 114.3 ? 
10 O1  ? I GOL .   ? A GOL 363 ? 1_555 NI ? D NI . ? A NI 359 ? 1_555 O2  ? I GOL .   ? A GOL 363 ? 1_555 84.6  ? 
11 O1  ? I GOL .   ? A GOL 363 ? 1_555 NI ? D NI . ? A NI 359 ? 1_555 O   ? O HOH .   ? A HOH 361 ? 1_555 83.8  ? 
12 O2  ? I GOL .   ? A GOL 363 ? 1_555 NI ? D NI . ? A NI 359 ? 1_555 O   ? O HOH .   ? A HOH 361 ? 1_555 93.1  ? 
13 O1  ? I GOL .   ? A GOL 363 ? 1_555 NI ? D NI . ? A NI 359 ? 1_555 O   ? O HOH .   ? A HOH 362 ? 1_555 91.8  ? 
14 O2  ? I GOL .   ? A GOL 363 ? 1_555 NI ? D NI . ? A NI 359 ? 1_555 O   ? O HOH .   ? A HOH 362 ? 1_555 87.6  ? 
15 O   ? O HOH .   ? A HOH 361 ? 1_555 NI ? D NI . ? A NI 359 ? 1_555 O   ? O HOH .   ? A HOH 362 ? 1_555 175.5 ? 
16 O1  ? I GOL .   ? A GOL 363 ? 1_555 NI ? D NI . ? A NI 359 ? 1_555 NE2 ? A HIS 193 ? A HIS 235 ? 1_555 173.6 ? 
17 O2  ? I GOL .   ? A GOL 363 ? 1_555 NI ? D NI . ? A NI 359 ? 1_555 NE2 ? A HIS 193 ? A HIS 235 ? 1_555 92.3  ? 
18 O   ? O HOH .   ? A HOH 361 ? 1_555 NI ? D NI . ? A NI 359 ? 1_555 NE2 ? A HIS 193 ? A HIS 235 ? 1_555 90.7  ? 
19 O   ? O HOH .   ? A HOH 362 ? 1_555 NI ? D NI . ? A NI 359 ? 1_555 NE2 ? A HIS 193 ? A HIS 235 ? 1_555 93.7  ? 
20 O1  ? I GOL .   ? A GOL 363 ? 1_555 NI ? D NI . ? A NI 359 ? 1_555 NE2 ? A HIS 263 ? A HIS 305 ? 4_456 87.4  ? 
21 O2  ? I GOL .   ? A GOL 363 ? 1_555 NI ? D NI . ? A NI 359 ? 1_555 NE2 ? A HIS 263 ? A HIS 305 ? 4_456 172.0 ? 
22 O   ? O HOH .   ? A HOH 361 ? 1_555 NI ? D NI . ? A NI 359 ? 1_555 NE2 ? A HIS 263 ? A HIS 305 ? 4_456 86.7  ? 
23 O   ? O HOH .   ? A HOH 362 ? 1_555 NI ? D NI . ? A NI 359 ? 1_555 NE2 ? A HIS 263 ? A HIS 305 ? 4_456 92.0  ? 
24 NE2 ? A HIS 193 ? A HIS 235 ? 1_555 NI ? D NI . ? A NI 359 ? 1_555 NE2 ? A HIS 263 ? A HIS 305 ? 4_456 95.6  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-05-11 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Non-polymer description'   
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' . ? 1 
SCALEPACK 'data scaling'   . ? 2 
CNS       refinement       . ? 3 
CNS       phasing          . ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 58  ? ? -177.74 -176.22 
2 1 PRO A 69  ? ? -80.22  49.03   
3 1 THR A 105 ? ? -159.54 -31.99  
4 1 THR A 130 ? ? -102.55 -63.98  
5 1 ASN A 144 ? ? 81.72   14.49   
6 1 ALA A 145 ? ? -156.35 85.97   
7 1 ILE A 176 ? ? -77.40  24.66   
8 1 HIS A 244 ? ? -99.19  -155.31 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A PHE 43 ? A PHE 1 
2 1 Y 1 A SER 44 ? A SER 2 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'COPPER (II) ION'                            CU  
3 'NICKEL (II) ION'                            NI  
4 'OXYGEN MOLECULE'                            OXY 
5 N-ALPHA-ACETYL-3,5-DIIODOTYROSYL-D-THREONINE IYT 
6 GLYCEROL                                     GOL 
7 water                                        HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 CU  1   357 357 CU  CU  A . 
C 2 CU  1   358 358 CU  CU  A . 
D 3 NI  1   359 359 NI  NI  A . 
E 4 OXY 1   360 360 OXY O2  A . 
F 5 IYT 1   701 701 IYT IYT A . 
G 5 IYT 1   702 702 IYT IYT A . 
H 5 IYT 1   703 703 IYT IYT A . 
I 6 GOL 1   363 363 GOL GOL A . 
J 6 GOL 1   364 364 GOL GOL A . 
K 6 GOL 1   365 365 GOL GOL A . 
L 6 GOL 1   366 366 GOL GOL A . 
M 6 GOL 1   367 367 GOL GOL A . 
N 6 GOL 1   368 368 GOL GOL A . 
O 7 HOH 1   361 361 HOH HOH A . 
O 7 HOH 2   362 362 HOH HOH A . 
O 7 HOH 3   400 400 HOH HOH A . 
O 7 HOH 4   401 401 HOH HOH A . 
O 7 HOH 5   402 402 HOH HOH A . 
O 7 HOH 6   403 403 HOH HOH A . 
O 7 HOH 7   404 404 HOH HOH A . 
O 7 HOH 8   405 405 HOH HOH A . 
O 7 HOH 9   406 406 HOH HOH A . 
O 7 HOH 10  407 407 HOH HOH A . 
O 7 HOH 11  408 408 HOH HOH A . 
O 7 HOH 12  409 409 HOH HOH A . 
O 7 HOH 13  410 410 HOH HOH A . 
O 7 HOH 14  411 411 HOH HOH A . 
O 7 HOH 15  412 412 HOH HOH A . 
O 7 HOH 16  413 413 HOH HOH A . 
O 7 HOH 17  414 414 HOH HOH A . 
O 7 HOH 18  415 415 HOH HOH A . 
O 7 HOH 19  416 416 HOH HOH A . 
O 7 HOH 20  417 417 HOH HOH A . 
O 7 HOH 21  418 418 HOH HOH A . 
O 7 HOH 22  419 419 HOH HOH A . 
O 7 HOH 23  420 420 HOH HOH A . 
O 7 HOH 24  421 421 HOH HOH A . 
O 7 HOH 25  422 422 HOH HOH A . 
O 7 HOH 26  423 423 HOH HOH A . 
O 7 HOH 27  424 424 HOH HOH A . 
O 7 HOH 28  425 425 HOH HOH A . 
O 7 HOH 29  426 426 HOH HOH A . 
O 7 HOH 30  427 427 HOH HOH A . 
O 7 HOH 31  428 428 HOH HOH A . 
O 7 HOH 32  429 429 HOH HOH A . 
O 7 HOH 33  430 430 HOH HOH A . 
O 7 HOH 34  431 431 HOH HOH A . 
O 7 HOH 35  432 432 HOH HOH A . 
O 7 HOH 36  433 433 HOH HOH A . 
O 7 HOH 37  434 434 HOH HOH A . 
O 7 HOH 38  435 435 HOH HOH A . 
O 7 HOH 39  436 436 HOH HOH A . 
O 7 HOH 40  437 437 HOH HOH A . 
O 7 HOH 41  438 438 HOH HOH A . 
O 7 HOH 42  439 439 HOH HOH A . 
O 7 HOH 43  440 440 HOH HOH A . 
O 7 HOH 44  441 441 HOH HOH A . 
O 7 HOH 45  442 442 HOH HOH A . 
O 7 HOH 46  443 443 HOH HOH A . 
O 7 HOH 47  444 444 HOH HOH A . 
O 7 HOH 48  445 445 HOH HOH A . 
O 7 HOH 49  446 446 HOH HOH A . 
O 7 HOH 50  447 447 HOH HOH A . 
O 7 HOH 51  448 448 HOH HOH A . 
O 7 HOH 52  449 449 HOH HOH A . 
O 7 HOH 53  450 450 HOH HOH A . 
O 7 HOH 54  451 451 HOH HOH A . 
O 7 HOH 55  452 452 HOH HOH A . 
O 7 HOH 56  453 453 HOH HOH A . 
O 7 HOH 57  454 454 HOH HOH A . 
O 7 HOH 58  455 455 HOH HOH A . 
O 7 HOH 59  456 456 HOH HOH A . 
O 7 HOH 60  457 457 HOH HOH A . 
O 7 HOH 61  458 458 HOH HOH A . 
O 7 HOH 62  459 459 HOH HOH A . 
O 7 HOH 63  460 460 HOH HOH A . 
O 7 HOH 64  461 461 HOH HOH A . 
O 7 HOH 65  462 462 HOH HOH A . 
O 7 HOH 66  463 463 HOH HOH A . 
O 7 HOH 67  464 464 HOH HOH A . 
O 7 HOH 68  465 465 HOH HOH A . 
O 7 HOH 69  466 466 HOH HOH A . 
O 7 HOH 70  467 467 HOH HOH A . 
O 7 HOH 71  468 468 HOH HOH A . 
O 7 HOH 72  469 469 HOH HOH A . 
O 7 HOH 73  470 470 HOH HOH A . 
O 7 HOH 74  471 471 HOH HOH A . 
O 7 HOH 75  472 472 HOH HOH A . 
O 7 HOH 76  473 473 HOH HOH A . 
O 7 HOH 77  474 474 HOH HOH A . 
O 7 HOH 78  475 475 HOH HOH A . 
O 7 HOH 79  476 476 HOH HOH A . 
O 7 HOH 80  477 477 HOH HOH A . 
O 7 HOH 81  478 478 HOH HOH A . 
O 7 HOH 82  479 479 HOH HOH A . 
O 7 HOH 83  480 480 HOH HOH A . 
O 7 HOH 84  481 481 HOH HOH A . 
O 7 HOH 85  482 482 HOH HOH A . 
O 7 HOH 86  483 483 HOH HOH A . 
O 7 HOH 87  484 484 HOH HOH A . 
O 7 HOH 88  485 485 HOH HOH A . 
O 7 HOH 89  486 486 HOH HOH A . 
O 7 HOH 90  487 487 HOH HOH A . 
O 7 HOH 91  488 488 HOH HOH A . 
O 7 HOH 92  489 489 HOH HOH A . 
O 7 HOH 93  490 490 HOH HOH A . 
O 7 HOH 94  491 491 HOH HOH A . 
O 7 HOH 95  492 492 HOH HOH A . 
O 7 HOH 96  493 493 HOH HOH A . 
O 7 HOH 97  494 494 HOH HOH A . 
O 7 HOH 98  495 495 HOH HOH A . 
O 7 HOH 99  496 496 HOH HOH A . 
O 7 HOH 100 497 497 HOH HOH A . 
O 7 HOH 101 498 498 HOH HOH A . 
O 7 HOH 102 499 499 HOH HOH A . 
O 7 HOH 103 500 500 HOH HOH A . 
O 7 HOH 104 501 501 HOH HOH A . 
O 7 HOH 105 502 502 HOH HOH A . 
O 7 HOH 106 503 503 HOH HOH A . 
O 7 HOH 107 504 504 HOH HOH A . 
O 7 HOH 108 505 505 HOH HOH A . 
O 7 HOH 109 506 506 HOH HOH A . 
O 7 HOH 110 507 507 HOH HOH A . 
O 7 HOH 111 508 508 HOH HOH A . 
O 7 HOH 112 509 509 HOH HOH A . 
O 7 HOH 113 510 510 HOH HOH A . 
O 7 HOH 114 511 511 HOH HOH A . 
O 7 HOH 115 512 512 HOH HOH A . 
O 7 HOH 116 513 513 HOH HOH A . 
O 7 HOH 117 514 514 HOH HOH A . 
O 7 HOH 118 515 515 HOH HOH A . 
O 7 HOH 119 516 516 HOH HOH A . 
O 7 HOH 120 517 517 HOH HOH A . 
O 7 HOH 121 518 518 HOH HOH A . 
O 7 HOH 122 519 519 HOH HOH A . 
O 7 HOH 123 520 520 HOH HOH A . 
O 7 HOH 124 521 521 HOH HOH A . 
O 7 HOH 125 522 522 HOH HOH A . 
O 7 HOH 126 523 523 HOH HOH A . 
O 7 HOH 127 524 524 HOH HOH A . 
O 7 HOH 128 525 525 HOH HOH A . 
O 7 HOH 129 526 526 HOH HOH A . 
O 7 HOH 130 527 527 HOH HOH A . 
O 7 HOH 131 528 528 HOH HOH A . 
O 7 HOH 132 529 529 HOH HOH A . 
O 7 HOH 133 530 530 HOH HOH A . 
O 7 HOH 134 531 531 HOH HOH A . 
O 7 HOH 135 532 532 HOH HOH A . 
O 7 HOH 136 533 533 HOH HOH A . 
O 7 HOH 137 534 534 HOH HOH A . 
O 7 HOH 138 535 535 HOH HOH A . 
O 7 HOH 139 536 536 HOH HOH A . 
O 7 HOH 140 537 537 HOH HOH A . 
O 7 HOH 141 538 538 HOH HOH A . 
O 7 HOH 142 539 539 HOH HOH A . 
O 7 HOH 143 540 540 HOH HOH A . 
O 7 HOH 144 541 541 HOH HOH A . 
O 7 HOH 145 542 542 HOH HOH A . 
O 7 HOH 146 543 543 HOH HOH A . 
O 7 HOH 147 544 544 HOH HOH A . 
O 7 HOH 148 545 545 HOH HOH A . 
O 7 HOH 149 546 546 HOH HOH A . 
O 7 HOH 150 547 547 HOH HOH A . 
O 7 HOH 151 548 548 HOH HOH A . 
O 7 HOH 152 549 549 HOH HOH A . 
O 7 HOH 153 550 550 HOH HOH A . 
O 7 HOH 154 551 551 HOH HOH A . 
O 7 HOH 155 552 552 HOH HOH A . 
O 7 HOH 156 553 553 HOH HOH A . 
O 7 HOH 157 554 554 HOH HOH A . 
O 7 HOH 158 555 555 HOH HOH A . 
O 7 HOH 159 556 556 HOH HOH A . 
O 7 HOH 160 557 557 HOH HOH A . 
O 7 HOH 161 558 558 HOH HOH A . 
O 7 HOH 162 559 559 HOH HOH A . 
O 7 HOH 163 560 560 HOH HOH A . 
O 7 HOH 164 561 561 HOH HOH A . 
O 7 HOH 165 562 562 HOH HOH A . 
O 7 HOH 166 563 563 HOH HOH A . 
O 7 HOH 167 564 564 HOH HOH A . 
O 7 HOH 168 565 565 HOH HOH A . 
O 7 HOH 169 566 566 HOH HOH A . 
O 7 HOH 170 567 567 HOH HOH A . 
O 7 HOH 171 568 568 HOH HOH A . 
O 7 HOH 172 569 569 HOH HOH A . 
O 7 HOH 173 570 570 HOH HOH A . 
O 7 HOH 174 571 571 HOH HOH A . 
O 7 HOH 175 572 572 HOH HOH A . 
O 7 HOH 176 573 573 HOH HOH A . 
O 7 HOH 177 574 574 HOH HOH A . 
O 7 HOH 178 575 575 HOH HOH A . 
O 7 HOH 179 576 576 HOH HOH A . 
O 7 HOH 180 577 577 HOH HOH A . 
#