data_1SFU
# 
_entry.id   1SFU 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1SFU         
NDB   PD0520       
RCSB  RCSB021674   
WWPDB D_1000021674 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1SFU 
_pdbx_database_status.recvd_initial_deposition_date   2004-02-20 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ha, S.C.'       1 
'Van Quyen, D.'  2 
'Wu, C.A.'       3 
'Lowenhaupt, K.' 4 
'Rich, A.'       5 
'Kim, Y.G.'      6 
'Kim, K.K.'      7 
# 
_citation.id                        primary 
_citation.title                     
'A poxvirus protein forms a complex with left-handed Z-DNA: crystal structure of a Yatapoxvirus Zalpha bound to DNA.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            101 
_citation.page_first                14367 
_citation.page_last                 14372 
_citation.year                      2004 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15448208 
_citation.pdbx_database_id_DOI      10.1073/pnas.0405586101 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Ha, S.C.'       1 
primary 'Lokanath, N.K.' 2 
primary 'Van Quyen, D.'  3 
primary 'Wu, C.A.'       4 
primary 'Lowenhaupt, K.' 5 
primary 'Rich, A.'       6 
primary 'Kim, Y.G.'      7 
primary 'Kim, K.K.'      8 
# 
_cell.entry_id           1SFU 
_cell.length_a           51.203 
_cell.length_b           92.452 
_cell.length_c           48.012 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1SFU 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn "5'-D(*T*CP*GP*CP*GP*CP*G)-3'" 2114.398 2   ? ? ?                          ? 
2 polymer man '34L protein'                  8722.137 2   ? ? 'N-terminal Zalpha domain' ? 
3 water   nat water                          18.015   170 ? ? ?                          ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DT)(DC)(DG)(DC)(DG)(DC)(DG)'                                              TCGCGCG C,D ? 
2 'polypeptide(L)'        no no MDLLSCTVNDAEIFSLVKKEVLSLNTNDYTTAISLSNRLKINKKKINQQLYKLQKEDTVKMVPSNPPKWFKNYNC 
MDLLSCTVNDAEIFSLVKKEVLSLNTNDYTTAISLSNRLKINKKKINQQLYKLQKEDTVKMVPSNPPKWFKNYNC A,B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  DT  n 
1 2  DC  n 
1 3  DG  n 
1 4  DC  n 
1 5  DG  n 
1 6  DC  n 
1 7  DG  n 
2 1  MET n 
2 2  ASP n 
2 3  LEU n 
2 4  LEU n 
2 5  SER n 
2 6  CYS n 
2 7  THR n 
2 8  VAL n 
2 9  ASN n 
2 10 ASP n 
2 11 ALA n 
2 12 GLU n 
2 13 ILE n 
2 14 PHE n 
2 15 SER n 
2 16 LEU n 
2 17 VAL n 
2 18 LYS n 
2 19 LYS n 
2 20 GLU n 
2 21 VAL n 
2 22 LEU n 
2 23 SER n 
2 24 LEU n 
2 25 ASN n 
2 26 THR n 
2 27 ASN n 
2 28 ASP n 
2 29 TYR n 
2 30 THR n 
2 31 THR n 
2 32 ALA n 
2 33 ILE n 
2 34 SER n 
2 35 LEU n 
2 36 SER n 
2 37 ASN n 
2 38 ARG n 
2 39 LEU n 
2 40 LYS n 
2 41 ILE n 
2 42 ASN n 
2 43 LYS n 
2 44 LYS n 
2 45 LYS n 
2 46 ILE n 
2 47 ASN n 
2 48 GLN n 
2 49 GLN n 
2 50 LEU n 
2 51 TYR n 
2 52 LYS n 
2 53 LEU n 
2 54 GLN n 
2 55 LYS n 
2 56 GLU n 
2 57 ASP n 
2 58 THR n 
2 59 VAL n 
2 60 LYS n 
2 61 MET n 
2 62 VAL n 
2 63 PRO n 
2 64 SER n 
2 65 ASN n 
2 66 PRO n 
2 67 PRO n 
2 68 LYS n 
2 69 TRP n 
2 70 PHE n 
2 71 LYS n 
2 72 ASN n 
2 73 TYR n 
2 74 ASN n 
2 75 CYS n 
# 
_entity_src_gen.entity_id                          2 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Yatapoxvirus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Yaba-like disease virus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     132475 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP Q9DHS8_YLDV Q9DHS8 2 MDLLSCTVNDAEIFSLVKKEVLSLNTNDYTTAISLSNRLKINKKKINQQLYKLQKEDTVKMVPSNPPKWFKNYNC 1 ? 
2 PDB 1SFU        1SFU   1 ?                                                                           ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1SFU A 1 ? 75 ? Q9DHS8 1 ? 75 ? 1 75 
2 1 1SFU B 1 ? 75 ? Q9DHS8 1 ? 75 ? 1 75 
3 2 1SFU C 1 ? 7  ? 1SFU   0 ? 6  ? 0 6  
4 2 1SFU D 1 ? 7  ? 1SFU   0 ? 6  ? 0 6  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1SFU 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   58.03 
_exptl_crystal.description           ? 
_exptl_crystal.density_Matthews      2.95 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_details    
'1-1.1 M lithium sulfate, 2-4 mM magnesium chloride, 25 mM cacodylate, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 295K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 'lithium sulfate'    ? ? ? 
1 2 1 'magnesium chloride' ? ? ? 
1 3 1 cacodylate           ? ? ? 
1 4 1 H2O                  ? ? ? 
1 5 2 'lithium sulfate'    ? ? ? 
1 6 2 'magnesium chloride' ? ? ? 
1 7 2 H2O                  ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2002-11-26 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             MAD 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.9201 1.0 
2 0.9203 1.0 
3 0.9159 1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SPRING-8 BEAMLINE BL41XU' 
_diffrn_source.pdbx_synchrotron_site       SPring-8 
_diffrn_source.pdbx_synchrotron_beamline   BL41XU 
_diffrn_source.pdbx_wavelength             0.9201 
_diffrn_source.pdbx_wavelength_list        '0.9203, 0.9159' 
# 
_reflns.entry_id                     1SFU 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            2.0 
_reflns.d_resolution_low             50.0 
_reflns.number_all                   ? 
_reflns.number_obs                   15772 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.0 
_reflns_shell.d_res_low              2.07 
_reflns_shell.percent_possible_all   99.8 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1SFU 
_refine.ls_d_res_high                            2.0 
_refine.ls_d_res_low                             20.0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     15970 
_refine.ls_number_reflns_obs                     15266 
_refine.ls_number_reflns_R_free                  1539 
_refine.ls_percent_reflns_obs                    95.6 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.2375 
_refine.ls_R_factor_R_free                       0.2704 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 9.6 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            -1.017 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][2]                            5.277 
_refine.aniso_B[2][3]                            0.000 
_refine.aniso_B[3][3]                            -4.259 
_refine.details                                  ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1132 
_refine_hist.pdbx_number_atoms_nucleic_acid   240 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             170 
_refine_hist.number_atoms_total               1542 
_refine_hist.d_res_high                       2.0 
_refine_hist.d_res_low                        20.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d    0.0053 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg 1.1844 ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1SFU 
_struct.title                     'Crystal structure of the viral Zalpha domain bound to left-handed Z-DNA' 
_struct.pdbx_descriptor           '34L PROTEIN/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1SFU 
_struct_keywords.pdbx_keywords   'DNA Binding Protein/DNA' 
_struct_keywords.text            'Protein-Z-DNA complex, DNA Binding Protein-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ALA C 11 ? SER C 23 ? ALA A 11 SER A 23 1 ? 13 
HELX_P HELX_P2 2 THR C 31 ? LEU C 39 ? THR A 31 LEU A 39 1 ? 9  
HELX_P HELX_P3 3 ASN C 42 ? GLU C 56 ? ASN A 42 GLU A 56 1 ? 15 
HELX_P HELX_P4 4 ALA D 11 ? SER D 23 ? ALA B 11 SER B 23 1 ? 13 
HELX_P HELX_P5 5 THR D 31 ? LEU D 39 ? THR B 31 LEU B 39 1 ? 9  
HELX_P HELX_P6 6 ASN D 42 ? GLU D 56 ? ASN B 42 GLU B 56 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? A DC 2 N3 ? ? ? 1_555 B DG 7 N1 ? ? C DC 1 D DG 6 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2  hydrog ? ? A DC 2 N4 ? ? ? 1_555 B DG 7 O6 ? ? C DC 1 D DG 6 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3  hydrog ? ? A DC 2 O2 ? ? ? 1_555 B DG 7 N2 ? ? C DC 1 D DG 6 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4  hydrog ? ? A DG 3 N1 ? ? ? 1_555 B DC 6 N3 ? ? C DG 2 D DC 5 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5  hydrog ? ? A DG 3 N2 ? ? ? 1_555 B DC 6 O2 ? ? C DG 2 D DC 5 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6  hydrog ? ? A DG 3 O6 ? ? ? 1_555 B DC 6 N4 ? ? C DG 2 D DC 5 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7  hydrog ? ? A DC 4 N3 ? ? ? 1_555 B DG 5 N1 ? ? C DC 3 D DG 4 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8  hydrog ? ? A DC 4 N4 ? ? ? 1_555 B DG 5 O6 ? ? C DC 3 D DG 4 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9  hydrog ? ? A DC 4 O2 ? ? ? 1_555 B DG 5 N2 ? ? C DC 3 D DG 4 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10 hydrog ? ? A DG 5 N1 ? ? ? 1_555 B DC 4 N3 ? ? C DG 4 D DC 3 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11 hydrog ? ? A DG 5 N2 ? ? ? 1_555 B DC 4 O2 ? ? C DG 4 D DC 3 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12 hydrog ? ? A DG 5 O6 ? ? ? 1_555 B DC 4 N4 ? ? C DG 4 D DC 3 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13 hydrog ? ? A DC 6 N3 ? ? ? 1_555 B DG 3 N1 ? ? C DC 5 D DG 2 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14 hydrog ? ? A DC 6 N4 ? ? ? 1_555 B DG 3 O6 ? ? C DC 5 D DG 2 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15 hydrog ? ? A DC 6 O2 ? ? ? 1_555 B DG 3 N2 ? ? C DC 5 D DG 2 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16 hydrog ? ? A DG 7 N1 ? ? ? 1_555 B DC 2 N3 ? ? C DG 6 D DC 1 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17 hydrog ? ? A DG 7 N2 ? ? ? 1_555 B DC 2 O2 ? ? C DG 6 D DC 1 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18 hydrog ? ? A DG 7 O6 ? ? ? 1_555 B DC 2 N4 ? ? C DG 6 D DC 1 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ASN 65 C . ? ASN 65 A PRO 66 C ? PRO 66 A 1 0.04  
2 ASN 65 D . ? ASN 65 B PRO 66 D ? PRO 66 B 1 -0.11 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL C 59 ? VAL C 62 ? VAL A 59 VAL A 62 
A 2 LYS C 68 ? LYS C 71 ? LYS A 68 LYS A 71 
B 1 TYR D 29 ? THR D 30 ? TYR B 29 THR B 30 
B 2 LYS D 68 ? LYS D 71 ? LYS B 68 LYS B 71 
B 3 VAL D 59 ? VAL D 62 ? VAL B 59 VAL B 62 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LYS C 60 ? N LYS A 60 O PHE C 70 ? O PHE A 70 
B 1 2 N THR D 30 ? N THR B 30 O TRP D 69 ? O TRP B 69 
B 2 3 O PHE D 70 ? O PHE B 70 N LYS D 60 ? N LYS B 60 
# 
_database_PDB_matrix.entry_id          1SFU 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1SFU 
_atom_sites.fract_transf_matrix[1][1]   0.019530 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010816 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.020828 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O "O5'" . DC  A 1 2  ? 25.807 42.171 -16.681 1.00 30.20 ? 1   DC  C "O5'" 1 
ATOM   2    C "C5'" . DC  A 1 2  ? 26.712 41.043 -16.638 1.00 27.18 ? 1   DC  C "C5'" 1 
ATOM   3    C "C4'" . DC  A 1 2  ? 27.131 40.685 -15.231 1.00 25.77 ? 1   DC  C "C4'" 1 
ATOM   4    O "O4'" . DC  A 1 2  ? 27.824 41.803 -14.624 1.00 23.74 ? 1   DC  C "O4'" 1 
ATOM   5    C "C3'" . DC  A 1 2  ? 25.971 40.360 -14.295 1.00 26.93 ? 1   DC  C "C3'" 1 
ATOM   6    O "O3'" . DC  A 1 2  ? 26.404 39.422 -13.307 1.00 28.97 ? 1   DC  C "O3'" 1 
ATOM   7    C "C2'" . DC  A 1 2  ? 25.709 41.691 -13.613 1.00 25.70 ? 1   DC  C "C2'" 1 
ATOM   8    C "C1'" . DC  A 1 2  ? 27.115 42.258 -13.475 1.00 23.51 ? 1   DC  C "C1'" 1 
ATOM   9    N N1    . DC  A 1 2  ? 27.181 43.729 -13.460 1.00 19.46 ? 1   DC  C N1    1 
ATOM   10   C C2    . DC  A 1 2  ? 27.184 44.398 -12.233 1.00 18.78 ? 1   DC  C C2    1 
ATOM   11   O O2    . DC  A 1 2  ? 27.112 43.732 -11.186 1.00 17.14 ? 1   DC  C O2    1 
ATOM   12   N N3    . DC  A 1 2  ? 27.265 45.753 -12.218 1.00 17.88 ? 1   DC  C N3    1 
ATOM   13   C C4    . DC  A 1 2  ? 27.337 46.429 -13.370 1.00 19.70 ? 1   DC  C C4    1 
ATOM   14   N N4    . DC  A 1 2  ? 27.430 47.760 -13.315 1.00 20.21 ? 1   DC  C N4    1 
ATOM   15   C C5    . DC  A 1 2  ? 27.321 45.771 -14.629 1.00 18.08 ? 1   DC  C C5    1 
ATOM   16   C C6    . DC  A 1 2  ? 27.245 44.433 -14.629 1.00 19.77 ? 1   DC  C C6    1 
ATOM   17   P P     . DG  A 1 3  ? 26.131 37.848 -13.512 1.00 25.51 ? 2   DG  C P     1 
ATOM   18   O OP1   . DG  A 1 3  ? 24.827 37.640 -14.189 1.00 31.01 ? 2   DG  C OP1   1 
ATOM   19   O OP2   . DG  A 1 3  ? 26.379 37.260 -12.180 1.00 25.80 ? 2   DG  C OP2   1 
ATOM   20   O "O5'" . DG  A 1 3  ? 27.263 37.391 -14.535 1.00 27.94 ? 2   DG  C "O5'" 1 
ATOM   21   C "C5'" . DG  A 1 3  ? 28.609 37.255 -14.099 1.00 24.94 ? 2   DG  C "C5'" 1 
ATOM   22   C "C4'" . DG  A 1 3  ? 29.503 36.882 -15.256 1.00 23.25 ? 2   DG  C "C4'" 1 
ATOM   23   O "O4'" . DG  A 1 3  ? 29.310 37.831 -16.320 1.00 23.24 ? 2   DG  C "O4'" 1 
ATOM   24   C "C3'" . DG  A 1 3  ? 30.981 36.944 -14.908 1.00 21.59 ? 2   DG  C "C3'" 1 
ATOM   25   O "O3'" . DG  A 1 3  ? 31.421 35.597 -14.704 1.00 21.26 ? 2   DG  C "O3'" 1 
ATOM   26   C "C2'" . DG  A 1 3  ? 31.635 37.401 -16.202 1.00 21.46 ? 2   DG  C "C2'" 1 
ATOM   27   C "C1'" . DG  A 1 3  ? 30.532 38.116 -16.973 1.00 21.70 ? 2   DG  C "C1'" 1 
ATOM   28   N N9    . DG  A 1 3  ? 30.642 39.571 -17.077 1.00 20.12 ? 2   DG  C N9    1 
ATOM   29   C C8    . DG  A 1 3  ? 30.674 40.302 -18.241 1.00 20.78 ? 2   DG  C C8    1 
ATOM   30   N N7    . DG  A 1 3  ? 30.745 41.589 -18.038 1.00 21.09 ? 2   DG  C N7    1 
ATOM   31   C C5    . DG  A 1 3  ? 30.764 41.721 -16.656 1.00 20.82 ? 2   DG  C C5    1 
ATOM   32   C C6    . DG  A 1 3  ? 30.825 42.887 -15.852 1.00 19.70 ? 2   DG  C C6    1 
ATOM   33   O O6    . DG  A 1 3  ? 30.874 44.068 -16.219 1.00 19.80 ? 2   DG  C O6    1 
ATOM   34   N N1    . DG  A 1 3  ? 30.823 42.576 -14.495 1.00 16.94 ? 2   DG  C N1    1 
ATOM   35   C C2    . DG  A 1 3  ? 30.769 41.306 -13.981 1.00 18.35 ? 2   DG  C C2    1 
ATOM   36   N N2    . DG  A 1 3  ? 30.784 41.213 -12.642 1.00 14.75 ? 2   DG  C N2    1 
ATOM   37   N N3    . DG  A 1 3  ? 30.709 40.204 -14.724 1.00 17.40 ? 2   DG  C N3    1 
ATOM   38   C C4    . DG  A 1 3  ? 30.712 40.486 -16.044 1.00 19.10 ? 2   DG  C C4    1 
ATOM   39   P P     . DC  A 1 4  ? 31.917 35.151 -13.246 1.00 22.16 ? 3   DC  C P     1 
ATOM   40   O OP1   . DC  A 1 4  ? 32.302 33.716 -13.316 1.00 20.82 ? 3   DC  C OP1   1 
ATOM   41   O OP2   . DC  A 1 4  ? 30.880 35.580 -12.286 1.00 19.92 ? 3   DC  C OP2   1 
ATOM   42   O "O5'" . DC  A 1 4  ? 33.210 36.053 -13.017 1.00 19.07 ? 3   DC  C "O5'" 1 
ATOM   43   C "C5'" . DC  A 1 4  ? 34.205 35.694 -12.069 1.00 18.46 ? 3   DC  C "C5'" 1 
ATOM   44   C "C4'" . DC  A 1 4  ? 34.484 36.855 -11.141 1.00 17.15 ? 3   DC  C "C4'" 1 
ATOM   45   O "O4'" . DC  A 1 4  ? 35.042 37.968 -11.888 1.00 18.12 ? 3   DC  C "O4'" 1 
ATOM   46   C "C3'" . DC  A 1 4  ? 33.254 37.403 -10.413 1.00 16.58 ? 3   DC  C "C3'" 1 
ATOM   47   O "O3'" . DC  A 1 4  ? 33.596 37.770 -9.070  1.00 17.33 ? 3   DC  C "O3'" 1 
ATOM   48   C "C2'" . DC  A 1 4  ? 32.923 38.665 -11.187 1.00 17.10 ? 3   DC  C "C2'" 1 
ATOM   49   C "C1'" . DC  A 1 4  ? 34.304 39.149 -11.588 1.00 15.56 ? 3   DC  C "C1'" 1 
ATOM   50   N N1    . DC  A 1 4  ? 34.301 40.004 -12.783 1.00 17.72 ? 3   DC  C N1    1 
ATOM   51   C C2    . DC  A 1 4  ? 34.389 41.381 -12.615 1.00 17.41 ? 3   DC  C C2    1 
ATOM   52   O O2    . DC  A 1 4  ? 34.473 41.830 -11.467 1.00 15.67 ? 3   DC  C O2    1 
ATOM   53   N N3    . DC  A 1 4  ? 34.377 42.190 -13.705 1.00 16.90 ? 3   DC  C N3    1 
ATOM   54   C C4    . DC  A 1 4  ? 34.279 41.659 -14.926 1.00 15.97 ? 3   DC  C C4    1 
ATOM   55   N N4    . DC  A 1 4  ? 34.264 42.495 -15.982 1.00 15.10 ? 3   DC  C N4    1 
ATOM   56   C C5    . DC  A 1 4  ? 34.191 40.250 -15.128 1.00 16.29 ? 3   DC  C C5    1 
ATOM   57   C C6    . DC  A 1 4  ? 34.206 39.466 -14.037 1.00 17.38 ? 3   DC  C C6    1 
ATOM   58   P P     . DG  A 1 5  ? 33.302 36.747 -7.872  1.00 19.93 ? 4   DG  C P     1 
ATOM   59   O OP1   . DG  A 1 5  ? 32.045 36.028 -8.173  1.00 20.56 ? 4   DG  C OP1   1 
ATOM   60   O OP2   . DG  A 1 5  ? 33.454 37.467 -6.580  1.00 20.78 ? 4   DG  C OP2   1 
ATOM   61   O "O5'" . DG  A 1 5  ? 34.491 35.698 -7.997  1.00 20.05 ? 4   DG  C "O5'" 1 
ATOM   62   C "C5'" . DG  A 1 5  ? 35.839 36.138 -7.877  1.00 22.69 ? 4   DG  C "C5'" 1 
ATOM   63   C "C4'" . DG  A 1 5  ? 36.797 35.005 -8.166  1.00 20.46 ? 4   DG  C "C4'" 1 
ATOM   64   O "O4'" . DG  A 1 5  ? 36.563 34.520 -9.506  1.00 16.31 ? 4   DG  C "O4'" 1 
ATOM   65   C "C3'" . DG  A 1 5  ? 38.257 35.433 -8.129  1.00 22.35 ? 4   DG  C "C3'" 1 
ATOM   66   O "O3'" . DG  A 1 5  ? 38.822 35.006 -6.887  1.00 25.34 ? 4   DG  C "O3'" 1 
ATOM   67   C "C2'" . DG  A 1 5  ? 38.908 34.553 -9.185  1.00 20.38 ? 4   DG  C "C2'" 1 
ATOM   68   C "C1'" . DG  A 1 5  ? 37.783 34.182 -10.139 1.00 18.60 ? 4   DG  C "C1'" 1 
ATOM   69   N N9    . DG  A 1 5  ? 37.804 34.856 -11.435 1.00 18.98 ? 4   DG  C N9    1 
ATOM   70   C C8    . DG  A 1 5  ? 37.771 34.251 -12.667 1.00 18.85 ? 4   DG  C C8    1 
ATOM   71   N N7    . DG  A 1 5  ? 37.747 35.102 -13.657 1.00 19.15 ? 4   DG  C N7    1 
ATOM   72   C C5    . DG  A 1 5  ? 37.777 36.348 -13.045 1.00 17.56 ? 4   DG  C C5    1 
ATOM   73   C C6    . DG  A 1 5  ? 37.756 37.649 -13.617 1.00 19.96 ? 4   DG  C C6    1 
ATOM   74   O O6    . DG  A 1 5  ? 37.689 37.962 -14.816 1.00 17.65 ? 4   DG  C O6    1 
ATOM   75   N N1    . DG  A 1 5  ? 37.809 38.640 -12.638 1.00 18.32 ? 4   DG  C N1    1 
ATOM   76   C C2    . DG  A 1 5  ? 37.859 38.408 -11.284 1.00 19.45 ? 4   DG  C C2    1 
ATOM   77   N N2    . DG  A 1 5  ? 37.895 39.503 -10.503 1.00 16.80 ? 4   DG  C N2    1 
ATOM   78   N N3    . DG  A 1 5  ? 37.869 37.197 -10.738 1.00 17.91 ? 4   DG  C N3    1 
ATOM   79   C C4    . DG  A 1 5  ? 37.828 36.220 -11.673 1.00 17.85 ? 4   DG  C C4    1 
ATOM   80   P P     . DC  A 1 6  ? 39.620 36.064 -5.978  1.00 28.24 ? 5   DC  C P     1 
ATOM   81   O OP1   . DC  A 1 6  ? 40.070 35.353 -4.745  1.00 26.64 ? 5   DC  C OP1   1 
ATOM   82   O OP2   . DC  A 1 6  ? 38.790 37.287 -5.847  1.00 27.04 ? 5   DC  C OP2   1 
ATOM   83   O "O5'" . DC  A 1 6  ? 40.893 36.423 -6.868  1.00 25.67 ? 5   DC  C "O5'" 1 
ATOM   84   C "C5'" . DC  A 1 6  ? 42.068 36.978 -6.279  1.00 26.31 ? 5   DC  C "C5'" 1 
ATOM   85   C "C4'" . DC  A 1 6  ? 42.378 38.324 -6.894  1.00 24.92 ? 5   DC  C "C4'" 1 
ATOM   86   O "O4'" . DC  A 1 6  ? 42.708 38.158 -8.293  1.00 23.08 ? 5   DC  C "O4'" 1 
ATOM   87   C "C3'" . DC  A 1 6  ? 41.230 39.338 -6.846  1.00 25.23 ? 5   DC  C "C3'" 1 
ATOM   88   O "O3'" . DC  A 1 6  ? 41.746 40.646 -6.594  1.00 28.66 ? 5   DC  C "O3'" 1 
ATOM   89   C "C2'" . DC  A 1 6  ? 40.675 39.302 -8.255  1.00 22.87 ? 5   DC  C "C2'" 1 
ATOM   90   C "C1'" . DC  A 1 6  ? 41.938 39.065 -9.061  1.00 21.65 ? 5   DC  C "C1'" 1 
ATOM   91   N N1    . DC  A 1 6  ? 41.704 38.465 -10.378 1.00 20.35 ? 5   DC  C N1    1 
ATOM   92   C C2    . DC  A 1 6  ? 41.653 39.308 -11.497 1.00 16.34 ? 5   DC  C C2    1 
ATOM   93   O O2    . DC  A 1 6  ? 41.835 40.522 -11.340 1.00 18.63 ? 5   DC  C O2    1 
ATOM   94   N N3    . DC  A 1 6  ? 41.406 38.779 -12.710 1.00 16.96 ? 5   DC  C N3    1 
ATOM   95   C C4    . DC  A 1 6  ? 41.213 37.464 -12.836 1.00 16.69 ? 5   DC  C C4    1 
ATOM   96   N N4    . DC  A 1 6  ? 40.945 36.986 -14.055 1.00 16.36 ? 5   DC  C N4    1 
ATOM   97   C C5    . DC  A 1 6  ? 41.278 36.580 -11.716 1.00 18.95 ? 5   DC  C C5    1 
ATOM   98   C C6    . DC  A 1 6  ? 41.526 37.119 -10.518 1.00 17.59 ? 5   DC  C C6    1 
ATOM   99   P P     . DG  A 1 7  ? 41.810 41.199 -5.090  1.00 29.49 ? 6   DG  C P     1 
ATOM   100  O OP1   . DG  A 1 7  ? 40.506 40.920 -4.443  1.00 32.79 ? 6   DG  C OP1   1 
ATOM   101  O OP2   . DG  A 1 7  ? 42.323 42.587 -5.135  1.00 33.30 ? 6   DG  C OP2   1 
ATOM   102  O "O5'" . DG  A 1 7  ? 42.908 40.283 -4.396  1.00 31.22 ? 6   DG  C "O5'" 1 
ATOM   103  C "C5'" . DG  A 1 7  ? 44.301 40.591 -4.512  1.00 30.92 ? 6   DG  C "C5'" 1 
ATOM   104  C "C4'" . DG  A 1 7  ? 45.113 39.610 -3.700  1.00 30.61 ? 6   DG  C "C4'" 1 
ATOM   105  O "O4'" . DG  A 1 7  ? 44.970 38.287 -4.271  1.00 30.69 ? 6   DG  C "O4'" 1 
ATOM   106  C "C3'" . DG  A 1 7  ? 46.616 39.874 -3.676  1.00 31.45 ? 6   DG  C "C3'" 1 
ATOM   107  O "O3'" . DG  A 1 7  ? 47.092 39.175 -2.519  1.00 33.23 ? 6   DG  C "O3'" 1 
ATOM   108  C "C2'" . DG  A 1 7  ? 47.109 39.059 -4.855  1.00 29.26 ? 6   DG  C "C2'" 1 
ATOM   109  C "C1'" . DG  A 1 7  ? 46.238 37.828 -4.726  1.00 28.30 ? 6   DG  C "C1'" 1 
ATOM   110  N N9    . DG  A 1 7  ? 46.028 37.069 -5.952  1.00 25.91 ? 6   DG  C N9    1 
ATOM   111  C C8    . DG  A 1 7  ? 46.027 35.702 -6.064  1.00 24.35 ? 6   DG  C C8    1 
ATOM   112  N N7    . DG  A 1 7  ? 45.790 35.287 -7.276  1.00 24.14 ? 6   DG  C N7    1 
ATOM   113  C C5    . DG  A 1 7  ? 45.632 36.450 -8.014  1.00 23.92 ? 6   DG  C C5    1 
ATOM   114  C C6    . DG  A 1 7  ? 45.360 36.621 -9.378  1.00 22.57 ? 6   DG  C C6    1 
ATOM   115  O O6    . DG  A 1 7  ? 45.195 35.755 -10.236 1.00 24.46 ? 6   DG  C O6    1 
ATOM   116  N N1    . DG  A 1 7  ? 45.281 37.966 -9.723  1.00 22.91 ? 6   DG  C N1    1 
ATOM   117  C C2    . DG  A 1 7  ? 45.443 39.013 -8.858  1.00 23.44 ? 6   DG  C C2    1 
ATOM   118  N N2    . DG  A 1 7  ? 45.316 40.240 -9.397  1.00 22.67 ? 6   DG  C N2    1 
ATOM   119  N N3    . DG  A 1 7  ? 45.702 38.868 -7.565  1.00 22.57 ? 6   DG  C N3    1 
ATOM   120  C C4    . DG  A 1 7  ? 45.781 37.563 -7.215  1.00 23.74 ? 6   DG  C C4    1 
ATOM   121  O "O5'" . DC  B 1 2  ? 45.053 40.293 -18.232 1.00 26.17 ? 1   DC  D "O5'" 1 
ATOM   122  C "C5'" . DC  B 1 2  ? 44.388 41.558 -18.363 1.00 19.38 ? 1   DC  D "C5'" 1 
ATOM   123  C "C4'" . DC  B 1 2  ? 44.410 42.265 -17.029 1.00 19.05 ? 1   DC  D "C4'" 1 
ATOM   124  O "O4'" . DC  B 1 2  ? 43.873 41.356 -16.037 1.00 17.55 ? 1   DC  D "O4'" 1 
ATOM   125  C "C3'" . DC  B 1 2  ? 45.819 42.631 -16.548 1.00 18.20 ? 1   DC  D "C3'" 1 
ATOM   126  O "O3'" . DC  B 1 2  ? 45.792 43.835 -15.772 1.00 22.23 ? 1   DC  D "O3'" 1 
ATOM   127  C "C2'" . DC  B 1 2  ? 46.167 41.486 -15.617 1.00 18.33 ? 1   DC  D "C2'" 1 
ATOM   128  C "C1'" . DC  B 1 2  ? 44.817 41.192 -14.991 1.00 18.08 ? 1   DC  D "C1'" 1 
ATOM   129  N N1    . DC  B 1 2  ? 44.682 39.829 -14.460 1.00 17.58 ? 1   DC  D N1    1 
ATOM   130  C C2    . DC  B 1 2  ? 44.909 39.617 -13.105 1.00 16.90 ? 1   DC  D C2    1 
ATOM   131  O O2    . DC  B 1 2  ? 45.198 40.588 -12.391 1.00 15.32 ? 1   DC  D O2    1 
ATOM   132  N N3    . DC  B 1 2  ? 44.803 38.367 -12.604 1.00 17.23 ? 1   DC  D N3    1 
ATOM   133  C C4    . DC  B 1 2  ? 44.475 37.352 -13.411 1.00 20.11 ? 1   DC  D C4    1 
ATOM   134  N N4    . DC  B 1 2  ? 44.370 36.132 -12.878 1.00 19.31 ? 1   DC  D N4    1 
ATOM   135  C C5    . DC  B 1 2  ? 44.237 37.543 -14.800 1.00 18.48 ? 1   DC  D C5    1 
ATOM   136  C C6    . DC  B 1 2  ? 44.347 38.787 -15.278 1.00 18.61 ? 1   DC  D C6    1 
ATOM   137  P P     . DG  B 1 3  ? 46.148 45.239 -16.457 1.00 23.11 ? 2   DG  D P     1 
ATOM   138  O OP1   . DG  B 1 3  ? 47.177 45.041 -17.507 1.00 22.19 ? 2   DG  D OP1   1 
ATOM   139  O OP2   . DG  B 1 3  ? 46.396 46.206 -15.359 1.00 19.15 ? 2   DG  D OP2   1 
ATOM   140  O "O5'" . DG  B 1 3  ? 44.790 45.640 -17.180 1.00 19.57 ? 2   DG  D "O5'" 1 
ATOM   141  C "C5'" . DG  B 1 3  ? 43.593 45.732 -16.420 1.00 19.92 ? 2   DG  D "C5'" 1 
ATOM   142  C "C4'" . DG  B 1 3  ? 42.403 45.948 -17.322 1.00 17.66 ? 2   DG  D "C4'" 1 
ATOM   143  O "O4'" . DG  B 1 3  ? 42.267 44.803 -18.193 1.00 18.36 ? 2   DG  D "O4'" 1 
ATOM   144  C "C3'" . DG  B 1 3  ? 41.098 46.027 -16.542 1.00 18.54 ? 2   DG  D "C3'" 1 
ATOM   145  O "O3'" . DG  B 1 3  ? 40.756 47.406 -16.397 1.00 18.07 ? 2   DG  D "O3'" 1 
ATOM   146  C "C2'" . DG  B 1 3  ? 40.083 45.409 -17.493 1.00 18.17 ? 2   DG  D "C2'" 1 
ATOM   147  C "C1'" . DG  B 1 3  ? 40.898 44.491 -18.399 1.00 16.78 ? 2   DG  D "C1'" 1 
ATOM   148  N N9    . DG  B 1 3  ? 40.737 43.060 -18.158 1.00 17.64 ? 2   DG  D N9    1 
ATOM   149  C C8    . DG  B 1 3  ? 40.432 42.102 -19.095 1.00 16.56 ? 2   DG  D C8    1 
ATOM   150  N N7    . DG  B 1 3  ? 40.375 40.897 -18.596 1.00 16.08 ? 2   DG  D N7    1 
ATOM   151  C C5    . DG  B 1 3  ? 40.658 41.064 -17.250 1.00 16.21 ? 2   DG  D C5    1 
ATOM   152  C C6    . DG  B 1 3  ? 40.741 40.106 -16.200 1.00 16.09 ? 2   DG  D C6    1 
ATOM   153  O O6    . DG  B 1 3  ? 40.575 38.884 -16.257 1.00 17.33 ? 2   DG  D O6    1 
ATOM   154  N N1    . DG  B 1 3  ? 41.054 40.704 -14.985 1.00 13.59 ? 2   DG  D N1    1 
ATOM   155  C C2    . DG  B 1 3  ? 41.256 42.053 -14.797 1.00 15.59 ? 2   DG  D C2    1 
ATOM   156  N N2    . DG  B 1 3  ? 41.555 42.442 -13.542 1.00 12.61 ? 2   DG  D N2    1 
ATOM   157  N N3    . DG  B 1 3  ? 41.173 42.954 -15.765 1.00 17.49 ? 2   DG  D N3    1 
ATOM   158  C C4    . DG  B 1 3  ? 40.877 42.394 -16.957 1.00 15.77 ? 2   DG  D C4    1 
ATOM   159  P P     . DC  B 1 4  ? 40.589 48.030 -14.920 1.00 17.17 ? 3   DC  D P     1 
ATOM   160  O OP1   . DC  B 1 4  ? 40.392 49.493 -15.051 1.00 15.50 ? 3   DC  D OP1   1 
ATOM   161  O OP2   . DC  B 1 4  ? 41.692 47.522 -14.085 1.00 19.09 ? 3   DC  D OP2   1 
ATOM   162  O "O5'" . DC  B 1 4  ? 39.227 47.365 -14.421 1.00 18.50 ? 3   DC  D "O5'" 1 
ATOM   163  C "C5'" . DC  B 1 4  ? 38.378 48.009 -13.477 1.00 15.63 ? 3   DC  D "C5'" 1 
ATOM   164  C "C4'" . DC  B 1 4  ? 38.071 47.065 -12.337 1.00 19.69 ? 3   DC  D "C4'" 1 
ATOM   165  O "O4'" . DC  B 1 4  ? 37.340 45.916 -12.844 1.00 17.24 ? 3   DC  D "O4'" 1 
ATOM   166  C "C3'" . DC  B 1 4  ? 39.327 46.500 -11.659 1.00 17.52 ? 3   DC  D "C3'" 1 
ATOM   167  O "O3'" . DC  B 1 4  ? 39.113 46.320 -10.261 1.00 18.32 ? 3   DC  D "O3'" 1 
ATOM   168  C "C2'" . DC  B 1 4  ? 39.463 45.126 -12.279 1.00 16.36 ? 3   DC  D "C2'" 1 
ATOM   169  C "C1'" . DC  B 1 4  ? 38.006 44.735 -12.418 1.00 17.27 ? 3   DC  D "C1'" 1 
ATOM   170  N N1    . DC  B 1 4  ? 37.797 43.677 -13.411 1.00 17.98 ? 3   DC  D N1    1 
ATOM   171  C C2    . DC  B 1 4  ? 37.815 42.352 -12.967 1.00 17.12 ? 3   DC  D C2    1 
ATOM   172  O O2    . DC  B 1 4  ? 37.947 42.131 -11.751 1.00 19.50 ? 3   DC  D O2    1 
ATOM   173  N N3    . DC  B 1 4  ? 37.691 41.353 -13.858 1.00 14.35 ? 3   DC  D N3    1 
ATOM   174  C C4    . DC  B 1 4  ? 37.542 41.629 -15.154 1.00 16.26 ? 3   DC  D C4    1 
ATOM   175  N N4    . DC  B 1 4  ? 37.438 40.597 -16.002 1.00 15.11 ? 3   DC  D N4    1 
ATOM   176  C C5    . DC  B 1 4  ? 37.494 42.973 -15.640 1.00 15.80 ? 3   DC  D C5    1 
ATOM   177  C C6    . DC  B 1 4  ? 37.620 43.960 -14.737 1.00 17.06 ? 3   DC  D C6    1 
ATOM   178  P P     . DG  B 1 5  ? 39.555 47.469 -9.236  1.00 19.79 ? 4   DG  D P     1 
ATOM   179  O OP1   . DG  B 1 5  ? 40.867 48.023 -9.646  1.00 20.52 ? 4   DG  D OP1   1 
ATOM   180  O OP2   . DG  B 1 5  ? 39.379 46.932 -7.863  1.00 18.70 ? 4   DG  D OP2   1 
ATOM   181  O "O5'" . DG  B 1 5  ? 38.456 48.590 -9.479  1.00 19.55 ? 4   DG  D "O5'" 1 
ATOM   182  C "C5'" . DG  B 1 5  ? 37.093 48.292 -9.218  1.00 20.04 ? 4   DG  D "C5'" 1 
ATOM   183  C "C4'" . DG  B 1 5  ? 36.202 49.432 -9.641  1.00 18.58 ? 4   DG  D "C4'" 1 
ATOM   184  O "O4'" . DG  B 1 5  ? 36.305 49.594 -11.072 1.00 17.39 ? 4   DG  D "O4'" 1 
ATOM   185  C "C3'" . DG  B 1 5  ? 34.736 49.134 -9.372  1.00 18.71 ? 4   DG  D "C3'" 1 
ATOM   186  O "O3'" . DG  B 1 5  ? 34.352 49.815 -8.181  1.00 21.50 ? 4   DG  D "O3'" 1 
ATOM   187  C "C2'" . DG  B 1 5  ? 34.017 49.840 -10.507 1.00 17.97 ? 4   DG  D "C2'" 1 
ATOM   188  C "C1'" . DG  B 1 5  ? 35.041 49.921 -11.629 1.00 15.72 ? 4   DG  D "C1'" 1 
ATOM   189  N N9    . DG  B 1 5  ? 34.813 49.013 -12.750 1.00 15.38 ? 4   DG  D N9    1 
ATOM   190  C C8    . DG  B 1 5  ? 34.749 49.362 -14.077 1.00 15.75 ? 4   DG  D C8    1 
ATOM   191  N N7    . DG  B 1 5  ? 34.584 48.341 -14.871 1.00 16.63 ? 4   DG  D N7    1 
ATOM   192  C C5    . DG  B 1 5  ? 34.520 47.246 -14.021 1.00 15.56 ? 4   DG  D C5    1 
ATOM   193  C C6    . DG  B 1 5  ? 34.357 45.870 -14.314 1.00 14.93 ? 4   DG  D C6    1 
ATOM   194  O O6    . DG  B 1 5  ? 34.234 45.328 -15.417 1.00 13.63 ? 4   DG  D O6    1 
ATOM   195  N N1    . DG  B 1 5  ? 34.350 45.097 -13.160 1.00 15.19 ? 4   DG  D N1    1 
ATOM   196  C C2    . DG  B 1 5  ? 34.491 45.582 -11.883 1.00 16.97 ? 4   DG  D C2    1 
ATOM   197  N N2    . DG  B 1 5  ? 34.468 44.661 -10.900 1.00 17.58 ? 4   DG  D N2    1 
ATOM   198  N N3    . DG  B 1 5  ? 34.647 46.869 -11.592 1.00 15.85 ? 4   DG  D N3    1 
ATOM   199  C C4    . DG  B 1 5  ? 34.650 47.640 -12.703 1.00 14.14 ? 4   DG  D C4    1 
ATOM   200  P P     . DC  B 1 6  ? 33.633 48.991 -7.005  1.00 23.76 ? 5   DC  D P     1 
ATOM   201  O OP1   . DC  B 1 6  ? 33.344 49.970 -5.916  1.00 22.02 ? 5   DC  D OP1   1 
ATOM   202  O OP2   . DC  B 1 6  ? 34.431 47.779 -6.701  1.00 21.81 ? 5   DC  D OP2   1 
ATOM   203  O "O5'" . DC  B 1 6  ? 32.271 48.523 -7.693  1.00 24.16 ? 5   DC  D "O5'" 1 
ATOM   204  C "C5'" . DC  B 1 6  ? 31.103 48.260 -6.920  1.00 22.38 ? 5   DC  D "C5'" 1 
ATOM   205  C "C4'" . DC  B 1 6  ? 30.544 46.897 -7.261  1.00 20.74 ? 5   DC  D "C4'" 1 
ATOM   206  O "O4'" . DC  B 1 6  ? 30.085 46.862 -8.635  1.00 21.33 ? 5   DC  D "O4'" 1 
ATOM   207  C "C3'" . DC  B 1 6  ? 31.533 45.735 -7.125  1.00 24.30 ? 5   DC  D "C3'" 1 
ATOM   208  O "O3'" . DC  B 1 6  ? 30.849 44.587 -6.617  1.00 25.65 ? 5   DC  D "O3'" 1 
ATOM   209  C "C2'" . DC  B 1 6  ? 31.928 45.450 -8.561  1.00 22.08 ? 5   DC  D "C2'" 1 
ATOM   210  C "C1'" . DC  B 1 6  ? 30.604 45.694 -9.250  1.00 20.44 ? 5   DC  D "C1'" 1 
ATOM   211  N N1    . DC  B 1 6  ? 30.711 45.934 -10.690 1.00 18.97 ? 5   DC  D N1    1 
ATOM   212  C C2    . DC  B 1 6  ? 30.694 44.835 -11.549 1.00 17.74 ? 5   DC  D C2    1 
ATOM   213  O O2    . DC  B 1 6  ? 30.581 43.697 -11.065 1.00 19.12 ? 5   DC  D O2    1 
ATOM   214  N N3    . DC  B 1 6  ? 30.800 45.036 -12.879 1.00 16.02 ? 5   DC  D N3    1 
ATOM   215  C C4    . DC  B 1 6  ? 30.908 46.280 -13.359 1.00 18.17 ? 5   DC  D C4    1 
ATOM   216  N N4    . DC  B 1 6  ? 30.990 46.438 -14.685 1.00 16.63 ? 5   DC  D N4    1 
ATOM   217  C C5    . DC  B 1 6  ? 30.931 47.419 -12.504 1.00 17.49 ? 5   DC  D C5    1 
ATOM   218  C C6    . DC  B 1 6  ? 30.828 47.201 -11.188 1.00 18.76 ? 5   DC  D C6    1 
ATOM   219  P P     . DG  B 1 7  ? 30.956 44.234 -5.060  1.00 27.56 ? 6   DG  D P     1 
ATOM   220  O OP1   . DG  B 1 7  ? 32.400 44.150 -4.725  1.00 27.17 ? 6   DG  D OP1   1 
ATOM   221  O OP2   . DG  B 1 7  ? 30.072 43.078 -4.792  1.00 25.65 ? 6   DG  D OP2   1 
ATOM   222  O "O5'" . DG  B 1 7  ? 30.336 45.520 -4.347  1.00 28.41 ? 6   DG  D "O5'" 1 
ATOM   223  C "C5'" . DG  B 1 7  ? 28.926 45.606 -4.107  1.00 28.73 ? 6   DG  D "C5'" 1 
ATOM   224  C "C4'" . DG  B 1 7  ? 28.566 46.943 -3.501  1.00 27.35 ? 6   DG  D "C4'" 1 
ATOM   225  O "O4'" . DG  B 1 7  ? 28.775 47.995 -4.479  1.00 25.78 ? 6   DG  D "O4'" 1 
ATOM   226  C "C3'" . DG  B 1 7  ? 27.092 47.050 -3.108  1.00 29.57 ? 6   DG  D "C3'" 1 
ATOM   227  O "O3'" . DG  B 1 7  ? 26.975 48.045 -2.081  1.00 30.84 ? 6   DG  D "O3'" 1 
ATOM   228  C "C2'" . DG  B 1 7  ? 26.459 47.636 -4.357  1.00 26.70 ? 6   DG  D "C2'" 1 
ATOM   229  C "C1'" . DG  B 1 7  ? 27.534 48.617 -4.784  1.00 24.70 ? 6   DG  D "C1'" 1 
ATOM   230  N N9    . DG  B 1 7  ? 27.534 48.995 -6.195  1.00 23.05 ? 6   DG  D N9    1 
ATOM   231  C C8    . DG  B 1 7  ? 27.646 50.273 -6.687  1.00 22.64 ? 6   DG  D C8    1 
ATOM   232  N N7    . DG  B 1 7  ? 27.611 50.327 -7.990  1.00 21.66 ? 6   DG  D N7    1 
ATOM   233  C C5    . DG  B 1 7  ? 27.468 49.003 -8.386  1.00 21.51 ? 6   DG  D C5    1 
ATOM   234  C C6    . DG  B 1 7  ? 27.371 48.443 -9.685  1.00 21.18 ? 6   DG  D C6    1 
ATOM   235  O O6    . DG  B 1 7  ? 27.395 49.023 -10.777 1.00 22.76 ? 6   DG  D O6    1 
ATOM   236  N N1    . DG  B 1 7  ? 27.236 47.060 -9.637  1.00 22.63 ? 6   DG  D N1    1 
ATOM   237  C C2    . DG  B 1 7  ? 27.196 46.311 -8.490  1.00 20.97 ? 6   DG  D C2    1 
ATOM   238  N N2    . DG  B 1 7  ? 27.061 44.985 -8.661  1.00 22.65 ? 6   DG  D N2    1 
ATOM   239  N N3    . DG  B 1 7  ? 27.284 46.822 -7.268  1.00 20.80 ? 6   DG  D N3    1 
ATOM   240  C C4    . DG  B 1 7  ? 27.418 48.165 -7.292  1.00 20.62 ? 6   DG  D C4    1 
ATOM   241  N N     . CYS C 2 6  ? 41.111 23.475 14.089  1.00 57.76 ? 6   CYS A N     1 
ATOM   242  C CA    . CYS C 2 6  ? 39.878 24.107 14.638  1.00 57.86 ? 6   CYS A CA    1 
ATOM   243  C C     . CYS C 2 6  ? 39.222 25.023 13.613  1.00 56.83 ? 6   CYS A C     1 
ATOM   244  O O     . CYS C 2 6  ? 38.135 25.547 13.845  1.00 55.70 ? 6   CYS A O     1 
ATOM   245  C CB    . CYS C 2 6  ? 40.216 24.914 15.888  1.00 57.96 ? 6   CYS A CB    1 
ATOM   246  S SG    . CYS C 2 6  ? 41.087 23.972 17.144  1.00 61.43 ? 6   CYS A SG    1 
ATOM   247  N N     . THR C 2 7  ? 39.880 25.211 12.476  1.00 56.55 ? 7   THR A N     1 
ATOM   248  C CA    . THR C 2 7  ? 39.341 26.076 11.437  1.00 56.85 ? 7   THR A CA    1 
ATOM   249  C C     . THR C 2 7  ? 39.280 25.383 10.083  1.00 57.12 ? 7   THR A C     1 
ATOM   250  O O     . THR C 2 7  ? 40.193 24.645 9.708   1.00 57.49 ? 7   THR A O     1 
ATOM   251  C CB    . THR C 2 7  ? 40.179 27.349 11.334  1.00 56.13 ? 7   THR A CB    1 
ATOM   252  N N     . VAL C 2 8  ? 38.193 25.631 9.358   1.00 57.66 ? 8   VAL A N     1 
ATOM   253  C CA    . VAL C 2 8  ? 37.985 25.061 8.030   1.00 57.97 ? 8   VAL A CA    1 
ATOM   254  C C     . VAL C 2 8  ? 37.972 26.198 7.009   1.00 58.02 ? 8   VAL A C     1 
ATOM   255  O O     . VAL C 2 8  ? 36.920 26.773 6.719   1.00 58.15 ? 8   VAL A O     1 
ATOM   256  C CB    . VAL C 2 8  ? 36.661 24.300 7.988   1.00 58.18 ? 8   VAL A CB    1 
ATOM   257  N N     . ASN C 2 9  ? 39.148 26.514 6.471   1.00 57.75 ? 9   ASN A N     1 
ATOM   258  C CA    . ASN C 2 9  ? 39.299 27.591 5.497   1.00 57.69 ? 9   ASN A CA    1 
ATOM   259  C C     . ASN C 2 9  ? 38.384 27.448 4.282   1.00 57.29 ? 9   ASN A C     1 
ATOM   260  O O     . ASN C 2 9  ? 37.164 27.364 4.418   1.00 57.85 ? 9   ASN A O     1 
ATOM   261  C CB    . ASN C 2 9  ? 40.755 27.677 5.048   1.00 57.74 ? 9   ASN A CB    1 
ATOM   262  N N     . ASP C 2 10 ? 38.981 27.429 3.093   1.00 56.27 ? 10  ASP A N     1 
ATOM   263  C CA    . ASP C 2 10 ? 38.219 27.304 1.856   1.00 55.25 ? 10  ASP A CA    1 
ATOM   264  C C     . ASP C 2 10 ? 38.176 25.861 1.352   1.00 53.74 ? 10  ASP A C     1 
ATOM   265  O O     . ASP C 2 10 ? 37.346 25.514 0.508   1.00 53.44 ? 10  ASP A O     1 
ATOM   266  C CB    . ASP C 2 10 ? 38.823 28.202 0.769   1.00 56.20 ? 10  ASP A CB    1 
ATOM   267  C CG    . ASP C 2 10 ? 38.891 29.663 1.182   1.00 58.36 ? 10  ASP A CG    1 
ATOM   268  O OD1   . ASP C 2 10 ? 37.868 30.211 1.645   1.00 20.15 ? 10  ASP A OD1   1 
ATOM   269  O OD2   . ASP C 2 10 ? 39.970 30.274 1.034   1.00 20.15 ? 10  ASP A OD2   1 
ATOM   270  N N     . ALA C 2 11 ? 39.068 25.024 1.878   1.00 51.99 ? 11  ALA A N     1 
ATOM   271  C CA    . ALA C 2 11 ? 39.149 23.620 1.477   1.00 50.42 ? 11  ALA A CA    1 
ATOM   272  C C     . ALA C 2 11 ? 37.823 22.871 1.595   1.00 48.35 ? 11  ALA A C     1 
ATOM   273  O O     . ALA C 2 11 ? 37.515 22.002 0.778   1.00 47.95 ? 11  ALA A O     1 
ATOM   274  C CB    . ALA C 2 11 ? 40.220 22.905 2.294   1.00 50.35 ? 11  ALA A CB    1 
ATOM   275  N N     . GLU C 2 12 ? 37.034 23.203 2.608   1.00 45.92 ? 12  GLU A N     1 
ATOM   276  C CA    . GLU C 2 12 ? 35.760 22.529 2.789   1.00 43.38 ? 12  GLU A CA    1 
ATOM   277  C C     . GLU C 2 12 ? 34.764 23.005 1.737   1.00 40.23 ? 12  GLU A C     1 
ATOM   278  O O     . GLU C 2 12 ? 33.855 22.273 1.345   1.00 38.50 ? 12  GLU A O     1 
ATOM   279  C CB    . GLU C 2 12 ? 35.230 22.781 4.201   1.00 46.45 ? 12  GLU A CB    1 
ATOM   280  C CG    . GLU C 2 12 ? 34.045 21.907 4.577   1.00 48.95 ? 12  GLU A CG    1 
ATOM   281  C CD    . GLU C 2 12 ? 32.720 22.536 4.211   1.00 49.65 ? 12  GLU A CD    1 
ATOM   282  O OE1   . GLU C 2 12 ? 31.686 21.838 4.298   1.00 50.07 ? 12  GLU A OE1   1 
ATOM   283  O OE2   . GLU C 2 12 ? 32.714 23.734 3.849   1.00 50.69 ? 12  GLU A OE2   1 
ATOM   284  N N     . ILE C 2 13 ? 34.947 24.237 1.277   1.00 38.00 ? 13  ILE A N     1 
ATOM   285  C CA    . ILE C 2 13 ? 34.073 24.803 0.257   1.00 34.42 ? 13  ILE A CA    1 
ATOM   286  C C     . ILE C 2 13 ? 34.454 24.114 -1.046  1.00 31.40 ? 13  ILE A C     1 
ATOM   287  O O     . ILE C 2 13 ? 33.598 23.635 -1.791  1.00 28.98 ? 13  ILE A O     1 
ATOM   288  C CB    . ILE C 2 13 ? 34.301 26.316 0.108   1.00 35.42 ? 13  ILE A CB    1 
ATOM   289  C CG1   . ILE C 2 13 ? 34.480 26.952 1.491   1.00 37.56 ? 13  ILE A CG1   1 
ATOM   290  C CG2   . ILE C 2 13 ? 33.117 26.941 -0.618  1.00 35.22 ? 13  ILE A CG2   1 
ATOM   291  C CD1   . ILE C 2 13 ? 34.954 28.395 1.452   1.00 39.08 ? 13  ILE A CD1   1 
ATOM   292  N N     . PHE C 2 14 ? 35.756 24.067 -1.302  1.00 29.53 ? 14  PHE A N     1 
ATOM   293  C CA    . PHE C 2 14 ? 36.289 23.418 -2.489  1.00 30.05 ? 14  PHE A CA    1 
ATOM   294  C C     . PHE C 2 14 ? 35.729 21.996 -2.565  1.00 29.96 ? 14  PHE A C     1 
ATOM   295  O O     . PHE C 2 14 ? 35.240 21.565 -3.605  1.00 29.53 ? 14  PHE A O     1 
ATOM   296  C CB    . PHE C 2 14 ? 37.814 23.369 -2.400  1.00 31.14 ? 14  PHE A CB    1 
ATOM   297  C CG    . PHE C 2 14 ? 38.471 22.661 -3.549  1.00 32.93 ? 14  PHE A CG    1 
ATOM   298  C CD1   . PHE C 2 14 ? 38.756 23.336 -4.734  1.00 31.94 ? 14  PHE A CD1   1 
ATOM   299  C CD2   . PHE C 2 14 ? 38.804 21.310 -3.450  1.00 32.19 ? 14  PHE A CD2   1 
ATOM   300  C CE1   . PHE C 2 14 ? 39.365 22.676 -5.804  1.00 31.40 ? 14  PHE A CE1   1 
ATOM   301  C CE2   . PHE C 2 14 ? 39.408 20.647 -4.510  1.00 31.86 ? 14  PHE A CE2   1 
ATOM   302  C CZ    . PHE C 2 14 ? 39.690 21.333 -5.690  1.00 31.09 ? 14  PHE A CZ    1 
ATOM   303  N N     . SER C 2 15 ? 35.799 21.271 -1.451  1.00 28.61 ? 15  SER A N     1 
ATOM   304  C CA    . SER C 2 15 ? 35.300 19.901 -1.404  1.00 27.35 ? 15  SER A CA    1 
ATOM   305  C C     . SER C 2 15 ? 33.795 19.824 -1.662  1.00 26.21 ? 15  SER A C     1 
ATOM   306  O O     . SER C 2 15 ? 33.325 18.929 -2.360  1.00 25.55 ? 15  SER A O     1 
ATOM   307  C CB    . SER C 2 15 ? 35.632 19.266 -0.047  1.00 26.96 ? 15  SER A CB    1 
ATOM   308  O OG    . SER C 2 15 ? 37.033 19.285 0.189   1.00 26.72 ? 15  SER A OG    1 
ATOM   309  N N     . LEU C 2 16 ? 33.034 20.756 -1.097  1.00 26.04 ? 16  LEU A N     1 
ATOM   310  C CA    . LEU C 2 16 ? 31.591 20.746 -1.304  1.00 25.96 ? 16  LEU A CA    1 
ATOM   311  C C     . LEU C 2 16 ? 31.260 20.992 -2.774  1.00 26.05 ? 16  LEU A C     1 
ATOM   312  O O     . LEU C 2 16 ? 30.378 20.345 -3.337  1.00 27.49 ? 16  LEU A O     1 
ATOM   313  C CB    . LEU C 2 16 ? 30.913 21.820 -0.451  1.00 27.88 ? 16  LEU A CB    1 
ATOM   314  C CG    . LEU C 2 16 ? 30.931 21.646 1.067   1.00 30.17 ? 16  LEU A CG    1 
ATOM   315  C CD1   . LEU C 2 16 ? 30.439 22.927 1.732   1.00 28.93 ? 16  LEU A CD1   1 
ATOM   316  C CD2   . LEU C 2 16 ? 30.059 20.456 1.452   1.00 29.77 ? 16  LEU A CD2   1 
ATOM   317  N N     . VAL C 2 17 ? 31.970 21.930 -3.394  1.00 23.98 ? 17  VAL A N     1 
ATOM   318  C CA    . VAL C 2 17 ? 31.716 22.243 -4.797  1.00 23.32 ? 17  VAL A CA    1 
ATOM   319  C C     . VAL C 2 17 ? 32.112 21.089 -5.716  1.00 21.25 ? 17  VAL A C     1 
ATOM   320  O O     . VAL C 2 17 ? 31.385 20.753 -6.655  1.00 23.34 ? 17  VAL A O     1 
ATOM   321  C CB    . VAL C 2 17 ? 32.479 23.518 -5.239  1.00 20.71 ? 17  VAL A CB    1 
ATOM   322  C CG1   . VAL C 2 17 ? 32.166 23.834 -6.695  1.00 19.79 ? 17  VAL A CG1   1 
ATOM   323  C CG2   . VAL C 2 17 ? 32.097 24.682 -4.355  1.00 19.69 ? 17  VAL A CG2   1 
ATOM   324  N N     . LYS C 2 18 ? 33.269 20.489 -5.455  1.00 22.74 ? 18  LYS A N     1 
ATOM   325  C CA    . LYS C 2 18 ? 33.728 19.382 -6.286  1.00 23.52 ? 18  LYS A CA    1 
ATOM   326  C C     . LYS C 2 18 ? 32.725 18.233 -6.235  1.00 24.64 ? 18  LYS A C     1 
ATOM   327  O O     . LYS C 2 18 ? 32.369 17.650 -7.264  1.00 24.77 ? 18  LYS A O     1 
ATOM   328  C CB    . LYS C 2 18 ? 35.109 18.907 -5.826  1.00 22.14 ? 18  LYS A CB    1 
ATOM   329  C CG    . LYS C 2 18 ? 35.687 17.767 -6.666  1.00 25.04 ? 18  LYS A CG    1 
ATOM   330  C CD    . LYS C 2 18 ? 37.143 17.507 -6.296  1.00 24.37 ? 18  LYS A CD    1 
ATOM   331  C CE    . LYS C 2 18 ? 37.701 16.288 -7.017  1.00 25.94 ? 18  LYS A CE    1 
ATOM   332  N NZ    . LYS C 2 18 ? 39.134 16.051 -6.645  1.00 25.00 ? 18  LYS A NZ    1 
ATOM   333  N N     . LYS C 2 19 ? 32.253 17.922 -5.033  1.00 26.15 ? 19  LYS A N     1 
ATOM   334  C CA    . LYS C 2 19 ? 31.287 16.847 -4.863  1.00 28.72 ? 19  LYS A CA    1 
ATOM   335  C C     . LYS C 2 19 ? 30.031 17.149 -5.677  1.00 28.56 ? 19  LYS A C     1 
ATOM   336  O O     . LYS C 2 19 ? 29.480 16.265 -6.322  1.00 26.97 ? 19  LYS A O     1 
ATOM   337  C CB    . LYS C 2 19 ? 30.937 16.690 -3.383  1.00 31.46 ? 19  LYS A CB    1 
ATOM   338  C CG    . LYS C 2 19 ? 30.373 15.331 -3.020  1.00 34.99 ? 19  LYS A CG    1 
ATOM   339  C CD    . LYS C 2 19 ? 30.321 15.138 -1.506  1.00 37.70 ? 19  LYS A CD    1 
ATOM   340  C CE    . LYS C 2 19 ? 30.015 13.690 -1.147  1.00 38.47 ? 19  LYS A CE    1 
ATOM   341  N NZ    . LYS C 2 19 ? 31.060 12.767 -1.687  1.00 38.10 ? 19  LYS A NZ    1 
ATOM   342  N N     . GLU C 2 20 ? 29.592 18.405 -5.665  1.00 30.15 ? 20  GLU A N     1 
ATOM   343  C CA    . GLU C 2 20 ? 28.397 18.794 -6.407  1.00 31.60 ? 20  GLU A CA    1 
ATOM   344  C C     . GLU C 2 20 ? 28.552 18.647 -7.917  1.00 32.35 ? 20  GLU A C     1 
ATOM   345  O O     . GLU C 2 20 ? 27.677 18.095 -8.583  1.00 32.86 ? 20  GLU A O     1 
ATOM   346  C CB    . GLU C 2 20 ? 28.013 20.243 -6.092  1.00 34.05 ? 20  GLU A CB    1 
ATOM   347  C CG    . GLU C 2 20 ? 27.479 20.467 -4.692  1.00 37.23 ? 20  GLU A CG    1 
ATOM   348  C CD    . GLU C 2 20 ? 26.185 19.721 -4.435  1.00 38.81 ? 20  GLU A CD    1 
ATOM   349  O OE1   . GLU C 2 20 ? 25.168 20.029 -5.098  1.00 39.92 ? 20  GLU A OE1   1 
ATOM   350  O OE2   . GLU C 2 20 ? 26.191 18.822 -3.569  1.00 41.15 ? 20  GLU A OE2   1 
ATOM   351  N N     . VAL C 2 21 ? 29.655 19.151 -8.463  1.00 32.28 ? 21  VAL A N     1 
ATOM   352  C CA    . VAL C 2 21 ? 29.860 19.068 -9.902  1.00 32.18 ? 21  VAL A CA    1 
ATOM   353  C C     . VAL C 2 21 ? 30.019 17.624 -10.367 1.00 31.86 ? 21  VAL A C     1 
ATOM   354  O O     . VAL C 2 21 ? 29.538 17.254 -11.436 1.00 31.91 ? 21  VAL A O     1 
ATOM   355  C CB    . VAL C 2 21 ? 31.091 19.896 -10.348 1.00 33.07 ? 21  VAL A CB    1 
ATOM   356  C CG1   . VAL C 2 21 ? 30.879 21.363 -9.999  1.00 31.25 ? 21  VAL A CG1   1 
ATOM   357  C CG2   . VAL C 2 21 ? 32.347 19.361 -9.696  1.00 33.89 ? 21  VAL A CG2   1 
ATOM   358  N N     . LEU C 2 22 ? 30.685 16.804 -9.561  1.00 31.67 ? 22  LEU A N     1 
ATOM   359  C CA    . LEU C 2 22 ? 30.877 15.405 -9.923  1.00 32.03 ? 22  LEU A CA    1 
ATOM   360  C C     . LEU C 2 22 ? 29.562 14.633 -9.942  1.00 32.04 ? 22  LEU A C     1 
ATOM   361  O O     . LEU C 2 22 ? 29.466 13.587 -10.575 1.00 30.32 ? 22  LEU A O     1 
ATOM   362  C CB    . LEU C 2 22 ? 31.867 14.736 -8.965  1.00 32.93 ? 22  LEU A CB    1 
ATOM   363  C CG    . LEU C 2 22 ? 33.320 15.156 -9.189  1.00 31.41 ? 22  LEU A CG    1 
ATOM   364  C CD1   . LEU C 2 22 ? 34.230 14.496 -8.160  1.00 34.05 ? 22  LEU A CD1   1 
ATOM   365  C CD2   . LEU C 2 22 ? 33.736 14.768 -10.602 1.00 33.39 ? 22  LEU A CD2   1 
ATOM   366  N N     . SER C 2 23 ? 28.544 15.157 -9.265  1.00 31.48 ? 23  SER A N     1 
ATOM   367  C CA    . SER C 2 23 ? 27.250 14.487 -9.235  1.00 32.70 ? 23  SER A CA    1 
ATOM   368  C C     . SER C 2 23 ? 26.434 14.800 -10.485 1.00 31.92 ? 23  SER A C     1 
ATOM   369  O O     . SER C 2 23 ? 25.392 14.198 -10.718 1.00 32.39 ? 23  SER A O     1 
ATOM   370  C CB    . SER C 2 23 ? 26.457 14.898 -7.986  1.00 32.18 ? 23  SER A CB    1 
ATOM   371  O OG    . SER C 2 23 ? 26.022 16.243 -8.068  1.00 34.17 ? 23  SER A OG    1 
ATOM   372  N N     . LEU C 2 24 ? 26.913 15.740 -11.291 1.00 31.97 ? 24  LEU A N     1 
ATOM   373  C CA    . LEU C 2 24 ? 26.211 16.127 -12.514 1.00 31.87 ? 24  LEU A CA    1 
ATOM   374  C C     . LEU C 2 24 ? 26.345 15.071 -13.601 1.00 32.62 ? 24  LEU A C     1 
ATOM   375  O O     . LEU C 2 24 ? 27.317 14.317 -13.633 1.00 31.66 ? 24  LEU A O     1 
ATOM   376  C CB    . LEU C 2 24 ? 26.773 17.441 -13.069 1.00 32.10 ? 24  LEU A CB    1 
ATOM   377  C CG    . LEU C 2 24 ? 26.704 18.733 -12.254 1.00 31.14 ? 24  LEU A CG    1 
ATOM   378  C CD1   . LEU C 2 24 ? 27.633 19.763 -12.875 1.00 31.93 ? 24  LEU A CD1   1 
ATOM   379  C CD2   . LEU C 2 24 ? 25.285 19.252 -12.212 1.00 30.23 ? 24  LEU A CD2   1 
ATOM   380  N N     . ASN C 2 25 ? 25.362 15.016 -14.491 1.00 32.87 ? 25  ASN A N     1 
ATOM   381  C CA    . ASN C 2 25 ? 25.427 14.088 -15.605 1.00 33.84 ? 25  ASN A CA    1 
ATOM   382  C C     . ASN C 2 25 ? 26.289 14.802 -16.633 1.00 34.67 ? 25  ASN A C     1 
ATOM   383  O O     . ASN C 2 25 ? 26.228 16.027 -16.758 1.00 33.72 ? 25  ASN A O     1 
ATOM   384  C CB    . ASN C 2 25 ? 24.040 13.826 -16.185 1.00 35.17 ? 25  ASN A CB    1 
ATOM   385  C CG    . ASN C 2 25 ? 23.111 13.167 -15.190 1.00 35.51 ? 25  ASN A CG    1 
ATOM   386  O OD1   . ASN C 2 25 ? 23.475 12.187 -14.542 1.00 36.37 ? 25  ASN A OD1   1 
ATOM   387  N ND2   . ASN C 2 25 ? 21.901 13.698 -15.068 1.00 35.91 ? 25  ASN A ND2   1 
ATOM   388  N N     . THR C 2 26 ? 27.097 14.045 -17.360 1.00 35.90 ? 26  THR A N     1 
ATOM   389  C CA    . THR C 2 26 ? 27.978 14.621 -18.367 1.00 36.89 ? 26  THR A CA    1 
ATOM   390  C C     . THR C 2 26 ? 27.263 15.666 -19.213 1.00 37.51 ? 26  THR A C     1 
ATOM   391  O O     . THR C 2 26 ? 27.832 16.702 -19.560 1.00 38.29 ? 26  THR A O     1 
ATOM   392  C CB    . THR C 2 26 ? 28.531 13.522 -19.304 1.00 37.71 ? 26  THR A CB    1 
ATOM   393  O OG1   . THR C 2 26 ? 29.373 12.637 -18.556 1.00 38.88 ? 26  THR A OG1   1 
ATOM   394  C CG2   . THR C 2 26 ? 29.326 14.137 -20.444 1.00 38.30 ? 26  THR A CG2   1 
ATOM   395  N N     . ASN C 2 27 ? 26.004 15.391 -19.524 1.00 38.36 ? 27  ASN A N     1 
ATOM   396  C CA    . ASN C 2 27 ? 25.213 16.276 -20.364 1.00 40.08 ? 27  ASN A CA    1 
ATOM   397  C C     . ASN C 2 27 ? 24.627 17.500 -19.666 1.00 39.11 ? 27  ASN A C     1 
ATOM   398  O O     . ASN C 2 27 ? 24.149 18.418 -20.327 1.00 40.82 ? 27  ASN A O     1 
ATOM   399  C CB    . ASN C 2 27 ? 24.087 15.471 -21.017 1.00 41.74 ? 27  ASN A CB    1 
ATOM   400  C CG    . ASN C 2 27 ? 23.324 16.272 -22.045 1.00 45.79 ? 27  ASN A CG    1 
ATOM   401  O OD1   . ASN C 2 27 ? 23.919 16.935 -22.899 1.00 47.49 ? 27  ASN A OD1   1 
ATOM   402  N ND2   . ASN C 2 27 ? 21.999 16.210 -21.980 1.00 47.33 ? 27  ASN A ND2   1 
ATOM   403  N N     . ASP C 2 28 ? 24.675 17.528 -18.341 1.00 38.47 ? 28  ASP A N     1 
ATOM   404  C CA    . ASP C 2 28 ? 24.107 18.645 -17.603 1.00 36.72 ? 28  ASP A CA    1 
ATOM   405  C C     . ASP C 2 28 ? 25.150 19.680 -17.194 1.00 34.89 ? 28  ASP A C     1 
ATOM   406  O O     . ASP C 2 28 ? 26.348 19.430 -17.280 1.00 33.98 ? 28  ASP A O     1 
ATOM   407  C CB    . ASP C 2 28 ? 23.370 18.119 -16.370 1.00 39.06 ? 28  ASP A CB    1 
ATOM   408  C CG    . ASP C 2 28 ? 22.513 19.181 -15.711 1.00 43.51 ? 28  ASP A CG    1 
ATOM   409  O OD1   . ASP C 2 28 ? 21.924 20.003 -16.449 1.00 44.25 ? 28  ASP A OD1   1 
ATOM   410  O OD2   . ASP C 2 28 ? 22.418 19.191 -14.463 1.00 46.82 ? 28  ASP A OD2   1 
ATOM   411  N N     . TYR C 2 29 ? 24.684 20.850 -16.767 1.00 31.96 ? 29  TYR A N     1 
ATOM   412  C CA    . TYR C 2 29 ? 25.575 21.923 -16.328 1.00 29.52 ? 29  TYR A CA    1 
ATOM   413  C C     . TYR C 2 29 ? 24.924 22.702 -15.201 1.00 27.12 ? 29  TYR A C     1 
ATOM   414  O O     . TYR C 2 29 ? 23.719 22.591 -14.979 1.00 27.69 ? 29  TYR A O     1 
ATOM   415  C CB    . TYR C 2 29 ? 25.911 22.870 -17.492 1.00 27.71 ? 29  TYR A CB    1 
ATOM   416  C CG    . TYR C 2 29 ? 24.734 23.623 -18.089 1.00 28.71 ? 29  TYR A CG    1 
ATOM   417  C CD1   . TYR C 2 29 ? 24.228 24.778 -17.480 1.00 29.92 ? 29  TYR A CD1   1 
ATOM   418  C CD2   . TYR C 2 29 ? 24.132 23.188 -19.272 1.00 29.69 ? 29  TYR A CD2   1 
ATOM   419  C CE1   . TYR C 2 29 ? 23.154 25.480 -18.040 1.00 28.57 ? 29  TYR A CE1   1 
ATOM   420  C CE2   . TYR C 2 29 ? 23.057 23.881 -19.837 1.00 30.59 ? 29  TYR A CE2   1 
ATOM   421  C CZ    . TYR C 2 29 ? 22.577 25.023 -19.216 1.00 31.16 ? 29  TYR A CZ    1 
ATOM   422  O OH    . TYR C 2 29 ? 21.528 25.708 -19.779 1.00 31.97 ? 29  TYR A OH    1 
ATOM   423  N N     . THR C 2 30 ? 25.720 23.476 -14.478 1.00 25.43 ? 30  THR A N     1 
ATOM   424  C CA    . THR C 2 30 ? 25.179 24.281 -13.389 1.00 24.30 ? 30  THR A CA    1 
ATOM   425  C C     . THR C 2 30 ? 25.816 25.667 -13.444 1.00 24.58 ? 30  THR A C     1 
ATOM   426  O O     . THR C 2 30 ? 26.595 25.952 -14.355 1.00 24.46 ? 30  THR A O     1 
ATOM   427  C CB    . THR C 2 30 ? 25.430 23.604 -12.005 1.00 23.28 ? 30  THR A CB    1 
ATOM   428  O OG1   . THR C 2 30 ? 24.688 24.294 -10.991 1.00 23.06 ? 30  THR A OG1   1 
ATOM   429  C CG2   . THR C 2 30 ? 26.897 23.623 -11.647 1.00 22.95 ? 30  THR A CG2   1 
ATOM   430  N N     . THR C 2 31 ? 25.471 26.531 -12.494 1.00 23.50 ? 31  THR A N     1 
ATOM   431  C CA    . THR C 2 31 ? 26.018 27.887 -12.454 1.00 24.66 ? 31  THR A CA    1 
ATOM   432  C C     . THR C 2 31 ? 26.433 28.212 -11.033 1.00 24.09 ? 31  THR A C     1 
ATOM   433  O O     . THR C 2 31 ? 26.082 27.496 -10.095 1.00 23.70 ? 31  THR A O     1 
ATOM   434  C CB    . THR C 2 31 ? 24.982 28.935 -12.894 1.00 25.41 ? 31  THR A CB    1 
ATOM   435  O OG1   . THR C 2 31 ? 23.909 28.979 -11.943 1.00 27.46 ? 31  THR A OG1   1 
ATOM   436  C CG2   . THR C 2 31 ? 24.420 28.588 -14.266 1.00 26.87 ? 31  THR A CG2   1 
ATOM   437  N N     . ALA C 2 32 ? 27.178 29.296 -10.870 1.00 23.78 ? 32  ALA A N     1 
ATOM   438  C CA    . ALA C 2 32 ? 27.627 29.686 -9.543  1.00 25.37 ? 32  ALA A CA    1 
ATOM   439  C C     . ALA C 2 32 ? 26.428 30.069 -8.684  1.00 27.12 ? 32  ALA A C     1 
ATOM   440  O O     . ALA C 2 32 ? 26.351 29.696 -7.511  1.00 25.85 ? 32  ALA A O     1 
ATOM   441  C CB    . ALA C 2 32 ? 28.597 30.854 -9.635  1.00 25.71 ? 32  ALA A CB    1 
ATOM   442  N N     . ILE C 2 33 ? 25.495 30.813 -9.271  1.00 27.28 ? 33  ILE A N     1 
ATOM   443  C CA    . ILE C 2 33 ? 24.314 31.243 -8.534  1.00 29.86 ? 33  ILE A CA    1 
ATOM   444  C C     . ILE C 2 33 ? 23.527 30.043 -8.008  1.00 30.37 ? 33  ILE A C     1 
ATOM   445  O O     . ILE C 2 33 ? 23.073 30.045 -6.863  1.00 30.81 ? 33  ILE A O     1 
ATOM   446  C CB    . ILE C 2 33 ? 23.390 32.123 -9.407  1.00 29.92 ? 33  ILE A CB    1 
ATOM   447  C CG1   . ILE C 2 33 ? 22.117 32.455 -8.634  1.00 31.31 ? 33  ILE A CG1   1 
ATOM   448  C CG2   . ILE C 2 33 ? 23.049 31.409 -10.696 1.00 29.75 ? 33  ILE A CG2   1 
ATOM   449  C CD1   . ILE C 2 33 ? 22.378 33.167 -7.312  1.00 33.87 ? 33  ILE A CD1   1 
ATOM   450  N N     . SER C 2 34 ? 23.366 29.018 -8.839  1.00 32.00 ? 34  SER A N     1 
ATOM   451  C CA    . SER C 2 34 ? 22.641 27.828 -8.411  1.00 33.05 ? 34  SER A CA    1 
ATOM   452  C C     . SER C 2 34 ? 23.387 27.134 -7.276  1.00 33.26 ? 34  SER A C     1 
ATOM   453  O O     . SER C 2 34 ? 22.796 26.788 -6.248  1.00 33.43 ? 34  SER A O     1 
ATOM   454  C CB    . SER C 2 34 ? 22.471 26.856 -9.574  1.00 34.73 ? 34  SER A CB    1 
ATOM   455  O OG    . SER C 2 34 ? 21.816 25.680 -9.136  1.00 37.57 ? 34  SER A OG    1 
ATOM   456  N N     . LEU C 2 35 ? 24.688 26.936 -7.462  1.00 32.43 ? 35  LEU A N     1 
ATOM   457  C CA    . LEU C 2 35 ? 25.505 26.288 -6.448  1.00 32.28 ? 35  LEU A CA    1 
ATOM   458  C C     . LEU C 2 35 ? 25.485 27.081 -5.151  1.00 32.28 ? 35  LEU A C     1 
ATOM   459  O O     . LEU C 2 35 ? 25.347 26.513 -4.067  1.00 31.60 ? 35  LEU A O     1 
ATOM   460  C CB    . LEU C 2 35 ? 26.943 26.136 -6.944  1.00 31.97 ? 35  LEU A CB    1 
ATOM   461  C CG    . LEU C 2 35 ? 27.150 25.068 -8.017  1.00 32.98 ? 35  LEU A CG    1 
ATOM   462  C CD1   . LEU C 2 35 ? 28.593 25.110 -8.508  1.00 20.04 ? 35  LEU A CD1   1 
ATOM   463  C CD2   . LEU C 2 35 ? 26.826 23.696 -7.436  1.00 20.04 ? 35  LEU A CD2   1 
ATOM   464  N N     . SER C 2 36 ? 25.631 28.396 -5.262  1.00 32.82 ? 36  SER A N     1 
ATOM   465  C CA    . SER C 2 36 ? 25.611 29.258 -4.087  1.00 35.22 ? 36  SER A CA    1 
ATOM   466  C C     . SER C 2 36 ? 24.296 29.072 -3.344  1.00 36.84 ? 36  SER A C     1 
ATOM   467  O O     . SER C 2 36 ? 24.251 29.087 -2.115  1.00 37.12 ? 36  SER A O     1 
ATOM   468  C CB    . SER C 2 36 ? 25.739 30.725 -4.499  1.00 34.82 ? 36  SER A CB    1 
ATOM   469  O OG    . SER C 2 36 ? 25.362 31.577 -3.431  1.00 36.15 ? 36  SER A OG    1 
ATOM   470  N N     . ASN C 2 37 ? 23.229 28.893 -4.112  1.00 38.70 ? 37  ASN A N     1 
ATOM   471  C CA    . ASN C 2 37 ? 21.895 28.718 -3.563  1.00 41.38 ? 37  ASN A CA    1 
ATOM   472  C C     . ASN C 2 37 ? 21.736 27.407 -2.789  1.00 42.97 ? 37  ASN A C     1 
ATOM   473  O O     . ASN C 2 37 ? 21.090 27.377 -1.739  1.00 44.21 ? 37  ASN A O     1 
ATOM   474  C CB    . ASN C 2 37 ? 20.877 28.799 -4.701  1.00 41.15 ? 37  ASN A CB    1 
ATOM   475  C CG    . ASN C 2 37 ? 19.448 28.768 -4.214  1.00 42.18 ? 37  ASN A CG    1 
ATOM   476  O OD1   . ASN C 2 37 ? 19.128 29.288 -3.150  1.00 20.04 ? 37  ASN A OD1   1 
ATOM   477  N ND2   . ASN C 2 37 ? 18.572 28.176 -5.006  1.00 20.04 ? 37  ASN A ND2   1 
ATOM   478  N N     . ARG C 2 38 ? 22.333 26.332 -3.297  1.00 44.22 ? 38  ARG A N     1 
ATOM   479  C CA    . ARG C 2 38 ? 22.235 25.029 -2.644  1.00 45.03 ? 38  ARG A CA    1 
ATOM   480  C C     . ARG C 2 38 ? 23.131 24.920 -1.420  1.00 44.13 ? 38  ARG A C     1 
ATOM   481  O O     . ARG C 2 38 ? 22.666 24.619 -0.322  1.00 43.92 ? 38  ARG A O     1 
ATOM   482  C CB    . ARG C 2 38 ? 22.598 23.905 -3.617  1.00 48.00 ? 38  ARG A CB    1 
ATOM   483  C CG    . ARG C 2 38 ? 21.722 23.814 -4.855  1.00 53.41 ? 38  ARG A CG    1 
ATOM   484  C CD    . ARG C 2 38 ? 21.991 22.507 -5.597  1.00 57.94 ? 38  ARG A CD    1 
ATOM   485  N NE    . ARG C 2 38 ? 21.601 22.560 -7.007  1.00 62.72 ? 38  ARG A NE    1 
ATOM   486  C CZ    . ARG C 2 38 ? 20.369 22.810 -7.445  1.00 64.72 ? 38  ARG A CZ    1 
ATOM   487  N NH1   . ARG C 2 38 ? 19.383 23.037 -6.585  1.00 66.02 ? 38  ARG A NH1   1 
ATOM   488  N NH2   . ARG C 2 38 ? 20.123 22.833 -8.749  1.00 65.26 ? 38  ARG A NH2   1 
ATOM   489  N N     . LEU C 2 39 ? 24.419 25.162 -1.616  1.00 42.66 ? 39  LEU A N     1 
ATOM   490  C CA    . LEU C 2 39 ? 25.384 25.066 -0.531  1.00 42.51 ? 39  LEU A CA    1 
ATOM   491  C C     . LEU C 2 39 ? 25.274 26.222 0.458   1.00 42.16 ? 39  LEU A C     1 
ATOM   492  O O     . LEU C 2 39 ? 26.046 26.302 1.411   1.00 41.25 ? 39  LEU A O     1 
ATOM   493  C CB    . LEU C 2 39 ? 26.805 25.000 -1.103  1.00 41.47 ? 39  LEU A CB    1 
ATOM   494  C CG    . LEU C 2 39 ? 27.144 23.803 -2.002  1.00 40.34 ? 39  LEU A CG    1 
ATOM   495  C CD1   . LEU C 2 39 ? 26.298 23.832 -3.255  1.00 40.54 ? 39  LEU A CD1   1 
ATOM   496  C CD2   . LEU C 2 39 ? 28.613 23.851 -2.377  1.00 40.72 ? 39  LEU A CD2   1 
ATOM   497  N N     . LYS C 2 40 ? 24.308 27.109 0.233   1.00 42.74 ? 40  LYS A N     1 
ATOM   498  C CA    . LYS C 2 40 ? 24.104 28.268 1.103   1.00 43.13 ? 40  LYS A CA    1 
ATOM   499  C C     . LYS C 2 40 ? 25.426 28.973 1.369   1.00 42.98 ? 40  LYS A C     1 
ATOM   500  O O     . LYS C 2 40 ? 25.766 29.275 2.512   1.00 42.80 ? 40  LYS A O     1 
ATOM   501  C CB    . LYS C 2 40 ? 23.477 27.834 2.429   1.00 42.91 ? 40  LYS A CB    1 
ATOM   502  C CG    . LYS C 2 40 ? 22.076 27.274 2.292   1.00 43.31 ? 40  LYS A CG    1 
ATOM   503  C CD    . LYS C 2 40 ? 21.093 28.351 1.872   1.00 44.50 ? 40  LYS A CD    1 
ATOM   504  C CE    . LYS C 2 40 ? 19.704 27.776 1.643   1.00 44.02 ? 40  LYS A CE    1 
ATOM   505  N NZ    . LYS C 2 40 ? 19.699 26.825 0.499   1.00 43.58 ? 40  LYS A NZ    1 
ATOM   506  N N     . ILE C 2 41 ? 26.171 29.225 0.300   1.00 42.63 ? 41  ILE A N     1 
ATOM   507  C CA    . ILE C 2 41 ? 27.464 29.890 0.398   1.00 41.42 ? 41  ILE A CA    1 
ATOM   508  C C     . ILE C 2 41 ? 27.492 31.083 -0.551  1.00 41.05 ? 41  ILE A C     1 
ATOM   509  O O     . ILE C 2 41 ? 26.795 31.091 -1.564  1.00 40.00 ? 41  ILE A O     1 
ATOM   510  C CB    . ILE C 2 41 ? 28.606 28.914 0.033   1.00 42.25 ? 41  ILE A CB    1 
ATOM   511  C CG1   . ILE C 2 41 ? 28.650 27.773 1.055   1.00 42.39 ? 41  ILE A CG1   1 
ATOM   512  C CG2   . ILE C 2 41 ? 29.937 29.652 -0.017  1.00 41.59 ? 41  ILE A CG2   1 
ATOM   513  C CD1   . ILE C 2 41 ? 29.709 26.723 0.770   1.00 43.12 ? 41  ILE A CD1   1 
ATOM   514  N N     . ASN C 2 42 ? 28.288 32.094 -0.218  1.00 40.52 ? 42  ASN A N     1 
ATOM   515  C CA    . ASN C 2 42 ? 28.393 33.282 -1.059  1.00 39.46 ? 42  ASN A CA    1 
ATOM   516  C C     . ASN C 2 42 ? 28.869 32.911 -2.460  1.00 37.07 ? 42  ASN A C     1 
ATOM   517  O O     . ASN C 2 42 ? 29.778 32.096 -2.622  1.00 33.78 ? 42  ASN A O     1 
ATOM   518  C CB    . ASN C 2 42 ? 29.358 34.292 -0.430  1.00 42.59 ? 42  ASN A CB    1 
ATOM   519  C CG    . ASN C 2 42 ? 28.823 34.878 0.864   1.00 46.72 ? 42  ASN A CG    1 
ATOM   520  O OD1   . ASN C 2 42 ? 29.515 35.627 1.558   1.00 49.29 ? 42  ASN A OD1   1 
ATOM   521  N ND2   . ASN C 2 42 ? 27.577 34.541 1.195   1.00 48.27 ? 42  ASN A ND2   1 
ATOM   522  N N     . LYS C 2 43 ? 28.246 33.514 -3.470  1.00 35.88 ? 43  LYS A N     1 
ATOM   523  C CA    . LYS C 2 43 ? 28.608 33.244 -4.855  1.00 33.16 ? 43  LYS A CA    1 
ATOM   524  C C     . LYS C 2 43 ? 30.099 33.496 -5.079  1.00 32.61 ? 43  LYS A C     1 
ATOM   525  O O     . LYS C 2 43 ? 30.746 32.782 -5.847  1.00 31.10 ? 43  LYS A O     1 
ATOM   526  C CB    . LYS C 2 43 ? 27.764 34.108 -5.799  1.00 33.05 ? 43  LYS A CB    1 
ATOM   527  C CG    . LYS C 2 43 ? 27.872 33.720 -7.272  1.00 34.93 ? 43  LYS A CG    1 
ATOM   528  C CD    . LYS C 2 43 ? 26.842 34.448 -8.140  1.00 36.69 ? 43  LYS A CD    1 
ATOM   529  C CE    . LYS C 2 43 ? 27.068 35.956 -8.159  1.00 37.51 ? 43  LYS A CE    1 
ATOM   530  N NZ    . LYS C 2 43 ? 28.391 36.319 -8.742  1.00 42.22 ? 43  LYS A NZ    1 
ATOM   531  N N     . LYS C 2 44 ? 30.651 34.500 -4.402  1.00 30.74 ? 44  LYS A N     1 
ATOM   532  C CA    . LYS C 2 44 ? 32.073 34.789 -4.554  1.00 31.20 ? 44  LYS A CA    1 
ATOM   533  C C     . LYS C 2 44 ? 32.910 33.587 -4.108  1.00 30.35 ? 44  LYS A C     1 
ATOM   534  O O     . LYS C 2 44 ? 33.888 33.221 -4.768  1.00 30.17 ? 44  LYS A O     1 
ATOM   535  C CB    . LYS C 2 44 ? 32.486 36.024 -3.743  1.00 30.77 ? 44  LYS A CB    1 
ATOM   536  C CG    . LYS C 2 44 ? 33.988 36.276 -3.793  1.00 32.25 ? 44  LYS A CG    1 
ATOM   537  C CD    . LYS C 2 44 ? 34.424 37.556 -3.073  1.00 32.74 ? 44  LYS A CD    1 
ATOM   538  C CE    . LYS C 2 44 ? 35.934 37.728 -3.197  1.00 32.01 ? 44  LYS A CE    1 
ATOM   539  N NZ    . LYS C 2 44 ? 36.453 38.985 -2.600  1.00 30.94 ? 44  LYS A NZ    1 
ATOM   540  N N     . LYS C 2 45 ? 32.532 32.978 -2.988  1.00 28.37 ? 45  LYS A N     1 
ATOM   541  C CA    . LYS C 2 45 ? 33.263 31.813 -2.493  1.00 28.10 ? 45  LYS A CA    1 
ATOM   542  C C     . LYS C 2 45 ? 33.128 30.665 -3.491  1.00 24.76 ? 45  LYS A C     1 
ATOM   543  O O     . LYS C 2 45 ? 34.105 29.989 -3.803  1.00 23.97 ? 45  LYS A O     1 
ATOM   544  C CB    . LYS C 2 45 ? 32.729 31.368 -1.126  1.00 30.67 ? 45  LYS A CB    1 
ATOM   545  C CG    . LYS C 2 45 ? 33.105 32.276 0.042   1.00 35.53 ? 45  LYS A CG    1 
ATOM   546  C CD    . LYS C 2 45 ? 32.634 31.675 1.369   1.00 38.78 ? 45  LYS A CD    1 
ATOM   547  C CE    . LYS C 2 45 ? 33.005 32.549 2.563   1.00 41.39 ? 45  LYS A CE    1 
ATOM   548  N NZ    . LYS C 2 45 ? 34.481 32.712 2.701   1.00 43.95 ? 45  LYS A NZ    1 
ATOM   549  N N     . ILE C 2 46 ? 31.913 30.455 -3.987  1.00 22.26 ? 46  ILE A N     1 
ATOM   550  C CA    . ILE C 2 46 ? 31.649 29.396 -4.960  1.00 22.13 ? 46  ILE A CA    1 
ATOM   551  C C     . ILE C 2 46 ? 32.528 29.557 -6.208  1.00 21.18 ? 46  ILE A C     1 
ATOM   552  O O     . ILE C 2 46 ? 33.072 28.576 -6.719  1.00 19.62 ? 46  ILE A O     1 
ATOM   553  C CB    . ILE C 2 46 ? 30.164 29.396 -5.391  1.00 21.85 ? 46  ILE A CB    1 
ATOM   554  C CG1   . ILE C 2 46 ? 29.270 29.004 -4.213  1.00 23.41 ? 46  ILE A CG1   1 
ATOM   555  C CG2   . ILE C 2 46 ? 29.957 28.444 -6.560  1.00 19.94 ? 46  ILE A CG2   1 
ATOM   556  C CD1   . ILE C 2 46 ? 29.483 27.585 -3.714  1.00 25.57 ? 46  ILE A CD1   1 
ATOM   557  N N     . ASN C 2 47 ? 32.659 30.792 -6.694  1.00 21.92 ? 47  ASN A N     1 
ATOM   558  C CA    . ASN C 2 47 ? 33.476 31.076 -7.879  1.00 21.78 ? 47  ASN A CA    1 
ATOM   559  C C     . ASN C 2 47 ? 34.964 30.855 -7.625  1.00 21.33 ? 47  ASN A C     1 
ATOM   560  O O     . ASN C 2 47 ? 35.677 30.330 -8.478  1.00 20.82 ? 47  ASN A O     1 
ATOM   561  C CB    . ASN C 2 47 ? 33.264 32.518 -8.362  1.00 21.20 ? 47  ASN A CB    1 
ATOM   562  C CG    . ASN C 2 47 ? 32.087 32.653 -9.309  1.00 19.62 ? 47  ASN A CG    1 
ATOM   563  O OD1   . ASN C 2 47 ? 31.816 31.759 -10.117 1.00 16.05 ? 47  ASN A OD1   1 
ATOM   564  N ND2   . ASN C 2 47 ? 31.391 33.784 -9.233  1.00 19.94 ? 47  ASN A ND2   1 
ATOM   565  N N     . GLN C 2 48 ? 35.439 31.270 -6.458  1.00 22.30 ? 48  GLN A N     1 
ATOM   566  C CA    . GLN C 2 48 ? 36.846 31.084 -6.134  1.00 22.90 ? 48  GLN A CA    1 
ATOM   567  C C     . GLN C 2 48 ? 37.224 29.609 -6.273  1.00 24.02 ? 48  GLN A C     1 
ATOM   568  O O     . GLN C 2 48 ? 38.319 29.285 -6.721  1.00 22.56 ? 48  GLN A O     1 
ATOM   569  C CB    . GLN C 2 48 ? 37.137 31.561 -4.706  1.00 24.67 ? 48  GLN A CB    1 
ATOM   570  C CG    . GLN C 2 48 ? 37.088 33.072 -4.529  1.00 26.45 ? 48  GLN A CG    1 
ATOM   571  C CD    . GLN C 2 48 ? 37.339 33.484 -3.092  1.00 30.20 ? 48  GLN A CD    1 
ATOM   572  O OE1   . GLN C 2 48 ? 36.672 33.005 -2.179  1.00 29.23 ? 48  GLN A OE1   1 
ATOM   573  N NE2   . GLN C 2 48 ? 38.305 34.376 -2.885  1.00 28.38 ? 48  GLN A NE2   1 
ATOM   574  N N     . GLN C 2 49 ? 36.311 28.720 -5.893  1.00 21.87 ? 49  GLN A N     1 
ATOM   575  C CA    . GLN C 2 49 ? 36.571 27.288 -5.986  1.00 24.16 ? 49  GLN A CA    1 
ATOM   576  C C     . GLN C 2 49 ? 36.345 26.723 -7.392  1.00 23.73 ? 49  GLN A C     1 
ATOM   577  O O     . GLN C 2 49 ? 37.109 25.872 -7.857  1.00 25.75 ? 49  GLN A O     1 
ATOM   578  C CB    . GLN C 2 49 ? 35.711 26.532 -4.972  1.00 25.74 ? 49  GLN A CB    1 
ATOM   579  C CG    . GLN C 2 49 ? 35.974 26.953 -3.532  1.00 30.07 ? 49  GLN A CG    1 
ATOM   580  C CD    . GLN C 2 49 ? 37.459 27.149 -3.243  1.00 31.49 ? 49  GLN A CD    1 
ATOM   581  O OE1   . GLN C 2 49 ? 38.279 26.270 -3.503  1.00 33.65 ? 49  GLN A OE1   1 
ATOM   582  N NE2   . GLN C 2 49 ? 37.807 28.311 -2.701  1.00 34.47 ? 49  GLN A NE2   1 
ATOM   583  N N     . LEU C 2 50 ? 35.302 27.196 -8.068  1.00 21.55 ? 50  LEU A N     1 
ATOM   584  C CA    . LEU C 2 50 ? 35.006 26.729 -9.416  1.00 21.30 ? 50  LEU A CA    1 
ATOM   585  C C     . LEU C 2 50 ? 36.173 26.960 -10.367 1.00 20.29 ? 50  LEU A C     1 
ATOM   586  O O     . LEU C 2 50 ? 36.520 26.078 -11.147 1.00 21.37 ? 50  LEU A O     1 
ATOM   587  C CB    . LEU C 2 50 ? 33.755 27.416 -9.962  1.00 16.72 ? 50  LEU A CB    1 
ATOM   588  C CG    . LEU C 2 50 ? 32.412 26.880 -9.474  1.00 18.97 ? 50  LEU A CG    1 
ATOM   589  C CD1   . LEU C 2 50 ? 31.293 27.785 -9.971  1.00 18.99 ? 50  LEU A CD1   1 
ATOM   590  C CD2   . LEU C 2 50 ? 32.210 25.459 -9.977  1.00 17.09 ? 50  LEU A CD2   1 
ATOM   591  N N     . TYR C 2 51 ? 36.788 28.137 -10.305 1.00 20.56 ? 51  TYR A N     1 
ATOM   592  C CA    . TYR C 2 51 ? 37.915 28.405 -11.191 1.00 21.64 ? 51  TYR A CA    1 
ATOM   593  C C     . TYR C 2 51 ? 39.153 27.607 -10.794 1.00 23.15 ? 51  TYR A C     1 
ATOM   594  O O     . TYR C 2 51 ? 39.946 27.235 -11.650 1.00 24.28 ? 51  TYR A O     1 
ATOM   595  C CB    . TYR C 2 51 ? 38.218 29.908 -11.254 1.00 18.82 ? 51  TYR A CB    1 
ATOM   596  C CG    . TYR C 2 51 ? 37.193 30.656 -12.079 1.00 16.77 ? 51  TYR A CG    1 
ATOM   597  C CD1   . TYR C 2 51 ? 36.101 31.288 -11.482 1.00 14.21 ? 51  TYR A CD1   1 
ATOM   598  C CD2   . TYR C 2 51 ? 37.284 30.673 -13.466 1.00 16.88 ? 51  TYR A CD2   1 
ATOM   599  C CE1   . TYR C 2 51 ? 35.117 31.921 -12.263 1.00 12.58 ? 51  TYR A CE1   1 
ATOM   600  C CE2   . TYR C 2 51 ? 36.317 31.294 -14.254 1.00 17.25 ? 51  TYR A CE2   1 
ATOM   601  C CZ    . TYR C 2 51 ? 35.238 31.915 -13.653 1.00 18.30 ? 51  TYR A CZ    1 
ATOM   602  O OH    . TYR C 2 51 ? 34.282 32.509 -14.452 1.00 15.42 ? 51  TYR A OH    1 
ATOM   603  N N     . LYS C 2 52 ? 39.313 27.338 -9.503  1.00 26.84 ? 52  LYS A N     1 
ATOM   604  C CA    . LYS C 2 52 ? 40.448 26.539 -9.034  1.00 28.83 ? 52  LYS A CA    1 
ATOM   605  C C     . LYS C 2 52 ? 40.223 25.101 -9.511  1.00 28.77 ? 52  LYS A C     1 
ATOM   606  O O     . LYS C 2 52 ? 41.148 24.413 -9.943  1.00 29.34 ? 52  LYS A O     1 
ATOM   607  C CB    . LYS C 2 52 ? 40.534 26.565 -7.504  1.00 31.10 ? 52  LYS A CB    1 
ATOM   608  C CG    . LYS C 2 52 ? 40.951 27.901 -6.895  1.00 37.01 ? 52  LYS A CG    1 
ATOM   609  C CD    . LYS C 2 52 ? 40.754 27.887 -5.371  1.00 20.04 ? 52  LYS A CD    1 
ATOM   610  C CE    . LYS C 2 52 ? 41.165 29.195 -4.706  1.00 20.04 ? 52  LYS A CE    1 
ATOM   611  N NZ    . LYS C 2 52 ? 42.643 29.385 -4.706  1.00 20.04 ? 52  LYS A NZ    1 
ATOM   612  N N     . LEU C 2 53 ? 38.974 24.662 -9.445  1.00 28.74 ? 53  LEU A N     1 
ATOM   613  C CA    . LEU C 2 53 ? 38.613 23.322 -9.863  1.00 28.29 ? 53  LEU A CA    1 
ATOM   614  C C     . LEU C 2 53 ? 38.819 23.150 -11.370 1.00 28.52 ? 53  LEU A C     1 
ATOM   615  O O     . LEU C 2 53 ? 39.170 22.063 -11.836 1.00 28.25 ? 53  LEU A O     1 
ATOM   616  C CB    . LEU C 2 53 ? 37.160 23.049 -9.488  1.00 30.47 ? 53  LEU A CB    1 
ATOM   617  C CG    . LEU C 2 53 ? 36.651 21.613 -9.558  1.00 33.01 ? 53  LEU A CG    1 
ATOM   618  C CD1   . LEU C 2 53 ? 37.449 20.716 -8.606  1.00 32.97 ? 53  LEU A CD1   1 
ATOM   619  C CD2   . LEU C 2 53 ? 35.173 21.607 -9.183  1.00 35.70 ? 53  LEU A CD2   1 
ATOM   620  N N     . GLN C 2 54 ? 38.611 24.218 -12.139 1.00 26.73 ? 54  GLN A N     1 
ATOM   621  C CA    . GLN C 2 54 ? 38.806 24.118 -13.583 1.00 27.00 ? 54  GLN A CA    1 
ATOM   622  C C     . GLN C 2 54 ? 40.288 23.915 -13.865 1.00 26.58 ? 54  GLN A C     1 
ATOM   623  O O     . GLN C 2 54 ? 40.659 23.228 -14.814 1.00 26.28 ? 54  GLN A O     1 
ATOM   624  C CB    . GLN C 2 54 ? 38.303 25.371 -14.311 1.00 26.59 ? 54  GLN A CB    1 
ATOM   625  C CG    . GLN C 2 54 ? 38.528 25.309 -15.816 1.00 25.04 ? 54  GLN A CG    1 
ATOM   626  C CD    . GLN C 2 54 ? 37.878 26.448 -16.569 1.00 28.16 ? 54  GLN A CD    1 
ATOM   627  O OE1   . GLN C 2 54 ? 38.073 27.621 -16.239 1.00 28.63 ? 54  GLN A OE1   1 
ATOM   628  N NE2   . GLN C 2 54 ? 37.107 26.111 -17.601 1.00 25.51 ? 54  GLN A NE2   1 
ATOM   629  N N     . LYS C 2 55 ? 41.134 24.515 -13.033 1.00 27.69 ? 55  LYS A N     1 
ATOM   630  C CA    . LYS C 2 55 ? 42.573 24.372 -13.200 1.00 29.50 ? 55  LYS A CA    1 
ATOM   631  C C     . LYS C 2 55 ? 42.972 22.915 -13.006 1.00 30.49 ? 55  LYS A C     1 
ATOM   632  O O     . LYS C 2 55 ? 43.974 22.459 -13.559 1.00 32.02 ? 55  LYS A O     1 
ATOM   633  C CB    . LYS C 2 55 ? 43.316 25.263 -12.207 1.00 32.57 ? 55  LYS A CB    1 
ATOM   634  C CG    . LYS C 2 55 ? 43.166 26.746 -12.518 1.00 35.77 ? 55  LYS A CG    1 
ATOM   635  C CD    . LYS C 2 55 ? 43.995 27.617 -11.587 1.00 39.48 ? 55  LYS A CD    1 
ATOM   636  C CE    . LYS C 2 55 ? 43.942 29.074 -12.033 1.00 41.69 ? 55  LYS A CE    1 
ATOM   637  N NZ    . LYS C 2 55 ? 44.744 29.971 -11.151 1.00 44.72 ? 55  LYS A NZ    1 
ATOM   638  N N     . GLU C 2 56 ? 42.180 22.179 -12.235 1.00 27.86 ? 56  GLU A N     1 
ATOM   639  C CA    . GLU C 2 56 ? 42.466 20.772 -11.996 1.00 29.11 ? 56  GLU A CA    1 
ATOM   640  C C     . GLU C 2 56 ? 41.726 19.872 -12.986 1.00 28.73 ? 56  GLU A C     1 
ATOM   641  O O     . GLU C 2 56 ? 41.749 18.648 -12.862 1.00 28.95 ? 56  GLU A O     1 
ATOM   642  C CB    . GLU C 2 56 ? 42.100 20.394 -10.560 1.00 29.97 ? 56  GLU A CB    1 
ATOM   643  C CG    . GLU C 2 56 ? 42.840 21.208 -9.520  1.00 34.10 ? 56  GLU A CG    1 
ATOM   644  C CD    . GLU C 2 56 ? 42.546 20.754 -8.107  1.00 36.47 ? 56  GLU A CD    1 
ATOM   645  O OE1   . GLU C 2 56 ? 43.083 21.368 -7.164  1.00 37.37 ? 56  GLU A OE1   1 
ATOM   646  O OE2   . GLU C 2 56 ? 41.782 19.781 -7.938  1.00 37.40 ? 56  GLU A OE2   1 
ATOM   647  N N     . ASP C 2 57 ? 41.070 20.493 -13.966 1.00 27.76 ? 57  ASP A N     1 
ATOM   648  C CA    . ASP C 2 57 ? 40.342 19.774 -15.005 1.00 27.32 ? 57  ASP A CA    1 
ATOM   649  C C     . ASP C 2 57 ? 39.120 18.967 -14.577 1.00 27.00 ? 57  ASP A C     1 
ATOM   650  O O     . ASP C 2 57 ? 38.628 18.134 -15.341 1.00 29.55 ? 57  ASP A O     1 
ATOM   651  C CB    . ASP C 2 57 ? 41.301 18.855 -15.757 1.00 29.74 ? 57  ASP A CB    1 
ATOM   652  C CG    . ASP C 2 57 ? 42.477 19.605 -16.339 1.00 31.33 ? 57  ASP A CG    1 
ATOM   653  O OD1   . ASP C 2 57 ? 42.252 20.647 -16.994 1.00 31.96 ? 57  ASP A OD1   1 
ATOM   654  O OD2   . ASP C 2 57 ? 43.623 19.151 -16.147 1.00 35.34 ? 57  ASP A OD2   1 
ATOM   655  N N     . THR C 2 58 ? 38.620 19.206 -13.372 1.00 23.78 ? 58  THR A N     1 
ATOM   656  C CA    . THR C 2 58 ? 37.446 18.482 -12.897 1.00 23.76 ? 58  THR A CA    1 
ATOM   657  C C     . THR C 2 58 ? 36.180 19.093 -13.498 1.00 22.45 ? 58  THR A C     1 
ATOM   658  O O     . THR C 2 58 ? 35.188 18.402 -13.726 1.00 21.87 ? 58  THR A O     1 
ATOM   659  C CB    . THR C 2 58 ? 37.345 18.542 -11.363 1.00 24.89 ? 58  THR A CB    1 
ATOM   660  O OG1   . THR C 2 58 ? 38.532 17.985 -10.793 1.00 24.03 ? 58  THR A OG1   1 
ATOM   661  C CG2   . THR C 2 58 ? 36.133 17.768 -10.872 1.00 24.22 ? 58  THR A CG2   1 
ATOM   662  N N     . VAL C 2 59 ? 36.229 20.395 -13.760 1.00 20.52 ? 59  VAL A N     1 
ATOM   663  C CA    . VAL C 2 59 ? 35.086 21.103 -14.323 1.00 20.53 ? 59  VAL A CA    1 
ATOM   664  C C     . VAL C 2 59 ? 35.528 21.954 -15.513 1.00 19.00 ? 59  VAL A C     1 
ATOM   665  O O     . VAL C 2 59 ? 36.698 22.310 -15.631 1.00 17.77 ? 59  VAL A O     1 
ATOM   666  C CB    . VAL C 2 59 ? 34.436 22.020 -13.254 1.00 22.20 ? 59  VAL A CB    1 
ATOM   667  C CG1   . VAL C 2 59 ? 35.381 23.176 -12.923 1.00 19.75 ? 59  VAL A CG1   1 
ATOM   668  C CG2   . VAL C 2 59 ? 33.090 22.538 -13.744 1.00 22.16 ? 59  VAL A CG2   1 
ATOM   669  N N     . LYS C 2 60 ? 34.588 22.270 -16.394 1.00 20.22 ? 60  LYS A N     1 
ATOM   670  C CA    . LYS C 2 60 ? 34.868 23.077 -17.574 1.00 22.13 ? 60  LYS A CA    1 
ATOM   671  C C     . LYS C 2 60 ? 33.858 24.219 -17.632 1.00 22.14 ? 60  LYS A C     1 
ATOM   672  O O     . LYS C 2 60 ? 32.647 23.994 -17.534 1.00 21.44 ? 60  LYS A O     1 
ATOM   673  C CB    . LYS C 2 60 ? 34.774 22.208 -18.838 1.00 25.28 ? 60  LYS A CB    1 
ATOM   674  C CG    . LYS C 2 60 ? 34.666 22.983 -20.156 1.00 25.88 ? 60  LYS A CG    1 
ATOM   675  C CD    . LYS C 2 60 ? 35.917 23.784 -20.454 1.00 26.33 ? 60  LYS A CD    1 
ATOM   676  C CE    . LYS C 2 60 ? 35.714 24.710 -21.655 1.00 26.43 ? 60  LYS A CE    1 
ATOM   677  N NZ    . LYS C 2 60 ? 36.942 25.502 -21.962 1.00 28.38 ? 60  LYS A NZ    1 
ATOM   678  N N     . MET C 2 61 ? 34.360 25.440 -17.784 1.00 22.40 ? 61  MET A N     1 
ATOM   679  C CA    . MET C 2 61 ? 33.505 26.628 -17.834 1.00 25.01 ? 61  MET A CA    1 
ATOM   680  C C     . MET C 2 61 ? 33.237 27.072 -19.264 1.00 26.45 ? 61  MET A C     1 
ATOM   681  O O     . MET C 2 61 ? 34.128 27.018 -20.108 1.00 26.25 ? 61  MET A O     1 
ATOM   682  C CB    . MET C 2 61 ? 34.168 27.780 -17.060 1.00 24.18 ? 61  MET A CB    1 
ATOM   683  C CG    . MET C 2 61 ? 33.363 29.072 -16.976 1.00 25.79 ? 61  MET A CG    1 
ATOM   684  S SD    . MET C 2 61 ? 33.451 30.140 -18.447 1.00 26.41 ? 61  MET A SD    1 
ATOM   685  C CE    . MET C 2 61 ? 34.912 31.066 -18.064 1.00 26.83 ? 61  MET A CE    1 
ATOM   686  N N     . VAL C 2 62 ? 32.009 27.507 -19.524 1.00 26.22 ? 62  VAL A N     1 
ATOM   687  C CA    . VAL C 2 62 ? 31.610 27.996 -20.841 1.00 27.87 ? 62  VAL A CA    1 
ATOM   688  C C     . VAL C 2 62 ? 31.152 29.437 -20.651 1.00 28.40 ? 62  VAL A C     1 
ATOM   689  O O     . VAL C 2 62 ? 30.129 29.688 -20.013 1.00 27.11 ? 62  VAL A O     1 
ATOM   690  C CB    . VAL C 2 62 ? 30.451 27.159 -21.428 1.00 27.72 ? 62  VAL A CB    1 
ATOM   691  C CG1   . VAL C 2 62 ? 29.834 27.877 -22.620 1.00 27.31 ? 62  VAL A CG1   1 
ATOM   692  C CG2   . VAL C 2 62 ? 30.972 25.792 -21.854 1.00 28.98 ? 62  VAL A CG2   1 
ATOM   693  N N     . PRO C 2 63 ? 31.912 30.400 -21.197 1.00 31.37 ? 63  PRO A N     1 
ATOM   694  C CA    . PRO C 2 63 ? 31.629 31.836 -21.105 1.00 33.21 ? 63  PRO A CA    1 
ATOM   695  C C     . PRO C 2 63 ? 30.263 32.278 -21.596 1.00 35.24 ? 63  PRO A C     1 
ATOM   696  O O     . PRO C 2 63 ? 30.137 33.007 -22.577 1.00 37.64 ? 63  PRO A O     1 
ATOM   697  C CB    . PRO C 2 63 ? 32.773 32.468 -21.898 1.00 32.44 ? 63  PRO A CB    1 
ATOM   698  C CG    . PRO C 2 63 ? 33.124 31.417 -22.881 1.00 32.83 ? 63  PRO A CG    1 
ATOM   699  C CD    . PRO C 2 63 ? 33.096 30.167 -22.040 1.00 31.55 ? 63  PRO A CD    1 
ATOM   700  N N     . SER C 2 64 ? 29.233 31.830 -20.899 1.00 35.45 ? 64  SER A N     1 
ATOM   701  C CA    . SER C 2 64 ? 27.887 32.206 -21.241 1.00 35.85 ? 64  SER A CA    1 
ATOM   702  C C     . SER C 2 64 ? 27.586 33.344 -20.265 1.00 35.84 ? 64  SER A C     1 
ATOM   703  O O     . SER C 2 64 ? 28.478 33.789 -19.529 1.00 37.62 ? 64  SER A O     1 
ATOM   704  C CB    . SER C 2 64 ? 26.949 31.020 -21.020 1.00 36.95 ? 64  SER A CB    1 
ATOM   705  O OG    . SER C 2 64 ? 25.707 31.235 -21.658 1.00 42.14 ? 64  SER A OG    1 
ATOM   706  N N     . ASN C 2 65 ? 26.353 33.825 -20.257 1.00 33.19 ? 65  ASN A N     1 
ATOM   707  C CA    . ASN C 2 65 ? 25.992 34.906 -19.352 1.00 29.92 ? 65  ASN A CA    1 
ATOM   708  C C     . ASN C 2 65 ? 24.852 34.456 -18.460 1.00 27.05 ? 65  ASN A C     1 
ATOM   709  O O     . ASN C 2 65 ? 23.683 34.529 -18.852 1.00 27.84 ? 65  ASN A O     1 
ATOM   710  C CB    . ASN C 2 65 ? 25.583 36.150 -20.148 1.00 32.43 ? 65  ASN A CB    1 
ATOM   711  C CG    . ASN C 2 65 ? 26.780 36.893 -20.720 1.00 35.14 ? 65  ASN A CG    1 
ATOM   712  O OD1   . ASN C 2 65 ? 27.537 37.544 -19.988 1.00 36.61 ? 65  ASN A OD1   1 
ATOM   713  N ND2   . ASN C 2 65 ? 26.968 36.787 -22.029 1.00 36.18 ? 65  ASN A ND2   1 
ATOM   714  N N     . PRO C 2 66 ? 25.175 33.972 -17.245 1.00 24.74 ? 66  PRO A N     1 
ATOM   715  C CA    . PRO C 2 66 ? 26.525 33.832 -16.684 1.00 23.67 ? 66  PRO A CA    1 
ATOM   716  C C     . PRO C 2 66 ? 27.228 32.546 -17.139 1.00 21.46 ? 66  PRO A C     1 
ATOM   717  O O     . PRO C 2 66 ? 26.656 31.734 -17.867 1.00 20.12 ? 66  PRO A O     1 
ATOM   718  C CB    . PRO C 2 66 ? 26.263 33.838 -15.182 1.00 22.38 ? 66  PRO A CB    1 
ATOM   719  C CG    . PRO C 2 66 ? 25.019 33.031 -15.092 1.00 22.00 ? 66  PRO A CG    1 
ATOM   720  C CD    . PRO C 2 66 ? 24.163 33.588 -16.243 1.00 23.62 ? 66  PRO A CD    1 
ATOM   721  N N     . PRO C 2 67 ? 28.482 32.345 -16.712 1.00 20.72 ? 67  PRO A N     1 
ATOM   722  C CA    . PRO C 2 67 ? 29.186 31.127 -17.129 1.00 19.85 ? 67  PRO A CA    1 
ATOM   723  C C     . PRO C 2 67 ? 28.494 29.846 -16.675 1.00 20.76 ? 67  PRO A C     1 
ATOM   724  O O     . PRO C 2 67 ? 27.932 29.782 -15.583 1.00 20.64 ? 67  PRO A O     1 
ATOM   725  C CB    . PRO C 2 67 ? 30.562 31.286 -16.489 1.00 18.65 ? 67  PRO A CB    1 
ATOM   726  C CG    . PRO C 2 67 ? 30.747 32.800 -16.474 1.00 20.85 ? 67  PRO A CG    1 
ATOM   727  C CD    . PRO C 2 67 ? 29.391 33.274 -16.015 1.00 19.38 ? 67  PRO A CD    1 
ATOM   728  N N     . LYS C 2 68 ? 28.531 28.832 -17.532 1.00 21.79 ? 68  LYS A N     1 
ATOM   729  C CA    . LYS C 2 68 ? 27.946 27.533 -17.224 1.00 22.57 ? 68  LYS A CA    1 
ATOM   730  C C     . LYS C 2 68 ? 29.101 26.596 -16.885 1.00 22.16 ? 68  LYS A C     1 
ATOM   731  O O     . LYS C 2 68 ? 30.165 26.662 -17.499 1.00 21.65 ? 68  LYS A O     1 
ATOM   732  C CB    . LYS C 2 68 ? 27.157 27.014 -18.428 1.00 27.07 ? 68  LYS A CB    1 
ATOM   733  C CG    . LYS C 2 68 ? 25.931 27.866 -18.735 1.00 31.68 ? 68  LYS A CG    1 
ATOM   734  C CD    . LYS C 2 68 ? 25.312 27.554 -20.098 1.00 35.55 ? 68  LYS A CD    1 
ATOM   735  C CE    . LYS C 2 68 ? 24.133 28.490 -20.372 1.00 37.69 ? 68  LYS A CE    1 
ATOM   736  N NZ    . LYS C 2 68 ? 23.657 28.485 -21.784 1.00 38.71 ? 68  LYS A NZ    1 
ATOM   737  N N     . TRP C 2 69 ? 28.898 25.737 -15.898 1.00 21.49 ? 69  TRP A N     1 
ATOM   738  C CA    . TRP C 2 69 ? 29.943 24.822 -15.477 1.00 19.47 ? 69  TRP A CA    1 
ATOM   739  C C     . TRP C 2 69 ? 29.569 23.357 -15.693 1.00 22.09 ? 69  TRP A C     1 
ATOM   740  O O     . TRP C 2 69 ? 28.545 22.881 -15.180 1.00 19.53 ? 69  TRP A O     1 
ATOM   741  C CB    . TRP C 2 69 ? 30.278 25.088 -14.006 1.00 18.44 ? 69  TRP A CB    1 
ATOM   742  C CG    . TRP C 2 69 ? 30.776 26.488 -13.776 1.00 17.11 ? 69  TRP A CG    1 
ATOM   743  C CD1   . TRP C 2 69 ? 30.021 27.619 -13.648 1.00 19.76 ? 69  TRP A CD1   1 
ATOM   744  C CD2   . TRP C 2 69 ? 32.145 26.910 -13.704 1.00 16.67 ? 69  TRP A CD2   1 
ATOM   745  N NE1   . TRP C 2 69 ? 30.836 28.722 -13.501 1.00 17.67 ? 69  TRP A NE1   1 
ATOM   746  C CE2   . TRP C 2 69 ? 32.144 28.313 -13.534 1.00 18.28 ? 69  TRP A CE2   1 
ATOM   747  C CE3   . TRP C 2 69 ? 33.373 26.238 -13.768 1.00 18.27 ? 69  TRP A CE3   1 
ATOM   748  C CZ2   . TRP C 2 69 ? 33.326 29.059 -13.429 1.00 17.23 ? 69  TRP A CZ2   1 
ATOM   749  C CZ3   . TRP C 2 69 ? 34.552 26.979 -13.661 1.00 18.10 ? 69  TRP A CZ3   1 
ATOM   750  C CH2   . TRP C 2 69 ? 34.517 28.374 -13.494 1.00 19.35 ? 69  TRP A CH2   1 
ATOM   751  N N     . PHE C 2 70 ? 30.409 22.665 -16.465 1.00 21.66 ? 70  PHE A N     1 
ATOM   752  C CA    . PHE C 2 70 ? 30.221 21.250 -16.800 1.00 24.20 ? 70  PHE A CA    1 
ATOM   753  C C     . PHE C 2 70 ? 31.257 20.359 -16.119 1.00 25.16 ? 70  PHE A C     1 
ATOM   754  O O     . PHE C 2 70 ? 32.401 20.770 -15.901 1.00 22.17 ? 70  PHE A O     1 
ATOM   755  C CB    . PHE C 2 70 ? 30.375 21.011 -18.311 1.00 24.43 ? 70  PHE A CB    1 
ATOM   756  C CG    . PHE C 2 70 ? 29.371 21.724 -19.161 1.00 27.65 ? 70  PHE A CG    1 
ATOM   757  C CD1   . PHE C 2 70 ? 29.449 23.101 -19.356 1.00 27.50 ? 70  PHE A CD1   1 
ATOM   758  C CD2   . PHE C 2 70 ? 28.356 21.012 -19.800 1.00 29.60 ? 70  PHE A CD2   1 
ATOM   759  C CE1   . PHE C 2 70 ? 28.532 23.761 -20.176 1.00 26.43 ? 70  PHE A CE1   1 
ATOM   760  C CE2   . PHE C 2 70 ? 27.432 21.666 -20.623 1.00 28.87 ? 70  PHE A CE2   1 
ATOM   761  C CZ    . PHE C 2 70 ? 27.524 23.042 -20.809 1.00 27.78 ? 70  PHE A CZ    1 
ATOM   762  N N     . LYS C 2 71 ? 30.857 19.133 -15.802 1.00 25.63 ? 71  LYS A N     1 
ATOM   763  C CA    . LYS C 2 71 ? 31.777 18.173 -15.209 1.00 28.63 ? 71  LYS A CA    1 
ATOM   764  C C     . LYS C 2 71 ? 32.664 17.717 -16.368 1.00 27.01 ? 71  LYS A C     1 
ATOM   765  O O     . LYS C 2 71 ? 32.180 17.566 -17.483 1.00 26.33 ? 71  LYS A O     1 
ATOM   766  C CB    . LYS C 2 71 ? 31.012 16.971 -14.650 1.00 29.98 ? 71  LYS A CB    1 
ATOM   767  C CG    . LYS C 2 71 ? 31.913 15.845 -14.168 1.00 33.76 ? 71  LYS A CG    1 
ATOM   768  C CD    . LYS C 2 71 ? 31.119 14.671 -13.597 1.00 35.56 ? 71  LYS A CD    1 
ATOM   769  C CE    . LYS C 2 71 ? 30.202 14.051 -14.641 1.00 36.88 ? 71  LYS A CE    1 
ATOM   770  N NZ    . LYS C 2 71 ? 29.480 12.862 -14.107 1.00 37.50 ? 71  LYS A NZ    1 
ATOM   771  N N     . ASN C 2 72 ? 33.953 17.519 -16.121 1.00 29.16 ? 72  ASN A N     1 
ATOM   772  C CA    . ASN C 2 72 ? 34.855 17.070 -17.182 1.00 30.15 ? 72  ASN A CA    1 
ATOM   773  C C     . ASN C 2 72 ? 34.277 15.761 -17.725 1.00 31.43 ? 72  ASN A C     1 
ATOM   774  O O     . ASN C 2 72 ? 34.055 14.829 -16.957 1.00 30.23 ? 72  ASN A O     1 
ATOM   775  C CB    . ASN C 2 72 ? 36.254 16.825 -16.611 1.00 32.09 ? 72  ASN A CB    1 
ATOM   776  C CG    . ASN C 2 72 ? 37.302 16.626 -17.691 1.00 32.18 ? 72  ASN A CG    1 
ATOM   777  O OD1   . ASN C 2 72 ? 38.184 17.466 -17.882 1.00 34.47 ? 72  ASN A OD1   1 
ATOM   778  N ND2   . ASN C 2 72 ? 37.205 15.515 -18.409 1.00 29.15 ? 72  ASN A ND2   1 
ATOM   779  N N     . TYR C 2 73 ? 34.027 15.687 -19.032 1.00 32.73 ? 73  TYR A N     1 
ATOM   780  C CA    . TYR C 2 73 ? 33.446 14.474 -19.607 1.00 35.91 ? 73  TYR A CA    1 
ATOM   781  C C     . TYR C 2 73 ? 34.297 13.210 -19.476 1.00 37.81 ? 73  TYR A C     1 
ATOM   782  O O     . TYR C 2 73 ? 33.793 12.105 -19.676 1.00 38.75 ? 73  TYR A O     1 
ATOM   783  C CB    . TYR C 2 73 ? 33.049 14.689 -21.076 1.00 35.90 ? 73  TYR A CB    1 
ATOM   784  C CG    . TYR C 2 73 ? 34.136 15.214 -21.980 1.00 36.65 ? 73  TYR A CG    1 
ATOM   785  C CD1   . TYR C 2 73 ? 35.307 14.496 -22.196 1.00 37.62 ? 73  TYR A CD1   1 
ATOM   786  C CD2   . TYR C 2 73 ? 33.986 16.436 -22.633 1.00 38.09 ? 73  TYR A CD2   1 
ATOM   787  C CE1   . TYR C 2 73 ? 36.303 14.984 -23.038 1.00 38.55 ? 73  TYR A CE1   1 
ATOM   788  C CE2   . TYR C 2 73 ? 34.969 16.932 -23.475 1.00 37.89 ? 73  TYR A CE2   1 
ATOM   789  C CZ    . TYR C 2 73 ? 36.126 16.208 -23.673 1.00 39.49 ? 73  TYR A CZ    1 
ATOM   790  O OH    . TYR C 2 73 ? 37.110 16.719 -24.489 1.00 40.94 ? 73  TYR A OH    1 
ATOM   791  N N     . ASN C 2 74 ? 35.576 13.366 -19.143 1.00 39.46 ? 74  ASN A N     1 
ATOM   792  C CA    . ASN C 2 74 ? 36.446 12.209 -18.961 1.00 40.90 ? 74  ASN A CA    1 
ATOM   793  C C     . ASN C 2 74 ? 36.013 11.485 -17.689 1.00 41.76 ? 74  ASN A C     1 
ATOM   794  O O     . ASN C 2 74 ? 36.430 10.357 -17.432 1.00 41.63 ? 74  ASN A O     1 
ATOM   795  C CB    . ASN C 2 74 ? 37.911 12.636 -18.839 1.00 42.61 ? 74  ASN A CB    1 
ATOM   796  C CG    . ASN C 2 74 ? 38.462 13.217 -20.133 1.00 45.03 ? 74  ASN A CG    1 
ATOM   797  O OD1   . ASN C 2 74 ? 38.233 12.676 -21.217 1.00 47.83 ? 74  ASN A OD1   1 
ATOM   798  N ND2   . ASN C 2 74 ? 39.203 14.314 -20.023 1.00 44.83 ? 74  ASN A ND2   1 
ATOM   799  N N     . CYS C 2 75 ? 35.181 12.153 -16.892 1.00 41.61 ? 75  CYS A N     1 
ATOM   800  C CA    . CYS C 2 75 ? 34.664 11.575 -15.656 1.00 42.58 ? 75  CYS A CA    1 
ATOM   801  C C     . CYS C 2 75 ? 33.463 10.704 -16.004 1.00 43.47 ? 75  CYS A C     1 
ATOM   802  O O     . CYS C 2 75 ? 32.369 10.973 -15.469 1.00 45.12 ? 75  CYS A O     1 
ATOM   803  C CB    . CYS C 2 75 ? 34.220 12.674 -14.683 1.00 42.17 ? 75  CYS A CB    1 
ATOM   804  S SG    . CYS C 2 75 ? 35.511 13.813 -14.135 1.00 41.52 ? 75  CYS A SG    1 
ATOM   805  O OXT   . CYS C 2 75 ? 33.625 9.767  -16.815 1.00 46.42 ? 75  CYS A OXT   1 
ATOM   806  N N     . CYS D 2 6  ? 38.421 59.501 10.890  1.00 37.04 ? 6   CYS B N     1 
ATOM   807  C CA    . CYS D 2 6  ? 39.777 58.914 11.130  1.00 38.61 ? 6   CYS B CA    1 
ATOM   808  C C     . CYS D 2 6  ? 40.392 58.284 9.880   1.00 37.84 ? 6   CYS B C     1 
ATOM   809  O O     . CYS D 2 6  ? 41.513 57.779 9.919   1.00 37.53 ? 6   CYS B O     1 
ATOM   810  C CB    . CYS D 2 6  ? 39.707 57.865 12.238  1.00 39.78 ? 6   CYS B CB    1 
ATOM   811  S SG    . CYS D 2 6  ? 39.034 58.495 13.782  1.00 42.69 ? 6   CYS B SG    1 
ATOM   812  N N     . THR D 2 7  ? 39.655 58.307 8.777   1.00 38.26 ? 7   THR B N     1 
ATOM   813  C CA    . THR D 2 7  ? 40.149 57.755 7.521   1.00 37.91 ? 7   THR B CA    1 
ATOM   814  C C     . THR D 2 7  ? 39.714 58.633 6.351   1.00 37.35 ? 7   THR B C     1 
ATOM   815  O O     . THR D 2 7  ? 38.687 59.310 6.417   1.00 34.90 ? 7   THR B O     1 
ATOM   816  C CB    . THR D 2 7  ? 39.626 56.309 7.279   1.00 39.82 ? 7   THR B CB    1 
ATOM   817  O OG1   . THR D 2 7  ? 38.215 56.258 7.530   1.00 40.70 ? 7   THR B OG1   1 
ATOM   818  C CG2   . THR D 2 7  ? 40.338 55.314 8.189   1.00 40.62 ? 7   THR B CG2   1 
ATOM   819  N N     . VAL D 2 8  ? 40.512 58.633 5.287   1.00 37.21 ? 8   VAL B N     1 
ATOM   820  C CA    . VAL D 2 8  ? 40.187 59.408 4.094   1.00 37.18 ? 8   VAL B CA    1 
ATOM   821  C C     . VAL D 2 8  ? 39.137 58.578 3.362   1.00 38.08 ? 8   VAL B C     1 
ATOM   822  O O     . VAL D 2 8  ? 39.431 57.479 2.903   1.00 38.15 ? 8   VAL B O     1 
ATOM   823  C CB    . VAL D 2 8  ? 41.435 59.602 3.206   1.00 37.41 ? 8   VAL B CB    1 
ATOM   824  C CG1   . VAL D 2 8  ? 41.084 60.408 1.971   1.00 36.88 ? 8   VAL B CG1   1 
ATOM   825  C CG2   . VAL D 2 8  ? 42.518 60.317 3.994   1.00 37.83 ? 8   VAL B CG2   1 
ATOM   826  N N     . ASN D 2 9  ? 37.912 59.096 3.275   1.00 38.27 ? 9   ASN B N     1 
ATOM   827  C CA    . ASN D 2 9  ? 36.817 58.372 2.633   1.00 38.01 ? 9   ASN B CA    1 
ATOM   828  C C     . ASN D 2 9  ? 36.740 58.535 1.119   1.00 38.21 ? 9   ASN B C     1 
ATOM   829  O O     . ASN D 2 9  ? 37.494 59.306 0.523   1.00 36.30 ? 9   ASN B O     1 
ATOM   830  C CB    . ASN D 2 9  ? 35.470 58.783 3.247   1.00 39.51 ? 9   ASN B CB    1 
ATOM   831  C CG    . ASN D 2 9  ? 35.124 60.242 2.988   1.00 41.64 ? 9   ASN B CG    1 
ATOM   832  O OD1   . ASN D 2 9  ? 35.329 60.759 1.887   1.00 43.03 ? 9   ASN B OD1   1 
ATOM   833  N ND2   . ASN D 2 9  ? 34.579 60.910 4.002   1.00 43.17 ? 9   ASN B ND2   1 
ATOM   834  N N     . ASP D 2 10 ? 35.803 57.809 0.514   1.00 38.60 ? 10  ASP B N     1 
ATOM   835  C CA    . ASP D 2 10 ? 35.599 57.834 -0.930  1.00 39.59 ? 10  ASP B CA    1 
ATOM   836  C C     . ASP D 2 10 ? 35.598 59.248 -1.499  1.00 38.42 ? 10  ASP B C     1 
ATOM   837  O O     . ASP D 2 10 ? 36.366 59.555 -2.409  1.00 38.06 ? 10  ASP B O     1 
ATOM   838  C CB    . ASP D 2 10 ? 34.277 57.144 -1.310  1.00 41.06 ? 10  ASP B CB    1 
ATOM   839  C CG    . ASP D 2 10 ? 34.200 55.705 -0.825  1.00 44.29 ? 10  ASP B CG    1 
ATOM   840  O OD1   . ASP D 2 10 ? 35.260 55.084 -0.629  1.00 20.15 ? 10  ASP B OD1   1 
ATOM   841  O OD2   . ASP D 2 10 ? 33.077 55.180 -0.649  1.00 20.15 ? 10  ASP B OD2   1 
ATOM   842  N N     . ALA D 2 11 ? 34.735 60.103 -0.959  1.00 37.57 ? 11  ALA B N     1 
ATOM   843  C CA    . ALA D 2 11 ? 34.618 61.481 -1.426  1.00 35.88 ? 11  ALA B CA    1 
ATOM   844  C C     . ALA D 2 11 ? 35.934 62.245 -1.376  1.00 34.88 ? 11  ALA B C     1 
ATOM   845  O O     . ALA D 2 11 ? 36.194 63.103 -2.221  1.00 34.99 ? 11  ALA B O     1 
ATOM   846  C CB    . ALA D 2 11 ? 33.561 62.221 -0.611  1.00 37.25 ? 11  ALA B CB    1 
ATOM   847  N N     . GLU D 2 12 ? 36.763 61.935 -0.389  1.00 31.81 ? 12  GLU B N     1 
ATOM   848  C CA    . GLU D 2 12 ? 38.041 62.613 -0.246  1.00 32.27 ? 12  GLU B CA    1 
ATOM   849  C C     . GLU D 2 12 ? 39.092 62.103 -1.229  1.00 31.17 ? 12  GLU B C     1 
ATOM   850  O O     . GLU D 2 12 ? 39.928 62.870 -1.710  1.00 30.24 ? 12  GLU B O     1 
ATOM   851  C CB    . GLU D 2 12 ? 38.552 62.470 1.189   1.00 30.69 ? 12  GLU B CB    1 
ATOM   852  C CG    . GLU D 2 12 ? 37.989 63.503 2.150   1.00 32.60 ? 12  GLU B CG    1 
ATOM   853  C CD    . GLU D 2 12 ? 37.439 62.887 3.425   1.00 33.36 ? 12  GLU B CD    1 
ATOM   854  O OE1   . GLU D 2 12 ? 38.047 61.921 3.945   1.00 31.27 ? 12  GLU B OE1   1 
ATOM   855  O OE2   . GLU D 2 12 ? 36.402 63.385 3.913   1.00 34.71 ? 12  GLU B OE2   1 
ATOM   856  N N     . ILE D 2 13 ? 39.061 60.809 -1.523  1.00 30.85 ? 13  ILE B N     1 
ATOM   857  C CA    . ILE D 2 13 ? 40.025 60.250 -2.468  1.00 28.50 ? 13  ILE B CA    1 
ATOM   858  C C     . ILE D 2 13 ? 39.632 60.734 -3.857  1.00 27.50 ? 13  ILE B C     1 
ATOM   859  O O     . ILE D 2 13 ? 40.481 60.964 -4.713  1.00 27.84 ? 13  ILE B O     1 
ATOM   860  C CB    . ILE D 2 13 ? 40.037 58.708 -2.407  1.00 28.30 ? 13  ILE B CB    1 
ATOM   861  C CG1   . ILE D 2 13 ? 40.511 58.264 -1.020  1.00 26.13 ? 13  ILE B CG1   1 
ATOM   862  C CG2   . ILE D 2 13 ? 40.947 58.140 -3.491  1.00 26.20 ? 13  ILE B CG2   1 
ATOM   863  C CD1   . ILE D 2 13 ? 40.508 56.775 -0.813  1.00 26.62 ? 13  ILE B CD1   1 
ATOM   864  N N     . PHE D 2 14 ? 38.332 60.914 -4.059  1.00 27.72 ? 14  PHE B N     1 
ATOM   865  C CA    . PHE D 2 14 ? 37.810 61.402 -5.326  1.00 27.23 ? 14  PHE B CA    1 
ATOM   866  C C     . PHE D 2 14 ? 38.481 62.732 -5.668  1.00 27.95 ? 14  PHE B C     1 
ATOM   867  O O     . PHE D 2 14 ? 38.927 62.944 -6.794  1.00 27.11 ? 14  PHE B O     1 
ATOM   868  C CB    . PHE D 2 14 ? 36.301 61.623 -5.221  1.00 25.64 ? 14  PHE B CB    1 
ATOM   869  C CG    . PHE D 2 14 ? 35.676 62.118 -6.487  1.00 26.42 ? 14  PHE B CG    1 
ATOM   870  C CD1   . PHE D 2 14 ? 35.301 61.225 -7.488  1.00 27.55 ? 14  PHE B CD1   1 
ATOM   871  C CD2   . PHE D 2 14 ? 35.454 63.479 -6.678  1.00 26.90 ? 14  PHE B CD2   1 
ATOM   872  C CE1   . PHE D 2 14 ? 34.710 61.678 -8.660  1.00 27.44 ? 14  PHE B CE1   1 
ATOM   873  C CE2   . PHE D 2 14 ? 34.865 63.949 -7.844  1.00 26.95 ? 14  PHE B CE2   1 
ATOM   874  C CZ    . PHE D 2 14 ? 34.488 63.046 -8.841  1.00 29.13 ? 14  PHE B CZ    1 
ATOM   875  N N     . SER D 2 15 ? 38.549 63.626 -4.683  1.00 27.44 ? 15  SER B N     1 
ATOM   876  C CA    . SER D 2 15 ? 39.151 64.942 -4.881  1.00 26.54 ? 15  SER B CA    1 
ATOM   877  C C     . SER D 2 15 ? 40.629 64.848 -5.223  1.00 25.80 ? 15  SER B C     1 
ATOM   878  O O     . SER D 2 15 ? 41.113 65.568 -6.096  1.00 26.55 ? 15  SER B O     1 
ATOM   879  C CB    . SER D 2 15 ? 38.973 65.806 -3.627  1.00 27.11 ? 15  SER B CB    1 
ATOM   880  O OG    . SER D 2 15 ? 37.603 66.031 -3.357  1.00 25.44 ? 15  SER B OG    1 
ATOM   881  N N     . LEU D 2 16 ? 41.343 63.957 -4.540  1.00 23.93 ? 16  LEU B N     1 
ATOM   882  C CA    . LEU D 2 16 ? 42.766 63.793 -4.787  1.00 23.98 ? 16  LEU B CA    1 
ATOM   883  C C     . LEU D 2 16 ? 43.010 63.296 -6.201  1.00 23.27 ? 16  LEU B C     1 
ATOM   884  O O     . LEU D 2 16 ? 43.893 63.792 -6.896  1.00 19.99 ? 16  LEU B O     1 
ATOM   885  C CB    . LEU D 2 16 ? 43.367 62.802 -3.796  1.00 24.37 ? 16  LEU B CB    1 
ATOM   886  C CG    . LEU D 2 16 ? 43.276 63.209 -2.322  1.00 27.86 ? 16  LEU B CG    1 
ATOM   887  C CD1   . LEU D 2 16 ? 43.830 62.091 -1.451  1.00 26.14 ? 16  LEU B CD1   1 
ATOM   888  C CD2   . LEU D 2 16 ? 44.049 64.501 -2.105  1.00 28.40 ? 16  LEU B CD2   1 
ATOM   889  N N     . VAL D 2 17 ? 42.229 62.305 -6.620  1.00 22.57 ? 17  VAL B N     1 
ATOM   890  C CA    . VAL D 2 17 ? 42.388 61.756 -7.956  1.00 21.74 ? 17  VAL B CA    1 
ATOM   891  C C     . VAL D 2 17 ? 41.962 62.795 -8.983  1.00 22.00 ? 17  VAL B C     1 
ATOM   892  O O     . VAL D 2 17 ? 42.624 62.974 -10.003 1.00 22.05 ? 17  VAL B O     1 
ATOM   893  C CB    . VAL D 2 17 ? 41.563 60.460 -8.131  1.00 19.56 ? 17  VAL B CB    1 
ATOM   894  C CG1   . VAL D 2 17 ? 41.648 59.970 -9.579  1.00 20.32 ? 17  VAL B CG1   1 
ATOM   895  C CG2   . VAL D 2 17 ? 42.105 59.379 -7.190  1.00 19.62 ? 17  VAL B CG2   1 
ATOM   896  N N     . LYS D 2 18 ? 40.870 63.495 -8.710  1.00 21.65 ? 18  LYS B N     1 
ATOM   897  C CA    . LYS D 2 18 ? 40.404 64.509 -9.645  1.00 24.49 ? 18  LYS B CA    1 
ATOM   898  C C     . LYS D 2 18 ? 41.467 65.576 -9.904  1.00 25.59 ? 18  LYS B C     1 
ATOM   899  O O     . LYS D 2 18 ? 41.631 66.030 -11.032 1.00 24.25 ? 18  LYS B O     1 
ATOM   900  C CB    . LYS D 2 18 ? 39.121 65.176 -9.136  1.00 24.45 ? 18  LYS B CB    1 
ATOM   901  C CG    . LYS D 2 18 ? 38.529 66.158 -10.138 1.00 26.01 ? 18  LYS B CG    1 
ATOM   902  C CD    . LYS D 2 18 ? 37.158 66.662 -9.707  1.00 29.03 ? 18  LYS B CD    1 
ATOM   903  C CE    . LYS D 2 18 ? 36.513 67.478 -10.821 1.00 32.07 ? 18  LYS B CE    1 
ATOM   904  N NZ    . LYS D 2 18 ? 35.077 67.777 -10.558 1.00 31.77 ? 18  LYS B NZ    1 
ATOM   905  N N     . LYS D 2 19 ? 42.198 65.966 -8.865  1.00 27.23 ? 19  LYS B N     1 
ATOM   906  C CA    . LYS D 2 19 ? 43.223 66.998 -9.013  1.00 28.48 ? 19  LYS B CA    1 
ATOM   907  C C     . LYS D 2 19 ? 44.395 66.523 -9.870  1.00 27.74 ? 19  LYS B C     1 
ATOM   908  O O     . LYS D 2 19 ? 44.891 67.269 -10.719 1.00 27.77 ? 19  LYS B O     1 
ATOM   909  C CB    . LYS D 2 19 ? 43.722 67.443 -7.634  1.00 30.27 ? 19  LYS B CB    1 
ATOM   910  C CG    . LYS D 2 19 ? 44.640 68.663 -7.647  1.00 33.73 ? 19  LYS B CG    1 
ATOM   911  C CD    . LYS D 2 19 ? 46.051 68.301 -8.070  1.00 37.53 ? 19  LYS B CD    1 
ATOM   912  C CE    . LYS D 2 19 ? 46.967 69.523 -8.083  1.00 39.69 ? 19  LYS B CE    1 
ATOM   913  N NZ    . LYS D 2 19 ? 48.382 69.143 -8.381  1.00 40.06 ? 19  LYS B NZ    1 
ATOM   914  N N     . GLU D 2 20 ? 44.828 65.285 -9.656  1.00 27.47 ? 20  GLU B N     1 
ATOM   915  C CA    . GLU D 2 20 ? 45.946 64.733 -10.415 1.00 29.49 ? 20  GLU B CA    1 
ATOM   916  C C     . GLU D 2 20 ? 45.602 64.639 -11.892 1.00 28.82 ? 20  GLU B C     1 
ATOM   917  O O     . GLU D 2 20 ? 46.409 64.986 -12.758 1.00 28.53 ? 20  GLU B O     1 
ATOM   918  C CB    . GLU D 2 20 ? 46.322 63.340 -9.899  1.00 30.91 ? 20  GLU B CB    1 
ATOM   919  C CG    . GLU D 2 20 ? 46.838 63.334 -8.473  1.00 34.66 ? 20  GLU B CG    1 
ATOM   920  C CD    . GLU D 2 20 ? 48.050 64.230 -8.298  1.00 37.19 ? 20  GLU B CD    1 
ATOM   921  O OE1   . GLU D 2 20 ? 49.100 63.937 -8.912  1.00 38.09 ? 20  GLU B OE1   1 
ATOM   922  O OE2   . GLU D 2 20 ? 47.946 65.231 -7.554  1.00 38.23 ? 20  GLU B OE2   1 
ATOM   923  N N     . VAL D 2 21 ? 44.396 64.167 -12.176 1.00 26.42 ? 21  VAL B N     1 
ATOM   924  C CA    . VAL D 2 21 ? 43.968 64.014 -13.549 1.00 26.15 ? 21  VAL B CA    1 
ATOM   925  C C     . VAL D 2 21 ? 43.798 65.356 -14.233 1.00 25.28 ? 21  VAL B C     1 
ATOM   926  O O     . VAL D 2 21 ? 44.094 65.490 -15.422 1.00 23.85 ? 21  VAL B O     1 
ATOM   927  C CB    . VAL D 2 21 ? 42.654 63.241 -13.637 1.00 26.04 ? 21  VAL B CB    1 
ATOM   928  C CG1   . VAL D 2 21 ? 42.157 63.266 -15.064 1.00 29.48 ? 21  VAL B CG1   1 
ATOM   929  C CG2   . VAL D 2 21 ? 42.865 61.814 -13.184 1.00 23.98 ? 21  VAL B CG2   1 
ATOM   930  N N     . LEU D 2 22 ? 43.311 66.346 -13.492 1.00 25.11 ? 22  LEU B N     1 
ATOM   931  C CA    . LEU D 2 22 ? 43.123 67.678 -14.053 1.00 25.88 ? 22  LEU B CA    1 
ATOM   932  C C     . LEU D 2 22 ? 44.465 68.371 -14.279 1.00 26.19 ? 22  LEU B C     1 
ATOM   933  O O     . LEU D 2 22 ? 44.533 69.406 -14.940 1.00 28.92 ? 22  LEU B O     1 
ATOM   934  C CB    . LEU D 2 22 ? 42.259 68.539 -13.130 1.00 25.30 ? 22  LEU B CB    1 
ATOM   935  C CG    . LEU D 2 22 ? 40.756 68.257 -13.098 1.00 24.58 ? 22  LEU B CG    1 
ATOM   936  C CD1   . LEU D 2 22 ? 40.083 69.206 -12.120 1.00 25.63 ? 22  LEU B CD1   1 
ATOM   937  C CD2   . LEU D 2 22 ? 40.175 68.429 -14.492 1.00 26.06 ? 22  LEU B CD2   1 
ATOM   938  N N     . SER D 2 23 ? 45.536 67.801 -13.742 1.00 25.96 ? 23  SER B N     1 
ATOM   939  C CA    . SER D 2 23 ? 46.849 68.405 -13.913 1.00 26.90 ? 23  SER B CA    1 
ATOM   940  C C     . SER D 2 23 ? 47.605 67.806 -15.093 1.00 27.02 ? 23  SER B C     1 
ATOM   941  O O     . SER D 2 23 ? 48.753 68.160 -15.340 1.00 28.56 ? 23  SER B O     1 
ATOM   942  C CB    . SER D 2 23 ? 47.678 68.254 -12.638 1.00 27.91 ? 23  SER B CB    1 
ATOM   943  O OG    . SER D 2 23 ? 48.062 66.910 -12.444 1.00 29.69 ? 23  SER B OG    1 
ATOM   944  N N     . LEU D 2 24 ? 46.967 66.895 -15.821 1.00 25.86 ? 24  LEU B N     1 
ATOM   945  C CA    . LEU D 2 24 ? 47.611 66.276 -16.975 1.00 27.12 ? 24  LEU B CA    1 
ATOM   946  C C     . LEU D 2 24 ? 47.605 67.254 -18.150 1.00 27.44 ? 24  LEU B C     1 
ATOM   947  O O     . LEU D 2 24 ? 46.699 68.078 -18.261 1.00 27.44 ? 24  LEU B O     1 
ATOM   948  C CB    . LEU D 2 24 ? 46.864 64.998 -17.380 1.00 25.96 ? 24  LEU B CB    1 
ATOM   949  C CG    . LEU D 2 24 ? 46.835 63.823 -16.396 1.00 28.02 ? 24  LEU B CG    1 
ATOM   950  C CD1   . LEU D 2 24 ? 45.754 62.821 -16.814 1.00 26.55 ? 24  LEU B CD1   1 
ATOM   951  C CD2   . LEU D 2 24 ? 48.197 63.159 -16.353 1.00 27.12 ? 24  LEU B CD2   1 
ATOM   952  N N     . ASN D 2 25 ? 48.618 67.182 -19.012 1.00 29.57 ? 25  ASN B N     1 
ATOM   953  C CA    . ASN D 2 25 ? 48.643 68.053 -20.184 1.00 30.81 ? 25  ASN B CA    1 
ATOM   954  C C     . ASN D 2 25 ? 47.657 67.453 -21.178 1.00 30.82 ? 25  ASN B C     1 
ATOM   955  O O     . ASN D 2 25 ? 47.320 66.274 -21.088 1.00 29.57 ? 25  ASN B O     1 
ATOM   956  C CB    . ASN D 2 25 ? 50.034 68.122 -20.819 1.00 31.94 ? 25  ASN B CB    1 
ATOM   957  C CG    . ASN D 2 25 ? 51.038 68.850 -19.949 1.00 35.67 ? 25  ASN B CG    1 
ATOM   958  O OD1   . ASN D 2 25 ? 50.766 69.942 -19.446 1.00 35.98 ? 25  ASN B OD1   1 
ATOM   959  N ND2   . ASN D 2 25 ? 52.215 68.251 -19.774 1.00 37.20 ? 25  ASN B ND2   1 
ATOM   960  N N     . THR D 2 26 ? 47.218 68.264 -22.131 1.00 31.19 ? 26  THR B N     1 
ATOM   961  C CA    . THR D 2 26 ? 46.235 67.858 -23.129 1.00 32.17 ? 26  THR B CA    1 
ATOM   962  C C     . THR D 2 26 ? 46.159 66.394 -23.564 1.00 31.61 ? 26  THR B C     1 
ATOM   963  O O     . THR D 2 26 ? 45.162 65.715 -23.283 1.00 34.77 ? 26  THR B O     1 
ATOM   964  C CB    . THR D 2 26 ? 46.352 68.742 -24.372 1.00 32.34 ? 26  THR B CB    1 
ATOM   965  O OG1   . THR D 2 26 ? 46.010 70.085 -24.009 1.00 35.10 ? 26  THR B OG1   1 
ATOM   966  C CG2   . THR D 2 26 ? 45.406 68.267 -25.473 1.00 32.64 ? 26  THR B CG2   1 
ATOM   967  N N     . ASN D 2 27 ? 47.181 65.893 -24.246 1.00 29.55 ? 27  ASN B N     1 
ATOM   968  C CA    . ASN D 2 27 ? 47.116 64.506 -24.701 1.00 26.70 ? 27  ASN B CA    1 
ATOM   969  C C     . ASN D 2 27 ? 47.918 63.475 -23.902 1.00 25.59 ? 27  ASN B C     1 
ATOM   970  O O     . ASN D 2 27 ? 48.201 62.395 -24.414 1.00 23.35 ? 27  ASN B O     1 
ATOM   971  C CB    . ASN D 2 27 ? 47.512 64.410 -26.184 1.00 25.99 ? 27  ASN B CB    1 
ATOM   972  C CG    . ASN D 2 27 ? 46.308 64.430 -27.130 1.00 26.89 ? 27  ASN B CG    1 
ATOM   973  O OD1   . ASN D 2 27 ? 46.448 64.147 -28.321 1.00 26.87 ? 27  ASN B OD1   1 
ATOM   974  N ND2   . ASN D 2 27 ? 45.130 64.763 -26.607 1.00 24.86 ? 27  ASN B ND2   1 
ATOM   975  N N     . ASP D 2 28 ? 48.312 63.779 -22.670 1.00 25.04 ? 28  ASP B N     1 
ATOM   976  C CA    . ASP D 2 28 ? 49.029 62.748 -21.928 1.00 27.72 ? 28  ASP B CA    1 
ATOM   977  C C     . ASP D 2 28 ? 48.104 62.040 -20.958 1.00 25.66 ? 28  ASP B C     1 
ATOM   978  O O     . ASP D 2 28 ? 47.128 62.609 -20.471 1.00 26.99 ? 28  ASP B O     1 
ATOM   979  C CB    . ASP D 2 28 ? 50.267 63.282 -21.199 1.00 31.97 ? 28  ASP B CB    1 
ATOM   980  C CG    . ASP D 2 28 ? 50.094 64.674 -20.687 1.00 37.72 ? 28  ASP B CG    1 
ATOM   981  O OD1   . ASP D 2 28 ? 49.030 64.969 -20.111 1.00 40.80 ? 28  ASP B OD1   1 
ATOM   982  O OD2   . ASP D 2 28 ? 51.045 65.470 -20.848 1.00 40.78 ? 28  ASP B OD2   1 
ATOM   983  N N     . TYR D 2 29 ? 48.410 60.781 -20.697 1.00 25.19 ? 29  TYR B N     1 
ATOM   984  C CA    . TYR D 2 29 ? 47.582 59.974 -19.822 1.00 22.64 ? 29  TYR B CA    1 
ATOM   985  C C     . TYR D 2 29 ? 48.316 59.531 -18.583 1.00 23.29 ? 29  TYR B C     1 
ATOM   986  O O     . TYR D 2 29 ? 49.490 59.845 -18.380 1.00 21.75 ? 29  TYR B O     1 
ATOM   987  C CB    . TYR D 2 29 ? 47.110 58.735 -20.580 1.00 24.15 ? 29  TYR B CB    1 
ATOM   988  C CG    . TYR D 2 29 ? 48.237 57.796 -20.967 1.00 26.27 ? 29  TYR B CG    1 
ATOM   989  C CD1   . TYR D 2 29 ? 48.736 56.858 -20.061 1.00 28.01 ? 29  TYR B CD1   1 
ATOM   990  C CD2   . TYR D 2 29 ? 48.819 57.860 -22.232 1.00 27.71 ? 29  TYR B CD2   1 
ATOM   991  C CE1   . TYR D 2 29 ? 49.787 56.006 -20.410 1.00 28.79 ? 29  TYR B CE1   1 
ATOM   992  C CE2   . TYR D 2 29 ? 49.869 57.019 -22.590 1.00 29.05 ? 29  TYR B CE2   1 
ATOM   993  C CZ    . TYR D 2 29 ? 50.346 56.094 -21.676 1.00 30.25 ? 29  TYR B CZ    1 
ATOM   994  O OH    . TYR D 2 29 ? 51.371 55.248 -22.038 1.00 32.49 ? 29  TYR B OH    1 
ATOM   995  N N     . THR D 2 30 ? 47.593 58.799 -17.752 1.00 21.45 ? 30  THR B N     1 
ATOM   996  C CA    . THR D 2 30 ? 48.146 58.222 -16.545 1.00 21.45 ? 30  THR B CA    1 
ATOM   997  C C     . THR D 2 30 ? 47.408 56.895 -16.388 1.00 20.53 ? 30  THR B C     1 
ATOM   998  O O     . THR D 2 30 ? 46.502 56.582 -17.164 1.00 19.42 ? 30  THR B O     1 
ATOM   999  C CB    . THR D 2 30 ? 47.918 59.117 -15.297 1.00 23.87 ? 30  THR B CB    1 
ATOM   1000 O OG1   . THR D 2 30 ? 48.612 58.548 -14.174 1.00 25.37 ? 30  THR B OG1   1 
ATOM   1001 C CG2   . THR D 2 30 ? 46.430 59.231 -14.966 1.00 21.15 ? 30  THR B CG2   1 
ATOM   1002 N N     . THR D 2 31 ? 47.805 56.109 -15.402 1.00 19.58 ? 31  THR B N     1 
ATOM   1003 C CA    . THR D 2 31 ? 47.169 54.825 -15.163 1.00 20.37 ? 31  THR B CA    1 
ATOM   1004 C C     . THR D 2 31 ? 46.828 54.720 -13.686 1.00 21.68 ? 31  THR B C     1 
ATOM   1005 O O     . THR D 2 31 ? 47.375 55.459 -12.860 1.00 19.44 ? 31  THR B O     1 
ATOM   1006 C CB    . THR D 2 31 ? 48.105 53.679 -15.531 1.00 24.92 ? 31  THR B CB    1 
ATOM   1007 O OG1   . THR D 2 31 ? 49.274 53.746 -14.711 1.00 21.59 ? 31  THR B OG1   1 
ATOM   1008 C CG2   . THR D 2 31 ? 48.516 53.781 -16.997 1.00 23.60 ? 31  THR B CG2   1 
ATOM   1009 N N     . ALA D 2 32 ? 45.915 53.813 -13.356 1.00 20.47 ? 32  ALA B N     1 
ATOM   1010 C CA    . ALA D 2 32 ? 45.517 53.625 -11.970 1.00 22.13 ? 32  ALA B CA    1 
ATOM   1011 C C     . ALA D 2 32 ? 46.745 53.299 -11.110 1.00 21.93 ? 32  ALA B C     1 
ATOM   1012 O O     . ALA D 2 32 ? 46.930 53.874 -10.044 1.00 23.12 ? 32  ALA B O     1 
ATOM   1013 C CB    . ALA D 2 32 ? 44.499 52.501 -11.871 1.00 20.39 ? 32  ALA B CB    1 
ATOM   1014 N N     . ILE D 2 33 ? 47.585 52.384 -11.581 1.00 22.92 ? 33  ILE B N     1 
ATOM   1015 C CA    . ILE D 2 33 ? 48.765 52.008 -10.809 1.00 25.25 ? 33  ILE B CA    1 
ATOM   1016 C C     . ILE D 2 33 ? 49.715 53.190 -10.618 1.00 26.10 ? 33  ILE B C     1 
ATOM   1017 O O     . ILE D 2 33 ? 50.344 53.323 -9.568  1.00 28.98 ? 33  ILE B O     1 
ATOM   1018 C CB    . ILE D 2 33 ? 49.518 50.804 -11.452 1.00 25.42 ? 33  ILE B CB    1 
ATOM   1019 C CG1   . ILE D 2 33 ? 50.641 50.341 -10.518 1.00 27.70 ? 33  ILE B CG1   1 
ATOM   1020 C CG2   . ILE D 2 33 ? 50.114 51.199 -12.788 1.00 29.09 ? 33  ILE B CG2   1 
ATOM   1021 C CD1   . ILE D 2 33 ? 50.179 50.056 -9.099  1.00 28.74 ? 33  ILE B CD1   1 
ATOM   1022 N N     . SER D 2 34 ? 49.805 54.063 -11.617 1.00 26.54 ? 34  SER B N     1 
ATOM   1023 C CA    . SER D 2 34 ? 50.677 55.227 -11.498 1.00 26.98 ? 34  SER B CA    1 
ATOM   1024 C C     . SER D 2 34 ? 50.153 56.155 -10.414 1.00 28.03 ? 34  SER B C     1 
ATOM   1025 O O     . SER D 2 34 ? 50.915 56.626 -9.567  1.00 26.30 ? 34  SER B O     1 
ATOM   1026 C CB    . SER D 2 34 ? 50.758 55.990 -12.821 1.00 28.84 ? 34  SER B CB    1 
ATOM   1027 O OG    . SER D 2 34 ? 51.509 57.178 -12.652 1.00 31.08 ? 34  SER B OG    1 
ATOM   1028 N N     . LEU D 2 35 ? 48.849 56.419 -10.437 1.00 27.38 ? 35  LEU B N     1 
ATOM   1029 C CA    . LEU D 2 35 ? 48.244 57.297 -9.444  1.00 29.33 ? 35  LEU B CA    1 
ATOM   1030 C C     . LEU D 2 35 ? 48.345 56.658 -8.076  1.00 29.68 ? 35  LEU B C     1 
ATOM   1031 O O     . LEU D 2 35 ? 48.528 57.342 -7.073  1.00 30.88 ? 35  LEU B O     1 
ATOM   1032 C CB    . LEU D 2 35 ? 46.778 57.572 -9.791  1.00 30.45 ? 35  LEU B CB    1 
ATOM   1033 C CG    . LEU D 2 35 ? 46.573 58.493 -10.997 1.00 33.35 ? 35  LEU B CG    1 
ATOM   1034 C CD1   . LEU D 2 35 ? 45.140 58.412 -11.485 1.00 20.04 ? 35  LEU B CD1   1 
ATOM   1035 C CD2   . LEU D 2 35 ? 46.922 59.913 -10.602 1.00 20.04 ? 35  LEU B CD2   1 
ATOM   1036 N N     . SER D 2 36 ? 48.227 55.337 -8.044  1.00 31.07 ? 36  SER B N     1 
ATOM   1037 C CA    . SER D 2 36 ? 48.317 54.602 -6.793  1.00 33.14 ? 36  SER B CA    1 
ATOM   1038 C C     . SER D 2 36 ? 49.697 54.860 -6.184  1.00 35.00 ? 36  SER B C     1 
ATOM   1039 O O     . SER D 2 36 ? 49.818 55.098 -4.986  1.00 34.03 ? 36  SER B O     1 
ATOM   1040 C CB    . SER D 2 36 ? 48.127 53.106 -7.057  1.00 32.60 ? 36  SER B CB    1 
ATOM   1041 O OG    . SER D 2 36 ? 48.030 52.374 -5.851  1.00 33.81 ? 36  SER B OG    1 
ATOM   1042 N N     . ASN D 2 37 ? 50.729 54.825 -7.026  1.00 35.66 ? 37  ASN B N     1 
ATOM   1043 C CA    . ASN D 2 37 ? 52.104 55.048 -6.587  1.00 36.06 ? 37  ASN B CA    1 
ATOM   1044 C C     . ASN D 2 37 ? 52.393 56.503 -6.228  1.00 38.09 ? 37  ASN B C     1 
ATOM   1045 O O     . ASN D 2 37 ? 52.960 56.783 -5.173  1.00 39.71 ? 37  ASN B O     1 
ATOM   1046 C CB    . ASN D 2 37 ? 53.092 54.572 -7.664  1.00 33.42 ? 37  ASN B CB    1 
ATOM   1047 C CG    . ASN D 2 37 ? 53.137 53.059 -7.782  1.00 32.90 ? 37  ASN B CG    1 
ATOM   1048 O OD1   . ASN D 2 37 ? 52.796 52.350 -6.833  1.00 20.04 ? 37  ASN B OD1   1 
ATOM   1049 N ND2   . ASN D 2 37 ? 53.580 52.552 -8.938  1.00 20.04 ? 37  ASN B ND2   1 
ATOM   1050 N N     . ARG D 2 38 ? 52.007 57.424 -7.106  1.00 40.73 ? 38  ARG B N     1 
ATOM   1051 C CA    . ARG D 2 38 ? 52.226 58.849 -6.877  1.00 42.28 ? 38  ARG B CA    1 
ATOM   1052 C C     . ARG D 2 38 ? 51.491 59.305 -5.619  1.00 42.73 ? 38  ARG B C     1 
ATOM   1053 O O     . ARG D 2 38 ? 51.895 60.261 -4.959  1.00 43.24 ? 38  ARG B O     1 
ATOM   1054 C CB    . ARG D 2 38 ? 51.755 59.647 -8.097  1.00 44.09 ? 38  ARG B CB    1 
ATOM   1055 C CG    . ARG D 2 38 ? 51.862 61.156 -7.960  1.00 47.43 ? 38  ARG B CG    1 
ATOM   1056 C CD    . ARG D 2 38 ? 51.966 61.855 -9.322  1.00 49.72 ? 38  ARG B CD    1 
ATOM   1057 N NE    . ARG D 2 38 ? 50.921 61.463 -10.270 1.00 51.35 ? 38  ARG B NE    1 
ATOM   1058 C CZ    . ARG D 2 38 ? 50.978 60.392 -11.060 1.00 51.98 ? 38  ARG B CZ    1 
ATOM   1059 N NH1   . ARG D 2 38 ? 52.034 59.589 -11.026 1.00 51.89 ? 38  ARG B NH1   1 
ATOM   1060 N NH2   . ARG D 2 38 ? 49.982 60.127 -11.896 1.00 51.58 ? 38  ARG B NH2   1 
ATOM   1061 N N     . LEU D 2 39 ? 50.400 58.620 -5.300  1.00 43.08 ? 39  LEU B N     1 
ATOM   1062 C CA    . LEU D 2 39 ? 49.624 58.920 -4.103  1.00 43.49 ? 39  LEU B CA    1 
ATOM   1063 C C     . LEU D 2 39 ? 49.892 57.743 -3.172  1.00 42.92 ? 39  LEU B C     1 
ATOM   1064 O O     . LEU D 2 39 ? 50.653 56.844 -3.518  1.00 44.40 ? 39  LEU B O     1 
ATOM   1065 C CB    . LEU D 2 39 ? 48.130 58.997 -4.436  1.00 43.60 ? 39  LEU B CB    1 
ATOM   1066 C CG    . LEU D 2 39 ? 47.685 60.100 -5.399  1.00 42.99 ? 39  LEU B CG    1 
ATOM   1067 C CD1   . LEU D 2 39 ? 46.250 59.858 -5.817  1.00 42.29 ? 39  LEU B CD1   1 
ATOM   1068 C CD2   . LEU D 2 39 ? 47.832 61.460 -4.732  1.00 42.33 ? 39  LEU B CD2   1 
ATOM   1069 N N     . LYS D 2 40 ? 49.290 57.737 -1.994  1.00 42.12 ? 40  LYS B N     1 
ATOM   1070 C CA    . LYS D 2 40 ? 49.516 56.616 -1.098  1.00 42.91 ? 40  LYS B CA    1 
ATOM   1071 C C     . LYS D 2 40 ? 48.211 55.870 -0.938  1.00 41.82 ? 40  LYS B C     1 
ATOM   1072 O O     . LYS D 2 40 ? 47.810 55.533 0.180   1.00 42.52 ? 40  LYS B O     1 
ATOM   1073 N N     . ILE D 2 41 ? 47.554 55.597 -2.064  1.00 39.83 ? 41  ILE B N     1 
ATOM   1074 C CA    . ILE D 2 41 ? 46.253 54.940 -2.045  1.00 37.09 ? 41  ILE B CA    1 
ATOM   1075 C C     . ILE D 2 41 ? 46.143 53.655 -2.854  1.00 36.03 ? 41  ILE B C     1 
ATOM   1076 O O     . ILE D 2 41 ? 46.666 53.561 -3.968  1.00 36.31 ? 41  ILE B O     1 
ATOM   1077 C CB    . ILE D 2 41 ? 45.178 55.928 -2.526  1.00 36.35 ? 41  ILE B CB    1 
ATOM   1078 C CG1   . ILE D 2 41 ? 45.265 57.205 -1.687  1.00 36.66 ? 41  ILE B CG1   1 
ATOM   1079 C CG2   . ILE D 2 41 ? 43.793 55.301 -2.417  1.00 35.86 ? 41  ILE B CG2   1 
ATOM   1080 C CD1   . ILE D 2 41 ? 44.243 58.250 -2.040  1.00 38.16 ? 41  ILE B CD1   1 
ATOM   1081 N N     . ASN D 2 42 ? 45.448 52.673 -2.284  1.00 33.18 ? 42  ASN B N     1 
ATOM   1082 C CA    . ASN D 2 42 ? 45.247 51.380 -2.930  1.00 32.64 ? 42  ASN B CA    1 
ATOM   1083 C C     . ASN D 2 42 ? 44.713 51.580 -4.341  1.00 30.50 ? 42  ASN B C     1 
ATOM   1084 O O     . ASN D 2 42 ? 43.878 52.453 -4.575  1.00 27.13 ? 42  ASN B O     1 
ATOM   1085 C CB    . ASN D 2 42 ? 44.253 50.529 -2.134  1.00 35.50 ? 42  ASN B CB    1 
ATOM   1086 C CG    . ASN D 2 42 ? 44.677 50.337 -0.693  1.00 40.16 ? 42  ASN B CG    1 
ATOM   1087 O OD1   . ASN D 2 42 ? 45.831 50.000 -0.412  1.00 41.62 ? 42  ASN B OD1   1 
ATOM   1088 N ND2   . ASN D 2 42 ? 43.741 50.546 0.235   1.00 41.01 ? 42  ASN B ND2   1 
ATOM   1089 N N     . LYS D 2 43 ? 45.194 50.761 -5.272  1.00 29.73 ? 43  LYS B N     1 
ATOM   1090 C CA    . LYS D 2 43 ? 44.780 50.857 -6.665  1.00 30.32 ? 43  LYS B CA    1 
ATOM   1091 C C     . LYS D 2 43 ? 43.267 50.756 -6.824  1.00 28.71 ? 43  LYS B C     1 
ATOM   1092 O O     . LYS D 2 43 ? 42.673 51.482 -7.624  1.00 28.74 ? 43  LYS B O     1 
ATOM   1093 C CB    . LYS D 2 43 ? 45.463 49.767 -7.501  1.00 30.63 ? 43  LYS B CB    1 
ATOM   1094 C CG    . LYS D 2 43 ? 45.357 49.996 -9.000  1.00 31.39 ? 43  LYS B CG    1 
ATOM   1095 C CD    . LYS D 2 43 ? 46.218 49.032 -9.788  1.00 33.32 ? 43  LYS B CD    1 
ATOM   1096 C CE    . LYS D 2 43 ? 45.683 47.620 -9.695  1.00 34.82 ? 43  LYS B CE    1 
ATOM   1097 N NZ    . LYS D 2 43 ? 44.256 47.551 -10.118 1.00 36.55 ? 43  LYS B NZ    1 
ATOM   1098 N N     . LYS D 2 44 ? 42.642 49.854 -6.073  1.00 27.01 ? 44  LYS B N     1 
ATOM   1099 C CA    . LYS D 2 44 ? 41.196 49.693 -6.167  1.00 24.45 ? 44  LYS B CA    1 
ATOM   1100 C C     . LYS D 2 44 ? 40.498 51.015 -5.915  1.00 23.37 ? 44  LYS B C     1 
ATOM   1101 O O     . LYS D 2 44 ? 39.595 51.406 -6.663  1.00 23.86 ? 44  LYS B O     1 
ATOM   1102 C CB    . LYS D 2 44 ? 40.689 48.658 -5.164  1.00 26.48 ? 44  LYS B CB    1 
ATOM   1103 C CG    . LYS D 2 44 ? 39.164 48.602 -5.083  1.00 27.09 ? 44  LYS B CG    1 
ATOM   1104 C CD    . LYS D 2 44 ? 38.674 47.343 -4.377  1.00 29.61 ? 44  LYS B CD    1 
ATOM   1105 C CE    . LYS D 2 44 ? 37.158 47.258 -4.434  1.00 30.66 ? 44  LYS B CE    1 
ATOM   1106 N NZ    . LYS D 2 44 ? 36.648 45.985 -3.857  1.00 28.53 ? 44  LYS B NZ    1 
ATOM   1107 N N     . LYS D 2 45 ? 40.918 51.705 -4.858  1.00 21.25 ? 45  LYS B N     1 
ATOM   1108 C CA    . LYS D 2 45 ? 40.326 52.985 -4.508  1.00 19.28 ? 45  LYS B CA    1 
ATOM   1109 C C     . LYS D 2 45 ? 40.561 54.012 -5.604  1.00 18.39 ? 45  LYS B C     1 
ATOM   1110 O O     . LYS D 2 45 ? 39.736 54.898 -5.817  1.00 16.97 ? 45  LYS B O     1 
ATOM   1111 C CB    . LYS D 2 45 ? 40.893 53.494 -3.184  1.00 20.25 ? 45  LYS B CB    1 
ATOM   1112 C CG    . LYS D 2 45 ? 40.432 52.681 -1.990  1.00 23.74 ? 45  LYS B CG    1 
ATOM   1113 C CD    . LYS D 2 45 ? 41.036 53.192 -0.693  1.00 25.76 ? 45  LYS B CD    1 
ATOM   1114 C CE    . LYS D 2 45 ? 40.511 52.400 0.496   1.00 30.27 ? 45  LYS B CE    1 
ATOM   1115 N NZ    . LYS D 2 45 ? 41.099 52.882 1.781   1.00 32.66 ? 45  LYS B NZ    1 
ATOM   1116 N N     . ILE D 2 46 ? 41.694 53.904 -6.290  1.00 15.70 ? 46  ILE B N     1 
ATOM   1117 C CA    . ILE D 2 46 ? 41.970 54.835 -7.373  1.00 16.31 ? 46  ILE B CA    1 
ATOM   1118 C C     . ILE D 2 46 ? 40.963 54.597 -8.498  1.00 16.21 ? 46  ILE B C     1 
ATOM   1119 O O     . ILE D 2 46 ? 40.324 55.539 -8.973  1.00 17.41 ? 46  ILE B O     1 
ATOM   1120 C CB    . ILE D 2 46 ? 43.399 54.653 -7.922  1.00 18.73 ? 46  ILE B CB    1 
ATOM   1121 C CG1   . ILE D 2 46 ? 44.415 55.053 -6.849  1.00 16.81 ? 46  ILE B CG1   1 
ATOM   1122 C CG2   . ILE D 2 46 ? 43.586 55.488 -9.189  1.00 19.23 ? 46  ILE B CG2   1 
ATOM   1123 C CD1   . ILE D 2 46 ? 44.248 56.479 -6.351  1.00 20.42 ? 46  ILE B CD1   1 
ATOM   1124 N N     . ASN D 2 47 ? 40.824 53.339 -8.924  1.00 14.46 ? 47  ASN B N     1 
ATOM   1125 C CA    . ASN D 2 47 ? 39.884 52.994 -9.991  1.00 14.08 ? 47  ASN B CA    1 
ATOM   1126 C C     . ASN D 2 47 ? 38.436 53.346 -9.639  1.00 14.08 ? 47  ASN B C     1 
ATOM   1127 O O     . ASN D 2 47 ? 37.656 53.749 -10.500 1.00 13.67 ? 47  ASN B O     1 
ATOM   1128 C CB    . ASN D 2 47 ? 39.966 51.501 -10.328 1.00 14.41 ? 47  ASN B CB    1 
ATOM   1129 C CG    . ASN D 2 47 ? 40.995 51.200 -11.391 1.00 16.86 ? 47  ASN B CG    1 
ATOM   1130 O OD1   . ASN D 2 47 ? 41.224 52.009 -12.290 1.00 17.20 ? 47  ASN B OD1   1 
ATOM   1131 N ND2   . ASN D 2 47 ? 41.605 50.024 -11.311 1.00 16.35 ? 47  ASN B ND2   1 
ATOM   1132 N N     . GLN D 2 48 ? 38.063 53.176 -8.378  1.00 13.66 ? 48  GLN B N     1 
ATOM   1133 C CA    . GLN D 2 48 ? 36.709 53.508 -7.965  1.00 16.87 ? 48  GLN B CA    1 
ATOM   1134 C C     . GLN D 2 48 ? 36.436 54.960 -8.334  1.00 15.87 ? 48  GLN B C     1 
ATOM   1135 O O     . GLN D 2 48 ? 35.351 55.290 -8.802  1.00 14.56 ? 48  GLN B O     1 
ATOM   1136 C CB    . GLN D 2 48 ? 36.540 53.306 -6.454  1.00 17.10 ? 48  GLN B CB    1 
ATOM   1137 C CG    . GLN D 2 48 ? 36.338 51.851 -6.050  1.00 22.18 ? 48  GLN B CG    1 
ATOM   1138 C CD    . GLN D 2 48 ? 36.349 51.653 -4.537  1.00 25.16 ? 48  GLN B CD    1 
ATOM   1139 O OE1   . GLN D 2 48 ? 37.307 52.031 -3.856  1.00 26.52 ? 48  GLN B OE1   1 
ATOM   1140 N NE2   . GLN D 2 48 ? 35.288 51.057 -4.010  1.00 26.04 ? 48  GLN B NE2   1 
ATOM   1141 N N     . GLN D 2 49 ? 37.433 55.823 -8.143  1.00 14.79 ? 49  GLN B N     1 
ATOM   1142 C CA    . GLN D 2 49 ? 37.261 57.238 -8.466  1.00 15.45 ? 49  GLN B CA    1 
ATOM   1143 C C     . GLN D 2 49 ? 37.343 57.504 -9.962  1.00 15.27 ? 49  GLN B C     1 
ATOM   1144 O O     . GLN D 2 49 ? 36.579 58.297 -10.492 1.00 16.44 ? 49  GLN B O     1 
ATOM   1145 C CB    . GLN D 2 49 ? 38.317 58.085 -7.756  1.00 16.82 ? 49  GLN B CB    1 
ATOM   1146 C CG    . GLN D 2 49 ? 38.411 57.820 -6.266  1.00 21.08 ? 49  GLN B CG    1 
ATOM   1147 C CD    . GLN D 2 49 ? 37.050 57.649 -5.644  1.00 24.61 ? 49  GLN B CD    1 
ATOM   1148 O OE1   . GLN D 2 49 ? 36.181 58.508 -5.777  1.00 26.70 ? 49  GLN B OE1   1 
ATOM   1149 N NE2   . GLN D 2 49 ? 36.849 56.527 -4.968  1.00 30.58 ? 49  GLN B NE2   1 
ATOM   1150 N N     . LEU D 2 50 ? 38.282 56.846 -10.634 1.00 14.71 ? 50  LEU B N     1 
ATOM   1151 C CA    . LEU D 2 50 ? 38.459 57.043 -12.074 1.00 14.91 ? 50  LEU B CA    1 
ATOM   1152 C C     . LEU D 2 50 ? 37.190 56.778 -12.872 1.00 14.64 ? 50  LEU B C     1 
ATOM   1153 O O     . LEU D 2 50 ? 36.817 57.584 -13.724 1.00 12.48 ? 50  LEU B O     1 
ATOM   1154 C CB    . LEU D 2 50 ? 39.575 56.151 -12.611 1.00 16.13 ? 50  LEU B CB    1 
ATOM   1155 C CG    . LEU D 2 50 ? 40.989 56.693 -12.871 1.00 18.47 ? 50  LEU B CG    1 
ATOM   1156 C CD1   . LEU D 2 50 ? 41.123 58.177 -12.562 1.00 14.99 ? 50  LEU B CD1   1 
ATOM   1157 C CD2   . LEU D 2 50 ? 41.947 55.870 -12.075 1.00 16.45 ? 50  LEU B CD2   1 
ATOM   1158 N N     . TYR D 2 51 ? 36.532 55.650 -12.620 1.00 13.69 ? 51  TYR B N     1 
ATOM   1159 C CA    . TYR D 2 51 ? 35.315 55.354 -13.365 1.00 15.04 ? 51  TYR B CA    1 
ATOM   1160 C C     . TYR D 2 51 ? 34.188 56.341 -13.060 1.00 15.38 ? 51  TYR B C     1 
ATOM   1161 O O     . TYR D 2 51 ? 33.341 56.616 -13.916 1.00 14.20 ? 51  TYR B O     1 
ATOM   1162 C CB    . TYR D 2 51 ? 34.881 53.902 -13.134 1.00 12.95 ? 51  TYR B CB    1 
ATOM   1163 C CG    . TYR D 2 51 ? 35.757 52.933 -13.906 1.00 12.61 ? 51  TYR B CG    1 
ATOM   1164 C CD1   . TYR D 2 51 ? 36.915 52.395 -13.338 1.00 11.35 ? 51  TYR B CD1   1 
ATOM   1165 C CD2   . TYR D 2 51 ? 35.476 52.629 -15.240 1.00 10.55 ? 51  TYR B CD2   1 
ATOM   1166 C CE1   . TYR D 2 51 ? 37.781 51.580 -14.085 1.00 11.96 ? 51  TYR B CE1   1 
ATOM   1167 C CE2   . TYR D 2 51 ? 36.327 51.815 -15.994 1.00 12.31 ? 51  TYR B CE2   1 
ATOM   1168 C CZ    . TYR D 2 51 ? 37.476 51.302 -15.414 1.00 12.34 ? 51  TYR B CZ    1 
ATOM   1169 O OH    . TYR D 2 51 ? 38.341 50.547 -16.165 1.00 9.67  ? 51  TYR B OH    1 
ATOM   1170 N N     . LYS D 2 52 ? 34.174 56.892 -11.851 1.00 15.42 ? 52  LYS B N     1 
ATOM   1171 C CA    . LYS D 2 52 ? 33.151 57.874 -11.514 1.00 15.85 ? 52  LYS B CA    1 
ATOM   1172 C C     . LYS D 2 52 ? 33.489 59.176 -12.236 1.00 17.47 ? 52  LYS B C     1 
ATOM   1173 O O     . LYS D 2 52 ? 32.601 59.865 -12.738 1.00 18.28 ? 52  LYS B O     1 
ATOM   1174 C CB    . LYS D 2 52 ? 33.091 58.108 -10.000 1.00 20.61 ? 52  LYS B CB    1 
ATOM   1175 C CG    . LYS D 2 52 ? 32.491 56.947 -9.228  1.00 24.20 ? 52  LYS B CG    1 
ATOM   1176 C CD    . LYS D 2 52 ? 32.346 57.249 -7.732  1.00 20.04 ? 52  LYS B CD    1 
ATOM   1177 C CE    . LYS D 2 52 ? 31.645 56.092 -7.022  1.00 20.04 ? 52  LYS B CE    1 
ATOM   1178 N NZ    . LYS D 2 52 ? 31.426 56.345 -5.556  1.00 20.04 ? 52  LYS B NZ    1 
ATOM   1179 N N     . LEU D 2 53 ? 34.780 59.504 -12.282 1.00 16.15 ? 53  LEU B N     1 
ATOM   1180 C CA    . LEU D 2 53 ? 35.262 60.709 -12.952 1.00 17.77 ? 53  LEU B CA    1 
ATOM   1181 C C     . LEU D 2 53 ? 34.918 60.631 -14.440 1.00 16.60 ? 53  LEU B C     1 
ATOM   1182 O O     . LEU D 2 53 ? 34.663 61.656 -15.090 1.00 16.40 ? 53  LEU B O     1 
ATOM   1183 C CB    . LEU D 2 53 ? 36.789 60.826 -12.799 1.00 18.13 ? 53  LEU B CB    1 
ATOM   1184 C CG    . LEU D 2 53 ? 37.518 61.839 -11.899 1.00 22.11 ? 53  LEU B CG    1 
ATOM   1185 C CD1   . LEU D 2 53 ? 36.555 62.760 -11.175 1.00 20.03 ? 53  LEU B CD1   1 
ATOM   1186 C CD2   . LEU D 2 53 ? 38.406 61.086 -10.920 1.00 18.86 ? 53  LEU B CD2   1 
ATOM   1187 N N     . GLN D 2 54 ? 34.917 59.415 -14.982 1.00 14.04 ? 54  GLN B N     1 
ATOM   1188 C CA    . GLN D 2 54 ? 34.601 59.229 -16.394 1.00 17.52 ? 54  GLN B CA    1 
ATOM   1189 C C     . GLN D 2 54 ? 33.108 59.470 -16.624 1.00 18.86 ? 54  GLN B C     1 
ATOM   1190 O O     . GLN D 2 54 ? 32.709 60.049 -17.638 1.00 18.45 ? 54  GLN B O     1 
ATOM   1191 C CB    . GLN D 2 54 ? 34.976 57.821 -16.869 1.00 15.65 ? 54  GLN B CB    1 
ATOM   1192 C CG    . GLN D 2 54 ? 34.596 57.569 -18.331 1.00 18.29 ? 54  GLN B CG    1 
ATOM   1193 C CD    . GLN D 2 54 ? 35.139 56.263 -18.871 1.00 21.45 ? 54  GLN B CD    1 
ATOM   1194 O OE1   . GLN D 2 54 ? 34.973 55.201 -18.261 1.00 22.22 ? 54  GLN B OE1   1 
ATOM   1195 N NE2   . GLN D 2 54 ? 35.792 56.331 -20.027 1.00 21.54 ? 54  GLN B NE2   1 
ATOM   1196 N N     . LYS D 2 55 ? 32.289 59.024 -15.680 1.00 19.08 ? 55  LYS B N     1 
ATOM   1197 C CA    . LYS D 2 55 ? 30.846 59.223 -15.779 1.00 18.89 ? 55  LYS B CA    1 
ATOM   1198 C C     . LYS D 2 55 ? 30.524 60.720 -15.746 1.00 20.81 ? 55  LYS B C     1 
ATOM   1199 O O     . LYS D 2 55 ? 29.522 61.168 -16.313 1.00 20.55 ? 55  LYS B O     1 
ATOM   1200 C CB    . LYS D 2 55 ? 30.131 58.534 -14.614 1.00 19.63 ? 55  LYS B CB    1 
ATOM   1201 C CG    . LYS D 2 55 ? 30.188 57.008 -14.633 1.00 21.57 ? 55  LYS B CG    1 
ATOM   1202 C CD    . LYS D 2 55 ? 29.361 56.427 -13.499 1.00 21.51 ? 55  LYS B CD    1 
ATOM   1203 C CE    . LYS D 2 55 ? 29.275 54.911 -13.597 1.00 21.92 ? 55  LYS B CE    1 
ATOM   1204 N NZ    . LYS D 2 55 ? 28.423 54.336 -12.494 1.00 25.09 ? 55  LYS B NZ    1 
ATOM   1205 N N     . GLU D 2 56 ? 31.378 61.480 -15.065 1.00 20.49 ? 56  GLU B N     1 
ATOM   1206 C CA    . GLU D 2 56 ? 31.196 62.920 -14.935 1.00 21.94 ? 56  GLU B CA    1 
ATOM   1207 C C     . GLU D 2 56 ? 31.892 63.720 -16.038 1.00 21.28 ? 56  GLU B C     1 
ATOM   1208 O O     . GLU D 2 56 ? 31.934 64.946 -15.988 1.00 23.32 ? 56  GLU B O     1 
ATOM   1209 C CB    . GLU D 2 56 ? 31.695 63.374 -13.553 1.00 24.93 ? 56  GLU B CB    1 
ATOM   1210 C CG    . GLU D 2 56 ? 30.971 62.679 -12.396 1.00 31.45 ? 56  GLU B CG    1 
ATOM   1211 C CD    . GLU D 2 56 ? 31.501 63.069 -11.020 1.00 33.69 ? 56  GLU B CD    1 
ATOM   1212 O OE1   . GLU D 2 56 ? 30.936 62.593 -10.012 1.00 36.46 ? 56  GLU B OE1   1 
ATOM   1213 O OE2   . GLU D 2 56 ? 32.479 63.844 -10.942 1.00 37.10 ? 56  GLU B OE2   1 
ATOM   1214 N N     . ASP D 2 57 ? 32.436 63.024 -17.030 1.00 22.91 ? 57  ASP B N     1 
ATOM   1215 C CA    . ASP D 2 57 ? 33.124 63.658 -18.151 1.00 23.78 ? 57  ASP B CA    1 
ATOM   1216 C C     . ASP D 2 57 ? 34.351 64.474 -17.768 1.00 24.66 ? 57  ASP B C     1 
ATOM   1217 O O     . ASP D 2 57 ? 34.663 65.478 -18.416 1.00 23.01 ? 57  ASP B O     1 
ATOM   1218 C CB    . ASP D 2 57 ? 32.167 64.553 -18.940 1.00 26.70 ? 57  ASP B CB    1 
ATOM   1219 C CG    . ASP D 2 57 ? 30.979 63.793 -19.490 1.00 28.98 ? 57  ASP B CG    1 
ATOM   1220 O OD1   . ASP D 2 57 ? 31.148 62.632 -19.919 1.00 29.93 ? 57  ASP B OD1   1 
ATOM   1221 O OD2   . ASP D 2 57 ? 29.875 64.365 -19.501 1.00 33.53 ? 57  ASP B OD2   1 
ATOM   1222 N N     . THR D 2 58 ? 35.048 64.047 -16.723 1.00 22.65 ? 58  THR B N     1 
ATOM   1223 C CA    . THR D 2 58 ? 36.255 64.734 -16.293 1.00 23.34 ? 58  THR B CA    1 
ATOM   1224 C C     . THR D 2 58 ? 37.467 64.038 -16.908 1.00 22.74 ? 58  THR B C     1 
ATOM   1225 O O     . THR D 2 58 ? 38.476 64.674 -17.232 1.00 23.92 ? 58  THR B O     1 
ATOM   1226 C CB    . THR D 2 58 ? 36.373 64.716 -14.764 1.00 23.83 ? 58  THR B CB    1 
ATOM   1227 O OG1   . THR D 2 58 ? 35.271 65.442 -14.207 1.00 22.93 ? 58  THR B OG1   1 
ATOM   1228 C CG2   . THR D 2 58 ? 37.685 65.355 -14.317 1.00 24.06 ? 58  THR B CG2   1 
ATOM   1229 N N     . VAL D 2 59 ? 37.356 62.725 -17.068 1.00 22.46 ? 59  VAL B N     1 
ATOM   1230 C CA    . VAL D 2 59 ? 38.424 61.930 -17.658 1.00 22.00 ? 59  VAL B CA    1 
ATOM   1231 C C     . VAL D 2 59 ? 37.843 61.046 -18.739 1.00 21.83 ? 59  VAL B C     1 
ATOM   1232 O O     . VAL D 2 59 ? 36.629 60.859 -18.812 1.00 21.56 ? 59  VAL B O     1 
ATOM   1233 C CB    . VAL D 2 59 ? 39.112 61.033 -16.610 1.00 21.33 ? 59  VAL B CB    1 
ATOM   1234 C CG1   . VAL D 2 59 ? 39.598 61.880 -15.484 1.00 21.06 ? 59  VAL B CG1   1 
ATOM   1235 C CG2   . VAL D 2 59 ? 38.141 59.972 -16.086 1.00 17.76 ? 59  VAL B CG2   1 
ATOM   1236 N N     . LYS D 2 60 ? 38.719 60.507 -19.576 1.00 21.10 ? 60  LYS B N     1 
ATOM   1237 C CA    . LYS D 2 60 ? 38.321 59.621 -20.654 1.00 21.43 ? 60  LYS B CA    1 
ATOM   1238 C C     . LYS D 2 60 ? 39.297 58.452 -20.627 1.00 20.81 ? 60  LYS B C     1 
ATOM   1239 O O     . LYS D 2 60 ? 40.507 58.656 -20.529 1.00 19.10 ? 60  LYS B O     1 
ATOM   1240 C CB    . LYS D 2 60 ? 38.395 60.357 -21.998 1.00 25.31 ? 60  LYS B CB    1 
ATOM   1241 C CG    . LYS D 2 60 ? 38.196 59.476 -23.208 1.00 28.51 ? 60  LYS B CG    1 
ATOM   1242 C CD    . LYS D 2 60 ? 36.823 58.832 -23.220 1.00 32.80 ? 60  LYS B CD    1 
ATOM   1243 C CE    . LYS D 2 60 ? 36.663 57.911 -24.426 1.00 36.75 ? 60  LYS B CE    1 
ATOM   1244 N NZ    . LYS D 2 60 ? 35.291 57.332 -24.516 1.00 36.78 ? 60  LYS B NZ    1 
ATOM   1245 N N     . MET D 2 61 ? 38.768 57.236 -20.710 1.00 20.18 ? 61  MET B N     1 
ATOM   1246 C CA    . MET D 2 61 ? 39.586 56.031 -20.665 1.00 22.50 ? 61  MET B CA    1 
ATOM   1247 C C     . MET D 2 61 ? 39.730 55.359 -22.024 1.00 24.09 ? 61  MET B C     1 
ATOM   1248 O O     . MET D 2 61 ? 38.769 55.256 -22.785 1.00 25.05 ? 61  MET B O     1 
ATOM   1249 C CB    . MET D 2 61 ? 38.981 55.035 -19.662 1.00 23.62 ? 61  MET B CB    1 
ATOM   1250 C CG    . MET D 2 61 ? 39.798 53.767 -19.415 1.00 26.02 ? 61  MET B CG    1 
ATOM   1251 S SD    . MET D 2 61 ? 39.437 52.406 -20.554 1.00 28.88 ? 61  MET B SD    1 
ATOM   1252 C CE    . MET D 2 61 ? 38.248 51.489 -19.591 1.00 29.47 ? 61  MET B CE    1 
ATOM   1253 N N     . VAL D 2 62 ? 40.946 54.912 -22.315 1.00 23.42 ? 62  VAL B N     1 
ATOM   1254 C CA    . VAL D 2 62 ? 41.242 54.212 -23.555 1.00 24.53 ? 62  VAL B CA    1 
ATOM   1255 C C     . VAL D 2 62 ? 41.680 52.828 -23.125 1.00 26.11 ? 62  VAL B C     1 
ATOM   1256 O O     . VAL D 2 62 ? 42.691 52.671 -22.442 1.00 24.28 ? 62  VAL B O     1 
ATOM   1257 C CB    . VAL D 2 62 ? 42.376 54.896 -24.339 1.00 22.81 ? 62  VAL B CB    1 
ATOM   1258 C CG1   . VAL D 2 62 ? 42.802 54.016 -25.500 1.00 24.38 ? 62  VAL B CG1   1 
ATOM   1259 C CG2   . VAL D 2 62 ? 41.901 56.261 -24.853 1.00 21.58 ? 62  VAL B CG2   1 
ATOM   1260 N N     . PRO D 2 63 ? 40.915 51.799 -23.504 1.00 27.78 ? 63  PRO B N     1 
ATOM   1261 C CA    . PRO D 2 63 ? 41.302 50.447 -23.097 1.00 29.34 ? 63  PRO B CA    1 
ATOM   1262 C C     . PRO D 2 63 ? 42.703 50.042 -23.537 1.00 31.32 ? 63  PRO B C     1 
ATOM   1263 O O     . PRO D 2 63 ? 43.172 50.409 -24.617 1.00 32.92 ? 63  PRO B O     1 
ATOM   1264 C CB    . PRO D 2 63 ? 40.198 49.574 -23.695 1.00 29.99 ? 63  PRO B CB    1 
ATOM   1265 C CG    . PRO D 2 63 ? 39.745 50.357 -24.885 1.00 30.80 ? 63  PRO B CG    1 
ATOM   1266 C CD    . PRO D 2 63 ? 39.726 51.774 -24.372 1.00 29.17 ? 63  PRO B CD    1 
ATOM   1267 N N     . SER D 2 64 ? 43.366 49.301 -22.662 1.00 30.43 ? 64  SER B N     1 
ATOM   1268 C CA    . SER D 2 64 ? 44.713 48.802 -22.873 1.00 31.23 ? 64  SER B CA    1 
ATOM   1269 C C     . SER D 2 64 ? 45.094 48.189 -21.538 1.00 31.51 ? 64  SER B C     1 
ATOM   1270 O O     . SER D 2 64 ? 44.353 48.310 -20.566 1.00 31.52 ? 64  SER B O     1 
ATOM   1271 C CB    . SER D 2 64 ? 45.682 49.936 -23.246 1.00 31.20 ? 64  SER B CB    1 
ATOM   1272 O OG    . SER D 2 64 ? 45.709 50.954 -22.263 1.00 36.05 ? 64  SER B OG    1 
ATOM   1273 N N     . ASN D 2 65 ? 46.243 47.534 -21.479 1.00 30.56 ? 65  ASN B N     1 
ATOM   1274 C CA    . ASN D 2 65 ? 46.659 46.902 -20.243 1.00 30.85 ? 65  ASN B CA    1 
ATOM   1275 C C     . ASN D 2 65 ? 47.957 47.501 -19.724 1.00 29.71 ? 65  ASN B C     1 
ATOM   1276 O O     . ASN D 2 65 ? 49.037 47.204 -20.226 1.00 30.51 ? 65  ASN B O     1 
ATOM   1277 C CB    . ASN D 2 65 ? 46.792 45.395 -20.476 1.00 32.73 ? 65  ASN B CB    1 
ATOM   1278 C CG    . ASN D 2 65 ? 45.511 44.783 -21.034 1.00 34.66 ? 65  ASN B CG    1 
ATOM   1279 O OD1   . ASN D 2 65 ? 44.488 44.708 -20.348 1.00 34.78 ? 65  ASN B OD1   1 
ATOM   1280 N ND2   . ASN D 2 65 ? 45.558 44.360 -22.288 1.00 34.43 ? 65  ASN B ND2   1 
ATOM   1281 N N     . PRO D 2 66 ? 47.862 48.374 -18.709 1.00 28.22 ? 66  PRO B N     1 
ATOM   1282 C CA    . PRO D 2 66 ? 46.621 48.804 -18.057 1.00 26.30 ? 66  PRO B CA    1 
ATOM   1283 C C     . PRO D 2 66 ? 45.917 49.938 -18.811 1.00 25.63 ? 66  PRO B C     1 
ATOM   1284 O O     . PRO D 2 66 ? 46.515 50.601 -19.659 1.00 24.30 ? 66  PRO B O     1 
ATOM   1285 C CB    . PRO D 2 66 ? 47.109 49.256 -16.690 1.00 26.59 ? 66  PRO B CB    1 
ATOM   1286 C CG    . PRO D 2 66 ? 48.390 49.942 -17.048 1.00 28.55 ? 66  PRO B CG    1 
ATOM   1287 C CD    . PRO D 2 66 ? 49.032 48.964 -18.032 1.00 28.48 ? 66  PRO B CD    1 
ATOM   1288 N N     . PRO D 2 67 ? 44.631 50.174 -18.503 1.00 22.85 ? 67  PRO B N     1 
ATOM   1289 C CA    . PRO D 2 67 ? 43.852 51.233 -19.151 1.00 21.87 ? 67  PRO B CA    1 
ATOM   1290 C C     . PRO D 2 67 ? 44.528 52.589 -18.977 1.00 20.16 ? 67  PRO B C     1 
ATOM   1291 O O     . PRO D 2 67 ? 45.072 52.877 -17.915 1.00 19.62 ? 67  PRO B O     1 
ATOM   1292 C CB    . PRO D 2 67 ? 42.513 51.172 -18.420 1.00 21.40 ? 67  PRO B CB    1 
ATOM   1293 C CG    . PRO D 2 67 ? 42.399 49.711 -18.055 1.00 20.82 ? 67  PRO B CG    1 
ATOM   1294 C CD    . PRO D 2 67 ? 43.790 49.387 -17.582 1.00 21.31 ? 67  PRO B CD    1 
ATOM   1295 N N     . LYS D 2 68 ? 44.494 53.406 -20.027 1.00 18.28 ? 68  LYS B N     1 
ATOM   1296 C CA    . LYS D 2 68 ? 45.084 54.740 -20.011 1.00 19.01 ? 68  LYS B CA    1 
ATOM   1297 C C     . LYS D 2 68 ? 43.982 55.749 -19.702 1.00 19.00 ? 68  LYS B C     1 
ATOM   1298 O O     . LYS D 2 68 ? 42.873 55.639 -20.225 1.00 18.52 ? 68  LYS B O     1 
ATOM   1299 C CB    . LYS D 2 68 ? 45.690 55.075 -21.378 1.00 20.16 ? 68  LYS B CB    1 
ATOM   1300 C CG    . LYS D 2 68 ? 46.818 54.160 -21.837 1.00 22.83 ? 68  LYS B CG    1 
ATOM   1301 C CD    . LYS D 2 68 ? 47.353 54.619 -23.200 1.00 26.76 ? 68  LYS B CD    1 
ATOM   1302 C CE    . LYS D 2 68 ? 48.480 53.724 -23.687 1.00 28.08 ? 68  LYS B CE    1 
ATOM   1303 N NZ    . LYS D 2 68 ? 48.030 52.318 -23.843 1.00 30.00 ? 68  LYS B NZ    1 
ATOM   1304 N N     . TRP D 2 69 ? 44.295 56.735 -18.869 1.00 18.49 ? 69  TRP B N     1 
ATOM   1305 C CA    . TRP D 2 69 ? 43.324 57.750 -18.488 1.00 17.32 ? 69  TRP B CA    1 
ATOM   1306 C C     . TRP D 2 69 ? 43.764 59.162 -18.880 1.00 20.69 ? 69  TRP B C     1 
ATOM   1307 O O     . TRP D 2 69 ? 44.765 59.671 -18.365 1.00 19.24 ? 69  TRP B O     1 
ATOM   1308 C CB    . TRP D 2 69 ? 43.083 57.686 -16.975 1.00 16.65 ? 69  TRP B CB    1 
ATOM   1309 C CG    . TRP D 2 69 ? 42.515 56.371 -16.530 1.00 16.30 ? 69  TRP B CG    1 
ATOM   1310 C CD1   . TRP D 2 69 ? 43.203 55.223 -16.281 1.00 14.07 ? 69  TRP B CD1   1 
ATOM   1311 C CD2   . TRP D 2 69 ? 41.123 56.055 -16.353 1.00 15.05 ? 69  TRP B CD2   1 
ATOM   1312 N NE1   . TRP D 2 69 ? 42.327 54.204 -15.963 1.00 12.57 ? 69  TRP B NE1   1 
ATOM   1313 C CE2   . TRP D 2 69 ? 41.045 54.688 -16.002 1.00 14.97 ? 69  TRP B CE2   1 
ATOM   1314 C CE3   . TRP D 2 69 ? 39.936 56.795 -16.461 1.00 18.39 ? 69  TRP B CE3   1 
ATOM   1315 C CZ2   . TRP D 2 69 ? 39.819 54.038 -15.756 1.00 15.49 ? 69  TRP B CZ2   1 
ATOM   1316 C CZ3   . TRP D 2 69 ? 38.714 56.149 -16.217 1.00 16.84 ? 69  TRP B CZ3   1 
ATOM   1317 C CH2   . TRP D 2 69 ? 38.671 54.783 -15.869 1.00 17.32 ? 69  TRP B CH2   1 
ATOM   1318 N N     . PHE D 2 70 ? 43.009 59.779 -19.791 1.00 20.67 ? 70  PHE B N     1 
ATOM   1319 C CA    . PHE D 2 70 ? 43.285 61.142 -20.264 1.00 23.26 ? 70  PHE B CA    1 
ATOM   1320 C C     . PHE D 2 70 ? 42.278 62.145 -19.702 1.00 25.64 ? 70  PHE B C     1 
ATOM   1321 O O     . PHE D 2 70 ? 41.152 61.788 -19.366 1.00 24.54 ? 70  PHE B O     1 
ATOM   1322 C CB    . PHE D 2 70 ? 43.194 61.230 -21.790 1.00 23.40 ? 70  PHE B CB    1 
ATOM   1323 C CG    . PHE D 2 70 ? 44.096 60.287 -22.520 1.00 22.96 ? 70  PHE B CG    1 
ATOM   1324 C CD1   . PHE D 2 70 ? 43.772 58.940 -22.633 1.00 21.24 ? 70  PHE B CD1   1 
ATOM   1325 C CD2   . PHE D 2 70 ? 45.254 60.754 -23.132 1.00 21.72 ? 70  PHE B CD2   1 
ATOM   1326 C CE1   . PHE D 2 70 ? 44.583 58.065 -23.349 1.00 20.67 ? 70  PHE B CE1   1 
ATOM   1327 C CE2   . PHE D 2 70 ? 46.074 59.893 -23.850 1.00 20.12 ? 70  PHE B CE2   1 
ATOM   1328 C CZ    . PHE D 2 70 ? 45.737 58.539 -23.961 1.00 22.92 ? 70  PHE B CZ    1 
ATOM   1329 N N     . LYS D 2 71 ? 42.679 63.409 -19.624 1.00 26.69 ? 71  LYS B N     1 
ATOM   1330 C CA    . LYS D 2 71 ? 41.776 64.443 -19.135 1.00 28.55 ? 71  LYS B CA    1 
ATOM   1331 C C     . LYS D 2 71 ? 40.759 64.661 -20.248 1.00 27.95 ? 71  LYS B C     1 
ATOM   1332 O O     . LYS D 2 71 ? 41.119 64.651 -21.429 1.00 29.68 ? 71  LYS B O     1 
ATOM   1333 C CB    . LYS D 2 71 ? 42.557 65.729 -18.842 1.00 30.54 ? 71  LYS B CB    1 
ATOM   1334 C CG    . LYS D 2 71 ? 41.707 66.882 -18.329 1.00 33.79 ? 71  LYS B CG    1 
ATOM   1335 C CD    . LYS D 2 71 ? 42.560 68.006 -17.732 1.00 35.77 ? 71  LYS B CD    1 
ATOM   1336 C CE    . LYS D 2 71 ? 43.525 68.607 -18.745 1.00 38.22 ? 71  LYS B CE    1 
ATOM   1337 N NZ    . LYS D 2 71 ? 44.168 69.855 -18.226 1.00 40.05 ? 71  LYS B NZ    1 
ATOM   1338 N N     . ASN D 2 72 ? 39.486 64.821 -19.892 1.00 28.64 ? 72  ASN B N     1 
ATOM   1339 C CA    . ASN D 2 72 ? 38.461 65.026 -20.912 1.00 28.00 ? 72  ASN B CA    1 
ATOM   1340 C C     . ASN D 2 72 ? 38.708 66.361 -21.598 1.00 29.14 ? 72  ASN B C     1 
ATOM   1341 O O     . ASN D 2 72 ? 38.989 67.362 -20.940 1.00 27.54 ? 72  ASN B O     1 
ATOM   1342 C CB    . ASN D 2 72 ? 37.058 65.011 -20.299 1.00 29.07 ? 72  ASN B CB    1 
ATOM   1343 C CG    . ASN D 2 72 ? 35.966 65.101 -21.351 1.00 28.05 ? 72  ASN B CG    1 
ATOM   1344 O OD1   . ASN D 2 72 ? 35.883 66.082 -22.092 1.00 30.32 ? 72  ASN B OD1   1 
ATOM   1345 N ND2   . ASN D 2 72 ? 35.126 64.077 -21.426 1.00 31.87 ? 72  ASN B ND2   1 
ATOM   1346 N N     . TYR D 2 73 ? 38.597 66.371 -22.922 1.00 30.87 ? 73  TYR B N     1 
ATOM   1347 C CA    . TYR D 2 73 ? 38.831 67.581 -23.699 1.00 35.13 ? 73  TYR B CA    1 
ATOM   1348 C C     . TYR D 2 73 ? 38.082 68.818 -23.215 1.00 37.48 ? 73  TYR B C     1 
ATOM   1349 O O     . TYR D 2 73 ? 38.507 69.940 -23.487 1.00 39.17 ? 73  TYR B O     1 
ATOM   1350 C CB    . TYR D 2 73 ? 38.534 67.309 -25.178 1.00 33.23 ? 73  TYR B CB    1 
ATOM   1351 C CG    . TYR D 2 73 ? 39.645 66.549 -25.871 1.00 31.50 ? 73  TYR B CG    1 
ATOM   1352 C CD1   . TYR D 2 73 ? 39.363 65.561 -26.812 1.00 32.21 ? 73  TYR B CD1   1 
ATOM   1353 C CD2   . TYR D 2 73 ? 40.982 66.821 -25.586 1.00 30.65 ? 73  TYR B CD2   1 
ATOM   1354 C CE1   . TYR D 2 73 ? 40.388 64.859 -27.450 1.00 30.27 ? 73  TYR B CE1   1 
ATOM   1355 C CE2   . TYR D 2 73 ? 42.011 66.128 -26.220 1.00 29.99 ? 73  TYR B CE2   1 
ATOM   1356 C CZ    . TYR D 2 73 ? 41.705 65.151 -27.148 1.00 30.10 ? 73  TYR B CZ    1 
ATOM   1357 O OH    . TYR D 2 73 ? 42.716 64.470 -27.782 1.00 27.44 ? 73  TYR B OH    1 
ATOM   1358 N N     . ASN D 2 74 ? 36.977 68.630 -22.500 1.00 41.42 ? 74  ASN B N     1 
ATOM   1359 C CA    . ASN D 2 74 ? 36.232 69.777 -21.985 1.00 45.31 ? 74  ASN B CA    1 
ATOM   1360 C C     . ASN D 2 74 ? 37.147 70.581 -21.070 1.00 47.85 ? 74  ASN B C     1 
ATOM   1361 O O     . ASN D 2 74 ? 37.149 71.814 -21.090 1.00 48.07 ? 74  ASN B O     1 
ATOM   1362 C CB    . ASN D 2 74 ? 35.017 69.332 -21.173 1.00 47.09 ? 74  ASN B CB    1 
ATOM   1363 C CG    . ASN D 2 74 ? 33.934 68.718 -22.025 1.00 48.93 ? 74  ASN B CG    1 
ATOM   1364 O OD1   . ASN D 2 74 ? 33.407 69.357 -22.940 1.00 49.81 ? 74  ASN B OD1   1 
ATOM   1365 N ND2   . ASN D 2 74 ? 33.584 67.471 -21.725 1.00 49.59 ? 74  ASN B ND2   1 
ATOM   1366 N N     . CYS D 2 75 ? 37.920 69.864 -20.261 1.00 49.47 ? 75  CYS B N     1 
ATOM   1367 C CA    . CYS D 2 75 ? 38.843 70.485 -19.321 1.00 51.53 ? 75  CYS B CA    1 
ATOM   1368 C C     . CYS D 2 75 ? 40.044 71.093 -20.040 1.00 52.66 ? 75  CYS B C     1 
ATOM   1369 O O     . CYS D 2 75 ? 40.161 70.906 -21.270 1.00 54.37 ? 75  CYS B O     1 
ATOM   1370 C CB    . CYS D 2 75 ? 39.324 69.445 -18.306 1.00 51.77 ? 75  CYS B CB    1 
ATOM   1371 S SG    . CYS D 2 75 ? 37.992 68.503 -17.519 1.00 53.08 ? 75  CYS B SG    1 
ATOM   1372 O OXT   . CYS D 2 75 ? 40.862 71.746 -19.360 1.00 53.71 ? 75  CYS B OXT   1 
HETATM 1373 O O     . HOH E 3 .  ? 34.237 41.216 -18.367 1.00 23.54 ? 10  HOH C O     1 
HETATM 1374 O O     . HOH E 3 .  ? 34.785 39.879 -6.656  1.00 27.55 ? 11  HOH C O     1 
HETATM 1375 O O     . HOH E 3 .  ? 35.300 37.080 -16.176 1.00 21.47 ? 20  HOH C O     1 
HETATM 1376 O O     . HOH E 3 .  ? 43.022 43.170 -7.580  1.00 37.13 ? 35  HOH C O     1 
HETATM 1377 O O     . HOH E 3 .  ? 34.053 41.455 -8.529  1.00 39.32 ? 46  HOH C O     1 
HETATM 1378 O O     . HOH E 3 .  ? 45.902 42.498 -7.625  1.00 40.24 ? 54  HOH C O     1 
HETATM 1379 O O     . HOH E 3 .  ? 40.602 32.583 -5.199  1.00 32.87 ? 58  HOH C O     1 
HETATM 1380 O O     . HOH E 3 .  ? 37.443 39.351 -7.459  1.00 26.47 ? 61  HOH C O     1 
HETATM 1381 O O     . HOH E 3 .  ? 34.372 38.282 -18.579 1.00 33.54 ? 69  HOH C O     1 
HETATM 1382 O O     . HOH E 3 .  ? 41.375 42.581 -9.648  1.00 35.11 ? 80  HOH C O     1 
HETATM 1383 O O     . HOH E 3 .  ? 26.135 41.474 -9.557  1.00 42.20 ? 90  HOH C O     1 
HETATM 1384 O O     . HOH E 3 .  ? 29.569 39.112 -11.083 1.00 37.85 ? 96  HOH C O     1 
HETATM 1385 O O     . HOH E 3 .  ? 39.408 38.772 -3.449  1.00 36.23 ? 99  HOH C O     1 
HETATM 1386 O O     . HOH E 3 .  ? 31.730 39.547 -6.665  1.00 40.82 ? 101 HOH C O     1 
HETATM 1387 O O     . HOH E 3 .  ? 32.862 42.666 -20.757 1.00 39.49 ? 102 HOH C O     1 
HETATM 1388 O O     . HOH E 3 .  ? 28.995 44.973 -18.082 1.00 36.66 ? 103 HOH C O     1 
HETATM 1389 O O     . HOH E 3 .  ? 37.481 34.764 -16.267 1.00 44.68 ? 108 HOH C O     1 
HETATM 1390 O O     . HOH E 3 .  ? 23.579 43.321 -16.151 1.00 32.36 ? 126 HOH C O     1 
HETATM 1391 O O     . HOH E 3 .  ? 26.054 34.908 -11.460 1.00 32.31 ? 141 HOH C O     1 
HETATM 1392 O O     . HOH E 3 .  ? 40.971 34.174 -15.631 1.00 49.84 ? 149 HOH C O     1 
HETATM 1393 O O     . HOH E 3 .  ? 23.424 34.507 -11.248 1.00 45.07 ? 164 HOH C O     1 
HETATM 1394 O O     . HOH E 3 .  ? 28.914 34.530 -11.353 1.00 45.55 ? 167 HOH C O     1 
HETATM 1395 O O     . HOH F 3 .  ? 42.604 45.101 -13.061 1.00 16.52 ? 7   HOH D O     1 
HETATM 1396 O O     . HOH F 3 .  ? 37.708 44.970 -7.395  1.00 24.35 ? 9   HOH D O     1 
HETATM 1397 O O     . HOH F 3 .  ? 35.069 45.383 -7.990  1.00 25.14 ? 13  HOH D O     1 
HETATM 1398 O O     . HOH F 3 .  ? 45.273 39.220 -20.140 1.00 40.33 ? 15  HOH D O     1 
HETATM 1399 O O     . HOH F 3 .  ? 37.038 41.495 -18.694 1.00 29.83 ? 16  HOH D O     1 
HETATM 1400 O O     . HOH F 3 .  ? 45.421 44.881 -13.269 1.00 34.50 ? 19  HOH D O     1 
HETATM 1401 O O     . HOH F 3 .  ? 32.759 45.645 -17.873 1.00 29.56 ? 21  HOH D O     1 
HETATM 1402 O O     . HOH F 3 .  ? 36.646 45.962 -17.280 1.00 23.98 ? 22  HOH D O     1 
HETATM 1403 O O     . HOH F 3 .  ? 28.257 51.550 -11.737 1.00 34.73 ? 31  HOH D O     1 
HETATM 1404 O O     . HOH F 3 .  ? 38.819 37.105 -17.339 1.00 26.78 ? 41  HOH D O     1 
HETATM 1405 O O     . HOH F 3 .  ? 24.502 48.412 -1.240  1.00 35.36 ? 42  HOH D O     1 
HETATM 1406 O O     . HOH F 3 .  ? 34.495 43.345 -6.584  1.00 29.82 ? 43  HOH D O     1 
HETATM 1407 O O     . HOH F 3 .  ? 38.872 42.849 -9.019  1.00 38.35 ? 47  HOH D O     1 
HETATM 1408 O O     . HOH F 3 .  ? 30.978 49.269 -15.616 1.00 31.65 ? 49  HOH D O     1 
HETATM 1409 O O     . HOH F 3 .  ? 43.900 48.635 -12.888 1.00 25.49 ? 51  HOH D O     1 
HETATM 1410 O O     . HOH F 3 .  ? 34.136 48.569 -17.433 1.00 49.13 ? 53  HOH D O     1 
HETATM 1411 O O     . HOH F 3 .  ? 44.066 34.129 -15.480 1.00 47.57 ? 55  HOH D O     1 
HETATM 1412 O O     . HOH F 3 .  ? 37.008 44.267 -19.386 1.00 33.10 ? 74  HOH D O     1 
HETATM 1413 O O     . HOH F 3 .  ? 32.538 52.517 -7.051  1.00 31.62 ? 75  HOH D O     1 
HETATM 1414 O O     . HOH F 3 .  ? 31.605 41.506 -9.106  1.00 40.14 ? 79  HOH D O     1 
HETATM 1415 O O     . HOH F 3 .  ? 46.924 48.217 -13.613 1.00 40.29 ? 82  HOH D O     1 
HETATM 1416 O O     . HOH F 3 .  ? 27.436 42.816 -6.396  1.00 29.45 ? 86  HOH D O     1 
HETATM 1417 O O     . HOH F 3 .  ? 49.999 45.491 -16.512 1.00 48.04 ? 104 HOH D O     1 
HETATM 1418 O O     . HOH F 3 .  ? 42.122 37.612 -17.978 1.00 33.10 ? 109 HOH D O     1 
HETATM 1419 O O     . HOH F 3 .  ? 31.304 48.409 -18.104 1.00 55.61 ? 113 HOH D O     1 
HETATM 1420 O O     . HOH F 3 .  ? 32.064 49.656 -3.200  1.00 53.06 ? 116 HOH D O     1 
HETATM 1421 O O     . HOH F 3 .  ? 30.271 51.087 -10.148 1.00 39.17 ? 119 HOH D O     1 
HETATM 1422 O O     . HOH F 3 .  ? 49.215 43.387 -18.130 1.00 40.85 ? 124 HOH D O     1 
HETATM 1423 O O     . HOH F 3 .  ? 26.157 41.357 -4.757  1.00 36.79 ? 127 HOH D O     1 
HETATM 1424 O O     . HOH F 3 .  ? 49.989 43.003 -15.030 1.00 43.66 ? 130 HOH D O     1 
HETATM 1425 O O     . HOH F 3 .  ? 30.064 52.160 -7.861  1.00 37.63 ? 135 HOH D O     1 
HETATM 1426 O O     . HOH F 3 .  ? 36.388 42.488 -9.139  1.00 51.68 ? 136 HOH D O     1 
HETATM 1427 O O     . HOH F 3 .  ? 30.209 41.514 -6.735  1.00 64.33 ? 158 HOH D O     1 
HETATM 1428 O O     . HOH F 3 .  ? 51.936 44.494 -14.270 1.00 54.14 ? 163 HOH D O     1 
HETATM 1429 O O     . HOH G 3 .  ? 32.474 36.196 0.297   1.00 21.28 ? 76  HOH A O     1 
HETATM 1430 O O     . HOH G 3 .  ? 30.704 31.610 -12.567 1.00 15.69 ? 77  HOH A O     1 
HETATM 1431 O O     . HOH G 3 .  ? 28.112 30.910 -13.178 1.00 18.34 ? 78  HOH A O     1 
HETATM 1432 O O     . HOH G 3 .  ? 26.002 35.446 -2.746  1.00 31.11 ? 79  HOH A O     1 
HETATM 1433 O O     . HOH G 3 .  ? 21.854 26.876 -12.419 1.00 28.55 ? 80  HOH A O     1 
HETATM 1434 O O     . HOH G 3 .  ? 39.940 28.279 -14.298 1.00 25.79 ? 81  HOH A O     1 
HETATM 1435 O O     . HOH G 3 .  ? 40.006 18.000 -8.361  1.00 28.89 ? 82  HOH A O     1 
HETATM 1436 O O     . HOH G 3 .  ? 26.603 37.546 -17.496 1.00 32.59 ? 83  HOH A O     1 
HETATM 1437 O O     . HOH G 3 .  ? 26.139 32.239 -11.806 1.00 25.27 ? 84  HOH A O     1 
HETATM 1438 O O     . HOH G 3 .  ? 43.134 23.723 11.941  1.00 44.08 ? 85  HOH A O     1 
HETATM 1439 O O     . HOH G 3 .  ? 34.881 34.507 -16.378 1.00 29.61 ? 86  HOH A O     1 
HETATM 1440 O O     . HOH G 3 .  ? 28.378 18.002 -16.511 1.00 28.57 ? 87  HOH A O     1 
HETATM 1441 O O     . HOH G 3 .  ? 22.784 16.461 -13.743 1.00 36.20 ? 88  HOH A O     1 
HETATM 1442 O O     . HOH G 3 .  ? 38.323 30.494 -17.594 1.00 39.80 ? 89  HOH A O     1 
HETATM 1443 O O     . HOH G 3 .  ? 29.709 13.629 -5.707  1.00 41.79 ? 90  HOH A O     1 
HETATM 1444 O O     . HOH G 3 .  ? 24.253 30.907 -18.952 1.00 42.69 ? 91  HOH A O     1 
HETATM 1445 O O     . HOH G 3 .  ? 35.430 41.117 -4.437  1.00 35.50 ? 92  HOH A O     1 
HETATM 1446 O O     . HOH G 3 .  ? 40.676 30.990 -15.227 1.00 35.98 ? 93  HOH A O     1 
HETATM 1447 O O     . HOH G 3 .  ? 23.263 29.082 -17.617 1.00 45.70 ? 94  HOH A O     1 
HETATM 1448 O O     . HOH G 3 .  ? 37.515 33.136 0.192   1.00 38.92 ? 95  HOH A O     1 
HETATM 1449 O O     . HOH G 3 .  ? 30.129 24.190 4.577   1.00 55.84 ? 96  HOH A O     1 
HETATM 1450 O O     . HOH G 3 .  ? 39.581 31.439 -7.631  1.00 34.91 ? 97  HOH A O     1 
HETATM 1451 O O     . HOH G 3 .  ? 39.783 15.607 -15.496 1.00 34.66 ? 98  HOH A O     1 
HETATM 1452 O O     . HOH G 3 .  ? 36.130 30.605 -0.879  1.00 37.75 ? 99  HOH A O     1 
HETATM 1453 O O     . HOH G 3 .  ? 26.798 11.701 -12.639 1.00 49.23 ? 100 HOH A O     1 
HETATM 1454 O O     . HOH G 3 .  ? 43.230 22.167 14.699  1.00 63.82 ? 101 HOH A O     1 
HETATM 1455 O O     . HOH G 3 .  ? 38.238 21.164 -17.601 1.00 36.31 ? 102 HOH A O     1 
HETATM 1456 O O     . HOH G 3 .  ? 39.238 24.365 -21.030 1.00 57.11 ? 103 HOH A O     1 
HETATM 1457 O O     . HOH G 3 .  ? 31.814 7.609  -16.171 1.00 52.52 ? 104 HOH A O     1 
HETATM 1458 O O     . HOH G 3 .  ? 32.900 8.370  -18.951 1.00 51.33 ? 105 HOH A O     1 
HETATM 1459 O O     . HOH G 3 .  ? 23.841 20.622 -21.989 1.00 52.95 ? 106 HOH A O     1 
HETATM 1460 O O     . HOH G 3 .  ? 30.947 9.757  -20.503 1.00 50.93 ? 107 HOH A O     1 
HETATM 1461 O O     . HOH G 3 .  ? 44.702 25.776 12.351  1.00 45.73 ? 108 HOH A O     1 
HETATM 1462 O O     . HOH G 3 .  ? 41.302 30.699 -9.791  1.00 38.51 ? 109 HOH A O     1 
HETATM 1463 O O     . HOH G 3 .  ? 39.925 22.253 -19.368 1.00 58.67 ? 110 HOH A O     1 
HETATM 1464 O O     . HOH G 3 .  ? 40.928 32.664 -12.018 1.00 13.73 ? 111 HOH A O     1 
HETATM 1465 O O     . HOH G 3 .  ? 24.072 23.114 -7.938  1.00 48.77 ? 112 HOH A O     1 
HETATM 1466 O O     . HOH G 3 .  ? 43.086 27.065 14.032  1.00 54.70 ? 113 HOH A O     1 
HETATM 1467 O O     . HOH G 3 .  ? 26.239 11.231 -17.411 1.00 36.94 ? 114 HOH A O     1 
HETATM 1468 O O     . HOH G 3 .  ? 43.742 30.725 -8.617  1.00 50.18 ? 115 HOH A O     1 
HETATM 1469 O O     . HOH G 3 .  ? 23.542 22.849 -23.262 1.00 46.94 ? 116 HOH A O     1 
HETATM 1470 O O     . HOH G 3 .  ? 23.369 21.495 -9.789  1.00 42.70 ? 117 HOH A O     1 
HETATM 1471 O O     . HOH G 3 .  ? 45.489 20.091 -14.189 1.00 44.78 ? 118 HOH A O     1 
HETATM 1472 O O     . HOH H 3 .  ? 42.296 51.490 -14.692 1.00 18.02 ? 76  HOH B O     1 
HETATM 1473 O O     . HOH H 3 .  ? 44.889 51.966 -15.371 1.00 15.10 ? 77  HOH B O     1 
HETATM 1474 O O     . HOH H 3 .  ? 32.732 55.172 -16.055 1.00 16.13 ? 78  HOH B O     1 
HETATM 1475 O O     . HOH H 3 .  ? 44.601 53.102 0.592   1.00 23.98 ? 79  HOH B O     1 
HETATM 1476 O O     . HOH H 3 .  ? 46.633 50.644 -13.774 1.00 23.45 ? 80  HOH B O     1 
HETATM 1477 O O     . HOH H 3 .  ? 33.828 68.031 -18.963 1.00 38.34 ? 81  HOH B O     1 
HETATM 1478 O O     . HOH H 3 .  ? 37.536 48.435 -17.955 1.00 23.61 ? 82  HOH B O     1 
HETATM 1479 O O     . HOH H 3 .  ? 34.212 65.564 -11.771 1.00 27.44 ? 83  HOH B O     1 
HETATM 1480 O O     . HOH H 3 .  ? 33.615 53.410 -9.246  1.00 25.40 ? 84  HOH B O     1 
HETATM 1481 O O     . HOH H 3 .  ? 29.353 60.467 -19.301 1.00 34.37 ? 85  HOH B O     1 
HETATM 1482 O O     . HOH H 3 .  ? 53.593 58.026 -9.996  1.00 44.00 ? 86  HOH B O     1 
HETATM 1483 O O     . HOH H 3 .  ? 45.224 64.497 -20.679 1.00 31.35 ? 87  HOH B O     1 
HETATM 1484 O O     . HOH H 3 .  ? 51.828 58.612 -15.084 1.00 33.46 ? 88  HOH B O     1 
HETATM 1485 O O     . HOH H 3 .  ? 47.150 48.940 -4.736  1.00 33.07 ? 89  HOH B O     1 
HETATM 1486 O O     . HOH H 3 .  ? 54.250 55.583 -11.406 1.00 33.89 ? 90  HOH B O     1 
HETATM 1487 O O     . HOH H 3 .  ? 49.025 51.428 -21.060 1.00 34.56 ? 91  HOH B O     1 
HETATM 1488 O O     . HOH H 3 .  ? 41.752 46.994 -20.795 1.00 30.16 ? 92  HOH B O     1 
HETATM 1489 O O     . HOH H 3 .  ? 37.001 54.643 -2.726  1.00 53.54 ? 93  HOH B O     1 
HETATM 1490 O O     . HOH H 3 .  ? 33.988 46.639 -4.210  1.00 39.06 ? 94  HOH B O     1 
HETATM 1491 O O     . HOH H 3 .  ? 48.591 71.194 -22.769 1.00 33.77 ? 95  HOH B O     1 
HETATM 1492 O O     . HOH H 3 .  ? 34.808 52.575 -19.511 1.00 32.35 ? 96  HOH B O     1 
HETATM 1493 O O     . HOH H 3 .  ? 42.069 55.847 2.249   1.00 51.26 ? 97  HOH B O     1 
HETATM 1494 O O     . HOH H 3 .  ? 34.879 55.515 2.519   1.00 38.63 ? 98  HOH B O     1 
HETATM 1495 O O     . HOH H 3 .  ? 36.912 43.750 -5.269  1.00 57.83 ? 99  HOH B O     1 
HETATM 1496 O O     . HOH H 3 .  ? 31.174 58.803 -19.652 1.00 42.63 ? 100 HOH B O     1 
HETATM 1497 O O     . HOH H 3 .  ? 37.095 56.599 10.376  1.00 36.42 ? 101 HOH B O     1 
HETATM 1498 O O     . HOH H 3 .  ? 33.839 58.640 -5.086  1.00 36.10 ? 102 HOH B O     1 
HETATM 1499 O O     . HOH H 3 .  ? 31.727 53.757 -11.176 1.00 31.03 ? 103 HOH B O     1 
HETATM 1500 O O     . HOH H 3 .  ? 54.561 56.669 -13.811 1.00 39.76 ? 104 HOH B O     1 
HETATM 1501 O O     . HOH H 3 .  ? 54.008 53.528 -13.227 1.00 25.45 ? 105 HOH B O     1 
HETATM 1502 O O     . HOH H 3 .  ? 31.931 52.417 -15.784 1.00 36.69 ? 106 HOH B O     1 
HETATM 1503 O O     . HOH H 3 .  ? 31.180 56.408 -18.073 1.00 40.12 ? 107 HOH B O     1 
HETATM 1504 O O     . HOH H 3 .  ? 39.062 47.881 -20.479 1.00 30.43 ? 108 HOH B O     1 
HETATM 1505 O O     . HOH H 3 .  ? 34.814 57.756 9.902   1.00 41.66 ? 109 HOH B O     1 
HETATM 1506 O O     . HOH H 3 .  ? 32.602 66.774 -9.651  1.00 30.79 ? 110 HOH B O     1 
HETATM 1507 O O     . HOH H 3 .  ? 35.027 65.193 -3.012  1.00 45.40 ? 111 HOH B O     1 
HETATM 1508 O O     . HOH H 3 .  ? 53.224 66.441 -22.099 1.00 35.57 ? 112 HOH B O     1 
HETATM 1509 O O     . HOH H 3 .  ? 42.631 71.261 -16.367 1.00 44.36 ? 113 HOH B O     1 
HETATM 1510 O O     . HOH H 3 .  ? 32.810 51.666 -18.205 1.00 37.25 ? 114 HOH B O     1 
HETATM 1511 O O     . HOH H 3 .  ? 49.178 62.701 -11.781 1.00 45.98 ? 115 HOH B O     1 
HETATM 1512 O O     . HOH H 3 .  ? 52.466 55.819 -1.825  1.00 55.64 ? 116 HOH B O     1 
HETATM 1513 O O     . HOH H 3 .  ? 42.866 44.898 -10.537 1.00 41.39 ? 117 HOH B O     1 
HETATM 1514 O O     . HOH H 3 .  ? 51.010 65.271 -18.197 1.00 52.36 ? 118 HOH B O     1 
HETATM 1515 O O     . HOH H 3 .  ? 34.916 65.217 2.992   1.00 43.48 ? 119 HOH B O     1 
HETATM 1516 O O     . HOH H 3 .  ? 30.947 67.447 -22.220 1.00 45.38 ? 120 HOH B O     1 
HETATM 1517 O O     . HOH H 3 .  ? 37.562 52.718 -1.230  1.00 50.60 ? 121 HOH B O     1 
HETATM 1518 O O     . HOH H 3 .  ? 42.336 43.460 -21.586 1.00 46.63 ? 122 HOH B O     1 
HETATM 1519 O O     . HOH H 3 .  ? 54.890 60.812 -5.384  1.00 34.33 ? 123 HOH B O     1 
HETATM 1520 O O     . HOH H 3 .  ? 32.684 51.451 0.472   1.00 57.03 ? 124 HOH B O     1 
HETATM 1521 O O     . HOH H 3 .  ? 31.924 51.362 -13.393 1.00 5.09  ? 125 HOH B O     1 
HETATM 1522 O O     . HOH H 3 .  ? 36.008 60.156 9.283   1.00 44.17 ? 126 HOH B O     1 
HETATM 1523 O O     . HOH H 3 .  ? 54.184 55.055 -15.992 1.00 57.62 ? 127 HOH B O     1 
HETATM 1524 O O     . HOH H 3 .  ? 54.257 51.826 -11.487 1.00 64.88 ? 128 HOH B O     1 
HETATM 1525 O O     . HOH H 3 .  ? 36.156 67.202 -5.146  1.00 42.79 ? 129 HOH B O     1 
HETATM 1526 O O     . HOH H 3 .  ? 33.819 54.434 -4.296  1.00 58.42 ? 130 HOH B O     1 
HETATM 1527 O O     . HOH H 3 .  ? 28.938 54.473 -18.104 1.00 48.39 ? 131 HOH B O     1 
HETATM 1528 O O     . HOH H 3 .  ? 46.180 65.255 -5.681  1.00 38.19 ? 132 HOH B O     1 
HETATM 1529 O O     . HOH H 3 .  ? 31.626 66.645 -7.186  1.00 53.63 ? 133 HOH B O     1 
HETATM 1530 O O     . HOH H 3 .  ? 38.682 45.401 -21.258 1.00 43.77 ? 134 HOH B O     1 
HETATM 1531 O O     . HOH H 3 .  ? 34.594 61.795 -20.457 1.00 46.53 ? 135 HOH B O     1 
HETATM 1532 O O     . HOH H 3 .  ? 44.059 47.876 -4.527  1.00 39.16 ? 136 HOH B O     1 
HETATM 1533 O O     . HOH H 3 .  ? 30.810 70.766 -21.828 1.00 40.25 ? 137 HOH B O     1 
HETATM 1534 O O     . HOH H 3 .  ? 31.679 68.626 -20.081 1.00 63.00 ? 138 HOH B O     1 
HETATM 1535 O O     . HOH H 3 .  ? 51.363 52.168 -15.432 1.00 44.26 ? 139 HOH B O     1 
HETATM 1536 O O     . HOH H 3 .  ? 48.865 57.285 1.845   1.00 49.75 ? 140 HOH B O     1 
HETATM 1537 O O     . HOH H 3 .  ? 47.790 67.938 -5.608  1.00 63.47 ? 141 HOH B O     1 
HETATM 1538 O O     . HOH H 3 .  ? 29.090 51.600 -14.042 1.00 40.40 ? 142 HOH B O     1 
HETATM 1539 O O     . HOH H 3 .  ? 42.558 70.231 -22.957 1.00 47.30 ? 143 HOH B O     1 
HETATM 1540 O O     . HOH H 3 .  ? 39.329 42.884 -21.747 1.00 67.77 ? 144 HOH B O     1 
HETATM 1541 O O     . HOH H 3 .  ? 42.794 57.025 5.635   1.00 54.01 ? 145 HOH B O     1 
HETATM 1542 O O     . HOH H 3 .  ? 50.797 65.875 -15.089 1.00 55.61 ? 146 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  DT  1  0  ?  ?   ?   C . n 
A 1 2  DC  2  1  1  DC  C   C . n 
A 1 3  DG  3  2  2  DG  G   C . n 
A 1 4  DC  4  3  3  DC  C   C . n 
A 1 5  DG  5  4  4  DG  G   C . n 
A 1 6  DC  6  5  5  DC  C   C . n 
A 1 7  DG  7  6  6  DG  G   C . n 
B 1 1  DT  1  0  ?  ?   ?   D . n 
B 1 2  DC  2  1  1  DC  C   D . n 
B 1 3  DG  3  2  2  DG  G   D . n 
B 1 4  DC  4  3  3  DC  C   D . n 
B 1 5  DG  5  4  4  DG  G   D . n 
B 1 6  DC  6  5  5  DC  C   D . n 
B 1 7  DG  7  6  6  DG  G   D . n 
C 2 1  MET 1  1  ?  ?   ?   A . n 
C 2 2  ASP 2  2  ?  ?   ?   A . n 
C 2 3  LEU 3  3  ?  ?   ?   A . n 
C 2 4  LEU 4  4  ?  ?   ?   A . n 
C 2 5  SER 5  5  ?  ?   ?   A . n 
C 2 6  CYS 6  6  6  CYS CYS A . n 
C 2 7  THR 7  7  7  THR THR A . n 
C 2 8  VAL 8  8  8  VAL VAL A . n 
C 2 9  ASN 9  9  9  ASN ASN A . n 
C 2 10 ASP 10 10 10 ASP ASP A . n 
C 2 11 ALA 11 11 11 ALA ALA A . n 
C 2 12 GLU 12 12 12 GLU GLU A . n 
C 2 13 ILE 13 13 13 ILE ILE A . n 
C 2 14 PHE 14 14 14 PHE PHE A . n 
C 2 15 SER 15 15 15 SER SER A . n 
C 2 16 LEU 16 16 16 LEU LEU A . n 
C 2 17 VAL 17 17 17 VAL VAL A . n 
C 2 18 LYS 18 18 18 LYS LYS A . n 
C 2 19 LYS 19 19 19 LYS LYS A . n 
C 2 20 GLU 20 20 20 GLU GLU A . n 
C 2 21 VAL 21 21 21 VAL VAL A . n 
C 2 22 LEU 22 22 22 LEU LEU A . n 
C 2 23 SER 23 23 23 SER SER A . n 
C 2 24 LEU 24 24 24 LEU LEU A . n 
C 2 25 ASN 25 25 25 ASN ASN A . n 
C 2 26 THR 26 26 26 THR THR A . n 
C 2 27 ASN 27 27 27 ASN ASN A . n 
C 2 28 ASP 28 28 28 ASP ASP A . n 
C 2 29 TYR 29 29 29 TYR TYR A . n 
C 2 30 THR 30 30 30 THR THR A . n 
C 2 31 THR 31 31 31 THR THR A . n 
C 2 32 ALA 32 32 32 ALA ALA A . n 
C 2 33 ILE 33 33 33 ILE ILE A . n 
C 2 34 SER 34 34 34 SER SER A . n 
C 2 35 LEU 35 35 35 LEU LEU A . n 
C 2 36 SER 36 36 36 SER SER A . n 
C 2 37 ASN 37 37 37 ASN ASN A . n 
C 2 38 ARG 38 38 38 ARG ARG A . n 
C 2 39 LEU 39 39 39 LEU LEU A . n 
C 2 40 LYS 40 40 40 LYS LYS A . n 
C 2 41 ILE 41 41 41 ILE ILE A . n 
C 2 42 ASN 42 42 42 ASN ASN A . n 
C 2 43 LYS 43 43 43 LYS LYS A . n 
C 2 44 LYS 44 44 44 LYS LYS A . n 
C 2 45 LYS 45 45 45 LYS LYS A . n 
C 2 46 ILE 46 46 46 ILE ILE A . n 
C 2 47 ASN 47 47 47 ASN ASN A . n 
C 2 48 GLN 48 48 48 GLN GLN A . n 
C 2 49 GLN 49 49 49 GLN GLN A . n 
C 2 50 LEU 50 50 50 LEU LEU A . n 
C 2 51 TYR 51 51 51 TYR TYR A . n 
C 2 52 LYS 52 52 52 LYS LYS A . n 
C 2 53 LEU 53 53 53 LEU LEU A . n 
C 2 54 GLN 54 54 54 GLN GLN A . n 
C 2 55 LYS 55 55 55 LYS LYS A . n 
C 2 56 GLU 56 56 56 GLU GLU A . n 
C 2 57 ASP 57 57 57 ASP ASP A . n 
C 2 58 THR 58 58 58 THR THR A . n 
C 2 59 VAL 59 59 59 VAL VAL A . n 
C 2 60 LYS 60 60 60 LYS LYS A . n 
C 2 61 MET 61 61 61 MET MET A . n 
C 2 62 VAL 62 62 62 VAL VAL A . n 
C 2 63 PRO 63 63 63 PRO PRO A . n 
C 2 64 SER 64 64 64 SER SER A . n 
C 2 65 ASN 65 65 65 ASN ASN A . n 
C 2 66 PRO 66 66 66 PRO PRO A . n 
C 2 67 PRO 67 67 67 PRO PRO A . n 
C 2 68 LYS 68 68 68 LYS LYS A . n 
C 2 69 TRP 69 69 69 TRP TRP A . n 
C 2 70 PHE 70 70 70 PHE PHE A . n 
C 2 71 LYS 71 71 71 LYS LYS A . n 
C 2 72 ASN 72 72 72 ASN ASN A . n 
C 2 73 TYR 73 73 73 TYR TYR A . n 
C 2 74 ASN 74 74 74 ASN ASN A . n 
C 2 75 CYS 75 75 75 CYS CYS A . n 
D 2 1  MET 1  1  ?  ?   ?   B . n 
D 2 2  ASP 2  2  ?  ?   ?   B . n 
D 2 3  LEU 3  3  ?  ?   ?   B . n 
D 2 4  LEU 4  4  ?  ?   ?   B . n 
D 2 5  SER 5  5  ?  ?   ?   B . n 
D 2 6  CYS 6  6  6  CYS CYS B . n 
D 2 7  THR 7  7  7  THR THR B . n 
D 2 8  VAL 8  8  8  VAL VAL B . n 
D 2 9  ASN 9  9  9  ASN ASN B . n 
D 2 10 ASP 10 10 10 ASP ASP B . n 
D 2 11 ALA 11 11 11 ALA ALA B . n 
D 2 12 GLU 12 12 12 GLU GLU B . n 
D 2 13 ILE 13 13 13 ILE ILE B . n 
D 2 14 PHE 14 14 14 PHE PHE B . n 
D 2 15 SER 15 15 15 SER SER B . n 
D 2 16 LEU 16 16 16 LEU LEU B . n 
D 2 17 VAL 17 17 17 VAL VAL B . n 
D 2 18 LYS 18 18 18 LYS LYS B . n 
D 2 19 LYS 19 19 19 LYS LYS B . n 
D 2 20 GLU 20 20 20 GLU GLU B . n 
D 2 21 VAL 21 21 21 VAL VAL B . n 
D 2 22 LEU 22 22 22 LEU LEU B . n 
D 2 23 SER 23 23 23 SER SER B . n 
D 2 24 LEU 24 24 24 LEU LEU B . n 
D 2 25 ASN 25 25 25 ASN ASN B . n 
D 2 26 THR 26 26 26 THR THR B . n 
D 2 27 ASN 27 27 27 ASN ASN B . n 
D 2 28 ASP 28 28 28 ASP ASP B . n 
D 2 29 TYR 29 29 29 TYR TYR B . n 
D 2 30 THR 30 30 30 THR THR B . n 
D 2 31 THR 31 31 31 THR THR B . n 
D 2 32 ALA 32 32 32 ALA ALA B . n 
D 2 33 ILE 33 33 33 ILE ILE B . n 
D 2 34 SER 34 34 34 SER SER B . n 
D 2 35 LEU 35 35 35 LEU LEU B . n 
D 2 36 SER 36 36 36 SER SER B . n 
D 2 37 ASN 37 37 37 ASN ASN B . n 
D 2 38 ARG 38 38 38 ARG ARG B . n 
D 2 39 LEU 39 39 39 LEU LEU B . n 
D 2 40 LYS 40 40 40 LYS GLY B . n 
D 2 41 ILE 41 41 41 ILE ILE B . n 
D 2 42 ASN 42 42 42 ASN ASN B . n 
D 2 43 LYS 43 43 43 LYS LYS B . n 
D 2 44 LYS 44 44 44 LYS LYS B . n 
D 2 45 LYS 45 45 45 LYS LYS B . n 
D 2 46 ILE 46 46 46 ILE ILE B . n 
D 2 47 ASN 47 47 47 ASN ASN B . n 
D 2 48 GLN 48 48 48 GLN GLN B . n 
D 2 49 GLN 49 49 49 GLN GLN B . n 
D 2 50 LEU 50 50 50 LEU LEU B . n 
D 2 51 TYR 51 51 51 TYR TYR B . n 
D 2 52 LYS 52 52 52 LYS LYS B . n 
D 2 53 LEU 53 53 53 LEU LEU B . n 
D 2 54 GLN 54 54 54 GLN GLN B . n 
D 2 55 LYS 55 55 55 LYS LYS B . n 
D 2 56 GLU 56 56 56 GLU GLU B . n 
D 2 57 ASP 57 57 57 ASP ASP B . n 
D 2 58 THR 58 58 58 THR THR B . n 
D 2 59 VAL 59 59 59 VAL VAL B . n 
D 2 60 LYS 60 60 60 LYS LYS B . n 
D 2 61 MET 61 61 61 MET MET B . n 
D 2 62 VAL 62 62 62 VAL VAL B . n 
D 2 63 PRO 63 63 63 PRO PRO B . n 
D 2 64 SER 64 64 64 SER SER B . n 
D 2 65 ASN 65 65 65 ASN ASN B . n 
D 2 66 PRO 66 66 66 PRO PRO B . n 
D 2 67 PRO 67 67 67 PRO PRO B . n 
D 2 68 LYS 68 68 68 LYS LYS B . n 
D 2 69 TRP 69 69 69 TRP TRP B . n 
D 2 70 PHE 70 70 70 PHE PHE B . n 
D 2 71 LYS 71 71 71 LYS LYS B . n 
D 2 72 ASN 72 72 72 ASN ASN B . n 
D 2 73 TYR 73 73 73 TYR TYR B . n 
D 2 74 ASN 74 74 74 ASN ASN B . n 
D 2 75 CYS 75 75 75 CYS CYS B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-08-17 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000  'data collection' . ? 1 
SCALEPACK 'data scaling'    . ? 2 
SOLVE     phasing           . ? 3 
CNS       refinement        . ? 4 
HKL-2000  'data reduction'  . ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASN A 9  ? ? -54.98 -123.61 
2 1 PRO A 63 ? ? -55.60 65.35   
3 1 THR B 26 ? ? -29.56 -67.43  
4 1 SER B 64 ? ? 172.44 173.64  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 C DC  1  ? P   ? A DC  2  P   
2  1 Y 1 C DC  1  ? OP1 ? A DC  2  OP1 
3  1 Y 1 C DC  1  ? OP2 ? A DC  2  OP2 
4  1 Y 1 D DC  1  ? P   ? B DC  2  P   
5  1 Y 1 D DC  1  ? OP1 ? B DC  2  OP1 
6  1 Y 1 D DC  1  ? OP2 ? B DC  2  OP2 
7  1 Y 1 A THR 7  ? OG1 ? C THR 7  OG1 
8  1 Y 1 A THR 7  ? CG2 ? C THR 7  CG2 
9  1 Y 1 A VAL 8  ? CG1 ? C VAL 8  CG1 
10 1 Y 1 A VAL 8  ? CG2 ? C VAL 8  CG2 
11 1 Y 1 A ASN 9  ? CG  ? C ASN 9  CG  
12 1 Y 1 A ASN 9  ? OD1 ? C ASN 9  OD1 
13 1 Y 1 A ASN 9  ? ND2 ? C ASN 9  ND2 
14 1 Y 1 B LYS 40 ? CB  ? D LYS 40 CB  
15 1 Y 1 B LYS 40 ? CG  ? D LYS 40 CG  
16 1 Y 1 B LYS 40 ? CD  ? D LYS 40 CD  
17 1 Y 1 B LYS 40 ? CE  ? D LYS 40 CE  
18 1 Y 1 B LYS 40 ? NZ  ? D LYS 40 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 C DT  0 ? A DT  1 
2  1 Y 1 D DT  0 ? B DT  1 
3  1 Y 1 A MET 1 ? C MET 1 
4  1 Y 1 A ASP 2 ? C ASP 2 
5  1 Y 1 A LEU 3 ? C LEU 3 
6  1 Y 1 A LEU 4 ? C LEU 4 
7  1 Y 1 A SER 5 ? C SER 5 
8  1 Y 1 B MET 1 ? D MET 1 
9  1 Y 1 B ASP 2 ? D ASP 2 
10 1 Y 1 B LEU 3 ? D LEU 3 
11 1 Y 1 B LEU 4 ? D LEU 4 
12 1 Y 1 B SER 5 ? D SER 5 
# 
_ndb_struct_conf_na.entry_id   1SFU 
_ndb_struct_conf_na.feature    'z-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DC 2 1_555 B DG 7 1_555 -0.189 -0.157 0.085 3.886  0.008  1.788 1 C_DC1:DG6_D C 1 ? D 6 ? 19 1 
1 A DG 3 1_555 B DC 6 1_555 0.361  -0.160 0.056 -2.597 -3.648 3.334 2 C_DG2:DC5_D C 2 ? D 5 ? 19 1 
1 A DC 4 1_555 B DG 5 1_555 -0.278 -0.121 0.263 2.975  0.926  1.761 3 C_DC3:DG4_D C 3 ? D 4 ? 19 1 
1 A DG 5 1_555 B DC 4 1_555 0.402  -0.114 0.092 -0.492 5.051  1.909 4 C_DG4:DC3_D C 4 ? D 3 ? 19 1 
1 A DC 6 1_555 B DG 3 1_555 -0.232 -0.056 0.241 -2.166 1.063  1.760 5 C_DC5:DG2_D C 5 ? D 2 ? 19 1 
1 A DG 7 1_555 B DC 2 1_555 0.194  -0.149 0.071 3.287  9.146  4.999 6 C_DG6:DC1_D C 6 ? D 1 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DC 2 1_555 B DG 7 1_555 A DG 3 1_555 B DC 6 1_555 0.027  5.402  3.778 2.151  0.222  -5.268  -55.808 14.187 3.274 -2.294  
22.204 -5.695  1 CC_DC1DG2:DC5DG6_DD C 1 ? D 6 ? C 2 ? D 5 ? 
1 A DG 3 1_555 B DC 6 1_555 A DC 4 1_555 B DG 5 1_555 0.238  -1.320 3.421 -3.274 -4.131 -49.111 1.898   0.033  3.315 4.953   
-3.926 -49.376 2 CC_DG2DC3:DG4DC5_DD C 2 ? D 5 ? C 3 ? D 4 ? 
1 A DC 4 1_555 B DG 5 1_555 A DG 5 1_555 B DC 4 1_555 0.076  5.283  3.586 4.069  -0.711 -8.749  -29.687 9.842  3.599 4.355   
24.927 -9.674  3 CC_DC3DG4:DC3DG4_DD C 3 ? D 4 ? C 4 ? D 3 ? 
1 A DG 5 1_555 B DC 4 1_555 A DC 6 1_555 B DG 3 1_555 -0.146 -1.162 3.431 -2.143 -7.775 -51.373 1.859   -0.313 3.227 8.906   
-2.455 -51.960 4 CC_DG4DC5:DG2DC3_DD C 4 ? D 3 ? C 5 ? D 2 ? 
1 A DC 6 1_555 B DG 3 1_555 A DG 7 1_555 B DC 2 1_555 0.265  5.316  3.365 2.366  1.833  -9.910  -32.260 5.080  2.223 -10.306 
13.305 -10.351 5 CC_DC5DG6:DC1DG2_DD C 5 ? D 2 ? C 6 ? D 1 ? 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 HOH 1  10  10  HOH HOH C . 
E 3 HOH 2  11  11  HOH HOH C . 
E 3 HOH 3  20  20  HOH HOH C . 
E 3 HOH 4  35  35  HOH HOH C . 
E 3 HOH 5  46  46  HOH HOH C . 
E 3 HOH 6  54  54  HOH HOH C . 
E 3 HOH 7  58  58  HOH HOH C . 
E 3 HOH 8  61  61  HOH HOH C . 
E 3 HOH 9  69  69  HOH HOH C . 
E 3 HOH 10 80  80  HOH HOH C . 
E 3 HOH 11 90  90  HOH HOH C . 
E 3 HOH 12 96  96  HOH HOH C . 
E 3 HOH 13 99  99  HOH HOH C . 
E 3 HOH 14 101 101 HOH HOH C . 
E 3 HOH 15 102 102 HOH HOH C . 
E 3 HOH 16 103 103 HOH HOH C . 
E 3 HOH 17 108 108 HOH HOH C . 
E 3 HOH 18 126 126 HOH HOH C . 
E 3 HOH 19 141 141 HOH HOH C . 
E 3 HOH 20 149 149 HOH HOH C . 
E 3 HOH 21 164 164 HOH HOH C . 
E 3 HOH 22 167 167 HOH HOH C . 
F 3 HOH 1  7   7   HOH HOH D . 
F 3 HOH 2  9   9   HOH HOH D . 
F 3 HOH 3  13  13  HOH HOH D . 
F 3 HOH 4  15  15  HOH HOH D . 
F 3 HOH 5  16  16  HOH HOH D . 
F 3 HOH 6  19  19  HOH HOH D . 
F 3 HOH 7  21  21  HOH HOH D . 
F 3 HOH 8  22  22  HOH HOH D . 
F 3 HOH 9  31  31  HOH HOH D . 
F 3 HOH 10 41  41  HOH HOH D . 
F 3 HOH 11 42  42  HOH HOH D . 
F 3 HOH 12 43  43  HOH HOH D . 
F 3 HOH 13 47  47  HOH HOH D . 
F 3 HOH 14 49  49  HOH HOH D . 
F 3 HOH 15 51  51  HOH HOH D . 
F 3 HOH 16 53  53  HOH HOH D . 
F 3 HOH 17 55  55  HOH HOH D . 
F 3 HOH 18 74  74  HOH HOH D . 
F 3 HOH 19 75  75  HOH HOH D . 
F 3 HOH 20 79  79  HOH HOH D . 
F 3 HOH 21 82  82  HOH HOH D . 
F 3 HOH 22 86  86  HOH HOH D . 
F 3 HOH 23 104 104 HOH HOH D . 
F 3 HOH 24 109 109 HOH HOH D . 
F 3 HOH 25 113 113 HOH HOH D . 
F 3 HOH 26 116 116 HOH HOH D . 
F 3 HOH 27 119 119 HOH HOH D . 
F 3 HOH 28 124 124 HOH HOH D . 
F 3 HOH 29 127 127 HOH HOH D . 
F 3 HOH 30 130 130 HOH HOH D . 
F 3 HOH 31 135 135 HOH HOH D . 
F 3 HOH 32 136 136 HOH HOH D . 
F 3 HOH 33 158 158 HOH HOH D . 
F 3 HOH 34 163 163 HOH HOH D . 
G 3 HOH 1  76  1   HOH HOH A . 
G 3 HOH 2  77  5   HOH HOH A . 
G 3 HOH 3  78  8   HOH HOH A . 
G 3 HOH 4  79  12  HOH HOH A . 
G 3 HOH 5  80  14  HOH HOH A . 
G 3 HOH 6  81  17  HOH HOH A . 
G 3 HOH 7  82  18  HOH HOH A . 
G 3 HOH 8  83  28  HOH HOH A . 
G 3 HOH 9  84  38  HOH HOH A . 
G 3 HOH 10 85  48  HOH HOH A . 
G 3 HOH 11 86  56  HOH HOH A . 
G 3 HOH 12 87  60  HOH HOH A . 
G 3 HOH 13 88  62  HOH HOH A . 
G 3 HOH 14 89  65  HOH HOH A . 
G 3 HOH 15 90  67  HOH HOH A . 
G 3 HOH 16 91  68  HOH HOH A . 
G 3 HOH 17 92  73  HOH HOH A . 
G 3 HOH 18 93  76  HOH HOH A . 
G 3 HOH 19 94  84  HOH HOH A . 
G 3 HOH 20 95  93  HOH HOH A . 
G 3 HOH 21 96  94  HOH HOH A . 
G 3 HOH 22 97  95  HOH HOH A . 
G 3 HOH 23 98  98  HOH HOH A . 
G 3 HOH 24 99  105 HOH HOH A . 
G 3 HOH 25 100 107 HOH HOH A . 
G 3 HOH 26 101 110 HOH HOH A . 
G 3 HOH 27 102 111 HOH HOH A . 
G 3 HOH 28 103 115 HOH HOH A . 
G 3 HOH 29 104 121 HOH HOH A . 
G 3 HOH 30 105 123 HOH HOH A . 
G 3 HOH 31 106 138 HOH HOH A . 
G 3 HOH 32 107 139 HOH HOH A . 
G 3 HOH 33 108 143 HOH HOH A . 
G 3 HOH 34 109 144 HOH HOH A . 
G 3 HOH 35 110 148 HOH HOH A . 
G 3 HOH 36 111 153 HOH HOH A . 
G 3 HOH 37 112 154 HOH HOH A . 
G 3 HOH 38 113 157 HOH HOH A . 
G 3 HOH 39 114 161 HOH HOH A . 
G 3 HOH 40 115 162 HOH HOH A . 
G 3 HOH 41 116 169 HOH HOH A . 
G 3 HOH 42 117 170 HOH HOH A . 
G 3 HOH 43 118 171 HOH HOH A . 
H 3 HOH 1  76  2   HOH HOH B . 
H 3 HOH 2  77  3   HOH HOH B . 
H 3 HOH 3  78  4   HOH HOH B . 
H 3 HOH 4  79  6   HOH HOH B . 
H 3 HOH 5  80  23  HOH HOH B . 
H 3 HOH 6  81  24  HOH HOH B . 
H 3 HOH 7  82  25  HOH HOH B . 
H 3 HOH 8  83  26  HOH HOH B . 
H 3 HOH 9  84  27  HOH HOH B . 
H 3 HOH 10 85  29  HOH HOH B . 
H 3 HOH 11 86  30  HOH HOH B . 
H 3 HOH 12 87  32  HOH HOH B . 
H 3 HOH 13 88  33  HOH HOH B . 
H 3 HOH 14 89  34  HOH HOH B . 
H 3 HOH 15 90  36  HOH HOH B . 
H 3 HOH 16 91  37  HOH HOH B . 
H 3 HOH 17 92  39  HOH HOH B . 
H 3 HOH 18 93  40  HOH HOH B . 
H 3 HOH 19 94  44  HOH HOH B . 
H 3 HOH 20 95  45  HOH HOH B . 
H 3 HOH 21 96  50  HOH HOH B . 
H 3 HOH 22 97  52  HOH HOH B . 
H 3 HOH 23 98  57  HOH HOH B . 
H 3 HOH 24 99  59  HOH HOH B . 
H 3 HOH 25 100 63  HOH HOH B . 
H 3 HOH 26 101 64  HOH HOH B . 
H 3 HOH 27 102 66  HOH HOH B . 
H 3 HOH 28 103 70  HOH HOH B . 
H 3 HOH 29 104 71  HOH HOH B . 
H 3 HOH 30 105 72  HOH HOH B . 
H 3 HOH 31 106 77  HOH HOH B . 
H 3 HOH 32 107 78  HOH HOH B . 
H 3 HOH 33 108 81  HOH HOH B . 
H 3 HOH 34 109 83  HOH HOH B . 
H 3 HOH 35 110 85  HOH HOH B . 
H 3 HOH 36 111 87  HOH HOH B . 
H 3 HOH 37 112 88  HOH HOH B . 
H 3 HOH 38 113 89  HOH HOH B . 
H 3 HOH 39 114 91  HOH HOH B . 
H 3 HOH 40 115 92  HOH HOH B . 
H 3 HOH 41 116 97  HOH HOH B . 
H 3 HOH 42 117 100 HOH HOH B . 
H 3 HOH 43 118 106 HOH HOH B . 
H 3 HOH 44 119 112 HOH HOH B . 
H 3 HOH 45 120 114 HOH HOH B . 
H 3 HOH 46 121 117 HOH HOH B . 
H 3 HOH 47 122 118 HOH HOH B . 
H 3 HOH 48 123 120 HOH HOH B . 
H 3 HOH 49 124 122 HOH HOH B . 
H 3 HOH 50 125 125 HOH HOH B . 
H 3 HOH 51 126 128 HOH HOH B . 
H 3 HOH 52 127 129 HOH HOH B . 
H 3 HOH 53 128 131 HOH HOH B . 
H 3 HOH 54 129 132 HOH HOH B . 
H 3 HOH 55 130 133 HOH HOH B . 
H 3 HOH 56 131 134 HOH HOH B . 
H 3 HOH 57 132 137 HOH HOH B . 
H 3 HOH 58 133 140 HOH HOH B . 
H 3 HOH 59 134 142 HOH HOH B . 
H 3 HOH 60 135 145 HOH HOH B . 
H 3 HOH 61 136 146 HOH HOH B . 
H 3 HOH 62 137 147 HOH HOH B . 
H 3 HOH 63 138 150 HOH HOH B . 
H 3 HOH 64 139 151 HOH HOH B . 
H 3 HOH 65 140 152 HOH HOH B . 
H 3 HOH 66 141 155 HOH HOH B . 
H 3 HOH 67 142 156 HOH HOH B . 
H 3 HOH 68 143 159 HOH HOH B . 
H 3 HOH 69 144 160 HOH HOH B . 
H 3 HOH 70 145 165 HOH HOH B . 
H 3 HOH 71 146 166 HOH HOH B . 
#