data_1SHC
# 
_entry.id   1SHC 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1SHC         
WWPDB D_1000176371 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1SHC 
_pdbx_database_status.recvd_initial_deposition_date   1996-03-27 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Zhou, M.-M.'        1  
'Ravichandran, K.S.' 2  
'Olejniczak, E.T.'   3  
'Petros, A.M.'       4  
'Meadows, R.P.'      5  
'Sattler, M.'        6  
'Harlan, J.E.'       7  
'Wade, W.S.'         8  
'Burakoff, S.J.'     9  
'Fesik, S.W.'        10 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structure and ligand recognition of the phosphotyrosine binding domain of Shc.'                                   Nature 
378 584   592 1995 NATUAS UK 0028-0836 0006 ? 8524391 10.1038/378584a0 
1       'Structural Basis for Il-4 Receptor Phosphopeptide Recognition by the Irs-1 Ptb Domain'                            
Nat.Struct.Biol. 3   388   ?   1996 NSBIEW US 1072-8368 2024 ? ?       ?                
2       'Specificity of the Ptb Domain of Shc for Beta Turn-Forming Pentapeptide Motifs Amino-Terminal to Phosphotyrosine' 
J.Biol.Chem.     270 18205 ?   1995 JBCHA3 US 0021-9258 0071 ? ?       ?                
3       'An Alternative to Sh2 Domains for Binding Tyrosine-Phosphorylated Proteins'                                       Science 
266 1862  ?   1994 SCIEAS US 0036-8075 0038 ? ?       ?                
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Zhou, M.M.'         1  
primary 'Ravichandran, K.S.' 2  
primary 'Olejniczak, E.F.'   3  
primary 'Petros, A.M.'       4  
primary 'Meadows, R.P.'      5  
primary 'Sattler, M.'        6  
primary 'Harlan, J.E.'       7  
primary 'Wade, W.S.'         8  
primary 'Burakoff, S.J.'     9  
primary 'Fesik, S.W.'        10 
1       'Zhou, M.M.'         11 
1       'Huang, B.'          12 
1       'Olejniczak, E.T.'   13 
1       'Meadows, R.P.'      14 
1       'Shuker, S.B.'       15 
1       'Miyazaki, M.'       16 
1       'Trub, T.'           17 
1       'Shoelson, S.E.'     18 
1       'Fesik, S.W.'        19 
2       'Trub, T.'           20 
2       'Choi, W.E.'         21 
2       'Wolf, G.'           22 
2       'Ottinger, E.'       23 
2       'Chen, Y.'           24 
2       'Weiss, M.'          25 
2       'Shoelson, S.E.'     26 
3       'Kavanaugh, W.M.'    27 
3       'Williams, L.T.'     28 
# 
_cell.entry_id           1SHC 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1SHC 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man SHC                            21409.584 1 ? ? 'PTB DOMAIN' ? 
2 polymer man 'TRKA RECEPTOR PHOSPHOPEPTIDE' 1514.508  1 ? ? ?            ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;GSHMGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALDFNTRTQVTREAISLVCEAVPGA
KGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSSLNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPV
NQRACHILECPEGLAQDVISTIGQAFELRFKQYLR
;
;GSHMGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALDFNTRTQVTREAISLVCEAVPGA
KGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSSLNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPV
NQRACHILECPEGLAQDVISTIGQAFELRFKQYLR
;
A ? 
2 'polypeptide(L)' no yes 'HIIENPQ(PTR)FSDA' HIIENPQYFSDA B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   HIS n 
1 4   MET n 
1 5   GLY n 
1 6   GLN n 
1 7   LEU n 
1 8   GLY n 
1 9   GLY n 
1 10  GLU n 
1 11  GLU n 
1 12  TRP n 
1 13  THR n 
1 14  ARG n 
1 15  HIS n 
1 16  GLY n 
1 17  SER n 
1 18  PHE n 
1 19  VAL n 
1 20  ASN n 
1 21  LYS n 
1 22  PRO n 
1 23  THR n 
1 24  ARG n 
1 25  GLY n 
1 26  TRP n 
1 27  LEU n 
1 28  HIS n 
1 29  PRO n 
1 30  ASN n 
1 31  ASP n 
1 32  LYS n 
1 33  VAL n 
1 34  MET n 
1 35  GLY n 
1 36  PRO n 
1 37  GLY n 
1 38  VAL n 
1 39  SER n 
1 40  TYR n 
1 41  LEU n 
1 42  VAL n 
1 43  ARG n 
1 44  TYR n 
1 45  MET n 
1 46  GLY n 
1 47  CYS n 
1 48  VAL n 
1 49  GLU n 
1 50  VAL n 
1 51  LEU n 
1 52  GLN n 
1 53  SER n 
1 54  MET n 
1 55  ARG n 
1 56  ALA n 
1 57  LEU n 
1 58  ASP n 
1 59  PHE n 
1 60  ASN n 
1 61  THR n 
1 62  ARG n 
1 63  THR n 
1 64  GLN n 
1 65  VAL n 
1 66  THR n 
1 67  ARG n 
1 68  GLU n 
1 69  ALA n 
1 70  ILE n 
1 71  SER n 
1 72  LEU n 
1 73  VAL n 
1 74  CYS n 
1 75  GLU n 
1 76  ALA n 
1 77  VAL n 
1 78  PRO n 
1 79  GLY n 
1 80  ALA n 
1 81  LYS n 
1 82  GLY n 
1 83  ALA n 
1 84  THR n 
1 85  ARG n 
1 86  ARG n 
1 87  ARG n 
1 88  LYS n 
1 89  PRO n 
1 90  CYS n 
1 91  SER n 
1 92  ARG n 
1 93  PRO n 
1 94  LEU n 
1 95  SER n 
1 96  SER n 
1 97  ILE n 
1 98  LEU n 
1 99  GLY n 
1 100 ARG n 
1 101 SER n 
1 102 ASN n 
1 103 LEU n 
1 104 LYS n 
1 105 PHE n 
1 106 ALA n 
1 107 GLY n 
1 108 MET n 
1 109 PRO n 
1 110 ILE n 
1 111 THR n 
1 112 LEU n 
1 113 THR n 
1 114 VAL n 
1 115 SER n 
1 116 THR n 
1 117 SER n 
1 118 SER n 
1 119 LEU n 
1 120 ASN n 
1 121 LEU n 
1 122 MET n 
1 123 ALA n 
1 124 ALA n 
1 125 ASP n 
1 126 CYS n 
1 127 LYS n 
1 128 GLN n 
1 129 ILE n 
1 130 ILE n 
1 131 ALA n 
1 132 ASN n 
1 133 HIS n 
1 134 HIS n 
1 135 MET n 
1 136 GLN n 
1 137 SER n 
1 138 ILE n 
1 139 SER n 
1 140 PHE n 
1 141 ALA n 
1 142 SER n 
1 143 GLY n 
1 144 GLY n 
1 145 ASP n 
1 146 PRO n 
1 147 ASP n 
1 148 THR n 
1 149 ALA n 
1 150 GLU n 
1 151 TYR n 
1 152 VAL n 
1 153 ALA n 
1 154 TYR n 
1 155 VAL n 
1 156 ALA n 
1 157 LYS n 
1 158 ASP n 
1 159 PRO n 
1 160 VAL n 
1 161 ASN n 
1 162 GLN n 
1 163 ARG n 
1 164 ALA n 
1 165 CYS n 
1 166 HIS n 
1 167 ILE n 
1 168 LEU n 
1 169 GLU n 
1 170 CYS n 
1 171 PRO n 
1 172 GLU n 
1 173 GLY n 
1 174 LEU n 
1 175 ALA n 
1 176 GLN n 
1 177 ASP n 
1 178 VAL n 
1 179 ILE n 
1 180 SER n 
1 181 THR n 
1 182 ILE n 
1 183 GLY n 
1 184 GLN n 
1 185 ALA n 
1 186 PHE n 
1 187 GLU n 
1 188 LEU n 
1 189 ARG n 
1 190 PHE n 
1 191 LYS n 
1 192 GLN n 
1 193 TYR n 
1 194 LEU n 
1 195 ARG n 
2 1   HIS n 
2 2   ILE n 
2 3   ILE n 
2 4   GLU n 
2 5   ASN n 
2 6   PRO n 
2 7   GLN n 
2 8   PTR n 
2 9   PHE n 
2 10  SER n 
2 11  ASP n 
2 12  ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'PTB DOMAIN OF SHC' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'BL21 (DE3)' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            BL21 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 'PTB DOMAIN OF SHC' 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET15B 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 UNP SHC_HUMAN   1 P29353 1 
;MNLLPPKPKYNPLRNESLSSMEEGASGSTPPEELPSPPASSLGPILPPLPGDDSPTTLCSFFPRMSNLRLANPAGGRPGS
KGEPGRAADDGEGIVGAAMPDSGPLPLLQDMNKLSGGGGRRTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGV
SYLVRYMGCVEVLQSMRALDFNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSS
LNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDVISTIGQAFELRFKQYLRNPP
KLVTPHDRMAGFDGSAWDEEEEEPPDHQYYNDFPGKEPPLGGVVDMRLREGAAPGAARPTAPNAQTPSHLGATLPVGQPV
GGDPEVRKQMPPPPPCPGRELFDDPSYVNVQNLDKARQAVGGAGPPNPAINGSAPRDLFDMKPFEDALRVPPPPQSVSMA
EQLRGEPWFHGKLSRREAEALLQLNGDFLVRESTTTPGQYVLTGLQSGQPKHLLLVDPEGVVRTKDHRFESVSHLISYHM
DNHLPIISAGSELCLQQPVERKL
;
? 
2 UNP NTRK1_HUMAN 2 P04629 1 
;MLRGGRRGQLGWHSWAAGPGSLLAWLILASAGAAPCPDACCPHGSSGLRCTRDGALDSLHHLPGAENLTELYIENQQHLQ
HLELRDLRGLGELRNLTIVKSGLRFVAPDAFHFTPRLSRLNLSFNALESLSWKTVQGLSLQELVLSGNPLHCSCALRWLQ
RWEEEGLGGVPEQKLQCHGQGPLAHMPNASCGVPTLKVQVPNASVDVGDDVLLRCQVEGRGLEQAGWILTELEQSATVMK
SGGLPSLGLTLANVTSDLNRKNLTCWAENDVGRAEVSVQVNVSFPASVQLHTAVEMHHWCIPFSVDGQPAPSLRWLFNGS
VLNETSFIFTEFLEPAANETVRHGCLRLNQPTHVNNGNYTLLAANPFGQASASIMAAFMDNPFEFNPEDPIPVSFSPVDT
NSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPTE
GKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQRE
AELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVY
LAGLHFVHRDLATRNCLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEI
FTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVLG
;
? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1SHC A 1 ? 195 ? P29353 126 ? 317 ? 13  207 
2 2 1SHC B 1 ? 12  ? P04629 489 ? 500 ? 483 494 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1SHC MET A 4 ? UNP P29353 GLY 126 CONFLICT           16  1 
2 1SHC PTR B 8 ? UNP P04629 TYR 496 'MODIFIED RESIDUE' 490 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE           ?                 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE          ?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE        ?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'   ?                 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE          ?                 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE         ?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'   ?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE           ?                 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE         ?                 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE        ?                 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE           ?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE            ?                 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE        ?                 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE     ?                 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE           ?                 'C5 H9 N O2'     115.130 
PTR 'L-peptide linking' n O-PHOSPHOTYROSINE PHOSPHONOTYROSINE 'C9 H12 N O6 P'  261.168 
SER 'L-peptide linking' y SERINE            ?                 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE         ?                 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN        ?                 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE          ?                 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE            ?                 'C5 H11 N O2'    117.146 
# 
_pdbx_nmr_refine.entry_id           1SHC 
_pdbx_nmr_refine.method             ? 
_pdbx_nmr_refine.details            'SET OF IDEAL BOND LENGTHS AND ANGLES WERE USED DURING REFINEMENT: PARALLHDG.PRO IN X-PLOR.' 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                             1SHC 
_pdbx_nmr_ensemble.conformers_calculated_total_number   ? 
_pdbx_nmr_ensemble.conformers_submitted_total_number    1 
_pdbx_nmr_ensemble.conformer_selection_criteria         ? 
# 
_pdbx_nmr_software.classification   refinement 
_pdbx_nmr_software.name             X-PLOR 
_pdbx_nmr_software.version          ? 
_pdbx_nmr_software.authors          BRUNGER 
_pdbx_nmr_software.ordinal          1 
# 
_exptl.entry_id          1SHC 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1SHC 
_struct.title                     'SHC PTB DOMAIN COMPLEXED WITH A TRKA RECEPTOR PHOSPHOPEPTIDE, NMR, MINIMIZED AVERAGE STRUCTURE' 
_struct.pdbx_descriptor           'SHC, TRKA RECEPTOR PHOSPHOPEPTIDE' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1SHC 
_struct_keywords.pdbx_keywords   'COMPLEX (SIGNAL TRANSDUCTION/PEPTIDE)' 
_struct_keywords.text            
'COMPLEX (SIGNAL TRANSDUCTION-PEPTIDE), PHOSPHOTYROSINE BINDING DOMAIN (PTB), COMPLEX (SIGNAL TRANSDUCTION-PEPTIDE) complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 HIS A 28  ? MET A 34  ? HIS A 40  MET A 46  1 ? 7  
HELX_P HELX_P2 2 THR A 61  ? ALA A 76  ? THR A 73  ALA A 88  1 ? 16 
HELX_P HELX_P3 3 ALA A 175 ? GLU A 187 ? ALA A 187 GLU A 199 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? B PTR 8 N ? ? ? 1_555 B GLN 7 C ? ? B PTR 490 B GLN 489 1_555 ? ? ? ? ? ? ? 1.304 ? 
covale2 covale ? ? B PTR 8 C ? ? ? 1_555 B PHE 9 N ? ? B PTR 490 B PHE 491 1_555 ? ? ? ? ? ? ? 1.305 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLY A 99  ? ASN A 102 ? GLY A 111 ASN A 114 
A 2 CYS A 47  ? VAL A 50  ? CYS A 59  VAL A 62  
A 3 ALA A 164 ? LEU A 168 ? ALA A 176 LEU A 180 
A 4 VAL A 152 ? ALA A 156 ? VAL A 164 ALA A 168 
A 5 PHE A 140 ? SER A 142 ? PHE A 152 SER A 154 
B 1 GLN A 128 ? ILE A 130 ? GLN A 140 ILE A 142 
B 2 SER A 118 ? ALA A 123 ? SER A 130 ALA A 135 
B 3 ALA A 106 ? SER A 115 ? ALA A 118 SER A 127 
B 4 VAL A 38  ? MET A 45  ? VAL A 50  MET A 57  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ARG A 100 ? O ARG A 112 N GLU A 49  ? N GLU A 61  
A 2 3 O VAL A 48  ? O VAL A 60  N CYS A 165 ? N CYS A 177 
A 3 4 O ALA A 164 ? O ALA A 176 N ALA A 156 ? N ALA A 168 
A 4 5 O ALA A 153 ? O ALA A 165 N SER A 142 ? N SER A 154 
B 1 2 O GLN A 128 ? O GLN A 140 N ALA A 123 ? N ALA A 135 
B 2 3 O SER A 118 ? O SER A 130 N SER A 115 ? N SER A 127 
B 3 4 O GLY A 107 ? O GLY A 119 N TYR A 44  ? N TYR A 56  
# 
_database_PDB_matrix.entry_id          1SHC 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1SHC 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N    . GLY A 1 1   ? -44.206 10.505  -12.834 1.00 25.56 ? 13  GLY A N    1 
ATOM   2    C CA   . GLY A 1 1   ? -44.501 9.371   -11.914 1.00 25.44 ? 13  GLY A CA   1 
ATOM   3    C C    . GLY A 1 1   ? -43.909 9.666   -10.534 1.00 24.86 ? 13  GLY A C    1 
ATOM   4    O O    . GLY A 1 1   ? -43.116 8.907   -10.013 1.00 24.63 ? 13  GLY A O    1 
ATOM   5    H H1   . GLY A 1 1   ? -43.184 10.698  -12.830 1.00 25.65 ? 13  GLY A H1   1 
ATOM   6    H H2   . GLY A 1 1   ? -44.508 10.256  -13.798 1.00 25.38 ? 13  GLY A H2   1 
ATOM   7    H H3   . GLY A 1 1   ? -44.720 11.351  -12.518 1.00 25.81 ? 13  GLY A H3   1 
ATOM   8    H HA2  . GLY A 1 1   ? -45.571 9.246   -11.827 1.00 25.86 ? 13  GLY A HA2  1 
ATOM   9    H HA3  . GLY A 1 1   ? -44.064 8.465   -12.307 1.00 25.44 ? 13  GLY A HA3  1 
ATOM   10   N N    . SER A 1 2   ? -44.287 10.764  -9.939  1.00 24.71 ? 14  SER A N    1 
ATOM   11   C CA   . SER A 1 2   ? -43.745 11.108  -8.594  1.00 24.24 ? 14  SER A CA   1 
ATOM   12   C C    . SER A 1 2   ? -44.812 10.842  -7.529  1.00 23.55 ? 14  SER A C    1 
ATOM   13   O O    . SER A 1 2   ? -45.971 11.159  -7.707  1.00 23.67 ? 14  SER A O    1 
ATOM   14   C CB   . SER A 1 2   ? -43.354 12.586  -8.565  1.00 24.45 ? 14  SER A CB   1 
ATOM   15   O OG   . SER A 1 2   ? -42.107 12.754  -9.226  1.00 24.58 ? 14  SER A OG   1 
ATOM   16   H H    . SER A 1 2   ? -44.927 11.363  -10.376 1.00 24.97 ? 14  SER A H    1 
ATOM   17   H HA   . SER A 1 2   ? -42.875 10.501  -8.390  1.00 24.35 ? 14  SER A HA   1 
ATOM   18   H HB2  . SER A 1 2   ? -44.105 13.169  -9.071  1.00 24.36 ? 14  SER A HB2  1 
ATOM   19   H HB3  . SER A 1 2   ? -43.277 12.917  -7.538  1.00 24.67 ? 14  SER A HB3  1 
ATOM   20   H HG   . SER A 1 2   ? -41.512 13.208  -8.626  1.00 24.99 ? 14  SER A HG   1 
ATOM   21   N N    . HIS A 1 3   ? -44.430 10.261  -6.424  1.00 22.93 ? 15  HIS A N    1 
ATOM   22   C CA   . HIS A 1 3   ? -45.424 9.976   -5.351  1.00 22.34 ? 15  HIS A CA   1 
ATOM   23   C C    . HIS A 1 3   ? -44.728 9.290   -4.174  1.00 21.91 ? 15  HIS A C    1 
ATOM   24   O O    . HIS A 1 3   ? -45.042 9.537   -3.026  1.00 21.69 ? 15  HIS A O    1 
ATOM   25   C CB   . HIS A 1 3   ? -46.517 9.058   -5.900  1.00 22.19 ? 15  HIS A CB   1 
ATOM   26   C CG   . HIS A 1 3   ? -45.910 8.079   -6.867  1.00 21.90 ? 15  HIS A CG   1 
ATOM   27   N ND1  . HIS A 1 3   ? -45.898 8.302   -8.234  1.00 21.86 ? 15  HIS A ND1  1 
ATOM   28   C CD2  . HIS A 1 3   ? -45.290 6.869   -6.679  1.00 21.74 ? 15  HIS A CD2  1 
ATOM   29   C CE1  . HIS A 1 3   ? -45.289 7.250   -8.812  1.00 21.70 ? 15  HIS A CE1  1 
ATOM   30   N NE2  . HIS A 1 3   ? -44.898 6.347   -7.908  1.00 21.63 ? 15  HIS A NE2  1 
ATOM   31   H H    . HIS A 1 3   ? -43.490 10.013  -6.300  1.00 22.92 ? 15  HIS A H    1 
ATOM   32   H HA   . HIS A 1 3   ? -45.867 10.903  -5.016  1.00 22.45 ? 15  HIS A HA   1 
ATOM   33   H HB2  . HIS A 1 3   ? -46.979 8.521   -5.085  1.00 22.47 ? 15  HIS A HB2  1 
ATOM   34   H HB3  . HIS A 1 3   ? -47.263 9.650   -6.409  1.00 22.13 ? 15  HIS A HB3  1 
ATOM   35   H HD1  . HIS A 1 3   ? -46.265 9.084   -8.697  1.00 22.00 ? 15  HIS A HD1  1 
ATOM   36   H HD2  . HIS A 1 3   ? -45.129 6.394   -5.722  1.00 21.79 ? 15  HIS A HD2  1 
ATOM   37   H HE1  . HIS A 1 3   ? -45.135 7.149   -9.876  1.00 21.72 ? 15  HIS A HE1  1 
ATOM   38   N N    . MET A 1 4   ? -43.785 8.429   -4.447  1.00 21.90 ? 16  MET A N    1 
ATOM   39   C CA   . MET A 1 4   ? -43.072 7.729   -3.341  1.00 21.63 ? 16  MET A CA   1 
ATOM   40   C C    . MET A 1 4   ? -42.495 8.762   -2.369  1.00 20.88 ? 16  MET A C    1 
ATOM   41   O O    . MET A 1 4   ? -43.051 9.019   -1.320  1.00 20.84 ? 16  MET A O    1 
ATOM   42   C CB   . MET A 1 4   ? -41.941 6.878   -3.921  1.00 22.25 ? 16  MET A CB   1 
ATOM   43   C CG   . MET A 1 4   ? -42.476 5.486   -4.266  1.00 22.81 ? 16  MET A CG   1 
ATOM   44   S SD   . MET A 1 4   ? -41.278 4.616   -5.308  1.00 23.23 ? 16  MET A SD   1 
ATOM   45   C CE   . MET A 1 4   ? -42.015 5.033   -6.907  1.00 23.43 ? 16  MET A CE   1 
ATOM   46   H H    . MET A 1 4   ? -43.547 8.242   -5.379  1.00 22.15 ? 16  MET A H    1 
ATOM   47   H HA   . MET A 1 4   ? -43.767 7.091   -2.814  1.00 21.63 ? 16  MET A HA   1 
ATOM   48   H HB2  . MET A 1 4   ? -41.558 7.350   -4.815  1.00 22.46 ? 16  MET A HB2  1 
ATOM   49   H HB3  . MET A 1 4   ? -41.148 6.787   -3.194  1.00 22.18 ? 16  MET A HB3  1 
ATOM   50   H HG2  . MET A 1 4   ? -42.633 4.926   -3.356  1.00 22.86 ? 16  MET A HG2  1 
ATOM   51   H HG3  . MET A 1 4   ? -43.412 5.581   -4.796  1.00 23.02 ? 16  MET A HG3  1 
ATOM   52   H HE1  . MET A 1 4   ? -43.089 5.102   -6.800  1.00 23.60 ? 16  MET A HE1  1 
ATOM   53   H HE2  . MET A 1 4   ? -41.620 5.979   -7.249  1.00 23.47 ? 16  MET A HE2  1 
ATOM   54   H HE3  . MET A 1 4   ? -41.777 4.265   -7.625  1.00 23.43 ? 16  MET A HE3  1 
ATOM   55   N N    . GLY A 1 5   ? -41.383 9.357   -2.707  1.00 20.39 ? 17  GLY A N    1 
ATOM   56   C CA   . GLY A 1 5   ? -40.777 10.371  -1.799  1.00 19.76 ? 17  GLY A CA   1 
ATOM   57   C C    . GLY A 1 5   ? -40.584 11.688  -2.554  1.00 19.26 ? 17  GLY A C    1 
ATOM   58   O O    . GLY A 1 5   ? -39.669 12.434  -2.272  1.00 19.28 ? 17  GLY A O    1 
ATOM   59   H H    . GLY A 1 5   ? -40.948 9.138   -3.557  1.00 20.51 ? 17  GLY A H    1 
ATOM   60   H HA2  . GLY A 1 5   ? -41.432 10.532  -0.953  1.00 19.85 ? 17  GLY A HA2  1 
ATOM   61   H HA3  . GLY A 1 5   ? -39.820 10.017  -1.450  1.00 19.69 ? 17  GLY A HA3  1 
ATOM   62   N N    . GLN A 1 6   ? -41.448 11.964  -3.506  1.00 18.91 ? 18  GLN A N    1 
ATOM   63   C CA   . GLN A 1 6   ? -41.362 13.225  -4.317  1.00 18.54 ? 18  GLN A CA   1 
ATOM   64   C C    . GLN A 1 6   ? -39.905 13.547  -4.682  1.00 18.16 ? 18  GLN A C    1 
ATOM   65   O O    . GLN A 1 6   ? -39.047 12.688  -4.660  1.00 18.27 ? 18  GLN A O    1 
ATOM   66   C CB   . GLN A 1 6   ? -42.010 14.393  -3.544  1.00 18.54 ? 18  GLN A CB   1 
ATOM   67   C CG   . GLN A 1 6   ? -41.172 14.799  -2.321  1.00 18.72 ? 18  GLN A CG   1 
ATOM   68   C CD   . GLN A 1 6   ? -41.676 14.052  -1.083  1.00 19.29 ? 18  GLN A CD   1 
ATOM   69   O OE1  . GLN A 1 6   ? -40.904 13.443  -0.370  1.00 19.50 ? 18  GLN A OE1  1 
ATOM   70   N NE2  . GLN A 1 6   ? -42.948 14.078  -0.792  1.00 19.64 ? 18  GLN A NE2  1 
ATOM   71   H H    . GLN A 1 6   ? -42.170 11.328  -3.693  1.00 18.99 ? 18  GLN A H    1 
ATOM   72   H HA   . GLN A 1 6   ? -41.914 13.075  -5.234  1.00 18.68 ? 18  GLN A HA   1 
ATOM   73   H HB2  . GLN A 1 6   ? -42.107 15.242  -4.203  1.00 18.75 ? 18  GLN A HB2  1 
ATOM   74   H HB3  . GLN A 1 6   ? -42.993 14.091  -3.214  1.00 18.34 ? 18  GLN A HB3  1 
ATOM   75   H HG2  . GLN A 1 6   ? -40.134 14.567  -2.487  1.00 18.61 ? 18  GLN A HG2  1 
ATOM   76   H HG3  . GLN A 1 6   ? -41.277 15.860  -2.158  1.00 18.68 ? 18  GLN A HG3  1 
ATOM   77   H HE21 . GLN A 1 6   ? -43.572 14.572  -1.365  1.00 19.53 ? 18  GLN A HE21 1 
ATOM   78   H HE22 . GLN A 1 6   ? -43.280 13.603  -0.002  1.00 20.08 ? 18  GLN A HE22 1 
ATOM   79   N N    . LEU A 1 7   ? -39.620 14.776  -5.020  1.00 17.83 ? 19  LEU A N    1 
ATOM   80   C CA   . LEU A 1 7   ? -38.223 15.144  -5.386  1.00 17.59 ? 19  LEU A CA   1 
ATOM   81   C C    . LEU A 1 7   ? -37.757 14.282  -6.562  1.00 17.60 ? 19  LEU A C    1 
ATOM   82   O O    . LEU A 1 7   ? -38.488 13.452  -7.065  1.00 17.96 ? 19  LEU A O    1 
ATOM   83   C CB   . LEU A 1 7   ? -37.300 14.910  -4.189  1.00 17.60 ? 19  LEU A CB   1 
ATOM   84   C CG   . LEU A 1 7   ? -36.992 16.245  -3.510  1.00 17.61 ? 19  LEU A CG   1 
ATOM   85   C CD1  . LEU A 1 7   ? -38.291 17.021  -3.291  1.00 17.75 ? 19  LEU A CD1  1 
ATOM   86   C CD2  . LEU A 1 7   ? -36.323 15.986  -2.158  1.00 17.78 ? 19  LEU A CD2  1 
ATOM   87   H H    . LEU A 1 7   ? -40.324 15.457  -5.035  1.00 17.84 ? 19  LEU A H    1 
ATOM   88   H HA   . LEU A 1 7   ? -38.187 16.186  -5.669  1.00 17.55 ? 19  LEU A HA   1 
ATOM   89   H HB2  . LEU A 1 7   ? -37.785 14.250  -3.484  1.00 17.70 ? 19  LEU A HB2  1 
ATOM   90   H HB3  . LEU A 1 7   ? -36.379 14.460  -4.528  1.00 17.62 ? 19  LEU A HB3  1 
ATOM   91   H HG   . LEU A 1 7   ? -36.329 16.824  -4.137  1.00 17.58 ? 19  LEU A HG   1 
ATOM   92   H HD11 . LEU A 1 7   ? -39.070 16.339  -2.983  1.00 17.84 ? 19  LEU A HD11 1 
ATOM   93   H HD12 . LEU A 1 7   ? -38.141 17.766  -2.525  1.00 17.74 ? 19  LEU A HD12 1 
ATOM   94   H HD13 . LEU A 1 7   ? -38.581 17.505  -4.212  1.00 17.88 ? 19  LEU A HD13 1 
ATOM   95   H HD21 . LEU A 1 7   ? -36.630 15.020  -1.785  1.00 18.14 ? 19  LEU A HD21 1 
ATOM   96   H HD22 . LEU A 1 7   ? -35.250 16.002  -2.278  1.00 17.67 ? 19  LEU A HD22 1 
ATOM   97   H HD23 . LEU A 1 7   ? -36.619 16.753  -1.457  1.00 17.76 ? 19  LEU A HD23 1 
ATOM   98   N N    . GLY A 1 8   ? -36.544 14.473  -7.004  1.00 17.33 ? 20  GLY A N    1 
ATOM   99   C CA   . GLY A 1 8   ? -36.030 13.667  -8.148  1.00 17.49 ? 20  GLY A CA   1 
ATOM   100  C C    . GLY A 1 8   ? -34.871 12.775  -7.687  1.00 17.05 ? 20  GLY A C    1 
ATOM   101  O O    . GLY A 1 8   ? -34.572 11.770  -8.301  1.00 17.35 ? 20  GLY A O    1 
ATOM   102  H H    . GLY A 1 8   ? -35.972 15.149  -6.585  1.00 17.13 ? 20  GLY A H    1 
ATOM   103  H HA2  . GLY A 1 8   ? -36.826 13.049  -8.537  1.00 17.76 ? 20  GLY A HA2  1 
ATOM   104  H HA3  . GLY A 1 8   ? -35.679 14.330  -8.925  1.00 17.79 ? 20  GLY A HA3  1 
ATOM   105  N N    . GLY A 1 9   ? -34.214 13.128  -6.614  1.00 16.48 ? 21  GLY A N    1 
ATOM   106  C CA   . GLY A 1 9   ? -33.078 12.292  -6.130  1.00 16.19 ? 21  GLY A CA   1 
ATOM   107  C C    . GLY A 1 9   ? -33.559 11.349  -5.024  1.00 15.84 ? 21  GLY A C    1 
ATOM   108  O O    . GLY A 1 9   ? -32.794 10.937  -4.174  1.00 15.96 ? 21  GLY A O    1 
ATOM   109  H H    . GLY A 1 9   ? -34.462 13.941  -6.128  1.00 16.34 ? 21  GLY A H    1 
ATOM   110  H HA2  . GLY A 1 9   ? -32.685 11.712  -6.953  1.00 16.50 ? 21  GLY A HA2  1 
ATOM   111  H HA3  . GLY A 1 9   ? -32.302 12.932  -5.739  1.00 16.06 ? 21  GLY A HA3  1 
ATOM   112  N N    . GLU A 1 10  ? -34.819 11.000  -5.024  1.00 15.57 ? 22  GLU A N    1 
ATOM   113  C CA   . GLU A 1 10  ? -35.336 10.083  -3.969  1.00 15.40 ? 22  GLU A CA   1 
ATOM   114  C C    . GLU A 1 10  ? -36.670 9.480   -4.415  1.00 15.72 ? 22  GLU A C    1 
ATOM   115  O O    . GLU A 1 10  ? -37.519 9.164   -3.605  1.00 16.08 ? 22  GLU A O    1 
ATOM   116  C CB   . GLU A 1 10  ? -35.539 10.858  -2.664  1.00 15.50 ? 22  GLU A CB   1 
ATOM   117  C CG   . GLU A 1 10  ? -36.103 12.248  -2.970  1.00 15.58 ? 22  GLU A CG   1 
ATOM   118  C CD   . GLU A 1 10  ? -34.998 13.294  -2.809  1.00 15.81 ? 22  GLU A CD   1 
ATOM   119  O OE1  . GLU A 1 10  ? -34.766 13.714  -1.688  1.00 15.89 ? 22  GLU A OE1  1 
ATOM   120  O OE2  . GLU A 1 10  ? -34.405 13.659  -3.811  1.00 16.05 ? 22  GLU A OE2  1 
ATOM   121  H H    . GLU A 1 10  ? -35.422 11.340  -5.717  1.00 15.57 ? 22  GLU A H    1 
ATOM   122  H HA   . GLU A 1 10  ? -34.622 9.289   -3.805  1.00 15.16 ? 22  GLU A HA   1 
ATOM   123  H HB2  . GLU A 1 10  ? -36.230 10.320  -2.032  1.00 15.67 ? 22  GLU A HB2  1 
ATOM   124  H HB3  . GLU A 1 10  ? -34.592 10.961  -2.156  1.00 15.51 ? 22  GLU A HB3  1 
ATOM   125  H HG2  . GLU A 1 10  ? -36.479 12.271  -3.982  1.00 15.46 ? 22  GLU A HG2  1 
ATOM   126  H HG3  . GLU A 1 10  ? -36.906 12.468  -2.283  1.00 15.75 ? 22  GLU A HG3  1 
ATOM   127  N N    . GLU A 1 11  ? -36.863 9.315   -5.695  1.00 15.74 ? 23  GLU A N    1 
ATOM   128  C CA   . GLU A 1 11  ? -38.143 8.729   -6.185  1.00 16.24 ? 23  GLU A CA   1 
ATOM   129  C C    . GLU A 1 11  ? -37.875 7.354   -6.805  1.00 16.18 ? 23  GLU A C    1 
ATOM   130  O O    . GLU A 1 11  ? -38.600 6.918   -7.676  1.00 16.59 ? 23  GLU A O    1 
ATOM   131  C CB   . GLU A 1 11  ? -38.754 9.651   -7.241  1.00 16.95 ? 23  GLU A CB   1 
ATOM   132  C CG   . GLU A 1 11  ? -40.252 9.368   -7.358  1.00 17.49 ? 23  GLU A CG   1 
ATOM   133  C CD   . GLU A 1 11  ? -41.036 10.448  -6.611  1.00 18.00 ? 23  GLU A CD   1 
ATOM   134  O OE1  . GLU A 1 11  ? -41.246 11.504  -7.184  1.00 17.99 ? 23  GLU A OE1  1 
ATOM   135  O OE2  . GLU A 1 11  ? -41.412 10.201  -5.477  1.00 18.50 ? 23  GLU A OE2  1 
ATOM   136  H H    . GLU A 1 11  ? -36.166 9.574   -6.334  1.00 15.53 ? 23  GLU A H    1 
ATOM   137  H HA   . GLU A 1 11  ? -38.831 8.624   -5.359  1.00 16.27 ? 23  GLU A HA   1 
ATOM   138  H HB2  . GLU A 1 11  ? -38.602 10.681  -6.952  1.00 16.87 ? 23  GLU A HB2  1 
ATOM   139  H HB3  . GLU A 1 11  ? -38.280 9.470   -8.195  1.00 17.29 ? 23  GLU A HB3  1 
ATOM   140  H HG2  . GLU A 1 11  ? -40.538 9.370   -8.400  1.00 17.76 ? 23  GLU A HG2  1 
ATOM   141  H HG3  . GLU A 1 11  ? -40.471 8.403   -6.926  1.00 17.38 ? 23  GLU A HG3  1 
ATOM   142  N N    . TRP A 1 12  ? -36.843 6.680   -6.341  1.00 15.79 ? 24  TRP A N    1 
ATOM   143  C CA   . TRP A 1 12  ? -36.478 5.321   -6.858  1.00 15.86 ? 24  TRP A CA   1 
ATOM   144  C C    . TRP A 1 12  ? -36.744 5.205   -8.356  1.00 16.03 ? 24  TRP A C    1 
ATOM   145  O O    . TRP A 1 12  ? -37.370 4.279   -8.831  1.00 15.81 ? 24  TRP A O    1 
ATOM   146  C CB   . TRP A 1 12  ? -37.267 4.294   -6.068  1.00 15.52 ? 24  TRP A CB   1 
ATOM   147  C CG   . TRP A 1 12  ? -37.220 4.707   -4.635  1.00 14.87 ? 24  TRP A CG   1 
ATOM   148  C CD1  . TRP A 1 12  ? -38.279 4.798   -3.808  1.00 14.58 ? 24  TRP A CD1  1 
ATOM   149  C CD2  . TRP A 1 12  ? -36.064 5.123   -3.865  1.00 14.61 ? 24  TRP A CD2  1 
ATOM   150  N NE1  . TRP A 1 12  ? -37.841 5.218   -2.563  1.00 14.18 ? 24  TRP A NE1  1 
ATOM   151  C CE2  . TRP A 1 12  ? -36.477 5.433   -2.551  1.00 14.17 ? 24  TRP A CE2  1 
ATOM   152  C CE3  . TRP A 1 12  ? -34.708 5.247   -4.182  1.00 14.85 ? 24  TRP A CE3  1 
ATOM   153  C CZ2  . TRP A 1 12  ? -35.567 5.855   -1.581  1.00 13.97 ? 24  TRP A CZ2  1 
ATOM   154  C CZ3  . TRP A 1 12  ? -33.784 5.673   -3.213  1.00 14.63 ? 24  TRP A CZ3  1 
ATOM   155  C CH2  . TRP A 1 12  ? -34.214 5.975   -1.913  1.00 14.20 ? 24  TRP A CH2  1 
ATOM   156  H H    . TRP A 1 12  ? -36.303 7.071   -5.629  1.00 15.55 ? 24  TRP A H    1 
ATOM   157  H HA   . TRP A 1 12  ? -35.430 5.157   -6.692  1.00 16.19 ? 24  TRP A HA   1 
ATOM   158  H HB2  . TRP A 1 12  ? -38.284 4.276   -6.411  1.00 15.89 ? 24  TRP A HB2  1 
ATOM   159  H HB3  . TRP A 1 12  ? -36.821 3.318   -6.180  1.00 15.52 ? 24  TRP A HB3  1 
ATOM   160  H HD1  . TRP A 1 12  ? -39.294 4.574   -4.074  1.00 14.76 ? 24  TRP A HD1  1 
ATOM   161  H HE1  . TRP A 1 12  ? -38.412 5.353   -1.778  1.00 14.02 ? 24  TRP A HE1  1 
ATOM   162  H HE3  . TRP A 1 12  ? -34.377 5.022   -5.183  1.00 15.31 ? 24  TRP A HE3  1 
ATOM   163  H HZ2  . TRP A 1 12  ? -35.903 6.087   -0.583  1.00 13.78 ? 24  TRP A HZ2  1 
ATOM   164  H HZ3  . TRP A 1 12  ? -32.739 5.766   -3.470  1.00 14.92 ? 24  TRP A HZ3  1 
ATOM   165  H HH2  . TRP A 1 12  ? -33.501 6.302   -1.170  1.00 14.15 ? 24  TRP A HH2  1 
ATOM   166  N N    . THR A 1 13  ? -36.254 6.156   -9.092  1.00 16.57 ? 25  THR A N    1 
ATOM   167  C CA   . THR A 1 13  ? -36.441 6.153   -10.571 1.00 16.94 ? 25  THR A CA   1 
ATOM   168  C C    . THR A 1 13  ? -35.413 7.098   -11.194 1.00 17.34 ? 25  THR A C    1 
ATOM   169  O O    . THR A 1 13  ? -35.758 8.071   -11.834 1.00 17.74 ? 25  THR A O    1 
ATOM   170  C CB   . THR A 1 13  ? -37.854 6.633   -10.912 1.00 17.43 ? 25  THR A CB   1 
ATOM   171  O OG1  . THR A 1 13  ? -38.010 6.671   -12.324 1.00 17.43 ? 25  THR A OG1  1 
ATOM   172  C CG2  . THR A 1 13  ? -38.073 8.032   -10.334 1.00 17.55 ? 25  THR A CG2  1 
ATOM   173  H H    . THR A 1 13  ? -35.749 6.881   -8.663  1.00 16.83 ? 25  THR A H    1 
ATOM   174  H HA   . THR A 1 13  ? -36.294 5.154   -10.953 1.00 16.70 ? 25  THR A HA   1 
ATOM   175  H HB   . THR A 1 13  ? -38.578 5.955   -10.488 1.00 17.85 ? 25  THR A HB   1 
ATOM   176  H HG1  . THR A 1 13  ? -38.259 5.792   -12.619 1.00 17.55 ? 25  THR A HG1  1 
ATOM   177  H HG21 . THR A 1 13  ? -37.246 8.288   -9.688  1.00 17.69 ? 25  THR A HG21 1 
ATOM   178  H HG22 . THR A 1 13  ? -38.136 8.748   -11.140 1.00 17.45 ? 25  THR A HG22 1 
ATOM   179  H HG23 . THR A 1 13  ? -38.991 8.047   -9.767  1.00 17.73 ? 25  THR A HG23 1 
ATOM   180  N N    . ARG A 1 14  ? -34.151 6.827   -11.004 1.00 17.33 ? 26  ARG A N    1 
ATOM   181  C CA   . ARG A 1 14  ? -33.107 7.721   -11.578 1.00 17.79 ? 26  ARG A CA   1 
ATOM   182  C C    . ARG A 1 14  ? -31.871 6.904   -11.966 1.00 17.29 ? 26  ARG A C    1 
ATOM   183  O O    . ARG A 1 14  ? -31.884 5.690   -11.940 1.00 17.16 ? 26  ARG A O    1 
ATOM   184  C CB   . ARG A 1 14  ? -32.713 8.782   -10.537 1.00 18.16 ? 26  ARG A CB   1 
ATOM   185  C CG   . ARG A 1 14  ? -33.085 8.312   -9.122  1.00 19.17 ? 26  ARG A CG   1 
ATOM   186  C CD   . ARG A 1 14  ? -32.261 7.075   -8.755  1.00 19.78 ? 26  ARG A CD   1 
ATOM   187  N NE   . ARG A 1 14  ? -32.932 6.325   -7.657  1.00 20.59 ? 26  ARG A NE   1 
ATOM   188  C CZ   . ARG A 1 14  ? -32.700 5.047   -7.509  1.00 21.07 ? 26  ARG A CZ   1 
ATOM   189  N NH1  . ARG A 1 14  ? -32.751 4.250   -8.541  1.00 21.47 ? 26  ARG A NH1  1 
ATOM   190  N NH2  . ARG A 1 14  ? -32.419 4.566   -6.330  1.00 21.23 ? 26  ARG A NH2  1 
ATOM   191  H H    . ARG A 1 14  ? -33.893 6.042   -10.479 1.00 17.09 ? 26  ARG A H    1 
ATOM   192  H HA   . ARG A 1 14  ? -33.498 8.211   -12.452 1.00 18.33 ? 26  ARG A HA   1 
ATOM   193  H HB2  . ARG A 1 14  ? -31.649 8.953   -10.586 1.00 18.09 ? 26  ARG A HB2  1 
ATOM   194  H HB3  . ARG A 1 14  ? -33.233 9.703   -10.754 1.00 17.90 ? 26  ARG A HB3  1 
ATOM   195  H HG2  . ARG A 1 14  ? -32.872 9.104   -8.418  1.00 19.42 ? 26  ARG A HG2  1 
ATOM   196  H HG3  . ARG A 1 14  ? -34.136 8.072   -9.079  1.00 19.31 ? 26  ARG A HG3  1 
ATOM   197  H HD2  . ARG A 1 14  ? -32.169 6.434   -9.613  1.00 19.71 ? 26  ARG A HD2  1 
ATOM   198  H HD3  . ARG A 1 14  ? -31.279 7.383   -8.433  1.00 19.80 ? 26  ARG A HD3  1 
ATOM   199  H HE   . ARG A 1 14  ? -33.545 6.787   -7.048  1.00 20.85 ? 26  ARG A HE   1 
ATOM   200  H HH11 . ARG A 1 14  ? -32.967 4.615   -9.445  1.00 21.42 ? 26  ARG A HH11 1 
ATOM   201  H HH12 . ARG A 1 14  ? -32.574 3.272   -8.426  1.00 21.90 ? 26  ARG A HH12 1 
ATOM   202  H HH21 . ARG A 1 14  ? -32.382 5.175   -5.538  1.00 21.00 ? 26  ARG A HH21 1 
ATOM   203  H HH22 . ARG A 1 14  ? -32.241 3.589   -6.218  1.00 21.67 ? 26  ARG A HH22 1 
ATOM   204  N N    . HIS A 1 15  ? -30.802 7.563   -12.321 1.00 17.13 ? 27  HIS A N    1 
ATOM   205  C CA   . HIS A 1 15  ? -29.567 6.825   -12.702 1.00 16.76 ? 27  HIS A CA   1 
ATOM   206  C C    . HIS A 1 15  ? -28.988 6.144   -11.456 1.00 16.16 ? 27  HIS A C    1 
ATOM   207  O O    . HIS A 1 15  ? -29.622 6.091   -10.421 1.00 16.16 ? 27  HIS A O    1 
ATOM   208  C CB   . HIS A 1 15  ? -28.547 7.810   -13.281 1.00 17.34 ? 27  HIS A CB   1 
ATOM   209  C CG   . HIS A 1 15  ? -28.340 8.943   -12.314 1.00 17.73 ? 27  HIS A CG   1 
ATOM   210  N ND1  . HIS A 1 15  ? -27.489 8.838   -11.227 1.00 17.97 ? 27  HIS A ND1  1 
ATOM   211  C CD2  . HIS A 1 15  ? -28.868 10.209  -12.258 1.00 18.09 ? 27  HIS A CD2  1 
ATOM   212  C CE1  . HIS A 1 15  ? -27.528 10.011  -10.567 1.00 18.44 ? 27  HIS A CE1  1 
ATOM   213  N NE2  . HIS A 1 15  ? -28.353 10.882  -11.153 1.00 18.54 ? 27  HIS A NE2  1 
ATOM   214  H H    . HIS A 1 15  ? -30.810 8.542   -12.332 1.00 17.34 ? 27  HIS A H    1 
ATOM   215  H HA   . HIS A 1 15  ? -29.808 6.077   -13.443 1.00 16.64 ? 27  HIS A HA   1 
ATOM   216  H HB2  . HIS A 1 15  ? -27.609 7.304   -13.449 1.00 17.65 ? 27  HIS A HB2  1 
ATOM   217  H HB3  . HIS A 1 15  ? -28.917 8.201   -14.217 1.00 17.30 ? 27  HIS A HB3  1 
ATOM   218  H HD1  . HIS A 1 15  ? -26.956 8.053   -10.983 1.00 17.90 ? 27  HIS A HD1  1 
ATOM   219  H HD2  . HIS A 1 15  ? -29.575 10.621  -12.963 1.00 18.13 ? 27  HIS A HD2  1 
ATOM   220  H HE1  . HIS A 1 15  ? -26.960 10.221  -9.673  1.00 18.80 ? 27  HIS A HE1  1 
ATOM   221  N N    . GLY A 1 16  ? -27.796 5.621   -11.543 1.00 15.78 ? 28  GLY A N    1 
ATOM   222  C CA   . GLY A 1 16  ? -27.190 4.944   -10.359 1.00 15.32 ? 28  GLY A CA   1 
ATOM   223  C C    . GLY A 1 16  ? -26.919 5.965   -9.250  1.00 14.37 ? 28  GLY A C    1 
ATOM   224  O O    . GLY A 1 16  ? -27.793 6.704   -8.844  1.00 14.03 ? 28  GLY A O    1 
ATOM   225  H H    . GLY A 1 16  ? -27.299 5.670   -12.386 1.00 15.90 ? 28  GLY A H    1 
ATOM   226  H HA2  . GLY A 1 16  ? -27.869 4.187   -9.993  1.00 15.75 ? 28  GLY A HA2  1 
ATOM   227  H HA3  . GLY A 1 16  ? -26.259 4.480   -10.650 1.00 15.35 ? 28  GLY A HA3  1 
ATOM   228  N N    . SER A 1 17  ? -25.708 6.006   -8.758  1.00 14.09 ? 29  SER A N    1 
ATOM   229  C CA   . SER A 1 17  ? -25.359 6.971   -7.672  1.00 13.31 ? 29  SER A CA   1 
ATOM   230  C C    . SER A 1 17  ? -26.080 6.581   -6.378  1.00 12.88 ? 29  SER A C    1 
ATOM   231  O O    . SER A 1 17  ? -26.743 7.393   -5.770  1.00 13.39 ? 29  SER A O    1 
ATOM   232  C CB   . SER A 1 17  ? -25.766 8.387   -8.080  1.00 13.34 ? 29  SER A CB   1 
ATOM   233  O OG   . SER A 1 17  ? -25.430 8.597   -9.445  1.00 13.94 ? 29  SER A OG   1 
ATOM   234  H H    . SER A 1 17  ? -25.023 5.396   -9.104  1.00 14.49 ? 29  SER A H    1 
ATOM   235  H HA   . SER A 1 17  ? -24.293 6.942   -7.504  1.00 13.23 ? 29  SER A HA   1 
ATOM   236  H HB2  . SER A 1 17  ? -26.828 8.511   -7.952  1.00 13.28 ? 29  SER A HB2  1 
ATOM   237  H HB3  . SER A 1 17  ? -25.245 9.102   -7.456  1.00 13.12 ? 29  SER A HB3  1 
ATOM   238  H HG   . SER A 1 17  ? -24.495 8.403   -9.553  1.00 13.94 ? 29  SER A HG   1 
ATOM   239  N N    . PHE A 1 18  ? -25.929 5.339   -5.969  1.00 12.10 ? 30  PHE A N    1 
ATOM   240  C CA   . PHE A 1 18  ? -26.564 4.806   -4.716  1.00 11.85 ? 30  PHE A CA   1 
ATOM   241  C C    . PHE A 1 18  ? -27.984 5.364   -4.513  1.00 11.57 ? 30  PHE A C    1 
ATOM   242  O O    . PHE A 1 18  ? -28.941 4.766   -4.958  1.00 11.99 ? 30  PHE A O    1 
ATOM   243  C CB   . PHE A 1 18  ? -25.676 5.116   -3.493  1.00 11.87 ? 30  PHE A CB   1 
ATOM   244  C CG   . PHE A 1 18  ? -24.614 6.128   -3.861  1.00 11.97 ? 30  PHE A CG   1 
ATOM   245  C CD1  . PHE A 1 18  ? -23.484 5.725   -4.584  1.00 12.04 ? 30  PHE A CD1  1 
ATOM   246  C CD2  . PHE A 1 18  ? -24.762 7.471   -3.487  1.00 12.21 ? 30  PHE A CD2  1 
ATOM   247  C CE1  . PHE A 1 18  ? -22.504 6.662   -4.932  1.00 12.30 ? 30  PHE A CE1  1 
ATOM   248  C CE2  . PHE A 1 18  ? -23.782 8.407   -3.837  1.00 12.49 ? 30  PHE A CE2  1 
ATOM   249  C CZ   . PHE A 1 18  ? -22.654 8.002   -4.559  1.00 12.51 ? 30  PHE A CZ   1 
ATOM   250  H H    . PHE A 1 18  ? -25.376 4.740   -6.499  1.00 11.79 ? 30  PHE A H    1 
ATOM   251  H HA   . PHE A 1 18  ? -26.640 3.732   -4.813  1.00 12.08 ? 30  PHE A HA   1 
ATOM   252  H HB2  . PHE A 1 18  ? -26.285 5.506   -2.693  1.00 11.82 ? 30  PHE A HB2  1 
ATOM   253  H HB3  . PHE A 1 18  ? -25.198 4.205   -3.163  1.00 12.06 ? 30  PHE A HB3  1 
ATOM   254  H HD1  . PHE A 1 18  ? -23.368 4.690   -4.872  1.00 12.03 ? 30  PHE A HD1  1 
ATOM   255  H HD2  . PHE A 1 18  ? -25.630 7.784   -2.928  1.00 12.32 ? 30  PHE A HD2  1 
ATOM   256  H HE1  . PHE A 1 18  ? -21.633 6.350   -5.489  1.00 12.48 ? 30  PHE A HE1  1 
ATOM   257  H HE2  . PHE A 1 18  ? -23.896 9.441   -3.548  1.00 12.81 ? 30  PHE A HE2  1 
ATOM   258  H HZ   . PHE A 1 18  ? -21.900 8.725   -4.830  1.00 12.83 ? 30  PHE A HZ   1 
ATOM   259  N N    . VAL A 1 19  ? -28.105 6.497   -3.850  1.00 11.03 ? 31  VAL A N    1 
ATOM   260  C CA   . VAL A 1 19  ? -29.440 7.145   -3.585  1.00 10.95 ? 31  VAL A CA   1 
ATOM   261  C C    . VAL A 1 19  ? -30.113 6.520   -2.353  1.00 10.79 ? 31  VAL A C    1 
ATOM   262  O O    . VAL A 1 19  ? -30.561 7.221   -1.468  1.00 10.80 ? 31  VAL A O    1 
ATOM   263  C CB   . VAL A 1 19  ? -30.373 7.022   -4.794  1.00 11.54 ? 31  VAL A CB   1 
ATOM   264  C CG1  . VAL A 1 19  ? -31.575 7.950   -4.599  1.00 11.83 ? 31  VAL A CG1  1 
ATOM   265  C CG2  . VAL A 1 19  ? -29.620 7.423   -6.064  1.00 11.52 ? 31  VAL A CG2  1 
ATOM   266  H H    . VAL A 1 19  ? -27.299 6.936   -3.521  1.00 10.82 ? 31  VAL A H    1 
ATOM   267  H HA   . VAL A 1 19  ? -29.273 8.194   -3.384  1.00 10.82 ? 31  VAL A HA   1 
ATOM   268  H HB   . VAL A 1 19  ? -30.722 6.006   -4.880  1.00 11.97 ? 31  VAL A HB   1 
ATOM   269  H HG11 . VAL A 1 19  ? -31.709 8.149   -3.546  1.00 12.03 ? 31  VAL A HG11 1 
ATOM   270  H HG12 . VAL A 1 19  ? -31.402 8.878   -5.122  1.00 11.94 ? 31  VAL A HG12 1 
ATOM   271  H HG13 . VAL A 1 19  ? -32.463 7.476   -4.991  1.00 11.92 ? 31  VAL A HG13 1 
ATOM   272  H HG21 . VAL A 1 19  ? -28.852 8.140   -5.816  1.00 11.38 ? 31  VAL A HG21 1 
ATOM   273  H HG22 . VAL A 1 19  ? -29.168 6.548   -6.506  1.00 11.58 ? 31  VAL A HG22 1 
ATOM   274  H HG23 . VAL A 1 19  ? -30.311 7.866   -6.766  1.00 11.79 ? 31  VAL A HG23 1 
ATOM   275  N N    . ASN A 1 20  ? -30.198 5.218   -2.283  1.00 10.86 ? 32  ASN A N    1 
ATOM   276  C CA   . ASN A 1 20  ? -30.848 4.574   -1.107  1.00 10.98 ? 32  ASN A CA   1 
ATOM   277  C C    . ASN A 1 20  ? -30.193 5.067   0.186   1.00 10.58 ? 32  ASN A C    1 
ATOM   278  O O    . ASN A 1 20  ? -30.812 5.097   1.232   1.00 10.92 ? 32  ASN A O    1 
ATOM   279  C CB   . ASN A 1 20  ? -30.698 3.055   -1.209  1.00 11.72 ? 32  ASN A CB   1 
ATOM   280  C CG   . ASN A 1 20  ? -32.035 2.438   -1.622  1.00 12.33 ? 32  ASN A CG   1 
ATOM   281  O OD1  . ASN A 1 20  ? -32.581 1.614   -0.915  1.00 12.41 ? 32  ASN A OD1  1 
ATOM   282  N ND2  . ASN A 1 20  ? -32.590 2.804   -2.745  1.00 12.91 ? 32  ASN A ND2  1 
ATOM   283  H H    . ASN A 1 20  ? -29.839 4.664   -3.000  1.00 11.01 ? 32  ASN A H    1 
ATOM   284  H HA   . ASN A 1 20  ? -31.898 4.829   -1.095  1.00 11.04 ? 32  ASN A HA   1 
ATOM   285  H HB2  . ASN A 1 20  ? -29.946 2.817   -1.949  1.00 11.98 ? 32  ASN A HB2  1 
ATOM   286  H HB3  . ASN A 1 20  ? -30.400 2.657   -0.251  1.00 11.72 ? 32  ASN A HB3  1 
ATOM   287  H HD21 . ASN A 1 20  ? -32.150 3.469   -3.314  1.00 12.96 ? 32  ASN A HD21 1 
ATOM   288  H HD22 . ASN A 1 20  ? -33.447 2.415   -3.018  1.00 13.40 ? 32  ASN A HD22 1 
ATOM   289  N N    . LYS A 1 21  ? -28.948 5.455   0.128   1.00 10.04 ? 33  LYS A N    1 
ATOM   290  C CA   . LYS A 1 21  ? -28.268 5.945   1.360   1.00 9.82  ? 33  LYS A CA   1 
ATOM   291  C C    . LYS A 1 21  ? -27.591 7.288   1.071   1.00 9.03  ? 33  LYS A C    1 
ATOM   292  O O    . LYS A 1 21  ? -27.338 7.621   -0.070  1.00 8.57  ? 33  LYS A O    1 
ATOM   293  C CB   . LYS A 1 21  ? -27.216 4.927   1.810   1.00 10.03 ? 33  LYS A CB   1 
ATOM   294  C CG   . LYS A 1 21  ? -26.627 4.216   0.589   1.00 9.88  ? 33  LYS A CG   1 
ATOM   295  C CD   . LYS A 1 21  ? -27.482 2.994   0.246   1.00 10.49 ? 33  LYS A CD   1 
ATOM   296  C CE   . LYS A 1 21  ? -27.406 2.722   -1.257  1.00 10.64 ? 33  LYS A CE   1 
ATOM   297  N NZ   . LYS A 1 21  ? -26.063 2.170   -1.595  1.00 10.91 ? 33  LYS A NZ   1 
ATOM   298  H H    . LYS A 1 21  ? -28.464 5.427   -0.723  1.00 9.91  ? 33  LYS A H    1 
ATOM   299  H HA   . LYS A 1 21  ? -29.002 6.072   2.142   1.00 10.29 ? 33  LYS A HA   1 
ATOM   300  H HB2  . LYS A 1 21  ? -26.428 5.438   2.344   1.00 10.10 ? 33  LYS A HB2  1 
ATOM   301  H HB3  . LYS A 1 21  ? -27.676 4.198   2.460   1.00 10.42 ? 33  LYS A HB3  1 
ATOM   302  H HG2  . LYS A 1 21  ? -26.612 4.895   -0.251  1.00 9.72  ? 33  LYS A HG2  1 
ATOM   303  H HG3  . LYS A 1 21  ? -25.620 3.896   0.811   1.00 9.76  ? 33  LYS A HG3  1 
ATOM   304  H HD2  . LYS A 1 21  ? -27.114 2.135   0.788   1.00 10.73 ? 33  LYS A HD2  1 
ATOM   305  H HD3  . LYS A 1 21  ? -28.508 3.183   0.524   1.00 10.82 ? 33  LYS A HD3  1 
ATOM   306  H HE2  . LYS A 1 21  ? -28.168 2.008   -1.533  1.00 10.70 ? 33  LYS A HE2  1 
ATOM   307  H HE3  . LYS A 1 21  ? -27.563 3.643   -1.799  1.00 10.72 ? 33  LYS A HE3  1 
ATOM   308  H HZ1  . LYS A 1 21  ? -25.330 2.710   -1.094  1.00 11.15 ? 33  LYS A HZ1  1 
ATOM   309  H HZ2  . LYS A 1 21  ? -26.015 1.173   -1.305  1.00 11.05 ? 33  LYS A HZ2  1 
ATOM   310  H HZ3  . LYS A 1 21  ? -25.908 2.242   -2.621  1.00 10.91 ? 33  LYS A HZ3  1 
ATOM   311  N N    . PRO A 1 22  ? -27.320 8.021   2.120   1.00 9.13  ? 34  PRO A N    1 
ATOM   312  C CA   . PRO A 1 22  ? -26.677 9.335   2.035   1.00 8.70  ? 34  PRO A CA   1 
ATOM   313  C C    . PRO A 1 22  ? -25.176 9.174   1.779   1.00 7.89  ? 34  PRO A C    1 
ATOM   314  O O    . PRO A 1 22  ? -24.574 9.942   1.055   1.00 7.88  ? 34  PRO A O    1 
ATOM   315  C CB   . PRO A 1 22  ? -26.911 9.994   3.387   1.00 9.37  ? 34  PRO A CB   1 
ATOM   316  C CG   . PRO A 1 22  ? -27.069 8.783   4.341   1.00 10.03 ? 34  PRO A CG   1 
ATOM   317  C CD   . PRO A 1 22  ? -27.634 7.607   3.505   1.00 9.96  ? 34  PRO A CD   1 
ATOM   318  H HA   . PRO A 1 22  ? -27.130 9.926   1.255   1.00 8.75  ? 34  PRO A HA   1 
ATOM   319  H HB2  . PRO A 1 22  ? -26.059 10.602  3.667   1.00 9.21  ? 34  PRO A HB2  1 
ATOM   320  H HB3  . PRO A 1 22  ? -27.817 10.579  3.378   1.00 9.78  ? 34  PRO A HB3  1 
ATOM   321  H HG2  . PRO A 1 22  ? -26.107 8.515   4.756   1.00 10.12 ? 34  PRO A HG2  1 
ATOM   322  H HG3  . PRO A 1 22  ? -27.758 9.027   5.135   1.00 10.63 ? 34  PRO A HG3  1 
ATOM   323  H HD2  . PRO A 1 22  ? -27.130 6.683   3.757   1.00 10.11 ? 34  PRO A HD2  1 
ATOM   324  H HD3  . PRO A 1 22  ? -28.700 7.516   3.638   1.00 10.51 ? 34  PRO A HD3  1 
ATOM   325  N N    . THR A 1 23  ? -24.566 8.184   2.371   1.00 7.42  ? 35  THR A N    1 
ATOM   326  C CA   . THR A 1 23  ? -23.105 7.980   2.163   1.00 6.75  ? 35  THR A CA   1 
ATOM   327  C C    . THR A 1 23  ? -22.827 7.731   0.669   1.00 6.24  ? 35  THR A C    1 
ATOM   328  O O    . THR A 1 23  ? -22.780 8.662   -0.109  1.00 6.57  ? 35  THR A O    1 
ATOM   329  C CB   . THR A 1 23  ? -22.632 6.796   3.014   1.00 6.86  ? 35  THR A CB   1 
ATOM   330  O OG1  . THR A 1 23  ? -23.588 5.747   2.935   1.00 7.48  ? 35  THR A OG1  1 
ATOM   331  C CG2  . THR A 1 23  ? -22.478 7.240   4.469   1.00 7.14  ? 35  THR A CG2  1 
ATOM   332  H H    . THR A 1 23  ? -25.068 7.576   2.954   1.00 7.64  ? 35  THR A H    1 
ATOM   333  H HA   . THR A 1 23  ? -22.579 8.871   2.474   1.00 6.86  ? 35  THR A HA   1 
ATOM   334  H HB   . THR A 1 23  ? -21.680 6.444   2.647   1.00 6.60  ? 35  THR A HB   1 
ATOM   335  H HG1  . THR A 1 23  ? -23.116 4.927   2.775   1.00 7.77  ? 35  THR A HG1  1 
ATOM   336  H HG21 . THR A 1 23  ? -21.912 8.158   4.508   1.00 7.24  ? 35  THR A HG21 1 
ATOM   337  H HG22 . THR A 1 23  ? -23.455 7.400   4.902   1.00 7.23  ? 35  THR A HG22 1 
ATOM   338  H HG23 . THR A 1 23  ? -21.960 6.473   5.027   1.00 7.46  ? 35  THR A HG23 1 
ATOM   339  N N    . ARG A 1 24  ? -22.645 6.497   0.251   1.00 5.76  ? 36  ARG A N    1 
ATOM   340  C CA   . ARG A 1 24  ? -22.376 6.230   -1.192  1.00 5.61  ? 36  ARG A CA   1 
ATOM   341  C C    . ARG A 1 24  ? -22.051 4.747   -1.391  1.00 4.98  ? 36  ARG A C    1 
ATOM   342  O O    . ARG A 1 24  ? -22.390 4.160   -2.400  1.00 5.23  ? 36  ARG A O    1 
ATOM   343  C CB   . ARG A 1 24  ? -21.191 7.074   -1.678  1.00 6.00  ? 36  ARG A CB   1 
ATOM   344  C CG   . ARG A 1 24  ? -20.056 7.047   -0.648  1.00 6.44  ? 36  ARG A CG   1 
ATOM   345  C CD   . ARG A 1 24  ? -19.769 8.471   -0.167  1.00 7.12  ? 36  ARG A CD   1 
ATOM   346  N NE   . ARG A 1 24  ? -19.617 9.373   -1.343  1.00 7.81  ? 36  ARG A NE   1 
ATOM   347  C CZ   . ARG A 1 24  ? -20.469 10.343  -1.536  1.00 8.51  ? 36  ARG A CZ   1 
ATOM   348  N NH1  . ARG A 1 24  ? -20.762 11.158  -0.560  1.00 9.15  ? 36  ARG A NH1  1 
ATOM   349  N NH2  . ARG A 1 24  ? -21.030 10.498  -2.705  1.00 8.79  ? 36  ARG A NH2  1 
ATOM   350  H H    . ARG A 1 24  ? -22.687 5.750   0.876   1.00 5.76  ? 36  ARG A H    1 
ATOM   351  H HA   . ARG A 1 24  ? -23.253 6.482   -1.769  1.00 6.01  ? 36  ARG A HA   1 
ATOM   352  H HB2  . ARG A 1 24  ? -20.833 6.669   -2.611  1.00 6.26  ? 36  ARG A HB2  1 
ATOM   353  H HB3  . ARG A 1 24  ? -21.513 8.092   -1.832  1.00 6.13  ? 36  ARG A HB3  1 
ATOM   354  H HG2  . ARG A 1 24  ? -20.338 6.433   0.192   1.00 6.70  ? 36  ARG A HG2  1 
ATOM   355  H HG3  . ARG A 1 24  ? -19.167 6.641   -1.106  1.00 6.40  ? 36  ARG A HG3  1 
ATOM   356  H HD2  . ARG A 1 24  ? -20.587 8.815   0.448   1.00 7.25  ? 36  ARG A HD2  1 
ATOM   357  H HD3  . ARG A 1 24  ? -18.857 8.478   0.412   1.00 7.29  ? 36  ARG A HD3  1 
ATOM   358  H HE   . ARG A 1 24  ? -18.878 9.238   -1.972  1.00 7.92  ? 36  ARG A HE   1 
ATOM   359  H HH11 . ARG A 1 24  ? -20.333 11.039  0.336   1.00 9.14  ? 36  ARG A HH11 1 
ATOM   360  H HH12 . ARG A 1 24  ? -21.415 11.900  -0.707  1.00 9.80  ? 36  ARG A HH12 1 
ATOM   361  H HH21 . ARG A 1 24  ? -20.806 9.874   -3.454  1.00 8.49  ? 36  ARG A HH21 1 
ATOM   362  H HH22 . ARG A 1 24  ? -21.683 11.241  -2.852  1.00 9.46  ? 36  ARG A HH22 1 
ATOM   363  N N    . GLY A 1 25  ? -21.395 4.136   -0.442  1.00 4.40  ? 37  GLY A N    1 
ATOM   364  C CA   . GLY A 1 25  ? -21.050 2.693   -0.587  1.00 3.92  ? 37  GLY A CA   1 
ATOM   365  C C    . GLY A 1 25  ? -19.687 2.560   -1.269  1.00 3.10  ? 37  GLY A C    1 
ATOM   366  O O    . GLY A 1 25  ? -18.711 2.175   -0.656  1.00 3.23  ? 37  GLY A O    1 
ATOM   367  H H    . GLY A 1 25  ? -21.128 4.624   0.363   1.00 4.49  ? 37  GLY A H    1 
ATOM   368  H HA2  . GLY A 1 25  ? -21.013 2.233   0.390   1.00 4.13  ? 37  GLY A HA2  1 
ATOM   369  H HA3  . GLY A 1 25  ? -21.799 2.202   -1.189  1.00 4.20  ? 37  GLY A HA3  1 
ATOM   370  N N    . TRP A 1 26  ? -19.612 2.876   -2.534  1.00 2.62  ? 38  TRP A N    1 
ATOM   371  C CA   . TRP A 1 26  ? -18.312 2.768   -3.255  1.00 2.05  ? 38  TRP A CA   1 
ATOM   372  C C    . TRP A 1 26  ? -17.750 1.355   -3.089  1.00 1.53  ? 38  TRP A C    1 
ATOM   373  O O    . TRP A 1 26  ? -18.441 0.450   -2.666  1.00 1.86  ? 38  TRP A O    1 
ATOM   374  C CB   . TRP A 1 26  ? -17.326 3.783   -2.683  1.00 2.41  ? 38  TRP A CB   1 
ATOM   375  C CG   . TRP A 1 26  ? -17.020 4.803   -3.729  1.00 2.55  ? 38  TRP A CG   1 
ATOM   376  C CD1  . TRP A 1 26  ? -17.863 5.780   -4.131  1.00 2.86  ? 38  TRP A CD1  1 
ATOM   377  C CD2  . TRP A 1 26  ? -15.808 4.957   -4.518  1.00 2.59  ? 38  TRP A CD2  1 
ATOM   378  N NE1  . TRP A 1 26  ? -17.240 6.531   -5.112  1.00 3.03  ? 38  TRP A NE1  1 
ATOM   379  C CE2  . TRP A 1 26  ? -15.971 6.062   -5.386  1.00 2.91  ? 38  TRP A CE2  1 
ATOM   380  C CE3  . TRP A 1 26  ? -14.595 4.252   -4.560  1.00 2.56  ? 38  TRP A CE3  1 
ATOM   381  C CZ2  . TRP A 1 26  ? -14.962 6.454   -6.267  1.00 3.17  ? 38  TRP A CZ2  1 
ATOM   382  C CZ3  . TRP A 1 26  ? -13.576 4.642   -5.445  1.00 2.88  ? 38  TRP A CZ3  1 
ATOM   383  C CH2  . TRP A 1 26  ? -13.759 5.742   -6.296  1.00 3.17  ? 38  TRP A CH2  1 
ATOM   384  H H    . TRP A 1 26  ? -20.411 3.184   -3.009  1.00 2.95  ? 38  TRP A H    1 
ATOM   385  H HA   . TRP A 1 26  ? -18.464 2.974   -4.305  1.00 2.19  ? 38  TRP A HA   1 
ATOM   386  H HB2  . TRP A 1 26  ? -17.763 4.267   -1.822  1.00 2.84  ? 38  TRP A HB2  1 
ATOM   387  H HB3  . TRP A 1 26  ? -16.416 3.280   -2.392  1.00 2.58  ? 38  TRP A HB3  1 
ATOM   388  H HD1  . TRP A 1 26  ? -18.857 5.946   -3.746  1.00 3.04  ? 38  TRP A HD1  1 
ATOM   389  H HE1  . TRP A 1 26  ? -17.635 7.303   -5.569  1.00 3.30  ? 38  TRP A HE1  1 
ATOM   390  H HE3  . TRP A 1 26  ? -14.448 3.404   -3.909  1.00 2.40  ? 38  TRP A HE3  1 
ATOM   391  H HZ2  . TRP A 1 26  ? -15.109 7.301   -6.920  1.00 3.45  ? 38  TRP A HZ2  1 
ATOM   392  H HZ3  . TRP A 1 26  ? -12.647 4.093   -5.469  1.00 3.00  ? 38  TRP A HZ3  1 
ATOM   393  H HH2  . TRP A 1 26  ? -12.973 6.037   -6.975  1.00 3.48  ? 38  TRP A HH2  1 
ATOM   394  N N    . LEU A 1 27  ? -16.502 1.155   -3.418  1.00 1.00  ? 39  LEU A N    1 
ATOM   395  C CA   . LEU A 1 27  ? -15.910 -0.204  -3.275  1.00 0.68  ? 39  LEU A CA   1 
ATOM   396  C C    . LEU A 1 27  ? -15.876 -0.594  -1.786  1.00 0.63  ? 39  LEU A C    1 
ATOM   397  O O    . LEU A 1 27  ? -16.289 0.159   -0.915  1.00 0.61  ? 39  LEU A O    1 
ATOM   398  C CB   . LEU A 1 27  ? -14.485 -0.217  -3.839  1.00 0.79  ? 39  LEU A CB   1 
ATOM   399  C CG   . LEU A 1 27  ? -14.501 -0.237  -5.366  1.00 0.84  ? 39  LEU A CG   1 
ATOM   400  C CD1  . LEU A 1 27  ? -13.057 -0.214  -5.877  1.00 0.71  ? 39  LEU A CD1  1 
ATOM   401  C CD2  . LEU A 1 27  ? -15.183 -1.516  -5.850  1.00 1.61  ? 39  LEU A CD2  1 
ATOM   402  H H    . LEU A 1 27  ? -15.958 1.896   -3.759  1.00 1.15  ? 39  LEU A H    1 
ATOM   403  H HA   . LEU A 1 27  ? -16.516 -0.916  -3.816  1.00 0.99  ? 39  LEU A HA   1 
ATOM   404  H HB2  . LEU A 1 27  ? -13.956 0.660   -3.499  1.00 1.38  ? 39  LEU A HB2  1 
ATOM   405  H HB3  . LEU A 1 27  ? -13.976 -1.100  -3.487  1.00 1.33  ? 39  LEU A HB3  1 
ATOM   406  H HG   . LEU A 1 27  ? -15.034 0.627   -5.737  1.00 1.52  ? 39  LEU A HG   1 
ATOM   407  H HD11 . LEU A 1 27  ? -12.381 -0.386  -5.051  1.00 1.12  ? 39  LEU A HD11 1 
ATOM   408  H HD12 . LEU A 1 27  ? -12.924 -0.989  -6.617  1.00 1.15  ? 39  LEU A HD12 1 
ATOM   409  H HD13 . LEU A 1 27  ? -12.845 0.748   -6.320  1.00 1.53  ? 39  LEU A HD13 1 
ATOM   410  H HD21 . LEU A 1 27  ? -14.835 -2.352  -5.262  1.00 2.14  ? 39  LEU A HD21 1 
ATOM   411  H HD22 . LEU A 1 27  ? -16.252 -1.418  -5.740  1.00 2.06  ? 39  LEU A HD22 1 
ATOM   412  H HD23 . LEU A 1 27  ? -14.940 -1.681  -6.889  1.00 2.12  ? 39  LEU A HD23 1 
ATOM   413  N N    . HIS A 1 28  ? -15.386 -1.769  -1.490  1.00 0.66  ? 40  HIS A N    1 
ATOM   414  C CA   . HIS A 1 28  ? -15.327 -2.227  -0.070  1.00 0.66  ? 40  HIS A CA   1 
ATOM   415  C C    . HIS A 1 28  ? -14.151 -1.609  0.737   1.00 0.59  ? 40  HIS A C    1 
ATOM   416  O O    . HIS A 1 28  ? -14.274 -1.506  1.936   1.00 0.63  ? 40  HIS A O    1 
ATOM   417  C CB   . HIS A 1 28  ? -15.233 -3.758  -0.026  1.00 0.78  ? 40  HIS A CB   1 
ATOM   418  C CG   . HIS A 1 28  ? -13.912 -4.218  -0.577  1.00 0.91  ? 40  HIS A CG   1 
ATOM   419  N ND1  . HIS A 1 28  ? -13.817 -4.959  -1.744  1.00 1.48  ? 40  HIS A ND1  1 
ATOM   420  C CD2  . HIS A 1 28  ? -12.624 -4.054  -0.132  1.00 1.17  ? 40  HIS A CD2  1 
ATOM   421  C CE1  . HIS A 1 28  ? -12.513 -5.212  -1.959  1.00 1.95  ? 40  HIS A CE1  1 
ATOM   422  N NE2  . HIS A 1 28  ? -11.742 -4.683  -1.006  1.00 1.70  ? 40  HIS A NE2  1 
ATOM   423  H H    . HIS A 1 28  ? -15.063 -2.356  -2.205  1.00 0.72  ? 40  HIS A H    1 
ATOM   424  H HA   . HIS A 1 28  ? -16.248 -1.937  0.411   1.00 0.69  ? 40  HIS A HA   1 
ATOM   425  H HB2  . HIS A 1 28  ? -15.328 -4.092  0.997   1.00 1.20  ? 40  HIS A HB2  1 
ATOM   426  H HB3  . HIS A 1 28  ? -16.033 -4.182  -0.615  1.00 0.97  ? 40  HIS A HB3  1 
ATOM   427  H HD1  . HIS A 1 28  ? -14.563 -5.247  -2.311  1.00 1.69  ? 40  HIS A HD1  1 
ATOM   428  H HD2  . HIS A 1 28  ? -12.338 -3.518  0.760   1.00 1.32  ? 40  HIS A HD2  1 
ATOM   429  H HE1  . HIS A 1 28  ? -12.135 -5.775  -2.800  1.00 2.59  ? 40  HIS A HE1  1 
ATOM   430  N N    . PRO A 1 29  ? -13.048 -1.210  0.118   1.00 0.56  ? 41  PRO A N    1 
ATOM   431  C CA   . PRO A 1 29  ? -11.925 -0.616  0.860   1.00 0.54  ? 41  PRO A CA   1 
ATOM   432  C C    . PRO A 1 29  ? -12.387 0.678   1.542   1.00 0.51  ? 41  PRO A C    1 
ATOM   433  O O    . PRO A 1 29  ? -12.052 0.950   2.677   1.00 0.51  ? 41  PRO A O    1 
ATOM   434  C CB   . PRO A 1 29  ? -10.852 -0.295  -0.182  1.00 0.69  ? 41  PRO A CB   1 
ATOM   435  C CG   . PRO A 1 29  ? -11.237 -1.217  -1.353  1.00 0.69  ? 41  PRO A CG   1 
ATOM   436  C CD   . PRO A 1 29  ? -12.772 -1.290  -1.329  1.00 0.65  ? 41  PRO A CD   1 
ATOM   437  H HA   . PRO A 1 29  ? -11.538 -1.310  1.586   1.00 0.53  ? 41  PRO A HA   1 
ATOM   438  H HB2  . PRO A 1 29  ? -10.901 0.747   -0.473  1.00 0.98  ? 41  PRO A HB2  1 
ATOM   439  H HB3  . PRO A 1 29  ? -9.874  -0.550  0.178   1.00 0.85  ? 41  PRO A HB3  1 
ATOM   440  H HG2  . PRO A 1 29  ? -10.892 -0.795  -2.288  1.00 0.94  ? 41  PRO A HG2  1 
ATOM   441  H HG3  . PRO A 1 29  ? -10.821 -2.201  -1.207  1.00 0.93  ? 41  PRO A HG3  1 
ATOM   442  H HD2  . PRO A 1 29  ? -13.191 -0.440  -1.838  1.00 0.69  ? 41  PRO A HD2  1 
ATOM   443  H HD3  . PRO A 1 29  ? -13.126 -2.216  -1.741  1.00 0.79  ? 41  PRO A HD3  1 
ATOM   444  N N    . ASN A 1 30  ? -13.151 1.480   0.848   1.00 0.53  ? 42  ASN A N    1 
ATOM   445  C CA   . ASN A 1 30  ? -13.631 2.762   1.441   1.00 0.58  ? 42  ASN A CA   1 
ATOM   446  C C    . ASN A 1 30  ? -14.841 2.521   2.345   1.00 0.53  ? 42  ASN A C    1 
ATOM   447  O O    . ASN A 1 30  ? -14.910 3.043   3.439   1.00 0.53  ? 42  ASN A O    1 
ATOM   448  C CB   . ASN A 1 30  ? -14.022 3.724   0.318   1.00 0.68  ? 42  ASN A CB   1 
ATOM   449  C CG   . ASN A 1 30  ? -14.700 4.959   0.913   1.00 1.45  ? 42  ASN A CG   1 
ATOM   450  O OD1  . ASN A 1 30  ? -14.054 5.954   1.174   1.00 2.10  ? 42  ASN A OD1  1 
ATOM   451  N ND2  . ASN A 1 30  ? -15.985 4.936   1.141   1.00 2.30  ? 42  ASN A ND2  1 
ATOM   452  H H    . ASN A 1 30  ? -13.404 1.241   -0.068  1.00 0.57  ? 42  ASN A H    1 
ATOM   453  H HA   . ASN A 1 30  ? -12.838 3.204   2.027   1.00 0.60  ? 42  ASN A HA   1 
ATOM   454  H HB2  . ASN A 1 30  ? -13.136 4.024   -0.223  1.00 1.21  ? 42  ASN A HB2  1 
ATOM   455  H HB3  . ASN A 1 30  ? -14.706 3.230   -0.357  1.00 1.12  ? 42  ASN A HB3  1 
ATOM   456  H HD21 . ASN A 1 30  ? -16.506 4.134   0.931   1.00 2.56  ? 42  ASN A HD21 1 
ATOM   457  H HD22 . ASN A 1 30  ? -16.428 5.723   1.522   1.00 3.02  ? 42  ASN A HD22 1 
ATOM   458  N N    . ASP A 1 31  ? -15.800 1.749   1.909   1.00 0.53  ? 43  ASP A N    1 
ATOM   459  C CA   . ASP A 1 31  ? -16.993 1.509   2.775   1.00 0.53  ? 43  ASP A CA   1 
ATOM   460  C C    . ASP A 1 31  ? -16.547 0.972   4.142   1.00 0.50  ? 43  ASP A C    1 
ATOM   461  O O    . ASP A 1 31  ? -17.127 1.281   5.168   1.00 0.58  ? 43  ASP A O    1 
ATOM   462  C CB   . ASP A 1 31  ? -17.912 0.488   2.103   1.00 0.55  ? 43  ASP A CB   1 
ATOM   463  C CG   . ASP A 1 31  ? -19.345 0.687   2.598   1.00 0.88  ? 43  ASP A CG   1 
ATOM   464  O OD1  . ASP A 1 31  ? -19.683 1.808   2.940   1.00 1.40  ? 43  ASP A OD1  1 
ATOM   465  O OD2  . ASP A 1 31  ? -20.081 -0.286  2.628   1.00 1.55  ? 43  ASP A OD2  1 
ATOM   466  H H    . ASP A 1 31  ? -15.742 1.333   1.017   1.00 0.56  ? 43  ASP A H    1 
ATOM   467  H HA   . ASP A 1 31  ? -17.527 2.438   2.914   1.00 0.57  ? 43  ASP A HA   1 
ATOM   468  H HB2  . ASP A 1 31  ? -17.878 0.624   1.032   1.00 0.74  ? 43  ASP A HB2  1 
ATOM   469  H HB3  . ASP A 1 31  ? -17.583 -0.510  2.350   1.00 0.71  ? 43  ASP A HB3  1 
ATOM   470  N N    . LYS A 1 32  ? -15.524 0.169   4.164   1.00 0.44  ? 44  LYS A N    1 
ATOM   471  C CA   . LYS A 1 32  ? -15.043 -0.396  5.455   1.00 0.42  ? 44  LYS A CA   1 
ATOM   472  C C    . LYS A 1 32  ? -14.103 0.590   6.149   1.00 0.41  ? 44  LYS A C    1 
ATOM   473  O O    . LYS A 1 32  ? -14.073 0.664   7.362   1.00 0.43  ? 44  LYS A O    1 
ATOM   474  C CB   . LYS A 1 32  ? -14.306 -1.706  5.195   1.00 0.42  ? 44  LYS A CB   1 
ATOM   475  C CG   . LYS A 1 32  ? -14.871 -2.798  6.105   1.00 0.58  ? 44  LYS A CG   1 
ATOM   476  C CD   . LYS A 1 32  ? -15.836 -3.679  5.311   1.00 0.86  ? 44  LYS A CD   1 
ATOM   477  C CE   . LYS A 1 32  ? -15.276 -5.100  5.224   1.00 1.37  ? 44  LYS A CE   1 
ATOM   478  N NZ   . LYS A 1 32  ? -15.927 -5.824  4.096   1.00 1.96  ? 44  LYS A NZ   1 
ATOM   479  H H    . LYS A 1 32  ? -15.075 -0.066  3.331   1.00 0.48  ? 44  LYS A H    1 
ATOM   480  H HA   . LYS A 1 32  ? -15.891 -0.588  6.095   1.00 0.45  ? 44  LYS A HA   1 
ATOM   481  H HB2  . LYS A 1 32  ? -14.436 -1.993  4.161   1.00 0.45  ? 44  LYS A HB2  1 
ATOM   482  H HB3  . LYS A 1 32  ? -13.256 -1.574  5.402   1.00 0.44  ? 44  LYS A HB3  1 
ATOM   483  H HG2  . LYS A 1 32  ? -14.061 -3.402  6.487   1.00 1.10  ? 44  LYS A HG2  1 
ATOM   484  H HG3  . LYS A 1 32  ? -15.399 -2.342  6.929   1.00 1.07  ? 44  LYS A HG3  1 
ATOM   485  H HD2  . LYS A 1 32  ? -16.796 -3.699  5.807   1.00 1.32  ? 44  LYS A HD2  1 
ATOM   486  H HD3  . LYS A 1 32  ? -15.953 -3.279  4.315   1.00 1.36  ? 44  LYS A HD3  1 
ATOM   487  H HE2  . LYS A 1 32  ? -14.210 -5.056  5.056   1.00 1.71  ? 44  LYS A HE2  1 
ATOM   488  H HE3  . LYS A 1 32  ? -15.473 -5.622  6.149   1.00 1.68  ? 44  LYS A HE3  1 
ATOM   489  H HZ1  . LYS A 1 32  ? -16.455 -5.146  3.508   1.00 2.40  ? 44  LYS A HZ1  1 
ATOM   490  H HZ2  . LYS A 1 32  ? -15.201 -6.293  3.519   1.00 2.34  ? 44  LYS A HZ2  1 
ATOM   491  H HZ3  . LYS A 1 32  ? -16.581 -6.538  4.474   1.00 2.28  ? 44  LYS A HZ3  1 
ATOM   492  N N    . VAL A 1 33  ? -13.339 1.351   5.403   1.00 0.40  ? 45  VAL A N    1 
ATOM   493  C CA   . VAL A 1 33  ? -12.416 2.326   6.054   1.00 0.41  ? 45  VAL A CA   1 
ATOM   494  C C    . VAL A 1 33  ? -13.249 3.205   6.978   1.00 0.44  ? 45  VAL A C    1 
ATOM   495  O O    . VAL A 1 33  ? -12.861 3.509   8.088   1.00 0.44  ? 45  VAL A O    1 
ATOM   496  C CB   . VAL A 1 33  ? -11.725 3.193   4.999   1.00 0.44  ? 45  VAL A CB   1 
ATOM   497  C CG1  . VAL A 1 33  ? -11.447 4.581   5.581   1.00 0.44  ? 45  VAL A CG1  1 
ATOM   498  C CG2  . VAL A 1 33  ? -10.400 2.542   4.601   1.00 0.47  ? 45  VAL A CG2  1 
ATOM   499  H H    . VAL A 1 33  ? -13.376 1.282   4.427   1.00 0.41  ? 45  VAL A H    1 
ATOM   500  H HA   . VAL A 1 33  ? -11.675 1.793   6.633   1.00 0.40  ? 45  VAL A HA   1 
ATOM   501  H HB   . VAL A 1 33  ? -12.362 3.284   4.131   1.00 0.49  ? 45  VAL A HB   1 
ATOM   502  H HG11 . VAL A 1 33  ? -11.101 4.480   6.599   1.00 1.10  ? 45  VAL A HG11 1 
ATOM   503  H HG12 . VAL A 1 33  ? -10.689 5.073   4.991   1.00 1.05  ? 45  VAL A HG12 1 
ATOM   504  H HG13 . VAL A 1 33  ? -12.353 5.167   5.564   1.00 0.92  ? 45  VAL A HG13 1 
ATOM   505  H HG21 . VAL A 1 33  ? -10.339 1.556   5.036   1.00 1.15  ? 45  VAL A HG21 1 
ATOM   506  H HG22 . VAL A 1 33  ? -10.344 2.467   3.526   1.00 1.05  ? 45  VAL A HG22 1 
ATOM   507  H HG23 . VAL A 1 33  ? -9.581  3.146   4.963   1.00 1.13  ? 45  VAL A HG23 1 
ATOM   508  N N    . MET A 1 34  ? -14.407 3.596   6.527   1.00 0.52  ? 46  MET A N    1 
ATOM   509  C CA   . MET A 1 34  ? -15.287 4.435   7.377   1.00 0.59  ? 46  MET A CA   1 
ATOM   510  C C    . MET A 1 34  ? -15.997 3.516   8.374   1.00 0.58  ? 46  MET A C    1 
ATOM   511  O O    . MET A 1 34  ? -16.286 3.897   9.491   1.00 0.67  ? 46  MET A O    1 
ATOM   512  C CB   . MET A 1 34  ? -16.317 5.154   6.504   1.00 0.65  ? 46  MET A CB   1 
ATOM   513  C CG   . MET A 1 34  ? -15.694 6.428   5.931   1.00 0.85  ? 46  MET A CG   1 
ATOM   514  S SD   . MET A 1 34  ? -16.199 7.851   6.929   1.00 1.37  ? 46  MET A SD   1 
ATOM   515  C CE   . MET A 1 34  ? -14.554 8.573   7.142   1.00 1.39  ? 46  MET A CE   1 
ATOM   516  H H    . MET A 1 34  ? -14.703 3.323   5.632   1.00 0.56  ? 46  MET A H    1 
ATOM   517  H HA   . MET A 1 34  ? -14.692 5.160   7.912   1.00 0.64  ? 46  MET A HA   1 
ATOM   518  H HB2  . MET A 1 34  ? -16.621 4.504   5.696   1.00 0.65  ? 46  MET A HB2  1 
ATOM   519  H HB3  . MET A 1 34  ? -17.178 5.414   7.101   1.00 0.68  ? 46  MET A HB3  1 
ATOM   520  H HG2  . MET A 1 34  ? -14.617 6.341   5.948   1.00 0.99  ? 46  MET A HG2  1 
ATOM   521  H HG3  . MET A 1 34  ? -16.027 6.566   4.913   1.00 1.11  ? 46  MET A HG3  1 
ATOM   522  H HE1  . MET A 1 34  ? -13.807 7.794   7.066   1.00 1.73  ? 46  MET A HE1  1 
ATOM   523  H HE2  . MET A 1 34  ? -14.386 9.317   6.375   1.00 1.65  ? 46  MET A HE2  1 
ATOM   524  H HE3  . MET A 1 34  ? -14.486 9.039   8.112   1.00 1.85  ? 46  MET A HE3  1 
ATOM   525  N N    . GLY A 1 35  ? -16.271 2.297   7.976   1.00 0.52  ? 47  GLY A N    1 
ATOM   526  C CA   . GLY A 1 35  ? -16.952 1.344   8.896   1.00 0.56  ? 47  GLY A CA   1 
ATOM   527  C C    . GLY A 1 35  ? -15.947 0.868   9.961   1.00 0.60  ? 47  GLY A C    1 
ATOM   528  O O    . GLY A 1 35  ? -15.196 1.668   10.483  1.00 0.71  ? 47  GLY A O    1 
ATOM   529  H H    . GLY A 1 35  ? -16.024 2.005   7.069   1.00 0.49  ? 47  GLY A H    1 
ATOM   530  H HA2  . GLY A 1 35  ? -17.784 1.842   9.377   1.00 0.62  ? 47  GLY A HA2  1 
ATOM   531  H HA3  . GLY A 1 35  ? -17.313 0.506   8.328   1.00 0.55  ? 47  GLY A HA3  1 
ATOM   532  N N    . PRO A 1 36  ? -15.952 -0.414  10.262  1.00 0.60  ? 48  PRO A N    1 
ATOM   533  C CA   . PRO A 1 36  ? -15.044 -0.994  11.261  1.00 0.66  ? 48  PRO A CA   1 
ATOM   534  C C    . PRO A 1 36  ? -13.608 -1.044  10.722  1.00 0.60  ? 48  PRO A C    1 
ATOM   535  O O    . PRO A 1 36  ? -12.655 -1.005  11.473  1.00 0.67  ? 48  PRO A O    1 
ATOM   536  C CB   . PRO A 1 36  ? -15.560 -2.405  11.524  1.00 0.72  ? 48  PRO A CB   1 
ATOM   537  C CG   . PRO A 1 36  ? -16.310 -2.746  10.215  1.00 0.92  ? 48  PRO A CG   1 
ATOM   538  C CD   . PRO A 1 36  ? -16.856 -1.414  9.646   1.00 0.71  ? 48  PRO A CD   1 
ATOM   539  H HA   . PRO A 1 36  ? -15.078 -0.420  12.173  1.00 0.72  ? 48  PRO A HA   1 
ATOM   540  H HB2  . PRO A 1 36  ? -14.735 -3.087  11.691  1.00 0.86  ? 48  PRO A HB2  1 
ATOM   541  H HB3  . PRO A 1 36  ? -16.245 -2.415  12.356  1.00 0.93  ? 48  PRO A HB3  1 
ATOM   542  H HG2  . PRO A 1 36  ? -15.628 -3.201  9.508   1.00 1.22  ? 48  PRO A HG2  1 
ATOM   543  H HG3  . PRO A 1 36  ? -17.130 -3.416  10.422  1.00 1.29  ? 48  PRO A HG3  1 
ATOM   544  H HD2  . PRO A 1 36  ? -16.776 -1.399  8.567   1.00 0.68  ? 48  PRO A HD2  1 
ATOM   545  H HD3  . PRO A 1 36  ? -17.873 -1.248  9.962   1.00 0.79  ? 48  PRO A HD3  1 
ATOM   546  N N    . GLY A 1 37  ? -13.444 -1.131  9.429   1.00 0.52  ? 49  GLY A N    1 
ATOM   547  C CA   . GLY A 1 37  ? -12.068 -1.183  8.854   1.00 0.50  ? 49  GLY A CA   1 
ATOM   548  C C    . GLY A 1 37  ? -11.916 -2.442  7.997   1.00 0.41  ? 49  GLY A C    1 
ATOM   549  O O    . GLY A 1 37  ? -12.171 -3.543  8.442   1.00 0.63  ? 49  GLY A O    1 
ATOM   550  H H    . GLY A 1 37  ? -14.223 -1.162  8.836   1.00 0.49  ? 49  GLY A H    1 
ATOM   551  H HA2  . GLY A 1 37  ? -11.901 -0.307  8.244   1.00 0.56  ? 49  GLY A HA2  1 
ATOM   552  H HA3  . GLY A 1 37  ? -11.345 -1.208  9.655   1.00 0.59  ? 49  GLY A HA3  1 
ATOM   553  N N    . VAL A 1 38  ? -11.505 -2.287  6.767   1.00 0.52  ? 50  VAL A N    1 
ATOM   554  C CA   . VAL A 1 38  ? -11.341 -3.485  5.880   1.00 0.41  ? 50  VAL A CA   1 
ATOM   555  C C    . VAL A 1 38  ? -10.355 -4.459  6.515   1.00 0.40  ? 50  VAL A C    1 
ATOM   556  O O    . VAL A 1 38  ? -9.761  -4.171  7.532   1.00 0.92  ? 50  VAL A O    1 
ATOM   557  C CB   . VAL A 1 38  ? -10.813 -3.088  4.495   1.00 0.46  ? 50  VAL A CB   1 
ATOM   558  C CG1  . VAL A 1 38  ? -11.983 -2.720  3.592   1.00 0.44  ? 50  VAL A CG1  1 
ATOM   559  C CG2  . VAL A 1 38  ? -9.864  -1.895  4.606   1.00 0.77  ? 50  VAL A CG2  1 
ATOM   560  H H    . VAL A 1 38  ? -11.310 -1.386  6.433   1.00 0.82  ? 50  VAL A H    1 
ATOM   561  H HA   . VAL A 1 38  ? -12.297 -3.976  5.767   1.00 0.43  ? 50  VAL A HA   1 
ATOM   562  H HB   . VAL A 1 38  ? -10.284 -3.927  4.064   1.00 0.66  ? 50  VAL A HB   1 
ATOM   563  H HG11 . VAL A 1 38  ? -12.863 -3.257  3.910   1.00 1.05  ? 50  VAL A HG11 1 
ATOM   564  H HG12 . VAL A 1 38  ? -12.166 -1.657  3.653   1.00 1.16  ? 50  VAL A HG12 1 
ATOM   565  H HG13 . VAL A 1 38  ? -11.747 -2.989  2.576   1.00 1.11  ? 50  VAL A HG13 1 
ATOM   566  H HG21 . VAL A 1 38  ? -9.509  -1.811  5.621   1.00 1.13  ? 50  VAL A HG21 1 
ATOM   567  H HG22 . VAL A 1 38  ? -9.025  -2.036  3.941   1.00 1.42  ? 50  VAL A HG22 1 
ATOM   568  H HG23 . VAL A 1 38  ? -10.391 -0.992  4.337   1.00 1.22  ? 50  VAL A HG23 1 
ATOM   569  N N    . SER A 1 39  ? -10.179 -5.610  5.915   1.00 0.55  ? 51  SER A N    1 
ATOM   570  C CA   . SER A 1 39  ? -9.230  -6.616  6.474   1.00 0.43  ? 51  SER A CA   1 
ATOM   571  C C    . SER A 1 39  ? -8.975  -7.714  5.438   1.00 0.37  ? 51  SER A C    1 
ATOM   572  O O    . SER A 1 39  ? -9.707  -8.680  5.351   1.00 0.50  ? 51  SER A O    1 
ATOM   573  C CB   . SER A 1 39  ? -9.829  -7.236  7.737   1.00 0.46  ? 51  SER A CB   1 
ATOM   574  O OG   . SER A 1 39  ? -11.146 -7.693  7.456   1.00 0.64  ? 51  SER A OG   1 
ATOM   575  H H    . SER A 1 39  ? -10.674 -5.811  5.094   1.00 1.04  ? 51  SER A H    1 
ATOM   576  H HA   . SER A 1 39  ? -8.298  -6.135  6.718   1.00 0.44  ? 51  SER A HA   1 
ATOM   577  H HB2  . SER A 1 39  ? -9.224  -8.070  8.052   1.00 0.48  ? 51  SER A HB2  1 
ATOM   578  H HB3  . SER A 1 39  ? -9.854  -6.494  8.524   1.00 0.51  ? 51  SER A HB3  1 
ATOM   579  H HG   . SER A 1 39  ? -11.604 -7.806  8.292   1.00 0.99  ? 51  SER A HG   1 
ATOM   580  N N    . TYR A 1 40  ? -7.939  -7.575  4.654   1.00 0.38  ? 52  TYR A N    1 
ATOM   581  C CA   . TYR A 1 40  ? -7.637  -8.615  3.628   1.00 0.36  ? 52  TYR A CA   1 
ATOM   582  C C    . TYR A 1 40  ? -6.569  -9.565  4.172   1.00 0.33  ? 52  TYR A C    1 
ATOM   583  O O    . TYR A 1 40  ? -6.281  -9.575  5.353   1.00 0.33  ? 52  TYR A O    1 
ATOM   584  C CB   . TYR A 1 40  ? -7.116  -7.951  2.353   1.00 0.47  ? 52  TYR A CB   1 
ATOM   585  C CG   . TYR A 1 40  ? -7.830  -6.641  2.128   1.00 0.47  ? 52  TYR A CG   1 
ATOM   586  C CD1  . TYR A 1 40  ? -9.160  -6.632  1.692   1.00 1.05  ? 52  TYR A CD1  1 
ATOM   587  C CD2  . TYR A 1 40  ? -7.158  -5.433  2.351   1.00 1.53  ? 52  TYR A CD2  1 
ATOM   588  C CE1  . TYR A 1 40  ? -9.818  -5.415  1.478   1.00 1.13  ? 52  TYR A CE1  1 
ATOM   589  C CE2  . TYR A 1 40  ? -7.815  -4.217  2.137   1.00 1.79  ? 52  TYR A CE2  1 
ATOM   590  C CZ   . TYR A 1 40  ? -9.145  -4.207  1.701   1.00 1.11  ? 52  TYR A CZ   1 
ATOM   591  O OH   . TYR A 1 40  ? -9.793  -3.008  1.488   1.00 1.50  ? 52  TYR A OH   1 
ATOM   592  H H    . TYR A 1 40  ? -7.359  -6.790  4.742   1.00 0.53  ? 52  TYR A H    1 
ATOM   593  H HA   . TYR A 1 40  ? -8.535  -9.172  3.404   1.00 0.36  ? 52  TYR A HA   1 
ATOM   594  H HB2  . TYR A 1 40  ? -6.055  -7.771  2.450   1.00 0.73  ? 52  TYR A HB2  1 
ATOM   595  H HB3  . TYR A 1 40  ? -7.294  -8.605  1.514   1.00 0.67  ? 52  TYR A HB3  1 
ATOM   596  H HD1  . TYR A 1 40  ? -9.678  -7.564  1.520   1.00 1.93  ? 52  TYR A HD1  1 
ATOM   597  H HD2  . TYR A 1 40  ? -6.133  -5.441  2.687   1.00 2.33  ? 52  TYR A HD2  1 
ATOM   598  H HE1  . TYR A 1 40  ? -10.844 -5.407  1.142   1.00 1.89  ? 52  TYR A HE1  1 
ATOM   599  H HE2  . TYR A 1 40  ? -7.297  -3.285  2.309   1.00 2.72  ? 52  TYR A HE2  1 
ATOM   600  H HH   . TYR A 1 40  ? -9.711  -2.786  0.558   1.00 1.81  ? 52  TYR A HH   1 
ATOM   601  N N    . LEU A 1 41  ? -5.973  -10.365 3.326   1.00 0.36  ? 53  LEU A N    1 
ATOM   602  C CA   . LEU A 1 41  ? -4.927  -11.304 3.819   1.00 0.39  ? 53  LEU A CA   1 
ATOM   603  C C    . LEU A 1 41  ? -3.709  -11.247 2.899   1.00 0.41  ? 53  LEU A C    1 
ATOM   604  O O    . LEU A 1 41  ? -3.684  -11.850 1.844   1.00 0.46  ? 53  LEU A O    1 
ATOM   605  C CB   . LEU A 1 41  ? -5.483  -12.730 3.848   1.00 0.45  ? 53  LEU A CB   1 
ATOM   606  C CG   . LEU A 1 41  ? -5.986  -13.054 5.255   1.00 0.57  ? 53  LEU A CG   1 
ATOM   607  C CD1  . LEU A 1 41  ? -7.440  -12.601 5.396   1.00 0.78  ? 53  LEU A CD1  1 
ATOM   608  C CD2  . LEU A 1 41  ? -5.898  -14.563 5.491   1.00 0.89  ? 53  LEU A CD2  1 
ATOM   609  H H    . LEU A 1 41  ? -6.211  -10.348 2.371   1.00 0.39  ? 53  LEU A H    1 
ATOM   610  H HA   . LEU A 1 41  ? -4.633  -11.016 4.818   1.00 0.38  ? 53  LEU A HA   1 
ATOM   611  H HB2  . LEU A 1 41  ? -6.299  -12.812 3.145   1.00 0.48  ? 53  LEU A HB2  1 
ATOM   612  H HB3  . LEU A 1 41  ? -4.703  -13.425 3.578   1.00 0.49  ? 53  LEU A HB3  1 
ATOM   613  H HG   . LEU A 1 41  ? -5.376  -12.538 5.983   1.00 0.56  ? 53  LEU A HG   1 
ATOM   614  H HD11 . LEU A 1 41  ? -8.001  -12.920 4.529   1.00 1.31  ? 53  LEU A HD11 1 
ATOM   615  H HD12 . LEU A 1 41  ? -7.870  -13.041 6.284   1.00 1.29  ? 53  LEU A HD12 1 
ATOM   616  H HD13 . LEU A 1 41  ? -7.476  -11.525 5.473   1.00 1.36  ? 53  LEU A HD13 1 
ATOM   617  H HD21 . LEU A 1 41  ? -5.508  -15.044 4.606   1.00 1.12  ? 53  LEU A HD21 1 
ATOM   618  H HD22 . LEU A 1 41  ? -5.243  -14.760 6.327   1.00 1.57  ? 53  LEU A HD22 1 
ATOM   619  H HD23 . LEU A 1 41  ? -6.883  -14.952 5.707   1.00 1.46  ? 53  LEU A HD23 1 
ATOM   620  N N    . VAL A 1 42  ? -2.697  -10.530 3.295   1.00 0.41  ? 54  VAL A N    1 
ATOM   621  C CA   . VAL A 1 42  ? -1.473  -10.433 2.454   1.00 0.45  ? 54  VAL A CA   1 
ATOM   622  C C    . VAL A 1 42  ? -0.289  -10.977 3.253   1.00 0.43  ? 54  VAL A C    1 
ATOM   623  O O    . VAL A 1 42  ? -0.071  -10.602 4.388   1.00 0.47  ? 54  VAL A O    1 
ATOM   624  C CB   . VAL A 1 42  ? -1.226  -8.967  2.062   1.00 0.47  ? 54  VAL A CB   1 
ATOM   625  C CG1  . VAL A 1 42  ? -2.219  -8.060  2.791   1.00 0.48  ? 54  VAL A CG1  1 
ATOM   626  C CG2  . VAL A 1 42  ? 0.199   -8.553  2.439   1.00 0.65  ? 54  VAL A CG2  1 
ATOM   627  H H    . VAL A 1 42  ? -2.740  -10.058 4.152   1.00 0.41  ? 54  VAL A H    1 
ATOM   628  H HA   . VAL A 1 42  ? -1.604  -11.026 1.563   1.00 0.52  ? 54  VAL A HA   1 
ATOM   629  H HB   . VAL A 1 42  ? -1.361  -8.857  0.996   1.00 0.70  ? 54  VAL A HB   1 
ATOM   630  H HG11 . VAL A 1 42  ? -2.101  -8.180  3.858   1.00 1.04  ? 54  VAL A HG11 1 
ATOM   631  H HG12 . VAL A 1 42  ? -2.032  -7.031  2.522   1.00 1.10  ? 54  VAL A HG12 1 
ATOM   632  H HG13 . VAL A 1 42  ? -3.227  -8.328  2.508   1.00 1.23  ? 54  VAL A HG13 1 
ATOM   633  H HG21 . VAL A 1 42  ? 0.907   -9.228  1.980   1.00 1.29  ? 54  VAL A HG21 1 
ATOM   634  H HG22 . VAL A 1 42  ? 0.384   -7.549  2.087   1.00 1.28  ? 54  VAL A HG22 1 
ATOM   635  H HG23 . VAL A 1 42  ? 0.314   -8.583  3.512   1.00 1.04  ? 54  VAL A HG23 1 
ATOM   636  N N    . ARG A 1 43  ? 0.477   -11.866 2.679   1.00 0.59  ? 55  ARG A N    1 
ATOM   637  C CA   . ARG A 1 43  ? 1.635   -12.425 3.430   1.00 0.57  ? 55  ARG A CA   1 
ATOM   638  C C    . ARG A 1 43  ? 2.836   -11.485 3.309   1.00 0.53  ? 55  ARG A C    1 
ATOM   639  O O    . ARG A 1 43  ? 3.173   -11.010 2.243   1.00 0.55  ? 55  ARG A O    1 
ATOM   640  C CB   . ARG A 1 43  ? 1.979   -13.821 2.894   1.00 0.65  ? 55  ARG A CB   1 
ATOM   641  C CG   . ARG A 1 43  ? 3.308   -13.789 2.134   1.00 1.31  ? 55  ARG A CG   1 
ATOM   642  C CD   . ARG A 1 43  ? 3.566   -15.163 1.515   1.00 1.40  ? 55  ARG A CD   1 
ATOM   643  N NE   . ARG A 1 43  ? 2.820   -15.274 0.231   1.00 2.09  ? 55  ARG A NE   1 
ATOM   644  C CZ   . ARG A 1 43  ? 2.755   -16.420 -0.390  1.00 2.24  ? 55  ARG A CZ   1 
ATOM   645  N NH1  . ARG A 1 43  ? 3.794   -17.210 -0.411  1.00 2.57  ? 55  ARG A NH1  1 
ATOM   646  N NH2  . ARG A 1 43  ? 1.652   -16.777 -0.988  1.00 2.64  ? 55  ARG A NH2  1 
ATOM   647  H H    . ARG A 1 43  ? 0.287   -12.167 1.763   1.00 0.79  ? 55  ARG A H    1 
ATOM   648  H HA   . ARG A 1 43  ? 1.367   -12.505 4.471   1.00 0.58  ? 55  ARG A HA   1 
ATOM   649  H HB2  . ARG A 1 43  ? 2.058   -14.511 3.722   1.00 0.95  ? 55  ARG A HB2  1 
ATOM   650  H HB3  . ARG A 1 43  ? 1.195   -14.152 2.229   1.00 1.29  ? 55  ARG A HB3  1 
ATOM   651  H HG2  . ARG A 1 43  ? 3.259   -13.046 1.352   1.00 1.92  ? 55  ARG A HG2  1 
ATOM   652  H HG3  . ARG A 1 43  ? 4.111   -13.548 2.814   1.00 1.74  ? 55  ARG A HG3  1 
ATOM   653  H HD2  . ARG A 1 43  ? 4.623   -15.283 1.331   1.00 1.53  ? 55  ARG A HD2  1 
ATOM   654  H HD3  . ARG A 1 43  ? 3.230   -15.933 2.195   1.00 1.43  ? 55  ARG A HD3  1 
ATOM   655  H HE   . ARG A 1 43  ? 2.377   -14.486 -0.148  1.00 2.62  ? 55  ARG A HE   1 
ATOM   656  H HH11 . ARG A 1 43  ? 4.639   -16.937 0.048   1.00 2.91  ? 55  ARG A HH11 1 
ATOM   657  H HH12 . ARG A 1 43  ? 3.745   -18.088 -0.888  1.00 2.81  ? 55  ARG A HH12 1 
ATOM   658  H HH21 . ARG A 1 43  ? 0.855   -16.172 -0.970  1.00 3.08  ? 55  ARG A HH21 1 
ATOM   659  H HH22 . ARG A 1 43  ? 1.602   -17.655 -1.464  1.00 2.81  ? 55  ARG A HH22 1 
ATOM   660  N N    . TYR A 1 44  ? 3.477   -11.214 4.411   1.00 0.56  ? 56  TYR A N    1 
ATOM   661  C CA   . TYR A 1 44  ? 4.656   -10.306 4.406   1.00 0.54  ? 56  TYR A CA   1 
ATOM   662  C C    . TYR A 1 44  ? 5.877   -11.052 3.864   1.00 0.50  ? 56  TYR A C    1 
ATOM   663  O O    . TYR A 1 44  ? 5.969   -12.260 3.957   1.00 0.55  ? 56  TYR A O    1 
ATOM   664  C CB   . TYR A 1 44  ? 4.923   -9.845  5.841   1.00 0.60  ? 56  TYR A CB   1 
ATOM   665  C CG   . TYR A 1 44  ? 5.868   -8.670  5.842   1.00 0.97  ? 56  TYR A CG   1 
ATOM   666  C CD1  . TYR A 1 44  ? 5.641   -7.581  4.993   1.00 1.84  ? 56  TYR A CD1  1 
ATOM   667  C CD2  . TYR A 1 44  ? 6.972   -8.669  6.701   1.00 1.80  ? 56  TYR A CD2  1 
ATOM   668  C CE1  . TYR A 1 44  ? 6.518   -6.491  5.004   1.00 2.55  ? 56  TYR A CE1  1 
ATOM   669  C CE2  . TYR A 1 44  ? 7.848   -7.581  6.711   1.00 2.60  ? 56  TYR A CE2  1 
ATOM   670  C CZ   . TYR A 1 44  ? 7.621   -6.492  5.863   1.00 2.75  ? 56  TYR A CZ   1 
ATOM   671  O OH   . TYR A 1 44  ? 8.484   -5.418  5.875   1.00 3.67  ? 56  TYR A OH   1 
ATOM   672  H H    . TYR A 1 44  ? 3.176   -11.608 5.252   1.00 0.64  ? 56  TYR A H    1 
ATOM   673  H HA   . TYR A 1 44  ? 4.450   -9.449  3.783   1.00 0.56  ? 56  TYR A HA   1 
ATOM   674  H HB2  . TYR A 1 44  ? 3.991   -9.554  6.302   1.00 1.11  ? 56  TYR A HB2  1 
ATOM   675  H HB3  . TYR A 1 44  ? 5.361   -10.656 6.404   1.00 1.04  ? 56  TYR A HB3  1 
ATOM   676  H HD1  . TYR A 1 44  ? 4.789   -7.579  4.331   1.00 2.41  ? 56  TYR A HD1  1 
ATOM   677  H HD2  . TYR A 1 44  ? 7.147   -9.510  7.356   1.00 2.28  ? 56  TYR A HD2  1 
ATOM   678  H HE1  . TYR A 1 44  ? 6.344   -5.652  4.349   1.00 3.31  ? 56  TYR A HE1  1 
ATOM   679  H HE2  . TYR A 1 44  ? 8.699   -7.582  7.374   1.00 3.43  ? 56  TYR A HE2  1 
ATOM   680  H HH   . TYR A 1 44  ? 8.737   -5.252  6.786   1.00 4.13  ? 56  TYR A HH   1 
ATOM   681  N N    . MET A 1 45  ? 6.815   -10.340 3.296   1.00 0.48  ? 57  MET A N    1 
ATOM   682  C CA   . MET A 1 45  ? 8.030   -11.005 2.745   1.00 0.49  ? 57  MET A CA   1 
ATOM   683  C C    . MET A 1 45  ? 9.285   -10.284 3.242   1.00 0.60  ? 57  MET A C    1 
ATOM   684  O O    . MET A 1 45  ? 10.035  -9.720  2.469   1.00 1.15  ? 57  MET A O    1 
ATOM   685  C CB   . MET A 1 45  ? 7.986   -10.956 1.217   1.00 0.63  ? 57  MET A CB   1 
ATOM   686  C CG   . MET A 1 45  ? 8.683   -12.192 0.645   1.00 0.69  ? 57  MET A CG   1 
ATOM   687  S SD   . MET A 1 45  ? 7.891   -12.664 -0.913  1.00 1.24  ? 57  MET A SD   1 
ATOM   688  C CE   . MET A 1 45  ? 8.903   -11.636 -2.006  1.00 0.79  ? 57  MET A CE   1 
ATOM   689  H H    . MET A 1 45  ? 6.718   -9.367  3.231   1.00 0.51  ? 57  MET A H    1 
ATOM   690  H HA   . MET A 1 45  ? 8.055   -12.035 3.071   1.00 0.58  ? 57  MET A HA   1 
ATOM   691  H HB2  . MET A 1 45  ? 6.958   -10.937 0.887   1.00 0.91  ? 57  MET A HB2  1 
ATOM   692  H HB3  . MET A 1 45  ? 8.493   -10.068 0.870   1.00 0.81  ? 57  MET A HB3  1 
ATOM   693  H HG2  . MET A 1 45  ? 9.724   -11.969 0.467   1.00 1.07  ? 57  MET A HG2  1 
ATOM   694  H HG3  . MET A 1 45  ? 8.605   -13.007 1.350   1.00 1.29  ? 57  MET A HG3  1 
ATOM   695  H HE1  . MET A 1 45  ? 9.912   -11.587 -1.620  1.00 1.39  ? 57  MET A HE1  1 
ATOM   696  H HE2  . MET A 1 45  ? 8.920   -12.066 -2.994  1.00 1.18  ? 57  MET A HE2  1 
ATOM   697  H HE3  . MET A 1 45  ? 8.482   -10.641 -2.055  1.00 1.27  ? 57  MET A HE3  1 
ATOM   698  N N    . GLY A 1 46  ? 9.521   -10.298 4.524   1.00 0.72  ? 58  GLY A N    1 
ATOM   699  C CA   . GLY A 1 46  ? 10.730  -9.616  5.069   1.00 0.89  ? 58  GLY A CA   1 
ATOM   700  C C    . GLY A 1 46  ? 10.617  -8.106  4.851   1.00 0.83  ? 58  GLY A C    1 
ATOM   701  O O    . GLY A 1 46  ? 9.619   -7.611  4.367   1.00 1.13  ? 58  GLY A O    1 
ATOM   702  H H    . GLY A 1 46  ? 8.905   -10.760 5.130   1.00 1.08  ? 58  GLY A H    1 
ATOM   703  H HA2  . GLY A 1 46  ? 10.811  -9.823  6.127   1.00 1.08  ? 58  GLY A HA2  1 
ATOM   704  H HA3  . GLY A 1 46  ? 11.609  -9.984  4.562   1.00 0.99  ? 58  GLY A HA3  1 
ATOM   705  N N    . CYS A 1 47  ? 11.636  -7.371  5.208   1.00 0.53  ? 59  CYS A N    1 
ATOM   706  C CA   . CYS A 1 47  ? 11.590  -5.890  5.025   1.00 0.50  ? 59  CYS A CA   1 
ATOM   707  C C    . CYS A 1 47  ? 12.948  -5.392  4.535   1.00 0.51  ? 59  CYS A C    1 
ATOM   708  O O    . CYS A 1 47  ? 13.979  -5.778  5.048   1.00 0.53  ? 59  CYS A O    1 
ATOM   709  C CB   . CYS A 1 47  ? 11.270  -5.220  6.362   1.00 0.52  ? 59  CYS A CB   1 
ATOM   710  S SG   . CYS A 1 47  ? 10.737  -6.471  7.555   1.00 1.35  ? 59  CYS A SG   1 
ATOM   711  H H    . CYS A 1 47  ? 12.432  -7.793  5.597   1.00 0.45  ? 59  CYS A H    1 
ATOM   712  H HA   . CYS A 1 47  ? 10.829  -5.636  4.301   1.00 0.50  ? 59  CYS A HA   1 
ATOM   713  H HB2  . CYS A 1 47  ? 12.155  -4.724  6.734   1.00 0.86  ? 59  CYS A HB2  1 
ATOM   714  H HB3  . CYS A 1 47  ? 10.484  -4.494  6.223   1.00 0.84  ? 59  CYS A HB3  1 
ATOM   715  H HG   . CYS A 1 47  ? 11.499  -6.723  8.082   1.00 1.68  ? 59  CYS A HG   1 
ATOM   716  N N    . VAL A 1 48  ? 12.959  -4.534  3.553   1.00 0.53  ? 60  VAL A N    1 
ATOM   717  C CA   . VAL A 1 48  ? 14.255  -4.011  3.040   1.00 0.55  ? 60  VAL A CA   1 
ATOM   718  C C    . VAL A 1 48  ? 14.459  -2.591  3.567   1.00 0.52  ? 60  VAL A C    1 
ATOM   719  O O    . VAL A 1 48  ? 13.554  -1.786  3.560   1.00 0.61  ? 60  VAL A O    1 
ATOM   720  C CB   . VAL A 1 48  ? 14.228  -3.992  1.509   1.00 0.58  ? 60  VAL A CB   1 
ATOM   721  C CG1  . VAL A 1 48  ? 13.798  -5.365  0.988   1.00 0.62  ? 60  VAL A CG1  1 
ATOM   722  C CG2  . VAL A 1 48  ? 13.232  -2.935  1.028   1.00 0.53  ? 60  VAL A CG2  1 
ATOM   723  H H    . VAL A 1 48  ? 12.115  -4.228  3.156   1.00 0.57  ? 60  VAL A H    1 
ATOM   724  H HA   . VAL A 1 48  ? 15.061  -4.643  3.381   1.00 0.59  ? 60  VAL A HA   1 
ATOM   725  H HB   . VAL A 1 48  ? 15.214  -3.758  1.135   1.00 0.65  ? 60  VAL A HB   1 
ATOM   726  H HG11 . VAL A 1 48  ? 14.062  -6.123  1.710   1.00 1.34  ? 60  VAL A HG11 1 
ATOM   727  H HG12 . VAL A 1 48  ? 12.730  -5.373  0.832   1.00 1.16  ? 60  VAL A HG12 1 
ATOM   728  H HG13 . VAL A 1 48  ? 14.300  -5.569  0.053   1.00 0.97  ? 60  VAL A HG13 1 
ATOM   729  H HG21 . VAL A 1 48  ? 12.434  -2.838  1.749   1.00 1.17  ? 60  VAL A HG21 1 
ATOM   730  H HG22 . VAL A 1 48  ? 13.738  -1.987  0.920   1.00 1.09  ? 60  VAL A HG22 1 
ATOM   731  H HG23 . VAL A 1 48  ? 12.822  -3.235  0.075   1.00 1.15  ? 60  VAL A HG23 1 
ATOM   732  N N    . GLU A 1 49  ? 15.637  -2.273  4.027   1.00 0.58  ? 61  GLU A N    1 
ATOM   733  C CA   . GLU A 1 49  ? 15.876  -0.899  4.551   1.00 0.58  ? 61  GLU A CA   1 
ATOM   734  C C    . GLU A 1 49  ? 16.598  -0.073  3.501   1.00 0.55  ? 61  GLU A C    1 
ATOM   735  O O    . GLU A 1 49  ? 17.298  -0.593  2.655   1.00 0.65  ? 61  GLU A O    1 
ATOM   736  C CB   . GLU A 1 49  ? 16.719  -0.968  5.826   1.00 0.62  ? 61  GLU A CB   1 
ATOM   737  C CG   . GLU A 1 49  ? 16.036  -1.885  6.842   1.00 0.76  ? 61  GLU A CG   1 
ATOM   738  C CD   . GLU A 1 49  ? 16.477  -1.499  8.255   1.00 1.26  ? 61  GLU A CD   1 
ATOM   739  O OE1  . GLU A 1 49  ? 17.668  -1.327  8.455   1.00 1.88  ? 61  GLU A OE1  1 
ATOM   740  O OE2  . GLU A 1 49  ? 15.617  -1.382  9.112   1.00 1.84  ? 61  GLU A OE2  1 
ATOM   741  H H    . GLU A 1 49  ? 16.360  -2.935  4.028   1.00 0.72  ? 61  GLU A H    1 
ATOM   742  H HA   . GLU A 1 49  ? 14.931  -0.426  4.767   1.00 0.63  ? 61  GLU A HA   1 
ATOM   743  H HB2  . GLU A 1 49  ? 17.698  -1.358  5.588   1.00 0.75  ? 61  GLU A HB2  1 
ATOM   744  H HB3  . GLU A 1 49  ? 16.817  0.021   6.246   1.00 0.85  ? 61  GLU A HB3  1 
ATOM   745  H HG2  . GLU A 1 49  ? 14.963  -1.780  6.757   1.00 0.96  ? 61  GLU A HG2  1 
ATOM   746  H HG3  . GLU A 1 49  ? 16.314  -2.909  6.647   1.00 1.10  ? 61  GLU A HG3  1 
ATOM   747  N N    . VAL A 1 50  ? 16.423  1.215   3.544   1.00 0.52  ? 62  VAL A N    1 
ATOM   748  C CA   . VAL A 1 50  ? 17.088  2.079   2.542   1.00 0.51  ? 62  VAL A CA   1 
ATOM   749  C C    . VAL A 1 50  ? 18.017  3.075   3.219   1.00 0.52  ? 62  VAL A C    1 
ATOM   750  O O    . VAL A 1 50  ? 18.043  3.211   4.426   1.00 0.60  ? 62  VAL A O    1 
ATOM   751  C CB   . VAL A 1 50  ? 16.031  2.858   1.776   1.00 0.58  ? 62  VAL A CB   1 
ATOM   752  C CG1  . VAL A 1 50  ? 16.542  3.129   0.372   1.00 0.88  ? 62  VAL A CG1  1 
ATOM   753  C CG2  . VAL A 1 50  ? 14.742  2.045   1.702   1.00 1.01  ? 62  VAL A CG2  1 
ATOM   754  H H    . VAL A 1 50  ? 15.845  1.611   4.232   1.00 0.61  ? 62  VAL A H    1 
ATOM   755  H HA   . VAL A 1 50  ? 17.651  1.468   1.854   1.00 0.51  ? 62  VAL A HA   1 
ATOM   756  H HB   . VAL A 1 50  ? 15.840  3.796   2.277   1.00 0.77  ? 62  VAL A HB   1 
ATOM   757  H HG11 . VAL A 1 50  ? 17.355  2.453   0.153   1.00 1.37  ? 62  VAL A HG11 1 
ATOM   758  H HG12 . VAL A 1 50  ? 15.743  2.978   -0.334  1.00 1.29  ? 62  VAL A HG12 1 
ATOM   759  H HG13 . VAL A 1 50  ? 16.894  4.147   0.313   1.00 1.58  ? 62  VAL A HG13 1 
ATOM   760  H HG21 . VAL A 1 50  ? 14.983  1.005   1.540   1.00 1.35  ? 62  VAL A HG21 1 
ATOM   761  H HG22 . VAL A 1 50  ? 14.198  2.150   2.629   1.00 1.45  ? 62  VAL A HG22 1 
ATOM   762  H HG23 . VAL A 1 50  ? 14.136  2.408   0.885   1.00 1.67  ? 62  VAL A HG23 1 
ATOM   763  N N    . LEU A 1 51  ? 18.774  3.783   2.431   1.00 0.51  ? 63  LEU A N    1 
ATOM   764  C CA   . LEU A 1 51  ? 19.703  4.790   2.991   1.00 0.56  ? 63  LEU A CA   1 
ATOM   765  C C    . LEU A 1 51  ? 19.698  6.022   2.084   1.00 0.58  ? 63  LEU A C    1 
ATOM   766  O O    . LEU A 1 51  ? 20.672  6.742   1.993   1.00 0.62  ? 63  LEU A O    1 
ATOM   767  C CB   . LEU A 1 51  ? 21.116  4.209   3.063   1.00 0.65  ? 63  LEU A CB   1 
ATOM   768  C CG   . LEU A 1 51  ? 21.300  3.472   4.391   1.00 0.79  ? 63  LEU A CG   1 
ATOM   769  C CD1  . LEU A 1 51  ? 22.371  2.392   4.230   1.00 1.09  ? 63  LEU A CD1  1 
ATOM   770  C CD2  . LEU A 1 51  ? 21.738  4.467   5.468   1.00 1.13  ? 63  LEU A CD2  1 
ATOM   771  H H    . LEU A 1 51  ? 18.722  3.655   1.461   1.00 0.52  ? 63  LEU A H    1 
ATOM   772  H HA   . LEU A 1 51  ? 19.371  5.068   3.976   1.00 0.59  ? 63  LEU A HA   1 
ATOM   773  H HB2  . LEU A 1 51  ? 21.264  3.520   2.245   1.00 0.71  ? 63  LEU A HB2  1 
ATOM   774  H HB3  . LEU A 1 51  ? 21.838  5.009   2.995   1.00 0.70  ? 63  LEU A HB3  1 
ATOM   775  H HG   . LEU A 1 51  ? 20.366  3.013   4.680   1.00 0.87  ? 63  LEU A HG   1 
ATOM   776  H HD11 . LEU A 1 51  ? 22.316  1.975   3.236   1.00 1.52  ? 63  LEU A HD11 1 
ATOM   777  H HD12 . LEU A 1 51  ? 23.348  2.828   4.383   1.00 1.70  ? 63  LEU A HD12 1 
ATOM   778  H HD13 . LEU A 1 51  ? 22.208  1.611   4.958   1.00 1.39  ? 63  LEU A HD13 1 
ATOM   779  H HD21 . LEU A 1 51  ? 22.209  5.320   5.001   1.00 1.41  ? 63  LEU A HD21 1 
ATOM   780  H HD22 . LEU A 1 51  ? 20.875  4.795   6.028   1.00 1.85  ? 63  LEU A HD22 1 
ATOM   781  H HD23 . LEU A 1 51  ? 22.440  3.990   6.135   1.00 1.51  ? 63  LEU A HD23 1 
ATOM   782  N N    . GLN A 1 52  ? 18.605  6.269   1.408   1.00 0.64  ? 64  GLN A N    1 
ATOM   783  C CA   . GLN A 1 52  ? 18.544  7.454   0.507   1.00 0.71  ? 64  GLN A CA   1 
ATOM   784  C C    . GLN A 1 52  ? 17.734  8.567   1.177   1.00 0.71  ? 64  GLN A C    1 
ATOM   785  O O    . GLN A 1 52  ? 17.192  8.394   2.251   1.00 0.75  ? 64  GLN A O    1 
ATOM   786  C CB   . GLN A 1 52  ? 17.874  7.056   -0.810  1.00 0.76  ? 64  GLN A CB   1 
ATOM   787  C CG   . GLN A 1 52  ? 16.360  6.974   -0.610  1.00 1.44  ? 64  GLN A CG   1 
ATOM   788  C CD   . GLN A 1 52  ? 15.746  6.106   -1.710  1.00 2.26  ? 64  GLN A CD   1 
ATOM   789  O OE1  . GLN A 1 52  ? 16.183  4.995   -1.939  1.00 2.74  ? 64  GLN A OE1  1 
ATOM   790  N NE2  . GLN A 1 52  ? 14.744  6.568   -2.407  1.00 3.01  ? 64  GLN A NE2  1 
ATOM   791  H H    . GLN A 1 52  ? 17.825  5.675   1.493   1.00 0.69  ? 64  GLN A H    1 
ATOM   792  H HA   . GLN A 1 52  ? 19.545  7.807   0.309   1.00 0.80  ? 64  GLN A HA   1 
ATOM   793  H HB2  . GLN A 1 52  ? 18.100  7.794   -1.566  1.00 0.88  ? 64  GLN A HB2  1 
ATOM   794  H HB3  . GLN A 1 52  ? 18.246  6.093   -1.126  1.00 1.18  ? 64  GLN A HB3  1 
ATOM   795  H HG2  . GLN A 1 52  ? 16.148  6.537   0.355   1.00 1.59  ? 64  GLN A HG2  1 
ATOM   796  H HG3  . GLN A 1 52  ? 15.936  7.965   -0.658  1.00 1.87  ? 64  GLN A HG3  1 
ATOM   797  H HE21 . GLN A 1 52  ? 14.391  7.464   -2.223  1.00 3.19  ? 64  GLN A HE21 1 
ATOM   798  H HE22 . GLN A 1 52  ? 14.344  6.019   -3.113  1.00 3.65  ? 64  GLN A HE22 1 
ATOM   799  N N    . SER A 1 53  ? 17.648  9.709   0.551   1.00 0.76  ? 65  SER A N    1 
ATOM   800  C CA   . SER A 1 53  ? 16.874  10.833  1.150   1.00 0.81  ? 65  SER A CA   1 
ATOM   801  C C    . SER A 1 53  ? 15.403  10.430  1.269   1.00 0.80  ? 65  SER A C    1 
ATOM   802  O O    . SER A 1 53  ? 15.038  9.298   1.024   1.00 0.99  ? 65  SER A O    1 
ATOM   803  C CB   . SER A 1 53  ? 16.994  12.068  0.255   1.00 0.92  ? 65  SER A CB   1 
ATOM   804  O OG   . SER A 1 53  ? 17.494  13.157  1.021   1.00 1.22  ? 65  SER A OG   1 
ATOM   805  H H    . SER A 1 53  ? 18.093  9.827   -0.315  1.00 0.83  ? 65  SER A H    1 
ATOM   806  H HA   . SER A 1 53  ? 17.267  11.059  2.130   1.00 0.93  ? 65  SER A HA   1 
ATOM   807  H HB2  . SER A 1 53  ? 17.674  11.863  -0.555  1.00 1.15  ? 65  SER A HB2  1 
ATOM   808  H HB3  . SER A 1 53  ? 16.021  12.314  -0.148  1.00 1.09  ? 65  SER A HB3  1 
ATOM   809  H HG   . SER A 1 53  ? 17.584  13.913  0.436   1.00 1.65  ? 65  SER A HG   1 
ATOM   810  N N    . MET A 1 54  ? 14.554  11.349  1.642   1.00 0.97  ? 66  MET A N    1 
ATOM   811  C CA   . MET A 1 54  ? 13.107  11.016  1.775   1.00 1.07  ? 66  MET A CA   1 
ATOM   812  C C    . MET A 1 54  ? 12.273  12.084  1.065   1.00 0.95  ? 66  MET A C    1 
ATOM   813  O O    . MET A 1 54  ? 12.799  13.041  0.533   1.00 1.47  ? 66  MET A O    1 
ATOM   814  C CB   . MET A 1 54  ? 12.728  10.970  3.257   1.00 1.49  ? 66  MET A CB   1 
ATOM   815  C CG   . MET A 1 54  ? 11.806  9.776   3.515   1.00 2.27  ? 66  MET A CG   1 
ATOM   816  S SD   . MET A 1 54  ? 12.532  8.281   2.801   1.00 2.79  ? 66  MET A SD   1 
ATOM   817  C CE   . MET A 1 54  ? 11.125  7.824   1.758   1.00 2.71  ? 66  MET A CE   1 
ATOM   818  H H    . MET A 1 54  ? 14.868  12.257  1.835   1.00 1.21  ? 66  MET A H    1 
ATOM   819  H HA   . MET A 1 54  ? 12.917  10.054  1.324   1.00 1.27  ? 66  MET A HA   1 
ATOM   820  H HB2  . MET A 1 54  ? 13.623  10.871  3.854   1.00 1.71  ? 66  MET A HB2  1 
ATOM   821  H HB3  . MET A 1 54  ? 12.216  11.882  3.525   1.00 1.60  ? 66  MET A HB3  1 
ATOM   822  H HG2  . MET A 1 54  ? 11.682  9.642   4.580   1.00 2.75  ? 66  MET A HG2  1 
ATOM   823  H HG3  . MET A 1 54  ? 10.843  9.960   3.062   1.00 2.72  ? 66  MET A HG3  1 
ATOM   824  H HE1  . MET A 1 54  ? 10.216  8.218   2.191   1.00 2.83  ? 66  MET A HE1  1 
ATOM   825  H HE2  . MET A 1 54  ? 11.258  8.236   0.771   1.00 3.10  ? 66  MET A HE2  1 
ATOM   826  H HE3  . MET A 1 54  ? 11.061  6.747   1.692   1.00 2.77  ? 66  MET A HE3  1 
ATOM   827  N N    . ARG A 1 55  ? 10.977  11.928  1.051   1.00 0.90  ? 67  ARG A N    1 
ATOM   828  C CA   . ARG A 1 55  ? 10.113  12.935  0.372   1.00 1.04  ? 67  ARG A CA   1 
ATOM   829  C C    . ARG A 1 55  ? 10.583  13.099  -1.075  1.00 1.04  ? 67  ARG A C    1 
ATOM   830  O O    . ARG A 1 55  ? 10.948  14.177  -1.503  1.00 1.39  ? 67  ARG A O    1 
ATOM   831  C CB   . ARG A 1 55  ? 10.217  14.275  1.105   1.00 1.21  ? 67  ARG A CB   1 
ATOM   832  C CG   . ARG A 1 55  ? 9.345   14.241  2.363   1.00 1.24  ? 67  ARG A CG   1 
ATOM   833  C CD   . ARG A 1 55  ? 10.239  14.178  3.602   1.00 1.84  ? 67  ARG A CD   1 
ATOM   834  N NE   . ARG A 1 55  ? 9.417   14.426  4.819   1.00 2.71  ? 67  ARG A NE   1 
ATOM   835  C CZ   . ARG A 1 55  ? 9.958   14.973  5.872   1.00 3.34  ? 67  ARG A CZ   1 
ATOM   836  N NH1  . ARG A 1 55  ? 10.327  16.224  5.839   1.00 3.95  ? 67  ARG A NH1  1 
ATOM   837  N NH2  . ARG A 1 55  ? 10.129  14.269  6.957   1.00 3.77  ? 67  ARG A NH2  1 
ATOM   838  H H    . ARG A 1 55  ? 10.572  11.149  1.485   1.00 1.26  ? 67  ARG A H    1 
ATOM   839  H HA   . ARG A 1 55  ? 9.088   12.596  0.382   1.00 1.27  ? 67  ARG A HA   1 
ATOM   840  H HB2  . ARG A 1 55  ? 11.245  14.452  1.385   1.00 1.30  ? 67  ARG A HB2  1 
ATOM   841  H HB3  . ARG A 1 55  ? 9.878   15.068  0.456   1.00 1.53  ? 67  ARG A HB3  1 
ATOM   842  H HG2  . ARG A 1 55  ? 8.735   15.132  2.404   1.00 1.23  ? 67  ARG A HG2  1 
ATOM   843  H HG3  . ARG A 1 55  ? 8.708   13.370  2.336   1.00 1.25  ? 67  ARG A HG3  1 
ATOM   844  H HD2  . ARG A 1 55  ? 10.695  13.201  3.667   1.00 1.95  ? 67  ARG A HD2  1 
ATOM   845  H HD3  . ARG A 1 55  ? 11.010  14.930  3.528   1.00 2.10  ? 67  ARG A HD3  1 
ATOM   846  H HE   . ARG A 1 55  ? 8.469   14.178  4.828   1.00 3.10  ? 67  ARG A HE   1 
ATOM   847  H HH11 . ARG A 1 55  ? 10.195  16.763  5.007   1.00 4.01  ? 67  ARG A HH11 1 
ATOM   848  H HH12 . ARG A 1 55  ? 10.742  16.644  6.646   1.00 4.59  ? 67  ARG A HH12 1 
ATOM   849  H HH21 . ARG A 1 55  ? 9.845   13.310  6.980   1.00 3.74  ? 67  ARG A HH21 1 
ATOM   850  H HH22 . ARG A 1 55  ? 10.543  14.687  7.765   1.00 4.38  ? 67  ARG A HH22 1 
ATOM   851  N N    . ALA A 1 56  ? 10.578  12.035  -1.832  1.00 0.87  ? 68  ALA A N    1 
ATOM   852  C CA   . ALA A 1 56  ? 11.022  12.116  -3.247  1.00 0.88  ? 68  ALA A CA   1 
ATOM   853  C C    . ALA A 1 56  ? 10.152  11.189  -4.091  1.00 0.78  ? 68  ALA A C    1 
ATOM   854  O O    . ALA A 1 56  ? 9.625   10.209  -3.602  1.00 0.82  ? 68  ALA A O    1 
ATOM   855  C CB   . ALA A 1 56  ? 12.481  11.670  -3.345  1.00 1.00  ? 68  ALA A CB   1 
ATOM   856  H H    . ALA A 1 56  ? 10.281  11.176  -1.468  1.00 0.94  ? 68  ALA A H    1 
ATOM   857  H HA   . ALA A 1 56  ? 10.926  13.131  -3.602  1.00 0.97  ? 68  ALA A HA   1 
ATOM   858  H HB1  . ALA A 1 56  ? 13.094  12.304  -2.724  1.00 1.45  ? 68  ALA A HB1  1 
ATOM   859  H HB2  . ALA A 1 56  ? 12.566  10.646  -3.010  1.00 1.24  ? 68  ALA A HB2  1 
ATOM   860  H HB3  . ALA A 1 56  ? 12.811  11.741  -4.371  1.00 1.52  ? 68  ALA A HB3  1 
ATOM   861  N N    . LEU A 1 57  ? 9.995   11.483  -5.351  1.00 0.84  ? 69  LEU A N    1 
ATOM   862  C CA   . LEU A 1 57  ? 9.156   10.606  -6.211  1.00 0.88  ? 69  LEU A CA   1 
ATOM   863  C C    . LEU A 1 57  ? 10.025  10.006  -7.321  1.00 0.84  ? 69  LEU A C    1 
ATOM   864  O O    . LEU A 1 57  ? 10.354  8.840   -7.291  1.00 1.65  ? 69  LEU A O    1 
ATOM   865  C CB   . LEU A 1 57  ? 8.010   11.436  -6.812  1.00 1.11  ? 69  LEU A CB   1 
ATOM   866  C CG   . LEU A 1 57  ? 7.108   10.566  -7.702  1.00 1.23  ? 69  LEU A CG   1 
ATOM   867  C CD1  . LEU A 1 57  ? 7.694   10.499  -9.112  1.00 1.92  ? 69  LEU A CD1  1 
ATOM   868  C CD2  . LEU A 1 57  ? 7.000   9.151   -7.127  1.00 1.32  ? 69  LEU A CD2  1 
ATOM   869  H H    . LEU A 1 57  ? 10.428  12.276  -5.729  1.00 0.96  ? 69  LEU A H    1 
ATOM   870  H HA   . LEU A 1 57  ? 8.750   9.812   -5.605  1.00 1.06  ? 69  LEU A HA   1 
ATOM   871  H HB2  . LEU A 1 57  ? 7.418   11.855  -6.012  1.00 1.31  ? 69  LEU A HB2  1 
ATOM   872  H HB3  . LEU A 1 57  ? 8.423   12.239  -7.403  1.00 1.20  ? 69  LEU A HB3  1 
ATOM   873  H HG   . LEU A 1 57  ? 6.124   11.010  -7.749  1.00 1.85  ? 69  LEU A HG   1 
ATOM   874  H HD11 . LEU A 1 57  ? 8.341   11.348  -9.273  1.00 2.59  ? 69  LEU A HD11 1 
ATOM   875  H HD12 . LEU A 1 57  ? 8.261   9.587   -9.221  1.00 2.31  ? 69  LEU A HD12 1 
ATOM   876  H HD13 . LEU A 1 57  ? 6.893   10.514  -9.835  1.00 2.26  ? 69  LEU A HD13 1 
ATOM   877  H HD21 . LEU A 1 57  ? 6.905   9.206   -6.052  1.00 1.75  ? 69  LEU A HD21 1 
ATOM   878  H HD22 . LEU A 1 57  ? 6.133   8.659   -7.540  1.00 1.92  ? 69  LEU A HD22 1 
ATOM   879  H HD23 . LEU A 1 57  ? 7.888   8.590   -7.380  1.00 1.79  ? 69  LEU A HD23 1 
ATOM   880  N N    . ASP A 1 58  ? 10.403  10.796  -8.294  1.00 0.93  ? 70  ASP A N    1 
ATOM   881  C CA   . ASP A 1 58  ? 11.255  10.278  -9.411  1.00 0.80  ? 70  ASP A CA   1 
ATOM   882  C C    . ASP A 1 58  ? 10.539  9.127   -10.125 1.00 0.82  ? 70  ASP A C    1 
ATOM   883  O O    . ASP A 1 58  ? 10.399  8.041   -9.601  1.00 0.85  ? 70  ASP A O    1 
ATOM   884  C CB   . ASP A 1 58  ? 12.589  9.774   -8.866  1.00 0.78  ? 70  ASP A CB   1 
ATOM   885  C CG   . ASP A 1 58  ? 12.946  10.525  -7.581  1.00 1.22  ? 70  ASP A CG   1 
ATOM   886  O OD1  . ASP A 1 58  ? 13.505  11.604  -7.685  1.00 1.71  ? 70  ASP A OD1  1 
ATOM   887  O OD2  . ASP A 1 58  ? 12.654  10.007  -6.516  1.00 1.85  ? 70  ASP A OD2  1 
ATOM   888  H H    . ASP A 1 58  ? 10.127  11.736  -8.292  1.00 1.65  ? 70  ASP A H    1 
ATOM   889  H HA   . ASP A 1 58  ? 11.437  11.074  -10.117 1.00 0.88  ? 70  ASP A HA   1 
ATOM   890  H HB2  . ASP A 1 58  ? 12.509  8.719   -8.662  1.00 0.91  ? 70  ASP A HB2  1 
ATOM   891  H HB3  . ASP A 1 58  ? 13.361  9.939   -9.602  1.00 0.86  ? 70  ASP A HB3  1 
ATOM   892  N N    . PHE A 1 59  ? 10.088  9.362   -11.321 1.00 0.87  ? 71  PHE A N    1 
ATOM   893  C CA   . PHE A 1 59  ? 9.378   8.292   -12.080 1.00 0.95  ? 71  PHE A CA   1 
ATOM   894  C C    . PHE A 1 59  ? 10.374  7.232   -12.557 1.00 0.86  ? 71  PHE A C    1 
ATOM   895  O O    . PHE A 1 59  ? 10.026  6.083   -12.743 1.00 0.93  ? 71  PHE A O    1 
ATOM   896  C CB   . PHE A 1 59  ? 8.681   8.911   -13.294 1.00 1.08  ? 71  PHE A CB   1 
ATOM   897  C CG   . PHE A 1 59  ? 7.318   8.286   -13.465 1.00 1.63  ? 71  PHE A CG   1 
ATOM   898  C CD1  . PHE A 1 59  ? 7.194   7.031   -14.074 1.00 2.14  ? 71  PHE A CD1  1 
ATOM   899  C CD2  . PHE A 1 59  ? 6.177   8.960   -13.014 1.00 2.57  ? 71  PHE A CD2  1 
ATOM   900  C CE1  . PHE A 1 59  ? 5.930   6.451   -14.233 1.00 3.00  ? 71  PHE A CE1  1 
ATOM   901  C CE2  . PHE A 1 59  ? 4.913   8.380   -13.172 1.00 3.37  ? 71  PHE A CE2  1 
ATOM   902  C CZ   . PHE A 1 59  ? 4.789   7.126   -13.781 1.00 3.44  ? 71  PHE A CZ   1 
ATOM   903  H H    . PHE A 1 59  ? 10.217  10.243  -11.721 1.00 0.90  ? 71  PHE A H    1 
ATOM   904  H HA   . PHE A 1 59  ? 8.640   7.829   -11.442 1.00 1.02  ? 71  PHE A HA   1 
ATOM   905  H HB2  . PHE A 1 59  ? 8.573   9.975   -13.142 1.00 1.36  ? 71  PHE A HB2  1 
ATOM   906  H HB3  . PHE A 1 59  ? 9.272   8.731   -14.179 1.00 1.33  ? 71  PHE A HB3  1 
ATOM   907  H HD1  . PHE A 1 59  ? 8.074   6.511   -14.423 1.00 2.39  ? 71  PHE A HD1  1 
ATOM   908  H HD2  . PHE A 1 59  ? 6.272   9.928   -12.544 1.00 3.00  ? 71  PHE A HD2  1 
ATOM   909  H HE1  . PHE A 1 59  ? 5.834   5.484   -14.703 1.00 3.64  ? 71  PHE A HE1  1 
ATOM   910  H HE2  . PHE A 1 59  ? 4.033   8.901   -12.824 1.00 4.22  ? 71  PHE A HE2  1 
ATOM   911  H HZ   . PHE A 1 59  ? 3.813   6.679   -13.903 1.00 4.20  ? 71  PHE A HZ   1 
ATOM   912  N N    . ASN A 1 60  ? 11.608  7.602   -12.762 1.00 0.76  ? 72  ASN A N    1 
ATOM   913  C CA   . ASN A 1 60  ? 12.612  6.605   -13.232 1.00 0.73  ? 72  ASN A CA   1 
ATOM   914  C C    . ASN A 1 60  ? 13.459  6.120   -12.053 1.00 0.67  ? 72  ASN A C    1 
ATOM   915  O O    . ASN A 1 60  ? 13.795  4.956   -11.955 1.00 0.68  ? 72  ASN A O    1 
ATOM   916  C CB   . ASN A 1 60  ? 13.522  7.253   -14.277 1.00 0.72  ? 72  ASN A CB   1 
ATOM   917  C CG   . ASN A 1 60  ? 13.155  6.730   -15.667 1.00 1.02  ? 72  ASN A CG   1 
ATOM   918  O OD1  . ASN A 1 60  ? 12.066  6.231   -15.872 1.00 1.92  ? 72  ASN A OD1  1 
ATOM   919  N ND2  . ASN A 1 60  ? 14.022  6.825   -16.637 1.00 1.25  ? 72  ASN A ND2  1 
ATOM   920  H H    . ASN A 1 60  ? 11.874  8.533   -12.611 1.00 0.72  ? 72  ASN A H    1 
ATOM   921  H HA   . ASN A 1 60  ? 12.101  5.763   -13.676 1.00 0.81  ? 72  ASN A HA   1 
ATOM   922  H HB2  . ASN A 1 60  ? 13.394  8.326   -14.249 1.00 0.96  ? 72  ASN A HB2  1 
ATOM   923  H HB3  . ASN A 1 60  ? 14.551  7.007   -14.062 1.00 0.91  ? 72  ASN A HB3  1 
ATOM   924  H HD21 . ASN A 1 60  ? 14.900  7.227   -16.471 1.00 1.73  ? 72  ASN A HD21 1 
ATOM   925  H HD22 . ASN A 1 60  ? 13.796  6.493   -17.530 1.00 1.55  ? 72  ASN A HD22 1 
ATOM   926  N N    . THR A 1 61  ? 13.811  7.002   -11.160 1.00 0.67  ? 73  THR A N    1 
ATOM   927  C CA   . THR A 1 61  ? 14.640  6.588   -9.993  1.00 0.69  ? 73  THR A CA   1 
ATOM   928  C C    . THR A 1 61  ? 13.812  5.714   -9.047  1.00 0.70  ? 73  THR A C    1 
ATOM   929  O O    . THR A 1 61  ? 14.340  4.871   -8.349  1.00 0.75  ? 73  THR A O    1 
ATOM   930  C CB   . THR A 1 61  ? 15.123  7.833   -9.246  1.00 0.70  ? 73  THR A CB   1 
ATOM   931  O OG1  . THR A 1 61  ? 15.270  8.907   -10.165 1.00 0.83  ? 73  THR A OG1  1 
ATOM   932  C CG2  . THR A 1 61  ? 16.469  7.541   -8.581  1.00 0.65  ? 73  THR A CG2  1 
ATOM   933  H H    . THR A 1 61  ? 13.534  7.937   -11.257 1.00 0.70  ? 73  THR A H    1 
ATOM   934  H HA   . THR A 1 61  ? 15.495  6.028   -10.342 1.00 0.73  ? 73  THR A HA   1 
ATOM   935  H HB   . THR A 1 61  ? 14.403  8.101   -8.489  1.00 0.74  ? 73  THR A HB   1 
ATOM   936  H HG1  . THR A 1 61  ? 15.689  9.637   -9.703  1.00 1.00  ? 73  THR A HG1  1 
ATOM   937  H HG21 . THR A 1 61  ? 16.902  6.654   -9.020  1.00 1.22  ? 73  THR A HG21 1 
ATOM   938  H HG22 . THR A 1 61  ? 17.134  8.378   -8.730  1.00 1.11  ? 73  THR A HG22 1 
ATOM   939  H HG23 . THR A 1 61  ? 16.321  7.383   -7.523  1.00 1.25  ? 73  THR A HG23 1 
ATOM   940  N N    . ARG A 1 62  ? 12.521  5.905   -9.013  1.00 0.71  ? 74  ARG A N    1 
ATOM   941  C CA   . ARG A 1 62  ? 11.676  5.079   -8.104  1.00 0.76  ? 74  ARG A CA   1 
ATOM   942  C C    . ARG A 1 62  ? 11.508  3.673   -8.680  1.00 0.72  ? 74  ARG A C    1 
ATOM   943  O O    . ARG A 1 62  ? 11.390  2.710   -7.954  1.00 0.69  ? 74  ARG A O    1 
ATOM   944  C CB   . ARG A 1 62  ? 10.298  5.724   -7.956  1.00 0.84  ? 74  ARG A CB   1 
ATOM   945  C CG   . ARG A 1 62  ? 9.347   4.739   -7.275  1.00 1.20  ? 74  ARG A CG   1 
ATOM   946  C CD   . ARG A 1 62  ? 8.485   5.483   -6.255  1.00 1.36  ? 74  ARG A CD   1 
ATOM   947  N NE   . ARG A 1 62  ? 7.383   4.593   -5.794  1.00 1.92  ? 74  ARG A NE   1 
ATOM   948  C CZ   . ARG A 1 62  ? 7.486   3.965   -4.654  1.00 2.41  ? 74  ARG A CZ   1 
ATOM   949  N NH1  . ARG A 1 62  ? 8.637   3.480   -4.278  1.00 2.88  ? 74  ARG A NH1  1 
ATOM   950  N NH2  . ARG A 1 62  ? 6.437   3.825   -3.890  1.00 3.05  ? 74  ARG A NH2  1 
ATOM   951  H H    . ARG A 1 62  ? 12.109  6.591   -9.580  1.00 0.72  ? 74  ARG A H    1 
ATOM   952  H HA   . ARG A 1 62  ? 12.147  5.016   -7.135  1.00 0.81  ? 74  ARG A HA   1 
ATOM   953  H HB2  . ARG A 1 62  ? 10.381  6.617   -7.356  1.00 0.86  ? 74  ARG A HB2  1 
ATOM   954  H HB3  . ARG A 1 62  ? 9.911   5.977   -8.931  1.00 1.00  ? 74  ARG A HB3  1 
ATOM   955  H HG2  . ARG A 1 62  ? 8.711   4.280   -8.019  1.00 1.99  ? 74  ARG A HG2  1 
ATOM   956  H HG3  . ARG A 1 62  ? 9.919   3.975   -6.770  1.00 1.68  ? 74  ARG A HG3  1 
ATOM   957  H HD2  . ARG A 1 62  ? 9.094   5.770   -5.410  1.00 1.76  ? 74  ARG A HD2  1 
ATOM   958  H HD3  . ARG A 1 62  ? 8.066   6.367   -6.713  1.00 2.00  ? 74  ARG A HD3  1 
ATOM   959  H HE   . ARG A 1 62  ? 6.581   4.479   -6.346  1.00 2.43  ? 74  ARG A HE   1 
ATOM   960  H HH11 . ARG A 1 62  ? 9.441   3.589   -4.863  1.00 2.98  ? 74  ARG A HH11 1 
ATOM   961  H HH12 . ARG A 1 62  ? 8.716   3.000   -3.404  1.00 3.48  ? 74  ARG A HH12 1 
ATOM   962  H HH21 . ARG A 1 62  ? 5.556   4.199   -4.178  1.00 3.26  ? 74  ARG A HH21 1 
ATOM   963  H HH22 . ARG A 1 62  ? 6.516   3.344   -3.017  1.00 3.62  ? 74  ARG A HH22 1 
ATOM   964  N N    . THR A 1 63  ? 11.491  3.545   -9.976  1.00 0.74  ? 75  THR A N    1 
ATOM   965  C CA   . THR A 1 63  ? 11.323  2.195   -10.585 1.00 0.74  ? 75  THR A CA   1 
ATOM   966  C C    . THR A 1 63  ? 12.662  1.453   -10.603 1.00 0.69  ? 75  THR A C    1 
ATOM   967  O O    . THR A 1 63  ? 12.707  0.240   -10.589 1.00 0.65  ? 75  THR A O    1 
ATOM   968  C CB   . THR A 1 63  ? 10.806  2.345   -12.017 1.00 0.84  ? 75  THR A CB   1 
ATOM   969  O OG1  . THR A 1 63  ? 11.462  3.438   -12.644 1.00 0.91  ? 75  THR A OG1  1 
ATOM   970  C CG2  . THR A 1 63  ? 9.298   2.598   -11.992 1.00 1.24  ? 75  THR A CG2  1 
ATOM   971  H H    . THR A 1 63  ? 11.583  4.334   -10.550 1.00 0.78  ? 75  THR A H    1 
ATOM   972  H HA   . THR A 1 63  ? 10.609  1.628   -10.006 1.00 0.75  ? 75  THR A HA   1 
ATOM   973  H HB   . THR A 1 63  ? 11.005  1.440   -12.570 1.00 0.98  ? 75  THR A HB   1 
ATOM   974  H HG1  . THR A 1 63  ? 11.423  3.303   -13.593 1.00 1.29  ? 75  THR A HG1  1 
ATOM   975  H HG21 . THR A 1 63  ? 9.076   3.383   -11.284 1.00 1.79  ? 75  THR A HG21 1 
ATOM   976  H HG22 . THR A 1 63  ? 8.966   2.897   -12.976 1.00 1.74  ? 75  THR A HG22 1 
ATOM   977  H HG23 . THR A 1 63  ? 8.785   1.694   -11.699 1.00 1.55  ? 75  THR A HG23 1 
ATOM   978  N N    . GLN A 1 64  ? 13.754  2.167   -10.637 1.00 0.71  ? 76  GLN A N    1 
ATOM   979  C CA   . GLN A 1 64  ? 15.083  1.490   -10.660 1.00 0.71  ? 76  GLN A CA   1 
ATOM   980  C C    . GLN A 1 64  ? 15.453  1.000   -9.258  1.00 0.65  ? 76  GLN A C    1 
ATOM   981  O O    . GLN A 1 64  ? 15.890  -0.120  -9.081  1.00 0.62  ? 76  GLN A O    1 
ATOM   982  C CB   . GLN A 1 64  ? 16.147  2.475   -11.147 1.00 0.79  ? 76  GLN A CB   1 
ATOM   983  C CG   . GLN A 1 64  ? 15.945  2.754   -12.637 1.00 0.88  ? 76  GLN A CG   1 
ATOM   984  C CD   . GLN A 1 64  ? 16.582  4.098   -12.994 1.00 1.05  ? 76  GLN A CD   1 
ATOM   985  O OE1  . GLN A 1 64  ? 16.807  4.925   -12.132 1.00 1.66  ? 76  GLN A OE1  1 
ATOM   986  N NE2  . GLN A 1 64  ? 16.884  4.354   -14.238 1.00 1.48  ? 76  GLN A NE2  1 
ATOM   987  H H    . GLN A 1 64  ? 13.701  3.146   -10.651 1.00 0.76  ? 76  GLN A H    1 
ATOM   988  H HA   . GLN A 1 64  ? 15.042  0.646   -11.333 1.00 0.72  ? 76  GLN A HA   1 
ATOM   989  H HB2  . GLN A 1 64  ? 16.062  3.399   -10.593 1.00 0.88  ? 76  GLN A HB2  1 
ATOM   990  H HB3  . GLN A 1 64  ? 17.128  2.051   -10.992 1.00 0.78  ? 76  GLN A HB3  1 
ATOM   991  H HG2  . GLN A 1 64  ? 16.410  1.969   -13.216 1.00 0.95  ? 76  GLN A HG2  1 
ATOM   992  H HG3  . GLN A 1 64  ? 14.889  2.788   -12.858 1.00 0.96  ? 76  GLN A HG3  1 
ATOM   993  H HE21 . GLN A 1 64  ? 16.702  3.688   -14.933 1.00 2.09  ? 76  GLN A HE21 1 
ATOM   994  H HE22 . GLN A 1 64  ? 17.292  5.213   -14.476 1.00 1.59  ? 76  GLN A HE22 1 
ATOM   995  N N    . VAL A 1 65  ? 15.290  1.824   -8.261  1.00 0.67  ? 77  VAL A N    1 
ATOM   996  C CA   . VAL A 1 65  ? 15.644  1.393   -6.879  1.00 0.64  ? 77  VAL A CA   1 
ATOM   997  C C    . VAL A 1 65  ? 14.556  0.471   -6.321  1.00 0.59  ? 77  VAL A C    1 
ATOM   998  O O    . VAL A 1 65  ? 14.840  -0.497  -5.641  1.00 0.56  ? 77  VAL A O    1 
ATOM   999  C CB   . VAL A 1 65  ? 15.786  2.625   -5.981  1.00 0.68  ? 77  VAL A CB   1 
ATOM   1000 C CG1  . VAL A 1 65  ? 14.405  3.211   -5.683  1.00 0.71  ? 77  VAL A CG1  1 
ATOM   1001 C CG2  . VAL A 1 65  ? 16.461  2.221   -4.668  1.00 0.63  ? 77  VAL A CG2  1 
ATOM   1002 H H    . VAL A 1 65  ? 14.941  2.726   -8.421  1.00 0.71  ? 77  VAL A H    1 
ATOM   1003 H HA   . VAL A 1 65  ? 16.583  0.860   -6.903  1.00 0.65  ? 77  VAL A HA   1 
ATOM   1004 H HB   . VAL A 1 65  ? 16.390  3.367   -6.484  1.00 0.76  ? 77  VAL A HB   1 
ATOM   1005 H HG11 . VAL A 1 65  ? 13.854  3.321   -6.606  1.00 1.17  ? 77  VAL A HG11 1 
ATOM   1006 H HG12 . VAL A 1 65  ? 13.869  2.549   -5.020  1.00 1.08  ? 77  VAL A HG12 1 
ATOM   1007 H HG13 . VAL A 1 65  ? 14.518  4.177   -5.214  1.00 1.30  ? 77  VAL A HG13 1 
ATOM   1008 H HG21 . VAL A 1 65  ? 17.425  1.783   -4.880  1.00 1.10  ? 77  VAL A HG21 1 
ATOM   1009 H HG22 . VAL A 1 65  ? 16.592  3.095   -4.047  1.00 1.21  ? 77  VAL A HG22 1 
ATOM   1010 H HG23 . VAL A 1 65  ? 15.844  1.501   -4.152  1.00 1.23  ? 77  VAL A HG23 1 
ATOM   1011 N N    . THR A 1 66  ? 13.313  0.760   -6.597  1.00 0.60  ? 78  THR A N    1 
ATOM   1012 C CA   . THR A 1 66  ? 12.219  -0.105  -6.072  1.00 0.57  ? 78  THR A CA   1 
ATOM   1013 C C    . THR A 1 66  ? 12.259  -1.468  -6.762  1.00 0.53  ? 78  THR A C    1 
ATOM   1014 O O    . THR A 1 66  ? 12.113  -2.490  -6.127  1.00 0.54  ? 78  THR A O    1 
ATOM   1015 C CB   . THR A 1 66  ? 10.863  0.556   -6.331  1.00 0.61  ? 78  THR A CB   1 
ATOM   1016 O OG1  . THR A 1 66  ? 10.830  1.829   -5.702  1.00 0.95  ? 78  THR A OG1  1 
ATOM   1017 C CG2  . THR A 1 66  ? 9.749   -0.324  -5.763  1.00 1.01  ? 78  THR A CG2  1 
ATOM   1018 H H    . THR A 1 66  ? 13.100  1.544   -7.144  1.00 0.64  ? 78  THR A H    1 
ATOM   1019 H HA   . THR A 1 66  ? 12.353  -0.241  -5.010  1.00 0.58  ? 78  THR A HA   1 
ATOM   1020 H HB   . THR A 1 66  ? 10.715  0.671   -7.393  1.00 0.92  ? 78  THR A HB   1 
ATOM   1021 H HG1  . THR A 1 66  ? 11.253  1.747   -4.844  1.00 1.33  ? 78  THR A HG1  1 
ATOM   1022 H HG21 . THR A 1 66  ? 10.013  -0.639  -4.764  1.00 1.51  ? 78  THR A HG21 1 
ATOM   1023 H HG22 . THR A 1 66  ? 8.827   0.237   -5.733  1.00 1.44  ? 78  THR A HG22 1 
ATOM   1024 H HG23 . THR A 1 66  ? 9.622   -1.193  -6.392  1.00 1.68  ? 78  THR A HG23 1 
ATOM   1025 N N    . ARG A 1 67  ? 12.455  -1.499  -8.052  1.00 0.52  ? 79  ARG A N    1 
ATOM   1026 C CA   . ARG A 1 67  ? 12.500  -2.811  -8.759  1.00 0.51  ? 79  ARG A CA   1 
ATOM   1027 C C    . ARG A 1 67  ? 13.822  -3.517  -8.450  1.00 0.50  ? 79  ARG A C    1 
ATOM   1028 O O    . ARG A 1 67  ? 13.907  -4.727  -8.478  1.00 0.49  ? 79  ARG A O    1 
ATOM   1029 C CB   . ARG A 1 67  ? 12.382  -2.591  -10.268 1.00 0.57  ? 79  ARG A CB   1 
ATOM   1030 C CG   . ARG A 1 67  ? 13.763  -2.277  -10.848 1.00 1.44  ? 79  ARG A CG   1 
ATOM   1031 C CD   . ARG A 1 67  ? 13.609  -1.736  -12.271 1.00 1.74  ? 79  ARG A CD   1 
ATOM   1032 N NE   . ARG A 1 67  ? 13.680  -2.864  -13.242 1.00 1.77  ? 79  ARG A NE   1 
ATOM   1033 C CZ   . ARG A 1 67  ? 12.781  -2.974  -14.182 1.00 2.11  ? 79  ARG A CZ   1 
ATOM   1034 N NH1  . ARG A 1 67  ? 11.646  -3.567  -13.933 1.00 2.47  ? 79  ARG A NH1  1 
ATOM   1035 N NH2  . ARG A 1 67  ? 13.017  -2.491  -15.371 1.00 2.74  ? 79  ARG A NH2  1 
ATOM   1036 H H    . ARG A 1 67  ? 12.571  -0.664  -8.553  1.00 0.54  ? 79  ARG A H    1 
ATOM   1037 H HA   . ARG A 1 67  ? 11.679  -3.427  -8.422  1.00 0.50  ? 79  ARG A HA   1 
ATOM   1038 H HB2  . ARG A 1 67  ? 11.991  -3.487  -10.730 1.00 1.18  ? 79  ARG A HB2  1 
ATOM   1039 H HB3  . ARG A 1 67  ? 11.715  -1.766  -10.460 1.00 1.12  ? 79  ARG A HB3  1 
ATOM   1040 H HG2  . ARG A 1 67  ? 14.252  -1.536  -10.231 1.00 2.07  ? 79  ARG A HG2  1 
ATOM   1041 H HG3  . ARG A 1 67  ? 14.358  -3.177  -10.870 1.00 2.07  ? 79  ARG A HG3  1 
ATOM   1042 H HD2  . ARG A 1 67  ? 12.655  -1.238  -12.366 1.00 2.20  ? 79  ARG A HD2  1 
ATOM   1043 H HD3  . ARG A 1 67  ? 14.404  -1.034  -12.476 1.00 2.24  ? 79  ARG A HD3  1 
ATOM   1044 H HE   . ARG A 1 67  ? 14.401  -3.524  -13.174 1.00 2.09  ? 79  ARG A HE   1 
ATOM   1045 H HH11 . ARG A 1 67  ? 11.464  -3.938  -13.022 1.00 2.62  ? 79  ARG A HH11 1 
ATOM   1046 H HH12 . ARG A 1 67  ? 10.957  -3.652  -14.653 1.00 2.95  ? 79  ARG A HH12 1 
ATOM   1047 H HH21 . ARG A 1 67  ? 13.887  -2.036  -15.562 1.00 2.97  ? 79  ARG A HH21 1 
ATOM   1048 H HH22 . ARG A 1 67  ? 12.328  -2.575  -16.091 1.00 3.27  ? 79  ARG A HH22 1 
ATOM   1049 N N    . GLU A 1 68  ? 14.854  -2.773  -8.156  1.00 0.52  ? 80  GLU A N    1 
ATOM   1050 C CA   . GLU A 1 68  ? 16.164  -3.412  -7.846  1.00 0.55  ? 80  GLU A CA   1 
ATOM   1051 C C    . GLU A 1 68  ? 16.042  -4.224  -6.554  1.00 0.51  ? 80  GLU A C    1 
ATOM   1052 O O    . GLU A 1 68  ? 16.236  -5.426  -6.542  1.00 0.52  ? 80  GLU A O    1 
ATOM   1053 C CB   . GLU A 1 68  ? 17.231  -2.330  -7.668  1.00 0.62  ? 80  GLU A CB   1 
ATOM   1054 C CG   . GLU A 1 68  ? 18.533  -2.971  -7.180  1.00 1.22  ? 80  GLU A CG   1 
ATOM   1055 C CD   . GLU A 1 68  ? 18.965  -4.061  -8.162  1.00 1.49  ? 80  GLU A CD   1 
ATOM   1056 O OE1  . GLU A 1 68  ? 19.666  -3.737  -9.106  1.00 2.16  ? 80  GLU A OE1  1 
ATOM   1057 O OE2  . GLU A 1 68  ? 18.589  -5.203  -7.952  1.00 1.97  ? 80  GLU A OE2  1 
ATOM   1058 H H    . GLU A 1 68  ? 14.768  -1.797  -8.139  1.00 0.54  ? 80  GLU A H    1 
ATOM   1059 H HA   . GLU A 1 68  ? 16.447  -4.066  -8.657  1.00 0.57  ? 80  GLU A HA   1 
ATOM   1060 H HB2  . GLU A 1 68  ? 17.404  -1.836  -8.613  1.00 0.77  ? 80  GLU A HB2  1 
ATOM   1061 H HB3  . GLU A 1 68  ? 16.894  -1.607  -6.940  1.00 0.95  ? 80  GLU A HB3  1 
ATOM   1062 H HG2  . GLU A 1 68  ? 19.303  -2.216  -7.116  1.00 1.89  ? 80  GLU A HG2  1 
ATOM   1063 H HG3  . GLU A 1 68  ? 18.376  -3.408  -6.206  1.00 1.85  ? 80  GLU A HG3  1 
ATOM   1064 N N    . ALA A 1 69  ? 15.720  -3.581  -5.464  1.00 0.50  ? 81  ALA A N    1 
ATOM   1065 C CA   . ALA A 1 69  ? 15.586  -4.325  -4.179  1.00 0.49  ? 81  ALA A CA   1 
ATOM   1066 C C    . ALA A 1 69  ? 14.493  -5.386  -4.326  1.00 0.44  ? 81  ALA A C    1 
ATOM   1067 O O    . ALA A 1 69  ? 14.701  -6.553  -4.052  1.00 0.42  ? 81  ALA A O    1 
ATOM   1068 C CB   . ALA A 1 69  ? 15.207  -3.350  -3.062  1.00 0.53  ? 81  ALA A CB   1 
ATOM   1069 H H    . ALA A 1 69  ? 15.565  -2.612  -5.490  1.00 0.51  ? 81  ALA A H    1 
ATOM   1070 H HA   . ALA A 1 69  ? 16.524  -4.803  -3.939  1.00 0.52  ? 81  ALA A HA   1 
ATOM   1071 H HB1  . ALA A 1 69  ? 14.320  -2.804  -3.346  1.00 1.19  ? 81  ALA A HB1  1 
ATOM   1072 H HB2  . ALA A 1 69  ? 15.014  -3.901  -2.153  1.00 1.14  ? 81  ALA A HB2  1 
ATOM   1073 H HB3  . ALA A 1 69  ? 16.019  -2.658  -2.898  1.00 0.99  ? 81  ALA A HB3  1 
ATOM   1074 N N    . ILE A 1 70  ? 13.330  -4.987  -4.763  1.00 0.43  ? 82  ILE A N    1 
ATOM   1075 C CA   . ILE A 1 70  ? 12.216  -5.962  -4.936  1.00 0.39  ? 82  ILE A CA   1 
ATOM   1076 C C    . ILE A 1 70  ? 12.678  -7.126  -5.815  1.00 0.38  ? 82  ILE A C    1 
ATOM   1077 O O    . ILE A 1 70  ? 12.146  -8.214  -5.742  1.00 0.37  ? 82  ILE A O    1 
ATOM   1078 C CB   . ILE A 1 70  ? 11.028  -5.263  -5.599  1.00 0.42  ? 82  ILE A CB   1 
ATOM   1079 C CG1  . ILE A 1 70  ? 10.229  -4.505  -4.536  1.00 0.48  ? 82  ILE A CG1  1 
ATOM   1080 C CG2  . ILE A 1 70  ? 10.130  -6.302  -6.269  1.00 0.44  ? 82  ILE A CG2  1 
ATOM   1081 C CD1  . ILE A 1 70  ? 9.405   -3.405  -5.205  1.00 0.68  ? 82  ILE A CD1  1 
ATOM   1082 H H    . ILE A 1 70  ? 13.190  -4.043  -4.979  1.00 0.46  ? 82  ILE A H    1 
ATOM   1083 H HA   . ILE A 1 70  ? 11.916  -6.339  -3.970  1.00 0.39  ? 82  ILE A HA   1 
ATOM   1084 H HB   . ILE A 1 70  ? 11.389  -4.571  -6.344  1.00 0.50  ? 82  ILE A HB   1 
ATOM   1085 H HG12 . ILE A 1 70  ? 9.569   -5.191  -4.026  1.00 0.61  ? 82  ILE A HG12 1 
ATOM   1086 H HG13 . ILE A 1 70  ? 10.908  -4.061  -3.824  1.00 0.77  ? 82  ILE A HG13 1 
ATOM   1087 H HG21 . ILE A 1 70  ? 10.025  -7.159  -5.622  1.00 1.04  ? 82  ILE A HG21 1 
ATOM   1088 H HG22 . ILE A 1 70  ? 9.158   -5.870  -6.456  1.00 1.08  ? 82  ILE A HG22 1 
ATOM   1089 H HG23 . ILE A 1 70  ? 10.573  -6.610  -7.205  1.00 1.10  ? 82  ILE A HG23 1 
ATOM   1090 H HD11 . ILE A 1 70  ? 9.846   -3.154  -6.158  1.00 1.34  ? 82  ILE A HD11 1 
ATOM   1091 H HD12 . ILE A 1 70  ? 8.394   -3.753  -5.356  1.00 1.17  ? 82  ILE A HD12 1 
ATOM   1092 H HD13 . ILE A 1 70  ? 9.393   -2.529  -4.572  1.00 1.29  ? 82  ILE A HD13 1 
ATOM   1093 N N    . SER A 1 71  ? 13.662  -6.912  -6.647  1.00 0.40  ? 83  SER A N    1 
ATOM   1094 C CA   . SER A 1 71  ? 14.146  -8.016  -7.520  1.00 0.42  ? 83  SER A CA   1 
ATOM   1095 C C    . SER A 1 71  ? 14.983  -8.983  -6.682  1.00 0.44  ? 83  SER A C    1 
ATOM   1096 O O    . SER A 1 71  ? 14.881  -10.185 -6.816  1.00 0.47  ? 83  SER A O    1 
ATOM   1097 C CB   . SER A 1 71  ? 15.005  -7.439  -8.647  1.00 0.46  ? 83  SER A CB   1 
ATOM   1098 O OG   . SER A 1 71  ? 16.070  -8.336  -8.932  1.00 1.31  ? 83  SER A OG   1 
ATOM   1099 H H    . SER A 1 71  ? 14.082  -6.030  -6.696  1.00 0.43  ? 83  SER A H    1 
ATOM   1100 H HA   . SER A 1 71  ? 13.301  -8.541  -7.941  1.00 0.43  ? 83  SER A HA   1 
ATOM   1101 H HB2  . SER A 1 71  ? 14.403  -7.310  -9.531  1.00 0.99  ? 83  SER A HB2  1 
ATOM   1102 H HB3  . SER A 1 71  ? 15.400  -6.479  -8.341  1.00 1.03  ? 83  SER A HB3  1 
ATOM   1103 H HG   . SER A 1 71  ? 15.927  -8.696  -9.811  1.00 1.70  ? 83  SER A HG   1 
ATOM   1104 N N    . LEU A 1 72  ? 15.809  -8.464  -5.815  1.00 0.44  ? 84  LEU A N    1 
ATOM   1105 C CA   . LEU A 1 72  ? 16.652  -9.352  -4.963  1.00 0.47  ? 84  LEU A CA   1 
ATOM   1106 C C    . LEU A 1 72  ? 15.769  -10.116 -3.975  1.00 0.46  ? 84  LEU A C    1 
ATOM   1107 O O    . LEU A 1 72  ? 16.136  -11.166 -3.494  1.00 0.49  ? 84  LEU A O    1 
ATOM   1108 C CB   . LEU A 1 72  ? 17.669  -8.507  -4.193  1.00 0.50  ? 84  LEU A CB   1 
ATOM   1109 C CG   . LEU A 1 72  ? 19.082  -9.016  -4.486  1.00 0.63  ? 84  LEU A CG   1 
ATOM   1110 C CD1  . LEU A 1 72  ? 20.053  -7.835  -4.526  1.00 0.92  ? 84  LEU A CD1  1 
ATOM   1111 C CD2  . LEU A 1 72  ? 19.511  -9.989  -3.385  1.00 0.94  ? 84  LEU A CD2  1 
ATOM   1112 H H    . LEU A 1 72  ? 15.875  -7.488  -5.723  1.00 0.44  ? 84  LEU A H    1 
ATOM   1113 H HA   . LEU A 1 72  ? 17.174  -10.061 -5.588  1.00 0.51  ? 84  LEU A HA   1 
ATOM   1114 H HB2  . LEU A 1 72  ? 17.586  -7.475  -4.501  1.00 0.48  ? 84  LEU A HB2  1 
ATOM   1115 H HB3  . LEU A 1 72  ? 17.473  -8.584  -3.134  1.00 0.54  ? 84  LEU A HB3  1 
ATOM   1116 H HG   . LEU A 1 72  ? 19.091  -9.522  -5.441  1.00 0.74  ? 84  LEU A HG   1 
ATOM   1117 H HD11 . LEU A 1 72  ? 19.677  -7.038  -3.903  1.00 1.36  ? 84  LEU A HD11 1 
ATOM   1118 H HD12 . LEU A 1 72  ? 21.020  -8.151  -4.162  1.00 1.34  ? 84  LEU A HD12 1 
ATOM   1119 H HD13 . LEU A 1 72  ? 20.150  -7.483  -5.543  1.00 1.59  ? 84  LEU A HD13 1 
ATOM   1120 H HD21 . LEU A 1 72  ? 18.674  -10.186 -2.732  1.00 1.21  ? 84  LEU A HD21 1 
ATOM   1121 H HD22 . LEU A 1 72  ? 19.844  -10.914 -3.833  1.00 1.59  ? 84  LEU A HD22 1 
ATOM   1122 H HD23 . LEU A 1 72  ? 20.318  -9.554  -2.815  1.00 1.49  ? 84  LEU A HD23 1 
ATOM   1123 N N    . VAL A 1 73  ? 14.609  -9.609  -3.664  1.00 0.43  ? 85  VAL A N    1 
ATOM   1124 C CA   . VAL A 1 73  ? 13.731  -10.335 -2.706  1.00 0.44  ? 85  VAL A CA   1 
ATOM   1125 C C    . VAL A 1 73  ? 12.986  -11.449 -3.448  1.00 0.45  ? 85  VAL A C    1 
ATOM   1126 O O    . VAL A 1 73  ? 13.100  -12.612 -3.121  1.00 0.52  ? 85  VAL A O    1 
ATOM   1127 C CB   . VAL A 1 73  ? 12.724  -9.366  -2.084  1.00 0.42  ? 85  VAL A CB   1 
ATOM   1128 C CG1  . VAL A 1 73  ? 12.259  -9.921  -0.737  1.00 0.45  ? 85  VAL A CG1  1 
ATOM   1129 C CG2  . VAL A 1 73  ? 13.391  -8.003  -1.870  1.00 0.41  ? 85  VAL A CG2  1 
ATOM   1130 H H    . VAL A 1 73  ? 14.317  -8.759  -4.056  1.00 0.41  ? 85  VAL A H    1 
ATOM   1131 H HA   . VAL A 1 73  ? 14.338  -10.770 -1.925  1.00 0.46  ? 85  VAL A HA   1 
ATOM   1132 H HB   . VAL A 1 73  ? 11.875  -9.256  -2.742  1.00 0.42  ? 85  VAL A HB   1 
ATOM   1133 H HG11 . VAL A 1 73  ? 12.955  -10.675 -0.400  1.00 1.10  ? 85  VAL A HG11 1 
ATOM   1134 H HG12 . VAL A 1 73  ? 12.214  -9.123  -0.012  1.00 1.12  ? 85  VAL A HG12 1 
ATOM   1135 H HG13 . VAL A 1 73  ? 11.280  -10.361 -0.849  1.00 1.06  ? 85  VAL A HG13 1 
ATOM   1136 H HG21 . VAL A 1 73  ? 14.464  -8.126  -1.848  1.00 1.11  ? 85  VAL A HG21 1 
ATOM   1137 H HG22 . VAL A 1 73  ? 13.121  -7.341  -2.679  1.00 0.99  ? 85  VAL A HG22 1 
ATOM   1138 H HG23 . VAL A 1 73  ? 13.058  -7.580  -0.934  1.00 1.17  ? 85  VAL A HG23 1 
ATOM   1139 N N    . CYS A 1 74  ? 12.225  -11.105 -4.446  1.00 0.43  ? 86  CYS A N    1 
ATOM   1140 C CA   . CYS A 1 74  ? 11.476  -12.146 -5.207  1.00 0.46  ? 86  CYS A CA   1 
ATOM   1141 C C    . CYS A 1 74  ? 12.453  -13.145 -5.844  1.00 0.49  ? 86  CYS A C    1 
ATOM   1142 O O    . CYS A 1 74  ? 12.075  -14.242 -6.207  1.00 0.52  ? 86  CYS A O    1 
ATOM   1143 C CB   . CYS A 1 74  ? 10.655  -11.472 -6.309  1.00 0.47  ? 86  CYS A CB   1 
ATOM   1144 S SG   . CYS A 1 74  ? 9.315   -10.512 -5.562  1.00 1.47  ? 86  CYS A SG   1 
ATOM   1145 H H    . CYS A 1 74  ? 12.145  -10.164 -4.698  1.00 0.43  ? 86  CYS A H    1 
ATOM   1146 H HA   . CYS A 1 74  ? 10.810  -12.671 -4.539  1.00 0.47  ? 86  CYS A HA   1 
ATOM   1147 H HB2  . CYS A 1 74  ? 11.293  -10.815 -6.882  1.00 0.97  ? 86  CYS A HB2  1 
ATOM   1148 H HB3  . CYS A 1 74  ? 10.239  -12.226 -6.960  1.00 0.85  ? 86  CYS A HB3  1 
ATOM   1149 H HG   . CYS A 1 74  ? 8.599   -10.458 -6.200  1.00 1.90  ? 86  CYS A HG   1 
ATOM   1150 N N    . GLU A 1 75  ? 13.701  -12.781 -5.992  1.00 0.51  ? 87  GLU A N    1 
ATOM   1151 C CA   . GLU A 1 75  ? 14.680  -13.721 -6.614  1.00 0.57  ? 87  GLU A CA   1 
ATOM   1152 C C    . GLU A 1 75  ? 15.523  -14.408 -5.534  1.00 0.59  ? 87  GLU A C    1 
ATOM   1153 O O    . GLU A 1 75  ? 15.416  -15.599 -5.318  1.00 0.63  ? 87  GLU A O    1 
ATOM   1154 C CB   . GLU A 1 75  ? 15.600  -12.942 -7.556  1.00 0.59  ? 87  GLU A CB   1 
ATOM   1155 C CG   . GLU A 1 75  ? 14.793  -12.433 -8.751  1.00 1.04  ? 87  GLU A CG   1 
ATOM   1156 C CD   . GLU A 1 75  ? 15.402  -12.975 -10.046 1.00 1.56  ? 87  GLU A CD   1 
ATOM   1157 O OE1  . GLU A 1 75  ? 16.555  -12.674 -10.306 1.00 2.03  ? 87  GLU A OE1  1 
ATOM   1158 O OE2  . GLU A 1 75  ? 14.705  -13.682 -10.754 1.00 2.28  ? 87  GLU A OE2  1 
ATOM   1159 H H    . GLU A 1 75  ? 13.994  -11.894 -5.702  1.00 0.50  ? 87  GLU A H    1 
ATOM   1160 H HA   . GLU A 1 75  ? 14.146  -14.470 -7.179  1.00 0.59  ? 87  GLU A HA   1 
ATOM   1161 H HB2  . GLU A 1 75  ? 16.030  -12.103 -7.026  1.00 1.07  ? 87  GLU A HB2  1 
ATOM   1162 H HB3  . GLU A 1 75  ? 16.389  -13.590 -7.906  1.00 1.01  ? 87  GLU A HB3  1 
ATOM   1163 H HG2  . GLU A 1 75  ? 13.770  -12.770 -8.665  1.00 1.70  ? 87  GLU A HG2  1 
ATOM   1164 H HG3  . GLU A 1 75  ? 14.817  -11.353 -8.769  1.00 1.45  ? 87  GLU A HG3  1 
ATOM   1165 N N    . ALA A 1 76  ? 16.365  -13.665 -4.862  1.00 0.57  ? 88  ALA A N    1 
ATOM   1166 C CA   . ALA A 1 76  ? 17.226  -14.268 -3.798  1.00 0.61  ? 88  ALA A CA   1 
ATOM   1167 C C    . ALA A 1 76  ? 16.372  -15.084 -2.826  1.00 0.60  ? 88  ALA A C    1 
ATOM   1168 O O    . ALA A 1 76  ? 16.712  -16.195 -2.471  1.00 0.70  ? 88  ALA A O    1 
ATOM   1169 C CB   . ALA A 1 76  ? 17.940  -13.154 -3.030  1.00 0.60  ? 88  ALA A CB   1 
ATOM   1170 H H    . ALA A 1 76  ? 16.436  -12.709 -5.061  1.00 0.55  ? 88  ALA A H    1 
ATOM   1171 H HA   . ALA A 1 76  ? 17.961  -14.913 -4.256  1.00 0.66  ? 88  ALA A HA   1 
ATOM   1172 H HB1  . ALA A 1 76  ? 18.238  -12.376 -3.717  1.00 1.11  ? 88  ALA A HB1  1 
ATOM   1173 H HB2  . ALA A 1 76  ? 17.270  -12.742 -2.289  1.00 1.16  ? 88  ALA A HB2  1 
ATOM   1174 H HB3  . ALA A 1 76  ? 18.814  -13.557 -2.540  1.00 1.21  ? 88  ALA A HB3  1 
ATOM   1175 N N    . VAL A 1 77  ? 15.266  -14.545 -2.394  1.00 0.52  ? 89  VAL A N    1 
ATOM   1176 C CA   . VAL A 1 77  ? 14.395  -15.302 -1.444  1.00 0.53  ? 89  VAL A CA   1 
ATOM   1177 C C    . VAL A 1 77  ? 13.046  -15.615 -2.117  1.00 0.51  ? 89  VAL A C    1 
ATOM   1178 O O    . VAL A 1 77  ? 12.143  -14.804 -2.088  1.00 0.84  ? 89  VAL A O    1 
ATOM   1179 C CB   . VAL A 1 77  ? 14.163  -14.481 -0.162  1.00 0.65  ? 89  VAL A CB   1 
ATOM   1180 C CG1  . VAL A 1 77  ? 13.760  -13.041 -0.494  1.00 0.52  ? 89  VAL A CG1  1 
ATOM   1181 C CG2  . VAL A 1 77  ? 13.051  -15.137 0.659   1.00 1.08  ? 89  VAL A CG2  1 
ATOM   1182 H H    . VAL A 1 77  ? 15.011  -13.648 -2.697  1.00 0.48  ? 89  VAL A H    1 
ATOM   1183 H HA   . VAL A 1 77  ? 14.889  -16.222 -1.176  1.00 0.60  ? 89  VAL A HA   1 
ATOM   1184 H HB   . VAL A 1 77  ? 15.073  -14.469 0.419   1.00 0.98  ? 89  VAL A HB   1 
ATOM   1185 H HG11 . VAL A 1 77  ? 14.488  -12.603 -1.157  1.00 1.22  ? 89  VAL A HG11 1 
ATOM   1186 H HG12 . VAL A 1 77  ? 12.791  -13.033 -0.964  1.00 0.98  ? 89  VAL A HG12 1 
ATOM   1187 H HG13 . VAL A 1 77  ? 13.716  -12.465 0.418   1.00 1.06  ? 89  VAL A HG13 1 
ATOM   1188 H HG21 . VAL A 1 77  ? 12.952  -16.173 0.369   1.00 1.44  ? 89  VAL A HG21 1 
ATOM   1189 H HG22 . VAL A 1 77  ? 13.297  -15.079 1.709   1.00 1.64  ? 89  VAL A HG22 1 
ATOM   1190 H HG23 . VAL A 1 77  ? 12.119  -14.622 0.479   1.00 1.52  ? 89  VAL A HG23 1 
ATOM   1191 N N    . PRO A 1 78  ? 12.945  -16.788 -2.708  1.00 0.61  ? 90  PRO A N    1 
ATOM   1192 C CA   . PRO A 1 78  ? 11.725  -17.233 -3.394  1.00 0.75  ? 90  PRO A CA   1 
ATOM   1193 C C    . PRO A 1 78  ? 10.489  -16.925 -2.544  1.00 0.74  ? 90  PRO A C    1 
ATOM   1194 O O    . PRO A 1 78  ? 10.565  -16.806 -1.338  1.00 1.02  ? 90  PRO A O    1 
ATOM   1195 C CB   . PRO A 1 78  ? 11.881  -18.737 -3.580  1.00 1.18  ? 90  PRO A CB   1 
ATOM   1196 C CG   . PRO A 1 78  ? 13.418  -18.920 -3.617  1.00 1.52  ? 90  PRO A CG   1 
ATOM   1197 C CD   . PRO A 1 78  ? 14.036  -17.791 -2.755  1.00 1.06  ? 90  PRO A CD   1 
ATOM   1198 H HA   . PRO A 1 78  ? 11.643  -16.755 -4.357  1.00 0.92  ? 90  PRO A HA   1 
ATOM   1199 H HB2  . PRO A 1 78  ? 11.445  -19.271 -2.745  1.00 1.26  ? 90  PRO A HB2  1 
ATOM   1200 H HB3  . PRO A 1 78  ? 11.448  -19.057 -4.512  1.00 1.51  ? 90  PRO A HB3  1 
ATOM   1201 H HG2  . PRO A 1 78  ? 13.682  -19.886 -3.208  1.00 1.88  ? 90  PRO A HG2  1 
ATOM   1202 H HG3  . PRO A 1 78  ? 13.775  -18.838 -4.631  1.00 1.97  ? 90  PRO A HG3  1 
ATOM   1203 H HD2  . PRO A 1 78  ? 14.272  -18.153 -1.763  1.00 1.17  ? 90  PRO A HD2  1 
ATOM   1204 H HD3  . PRO A 1 78  ? 14.908  -17.375 -3.233  1.00 1.18  ? 90  PRO A HD3  1 
ATOM   1205 N N    . GLY A 1 79  ? 9.351   -16.795 -3.169  1.00 0.90  ? 91  GLY A N    1 
ATOM   1206 C CA   . GLY A 1 79  ? 8.108   -16.492 -2.405  1.00 1.13  ? 91  GLY A CA   1 
ATOM   1207 C C    . GLY A 1 79  ? 7.128   -15.730 -3.301  1.00 1.18  ? 91  GLY A C    1 
ATOM   1208 O O    . GLY A 1 79  ? 5.928   -15.807 -3.130  1.00 1.79  ? 91  GLY A O    1 
ATOM   1209 H H    . GLY A 1 79  ? 9.313   -16.894 -4.143  1.00 1.11  ? 91  GLY A H    1 
ATOM   1210 H HA2  . GLY A 1 79  ? 7.654   -17.417 -2.077  1.00 1.36  ? 91  GLY A HA2  1 
ATOM   1211 H HA3  . GLY A 1 79  ? 8.352   -15.886 -1.546  1.00 1.28  ? 91  GLY A HA3  1 
ATOM   1212 N N    . ALA A 1 80  ? 7.630   -14.993 -4.255  1.00 1.18  ? 92  ALA A N    1 
ATOM   1213 C CA   . ALA A 1 80  ? 6.728   -14.227 -5.160  1.00 1.27  ? 92  ALA A CA   1 
ATOM   1214 C C    . ALA A 1 80  ? 6.027   -15.188 -6.121  1.00 1.08  ? 92  ALA A C    1 
ATOM   1215 O O    . ALA A 1 80  ? 6.008   -16.385 -5.914  1.00 1.44  ? 92  ALA A O    1 
ATOM   1216 C CB   . ALA A 1 80  ? 7.550   -13.215 -5.961  1.00 1.78  ? 92  ALA A CB   1 
ATOM   1217 H H    . ALA A 1 80  ? 8.601   -14.943 -4.377  1.00 1.56  ? 92  ALA A H    1 
ATOM   1218 H HA   . ALA A 1 80  ? 5.989   -13.705 -4.573  1.00 1.46  ? 92  ALA A HA   1 
ATOM   1219 H HB1  . ALA A 1 80  ? 8.173   -12.644 -5.288  1.00 2.10  ? 92  ALA A HB1  1 
ATOM   1220 H HB2  . ALA A 1 80  ? 8.172   -13.739 -6.671  1.00 2.08  ? 92  ALA A HB2  1 
ATOM   1221 H HB3  . ALA A 1 80  ? 6.884   -12.548 -6.488  1.00 2.30  ? 92  ALA A HB3  1 
ATOM   1222 N N    . LYS A 1 81  ? 5.450   -14.672 -7.172  1.00 1.09  ? 93  LYS A N    1 
ATOM   1223 C CA   . LYS A 1 81  ? 4.750   -15.554 -8.147  1.00 1.26  ? 93  LYS A CA   1 
ATOM   1224 C C    . LYS A 1 81  ? 5.074   -15.096 -9.571  1.00 1.67  ? 93  LYS A C    1 
ATOM   1225 O O    . LYS A 1 81  ? 4.332   -14.349 -10.177 1.00 2.57  ? 93  LYS A O    1 
ATOM   1226 C CB   . LYS A 1 81  ? 3.239   -15.470 -7.916  1.00 1.54  ? 93  LYS A CB   1 
ATOM   1227 C CG   . LYS A 1 81  ? 2.768   -16.714 -7.161  1.00 2.05  ? 93  LYS A CG   1 
ATOM   1228 C CD   . LYS A 1 81  ? 1.892   -17.568 -8.080  1.00 2.46  ? 93  LYS A CD   1 
ATOM   1229 C CE   . LYS A 1 81  ? 2.217   -19.048 -7.866  1.00 2.95  ? 93  LYS A CE   1 
ATOM   1230 N NZ   . LYS A 1 81  ? 1.364   -19.590 -6.771  1.00 3.68  ? 93  LYS A NZ   1 
ATOM   1231 H H    . LYS A 1 81  ? 5.478   -13.704 -7.319  1.00 1.37  ? 93  LYS A H    1 
ATOM   1232 H HA   . LYS A 1 81  ? 5.079   -16.573 -8.013  1.00 1.44  ? 93  LYS A HA   1 
ATOM   1233 H HB2  . LYS A 1 81  ? 3.013   -14.588 -7.335  1.00 1.70  ? 93  LYS A HB2  1 
ATOM   1234 H HB3  . LYS A 1 81  ? 2.732   -15.415 -8.868  1.00 1.86  ? 93  LYS A HB3  1 
ATOM   1235 H HG2  . LYS A 1 81  ? 3.626   -17.289 -6.843  1.00 2.73  ? 93  LYS A HG2  1 
ATOM   1236 H HG3  . LYS A 1 81  ? 2.194   -16.415 -6.297  1.00 2.28  ? 93  LYS A HG3  1 
ATOM   1237 H HD2  . LYS A 1 81  ? 0.851   -17.391 -7.851  1.00 2.81  ? 93  LYS A HD2  1 
ATOM   1238 H HD3  . LYS A 1 81  ? 2.085   -17.304 -9.109  1.00 2.74  ? 93  LYS A HD3  1 
ATOM   1239 H HE2  . LYS A 1 81  ? 2.024   -19.594 -8.777  1.00 3.22  ? 93  LYS A HE2  1 
ATOM   1240 H HE3  . LYS A 1 81  ? 3.258   -19.152 -7.597  1.00 2.99  ? 93  LYS A HE3  1 
ATOM   1241 H HZ1  . LYS A 1 81  ? 1.084   -18.816 -6.135  1.00 3.80  ? 93  LYS A HZ1  1 
ATOM   1242 H HZ2  . LYS A 1 81  ? 0.515   -20.030 -7.179  1.00 4.21  ? 93  LYS A HZ2  1 
ATOM   1243 H HZ3  . LYS A 1 81  ? 1.898   -20.304 -6.236  1.00 4.00  ? 93  LYS A HZ3  1 
ATOM   1244 N N    . GLY A 1 82  ? 6.178   -15.538 -10.109 1.00 1.43  ? 94  GLY A N    1 
ATOM   1245 C CA   . GLY A 1 82  ? 6.548   -15.127 -11.493 1.00 2.00  ? 94  GLY A CA   1 
ATOM   1246 C C    . GLY A 1 82  ? 7.834   -14.299 -11.454 1.00 1.57  ? 94  GLY A C    1 
ATOM   1247 O O    . GLY A 1 82  ? 7.947   -13.280 -12.106 1.00 1.54  ? 94  GLY A O    1 
ATOM   1248 H H    . GLY A 1 82  ? 6.763   -16.140 -9.603  1.00 1.35  ? 94  GLY A H    1 
ATOM   1249 H HA2  . GLY A 1 82  ? 6.704   -16.009 -12.100 1.00 2.46  ? 94  GLY A HA2  1 
ATOM   1250 H HA3  . GLY A 1 82  ? 5.754   -14.533 -11.918 1.00 2.60  ? 94  GLY A HA3  1 
ATOM   1251 N N    . ALA A 1 83  ? 8.804   -14.728 -10.694 1.00 1.56  ? 95  ALA A N    1 
ATOM   1252 C CA   . ALA A 1 83  ? 10.081  -13.965 -10.612 1.00 1.40  ? 95  ALA A CA   1 
ATOM   1253 C C    . ALA A 1 83  ? 11.016  -14.645 -9.611  1.00 1.25  ? 95  ALA A C    1 
ATOM   1254 O O    . ALA A 1 83  ? 11.703  -13.996 -8.848  1.00 1.67  ? 95  ALA A O    1 
ATOM   1255 C CB   . ALA A 1 83  ? 9.793   -12.535 -10.151 1.00 1.82  ? 95  ALA A CB   1 
ATOM   1256 H H    . ALA A 1 83  ? 8.692   -15.552 -10.176 1.00 1.87  ? 95  ALA A H    1 
ATOM   1257 H HA   . ALA A 1 83  ? 10.550  -13.943 -11.585 1.00 1.47  ? 95  ALA A HA   1 
ATOM   1258 H HB1  . ALA A 1 83  ? 8.970   -12.541 -9.452  1.00 2.12  ? 95  ALA A HB1  1 
ATOM   1259 H HB2  . ALA A 1 83  ? 10.671  -12.128 -9.671  1.00 2.19  ? 95  ALA A HB2  1 
ATOM   1260 H HB3  . ALA A 1 83  ? 9.536   -11.926 -11.005 1.00 2.12  ? 95  ALA A HB3  1 
ATOM   1261 N N    . THR A 1 84  ? 11.047  -15.950 -9.607  1.00 1.24  ? 96  THR A N    1 
ATOM   1262 C CA   . THR A 1 84  ? 11.936  -16.672 -8.654  1.00 1.32  ? 96  THR A CA   1 
ATOM   1263 C C    . THR A 1 84  ? 13.340  -16.785 -9.251  1.00 1.75  ? 96  THR A C    1 
ATOM   1264 O O    . THR A 1 84  ? 14.329  -16.541 -8.587  1.00 2.42  ? 96  THR A O    1 
ATOM   1265 C CB   . THR A 1 84  ? 11.376  -18.073 -8.398  1.00 1.42  ? 96  THR A CB   1 
ATOM   1266 O OG1  . THR A 1 84  ? 10.002  -18.104 -8.757  1.00 1.84  ? 96  THR A OG1  1 
ATOM   1267 C CG2  . THR A 1 84  ? 11.527  -18.421 -6.917  1.00 1.37  ? 96  THR A CG2  1 
ATOM   1268 H H    . THR A 1 84  ? 10.484  -16.455 -10.230 1.00 1.56  ? 96  THR A H    1 
ATOM   1269 H HA   . THR A 1 84  ? 11.984  -16.127 -7.723  1.00 1.34  ? 96  THR A HA   1 
ATOM   1270 H HB   . THR A 1 84  ? 11.920  -18.792 -8.990  1.00 1.63  ? 96  THR A HB   1 
ATOM   1271 H HG1  . THR A 1 84  ? 9.908   -18.674 -9.523  1.00 2.05  ? 96  THR A HG1  1 
ATOM   1272 H HG21 . THR A 1 84  ? 11.153  -17.606 -6.316  1.00 1.69  ? 96  THR A HG21 1 
ATOM   1273 H HG22 . THR A 1 84  ? 10.964  -19.317 -6.699  1.00 1.80  ? 96  THR A HG22 1 
ATOM   1274 H HG23 . THR A 1 84  ? 12.570  -18.587 -6.691  1.00 1.61  ? 96  THR A HG23 1 
ATOM   1275 N N    . ARG A 1 85  ? 13.436  -17.154 -10.498 1.00 1.86  ? 97  ARG A N    1 
ATOM   1276 C CA   . ARG A 1 85  ? 14.776  -17.284 -11.136 1.00 2.36  ? 97  ARG A CA   1 
ATOM   1277 C C    . ARG A 1 85  ? 14.604  -17.461 -12.646 1.00 2.11  ? 97  ARG A C    1 
ATOM   1278 O O    . ARG A 1 85  ? 13.918  -18.355 -13.101 1.00 2.29  ? 97  ARG A O    1 
ATOM   1279 C CB   . ARG A 1 85  ? 15.500  -18.501 -10.558 1.00 2.91  ? 97  ARG A CB   1 
ATOM   1280 C CG   . ARG A 1 85  ? 16.850  -18.673 -11.258 1.00 3.97  ? 97  ARG A CG   1 
ATOM   1281 C CD   . ARG A 1 85  ? 16.688  -19.610 -12.457 1.00 4.75  ? 97  ARG A CD   1 
ATOM   1282 N NE   . ARG A 1 85  ? 17.372  -19.021 -13.643 1.00 5.73  ? 97  ARG A NE   1 
ATOM   1283 C CZ   . ARG A 1 85  ? 18.675  -18.949 -13.675 1.00 6.46  ? 97  ARG A CZ   1 
ATOM   1284 N NH1  . ARG A 1 85  ? 19.284  -17.916 -13.162 1.00 7.12  ? 97  ARG A NH1  1 
ATOM   1285 N NH2  . ARG A 1 85  ? 19.368  -19.910 -14.221 1.00 6.80  ? 97  ARG A NH2  1 
ATOM   1286 H H    . ARG A 1 85  ? 12.627  -17.346 -11.016 1.00 1.99  ? 97  ARG A H    1 
ATOM   1287 H HA   . ARG A 1 85  ? 15.356  -16.394 -10.942 1.00 3.12  ? 97  ARG A HA   1 
ATOM   1288 H HB2  . ARG A 1 85  ? 15.659  -18.356 -9.499  1.00 3.17  ? 97  ARG A HB2  1 
ATOM   1289 H HB3  . ARG A 1 85  ? 14.901  -19.385 -10.715 1.00 2.84  ? 97  ARG A HB3  1 
ATOM   1290 H HG2  . ARG A 1 85  ? 17.204  -17.710 -11.598 1.00 4.13  ? 97  ARG A HG2  1 
ATOM   1291 H HG3  . ARG A 1 85  ? 17.563  -19.096 -10.567 1.00 4.40  ? 97  ARG A HG3  1 
ATOM   1292 H HD2  . ARG A 1 85  ? 17.128  -20.569 -12.226 1.00 4.72  ? 97  ARG A HD2  1 
ATOM   1293 H HD3  . ARG A 1 85  ? 15.638  -19.739 -12.674 1.00 4.96  ? 97  ARG A HD3  1 
ATOM   1294 H HE   . ARG A 1 85  ? 16.844  -18.689 -14.398 1.00 6.03  ? 97  ARG A HE   1 
ATOM   1295 H HH11 . ARG A 1 85  ? 18.753  -17.179 -12.743 1.00 7.09  ? 97  ARG A HH11 1 
ATOM   1296 H HH12 . ARG A 1 85  ? 20.282  -17.860 -13.187 1.00 7.79  ? 97  ARG A HH12 1 
ATOM   1297 H HH21 . ARG A 1 85  ? 18.901  -20.703 -14.615 1.00 6.55  ? 97  ARG A HH21 1 
ATOM   1298 H HH22 . ARG A 1 85  ? 20.366  -19.855 -14.246 1.00 7.47  ? 97  ARG A HH22 1 
ATOM   1299 N N    . ARG A 1 86  ? 15.220  -16.617 -13.426 1.00 2.20  ? 98  ARG A N    1 
ATOM   1300 C CA   . ARG A 1 86  ? 15.090  -16.738 -14.905 1.00 2.90  ? 98  ARG A CA   1 
ATOM   1301 C C    . ARG A 1 86  ? 16.137  -15.852 -15.582 1.00 3.22  ? 98  ARG A C    1 
ATOM   1302 O O    . ARG A 1 86  ? 15.886  -15.253 -16.609 1.00 3.89  ? 98  ARG A O    1 
ATOM   1303 C CB   . ARG A 1 86  ? 13.690  -16.291 -15.332 1.00 3.44  ? 98  ARG A CB   1 
ATOM   1304 C CG   . ARG A 1 86  ? 13.050  -17.371 -16.207 1.00 4.36  ? 98  ARG A CG   1 
ATOM   1305 C CD   . ARG A 1 86  ? 13.267  -17.027 -17.682 1.00 5.06  ? 98  ARG A CD   1 
ATOM   1306 N NE   . ARG A 1 86  ? 13.729  -18.241 -18.412 1.00 5.88  ? 98  ARG A NE   1 
ATOM   1307 C CZ   . ARG A 1 86  ? 14.906  -18.255 -18.976 1.00 6.35  ? 98  ARG A CZ   1 
ATOM   1308 N NH1  . ARG A 1 86  ? 15.235  -17.318 -19.823 1.00 6.71  ? 98  ARG A NH1  1 
ATOM   1309 N NH2  . ARG A 1 86  ? 15.754  -19.206 -18.693 1.00 6.71  ? 98  ARG A NH2  1 
ATOM   1310 H H    . ARG A 1 86  ? 15.769  -15.902 -13.039 1.00 2.10  ? 98  ARG A H    1 
ATOM   1311 H HA   . ARG A 1 86  ? 15.245  -17.766 -15.197 1.00 3.25  ? 98  ARG A HA   1 
ATOM   1312 H HB2  . ARG A 1 86  ? 13.081  -16.131 -14.454 1.00 3.37  ? 98  ARG A HB2  1 
ATOM   1313 H HB3  . ARG A 1 86  ? 13.761  -15.372 -15.893 1.00 3.65  ? 98  ARG A HB3  1 
ATOM   1314 H HG2  . ARG A 1 86  ? 13.504  -18.327 -15.989 1.00 4.68  ? 98  ARG A HG2  1 
ATOM   1315 H HG3  . ARG A 1 86  ? 11.992  -17.420 -16.003 1.00 4.54  ? 98  ARG A HG3  1 
ATOM   1316 H HD2  . ARG A 1 86  ? 12.339  -16.680 -18.111 1.00 5.25  ? 98  ARG A HD2  1 
ATOM   1317 H HD3  . ARG A 1 86  ? 14.014  -16.252 -17.764 1.00 5.15  ? 98  ARG A HD3  1 
ATOM   1318 H HE   . ARG A 1 86  ? 13.149  -19.029 -18.468 1.00 6.24  ? 98  ARG A HE   1 
ATOM   1319 H HH11 . ARG A 1 86  ? 14.585  -16.590 -20.039 1.00 6.67  ? 98  ARG A HH11 1 
ATOM   1320 H HH12 . ARG A 1 86  ? 16.136  -17.329 -20.255 1.00 7.19  ? 98  ARG A HH12 1 
ATOM   1321 H HH21 . ARG A 1 86  ? 15.502  -19.924 -18.044 1.00 6.71  ? 98  ARG A HH21 1 
ATOM   1322 H HH22 . ARG A 1 86  ? 16.655  -19.217 -19.126 1.00 7.15  ? 98  ARG A HH22 1 
ATOM   1323 N N    . ARG A 1 87  ? 17.309  -15.764 -15.016 1.00 3.12  ? 99  ARG A N    1 
ATOM   1324 C CA   . ARG A 1 87  ? 18.368  -14.916 -15.629 1.00 3.55  ? 99  ARG A CA   1 
ATOM   1325 C C    . ARG A 1 87  ? 17.843  -13.488 -15.793 1.00 3.04  ? 99  ARG A C    1 
ATOM   1326 O O    . ARG A 1 87  ? 17.328  -13.123 -16.831 1.00 3.56  ? 99  ARG A O    1 
ATOM   1327 C CB   . ARG A 1 87  ? 18.745  -15.481 -17.000 1.00 4.65  ? 99  ARG A CB   1 
ATOM   1328 C CG   . ARG A 1 87  ? 19.792  -16.583 -16.828 1.00 5.53  ? 99  ARG A CG   1 
ATOM   1329 C CD   . ARG A 1 87  ? 21.110  -16.141 -17.468 1.00 6.48  ? 99  ARG A CD   1 
ATOM   1330 N NE   . ARG A 1 87  ? 21.979  -15.514 -16.433 1.00 7.29  ? 99  ARG A NE   1 
ATOM   1331 C CZ   . ARG A 1 87  ? 22.895  -14.654 -16.785 1.00 8.15  ? 99  ARG A CZ   1 
ATOM   1332 N NH1  . ARG A 1 87  ? 23.709  -14.933 -17.766 1.00 8.94  ? 99  ARG A NH1  1 
ATOM   1333 N NH2  . ARG A 1 87  ? 22.998  -13.516 -16.155 1.00 8.37  ? 99  ARG A NH2  1 
ATOM   1334 H H    . ARG A 1 87  ? 17.492  -16.255 -14.188 1.00 3.06  ? 99  ARG A H    1 
ATOM   1335 H HA   . ARG A 1 87  ? 19.239  -14.908 -14.989 1.00 3.79  ? 99  ARG A HA   1 
ATOM   1336 H HB2  . ARG A 1 87  ? 17.865  -15.890 -17.474 1.00 4.93  ? 99  ARG A HB2  1 
ATOM   1337 H HB3  . ARG A 1 87  ? 19.153  -14.693 -17.614 1.00 4.87  ? 99  ARG A HB3  1 
ATOM   1338 H HG2  . ARG A 1 87  ? 19.948  -16.771 -15.776 1.00 5.72  ? 99  ARG A HG2  1 
ATOM   1339 H HG3  . ARG A 1 87  ? 19.447  -17.486 -17.308 1.00 5.64  ? 99  ARG A HG3  1 
ATOM   1340 H HD2  . ARG A 1 87  ? 21.612  -17.000 -17.888 1.00 6.56  ? 99  ARG A HD2  1 
ATOM   1341 H HD3  . ARG A 1 87  ? 20.907  -15.425 -18.251 1.00 6.76  ? 99  ARG A HD3  1 
ATOM   1342 H HE   . ARG A 1 87  ? 21.862  -15.747 -15.489 1.00 7.35  ? 99  ARG A HE   1 
ATOM   1343 H HH11 . ARG A 1 87  ? 23.631  -15.805 -18.249 1.00 8.91  ? 99  ARG A HH11 1 
ATOM   1344 H HH12 . ARG A 1 87  ? 24.412  -14.274 -18.036 1.00 9.66  ? 99  ARG A HH12 1 
ATOM   1345 H HH21 . ARG A 1 87  ? 22.374  -13.303 -15.403 1.00 7.93  ? 99  ARG A HH21 1 
ATOM   1346 H HH22 . ARG A 1 87  ? 23.700  -12.857 -16.424 1.00 9.10  ? 99  ARG A HH22 1 
ATOM   1347 N N    . LYS A 1 88  ? 17.967  -12.679 -14.777 1.00 2.46  ? 100 LYS A N    1 
ATOM   1348 C CA   . LYS A 1 88  ? 17.472  -11.277 -14.879 1.00 2.53  ? 100 LYS A CA   1 
ATOM   1349 C C    . LYS A 1 88  ? 18.541  -10.310 -14.362 1.00 2.52  ? 100 LYS A C    1 
ATOM   1350 O O    . LYS A 1 88  ? 18.324  -9.606  -13.395 1.00 2.62  ? 100 LYS A O    1 
ATOM   1351 C CB   . LYS A 1 88  ? 16.202  -11.125 -14.039 1.00 2.89  ? 100 LYS A CB   1 
ATOM   1352 C CG   . LYS A 1 88  ? 15.434  -9.883  -14.495 1.00 3.82  ? 100 LYS A CG   1 
ATOM   1353 C CD   . LYS A 1 88  ? 14.504  -10.255 -15.651 1.00 4.50  ? 100 LYS A CD   1 
ATOM   1354 C CE   . LYS A 1 88  ? 14.312  -9.042  -16.562 1.00 5.19  ? 100 LYS A CE   1 
ATOM   1355 N NZ   . LYS A 1 88  ? 14.136  -9.501  -17.969 1.00 6.18  ? 100 LYS A NZ   1 
ATOM   1356 H H    . LYS A 1 88  ? 18.384  -12.992 -13.948 1.00 2.42  ? 100 LYS A H    1 
ATOM   1357 H HA   . LYS A 1 88  ? 17.249  -11.048 -15.911 1.00 3.03  ? 100 LYS A HA   1 
ATOM   1358 H HB2  . LYS A 1 88  ? 15.581  -12.000 -14.165 1.00 2.92  ? 100 LYS A HB2  1 
ATOM   1359 H HB3  . LYS A 1 88  ? 16.469  -11.019 -12.999 1.00 3.02  ? 100 LYS A HB3  1 
ATOM   1360 H HG2  . LYS A 1 88  ? 14.850  -9.499  -13.670 1.00 4.22  ? 100 LYS A HG2  1 
ATOM   1361 H HG3  . LYS A 1 88  ? 16.132  -9.128  -14.825 1.00 4.08  ? 100 LYS A HG3  1 
ATOM   1362 H HD2  . LYS A 1 88  ? 14.940  -11.066 -16.216 1.00 4.57  ? 100 LYS A HD2  1 
ATOM   1363 H HD3  . LYS A 1 88  ? 13.547  -10.563 -15.258 1.00 4.88  ? 100 LYS A HD3  1 
ATOM   1364 H HE2  . LYS A 1 88  ? 13.437  -8.492  -16.251 1.00 5.32  ? 100 LYS A HE2  1 
ATOM   1365 H HE3  . LYS A 1 88  ? 15.181  -8.403  -16.499 1.00 5.18  ? 100 LYS A HE3  1 
ATOM   1366 H HZ1  . LYS A 1 88  ? 13.315  -10.136 -18.027 1.00 6.54  ? 100 LYS A HZ1  1 
ATOM   1367 H HZ2  . LYS A 1 88  ? 13.982  -8.677  -18.585 1.00 6.35  ? 100 LYS A HZ2  1 
ATOM   1368 H HZ3  . LYS A 1 88  ? 14.988  -10.011 -18.277 1.00 6.60  ? 100 LYS A HZ3  1 
ATOM   1369 N N    . PRO A 1 89  ? 19.665  -10.304 -15.029 1.00 3.03  ? 101 PRO A N    1 
ATOM   1370 C CA   . PRO A 1 89  ? 20.796  -9.440  -14.677 1.00 3.47  ? 101 PRO A CA   1 
ATOM   1371 C C    . PRO A 1 89  ? 20.464  -7.974  -14.992 1.00 3.05  ? 101 PRO A C    1 
ATOM   1372 O O    . PRO A 1 89  ? 20.043  -7.231  -14.127 1.00 3.17  ? 101 PRO A O    1 
ATOM   1373 C CB   . PRO A 1 89  ? 21.975  -9.932  -15.514 1.00 4.26  ? 101 PRO A CB   1 
ATOM   1374 C CG   . PRO A 1 89  ? 21.294  -10.665 -16.700 1.00 4.60  ? 101 PRO A CG   1 
ATOM   1375 C CD   . PRO A 1 89  ? 19.915  -11.166 -16.203 1.00 3.76  ? 101 PRO A CD   1 
ATOM   1376 H HA   . PRO A 1 89  ? 21.028  -9.548  -13.629 1.00 3.95  ? 101 PRO A HA   1 
ATOM   1377 H HB2  . PRO A 1 89  ? 22.566  -9.095  -15.864 1.00 4.28  ? 101 PRO A HB2  1 
ATOM   1378 H HB3  . PRO A 1 89  ? 22.582  -10.624 -14.953 1.00 4.91  ? 101 PRO A HB3  1 
ATOM   1379 H HG2  . PRO A 1 89  ? 21.165  -9.987  -17.531 1.00 5.02  ? 101 PRO A HG2  1 
ATOM   1380 H HG3  . PRO A 1 89  ? 21.895  -11.508 -17.004 1.00 5.29  ? 101 PRO A HG3  1 
ATOM   1381 H HD2  . PRO A 1 89  ? 19.158  -11.018 -16.962 1.00 3.77  ? 101 PRO A HD2  1 
ATOM   1382 H HD3  . PRO A 1 89  ? 19.968  -12.201 -15.905 1.00 4.06  ? 101 PRO A HD3  1 
ATOM   1383 N N    . CYS A 1 90  ? 20.644  -7.547  -16.215 1.00 3.12  ? 102 CYS A N    1 
ATOM   1384 C CA   . CYS A 1 90  ? 20.333  -6.132  -16.564 1.00 3.12  ? 102 CYS A CA   1 
ATOM   1385 C C    . CYS A 1 90  ? 21.245  -5.192  -15.772 1.00 2.92  ? 102 CYS A C    1 
ATOM   1386 O O    . CYS A 1 90  ? 21.771  -5.547  -14.735 1.00 3.36  ? 102 CYS A O    1 
ATOM   1387 C CB   . CYS A 1 90  ? 18.873  -5.832  -16.220 1.00 4.07  ? 102 CYS A CB   1 
ATOM   1388 S SG   . CYS A 1 90  ? 17.935  -7.379  -16.169 1.00 4.82  ? 102 CYS A SG   1 
ATOM   1389 H H    . CYS A 1 90  ? 20.982  -8.153  -16.903 1.00 3.50  ? 102 CYS A H    1 
ATOM   1390 H HA   . CYS A 1 90  ? 20.491  -5.979  -17.621 1.00 3.18  ? 102 CYS A HA   1 
ATOM   1391 H HB2  . CYS A 1 90  ? 18.822  -5.348  -15.256 1.00 4.45  ? 102 CYS A HB2  1 
ATOM   1392 H HB3  . CYS A 1 90  ? 18.452  -5.181  -16.972 1.00 4.46  ? 102 CYS A HB3  1 
ATOM   1393 H HG   . CYS A 1 90  ? 17.715  -7.563  -15.253 1.00 5.12  ? 102 CYS A HG   1 
ATOM   1394 N N    . SER A 1 91  ? 21.436  -3.994  -16.253 1.00 2.77  ? 103 SER A N    1 
ATOM   1395 C CA   . SER A 1 91  ? 22.311  -3.028  -15.531 1.00 2.80  ? 103 SER A CA   1 
ATOM   1396 C C    . SER A 1 91  ? 21.672  -2.678  -14.183 1.00 2.65  ? 103 SER A C    1 
ATOM   1397 O O    . SER A 1 91  ? 20.862  -3.419  -13.663 1.00 3.04  ? 103 SER A O    1 
ATOM   1398 C CB   . SER A 1 91  ? 22.467  -1.761  -16.374 1.00 3.32  ? 103 SER A CB   1 
ATOM   1399 O OG   . SER A 1 91  ? 23.753  -1.201  -16.146 1.00 3.97  ? 103 SER A OG   1 
ATOM   1400 H H    . SER A 1 91  ? 21.001  -3.728  -17.091 1.00 3.00  ? 103 SER A H    1 
ATOM   1401 H HA   . SER A 1 91  ? 23.282  -3.474  -15.366 1.00 3.25  ? 103 SER A HA   1 
ATOM   1402 H HB2  . SER A 1 91  ? 22.366  -2.006  -17.418 1.00 3.67  ? 103 SER A HB2  1 
ATOM   1403 H HB3  . SER A 1 91  ? 21.699  -1.050  -16.097 1.00 3.50  ? 103 SER A HB3  1 
ATOM   1404 H HG   . SER A 1 91  ? 24.200  -1.131  -16.992 1.00 4.43  ? 103 SER A HG   1 
ATOM   1405 N N    . ARG A 1 92  ? 22.024  -1.555  -13.611 1.00 2.76  ? 104 ARG A N    1 
ATOM   1406 C CA   . ARG A 1 92  ? 21.423  -1.175  -12.300 1.00 3.12  ? 104 ARG A CA   1 
ATOM   1407 C C    . ARG A 1 92  ? 21.611  0.332   -12.040 1.00 2.45  ? 104 ARG A C    1 
ATOM   1408 O O    . ARG A 1 92  ? 22.321  0.742   -11.148 1.00 2.54  ? 104 ARG A O    1 
ATOM   1409 C CB   . ARG A 1 92  ? 22.027  -2.045  -11.166 1.00 4.22  ? 104 ARG A CB   1 
ATOM   1410 C CG   . ARG A 1 92  ? 23.474  -1.653  -10.784 1.00 5.09  ? 104 ARG A CG   1 
ATOM   1411 C CD   . ARG A 1 92  ? 24.320  -1.339  -12.022 1.00 6.12  ? 104 ARG A CD   1 
ATOM   1412 N NE   . ARG A 1 92  ? 24.413  -2.551  -12.884 1.00 6.95  ? 104 ARG A NE   1 
ATOM   1413 C CZ   . ARG A 1 92  ? 24.841  -3.678  -12.383 1.00 7.80  ? 104 ARG A CZ   1 
ATOM   1414 N NH1  . ARG A 1 92  ? 26.099  -3.812  -12.057 1.00 8.50  ? 104 ARG A NH1  1 
ATOM   1415 N NH2  . ARG A 1 92  ? 24.013  -4.671  -12.206 1.00 8.19  ? 104 ARG A NH2  1 
ATOM   1416 H H    . ARG A 1 92  ? 22.675  -0.966  -14.043 1.00 3.03  ? 104 ARG A H    1 
ATOM   1417 H HA   . ARG A 1 92  ? 20.361  -1.373  -12.350 1.00 3.53  ? 104 ARG A HA   1 
ATOM   1418 H HB2  . ARG A 1 92  ? 21.404  -1.950  -10.290 1.00 4.38  ? 104 ARG A HB2  1 
ATOM   1419 H HB3  . ARG A 1 92  ? 22.019  -3.078  -11.484 1.00 4.63  ? 104 ARG A HB3  1 
ATOM   1420 H HG2  . ARG A 1 92  ? 23.455  -0.792  -10.136 1.00 5.20  ? 104 ARG A HG2  1 
ATOM   1421 H HG3  . ARG A 1 92  ? 23.927  -2.477  -10.252 1.00 5.22  ? 104 ARG A HG3  1 
ATOM   1422 H HD2  . ARG A 1 92  ? 23.870  -0.532  -12.575 1.00 6.28  ? 104 ARG A HD2  1 
ATOM   1423 H HD3  . ARG A 1 92  ? 25.312  -1.046  -11.710 1.00 6.41  ? 104 ARG A HD3  1 
ATOM   1424 H HE   . ARG A 1 92  ? 24.157  -2.502  -13.829 1.00 7.01  ? 104 ARG A HE   1 
ATOM   1425 H HH11 . ARG A 1 92  ? 26.733  -3.051  -12.193 1.00 8.42  ? 104 ARG A HH11 1 
ATOM   1426 H HH12 . ARG A 1 92  ? 26.427  -4.675  -11.674 1.00 9.24  ? 104 ARG A HH12 1 
ATOM   1427 H HH21 . ARG A 1 92  ? 23.049  -4.569  -12.454 1.00 7.87  ? 104 ARG A HH21 1 
ATOM   1428 H HH22 . ARG A 1 92  ? 24.341  -5.535  -11.822 1.00 8.97  ? 104 ARG A HH22 1 
ATOM   1429 N N    . PRO A 1 93  ? 20.946  1.121   -12.845 1.00 2.26  ? 105 PRO A N    1 
ATOM   1430 C CA   . PRO A 1 93  ? 20.995  2.585   -12.750 1.00 2.06  ? 105 PRO A CA   1 
ATOM   1431 C C    . PRO A 1 93  ? 20.781  3.024   -11.298 1.00 1.69  ? 105 PRO A C    1 
ATOM   1432 O O    . PRO A 1 93  ? 19.663  3.184   -10.849 1.00 2.12  ? 105 PRO A O    1 
ATOM   1433 C CB   . PRO A 1 93  ? 19.859  3.097   -13.627 1.00 2.68  ? 105 PRO A CB   1 
ATOM   1434 C CG   . PRO A 1 93  ? 19.653  1.944   -14.640 1.00 3.17  ? 105 PRO A CG   1 
ATOM   1435 C CD   . PRO A 1 93  ? 20.073  0.630   -13.935 1.00 2.87  ? 105 PRO A CD   1 
ATOM   1436 H HA   . PRO A 1 93  ? 21.939  2.954   -13.119 1.00 2.29  ? 105 PRO A HA   1 
ATOM   1437 H HB2  . PRO A 1 93  ? 18.966  3.259   -13.035 1.00 2.78  ? 105 PRO A HB2  1 
ATOM   1438 H HB3  . PRO A 1 93  ? 20.148  3.997   -14.144 1.00 3.12  ? 105 PRO A HB3  1 
ATOM   1439 H HG2  . PRO A 1 93  ? 18.612  1.893   -14.930 1.00 3.60  ? 105 PRO A HG2  1 
ATOM   1440 H HG3  . PRO A 1 93  ? 20.271  2.103   -15.509 1.00 3.66  ? 105 PRO A HG3  1 
ATOM   1441 H HD2  . PRO A 1 93  ? 19.208  0.114   -13.538 1.00 3.27  ? 105 PRO A HD2  1 
ATOM   1442 H HD3  . PRO A 1 93  ? 20.628  -0.003  -14.607 1.00 3.04  ? 105 PRO A HD3  1 
ATOM   1443 N N    . LEU A 1 94  ? 21.841  3.221   -10.563 1.00 1.60  ? 106 LEU A N    1 
ATOM   1444 C CA   . LEU A 1 94  ? 21.694  3.649   -9.142  1.00 1.40  ? 106 LEU A CA   1 
ATOM   1445 C C    . LEU A 1 94  ? 23.072  3.979   -8.566  1.00 1.72  ? 106 LEU A C    1 
ATOM   1446 O O    . LEU A 1 94  ? 23.981  3.174   -8.607  1.00 2.40  ? 106 LEU A O    1 
ATOM   1447 C CB   . LEU A 1 94  ? 21.059  2.517   -8.330  1.00 1.59  ? 106 LEU A CB   1 
ATOM   1448 C CG   . LEU A 1 94  ? 19.566  2.798   -8.139  1.00 1.64  ? 106 LEU A CG   1 
ATOM   1449 C CD1  . LEU A 1 94  ? 18.751  1.623   -8.681  1.00 2.17  ? 106 LEU A CD1  1 
ATOM   1450 C CD2  . LEU A 1 94  ? 19.267  2.979   -6.648  1.00 1.93  ? 106 LEU A CD2  1 
ATOM   1451 H H    . LEU A 1 94  ? 22.733  3.087   -10.944 1.00 2.13  ? 106 LEU A H    1 
ATOM   1452 H HA   . LEU A 1 94  ? 21.064  4.525   -9.094  1.00 1.39  ? 106 LEU A HA   1 
ATOM   1453 H HB2  . LEU A 1 94  ? 21.184  1.582   -8.858  1.00 2.13  ? 106 LEU A HB2  1 
ATOM   1454 H HB3  . LEU A 1 94  ? 21.538  2.453   -7.366  1.00 2.04  ? 106 LEU A HB3  1 
ATOM   1455 H HG   . LEU A 1 94  ? 19.298  3.698   -8.673  1.00 2.21  ? 106 LEU A HG   1 
ATOM   1456 H HD11 . LEU A 1 94  ? 19.259  1.195   -9.533  1.00 2.81  ? 106 LEU A HD11 1 
ATOM   1457 H HD12 . LEU A 1 94  ? 18.644  0.873   -7.911  1.00 2.30  ? 106 LEU A HD12 1 
ATOM   1458 H HD13 . LEU A 1 94  ? 17.774  1.971   -8.982  1.00 2.57  ? 106 LEU A HD13 1 
ATOM   1459 H HD21 . LEU A 1 94  ? 20.180  3.214   -6.122  1.00 2.22  ? 106 LEU A HD21 1 
ATOM   1460 H HD22 . LEU A 1 94  ? 18.560  3.785   -6.519  1.00 2.55  ? 106 LEU A HD22 1 
ATOM   1461 H HD23 . LEU A 1 94  ? 18.847  2.066   -6.252  1.00 2.18  ? 106 LEU A HD23 1 
ATOM   1462 N N    . SER A 1 95  ? 23.235  5.157   -8.028  1.00 1.69  ? 107 SER A N    1 
ATOM   1463 C CA   . SER A 1 95  ? 24.556  5.536   -7.450  1.00 2.19  ? 107 SER A CA   1 
ATOM   1464 C C    . SER A 1 95  ? 24.478  5.493   -5.922  1.00 1.65  ? 107 SER A C    1 
ATOM   1465 O O    . SER A 1 95  ? 25.161  4.722   -5.278  1.00 2.06  ? 107 SER A O    1 
ATOM   1466 C CB   . SER A 1 95  ? 24.925  6.949   -7.902  1.00 2.92  ? 107 SER A CB   1 
ATOM   1467 O OG   . SER A 1 95  ? 25.839  6.871   -8.988  1.00 3.30  ? 107 SER A OG   1 
ATOM   1468 H H    . SER A 1 95  ? 22.489  5.793   -8.004  1.00 1.70  ? 107 SER A H    1 
ATOM   1469 H HA   . SER A 1 95  ? 25.310  4.841   -7.791  1.00 2.75  ? 107 SER A HA   1 
ATOM   1470 H HB2  . SER A 1 95  ? 24.038  7.471   -8.221  1.00 3.34  ? 107 SER A HB2  1 
ATOM   1471 H HB3  . SER A 1 95  ? 25.376  7.484   -7.076  1.00 3.27  ? 107 SER A HB3  1 
ATOM   1472 H HG   . SER A 1 95  ? 26.716  7.071   -8.653  1.00 3.72  ? 107 SER A HG   1 
ATOM   1473 N N    . SER A 1 96  ? 23.652  6.316   -5.336  1.00 1.22  ? 108 SER A N    1 
ATOM   1474 C CA   . SER A 1 96  ? 23.535  6.320   -3.850  1.00 1.10  ? 108 SER A CA   1 
ATOM   1475 C C    . SER A 1 96  ? 22.057  6.349   -3.454  1.00 1.10  ? 108 SER A C    1 
ATOM   1476 O O    . SER A 1 96  ? 21.559  7.336   -2.949  1.00 1.69  ? 108 SER A O    1 
ATOM   1477 C CB   . SER A 1 96  ? 24.239  7.555   -3.287  1.00 1.38  ? 108 SER A CB   1 
ATOM   1478 O OG   . SER A 1 96  ? 25.638  7.309   -3.224  1.00 1.93  ? 108 SER A OG   1 
ATOM   1479 H H    . SER A 1 96  ? 23.110  6.932   -5.873  1.00 1.50  ? 108 SER A H    1 
ATOM   1480 H HA   . SER A 1 96  ? 23.997  5.429   -3.451  1.00 1.39  ? 108 SER A HA   1 
ATOM   1481 H HB2  . SER A 1 96  ? 24.056  8.401   -3.929  1.00 1.57  ? 108 SER A HB2  1 
ATOM   1482 H HB3  . SER A 1 96  ? 23.855  7.767   -2.298  1.00 1.93  ? 108 SER A HB3  1 
ATOM   1483 H HG   . SER A 1 96  ? 26.022  7.566   -4.066  1.00 2.37  ? 108 SER A HG   1 
ATOM   1484 N N    . ILE A 1 97  ? 21.352  5.274   -3.677  1.00 0.81  ? 109 ILE A N    1 
ATOM   1485 C CA   . ILE A 1 97  ? 19.908  5.241   -3.313  1.00 0.76  ? 109 ILE A CA   1 
ATOM   1486 C C    . ILE A 1 97  ? 19.478  3.794   -3.060  1.00 0.81  ? 109 ILE A C    1 
ATOM   1487 O O    . ILE A 1 97  ? 18.937  3.138   -3.926  1.00 1.53  ? 109 ILE A O    1 
ATOM   1488 C CB   . ILE A 1 97  ? 19.079  5.826   -4.458  1.00 0.81  ? 109 ILE A CB   1 
ATOM   1489 C CG1  . ILE A 1 97  ? 19.983  6.064   -5.671  1.00 0.79  ? 109 ILE A CG1  1 
ATOM   1490 C CG2  . ILE A 1 97  ? 18.462  7.155   -4.017  1.00 1.00  ? 109 ILE A CG2  1 
ATOM   1491 C CD1  . ILE A 1 97  ? 19.123  6.418   -6.885  1.00 0.85  ? 109 ILE A CD1  1 
ATOM   1492 H H    . ILE A 1 97  ? 21.772  4.489   -4.085  1.00 1.07  ? 109 ILE A H    1 
ATOM   1493 H HA   . ILE A 1 97  ? 19.749  5.826   -2.418  1.00 0.75  ? 109 ILE A HA   1 
ATOM   1494 H HB   . ILE A 1 97  ? 18.293  5.135   -4.723  1.00 1.04  ? 109 ILE A HB   1 
ATOM   1495 H HG12 . ILE A 1 97  ? 20.662  6.877   -5.460  1.00 0.90  ? 109 ILE A HG12 1 
ATOM   1496 H HG13 . ILE A 1 97  ? 20.547  5.168   -5.880  1.00 0.91  ? 109 ILE A HG13 1 
ATOM   1497 H HG21 . ILE A 1 97  ? 19.181  7.709   -3.432  1.00 1.55  ? 109 ILE A HG21 1 
ATOM   1498 H HG22 . ILE A 1 97  ? 18.186  7.730   -4.888  1.00 1.51  ? 109 ILE A HG22 1 
ATOM   1499 H HG23 . ILE A 1 97  ? 17.583  6.962   -3.419  1.00 1.24  ? 109 ILE A HG23 1 
ATOM   1500 H HD11 . ILE A 1 97  ? 18.162  5.933   -6.799  1.00 1.37  ? 109 ILE A HD11 1 
ATOM   1501 H HD12 . ILE A 1 97  ? 18.984  7.488   -6.928  1.00 1.22  ? 109 ILE A HD12 1 
ATOM   1502 H HD13 . ILE A 1 97  ? 19.616  6.082   -7.785  1.00 1.42  ? 109 ILE A HD13 1 
ATOM   1503 N N    . LEU A 1 98  ? 19.714  3.294   -1.877  1.00 0.79  ? 110 LEU A N    1 
ATOM   1504 C CA   . LEU A 1 98  ? 19.320  1.889   -1.564  1.00 0.77  ? 110 LEU A CA   1 
ATOM   1505 C C    . LEU A 1 98  ? 19.850  1.514   -0.177  1.00 0.58  ? 110 LEU A C    1 
ATOM   1506 O O    . LEU A 1 98  ? 20.304  2.356   0.572   1.00 0.55  ? 110 LEU A O    1 
ATOM   1507 C CB   . LEU A 1 98  ? 19.916  0.943   -2.610  1.00 0.96  ? 110 LEU A CB   1 
ATOM   1508 C CG   . LEU A 1 98  ? 18.794  0.179   -3.316  1.00 1.13  ? 110 LEU A CG   1 
ATOM   1509 C CD1  . LEU A 1 98  ? 19.156  -0.009  -4.790  1.00 1.48  ? 110 LEU A CD1  1 
ATOM   1510 C CD2  . LEU A 1 98  ? 18.617  -1.193  -2.662  1.00 1.51  ? 110 LEU A CD2  1 
ATOM   1511 H H    . LEU A 1 98  ? 20.151  3.842   -1.193  1.00 1.33  ? 110 LEU A H    1 
ATOM   1512 H HA   . LEU A 1 98  ? 18.243  1.806   -1.573  1.00 0.88  ? 110 LEU A HA   1 
ATOM   1513 H HB2  . LEU A 1 98  ? 20.470  1.518   -3.338  1.00 1.08  ? 110 LEU A HB2  1 
ATOM   1514 H HB3  . LEU A 1 98  ? 20.578  0.241   -2.126  1.00 0.98  ? 110 LEU A HB3  1 
ATOM   1515 H HG   . LEU A 1 98  ? 17.874  0.739   -3.239  1.00 1.08  ? 110 LEU A HG   1 
ATOM   1516 H HD11 . LEU A 1 98  ? 19.837  0.771   -5.096  1.00 1.80  ? 110 LEU A HD11 1 
ATOM   1517 H HD12 . LEU A 1 98  ? 19.627  -0.971  -4.925  1.00 2.01  ? 110 LEU A HD12 1 
ATOM   1518 H HD13 . LEU A 1 98  ? 18.259  0.040   -5.390  1.00 1.67  ? 110 LEU A HD13 1 
ATOM   1519 H HD21 . LEU A 1 98  ? 19.528  -1.471  -2.154  1.00 1.83  ? 110 LEU A HD21 1 
ATOM   1520 H HD22 . LEU A 1 98  ? 17.806  -1.151  -1.950  1.00 2.09  ? 110 LEU A HD22 1 
ATOM   1521 H HD23 . LEU A 1 98  ? 18.390  -1.927  -3.422  1.00 1.77  ? 110 LEU A HD23 1 
ATOM   1522 N N    . GLY A 1 99  ? 19.797  0.257   0.169   1.00 0.59  ? 111 GLY A N    1 
ATOM   1523 C CA   . GLY A 1 99  ? 20.298  -0.172  1.505   1.00 0.57  ? 111 GLY A CA   1 
ATOM   1524 C C    . GLY A 1 99  ? 20.585  -1.675  1.481   1.00 0.62  ? 111 GLY A C    1 
ATOM   1525 O O    . GLY A 1 99  ? 21.711  -2.099  1.313   1.00 0.72  ? 111 GLY A O    1 
ATOM   1526 H H    . GLY A 1 99  ? 19.427  -0.405  -0.450  1.00 0.70  ? 111 GLY A H    1 
ATOM   1527 H HA2  . GLY A 1 99  ? 21.206  0.366   1.738   1.00 0.58  ? 111 GLY A HA2  1 
ATOM   1528 H HA3  . GLY A 1 99  ? 19.551  0.037   2.255   1.00 0.65  ? 111 GLY A HA3  1 
ATOM   1529 N N    . ARG A 1 100 ? 19.573  -2.483  1.649   1.00 0.65  ? 112 ARG A N    1 
ATOM   1530 C CA   . ARG A 1 100 ? 19.786  -3.958  1.636   1.00 0.74  ? 112 ARG A CA   1 
ATOM   1531 C C    . ARG A 1 100 ? 18.467  -4.663  1.961   1.00 0.68  ? 112 ARG A C    1 
ATOM   1532 O O    . ARG A 1 100 ? 17.709  -4.222  2.802   1.00 0.74  ? 112 ARG A O    1 
ATOM   1533 C CB   . ARG A 1 100 ? 20.835  -4.331  2.686   1.00 0.84  ? 112 ARG A CB   1 
ATOM   1534 C CG   . ARG A 1 100 ? 20.590  -3.524  3.962   1.00 1.19  ? 112 ARG A CG   1 
ATOM   1535 C CD   . ARG A 1 100 ? 21.350  -4.165  5.124   1.00 1.57  ? 112 ARG A CD   1 
ATOM   1536 N NE   . ARG A 1 100 ? 22.703  -3.551  5.231   1.00 2.15  ? 112 ARG A NE   1 
ATOM   1537 C CZ   . ARG A 1 100 ? 23.766  -4.308  5.206   1.00 2.81  ? 112 ARG A CZ   1 
ATOM   1538 N NH1  . ARG A 1 100 ? 24.208  -4.847  6.309   1.00 3.29  ? 112 ARG A NH1  1 
ATOM   1539 N NH2  . ARG A 1 100 ? 24.387  -4.525  4.079   1.00 3.55  ? 112 ARG A NH2  1 
ATOM   1540 H H    . ARG A 1 100 ? 18.673  -2.119  1.783   1.00 0.70  ? 112 ARG A H    1 
ATOM   1541 H HA   . ARG A 1 100 ? 20.128  -4.265  0.659   1.00 0.80  ? 112 ARG A HA   1 
ATOM   1542 H HB2  . ARG A 1 100 ? 20.763  -5.386  2.906   1.00 1.37  ? 112 ARG A HB2  1 
ATOM   1543 H HB3  . ARG A 1 100 ? 21.820  -4.109  2.305   1.00 1.29  ? 112 ARG A HB3  1 
ATOM   1544 H HG2  . ARG A 1 100 ? 20.937  -2.510  3.819   1.00 1.60  ? 112 ARG A HG2  1 
ATOM   1545 H HG3  . ARG A 1 100 ? 19.534  -3.516  4.186   1.00 1.71  ? 112 ARG A HG3  1 
ATOM   1546 H HD2  . ARG A 1 100 ? 20.807  -4.001  6.043   1.00 2.02  ? 112 ARG A HD2  1 
ATOM   1547 H HD3  . ARG A 1 100 ? 21.448  -5.226  4.948   1.00 1.87  ? 112 ARG A HD3  1 
ATOM   1548 H HE   . ARG A 1 100 ? 22.795  -2.580  5.319   1.00 2.55  ? 112 ARG A HE   1 
ATOM   1549 H HH11 . ARG A 1 100 ? 23.732  -4.680  7.173   1.00 3.29  ? 112 ARG A HH11 1 
ATOM   1550 H HH12 . ARG A 1 100 ? 25.023  -5.427  6.291   1.00 3.99  ? 112 ARG A HH12 1 
ATOM   1551 H HH21 . ARG A 1 100 ? 24.048  -4.112  3.234   1.00 3.71  ? 112 ARG A HH21 1 
ATOM   1552 H HH22 . ARG A 1 100 ? 25.201  -5.105  4.061   1.00 4.22  ? 112 ARG A HH22 1 
ATOM   1553 N N    . SER A 1 101 ? 18.186  -5.755  1.303   1.00 0.60  ? 113 SER A N    1 
ATOM   1554 C CA   . SER A 1 101 ? 16.915  -6.481  1.580   1.00 0.55  ? 113 SER A CA   1 
ATOM   1555 C C    . SER A 1 101 ? 17.095  -7.383  2.802   1.00 0.53  ? 113 SER A C    1 
ATOM   1556 O O    . SER A 1 101 ? 18.006  -8.184  2.869   1.00 0.58  ? 113 SER A O    1 
ATOM   1557 C CB   . SER A 1 101 ? 16.529  -7.333  0.369   1.00 0.57  ? 113 SER A CB   1 
ATOM   1558 O OG   . SER A 1 101 ? 17.260  -6.896  -0.769  1.00 0.60  ? 113 SER A OG   1 
ATOM   1559 H H    . SER A 1 101 ? 18.809  -6.096  0.628   1.00 0.60  ? 113 SER A H    1 
ATOM   1560 H HA   . SER A 1 101 ? 16.131  -5.764  1.778   1.00 0.53  ? 113 SER A HA   1 
ATOM   1561 H HB2  . SER A 1 101 ? 16.762  -8.367  0.565   1.00 0.58  ? 113 SER A HB2  1 
ATOM   1562 H HB3  . SER A 1 101 ? 15.467  -7.235  0.187   1.00 0.58  ? 113 SER A HB3  1 
ATOM   1563 H HG   . SER A 1 101 ? 16.732  -7.081  -1.549  1.00 0.93  ? 113 SER A HG   1 
ATOM   1564 N N    . ASN A 1 102 ? 16.230  -7.256  3.769   1.00 0.49  ? 114 ASN A N    1 
ATOM   1565 C CA   . ASN A 1 102 ? 16.338  -8.101  4.992   1.00 0.50  ? 114 ASN A CA   1 
ATOM   1566 C C    . ASN A 1 102 ? 15.356  -9.266  4.889   1.00 0.48  ? 114 ASN A C    1 
ATOM   1567 O O    . ASN A 1 102 ? 14.165  -9.107  5.076   1.00 0.47  ? 114 ASN A O    1 
ATOM   1568 C CB   . ASN A 1 102 ? 16.005  -7.260  6.227   1.00 0.52  ? 114 ASN A CB   1 
ATOM   1569 C CG   . ASN A 1 102 ? 16.782  -7.793  7.432   1.00 0.69  ? 114 ASN A CG   1 
ATOM   1570 O OD1  . ASN A 1 102 ? 16.947  -8.987  7.584   1.00 1.28  ? 114 ASN A OD1  1 
ATOM   1571 N ND2  . ASN A 1 102 ? 17.269  -6.952  8.303   1.00 1.24  ? 114 ASN A ND2  1 
ATOM   1572 H H    . ASN A 1 102 ? 15.506  -6.603  3.689   1.00 0.49  ? 114 ASN A H    1 
ATOM   1573 H HA   . ASN A 1 102 ? 17.342  -8.486  5.079   1.00 0.52  ? 114 ASN A HA   1 
ATOM   1574 H HB2  . ASN A 1 102 ? 16.281  -6.231  6.046   1.00 0.52  ? 114 ASN A HB2  1 
ATOM   1575 H HB3  . ASN A 1 102 ? 14.947  -7.319  6.428   1.00 0.62  ? 114 ASN A HB3  1 
ATOM   1576 H HD21 . ASN A 1 102 ? 17.135  -5.988  8.182   1.00 1.86  ? 114 ASN A HD21 1 
ATOM   1577 H HD22 . ASN A 1 102 ? 17.767  -7.283  9.079   1.00 1.36  ? 114 ASN A HD22 1 
ATOM   1578 N N    . LEU A 1 103 ? 15.846  -10.438 4.592   1.00 0.50  ? 115 LEU A N    1 
ATOM   1579 C CA   . LEU A 1 103 ? 14.943  -11.616 4.476   1.00 0.51  ? 115 LEU A CA   1 
ATOM   1580 C C    . LEU A 1 103 ? 14.942  -12.383 5.799   1.00 0.55  ? 115 LEU A C    1 
ATOM   1581 O O    . LEU A 1 103 ? 15.178  -13.574 5.836   1.00 0.62  ? 115 LEU A O    1 
ATOM   1582 C CB   . LEU A 1 103 ? 15.436  -12.542 3.358   1.00 0.57  ? 115 LEU A CB   1 
ATOM   1583 C CG   . LEU A 1 103 ? 15.623  -11.757 2.054   1.00 0.59  ? 115 LEU A CG   1 
ATOM   1584 C CD1  . LEU A 1 103 ? 14.551  -10.672 1.936   1.00 0.54  ? 115 LEU A CD1  1 
ATOM   1585 C CD2  . LEU A 1 103 ? 17.009  -11.108 2.041   1.00 0.63  ? 115 LEU A CD2  1 
ATOM   1586 H H    . LEU A 1 103 ? 16.809  -10.542 4.447   1.00 0.52  ? 115 LEU A H    1 
ATOM   1587 H HA   . LEU A 1 103 ? 13.940  -11.281 4.256   1.00 0.49  ? 115 LEU A HA   1 
ATOM   1588 H HB2  . LEU A 1 103 ? 16.380  -12.980 3.649   1.00 0.62  ? 115 LEU A HB2  1 
ATOM   1589 H HB3  . LEU A 1 103 ? 14.712  -13.328 3.200   1.00 0.59  ? 115 LEU A HB3  1 
ATOM   1590 H HG   . LEU A 1 103 ? 15.538  -12.435 1.216   1.00 0.65  ? 115 LEU A HG   1 
ATOM   1591 H HD11 . LEU A 1 103 ? 13.610  -11.054 2.304   1.00 1.12  ? 115 LEU A HD11 1 
ATOM   1592 H HD12 . LEU A 1 103 ? 14.843  -9.812  2.517   1.00 1.16  ? 115 LEU A HD12 1 
ATOM   1593 H HD13 . LEU A 1 103 ? 14.442  -10.386 0.900   1.00 1.08  ? 115 LEU A HD13 1 
ATOM   1594 H HD21 . LEU A 1 103 ? 17.700  -11.723 2.597   1.00 1.27  ? 115 LEU A HD21 1 
ATOM   1595 H HD22 . LEU A 1 103 ? 17.352  -11.012 1.021   1.00 1.17  ? 115 LEU A HD22 1 
ATOM   1596 H HD23 . LEU A 1 103 ? 16.952  -10.130 2.495   1.00 1.07  ? 115 LEU A HD23 1 
ATOM   1597 N N    . LYS A 1 104 ? 14.677  -11.712 6.886   1.00 0.56  ? 116 LYS A N    1 
ATOM   1598 C CA   . LYS A 1 104 ? 14.662  -12.409 8.203   1.00 0.64  ? 116 LYS A CA   1 
ATOM   1599 C C    . LYS A 1 104 ? 13.339  -13.161 8.369   1.00 0.71  ? 116 LYS A C    1 
ATOM   1600 O O    . LYS A 1 104 ? 13.265  -14.157 9.060   1.00 1.19  ? 116 LYS A O    1 
ATOM   1601 C CB   . LYS A 1 104 ? 14.809  -11.381 9.328   1.00 0.71  ? 116 LYS A CB   1 
ATOM   1602 C CG   . LYS A 1 104 ? 15.681  -11.966 10.441  1.00 0.80  ? 116 LYS A CG   1 
ATOM   1603 C CD   . LYS A 1 104 ? 16.443  -10.837 11.139  1.00 1.43  ? 116 LYS A CD   1 
ATOM   1604 C CE   . LYS A 1 104 ? 16.629  -11.183 12.617  1.00 1.69  ? 116 LYS A CE   1 
ATOM   1605 N NZ   . LYS A 1 104 ? 16.681  -9.927  13.418  1.00 2.31  ? 116 LYS A NZ   1 
ATOM   1606 H H    . LYS A 1 104 ? 14.490  -10.750 6.835   1.00 0.53  ? 116 LYS A H    1 
ATOM   1607 H HA   . LYS A 1 104 ? 15.482  -13.110 8.249   1.00 0.67  ? 116 LYS A HA   1 
ATOM   1608 H HB2  . LYS A 1 104 ? 15.271  -10.486 8.939   1.00 0.68  ? 116 LYS A HB2  1 
ATOM   1609 H HB3  . LYS A 1 104 ? 13.834  -11.141 9.725   1.00 0.76  ? 116 LYS A HB3  1 
ATOM   1610 H HG2  . LYS A 1 104 ? 15.054  -12.476 11.158  1.00 0.93  ? 116 LYS A HG2  1 
ATOM   1611 H HG3  . LYS A 1 104 ? 16.385  -12.665 10.017  1.00 1.06  ? 116 LYS A HG3  1 
ATOM   1612 H HD2  . LYS A 1 104 ? 17.410  -10.715 10.673  1.00 2.15  ? 116 LYS A HD2  1 
ATOM   1613 H HD3  . LYS A 1 104 ? 15.883  -9.918  11.054  1.00 1.94  ? 116 LYS A HD3  1 
ATOM   1614 H HE2  . LYS A 1 104 ? 15.800  -11.789 12.952  1.00 2.04  ? 116 LYS A HE2  1 
ATOM   1615 H HE3  . LYS A 1 104 ? 17.551  -11.730 12.746  1.00 2.07  ? 116 LYS A HE3  1 
ATOM   1616 H HZ1  . LYS A 1 104 ? 17.086  -9.164  12.840  1.00 2.56  ? 116 LYS A HZ1  1 
ATOM   1617 H HZ2  . LYS A 1 104 ? 15.718  -9.665  13.714  1.00 2.80  ? 116 LYS A HZ2  1 
ATOM   1618 H HZ3  . LYS A 1 104 ? 17.275  -10.075 14.258  1.00 2.65  ? 116 LYS A HZ3  1 
ATOM   1619 N N    . PHE A 1 105 ? 12.293  -12.695 7.741   1.00 0.72  ? 117 PHE A N    1 
ATOM   1620 C CA   . PHE A 1 105 ? 10.980  -13.389 7.866   1.00 0.76  ? 117 PHE A CA   1 
ATOM   1621 C C    . PHE A 1 105 ? 10.292  -13.426 6.499   1.00 0.68  ? 117 PHE A C    1 
ATOM   1622 O O    . PHE A 1 105 ? 9.393   -12.657 6.225   1.00 1.38  ? 117 PHE A O    1 
ATOM   1623 C CB   . PHE A 1 105 ? 10.097  -12.637 8.863   1.00 1.03  ? 117 PHE A CB   1 
ATOM   1624 C CG   . PHE A 1 105 ? 10.079  -13.379 10.178  1.00 1.41  ? 117 PHE A CG   1 
ATOM   1625 C CD1  . PHE A 1 105 ? 9.599   -14.693 10.233  1.00 2.00  ? 117 PHE A CD1  1 
ATOM   1626 C CD2  . PHE A 1 105 ? 10.541  -12.754 11.342  1.00 2.18  ? 117 PHE A CD2  1 
ATOM   1627 C CE1  . PHE A 1 105 ? 9.582   -15.382 11.452  1.00 2.58  ? 117 PHE A CE1  1 
ATOM   1628 C CE2  . PHE A 1 105 ? 10.524  -13.442 12.561  1.00 2.77  ? 117 PHE A CE2  1 
ATOM   1629 C CZ   . PHE A 1 105 ? 10.044  -14.756 12.616  1.00 2.76  ? 117 PHE A CZ   1 
ATOM   1630 H H    . PHE A 1 105 ? 12.370  -11.891 7.187   1.00 1.06  ? 117 PHE A H    1 
ATOM   1631 H HA   . PHE A 1 105 ? 11.139  -14.399 8.216   1.00 0.88  ? 117 PHE A HA   1 
ATOM   1632 H HB2  . PHE A 1 105 ? 10.493  -11.643 9.016   1.00 1.40  ? 117 PHE A HB2  1 
ATOM   1633 H HB3  . PHE A 1 105 ? 9.092   -12.569 8.475   1.00 1.07  ? 117 PHE A HB3  1 
ATOM   1634 H HD1  . PHE A 1 105 ? 9.243   -15.176 9.335   1.00 2.48  ? 117 PHE A HD1  1 
ATOM   1635 H HD2  . PHE A 1 105 ? 10.912  -11.740 11.300  1.00 2.70  ? 117 PHE A HD2  1 
ATOM   1636 H HE1  . PHE A 1 105 ? 9.212   -16.396 11.494  1.00 3.27  ? 117 PHE A HE1  1 
ATOM   1637 H HE2  . PHE A 1 105 ? 10.881  -12.960 13.459  1.00 3.56  ? 117 PHE A HE2  1 
ATOM   1638 H HZ   . PHE A 1 105 ? 10.031  -15.288 13.556  1.00 3.33  ? 117 PHE A HZ   1 
ATOM   1639 N N    . ALA A 1 106 ? 10.708  -14.316 5.639   1.00 0.66  ? 118 ALA A N    1 
ATOM   1640 C CA   . ALA A 1 106 ? 10.079  -14.403 4.291   1.00 0.46  ? 118 ALA A CA   1 
ATOM   1641 C C    . ALA A 1 106 ? 8.843   -15.302 4.359   1.00 0.48  ? 118 ALA A C    1 
ATOM   1642 O O    . ALA A 1 106 ? 8.945   -16.505 4.500   1.00 0.73  ? 118 ALA A O    1 
ATOM   1643 C CB   . ALA A 1 106 ? 11.083  -14.992 3.297   1.00 0.51  ? 118 ALA A CB   1 
ATOM   1644 H H    . ALA A 1 106 ? 11.435  -14.928 5.881   1.00 1.27  ? 118 ALA A H    1 
ATOM   1645 H HA   . ALA A 1 106 ? 9.789   -13.415 3.965   1.00 0.51  ? 118 ALA A HA   1 
ATOM   1646 H HB1  . ALA A 1 106 ? 11.559  -15.857 3.736   1.00 0.96  ? 118 ALA A HB1  1 
ATOM   1647 H HB2  . ALA A 1 106 ? 10.567  -15.285 2.395   1.00 1.19  ? 118 ALA A HB2  1 
ATOM   1648 H HB3  . ALA A 1 106 ? 11.832  -14.251 3.060   1.00 1.17  ? 118 ALA A HB3  1 
ATOM   1649 N N    . GLY A 1 107 ? 7.675   -14.729 4.259   1.00 0.57  ? 119 GLY A N    1 
ATOM   1650 C CA   . GLY A 1 107 ? 6.433   -15.552 4.317   1.00 0.62  ? 119 GLY A CA   1 
ATOM   1651 C C    . GLY A 1 107 ? 5.797   -15.425 5.702   1.00 0.63  ? 119 GLY A C    1 
ATOM   1652 O O    . GLY A 1 107 ? 6.013   -16.245 6.572   1.00 0.73  ? 119 GLY A O    1 
ATOM   1653 H H    . GLY A 1 107 ? 7.615   -13.758 4.145   1.00 0.81  ? 119 GLY A H    1 
ATOM   1654 H HA2  . GLY A 1 107 ? 5.737   -15.205 3.566   1.00 0.64  ? 119 GLY A HA2  1 
ATOM   1655 H HA3  . GLY A 1 107 ? 6.677   -16.587 4.130   1.00 0.65  ? 119 GLY A HA3  1 
ATOM   1656 N N    . MET A 1 108 ? 5.014   -14.403 5.916   1.00 0.59  ? 120 MET A N    1 
ATOM   1657 C CA   . MET A 1 108 ? 4.367   -14.225 7.247   1.00 0.61  ? 120 MET A CA   1 
ATOM   1658 C C    . MET A 1 108 ? 2.946   -13.681 7.062   1.00 0.58  ? 120 MET A C    1 
ATOM   1659 O O    . MET A 1 108 ? 2.720   -12.497 7.210   1.00 0.57  ? 120 MET A O    1 
ATOM   1660 C CB   . MET A 1 108 ? 5.185   -13.233 8.076   1.00 0.65  ? 120 MET A CB   1 
ATOM   1661 C CG   . MET A 1 108 ? 4.435   -12.901 9.366   1.00 0.67  ? 120 MET A CG   1 
ATOM   1662 S SD   . MET A 1 108 ? 5.616   -12.747 10.729  1.00 1.17  ? 120 MET A SD   1 
ATOM   1663 C CE   . MET A 1 108 ? 5.223   -11.038 11.179  1.00 0.98  ? 120 MET A CE   1 
ATOM   1664 H H    . MET A 1 108 ? 4.852   -13.751 5.201   1.00 0.58  ? 120 MET A H    1 
ATOM   1665 H HA   . MET A 1 108 ? 4.329   -15.175 7.761   1.00 0.63  ? 120 MET A HA   1 
ATOM   1666 H HB2  . MET A 1 108 ? 6.143   -13.671 8.317   1.00 0.77  ? 120 MET A HB2  1 
ATOM   1667 H HB3  . MET A 1 108 ? 5.336   -12.328 7.507   1.00 0.64  ? 120 MET A HB3  1 
ATOM   1668 H HG2  . MET A 1 108 ? 3.902   -11.970 9.243   1.00 0.81  ? 120 MET A HG2  1 
ATOM   1669 H HG3  . MET A 1 108 ? 3.732   -13.691 9.587   1.00 0.88  ? 120 MET A HG3  1 
ATOM   1670 H HE1  . MET A 1 108 ? 4.821   -10.522 10.322  1.00 1.44  ? 120 MET A HE1  1 
ATOM   1671 H HE2  . MET A 1 108 ? 4.491   -11.036 11.975  1.00 1.58  ? 120 MET A HE2  1 
ATOM   1672 H HE3  . MET A 1 108 ? 6.123   -10.538 11.508  1.00 1.48  ? 120 MET A HE3  1 
ATOM   1673 N N    . PRO A 1 109 ? 2.034   -14.570 6.744   1.00 0.59  ? 121 PRO A N    1 
ATOM   1674 C CA   . PRO A 1 109 ? 0.620   -14.239 6.525   1.00 0.57  ? 121 PRO A CA   1 
ATOM   1675 C C    . PRO A 1 109 ? 0.136   -13.223 7.557   1.00 0.52  ? 121 PRO A C    1 
ATOM   1676 O O    . PRO A 1 109 ? 0.212   -13.450 8.744   1.00 0.60  ? 121 PRO A O    1 
ATOM   1677 C CB   . PRO A 1 109 ? -0.131  -15.552 6.673   1.00 0.64  ? 121 PRO A CB   1 
ATOM   1678 C CG   . PRO A 1 109 ? 0.928   -16.599 6.251   1.00 0.69  ? 121 PRO A CG   1 
ATOM   1679 C CD   . PRO A 1 109 ? 2.327   -16.008 6.574   1.00 0.64  ? 121 PRO A CD   1 
ATOM   1680 H HA   . PRO A 1 109 ? 0.477   -13.854 5.531   1.00 0.58  ? 121 PRO A HA   1 
ATOM   1681 H HB2  . PRO A 1 109 ? -0.439  -15.701 7.701   1.00 0.64  ? 121 PRO A HB2  1 
ATOM   1682 H HB3  . PRO A 1 109 ? -0.976  -15.590 6.005   1.00 0.65  ? 121 PRO A HB3  1 
ATOM   1683 H HG2  . PRO A 1 109 ? 0.777   -17.516 6.799   1.00 0.75  ? 121 PRO A HG2  1 
ATOM   1684 H HG3  . PRO A 1 109 ? 0.850   -16.786 5.194   1.00 0.74  ? 121 PRO A HG3  1 
ATOM   1685 H HD2  . PRO A 1 109 ? 2.720   -16.435 7.487   1.00 0.64  ? 121 PRO A HD2  1 
ATOM   1686 H HD3  . PRO A 1 109 ? 3.008   -16.158 5.752   1.00 0.64  ? 121 PRO A HD3  1 
ATOM   1687 N N    . ILE A 1 110 ? -0.359  -12.101 7.105   1.00 0.44  ? 122 ILE A N    1 
ATOM   1688 C CA   . ILE A 1 110 ? -0.850  -11.059 8.051   1.00 0.41  ? 122 ILE A CA   1 
ATOM   1689 C C    . ILE A 1 110 ? -2.127  -10.431 7.487   1.00 0.40  ? 122 ILE A C    1 
ATOM   1690 O O    . ILE A 1 110 ? -2.225  -10.162 6.308   1.00 0.54  ? 122 ILE A O    1 
ATOM   1691 C CB   . ILE A 1 110 ? 0.218   -9.973  8.219   1.00 0.41  ? 122 ILE A CB   1 
ATOM   1692 C CG1  . ILE A 1 110 ? 0.704   -9.520  6.841   1.00 0.53  ? 122 ILE A CG1  1 
ATOM   1693 C CG2  . ILE A 1 110 ? 1.400   -10.528 9.017   1.00 0.51  ? 122 ILE A CG2  1 
ATOM   1694 C CD1  . ILE A 1 110 ? 1.578   -8.274  6.993   1.00 0.57  ? 122 ILE A CD1  1 
ATOM   1695 H H    . ILE A 1 110 ? -0.405  -11.943 6.139   1.00 0.45  ? 122 ILE A H    1 
ATOM   1696 H HA   . ILE A 1 110 ? -1.062  -11.509 9.007   1.00 0.43  ? 122 ILE A HA   1 
ATOM   1697 H HB   . ILE A 1 110 ? -0.205  -9.130  8.748   1.00 0.48  ? 122 ILE A HB   1 
ATOM   1698 H HG12 . ILE A 1 110 ? 1.279   -10.312 6.384   1.00 0.68  ? 122 ILE A HG12 1 
ATOM   1699 H HG13 . ILE A 1 110 ? -0.147  -9.287  6.218   1.00 0.74  ? 122 ILE A HG13 1 
ATOM   1700 H HG21 . ILE A 1 110 ? 1.480   -11.592 8.852   1.00 1.05  ? 122 ILE A HG21 1 
ATOM   1701 H HG22 . ILE A 1 110 ? 2.310   -10.045 8.693   1.00 1.19  ? 122 ILE A HG22 1 
ATOM   1702 H HG23 . ILE A 1 110 ? 1.246   -10.338 10.068  1.00 1.17  ? 122 ILE A HG23 1 
ATOM   1703 H HD11 . ILE A 1 110 ? 1.121   -7.598  7.700   1.00 1.15  ? 122 ILE A HD11 1 
ATOM   1704 H HD12 . ILE A 1 110 ? 2.556   -8.562  7.350   1.00 1.15  ? 122 ILE A HD12 1 
ATOM   1705 H HD13 . ILE A 1 110 ? 1.675   -7.783  6.035   1.00 1.10  ? 122 ILE A HD13 1 
ATOM   1706 N N    . THR A 1 111 ? -3.105  -10.193 8.317   1.00 0.39  ? 123 THR A N    1 
ATOM   1707 C CA   . THR A 1 111 ? -4.368  -9.580  7.816   1.00 0.40  ? 123 THR A CA   1 
ATOM   1708 C C    . THR A 1 111 ? -4.158  -8.075  7.650   1.00 0.39  ? 123 THR A C    1 
ATOM   1709 O O    . THR A 1 111 ? -3.832  -7.379  8.589   1.00 0.52  ? 123 THR A O    1 
ATOM   1710 C CB   . THR A 1 111 ? -5.495  -9.834  8.822   1.00 0.42  ? 123 THR A CB   1 
ATOM   1711 O OG1  . THR A 1 111 ? -6.259  -10.956 8.401   1.00 0.67  ? 123 THR A OG1  1 
ATOM   1712 C CG2  . THR A 1 111 ? -6.398  -8.602  8.902   1.00 0.49  ? 123 THR A CG2  1 
ATOM   1713 H H    . THR A 1 111 ? -3.010  -10.415 9.266   1.00 0.49  ? 123 THR A H    1 
ATOM   1714 H HA   . THR A 1 111 ? -4.628  -10.017 6.863   1.00 0.42  ? 123 THR A HA   1 
ATOM   1715 H HB   . THR A 1 111 ? -5.073  -10.030 9.796   1.00 0.57  ? 123 THR A HB   1 
ATOM   1716 H HG1  . THR A 1 111 ? -6.393  -11.526 9.162   1.00 1.01  ? 123 THR A HG1  1 
ATOM   1717 H HG21 . THR A 1 111 ? -6.636  -8.264  7.904   1.00 1.14  ? 123 THR A HG21 1 
ATOM   1718 H HG22 . THR A 1 111 ? -7.309  -8.856  9.423   1.00 1.26  ? 123 THR A HG22 1 
ATOM   1719 H HG23 . THR A 1 111 ? -5.886  -7.814  9.435   1.00 1.05  ? 123 THR A HG23 1 
ATOM   1720 N N    . LEU A 1 112 ? -4.336  -7.565  6.461   1.00 0.34  ? 124 LEU A N    1 
ATOM   1721 C CA   . LEU A 1 112 ? -4.137  -6.103  6.243   1.00 0.36  ? 124 LEU A CA   1 
ATOM   1722 C C    . LEU A 1 112 ? -5.425  -5.346  6.573   1.00 0.32  ? 124 LEU A C    1 
ATOM   1723 O O    . LEU A 1 112 ? -6.256  -5.111  5.718   1.00 0.35  ? 124 LEU A O    1 
ATOM   1724 C CB   . LEU A 1 112 ? -3.759  -5.850  4.783   1.00 0.42  ? 124 LEU A CB   1 
ATOM   1725 C CG   . LEU A 1 112 ? -3.492  -4.359  4.577   1.00 0.47  ? 124 LEU A CG   1 
ATOM   1726 C CD1  . LEU A 1 112 ? -2.033  -4.152  4.167   1.00 0.60  ? 124 LEU A CD1  1 
ATOM   1727 C CD2  . LEU A 1 112 ? -4.409  -3.825  3.475   1.00 0.60  ? 124 LEU A CD2  1 
ATOM   1728 H H    . LEU A 1 112 ? -4.596  -8.143  5.713   1.00 0.40  ? 124 LEU A H    1 
ATOM   1729 H HA   . LEU A 1 112 ? -3.342  -5.751  6.884   1.00 0.40  ? 124 LEU A HA   1 
ATOM   1730 H HB2  . LEU A 1 112 ? -2.869  -6.413  4.541   1.00 0.47  ? 124 LEU A HB2  1 
ATOM   1731 H HB3  . LEU A 1 112 ? -4.569  -6.162  4.141   1.00 0.44  ? 124 LEU A HB3  1 
ATOM   1732 H HG   . LEU A 1 112 ? -3.685  -3.828  5.498   1.00 0.45  ? 124 LEU A HG   1 
ATOM   1733 H HD11 . LEU A 1 112 ? -1.669  -5.039  3.670   1.00 1.16  ? 124 LEU A HD11 1 
ATOM   1734 H HD12 . LEU A 1 112 ? -1.964  -3.309  3.495   1.00 1.15  ? 124 LEU A HD12 1 
ATOM   1735 H HD13 . LEU A 1 112 ? -1.435  -3.962  5.046   1.00 1.26  ? 124 LEU A HD13 1 
ATOM   1736 H HD21 . LEU A 1 112 ? -4.325  -4.454  2.601   1.00 1.35  ? 124 LEU A HD21 1 
ATOM   1737 H HD22 . LEU A 1 112 ? -5.431  -3.828  3.824   1.00 1.14  ? 124 LEU A HD22 1 
ATOM   1738 H HD23 . LEU A 1 112 ? -4.118  -2.816  3.221   1.00 1.09  ? 124 LEU A HD23 1 
ATOM   1739 N N    . THR A 1 113 ? -5.597  -4.963  7.809   1.00 0.32  ? 125 THR A N    1 
ATOM   1740 C CA   . THR A 1 113 ? -6.831  -4.223  8.194   1.00 0.32  ? 125 THR A CA   1 
ATOM   1741 C C    . THR A 1 113 ? -6.612  -2.716  8.043   1.00 0.35  ? 125 THR A C    1 
ATOM   1742 O O    . THR A 1 113 ? -5.673  -2.152  8.577   1.00 0.47  ? 125 THR A O    1 
ATOM   1743 C CB   . THR A 1 113 ? -7.203  -4.540  9.645   1.00 0.35  ? 125 THR A CB   1 
ATOM   1744 O OG1  . THR A 1 113 ? -7.285  -5.949  9.813   1.00 0.37  ? 125 THR A OG1  1 
ATOM   1745 C CG2  . THR A 1 113 ? -8.557  -3.904  9.976   1.00 0.39  ? 125 THR A CG2  1 
ATOM   1746 H H    . THR A 1 113 ? -4.917  -5.165  8.480   1.00 0.35  ? 125 THR A H    1 
ATOM   1747 H HA   . THR A 1 113 ? -7.631  -4.525  7.547   1.00 0.31  ? 125 THR A HA   1 
ATOM   1748 H HB   . THR A 1 113 ? -6.451  -4.141  10.306  1.00 0.37  ? 125 THR A HB   1 
ATOM   1749 H HG1  . THR A 1 113 ? -7.159  -6.144  10.744  1.00 0.89  ? 125 THR A HG1  1 
ATOM   1750 H HG21 . THR A 1 113 ? -8.774  -3.123  9.261   1.00 1.21  ? 125 THR A HG21 1 
ATOM   1751 H HG22 . THR A 1 113 ? -9.331  -4.656  9.931   1.00 1.04  ? 125 THR A HG22 1 
ATOM   1752 H HG23 . THR A 1 113 ? -8.525  -3.481  10.969  1.00 1.01  ? 125 THR A HG23 1 
ATOM   1753 N N    . VAL A 1 114 ? -7.483  -2.062  7.322   1.00 0.32  ? 126 VAL A N    1 
ATOM   1754 C CA   . VAL A 1 114 ? -7.343  -0.587  7.131   1.00 0.36  ? 126 VAL A CA   1 
ATOM   1755 C C    . VAL A 1 114 ? -8.560  0.120   7.727   1.00 0.43  ? 126 VAL A C    1 
ATOM   1756 O O    . VAL A 1 114 ? -9.678  -0.059  7.278   1.00 0.48  ? 126 VAL A O    1 
ATOM   1757 C CB   . VAL A 1 114 ? -7.253  -0.246  5.639   1.00 0.35  ? 126 VAL A CB   1 
ATOM   1758 C CG1  . VAL A 1 114 ? -6.490  1.067   5.462   1.00 0.42  ? 126 VAL A CG1  1 
ATOM   1759 C CG2  . VAL A 1 114 ? -6.516  -1.364  4.897   1.00 0.37  ? 126 VAL A CG2  1 
ATOM   1760 H H    . VAL A 1 114 ? -8.234  -2.545  6.911   1.00 0.35  ? 126 VAL A H    1 
ATOM   1761 H HA   . VAL A 1 114 ? -6.449  -0.245  7.632   1.00 0.39  ? 126 VAL A HA   1 
ATOM   1762 H HB   . VAL A 1 114 ? -8.248  -0.132  5.234   1.00 0.36  ? 126 VAL A HB   1 
ATOM   1763 H HG11 . VAL A 1 114 ? -6.335  1.526   6.427   1.00 1.19  ? 126 VAL A HG11 1 
ATOM   1764 H HG12 . VAL A 1 114 ? -5.534  0.868   5.000   1.00 1.17  ? 126 VAL A HG12 1 
ATOM   1765 H HG13 . VAL A 1 114 ? -7.062  1.733   4.833   1.00 0.92  ? 126 VAL A HG13 1 
ATOM   1766 H HG21 . VAL A 1 114 ? -5.606  -1.608  5.425   1.00 1.15  ? 126 VAL A HG21 1 
ATOM   1767 H HG22 . VAL A 1 114 ? -7.147  -2.238  4.843   1.00 1.09  ? 126 VAL A HG22 1 
ATOM   1768 H HG23 . VAL A 1 114 ? -6.274  -1.032  3.897   1.00 1.02  ? 126 VAL A HG23 1 
ATOM   1769 N N    . SER A 1 115 ? -8.349  0.924   8.730   1.00 0.51  ? 127 SER A N    1 
ATOM   1770 C CA   . SER A 1 115 ? -9.485  1.652   9.356   1.00 0.60  ? 127 SER A CA   1 
ATOM   1771 C C    . SER A 1 115 ? -9.277  3.151   9.148   1.00 0.64  ? 127 SER A C    1 
ATOM   1772 O O    . SER A 1 115 ? -8.286  3.574   8.587   1.00 1.19  ? 127 SER A O    1 
ATOM   1773 C CB   . SER A 1 115 ? -9.532  1.343   10.853  1.00 0.81  ? 127 SER A CB   1 
ATOM   1774 O OG   . SER A 1 115 ? -10.846 0.936   11.207  1.00 1.21  ? 127 SER A OG   1 
ATOM   1775 H H    . SER A 1 115 ? -7.438  1.053   9.071   1.00 0.56  ? 127 SER A H    1 
ATOM   1776 H HA   . SER A 1 115 ? -10.412 1.346   8.892   1.00 0.59  ? 127 SER A HA   1 
ATOM   1777 H HB2  . SER A 1 115 ? -8.840  0.549   11.080  1.00 1.26  ? 127 SER A HB2  1 
ATOM   1778 H HB3  . SER A 1 115 ? -9.255  2.229   11.410  1.00 1.37  ? 127 SER A HB3  1 
ATOM   1779 H HG   . SER A 1 115 ? -10.775 0.273   11.898  1.00 1.48  ? 127 SER A HG   1 
ATOM   1780 N N    . THR A 1 116 ? -10.194 3.962   9.592   1.00 0.50  ? 128 THR A N    1 
ATOM   1781 C CA   . THR A 1 116 ? -10.029 5.424   9.413   1.00 0.47  ? 128 THR A CA   1 
ATOM   1782 C C    . THR A 1 116 ? -8.824  5.880   10.230  1.00 0.63  ? 128 THR A C    1 
ATOM   1783 O O    . THR A 1 116 ? -8.926  6.143   11.411  1.00 1.32  ? 128 THR A O    1 
ATOM   1784 C CB   . THR A 1 116 ? -11.281 6.161   9.899   1.00 0.66  ? 128 THR A CB   1 
ATOM   1785 O OG1  . THR A 1 116 ? -11.759 5.544   11.086  1.00 1.22  ? 128 THR A OG1  1 
ATOM   1786 C CG2  . THR A 1 116 ? -12.365 6.107   8.821   1.00 0.82  ? 128 THR A CG2  1 
ATOM   1787 H H    . THR A 1 116 ? -10.981 3.612   10.041  1.00 0.85  ? 128 THR A H    1 
ATOM   1788 H HA   . THR A 1 116 ? -9.861  5.638   8.366   1.00 0.43  ? 128 THR A HA   1 
ATOM   1789 H HB   . THR A 1 116 ? -11.033 7.192   10.102  1.00 0.85  ? 128 THR A HB   1 
ATOM   1790 H HG1  . THR A 1 116 ? -12.243 6.204   11.588  1.00 1.20  ? 128 THR A HG1  1 
ATOM   1791 H HG21 . THR A 1 116 ? -11.944 5.723   7.905   1.00 1.29  ? 128 THR A HG21 1 
ATOM   1792 H HG22 . THR A 1 116 ? -13.165 5.460   9.149   1.00 1.35  ? 128 THR A HG22 1 
ATOM   1793 H HG23 . THR A 1 116 ? -12.753 7.100   8.651   1.00 1.32  ? 128 THR A HG23 1 
ATOM   1794 N N    . SER A 1 117 ? -7.688  5.959   9.598   1.00 1.15  ? 129 SER A N    1 
ATOM   1795 C CA   . SER A 1 117 ? -6.439  6.388   10.302  1.00 1.43  ? 129 SER A CA   1 
ATOM   1796 C C    . SER A 1 117 ? -5.958  5.258   11.210  1.00 0.83  ? 129 SER A C    1 
ATOM   1797 O O    . SER A 1 117 ? -5.453  5.486   12.292  1.00 0.88  ? 129 SER A O    1 
ATOM   1798 C CB   . SER A 1 117 ? -6.702  7.642   11.144  1.00 2.02  ? 129 SER A CB   1 
ATOM   1799 O OG   . SER A 1 117 ? -5.808  8.670   10.743  1.00 2.78  ? 129 SER A OG   1 
ATOM   1800 H H    . SER A 1 117 ? -7.656  5.726   8.649   1.00 1.75  ? 129 SER A H    1 
ATOM   1801 H HA   . SER A 1 117 ? -5.675  6.603   9.569   1.00 1.98  ? 129 SER A HA   1 
ATOM   1802 H HB2  . SER A 1 117 ? -7.714  7.973   10.996  1.00 2.51  ? 129 SER A HB2  1 
ATOM   1803 H HB3  . SER A 1 117 ? -6.553  7.411   12.190  1.00 2.05  ? 129 SER A HB3  1 
ATOM   1804 H HG   . SER A 1 117 ? -5.086  8.699   11.375  1.00 3.12  ? 129 SER A HG   1 
ATOM   1805 N N    . SER A 1 118 ? -6.110  4.037   10.781  1.00 0.65  ? 130 SER A N    1 
ATOM   1806 C CA   . SER A 1 118 ? -5.660  2.902   11.627  1.00 0.95  ? 130 SER A CA   1 
ATOM   1807 C C    . SER A 1 118 ? -5.281  1.709   10.746  1.00 0.78  ? 130 SER A C    1 
ATOM   1808 O O    . SER A 1 118 ? -5.969  0.708   10.719  1.00 0.85  ? 130 SER A O    1 
ATOM   1809 C CB   . SER A 1 118 ? -6.791  2.497   12.573  1.00 1.59  ? 130 SER A CB   1 
ATOM   1810 O OG   . SER A 1 118 ? -7.604  3.631   12.845  1.00 1.52  ? 130 SER A OG   1 
ATOM   1811 H H    . SER A 1 118 ? -6.518  3.869   9.907   1.00 0.77  ? 130 SER A H    1 
ATOM   1812 H HA   . SER A 1 118 ? -4.801  3.205   12.206  1.00 1.37  ? 130 SER A HA   1 
ATOM   1813 H HB2  . SER A 1 118 ? -7.393  1.732   12.113  1.00 2.19  ? 130 SER A HB2  1 
ATOM   1814 H HB3  . SER A 1 118 ? -6.369  2.115   13.494  1.00 2.29  ? 130 SER A HB3  1 
ATOM   1815 H HG   . SER A 1 118 ? -7.171  4.151   13.526  1.00 1.81  ? 130 SER A HG   1 
ATOM   1816 N N    . LEU A 1 119 ? -4.190  1.799   10.032  1.00 0.61  ? 131 LEU A N    1 
ATOM   1817 C CA   . LEU A 1 119 ? -3.777  0.655   9.171   1.00 0.46  ? 131 LEU A CA   1 
ATOM   1818 C C    . LEU A 1 119 ? -3.124  -0.395  10.068  1.00 0.42  ? 131 LEU A C    1 
ATOM   1819 O O    . LEU A 1 119 ? -1.923  -0.419  10.244  1.00 0.45  ? 131 LEU A O    1 
ATOM   1820 C CB   . LEU A 1 119 ? -2.776  1.125   8.108   1.00 0.39  ? 131 LEU A CB   1 
ATOM   1821 C CG   . LEU A 1 119 ? -3.275  0.703   6.723   1.00 0.34  ? 131 LEU A CG   1 
ATOM   1822 C CD1  . LEU A 1 119 ? -2.580  1.529   5.637   1.00 0.40  ? 131 LEU A CD1  1 
ATOM   1823 C CD2  . LEU A 1 119 ? -2.966  -0.777  6.500   1.00 0.37  ? 131 LEU A CD2  1 
ATOM   1824 H H    . LEU A 1 119 ? -3.641  2.609   10.070  1.00 0.64  ? 131 LEU A H    1 
ATOM   1825 H HA   . LEU A 1 119 ? -4.647  0.230   8.692   1.00 0.48  ? 131 LEU A HA   1 
ATOM   1826 H HB2  . LEU A 1 119 ? -2.684  2.199   8.149   1.00 0.50  ? 131 LEU A HB2  1 
ATOM   1827 H HB3  . LEU A 1 119 ? -1.813  0.673   8.293   1.00 0.34  ? 131 LEU A HB3  1 
ATOM   1828 H HG   . LEU A 1 119 ? -4.340  0.860   6.665   1.00 0.40  ? 131 LEU A HG   1 
ATOM   1829 H HD11 . LEU A 1 119 ? -1.867  2.198   6.093   1.00 1.08  ? 131 LEU A HD11 1 
ATOM   1830 H HD12 . LEU A 1 119 ? -2.067  0.866   4.955   1.00 1.09  ? 131 LEU A HD12 1 
ATOM   1831 H HD13 . LEU A 1 119 ? -3.317  2.102   5.094   1.00 1.14  ? 131 LEU A HD13 1 
ATOM   1832 H HD21 . LEU A 1 119 ? -3.343  -1.353  7.331   1.00 1.07  ? 131 LEU A HD21 1 
ATOM   1833 H HD22 . LEU A 1 119 ? -3.438  -1.109  5.587   1.00 1.12  ? 131 LEU A HD22 1 
ATOM   1834 H HD23 . LEU A 1 119 ? -1.897  -0.913  6.422   1.00 1.03  ? 131 LEU A HD23 1 
ATOM   1835 N N    . ASN A 1 120 ? -3.911  -1.259  10.645  1.00 0.43  ? 132 ASN A N    1 
ATOM   1836 C CA   . ASN A 1 120 ? -3.344  -2.304  11.540  1.00 0.43  ? 132 ASN A CA   1 
ATOM   1837 C C    . ASN A 1 120 ? -3.201  -3.601  10.760  1.00 0.45  ? 132 ASN A C    1 
ATOM   1838 O O    . ASN A 1 120 ? -4.138  -4.058  10.149  1.00 0.54  ? 132 ASN A O    1 
ATOM   1839 C CB   . ASN A 1 120 ? -4.292  -2.535  12.717  1.00 0.53  ? 132 ASN A CB   1 
ATOM   1840 C CG   . ASN A 1 120 ? -5.102  -1.266  12.989  1.00 1.79  ? 132 ASN A CG   1 
ATOM   1841 O OD1  . ASN A 1 120 ? -4.590  -0.170  12.885  1.00 2.63  ? 132 ASN A OD1  1 
ATOM   1842 N ND2  . ASN A 1 120 ? -6.356  -1.369  13.335  1.00 2.34  ? 132 ASN A ND2  1 
ATOM   1843 H H    . ASN A 1 120 ? -4.879  -1.219  10.491  1.00 0.48  ? 132 ASN A H    1 
ATOM   1844 H HA   . ASN A 1 120 ? -2.378  -1.988  11.905  1.00 0.41  ? 132 ASN A HA   1 
ATOM   1845 H HB2  . ASN A 1 120 ? -4.964  -3.347  12.479  1.00 1.08  ? 132 ASN A HB2  1 
ATOM   1846 H HB3  . ASN A 1 120 ? -3.718  -2.790  13.594  1.00 0.98  ? 132 ASN A HB3  1 
ATOM   1847 H HD21 . ASN A 1 120 ? -6.770  -2.254  13.418  1.00 2.08  ? 132 ASN A HD21 1 
ATOM   1848 H HD22 . ASN A 1 120 ? -6.884  -0.563  13.511  1.00 3.23  ? 132 ASN A HD22 1 
ATOM   1849 N N    . LEU A 1 121 ? -2.047  -4.203  10.773  1.00 0.46  ? 133 LEU A N    1 
ATOM   1850 C CA   . LEU A 1 121 ? -1.886  -5.474  10.020  1.00 0.53  ? 133 LEU A CA   1 
ATOM   1851 C C    . LEU A 1 121 ? -1.853  -6.638  11.009  1.00 0.59  ? 133 LEU A C    1 
ATOM   1852 O O    . LEU A 1 121 ? -0.830  -6.954  11.566  1.00 1.22  ? 133 LEU A O    1 
ATOM   1853 C CB   . LEU A 1 121 ? -0.583  -5.430  9.218   1.00 0.57  ? 133 LEU A CB   1 
ATOM   1854 C CG   . LEU A 1 121 ? -0.846  -4.796  7.847   1.00 0.63  ? 133 LEU A CG   1 
ATOM   1855 C CD1  . LEU A 1 121 ? -1.813  -3.619  7.997   1.00 1.07  ? 133 LEU A CD1  1 
ATOM   1856 C CD2  . LEU A 1 121 ? 0.473   -4.294  7.256   1.00 1.35  ? 133 LEU A CD2  1 
ATOM   1857 H H    . LEU A 1 121 ? -1.290  -3.825  11.278  1.00 0.48  ? 133 LEU A H    1 
ATOM   1858 H HA   . LEU A 1 121 ? -2.720  -5.599  9.346   1.00 0.56  ? 133 LEU A HA   1 
ATOM   1859 H HB2  . LEU A 1 121 ? 0.149   -4.842  9.753   1.00 0.69  ? 133 LEU A HB2  1 
ATOM   1860 H HB3  . LEU A 1 121 ? -0.209  -6.434  9.082   1.00 0.71  ? 133 LEU A HB3  1 
ATOM   1861 H HG   . LEU A 1 121 ? -1.280  -5.535  7.188   1.00 1.42  ? 133 LEU A HG   1 
ATOM   1862 H HD11 . LEU A 1 121 ? -1.507  -3.005  8.832   1.00 1.58  ? 133 LEU A HD11 1 
ATOM   1863 H HD12 . LEU A 1 121 ? -1.802  -3.027  7.094   1.00 1.73  ? 133 LEU A HD12 1 
ATOM   1864 H HD13 . LEU A 1 121 ? -2.812  -3.991  8.171   1.00 1.65  ? 133 LEU A HD13 1 
ATOM   1865 H HD21 . LEU A 1 121 ? 0.979   -3.673  7.980   1.00 1.67  ? 133 LEU A HD21 1 
ATOM   1866 H HD22 . LEU A 1 121 ? 1.099   -5.137  7.004   1.00 1.88  ? 133 LEU A HD22 1 
ATOM   1867 H HD23 . LEU A 1 121 ? 0.272   -3.717  6.365   1.00 2.08  ? 133 LEU A HD23 1 
ATOM   1868 N N    . MET A 1 122 ? -2.966  -7.277  11.238  1.00 0.54  ? 134 MET A N    1 
ATOM   1869 C CA   . MET A 1 122 ? -2.975  -8.414  12.201  1.00 0.54  ? 134 MET A CA   1 
ATOM   1870 C C    . MET A 1 122 ? -1.916  -9.442  11.797  1.00 0.52  ? 134 MET A C    1 
ATOM   1871 O O    . MET A 1 122 ? -1.518  -9.525  10.652  1.00 0.60  ? 134 MET A O    1 
ATOM   1872 C CB   . MET A 1 122 ? -4.354  -9.068  12.217  1.00 0.57  ? 134 MET A CB   1 
ATOM   1873 C CG   . MET A 1 122 ? -4.854  -9.134  13.660  1.00 0.64  ? 134 MET A CG   1 
ATOM   1874 S SD   . MET A 1 122 ? -6.482  -9.919  13.701  1.00 0.86  ? 134 MET A SD   1 
ATOM   1875 C CE   . MET A 1 122 ? -5.918  -11.530 14.295  1.00 0.96  ? 134 MET A CE   1 
ATOM   1876 H H    . MET A 1 122 ? -3.792  -7.009  10.784  1.00 1.00  ? 134 MET A H    1 
ATOM   1877 H HA   . MET A 1 122 ? -2.748  -8.043  13.190  1.00 0.56  ? 134 MET A HA   1 
ATOM   1878 H HB2  . MET A 1 122 ? -5.040  -8.482  11.621  1.00 0.61  ? 134 MET A HB2  1 
ATOM   1879 H HB3  . MET A 1 122 ? -4.286  -10.067 11.815  1.00 0.57  ? 134 MET A HB3  1 
ATOM   1880 H HG2  . MET A 1 122 ? -4.162  -9.716  14.251  1.00 0.66  ? 134 MET A HG2  1 
ATOM   1881 H HG3  . MET A 1 122 ? -4.923  -8.136  14.066  1.00 0.69  ? 134 MET A HG3  1 
ATOM   1882 H HE1  . MET A 1 122 ? -4.865  -11.640 14.091  1.00 1.24  ? 134 MET A HE1  1 
ATOM   1883 H HE2  . MET A 1 122 ? -6.085  -11.597 15.361  1.00 1.47  ? 134 MET A HE2  1 
ATOM   1884 H HE3  . MET A 1 122 ? -6.465  -12.311 13.788  1.00 1.49  ? 134 MET A HE3  1 
ATOM   1885 N N    . ALA A 1 123 ? -1.455  -10.221 12.734  1.00 0.68  ? 135 ALA A N    1 
ATOM   1886 C CA   . ALA A 1 123 ? -0.417  -11.243 12.420  1.00 0.68  ? 135 ALA A CA   1 
ATOM   1887 C C    . ALA A 1 123 ? -1.040  -12.641 12.457  1.00 0.66  ? 135 ALA A C    1 
ATOM   1888 O O    . ALA A 1 123 ? -1.365  -13.163 13.507  1.00 0.71  ? 135 ALA A O    1 
ATOM   1889 C CB   . ALA A 1 123 ? 0.710   -11.156 13.451  1.00 0.70  ? 135 ALA A CB   1 
ATOM   1890 H H    . ALA A 1 123 ? -1.789  -10.130 13.646  1.00 0.90  ? 135 ALA A H    1 
ATOM   1891 H HA   . ALA A 1 123 ? -0.016  -11.055 11.435  1.00 0.70  ? 135 ALA A HA   1 
ATOM   1892 H HB1  . ALA A 1 123 ? 0.684   -10.189 13.932  1.00 1.39  ? 135 ALA A HB1  1 
ATOM   1893 H HB2  . ALA A 1 123 ? 0.580   -11.930 14.193  1.00 1.12  ? 135 ALA A HB2  1 
ATOM   1894 H HB3  . ALA A 1 123 ? 1.661   -11.286 12.957  1.00 1.14  ? 135 ALA A HB3  1 
ATOM   1895 N N    . ALA A 1 124 ? -1.204  -13.246 11.312  1.00 0.62  ? 136 ALA A N    1 
ATOM   1896 C CA   . ALA A 1 124 ? -1.802  -14.611 11.245  1.00 0.63  ? 136 ALA A CA   1 
ATOM   1897 C C    . ALA A 1 124 ? -0.696  -15.674 11.263  1.00 0.68  ? 136 ALA A C    1 
ATOM   1898 O O    . ALA A 1 124 ? -0.884  -16.778 10.790  1.00 1.25  ? 136 ALA A O    1 
ATOM   1899 C CB   . ALA A 1 124 ? -2.598  -14.748 9.942   1.00 0.66  ? 136 ALA A CB   1 
ATOM   1900 H H    . ALA A 1 124 ? -0.932  -12.797 10.490  1.00 0.63  ? 136 ALA A H    1 
ATOM   1901 H HA   . ALA A 1 124 ? -2.462  -14.759 12.087  1.00 0.65  ? 136 ALA A HA   1 
ATOM   1902 H HB1  . ALA A 1 124 ? -2.241  -14.023 9.224   1.00 1.20  ? 136 ALA A HB1  1 
ATOM   1903 H HB2  . ALA A 1 124 ? -2.466  -15.743 9.542   1.00 1.27  ? 136 ALA A HB2  1 
ATOM   1904 H HB3  . ALA A 1 124 ? -3.645  -14.575 10.137  1.00 1.15  ? 136 ALA A HB3  1 
ATOM   1905 N N    . ASP A 1 125 ? 0.454   -15.361 11.798  1.00 1.07  ? 137 ASP A N    1 
ATOM   1906 C CA   . ASP A 1 125 ? 1.552   -16.367 11.830  1.00 1.19  ? 137 ASP A CA   1 
ATOM   1907 C C    . ASP A 1 125 ? 1.702   -16.926 13.247  1.00 0.99  ? 137 ASP A C    1 
ATOM   1908 O O    . ASP A 1 125 ? 1.407   -18.076 13.505  1.00 1.00  ? 137 ASP A O    1 
ATOM   1909 C CB   . ASP A 1 125 ? 2.863   -15.706 11.400  1.00 1.55  ? 137 ASP A CB   1 
ATOM   1910 C CG   . ASP A 1 125 ? 3.648   -16.665 10.504  1.00 2.00  ? 137 ASP A CG   1 
ATOM   1911 O OD1  . ASP A 1 125 ? 3.390   -17.855 10.575  1.00 2.59  ? 137 ASP A OD1  1 
ATOM   1912 O OD2  . ASP A 1 125 ? 4.493   -16.193 9.761   1.00 2.31  ? 137 ASP A OD2  1 
ATOM   1913 H H    . ASP A 1 125 ? 0.597   -14.470 12.174  1.00 1.65  ? 137 ASP A H    1 
ATOM   1914 H HA   . ASP A 1 125 ? 1.319   -17.174 11.151  1.00 1.44  ? 137 ASP A HA   1 
ATOM   1915 H HB2  . ASP A 1 125 ? 2.645   -14.798 10.855  1.00 1.90  ? 137 ASP A HB2  1 
ATOM   1916 H HB3  . ASP A 1 125 ? 3.452   -15.469 12.273  1.00 1.65  ? 137 ASP A HB3  1 
ATOM   1917 N N    . CYS A 1 126 ? 2.160   -16.123 14.169  1.00 1.51  ? 138 CYS A N    1 
ATOM   1918 C CA   . CYS A 1 126 ? 2.328   -16.615 15.566  1.00 1.71  ? 138 CYS A CA   1 
ATOM   1919 C C    . CYS A 1 126 ? 1.252   -15.996 16.460  1.00 1.35  ? 138 CYS A C    1 
ATOM   1920 O O    . CYS A 1 126 ? 1.484   -15.710 17.618  1.00 1.76  ? 138 CYS A O    1 
ATOM   1921 C CB   . CYS A 1 126 ? 3.712   -16.215 16.083  1.00 2.62  ? 138 CYS A CB   1 
ATOM   1922 S SG   . CYS A 1 126 ? 4.906   -17.511 15.672  1.00 3.69  ? 138 CYS A SG   1 
ATOM   1923 H H    . CYS A 1 126 ? 2.395   -15.199 13.943  1.00 1.99  ? 138 CYS A H    1 
ATOM   1924 H HA   . CYS A 1 126 ? 2.235   -17.690 15.583  1.00 2.01  ? 138 CYS A HA   1 
ATOM   1925 H HB2  . CYS A 1 126 ? 4.015   -15.287 15.621  1.00 2.87  ? 138 CYS A HB2  1 
ATOM   1926 H HB3  . CYS A 1 126 ? 3.673   -16.088 17.155  1.00 2.83  ? 138 CYS A HB3  1 
ATOM   1927 H HG   . CYS A 1 126 ? 4.419   -18.270 15.342  1.00 3.97  ? 138 CYS A HG   1 
ATOM   1928 N N    . LYS A 1 127 ? 0.077   -15.788 15.931  1.00 1.22  ? 139 LYS A N    1 
ATOM   1929 C CA   . LYS A 1 127 ? -1.015  -15.188 16.749  1.00 2.02  ? 139 LYS A CA   1 
ATOM   1930 C C    . LYS A 1 127 ? -0.530  -13.874 17.358  1.00 1.40  ? 139 LYS A C    1 
ATOM   1931 O O    . LYS A 1 127 ? -0.305  -13.771 18.547  1.00 1.46  ? 139 LYS A O    1 
ATOM   1932 C CB   . LYS A 1 127 ? -1.410  -16.156 17.863  1.00 3.15  ? 139 LYS A CB   1 
ATOM   1933 C CG   . LYS A 1 127 ? -2.329  -17.233 17.286  1.00 4.30  ? 139 LYS A CG   1 
ATOM   1934 C CD   . LYS A 1 127 ? -3.640  -17.270 18.075  1.00 5.20  ? 139 LYS A CD   1 
ATOM   1935 C CE   . LYS A 1 127 ? -4.741  -16.579 17.268  1.00 5.92  ? 139 LYS A CE   1 
ATOM   1936 N NZ   . LYS A 1 127 ? -4.784  -15.132 17.623  1.00 6.90  ? 139 LYS A NZ   1 
ATOM   1937 H H    . LYS A 1 127 ? -0.088  -16.027 14.995  1.00 1.02  ? 139 LYS A H    1 
ATOM   1938 H HA   . LYS A 1 127 ? -1.872  -14.997 16.119  1.00 2.70  ? 139 LYS A HA   1 
ATOM   1939 H HB2  . LYS A 1 127 ? -0.523  -16.616 18.272  1.00 3.34  ? 139 LYS A HB2  1 
ATOM   1940 H HB3  . LYS A 1 127 ? -1.930  -15.618 18.641  1.00 3.36  ? 139 LYS A HB3  1 
ATOM   1941 H HG2  . LYS A 1 127 ? -2.538  -17.007 16.250  1.00 4.42  ? 139 LYS A HG2  1 
ATOM   1942 H HG3  . LYS A 1 127 ? -1.842  -18.193 17.354  1.00 4.72  ? 139 LYS A HG3  1 
ATOM   1943 H HD2  . LYS A 1 127 ? -3.919  -18.297 18.259  1.00 5.51  ? 139 LYS A HD2  1 
ATOM   1944 H HD3  . LYS A 1 127 ? -3.510  -16.757 19.016  1.00 5.41  ? 139 LYS A HD3  1 
ATOM   1945 H HE2  . LYS A 1 127 ? -4.536  -16.685 16.213  1.00 5.93  ? 139 LYS A HE2  1 
ATOM   1946 H HE3  . LYS A 1 127 ? -5.694  -17.034 17.497  1.00 6.07  ? 139 LYS A HE3  1 
ATOM   1947 H HZ1  . LYS A 1 127 ? -4.918  -15.031 18.650  1.00 7.03  ? 139 LYS A HZ1  1 
ATOM   1948 H HZ2  . LYS A 1 127 ? -3.891  -14.680 17.342  1.00 7.57  ? 139 LYS A HZ2  1 
ATOM   1949 H HZ3  . LYS A 1 127 ? -5.573  -14.676 17.123  1.00 7.03  ? 139 LYS A HZ3  1 
ATOM   1950 N N    . GLN A 1 128 ? -0.366  -12.868 16.547  1.00 0.95  ? 140 GLN A N    1 
ATOM   1951 C CA   . GLN A 1 128 ? 0.106   -11.554 17.070  1.00 0.83  ? 140 GLN A CA   1 
ATOM   1952 C C    . GLN A 1 128 ? -0.620  -10.431 16.327  1.00 0.74  ? 140 GLN A C    1 
ATOM   1953 O O    . GLN A 1 128 ? -1.675  -10.641 15.767  1.00 0.85  ? 140 GLN A O    1 
ATOM   1954 C CB   . GLN A 1 128 ? 1.616   -11.432 16.843  1.00 1.25  ? 140 GLN A CB   1 
ATOM   1955 C CG   . GLN A 1 128 ? 2.299   -11.040 18.155  1.00 1.89  ? 140 GLN A CG   1 
ATOM   1956 C CD   . GLN A 1 128 ? 3.814   -11.187 18.005  1.00 2.48  ? 140 GLN A CD   1 
ATOM   1957 O OE1  . GLN A 1 128 ? 4.396   -10.679 17.067  1.00 2.81  ? 140 GLN A OE1  1 
ATOM   1958 N NE2  . GLN A 1 128 ? 4.484   -11.865 18.897  1.00 3.19  ? 140 GLN A NE2  1 
ATOM   1959 H H    . GLN A 1 128 ? -0.554  -12.978 15.590  1.00 0.96  ? 140 GLN A H    1 
ATOM   1960 H HA   . GLN A 1 128 ? -0.108  -11.487 18.126  1.00 1.08  ? 140 GLN A HA   1 
ATOM   1961 H HB2  . GLN A 1 128 ? 2.006   -12.380 16.502  1.00 1.66  ? 140 GLN A HB2  1 
ATOM   1962 H HB3  . GLN A 1 128 ? 1.808   -10.674 16.099  1.00 1.56  ? 140 GLN A HB3  1 
ATOM   1963 H HG2  . GLN A 1 128 ? 2.057   -10.014 18.394  1.00 2.18  ? 140 GLN A HG2  1 
ATOM   1964 H HG3  . GLN A 1 128 ? 1.954   -11.686 18.948  1.00 2.35  ? 140 GLN A HG3  1 
ATOM   1965 H HE21 . GLN A 1 128 ? 4.015   -12.275 19.654  1.00 3.51  ? 140 GLN A HE21 1 
ATOM   1966 H HE22 . GLN A 1 128 ? 5.455   -11.965 18.810  1.00 3.66  ? 140 GLN A HE22 1 
ATOM   1967 N N    . ILE A 1 129 ? -0.067  -9.245  16.316  1.00 0.73  ? 141 ILE A N    1 
ATOM   1968 C CA   . ILE A 1 129 ? -0.731  -8.113  15.604  1.00 0.65  ? 141 ILE A CA   1 
ATOM   1969 C C    . ILE A 1 129 ? 0.327   -7.078  15.208  1.00 0.65  ? 141 ILE A C    1 
ATOM   1970 O O    . ILE A 1 129 ? 0.795   -6.317  16.029  1.00 0.77  ? 141 ILE A O    1 
ATOM   1971 C CB   . ILE A 1 129 ? -1.778  -7.460  16.522  1.00 0.68  ? 141 ILE A CB   1 
ATOM   1972 C CG1  . ILE A 1 129 ? -2.951  -8.432  16.708  1.00 1.02  ? 141 ILE A CG1  1 
ATOM   1973 C CG2  . ILE A 1 129 ? -2.284  -6.149  15.899  1.00 0.81  ? 141 ILE A CG2  1 
ATOM   1974 C CD1  . ILE A 1 129 ? -4.204  -7.672  17.150  1.00 1.05  ? 141 ILE A CD1  1 
ATOM   1975 H H    . ILE A 1 129 ? 0.786   -9.098  16.775  1.00 0.90  ? 141 ILE A H    1 
ATOM   1976 H HA   . ILE A 1 129 ? -1.217  -8.486  14.714  1.00 0.63  ? 141 ILE A HA   1 
ATOM   1977 H HB   . ILE A 1 129 ? -1.331  -7.250  17.482  1.00 0.94  ? 141 ILE A HB   1 
ATOM   1978 H HG12 . ILE A 1 129 ? -3.150  -8.934  15.773  1.00 1.48  ? 141 ILE A HG12 1 
ATOM   1979 H HG13 . ILE A 1 129 ? -2.695  -9.164  17.459  1.00 1.59  ? 141 ILE A HG13 1 
ATOM   1980 H HG21 . ILE A 1 129 ? -1.449  -5.500  15.681  1.00 1.14  ? 141 ILE A HG21 1 
ATOM   1981 H HG22 . ILE A 1 129 ? -2.816  -6.366  14.985  1.00 1.50  ? 141 ILE A HG22 1 
ATOM   1982 H HG23 . ILE A 1 129 ? -2.946  -5.650  16.591  1.00 1.42  ? 141 ILE A HG23 1 
ATOM   1983 H HD11 . ILE A 1 129 ? -3.932  -6.925  17.881  1.00 1.51  ? 141 ILE A HD11 1 
ATOM   1984 H HD12 . ILE A 1 129 ? -4.654  -7.192  16.294  1.00 1.31  ? 141 ILE A HD12 1 
ATOM   1985 H HD13 . ILE A 1 129 ? -4.908  -8.364  17.587  1.00 1.74  ? 141 ILE A HD13 1 
ATOM   1986 N N    . ILE A 1 130 ? 0.702   -7.042  13.956  1.00 0.68  ? 142 ILE A N    1 
ATOM   1987 C CA   . ILE A 1 130 ? 1.722   -6.054  13.511  1.00 0.68  ? 142 ILE A CA   1 
ATOM   1988 C C    . ILE A 1 130 ? 1.141   -4.648  13.638  1.00 0.65  ? 142 ILE A C    1 
ATOM   1989 O O    . ILE A 1 130 ? 0.496   -4.133  12.738  1.00 0.63  ? 142 ILE A O    1 
ATOM   1990 C CB   . ILE A 1 130 ? 2.127   -6.324  12.056  1.00 0.73  ? 142 ILE A CB   1 
ATOM   1991 C CG1  . ILE A 1 130 ? 2.937   -7.629  11.999  1.00 0.77  ? 142 ILE A CG1  1 
ATOM   1992 C CG2  . ILE A 1 130 ? 2.959   -5.151  11.521  1.00 0.77  ? 142 ILE A CG2  1 
ATOM   1993 C CD1  . ILE A 1 130 ? 4.355   -7.367  11.481  1.00 0.71  ? 142 ILE A CD1  1 
ATOM   1994 H H    . ILE A 1 130 ? 0.312   -7.659  13.315  1.00 0.81  ? 142 ILE A H    1 
ATOM   1995 H HA   . ILE A 1 130 ? 2.594   -6.135  14.145  1.00 0.72  ? 142 ILE A HA   1 
ATOM   1996 H HB   . ILE A 1 130 ? 1.244   -6.426  11.452  1.00 0.78  ? 142 ILE A HB   1 
ATOM   1997 H HG12 . ILE A 1 130 ? 2.993   -8.055  12.990  1.00 0.92  ? 142 ILE A HG12 1 
ATOM   1998 H HG13 . ILE A 1 130 ? 2.441   -8.326  11.340  1.00 0.83  ? 142 ILE A HG13 1 
ATOM   1999 H HG21 . ILE A 1 130 ? 3.827   -5.007  12.143  1.00 1.24  ? 142 ILE A HG21 1 
ATOM   2000 H HG22 . ILE A 1 130 ? 3.268   -5.358  10.508  1.00 1.12  ? 142 ILE A HG22 1 
ATOM   2001 H HG23 . ILE A 1 130 ? 2.361   -4.252  11.529  1.00 1.32  ? 142 ILE A HG23 1 
ATOM   2002 H HD11 . ILE A 1 130 ? 4.850   -6.655  12.122  1.00 1.26  ? 142 ILE A HD11 1 
ATOM   2003 H HD12 . ILE A 1 130 ? 4.910   -8.292  11.480  1.00 1.02  ? 142 ILE A HD12 1 
ATOM   2004 H HD13 . ILE A 1 130 ? 4.308   -6.978  10.475  1.00 1.33  ? 142 ILE A HD13 1 
ATOM   2005 N N    . ALA A 1 131 ? 1.378   -4.033  14.758  1.00 0.69  ? 143 ALA A N    1 
ATOM   2006 C CA   . ALA A 1 131 ? 0.870   -2.654  15.001  1.00 0.70  ? 143 ALA A CA   1 
ATOM   2007 C C    . ALA A 1 131 ? -0.658  -2.624  14.985  1.00 0.64  ? 143 ALA A C    1 
ATOM   2008 O O    . ALA A 1 131 ? -1.292  -2.998  14.019  1.00 0.85  ? 143 ALA A O    1 
ATOM   2009 C CB   . ALA A 1 131 ? 1.407   -1.719  13.917  1.00 0.72  ? 143 ALA A CB   1 
ATOM   2010 H H    . ALA A 1 131 ? 1.901   -4.486  15.449  1.00 0.74  ? 143 ALA A H    1 
ATOM   2011 H HA   . ALA A 1 131 ? 1.218   -2.315  15.964  1.00 0.77  ? 143 ALA A HA   1 
ATOM   2012 H HB1  . ALA A 1 131 ? 2.384   -2.055  13.603  1.00 1.38  ? 143 ALA A HB1  1 
ATOM   2013 H HB2  . ALA A 1 131 ? 0.735   -1.726  13.071  1.00 1.19  ? 143 ALA A HB2  1 
ATOM   2014 H HB3  . ALA A 1 131 ? 1.480   -0.716  14.310  1.00 1.09  ? 143 ALA A HB3  1 
ATOM   2015 N N    . ASN A 1 132 ? -1.251  -2.166  16.052  1.00 0.62  ? 144 ASN A N    1 
ATOM   2016 C CA   . ASN A 1 132 ? -2.736  -2.091  16.110  1.00 0.64  ? 144 ASN A CA   1 
ATOM   2017 C C    . ASN A 1 132 ? -3.205  -0.722  15.588  1.00 0.67  ? 144 ASN A C    1 
ATOM   2018 O O    . ASN A 1 132 ? -4.388  -0.454  15.515  1.00 0.97  ? 144 ASN A O    1 
ATOM   2019 C CB   . ASN A 1 132 ? -3.198  -2.270  17.558  1.00 0.72  ? 144 ASN A CB   1 
ATOM   2020 C CG   . ASN A 1 132 ? -4.642  -2.774  17.577  1.00 1.26  ? 144 ASN A CG   1 
ATOM   2021 O OD1  . ASN A 1 132 ? -5.453  -2.359  16.773  1.00 2.09  ? 144 ASN A OD1  1 
ATOM   2022 N ND2  . ASN A 1 132 ? -5.000  -3.658  18.467  1.00 1.82  ? 144 ASN A ND2  1 
ATOM   2023 H H    . ASN A 1 132 ? -0.717  -1.861  16.815  1.00 0.77  ? 144 ASN A H    1 
ATOM   2024 H HA   . ASN A 1 132 ? -3.159  -2.874  15.498  1.00 0.68  ? 144 ASN A HA   1 
ATOM   2025 H HB2  . ASN A 1 132 ? -2.559  -2.987  18.053  1.00 1.21  ? 144 ASN A HB2  1 
ATOM   2026 H HB3  . ASN A 1 132 ? -3.143  -1.323  18.073  1.00 1.11  ? 144 ASN A HB3  1 
ATOM   2027 H HD21 . ASN A 1 132 ? -4.346  -3.993  19.116  1.00 2.13  ? 144 ASN A HD21 1 
ATOM   2028 H HD22 . ASN A 1 132 ? -5.923  -3.988  18.487  1.00 2.37  ? 144 ASN A HD22 1 
ATOM   2029 N N    . HIS A 1 133 ? -2.292  0.151   15.226  1.00 0.70  ? 145 HIS A N    1 
ATOM   2030 C CA   . HIS A 1 133 ? -2.699  1.490   14.716  1.00 0.75  ? 145 HIS A CA   1 
ATOM   2031 C C    . HIS A 1 133 ? -1.566  2.074   13.866  1.00 0.71  ? 145 HIS A C    1 
ATOM   2032 O O    . HIS A 1 133 ? -1.117  3.180   14.090  1.00 1.01  ? 145 HIS A O    1 
ATOM   2033 C CB   . HIS A 1 133 ? -2.983  2.417   15.900  1.00 0.91  ? 145 HIS A CB   1 
ATOM   2034 C CG   . HIS A 1 133 ? -2.170  1.977   17.086  1.00 1.52  ? 145 HIS A CG   1 
ATOM   2035 N ND1  . HIS A 1 133 ? -2.714  1.866   18.356  1.00 2.24  ? 145 HIS A ND1  1 
ATOM   2036 C CD2  . HIS A 1 133 ? -0.851  1.614   17.210  1.00 2.45  ? 145 HIS A CD2  1 
ATOM   2037 C CE1  . HIS A 1 133 ? -1.736  1.452   19.182  1.00 3.02  ? 145 HIS A CE1  1 
ATOM   2038 N NE2  . HIS A 1 133 ? -0.580  1.283   18.534  1.00 3.22  ? 145 HIS A NE2  1 
ATOM   2039 H H    . HIS A 1 133 ? -1.342  -0.071  15.289  1.00 0.91  ? 145 HIS A H    1 
ATOM   2040 H HA   . HIS A 1 133 ? -3.589  1.393   14.113  1.00 0.80  ? 145 HIS A HA   1 
ATOM   2041 H HB2  . HIS A 1 133 ? -2.717  3.431   15.636  1.00 1.28  ? 145 HIS A HB2  1 
ATOM   2042 H HB3  . HIS A 1 133 ? -4.033  2.373   16.148  1.00 1.41  ? 145 HIS A HB3  1 
ATOM   2043 H HD1  . HIS A 1 133 ? -3.643  2.055   18.606  1.00 2.58  ? 145 HIS A HD1  1 
ATOM   2044 H HD2  . HIS A 1 133 ? -0.134  1.589   16.403  1.00 2.92  ? 145 HIS A HD2  1 
ATOM   2045 H HE1  . HIS A 1 133 ? -1.869  1.277   20.239  1.00 3.75  ? 145 HIS A HE1  1 
ATOM   2046 N N    . HIS A 1 134 ? -1.100  1.339   12.891  1.00 0.74  ? 146 HIS A N    1 
ATOM   2047 C CA   . HIS A 1 134 ? 0.004   1.853   12.028  1.00 0.67  ? 146 HIS A CA   1 
ATOM   2048 C C    . HIS A 1 134 ? -0.532  2.968   11.124  1.00 0.73  ? 146 HIS A C    1 
ATOM   2049 O O    . HIS A 1 134 ? -0.979  2.723   10.021  1.00 1.31  ? 146 HIS A O    1 
ATOM   2050 C CB   . HIS A 1 134 ? 0.551   0.712   11.160  1.00 0.61  ? 146 HIS A CB   1 
ATOM   2051 C CG   . HIS A 1 134 ? 2.010   0.490   11.465  1.00 0.68  ? 146 HIS A CG   1 
ATOM   2052 N ND1  . HIS A 1 134 ? 2.860   1.533   11.800  1.00 0.93  ? 146 HIS A ND1  1 
ATOM   2053 C CD2  . HIS A 1 134 ? 2.785   -0.648  11.487  1.00 0.74  ? 146 HIS A CD2  1 
ATOM   2054 C CE1  . HIS A 1 134 ? 4.083   1.009   12.007  1.00 1.13  ? 146 HIS A CE1  1 
ATOM   2055 N NE2  . HIS A 1 134 ? 4.092   -0.314  11.829  1.00 1.02  ? 146 HIS A NE2  1 
ATOM   2056 H H    . HIS A 1 134 ? -1.475  0.448   12.727  1.00 1.03  ? 146 HIS A H    1 
ATOM   2057 H HA   . HIS A 1 134 ? 0.795   2.243   12.651  1.00 0.71  ? 146 HIS A HA   1 
ATOM   2058 H HB2  . HIS A 1 134 ? 0.000   -0.192  11.368  1.00 0.61  ? 146 HIS A HB2  1 
ATOM   2059 H HB3  . HIS A 1 134 ? 0.438   0.969   10.118  1.00 0.77  ? 146 HIS A HB3  1 
ATOM   2060 H HD1  . HIS A 1 134 ? 2.616   2.479   11.872  1.00 1.03  ? 146 HIS A HD1  1 
ATOM   2061 H HD2  . HIS A 1 134 ? 2.435   -1.650  11.274  1.00 0.70  ? 146 HIS A HD2  1 
ATOM   2062 H HE1  . HIS A 1 134 ? 4.951   1.590   12.283  1.00 1.40  ? 146 HIS A HE1  1 
ATOM   2063 N N    . MET A 1 135 ? -0.490  4.192   11.581  1.00 0.57  ? 147 MET A N    1 
ATOM   2064 C CA   . MET A 1 135 ? -0.997  5.319   10.745  1.00 0.58  ? 147 MET A CA   1 
ATOM   2065 C C    . MET A 1 135 ? -0.577  6.651   11.373  1.00 0.69  ? 147 MET A C    1 
ATOM   2066 O O    . MET A 1 135 ? -1.395  7.415   11.845  1.00 1.70  ? 147 MET A O    1 
ATOM   2067 C CB   . MET A 1 135 ? -2.526  5.251   10.661  1.00 0.60  ? 147 MET A CB   1 
ATOM   2068 C CG   . MET A 1 135 ? -2.983  5.658   9.257   1.00 0.96  ? 147 MET A CG   1 
ATOM   2069 S SD   . MET A 1 135 ? -4.050  4.367   8.570   1.00 1.39  ? 147 MET A SD   1 
ATOM   2070 C CE   . MET A 1 135 ? -3.278  4.280   6.936   1.00 0.55  ? 147 MET A CE   1 
ATOM   2071 H H    . MET A 1 135 ? -0.125  4.369   12.473  1.00 0.92  ? 147 MET A H    1 
ATOM   2072 H HA   . MET A 1 135 ? -0.578  5.245   9.753   1.00 0.55  ? 147 MET A HA   1 
ATOM   2073 H HB2  . MET A 1 135 ? -2.852  4.243   10.868  1.00 0.82  ? 147 MET A HB2  1 
ATOM   2074 H HB3  . MET A 1 135 ? -2.961  5.923   11.386  1.00 0.68  ? 147 MET A HB3  1 
ATOM   2075 H HG2  . MET A 1 135 ? -3.532  6.586   9.313   1.00 1.67  ? 147 MET A HG2  1 
ATOM   2076 H HG3  . MET A 1 135 ? -2.120  5.788   8.621   1.00 1.48  ? 147 MET A HG3  1 
ATOM   2077 H HE1  . MET A 1 135 ? -3.266  5.265   6.492   1.00 0.96  ? 147 MET A HE1  1 
ATOM   2078 H HE2  . MET A 1 135 ? -2.266  3.912   7.036   1.00 1.10  ? 147 MET A HE2  1 
ATOM   2079 H HE3  . MET A 1 135 ? -3.840  3.610   6.305   1.00 0.95  ? 147 MET A HE3  1 
ATOM   2080 N N    . GLN A 1 136 ? 0.695   6.935   11.382  1.00 0.65  ? 148 GLN A N    1 
ATOM   2081 C CA   . GLN A 1 136 ? 1.166   8.218   11.979  1.00 0.61  ? 148 GLN A CA   1 
ATOM   2082 C C    . GLN A 1 136 ? 2.546   8.572   11.422  1.00 0.52  ? 148 GLN A C    1 
ATOM   2083 O O    . GLN A 1 136 ? 2.823   9.712   11.118  1.00 0.62  ? 148 GLN A O    1 
ATOM   2084 C CB   . GLN A 1 136 ? 1.253   8.072   13.500  1.00 0.69  ? 148 GLN A CB   1 
ATOM   2085 C CG   . GLN A 1 136 ? -0.133  8.276   14.113  1.00 1.03  ? 148 GLN A CG   1 
ATOM   2086 C CD   . GLN A 1 136 ? 0.012   8.720   15.570  1.00 1.49  ? 148 GLN A CD   1 
ATOM   2087 O OE1  . GLN A 1 136 ? 0.632   9.726   15.851  1.00 1.95  ? 148 GLN A OE1  1 
ATOM   2088 N NE2  . GLN A 1 136 ? -0.538  8.006   16.514  1.00 1.99  ? 148 GLN A NE2  1 
ATOM   2089 H H    . GLN A 1 136 ? 1.340   6.307   10.996  1.00 1.44  ? 148 GLN A H    1 
ATOM   2090 H HA   . GLN A 1 136 ? 0.466   9.007   11.732  1.00 0.62  ? 148 GLN A HA   1 
ATOM   2091 H HB2  . GLN A 1 136 ? 1.615   7.084   13.746  1.00 0.91  ? 148 GLN A HB2  1 
ATOM   2092 H HB3  . GLN A 1 136 ? 1.932   8.813   13.895  1.00 0.87  ? 148 GLN A HB3  1 
ATOM   2093 H HG2  . GLN A 1 136 ? -0.665  9.033   13.555  1.00 1.21  ? 148 GLN A HG2  1 
ATOM   2094 H HG3  . GLN A 1 136 ? -0.684  7.348   14.074  1.00 1.15  ? 148 GLN A HG3  1 
ATOM   2095 H HE21 . GLN A 1 136 ? -1.038  7.195   16.286  1.00 2.38  ? 148 GLN A HE21 1 
ATOM   2096 H HE22 . GLN A 1 136 ? -0.450  8.282   17.450  1.00 2.29  ? 148 GLN A HE22 1 
ATOM   2097 N N    . SER A 1 137 ? 3.419   7.612   11.282  1.00 0.61  ? 149 SER A N    1 
ATOM   2098 C CA   . SER A 1 137 ? 4.771   7.923   10.740  1.00 0.58  ? 149 SER A CA   1 
ATOM   2099 C C    . SER A 1 137 ? 4.853   7.449   9.283   1.00 0.57  ? 149 SER A C    1 
ATOM   2100 O O    . SER A 1 137 ? 4.575   8.202   8.370   1.00 0.60  ? 149 SER A O    1 
ATOM   2101 C CB   . SER A 1 137 ? 5.841   7.227   11.584  1.00 0.63  ? 149 SER A CB   1 
ATOM   2102 O OG   . SER A 1 137 ? 6.039   7.956   12.788  1.00 0.98  ? 149 SER A OG   1 
ATOM   2103 H H    . SER A 1 137 ? 3.188   6.694   11.530  1.00 0.81  ? 149 SER A H    1 
ATOM   2104 H HA   . SER A 1 137 ? 4.929   8.992   10.774  1.00 0.57  ? 149 SER A HA   1 
ATOM   2105 H HB2  . SER A 1 137 ? 5.518   6.228   11.824  1.00 0.72  ? 149 SER A HB2  1 
ATOM   2106 H HB3  . SER A 1 137 ? 6.765   7.179   11.022  1.00 0.79  ? 149 SER A HB3  1 
ATOM   2107 H HG   . SER A 1 137 ? 6.788   7.571   13.248  1.00 1.48  ? 149 SER A HG   1 
ATOM   2108 N N    . ILE A 1 138 ? 5.228   6.211   9.056   1.00 0.56  ? 150 ILE A N    1 
ATOM   2109 C CA   . ILE A 1 138 ? 5.324   5.695   7.659   1.00 0.57  ? 150 ILE A CA   1 
ATOM   2110 C C    . ILE A 1 138 ? 6.162   6.668   6.814   1.00 0.61  ? 150 ILE A C    1 
ATOM   2111 O O    . ILE A 1 138 ? 6.995   7.383   7.335   1.00 0.84  ? 150 ILE A O    1 
ATOM   2112 C CB   . ILE A 1 138 ? 3.915   5.540   7.068   1.00 0.54  ? 150 ILE A CB   1 
ATOM   2113 C CG1  . ILE A 1 138 ? 2.905   5.313   8.200   1.00 0.46  ? 150 ILE A CG1  1 
ATOM   2114 C CG2  . ILE A 1 138 ? 3.882   4.335   6.118   1.00 0.70  ? 150 ILE A CG2  1 
ATOM   2115 C CD1  . ILE A 1 138 ? 1.742   4.457   7.689   1.00 0.47  ? 150 ILE A CD1  1 
ATOM   2116 H H    . ILE A 1 138 ? 5.444   5.618   9.805   1.00 0.58  ? 150 ILE A H    1 
ATOM   2117 H HA   . ILE A 1 138 ? 5.811   4.734   7.677   1.00 0.59  ? 150 ILE A HA   1 
ATOM   2118 H HB   . ILE A 1 138 ? 3.653   6.435   6.522   1.00 0.59  ? 150 ILE A HB   1 
ATOM   2119 H HG12 . ILE A 1 138 ? 3.389   4.802   9.019   1.00 0.53  ? 150 ILE A HG12 1 
ATOM   2120 H HG13 . ILE A 1 138 ? 2.526   6.264   8.541   1.00 0.68  ? 150 ILE A HG13 1 
ATOM   2121 H HG21 . ILE A 1 138 ? 4.801   4.291   5.555   1.00 0.93  ? 150 ILE A HG21 1 
ATOM   2122 H HG22 . ILE A 1 138 ? 3.770   3.426   6.691   1.00 1.32  ? 150 ILE A HG22 1 
ATOM   2123 H HG23 . ILE A 1 138 ? 3.048   4.436   5.438   1.00 1.20  ? 150 ILE A HG23 1 
ATOM   2124 H HD11 . ILE A 1 138 ? 1.480   4.766   6.689   1.00 1.23  ? 150 ILE A HD11 1 
ATOM   2125 H HD12 . ILE A 1 138 ? 2.038   3.418   7.679   1.00 1.05  ? 150 ILE A HD12 1 
ATOM   2126 H HD13 . ILE A 1 138 ? 0.890   4.582   8.341   1.00 1.12  ? 150 ILE A HD13 1 
ATOM   2127 N N    . SER A 1 139 ? 5.961   6.709   5.521   1.00 0.57  ? 151 SER A N    1 
ATOM   2128 C CA   . SER A 1 139 ? 6.763   7.645   4.681   1.00 0.60  ? 151 SER A CA   1 
ATOM   2129 C C    . SER A 1 139 ? 6.290   7.570   3.229   1.00 0.57  ? 151 SER A C    1 
ATOM   2130 O O    . SER A 1 139 ? 5.973   8.571   2.618   1.00 0.69  ? 151 SER A O    1 
ATOM   2131 C CB   . SER A 1 139 ? 8.240   7.259   4.757   1.00 0.66  ? 151 SER A CB   1 
ATOM   2132 O OG   . SER A 1 139 ? 8.358   5.961   5.324   1.00 0.82  ? 151 SER A OG   1 
ATOM   2133 H H    . SER A 1 139 ? 5.291   6.132   5.105   1.00 0.66  ? 151 SER A H    1 
ATOM   2134 H HA   . SER A 1 139 ? 6.636   8.652   5.047   1.00 0.63  ? 151 SER A HA   1 
ATOM   2135 H HB2  . SER A 1 139 ? 8.665   7.253   3.767   1.00 0.82  ? 151 SER A HB2  1 
ATOM   2136 H HB3  . SER A 1 139 ? 8.768   7.979   5.369   1.00 0.83  ? 151 SER A HB3  1 
ATOM   2137 H HG   . SER A 1 139 ? 9.245   5.871   5.680   1.00 1.00  ? 151 SER A HG   1 
ATOM   2138 N N    . PHE A 1 140 ? 6.239   6.393   2.671   1.00 0.53  ? 152 PHE A N    1 
ATOM   2139 C CA   . PHE A 1 140 ? 5.785   6.261   1.257   1.00 0.51  ? 152 PHE A CA   1 
ATOM   2140 C C    . PHE A 1 140 ? 4.942   4.993   1.123   1.00 0.48  ? 152 PHE A C    1 
ATOM   2141 O O    . PHE A 1 140 ? 5.246   3.975   1.708   1.00 0.73  ? 152 PHE A O    1 
ATOM   2142 C CB   . PHE A 1 140 ? 7.008   6.171   0.334   1.00 0.57  ? 152 PHE A CB   1 
ATOM   2143 C CG   . PHE A 1 140 ? 6.728   6.876   -0.975  1.00 0.66  ? 152 PHE A CG   1 
ATOM   2144 C CD1  . PHE A 1 140 ? 6.224   8.182   -0.978  1.00 1.30  ? 152 PHE A CD1  1 
ATOM   2145 C CD2  . PHE A 1 140 ? 6.978   6.222   -2.188  1.00 1.42  ? 152 PHE A CD2  1 
ATOM   2146 C CE1  . PHE A 1 140 ? 5.968   8.833   -2.190  1.00 1.41  ? 152 PHE A CE1  1 
ATOM   2147 C CE2  . PHE A 1 140 ? 6.723   6.874   -3.401  1.00 1.56  ? 152 PHE A CE2  1 
ATOM   2148 C CZ   . PHE A 1 140 ? 6.218   8.179   -3.402  1.00 1.07  ? 152 PHE A CZ   1 
ATOM   2149 H H    . PHE A 1 140 ? 6.499   5.595   3.181   1.00 0.61  ? 152 PHE A H    1 
ATOM   2150 H HA   . PHE A 1 140 ? 5.188   7.119   0.990   1.00 0.50  ? 152 PHE A HA   1 
ATOM   2151 H HB2  . PHE A 1 140 ? 7.855   6.636   0.817   1.00 0.71  ? 152 PHE A HB2  1 
ATOM   2152 H HB3  . PHE A 1 140 ? 7.233   5.133   0.140   1.00 0.57  ? 152 PHE A HB3  1 
ATOM   2153 H HD1  . PHE A 1 140 ? 6.029   8.686   -0.044  1.00 2.08  ? 152 PHE A HD1  1 
ATOM   2154 H HD2  . PHE A 1 140 ? 7.366   5.214   -2.188  1.00 2.19  ? 152 PHE A HD2  1 
ATOM   2155 H HE1  . PHE A 1 140 ? 5.579   9.840   -2.191  1.00 2.18  ? 152 PHE A HE1  1 
ATOM   2156 H HE2  . PHE A 1 140 ? 6.915   6.370   -4.336  1.00 2.37  ? 152 PHE A HE2  1 
ATOM   2157 H HZ   . PHE A 1 140 ? 6.022   8.682   -4.337  1.00 1.26  ? 152 PHE A HZ   1 
ATOM   2158 N N    . ALA A 1 141 ? 3.883   5.043   0.366   1.00 0.42  ? 153 ALA A N    1 
ATOM   2159 C CA   . ALA A 1 141 ? 3.031   3.832   0.212   1.00 0.38  ? 153 ALA A CA   1 
ATOM   2160 C C    . ALA A 1 141 ? 2.496   3.757   -1.219  1.00 0.38  ? 153 ALA A C    1 
ATOM   2161 O O    . ALA A 1 141 ? 2.167   4.758   -1.820  1.00 0.42  ? 153 ALA A O    1 
ATOM   2162 C CB   . ALA A 1 141 ? 1.861   3.914   1.192   1.00 0.35  ? 153 ALA A CB   1 
ATOM   2163 H H    . ALA A 1 141 ? 3.647   5.874   -0.098  1.00 0.60  ? 153 ALA A H    1 
ATOM   2164 H HA   . ALA A 1 141 ? 3.617   2.951   0.424   1.00 0.41  ? 153 ALA A HA   1 
ATOM   2165 H HB1  . ALA A 1 141 ? 1.482   4.925   1.216   1.00 1.02  ? 153 ALA A HB1  1 
ATOM   2166 H HB2  . ALA A 1 141 ? 1.077   3.243   0.874   1.00 1.07  ? 153 ALA A HB2  1 
ATOM   2167 H HB3  . ALA A 1 141 ? 2.198   3.633   2.179   1.00 0.98  ? 153 ALA A HB3  1 
ATOM   2168 N N    . SER A 1 142 ? 2.407   2.575   -1.766  1.00 0.39  ? 154 SER A N    1 
ATOM   2169 C CA   . SER A 1 142 ? 1.893   2.429   -3.157  1.00 0.42  ? 154 SER A CA   1 
ATOM   2170 C C    . SER A 1 142 ? 1.828   0.944   -3.523  1.00 0.44  ? 154 SER A C    1 
ATOM   2171 O O    . SER A 1 142 ? 2.034   0.079   -2.694  1.00 0.48  ? 154 SER A O    1 
ATOM   2172 C CB   . SER A 1 142 ? 2.829   3.148   -4.130  1.00 0.49  ? 154 SER A CB   1 
ATOM   2173 O OG   . SER A 1 142 ? 4.094   2.499   -4.130  1.00 0.59  ? 154 SER A OG   1 
ATOM   2174 H H    . SER A 1 142 ? 2.678   1.781   -1.259  1.00 0.41  ? 154 SER A H    1 
ATOM   2175 H HA   . SER A 1 142 ? 0.904   2.860   -3.223  1.00 0.40  ? 154 SER A HA   1 
ATOM   2176 H HB2  . SER A 1 142 ? 2.413   3.114   -5.123  1.00 0.51  ? 154 SER A HB2  1 
ATOM   2177 H HB3  . SER A 1 142 ? 2.942   4.180   -3.825  1.00 0.59  ? 154 SER A HB3  1 
ATOM   2178 H HG   . SER A 1 142 ? 4.367   2.381   -5.042  1.00 1.03  ? 154 SER A HG   1 
ATOM   2179 N N    . GLY A 1 143 ? 1.544   0.642   -4.760  1.00 0.57  ? 155 GLY A N    1 
ATOM   2180 C CA   . GLY A 1 143 ? 1.466   -0.785  -5.180  1.00 0.62  ? 155 GLY A CA   1 
ATOM   2181 C C    . GLY A 1 143 ? 0.367   -0.949  -6.231  1.00 0.48  ? 155 GLY A C    1 
ATOM   2182 O O    . GLY A 1 143 ? -0.637  -1.592  -5.997  1.00 1.08  ? 155 GLY A O    1 
ATOM   2183 H H    . GLY A 1 143 ? 1.382   1.355   -5.413  1.00 0.71  ? 155 GLY A H    1 
ATOM   2184 H HA2  . GLY A 1 143 ? 2.416   -1.089  -5.598  1.00 0.76  ? 155 GLY A HA2  1 
ATOM   2185 H HA3  . GLY A 1 143 ? 1.235   -1.400  -4.324  1.00 0.89  ? 155 GLY A HA3  1 
ATOM   2186 N N    . GLY A 1 144 ? 0.548   -0.372  -7.387  1.00 0.66  ? 156 GLY A N    1 
ATOM   2187 C CA   . GLY A 1 144 ? -0.488  -0.495  -8.452  1.00 0.53  ? 156 GLY A CA   1 
ATOM   2188 C C    . GLY A 1 144 ? 0.162   -0.979  -9.749  1.00 0.76  ? 156 GLY A C    1 
ATOM   2189 O O    . GLY A 1 144 ? 0.659   -2.084  -9.831  1.00 1.20  ? 156 GLY A O    1 
ATOM   2190 H H    . GLY A 1 144 ? 1.365   0.143   -7.556  1.00 1.25  ? 156 GLY A H    1 
ATOM   2191 H HA2  . GLY A 1 144 ? -1.241  -1.204  -8.139  1.00 0.73  ? 156 GLY A HA2  1 
ATOM   2192 H HA3  . GLY A 1 144 ? -0.946  0.467   -8.620  1.00 0.71  ? 156 GLY A HA3  1 
ATOM   2193 N N    . ASP A 1 145 ? 0.160   -0.159  -10.765 1.00 1.29  ? 157 ASP A N    1 
ATOM   2194 C CA   . ASP A 1 145 ? 0.775   -0.570  -12.059 1.00 1.85  ? 157 ASP A CA   1 
ATOM   2195 C C    . ASP A 1 145 ? 2.305   -0.643  -11.924 1.00 1.21  ? 157 ASP A C    1 
ATOM   2196 O O    . ASP A 1 145 ? 2.885   -1.682  -12.171 1.00 1.24  ? 157 ASP A O    1 
ATOM   2197 C CB   . ASP A 1 145 ? 0.393   0.430   -13.154 1.00 2.82  ? 157 ASP A CB   1 
ATOM   2198 C CG   . ASP A 1 145 ? -0.699  -0.173  -14.039 1.00 3.83  ? 157 ASP A CG   1 
ATOM   2199 O OD1  . ASP A 1 145 ? -0.450  -1.212  -14.628 1.00 4.28  ? 157 ASP A OD1  1 
ATOM   2200 O OD2  . ASP A 1 145 ? -1.766  0.415   -14.113 1.00 4.46  ? 157 ASP A OD2  1 
ATOM   2201 H H    . ASP A 1 145 ? -0.248  0.728   -10.677 1.00 1.60  ? 157 ASP A H    1 
ATOM   2202 H HA   . ASP A 1 145 ? 0.402   -1.547  -12.329 1.00 2.30  ? 157 ASP A HA   1 
ATOM   2203 H HB2  . ASP A 1 145 ? 0.028   1.339   -12.699 1.00 2.87  ? 157 ASP A HB2  1 
ATOM   2204 H HB3  . ASP A 1 145 ? 1.260   0.653   -13.757 1.00 3.06  ? 157 ASP A HB3  1 
ATOM   2205 N N    . PRO A 1 146 ? 2.928   0.452   -11.540 1.00 0.92  ? 158 PRO A N    1 
ATOM   2206 C CA   . PRO A 1 146 ? 4.386   0.507   -11.378 1.00 0.80  ? 158 PRO A CA   1 
ATOM   2207 C C    . PRO A 1 146 ? 4.802   -0.227  -10.099 1.00 0.95  ? 158 PRO A C    1 
ATOM   2208 O O    . PRO A 1 146 ? 4.017   -0.929  -9.499  1.00 1.16  ? 158 PRO A O    1 
ATOM   2209 C CB   . PRO A 1 146 ? 4.739   1.986   -11.281 1.00 1.20  ? 158 PRO A CB   1 
ATOM   2210 C CG   . PRO A 1 146 ? 3.435   2.619   -10.739 1.00 1.41  ? 158 PRO A CG   1 
ATOM   2211 C CD   . PRO A 1 146 ? 2.257   1.740   -11.230 1.00 1.24  ? 158 PRO A CD   1 
ATOM   2212 H HA   . PRO A 1 146 ? 4.873   0.070   -12.235 1.00 0.80  ? 158 PRO A HA   1 
ATOM   2213 H HB2  . PRO A 1 146 ? 5.561   2.138   -10.593 1.00 1.28  ? 158 PRO A HB2  1 
ATOM   2214 H HB3  . PRO A 1 146 ? 4.969   2.390   -12.253 1.00 1.38  ? 158 PRO A HB3  1 
ATOM   2215 H HG2  . PRO A 1 146 ? 3.459   2.637   -9.658  1.00 1.95  ? 158 PRO A HG2  1 
ATOM   2216 H HG3  . PRO A 1 146 ? 3.325   3.621   -11.123 1.00 1.54  ? 158 PRO A HG3  1 
ATOM   2217 H HD2  . PRO A 1 146 ? 1.526   1.625   -10.444 1.00 1.80  ? 158 PRO A HD2  1 
ATOM   2218 H HD3  . PRO A 1 146 ? 1.812   2.160   -12.117 1.00 1.15  ? 158 PRO A HD3  1 
ATOM   2219 N N    . ASP A 1 147 ? 6.036   -0.063  -9.690  1.00 1.09  ? 159 ASP A N    1 
ATOM   2220 C CA   . ASP A 1 147 ? 6.540   -0.736  -8.454  1.00 1.33  ? 159 ASP A CA   1 
ATOM   2221 C C    . ASP A 1 147 ? 6.628   -2.249  -8.690  1.00 1.17  ? 159 ASP A C    1 
ATOM   2222 O O    . ASP A 1 147 ? 7.670   -2.769  -9.036  1.00 1.42  ? 159 ASP A O    1 
ATOM   2223 C CB   . ASP A 1 147 ? 5.608   -0.435  -7.273  1.00 1.53  ? 159 ASP A CB   1 
ATOM   2224 C CG   . ASP A 1 147 ? 6.329   0.472   -6.275  1.00 2.02  ? 159 ASP A CG   1 
ATOM   2225 O OD1  . ASP A 1 147 ? 6.780   1.529   -6.684  1.00 2.56  ? 159 ASP A OD1  1 
ATOM   2226 O OD2  . ASP A 1 147 ? 6.418   0.094   -5.118  1.00 2.42  ? 159 ASP A OD2  1 
ATOM   2227 H H    . ASP A 1 147 ? 6.639   0.509   -10.201 1.00 1.21  ? 159 ASP A H    1 
ATOM   2228 H HA   . ASP A 1 147 ? 7.527   -0.360  -8.229  1.00 1.64  ? 159 ASP A HA   1 
ATOM   2229 H HB2  . ASP A 1 147 ? 4.718   0.060   -7.630  1.00 1.44  ? 159 ASP A HB2  1 
ATOM   2230 H HB3  . ASP A 1 147 ? 5.336   -1.357  -6.783  1.00 1.74  ? 159 ASP A HB3  1 
ATOM   2231 N N    . THR A 1 148 ? 5.549   -2.960  -8.511  1.00 0.93  ? 160 THR A N    1 
ATOM   2232 C CA   . THR A 1 148 ? 5.579   -4.433  -8.729  1.00 0.96  ? 160 THR A CA   1 
ATOM   2233 C C    . THR A 1 148 ? 4.549   -4.814  -9.798  1.00 0.94  ? 160 THR A C    1 
ATOM   2234 O O    . THR A 1 148 ? 4.627   -5.868  -10.397 1.00 1.53  ? 160 THR A O    1 
ATOM   2235 C CB   . THR A 1 148 ? 5.242   -5.149  -7.420  1.00 1.04  ? 160 THR A CB   1 
ATOM   2236 O OG1  . THR A 1 148 ? 4.052   -4.597  -6.874  1.00 1.36  ? 160 THR A OG1  1 
ATOM   2237 C CG2  . THR A 1 148 ? 6.392   -4.970  -6.429  1.00 1.21  ? 160 THR A CG2  1 
ATOM   2238 H H    . THR A 1 148 ? 4.718   -2.528  -8.236  1.00 0.90  ? 160 THR A H    1 
ATOM   2239 H HA   . THR A 1 148 ? 6.564   -4.728  -9.058  1.00 1.15  ? 160 THR A HA   1 
ATOM   2240 H HB   . THR A 1 148 ? 5.097   -6.201  -7.611  1.00 1.19  ? 160 THR A HB   1 
ATOM   2241 H HG1  . THR A 1 148 ? 4.275   -3.759  -6.461  1.00 1.86  ? 160 THR A HG1  1 
ATOM   2242 H HG21 . THR A 1 148 ? 7.014   -4.145  -6.744  1.00 1.78  ? 160 THR A HG21 1 
ATOM   2243 H HG22 . THR A 1 148 ? 5.992   -4.764  -5.446  1.00 1.63  ? 160 THR A HG22 1 
ATOM   2244 H HG23 . THR A 1 148 ? 6.982   -5.874  -6.395  1.00 1.54  ? 160 THR A HG23 1 
ATOM   2245 N N    . ALA A 1 149 ? 3.581   -3.968  -10.044 1.00 0.54  ? 161 ALA A N    1 
ATOM   2246 C CA   . ALA A 1 149 ? 2.557   -4.285  -11.066 1.00 0.71  ? 161 ALA A CA   1 
ATOM   2247 C C    . ALA A 1 149 ? 1.814   -5.563  -10.669 1.00 0.77  ? 161 ALA A C    1 
ATOM   2248 O O    . ALA A 1 149 ? 1.352   -6.310  -11.509 1.00 1.22  ? 161 ALA A O    1 
ATOM   2249 C CB   . ALA A 1 149 ? 3.232   -4.481  -12.425 1.00 0.96  ? 161 ALA A CB   1 
ATOM   2250 H H    . ALA A 1 149 ? 3.525   -3.123  -9.557  1.00 0.62  ? 161 ALA A H    1 
ATOM   2251 H HA   . ALA A 1 149 ? 1.862   -3.465  -11.124 1.00 0.78  ? 161 ALA A HA   1 
ATOM   2252 H HB1  . ALA A 1 149 ? 4.301   -4.378  -12.314 1.00 1.26  ? 161 ALA A HB1  1 
ATOM   2253 H HB2  . ALA A 1 149 ? 3.003   -5.467  -12.802 1.00 1.38  ? 161 ALA A HB2  1 
ATOM   2254 H HB3  . ALA A 1 149 ? 2.869   -3.737  -13.118 1.00 1.57  ? 161 ALA A HB3  1 
ATOM   2255 N N    . GLU A 1 150 ? 1.696   -5.821  -9.395  1.00 0.51  ? 162 GLU A N    1 
ATOM   2256 C CA   . GLU A 1 150 ? 0.983   -7.049  -8.946  1.00 0.57  ? 162 GLU A CA   1 
ATOM   2257 C C    . GLU A 1 150 ? 0.990   -7.116  -7.416  1.00 0.54  ? 162 GLU A C    1 
ATOM   2258 O O    . GLU A 1 150 ? -0.028  -7.337  -6.792  1.00 0.66  ? 162 GLU A O    1 
ATOM   2259 C CB   . GLU A 1 150 ? 1.686   -8.283  -9.514  1.00 0.61  ? 162 GLU A CB   1 
ATOM   2260 C CG   . GLU A 1 150 ? 0.640   -9.272  -10.033 1.00 0.81  ? 162 GLU A CG   1 
ATOM   2261 C CD   . GLU A 1 150 ? 1.285   -10.211 -11.054 1.00 1.08  ? 162 GLU A CD   1 
ATOM   2262 O OE1  . GLU A 1 150 ? 2.060   -11.058 -10.643 1.00 1.47  ? 162 GLU A OE1  1 
ATOM   2263 O OE2  . GLU A 1 150 ? 0.993   -10.066 -12.230 1.00 1.81  ? 162 GLU A OE2  1 
ATOM   2264 H H    . GLU A 1 150 ? 2.077   -5.206  -8.733  1.00 0.59  ? 162 GLU A H    1 
ATOM   2265 H HA   . GLU A 1 150 ? -0.037  -7.022  -9.300  1.00 0.66  ? 162 GLU A HA   1 
ATOM   2266 H HB2  . GLU A 1 150 ? 2.336   -7.986  -10.325 1.00 0.81  ? 162 GLU A HB2  1 
ATOM   2267 H HB3  . GLU A 1 150 ? 2.271   -8.755  -8.739  1.00 0.68  ? 162 GLU A HB3  1 
ATOM   2268 H HG2  . GLU A 1 150 ? 0.250   -9.849  -9.207  1.00 1.14  ? 162 GLU A HG2  1 
ATOM   2269 H HG3  . GLU A 1 150 ? -0.165  -8.729  -10.505 1.00 1.23  ? 162 GLU A HG3  1 
ATOM   2270 N N    . TYR A 1 151 ? 2.129   -6.926  -6.807  1.00 0.45  ? 163 TYR A N    1 
ATOM   2271 C CA   . TYR A 1 151 ? 2.193   -6.979  -5.318  1.00 0.47  ? 163 TYR A CA   1 
ATOM   2272 C C    . TYR A 1 151 ? 2.002   -5.573  -4.747  1.00 0.45  ? 163 TYR A C    1 
ATOM   2273 O O    . TYR A 1 151 ? 1.725   -4.632  -5.464  1.00 0.57  ? 163 TYR A O    1 
ATOM   2274 C CB   . TYR A 1 151 ? 3.557   -7.519  -4.878  1.00 0.53  ? 163 TYR A CB   1 
ATOM   2275 C CG   . TYR A 1 151 ? 4.063   -8.520  -5.889  1.00 0.49  ? 163 TYR A CG   1 
ATOM   2276 C CD1  . TYR A 1 151 ? 3.222   -9.542  -6.344  1.00 1.21  ? 163 TYR A CD1  1 
ATOM   2277 C CD2  . TYR A 1 151 ? 5.375   -8.429  -6.367  1.00 1.27  ? 163 TYR A CD2  1 
ATOM   2278 C CE1  . TYR A 1 151 ? 3.693   -10.473 -7.278  1.00 1.21  ? 163 TYR A CE1  1 
ATOM   2279 C CE2  . TYR A 1 151 ? 5.847   -9.359  -7.301  1.00 1.28  ? 163 TYR A CE2  1 
ATOM   2280 C CZ   . TYR A 1 151 ? 5.006   -10.381 -7.756  1.00 0.52  ? 163 TYR A CZ   1 
ATOM   2281 O OH   . TYR A 1 151 ? 5.471   -11.298 -8.677  1.00 0.58  ? 163 TYR A OH   1 
ATOM   2282 H H    . TYR A 1 151 ? 2.940   -6.749  -7.327  1.00 0.44  ? 163 TYR A H    1 
ATOM   2283 H HA   . TYR A 1 151 ? 1.413   -7.628  -4.947  1.00 0.50  ? 163 TYR A HA   1 
ATOM   2284 H HB2  . TYR A 1 151 ? 4.259   -6.701  -4.802  1.00 0.58  ? 163 TYR A HB2  1 
ATOM   2285 H HB3  . TYR A 1 151 ? 3.460   -7.999  -3.916  1.00 0.62  ? 163 TYR A HB3  1 
ATOM   2286 H HD1  . TYR A 1 151 ? 2.209   -9.613  -5.975  1.00 2.06  ? 163 TYR A HD1  1 
ATOM   2287 H HD2  . TYR A 1 151 ? 6.024   -7.640  -6.015  1.00 2.11  ? 163 TYR A HD2  1 
ATOM   2288 H HE1  . TYR A 1 151 ? 3.045   -11.261 -7.630  1.00 2.05  ? 163 TYR A HE1  1 
ATOM   2289 H HE2  . TYR A 1 151 ? 6.860   -9.288  -7.669  1.00 2.13  ? 163 TYR A HE2  1 
ATOM   2290 H HH   . TYR A 1 151 ? 6.330   -11.000 -8.985  1.00 1.06  ? 163 TYR A HH   1 
ATOM   2291 N N    . VAL A 1 152 ? 2.151   -5.424  -3.459  1.00 0.38  ? 164 VAL A N    1 
ATOM   2292 C CA   . VAL A 1 152 ? 1.982   -4.080  -2.837  1.00 0.37  ? 164 VAL A CA   1 
ATOM   2293 C C    . VAL A 1 152 ? 3.258   -3.720  -2.071  1.00 0.38  ? 164 VAL A C    1 
ATOM   2294 O O    . VAL A 1 152 ? 3.847   -4.551  -1.407  1.00 0.49  ? 164 VAL A O    1 
ATOM   2295 C CB   . VAL A 1 152 ? 0.796   -4.107  -1.869  1.00 0.38  ? 164 VAL A CB   1 
ATOM   2296 C CG1  . VAL A 1 152 ? -0.509  -3.905  -2.645  1.00 0.39  ? 164 VAL A CG1  1 
ATOM   2297 C CG2  . VAL A 1 152 ? 0.755   -5.457  -1.151  1.00 0.45  ? 164 VAL A CG2  1 
ATOM   2298 H H    . VAL A 1 152 ? 2.377   -6.197  -2.901  1.00 0.42  ? 164 VAL A H    1 
ATOM   2299 H HA   . VAL A 1 152 ? 1.804   -3.344  -3.608  1.00 0.38  ? 164 VAL A HA   1 
ATOM   2300 H HB   . VAL A 1 152 ? 0.907   -3.314  -1.143  1.00 0.40  ? 164 VAL A HB   1 
ATOM   2301 H HG11 . VAL A 1 152 ? -0.345  -3.205  -3.451  1.00 1.08  ? 164 VAL A HG11 1 
ATOM   2302 H HG12 . VAL A 1 152 ? -0.837  -4.851  -3.050  1.00 1.11  ? 164 VAL A HG12 1 
ATOM   2303 H HG13 . VAL A 1 152 ? -1.267  -3.517  -1.980  1.00 1.08  ? 164 VAL A HG13 1 
ATOM   2304 H HG21 . VAL A 1 152 ? 1.759   -5.839  -1.045  1.00 1.17  ? 164 VAL A HG21 1 
ATOM   2305 H HG22 . VAL A 1 152 ? 0.313   -5.332  -0.174  1.00 1.01  ? 164 VAL A HG22 1 
ATOM   2306 H HG23 . VAL A 1 152 ? 0.164   -6.154  -1.727  1.00 1.13  ? 164 VAL A HG23 1 
ATOM   2307 N N    . ALA A 1 153 ? 3.693   -2.491  -2.153  1.00 0.35  ? 165 ALA A N    1 
ATOM   2308 C CA   . ALA A 1 153 ? 4.932   -2.095  -1.423  1.00 0.37  ? 165 ALA A CA   1 
ATOM   2309 C C    . ALA A 1 153 ? 4.710   -0.759  -0.719  1.00 0.35  ? 165 ALA A C    1 
ATOM   2310 O O    . ALA A 1 153 ? 4.238   0.193   -1.309  1.00 0.44  ? 165 ALA A O    1 
ATOM   2311 C CB   . ALA A 1 153 ? 6.093   -1.953  -2.409  1.00 0.43  ? 165 ALA A CB   1 
ATOM   2312 H H    . ALA A 1 153 ? 3.207   -1.830  -2.692  1.00 0.40  ? 165 ALA A H    1 
ATOM   2313 H HA   . ALA A 1 153 ? 5.173   -2.851  -0.691  1.00 0.39  ? 165 ALA A HA   1 
ATOM   2314 H HB1  . ALA A 1 153 ? 5.977   -2.667  -3.210  1.00 1.12  ? 165 ALA A HB1  1 
ATOM   2315 H HB2  . ALA A 1 153 ? 6.099   -0.952  -2.816  1.00 1.09  ? 165 ALA A HB2  1 
ATOM   2316 H HB3  . ALA A 1 153 ? 7.026   -2.137  -1.895  1.00 1.10  ? 165 ALA A HB3  1 
ATOM   2317 N N    . TYR A 1 154 ? 5.051   -0.676  0.536   1.00 0.33  ? 166 TYR A N    1 
ATOM   2318 C CA   . TYR A 1 154 ? 4.863   0.606   1.270   1.00 0.34  ? 166 TYR A CA   1 
ATOM   2319 C C    . TYR A 1 154 ? 5.991   0.781   2.289   1.00 0.38  ? 166 TYR A C    1 
ATOM   2320 O O    . TYR A 1 154 ? 6.110   0.040   3.244   1.00 0.41  ? 166 TYR A O    1 
ATOM   2321 C CB   . TYR A 1 154 ? 3.496   0.615   1.974   1.00 0.35  ? 166 TYR A CB   1 
ATOM   2322 C CG   . TYR A 1 154 ? 3.462   -0.416  3.079   1.00 0.37  ? 166 TYR A CG   1 
ATOM   2323 C CD1  . TYR A 1 154 ? 3.549   -1.779  2.775   1.00 1.25  ? 166 TYR A CD1  1 
ATOM   2324 C CD2  . TYR A 1 154 ? 3.343   -0.003  4.412   1.00 1.27  ? 166 TYR A CD2  1 
ATOM   2325 C CE1  . TYR A 1 154 ? 3.518   -2.728  3.803   1.00 1.28  ? 166 TYR A CE1  1 
ATOM   2326 C CE2  . TYR A 1 154 ? 3.312   -0.952  5.440   1.00 1.35  ? 166 TYR A CE2  1 
ATOM   2327 C CZ   . TYR A 1 154 ? 3.399   -2.315  5.135   1.00 0.63  ? 166 TYR A CZ   1 
ATOM   2328 O OH   . TYR A 1 154 ? 3.369   -3.252  6.148   1.00 0.79  ? 166 TYR A OH   1 
ATOM   2329 H H    . TYR A 1 154 ? 5.436   -1.456  0.994   1.00 0.39  ? 166 TYR A H    1 
ATOM   2330 H HA   . TYR A 1 154 ? 4.900   1.424   0.565   1.00 0.35  ? 166 TYR A HA   1 
ATOM   2331 H HB2  . TYR A 1 154 ? 3.320   1.593   2.396   1.00 0.37  ? 166 TYR A HB2  1 
ATOM   2332 H HB3  . TYR A 1 154 ? 2.722   0.393   1.255   1.00 0.43  ? 166 TYR A HB3  1 
ATOM   2333 H HD1  . TYR A 1 154 ? 3.641   -2.099  1.748   1.00 2.14  ? 166 TYR A HD1  1 
ATOM   2334 H HD2  . TYR A 1 154 ? 3.276   1.049   4.647   1.00 2.15  ? 166 TYR A HD2  1 
ATOM   2335 H HE1  . TYR A 1 154 ? 3.586   -3.780  3.569   1.00 2.15  ? 166 TYR A HE1  1 
ATOM   2336 H HE2  . TYR A 1 154 ? 3.220   -0.634  6.467   1.00 2.24  ? 166 TYR A HE2  1 
ATOM   2337 H HH   . TYR A 1 154 ? 3.545   -2.800  6.977   1.00 1.04  ? 166 TYR A HH   1 
ATOM   2338 N N    . VAL A 1 155 ? 6.828   1.759   2.095   1.00 0.41  ? 167 VAL A N    1 
ATOM   2339 C CA   . VAL A 1 155 ? 7.939   1.972   3.057   1.00 0.47  ? 167 VAL A CA   1 
ATOM   2340 C C    . VAL A 1 155 ? 7.367   2.613   4.323   1.00 0.51  ? 167 VAL A C    1 
ATOM   2341 O O    . VAL A 1 155 ? 6.733   3.653   4.283   1.00 0.53  ? 167 VAL A O    1 
ATOM   2342 C CB   . VAL A 1 155 ? 9.016   2.857   2.415   1.00 0.50  ? 167 VAL A CB   1 
ATOM   2343 C CG1  . VAL A 1 155 ? 9.207   2.428   0.957   1.00 0.44  ? 167 VAL A CG1  1 
ATOM   2344 C CG2  . VAL A 1 155 ? 8.593   4.329   2.456   1.00 0.61  ? 167 VAL A CG2  1 
ATOM   2345 H H    . VAL A 1 155 ? 6.725   2.352   1.321   1.00 0.42  ? 167 VAL A H    1 
ATOM   2346 H HA   . VAL A 1 155 ? 8.368   1.016   3.314   1.00 0.49  ? 167 VAL A HA   1 
ATOM   2347 H HB   . VAL A 1 155 ? 9.947   2.732   2.950   1.00 0.57  ? 167 VAL A HB   1 
ATOM   2348 H HG11 . VAL A 1 155 ? 8.765   1.454   0.807   1.00 1.08  ? 167 VAL A HG11 1 
ATOM   2349 H HG12 . VAL A 1 155 ? 8.728   3.143   0.305   1.00 1.18  ? 167 VAL A HG12 1 
ATOM   2350 H HG13 . VAL A 1 155 ? 10.261  2.383   0.729   1.00 0.92  ? 167 VAL A HG13 1 
ATOM   2351 H HG21 . VAL A 1 155 ? 7.614   4.434   2.014   1.00 1.11  ? 167 VAL A HG21 1 
ATOM   2352 H HG22 . VAL A 1 155 ? 8.564   4.668   3.481   1.00 1.21  ? 167 VAL A HG22 1 
ATOM   2353 H HG23 . VAL A 1 155 ? 9.304   4.924   1.901   1.00 1.20  ? 167 VAL A HG23 1 
ATOM   2354 N N    . ALA A 1 156 ? 7.570   1.988   5.451   1.00 0.57  ? 168 ALA A N    1 
ATOM   2355 C CA   . ALA A 1 156 ? 7.025   2.549   6.715   1.00 0.66  ? 168 ALA A CA   1 
ATOM   2356 C C    . ALA A 1 156 ? 8.150   3.168   7.547   1.00 0.48  ? 168 ALA A C    1 
ATOM   2357 O O    . ALA A 1 156 ? 9.286   3.249   7.120   1.00 0.44  ? 168 ALA A O    1 
ATOM   2358 C CB   . ALA A 1 156 ? 6.358   1.431   7.519   1.00 0.92  ? 168 ALA A CB   1 
ATOM   2359 H H    . ALA A 1 156 ? 8.070   1.145   5.462   1.00 0.59  ? 168 ALA A H    1 
ATOM   2360 H HA   . ALA A 1 156 ? 6.291   3.303   6.480   1.00 0.80  ? 168 ALA A HA   1 
ATOM   2361 H HB1  . ALA A 1 156 ? 6.479   0.492   7.000   1.00 1.39  ? 168 ALA A HB1  1 
ATOM   2362 H HB2  . ALA A 1 156 ? 6.819   1.365   8.494   1.00 1.42  ? 168 ALA A HB2  1 
ATOM   2363 H HB3  . ALA A 1 156 ? 5.306   1.648   7.633   1.00 1.42  ? 168 ALA A HB3  1 
ATOM   2364 N N    . LYS A 1 157 ? 7.834   3.603   8.737   1.00 0.56  ? 169 LYS A N    1 
ATOM   2365 C CA   . LYS A 1 157 ? 8.864   4.219   9.619   1.00 0.52  ? 169 LYS A CA   1 
ATOM   2366 C C    . LYS A 1 157 ? 8.243   4.479   10.992  1.00 0.59  ? 169 LYS A C    1 
ATOM   2367 O O    . LYS A 1 157 ? 7.077   4.804   11.098  1.00 0.59  ? 169 LYS A O    1 
ATOM   2368 C CB   . LYS A 1 157 ? 9.333   5.543   9.013   1.00 0.56  ? 169 LYS A CB   1 
ATOM   2369 C CG   . LYS A 1 157 ? 10.662  5.333   8.286   1.00 0.62  ? 169 LYS A CG   1 
ATOM   2370 C CD   . LYS A 1 157 ? 11.740  6.206   8.930   1.00 1.02  ? 169 LYS A CD   1 
ATOM   2371 C CE   . LYS A 1 157 ? 11.467  7.676   8.609   1.00 1.02  ? 169 LYS A CE   1 
ATOM   2372 N NZ   . LYS A 1 157 ? 11.290  8.438   9.877   1.00 1.44  ? 169 LYS A NZ   1 
ATOM   2373 H H    . LYS A 1 157 ? 6.909   3.522   9.053   1.00 0.75  ? 169 LYS A H    1 
ATOM   2374 H HA   . LYS A 1 157 ? 9.704   3.547   9.720   1.00 0.60  ? 169 LYS A HA   1 
ATOM   2375 H HB2  . LYS A 1 157 ? 8.591   5.901   8.314   1.00 0.67  ? 169 LYS A HB2  1 
ATOM   2376 H HB3  . LYS A 1 157 ? 9.467   6.271   9.800   1.00 0.66  ? 169 LYS A HB3  1 
ATOM   2377 H HG2  . LYS A 1 157 ? 10.949  4.294   8.355   1.00 1.00  ? 169 LYS A HG2  1 
ATOM   2378 H HG3  . LYS A 1 157 ? 10.552  5.608   7.248   1.00 1.03  ? 169 LYS A HG3  1 
ATOM   2379 H HD2  . LYS A 1 157 ? 11.726  6.062   10.001  1.00 1.72  ? 169 LYS A HD2  1 
ATOM   2380 H HD3  . LYS A 1 157 ? 12.708  5.928   8.542   1.00 1.65  ? 169 LYS A HD3  1 
ATOM   2381 H HE2  . LYS A 1 157 ? 12.301  8.085   8.057   1.00 1.53  ? 169 LYS A HE2  1 
ATOM   2382 H HE3  . LYS A 1 157 ? 10.569  7.754   8.014   1.00 1.40  ? 169 LYS A HE3  1 
ATOM   2383 H HZ1  . LYS A 1 157 ? 11.842  7.984   10.634  1.00 1.81  ? 169 LYS A HZ1  1 
ATOM   2384 H HZ2  . LYS A 1 157 ? 11.621  9.414   9.745   1.00 1.90  ? 169 LYS A HZ2  1 
ATOM   2385 H HZ3  . LYS A 1 157 ? 10.284  8.448   10.139  1.00 1.90  ? 169 LYS A HZ3  1 
ATOM   2386 N N    . ASP A 1 158 ? 9.007   4.341   12.044  1.00 0.75  ? 170 ASP A N    1 
ATOM   2387 C CA   . ASP A 1 158 ? 8.447   4.582   13.406  1.00 0.89  ? 170 ASP A CA   1 
ATOM   2388 C C    . ASP A 1 158 ? 9.483   4.230   14.487  1.00 1.24  ? 170 ASP A C    1 
ATOM   2389 O O    . ASP A 1 158 ? 9.840   5.079   15.280  1.00 1.77  ? 170 ASP A O    1 
ATOM   2390 C CB   . ASP A 1 158 ? 7.183   3.740   13.608  1.00 1.39  ? 170 ASP A CB   1 
ATOM   2391 C CG   . ASP A 1 158 ? 5.986   4.662   13.852  1.00 1.78  ? 170 ASP A CG   1 
ATOM   2392 O OD1  . ASP A 1 158 ? 6.175   5.691   14.480  1.00 2.32  ? 170 ASP A OD1  1 
ATOM   2393 O OD2  . ASP A 1 158 ? 4.902   4.324   13.407  1.00 2.36  ? 170 ASP A OD2  1 
ATOM   2394 H H    . ASP A 1 158 ? 9.945   4.080   11.938  1.00 0.81  ? 170 ASP A H    1 
ATOM   2395 H HA   . ASP A 1 158 ? 8.190   5.627   13.497  1.00 0.88  ? 170 ASP A HA   1 
ATOM   2396 H HB2  . ASP A 1 158 ? 7.004   3.143   12.725  1.00 1.91  ? 170 ASP A HB2  1 
ATOM   2397 H HB3  . ASP A 1 158 ? 7.314   3.091   14.460  1.00 1.72  ? 170 ASP A HB3  1 
ATOM   2398 N N    . PRO A 1 159 ? 9.940   2.994   14.505  1.00 1.63  ? 171 PRO A N    1 
ATOM   2399 C CA   . PRO A 1 159 ? 10.926  2.542   15.495  1.00 2.27  ? 171 PRO A CA   1 
ATOM   2400 C C    . PRO A 1 159 ? 12.301  3.150   15.204  1.00 1.78  ? 171 PRO A C    1 
ATOM   2401 O O    . PRO A 1 159 ? 13.094  3.364   16.099  1.00 1.83  ? 171 PRO A O    1 
ATOM   2402 C CB   . PRO A 1 159 ? 10.976  1.023   15.377  1.00 3.10  ? 171 PRO A CB   1 
ATOM   2403 C CG   . PRO A 1 159 ? 10.493  0.769   13.930  1.00 3.15  ? 171 PRO A CG   1 
ATOM   2404 C CD   . PRO A 1 159 ? 9.532   1.926   13.557  1.00 2.12  ? 171 PRO A CD   1 
ATOM   2405 H HA   . PRO A 1 159 ? 10.604  2.816   16.488  1.00 2.78  ? 171 PRO A HA   1 
ATOM   2406 H HB2  . PRO A 1 159 ? 11.988  0.664   15.518  1.00 3.24  ? 171 PRO A HB2  1 
ATOM   2407 H HB3  . PRO A 1 159 ? 10.301  0.561   16.079  1.00 3.76  ? 171 PRO A HB3  1 
ATOM   2408 H HG2  . PRO A 1 159 ? 11.339  0.758   13.257  1.00 3.51  ? 171 PRO A HG2  1 
ATOM   2409 H HG3  . PRO A 1 159 ? 9.966   -0.171  13.877  1.00 3.81  ? 171 PRO A HG3  1 
ATOM   2410 H HD2  . PRO A 1 159 ? 9.689   2.224   12.533  1.00 2.06  ? 171 PRO A HD2  1 
ATOM   2411 H HD3  . PRO A 1 159 ? 8.506   1.642   13.726  1.00 2.24  ? 171 PRO A HD3  1 
ATOM   2412 N N    . VAL A 1 160 ? 12.594  3.433   13.965  1.00 1.63  ? 172 VAL A N    1 
ATOM   2413 C CA   . VAL A 1 160 ? 13.919  4.026   13.638  1.00 1.58  ? 172 VAL A CA   1 
ATOM   2414 C C    . VAL A 1 160 ? 13.738  5.116   12.584  1.00 1.90  ? 172 VAL A C    1 
ATOM   2415 O O    . VAL A 1 160 ? 12.660  5.316   12.061  1.00 2.71  ? 172 VAL A O    1 
ATOM   2416 C CB   . VAL A 1 160 ? 14.845  2.938   13.092  1.00 1.85  ? 172 VAL A CB   1 
ATOM   2417 C CG1  . VAL A 1 160 ? 15.270  2.008   14.230  1.00 2.15  ? 172 VAL A CG1  1 
ATOM   2418 C CG2  . VAL A 1 160 ? 14.107  2.130   12.023  1.00 2.21  ? 172 VAL A CG2  1 
ATOM   2419 H H    . VAL A 1 160 ? 11.947  3.257   13.250  1.00 1.82  ? 172 VAL A H    1 
ATOM   2420 H HA   . VAL A 1 160 ? 14.352  4.454   14.530  1.00 1.68  ? 172 VAL A HA   1 
ATOM   2421 H HB   . VAL A 1 160 ? 15.721  3.397   12.657  1.00 2.04  ? 172 VAL A HB   1 
ATOM   2422 H HG11 . VAL A 1 160 ? 15.271  2.555   15.161  1.00 2.53  ? 172 VAL A HG11 1 
ATOM   2423 H HG12 . VAL A 1 160 ? 14.577  1.183   14.298  1.00 2.32  ? 172 VAL A HG12 1 
ATOM   2424 H HG13 . VAL A 1 160 ? 16.262  1.630   14.034  1.00 2.54  ? 172 VAL A HG13 1 
ATOM   2425 H HG21 . VAL A 1 160 ? 13.371  2.757   11.541  1.00 2.42  ? 172 VAL A HG21 1 
ATOM   2426 H HG22 . VAL A 1 160 ? 14.814  1.775   11.287  1.00 2.60  ? 172 VAL A HG22 1 
ATOM   2427 H HG23 . VAL A 1 160 ? 13.614  1.287   12.485  1.00 2.55  ? 172 VAL A HG23 1 
ATOM   2428 N N    . ASN A 1 161 ? 14.786  5.823   12.265  1.00 1.76  ? 173 ASN A N    1 
ATOM   2429 C CA   . ASN A 1 161 ? 14.674  6.897   11.241  1.00 2.41  ? 173 ASN A CA   1 
ATOM   2430 C C    . ASN A 1 161 ? 15.145  6.353   9.892   1.00 1.89  ? 173 ASN A C    1 
ATOM   2431 O O    . ASN A 1 161 ? 15.767  7.049   9.114   1.00 2.28  ? 173 ASN A O    1 
ATOM   2432 C CB   . ASN A 1 161 ? 15.548  8.085   11.647  1.00 3.34  ? 173 ASN A CB   1 
ATOM   2433 C CG   . ASN A 1 161 ? 15.578  8.200   13.172  1.00 4.16  ? 173 ASN A CG   1 
ATOM   2434 O OD1  . ASN A 1 161 ? 14.556  8.395   13.799  1.00 4.61  ? 173 ASN A OD1  1 
ATOM   2435 N ND2  . ASN A 1 161 ? 16.717  8.087   13.800  1.00 4.81  ? 173 ASN A ND2  1 
ATOM   2436 H H    . ASN A 1 161 ? 15.648  5.645   12.696  1.00 1.66  ? 173 ASN A H    1 
ATOM   2437 H HA   . ASN A 1 161 ? 13.644  7.215   11.162  1.00 2.85  ? 173 ASN A HA   1 
ATOM   2438 H HB2  . ASN A 1 161 ? 16.552  7.936   11.276  1.00 3.65  ? 173 ASN A HB2  1 
ATOM   2439 H HB3  . ASN A 1 161 ? 15.139  8.992   11.228  1.00 3.58  ? 173 ASN A HB3  1 
ATOM   2440 H HD21 . ASN A 1 161 ? 17.542  7.931   13.294  1.00 4.78  ? 173 ASN A HD21 1 
ATOM   2441 H HD22 . ASN A 1 161 ? 16.747  8.159   14.777  1.00 5.53  ? 173 ASN A HD22 1 
ATOM   2442 N N    . GLN A 1 162 ? 14.855  5.112   9.608   1.00 1.17  ? 174 GLN A N    1 
ATOM   2443 C CA   . GLN A 1 162 ? 15.288  4.525   8.310   1.00 0.84  ? 174 GLN A CA   1 
ATOM   2444 C C    . GLN A 1 162 ? 14.073  3.972   7.567   1.00 0.69  ? 174 GLN A C    1 
ATOM   2445 O O    . GLN A 1 162 ? 13.459  3.012   7.989   1.00 0.81  ? 174 GLN A O    1 
ATOM   2446 C CB   . GLN A 1 162 ? 16.283  3.391   8.569   1.00 0.96  ? 174 GLN A CB   1 
ATOM   2447 C CG   . GLN A 1 162 ? 17.648  3.981   8.927   1.00 1.50  ? 174 GLN A CG   1 
ATOM   2448 C CD   . GLN A 1 162 ? 18.485  2.927   9.653   1.00 1.92  ? 174 GLN A CD   1 
ATOM   2449 O OE1  . GLN A 1 162 ? 18.236  1.744   9.527   1.00 2.28  ? 174 GLN A OE1  1 
ATOM   2450 N NE2  . GLN A 1 162 ? 19.475  3.308   10.413  1.00 2.71  ? 174 GLN A NE2  1 
ATOM   2451 H H    . GLN A 1 162 ? 14.352  4.565   10.250  1.00 1.11  ? 174 GLN A H    1 
ATOM   2452 H HA   . GLN A 1 162 ? 15.761  5.288   7.710   1.00 1.01  ? 174 GLN A HA   1 
ATOM   2453 H HB2  . GLN A 1 162 ? 15.928  2.781   9.387   1.00 1.25  ? 174 GLN A HB2  1 
ATOM   2454 H HB3  . GLN A 1 162 ? 16.377  2.785   7.681   1.00 1.21  ? 174 GLN A HB3  1 
ATOM   2455 H HG2  . GLN A 1 162 ? 18.156  4.287   8.024   1.00 1.98  ? 174 GLN A HG2  1 
ATOM   2456 H HG3  . GLN A 1 162 ? 17.513  4.837   9.572   1.00 2.04  ? 174 GLN A HG3  1 
ATOM   2457 H HE21 . GLN A 1 162 ? 19.676  4.262   10.514  1.00 3.05  ? 174 GLN A HE21 1 
ATOM   2458 H HE22 . GLN A 1 162 ? 20.017  2.640   10.882  1.00 3.25  ? 174 GLN A HE22 1 
ATOM   2459 N N    . ARG A 1 163 ? 13.721  4.569   6.462   1.00 0.63  ? 175 ARG A N    1 
ATOM   2460 C CA   . ARG A 1 163 ? 12.545  4.076   5.691   1.00 0.60  ? 175 ARG A CA   1 
ATOM   2461 C C    . ARG A 1 163 ? 12.731  2.588   5.382   1.00 0.54  ? 175 ARG A C    1 
ATOM   2462 O O    . ARG A 1 163 ? 13.760  2.171   4.880   1.00 0.65  ? 175 ARG A O    1 
ATOM   2463 C CB   . ARG A 1 163 ? 12.428  4.857   4.380   1.00 0.72  ? 175 ARG A CB   1 
ATOM   2464 C CG   . ARG A 1 163 ? 13.805  4.956   3.716   1.00 1.43  ? 175 ARG A CG   1 
ATOM   2465 C CD   . ARG A 1 163 ? 14.357  6.376   3.875   1.00 1.70  ? 175 ARG A CD   1 
ATOM   2466 N NE   . ARG A 1 163 ? 15.693  6.319   4.533   1.00 2.51  ? 175 ARG A NE   1 
ATOM   2467 C CZ   . ARG A 1 163 ? 16.353  7.420   4.771   1.00 3.18  ? 175 ARG A CZ   1 
ATOM   2468 N NH1  . ARG A 1 163 ? 15.716  8.493   5.155   1.00 3.65  ? 175 ARG A NH1  1 
ATOM   2469 N NH2  . ARG A 1 163 ? 17.649  7.448   4.626   1.00 3.88  ? 175 ARG A NH2  1 
ATOM   2470 H H    . ARG A 1 163 ? 14.230  5.341   6.140   1.00 0.76  ? 175 ARG A H    1 
ATOM   2471 H HA   . ARG A 1 163 ? 11.645  4.215   6.277   1.00 0.66  ? 175 ARG A HA   1 
ATOM   2472 H HB2  . ARG A 1 163 ? 11.746  4.344   3.717   1.00 0.99  ? 175 ARG A HB2  1 
ATOM   2473 H HB3  . ARG A 1 163 ? 12.054  5.849   4.583   1.00 0.96  ? 175 ARG A HB3  1 
ATOM   2474 H HG2  . ARG A 1 163 ? 14.480  4.253   4.183   1.00 1.89  ? 175 ARG A HG2  1 
ATOM   2475 H HG3  . ARG A 1 163 ? 13.715  4.723   2.666   1.00 2.15  ? 175 ARG A HG3  1 
ATOM   2476 H HD2  . ARG A 1 163 ? 14.456  6.835   2.902   1.00 1.80  ? 175 ARG A HD2  1 
ATOM   2477 H HD3  . ARG A 1 163 ? 13.683  6.961   4.482   1.00 2.12  ? 175 ARG A HD3  1 
ATOM   2478 H HE   . ARG A 1 163 ? 16.077  5.453   4.787   1.00 2.90  ? 175 ARG A HE   1 
ATOM   2479 H HH11 . ARG A 1 163 ? 14.723  8.472   5.267   1.00 3.62  ? 175 ARG A HH11 1 
ATOM   2480 H HH12 . ARG A 1 163 ? 16.222  9.336   5.337   1.00 4.31  ? 175 ARG A HH12 1 
ATOM   2481 H HH21 . ARG A 1 163 ? 18.138  6.626   4.333   1.00 4.00  ? 175 ARG A HH21 1 
ATOM   2482 H HH22 . ARG A 1 163 ? 18.154  8.292   4.808   1.00 4.54  ? 175 ARG A HH22 1 
ATOM   2483 N N    . ALA A 1 164 ? 11.746  1.783   5.678   1.00 0.49  ? 176 ALA A N    1 
ATOM   2484 C CA   . ALA A 1 164 ? 11.868  0.323   5.401   1.00 0.55  ? 176 ALA A CA   1 
ATOM   2485 C C    . ALA A 1 164 ? 10.819  -0.089  4.365   1.00 0.72  ? 176 ALA A C    1 
ATOM   2486 O O    . ALA A 1 164 ? 9.650   -0.217  4.670   1.00 0.81  ? 176 ALA A O    1 
ATOM   2487 C CB   . ALA A 1 164 ? 11.641  -0.463  6.695   1.00 0.63  ? 176 ALA A CB   1 
ATOM   2488 H H    . ALA A 1 164 ? 10.927  2.139   6.083   1.00 0.52  ? 176 ALA A H    1 
ATOM   2489 H HA   . ALA A 1 164 ? 12.855  0.110   5.019   1.00 0.56  ? 176 ALA A HA   1 
ATOM   2490 H HB1  . ALA A 1 164 ? 12.015  0.107   7.532   1.00 1.18  ? 176 ALA A HB1  1 
ATOM   2491 H HB2  . ALA A 1 164 ? 10.584  -0.644  6.825   1.00 1.25  ? 176 ALA A HB2  1 
ATOM   2492 H HB3  . ALA A 1 164 ? 12.164  -1.406  6.639   1.00 1.23  ? 176 ALA A HB3  1 
ATOM   2493 N N    . CYS A 1 165 ? 11.228  -0.299  3.143   1.00 0.85  ? 177 CYS A N    1 
ATOM   2494 C CA   . CYS A 1 165 ? 10.256  -0.704  2.090   1.00 1.07  ? 177 CYS A CA   1 
ATOM   2495 C C    . CYS A 1 165 ? 9.641   -2.057  2.454   1.00 0.44  ? 177 CYS A C    1 
ATOM   2496 O O    . CYS A 1 165 ? 10.318  -3.066  2.500   1.00 0.53  ? 177 CYS A O    1 
ATOM   2497 C CB   . CYS A 1 165 ? 10.980  -0.816  0.746   1.00 1.80  ? 177 CYS A CB   1 
ATOM   2498 S SG   . CYS A 1 165 ? 10.589  -2.409  -0.018  1.00 2.73  ? 177 CYS A SG   1 
ATOM   2499 H H    . CYS A 1 165 ? 12.174  -0.192  2.917   1.00 0.82  ? 177 CYS A H    1 
ATOM   2500 H HA   . CYS A 1 165 ? 9.477   0.037   2.015   1.00 1.54  ? 177 CYS A HA   1 
ATOM   2501 H HB2  . CYS A 1 165 ? 10.658  -0.016  0.096   1.00 2.28  ? 177 CYS A HB2  1 
ATOM   2502 H HB3  . CYS A 1 165 ? 12.046  -0.744  0.905   1.00 2.18  ? 177 CYS A HB3  1 
ATOM   2503 H HG   . CYS A 1 165 ? 10.021  -2.244  -0.774  1.00 3.09  ? 177 CYS A HG   1 
ATOM   2504 N N    . HIS A 1 166 ? 8.361   -2.087  2.713   1.00 0.42  ? 178 HIS A N    1 
ATOM   2505 C CA   . HIS A 1 166 ? 7.701   -3.374  3.073   1.00 1.08  ? 178 HIS A CA   1 
ATOM   2506 C C    . HIS A 1 166 ? 7.197   -4.059  1.801   1.00 0.82  ? 178 HIS A C    1 
ATOM   2507 O O    . HIS A 1 166 ? 6.442   -3.488  1.038   1.00 0.83  ? 178 HIS A O    1 
ATOM   2508 C CB   . HIS A 1 166 ? 6.515   -3.101  4.000   1.00 1.87  ? 178 HIS A CB   1 
ATOM   2509 C CG   . HIS A 1 166 ? 6.962   -3.179  5.434   1.00 2.61  ? 178 HIS A CG   1 
ATOM   2510 N ND1  . HIS A 1 166 ? 6.229   -3.852  6.399   1.00 3.40  ? 178 HIS A ND1  1 
ATOM   2511 C CD2  . HIS A 1 166 ? 8.061   -2.674  6.082   1.00 3.09  ? 178 HIS A CD2  1 
ATOM   2512 C CE1  . HIS A 1 166 ? 6.890   -3.735  7.565   1.00 4.02  ? 178 HIS A CE1  1 
ATOM   2513 N NE2  . HIS A 1 166 ? 8.014   -3.025  7.428   1.00 3.85  ? 178 HIS A NE2  1 
ATOM   2514 H H    . HIS A 1 166 ? 7.833   -1.261  2.669   1.00 0.38  ? 178 HIS A H    1 
ATOM   2515 H HA   . HIS A 1 166 ? 8.411   -4.016  3.573   1.00 1.57  ? 178 HIS A HA   1 
ATOM   2516 H HB2  . HIS A 1 166 ? 6.123   -2.116  3.800   1.00 1.86  ? 178 HIS A HB2  1 
ATOM   2517 H HB3  . HIS A 1 166 ? 5.746   -3.837  3.823   1.00 2.18  ? 178 HIS A HB3  1 
ATOM   2518 H HD1  . HIS A 1 166 ? 5.384   -4.327  6.258   1.00 3.71  ? 178 HIS A HD1  1 
ATOM   2519 H HD2  . HIS A 1 166 ? 8.845   -2.093  5.618   1.00 3.23  ? 178 HIS A HD2  1 
ATOM   2520 H HE1  . HIS A 1 166 ? 6.554   -4.165  8.497   1.00 4.78  ? 178 HIS A HE1  1 
ATOM   2521 N N    . ILE A 1 167 ? 7.608   -5.278  1.568   1.00 0.69  ? 179 ILE A N    1 
ATOM   2522 C CA   . ILE A 1 167 ? 7.152   -6.001  0.345   1.00 0.53  ? 179 ILE A CA   1 
ATOM   2523 C C    . ILE A 1 167 ? 6.177   -7.109  0.741   1.00 0.55  ? 179 ILE A C    1 
ATOM   2524 O O    . ILE A 1 167 ? 6.518   -8.017  1.471   1.00 0.69  ? 179 ILE A O    1 
ATOM   2525 C CB   . ILE A 1 167 ? 8.355   -6.626  -0.363  1.00 0.54  ? 179 ILE A CB   1 
ATOM   2526 C CG1  . ILE A 1 167 ? 8.950   -5.616  -1.343  1.00 0.51  ? 179 ILE A CG1  1 
ATOM   2527 C CG2  . ILE A 1 167 ? 7.906   -7.873  -1.128  1.00 0.79  ? 179 ILE A CG2  1 
ATOM   2528 C CD1  . ILE A 1 167 ? 10.293  -5.125  -0.806  1.00 0.54  ? 179 ILE A CD1  1 
ATOM   2529 H H    . ILE A 1 167 ? 8.216   -5.718  2.198   1.00 0.77  ? 179 ILE A H    1 
ATOM   2530 H HA   . ILE A 1 167 ? 6.661   -5.309  -0.322  1.00 0.56  ? 179 ILE A HA   1 
ATOM   2531 H HB   . ILE A 1 167 ? 9.099   -6.903  0.370   1.00 0.80  ? 179 ILE A HB   1 
ATOM   2532 H HG12 . ILE A 1 167 ? 9.094   -6.088  -2.304  1.00 0.87  ? 179 ILE A HG12 1 
ATOM   2533 H HG13 . ILE A 1 167 ? 8.278   -4.778  -1.449  1.00 0.84  ? 179 ILE A HG13 1 
ATOM   2534 H HG21 . ILE A 1 167 ? 6.988   -7.660  -1.657  1.00 1.45  ? 179 ILE A HG21 1 
ATOM   2535 H HG22 . ILE A 1 167 ? 8.672   -8.156  -1.836  1.00 1.24  ? 179 ILE A HG22 1 
ATOM   2536 H HG23 . ILE A 1 167 ? 7.741   -8.683  -0.433  1.00 1.31  ? 179 ILE A HG23 1 
ATOM   2537 H HD11 . ILE A 1 167 ? 10.162  -4.749  0.198   1.00 1.01  ? 179 ILE A HD11 1 
ATOM   2538 H HD12 . ILE A 1 167 ? 10.997  -5.943  -0.795  1.00 1.02  ? 179 ILE A HD12 1 
ATOM   2539 H HD13 . ILE A 1 167 ? 10.667  -4.336  -1.441  1.00 1.19  ? 179 ILE A HD13 1 
ATOM   2540 N N    . LEU A 1 168 ? 4.967   -7.043  0.263   1.00 0.52  ? 180 LEU A N    1 
ATOM   2541 C CA   . LEU A 1 168 ? 3.974   -8.097  0.614   1.00 0.58  ? 180 LEU A CA   1 
ATOM   2542 C C    . LEU A 1 168 ? 3.284   -8.593  -0.658  1.00 0.50  ? 180 LEU A C    1 
ATOM   2543 O O    . LEU A 1 168 ? 3.130   -7.865  -1.620  1.00 0.45  ? 180 LEU A O    1 
ATOM   2544 C CB   . LEU A 1 168 ? 2.926   -7.529  1.575   1.00 0.74  ? 180 LEU A CB   1 
ATOM   2545 C CG   . LEU A 1 168 ? 3.495   -6.314  2.310   1.00 0.72  ? 180 LEU A CG   1 
ATOM   2546 C CD1  . LEU A 1 168 ? 3.313   -5.063  1.450   1.00 1.25  ? 180 LEU A CD1  1 
ATOM   2547 C CD2  . LEU A 1 168 ? 2.752   -6.131  3.636   1.00 1.44  ? 180 LEU A CD2  1 
ATOM   2548 H H    . LEU A 1 168 ? 4.712   -6.302  -0.326  1.00 0.54  ? 180 LEU A H    1 
ATOM   2549 H HA   . LEU A 1 168 ? 4.484   -8.922  1.088   1.00 0.65  ? 180 LEU A HA   1 
ATOM   2550 H HB2  . LEU A 1 168 ? 2.048   -7.235  1.018   1.00 1.21  ? 180 LEU A HB2  1 
ATOM   2551 H HB3  . LEU A 1 168 ? 2.658   -8.287  2.295   1.00 1.28  ? 180 LEU A HB3  1 
ATOM   2552 H HG   . LEU A 1 168 ? 4.546   -6.469  2.504   1.00 1.58  ? 180 LEU A HG   1 
ATOM   2553 H HD11 . LEU A 1 168 ? 2.934   -5.345  0.480   1.00 1.78  ? 180 LEU A HD11 1 
ATOM   2554 H HD12 . LEU A 1 168 ? 2.613   -4.395  1.930   1.00 1.90  ? 180 LEU A HD12 1 
ATOM   2555 H HD13 . LEU A 1 168 ? 4.264   -4.565  1.334   1.00 1.63  ? 180 LEU A HD13 1 
ATOM   2556 H HD21 . LEU A 1 168 ? 2.408   -7.091  3.992   1.00 1.95  ? 180 LEU A HD21 1 
ATOM   2557 H HD22 . LEU A 1 168 ? 3.420   -5.696  4.365   1.00 2.04  ? 180 LEU A HD22 1 
ATOM   2558 H HD23 . LEU A 1 168 ? 1.906   -5.477  3.487   1.00 1.89  ? 180 LEU A HD23 1 
ATOM   2559 N N    . GLU A 1 169 ? 2.868   -9.831  -0.670  1.00 0.56  ? 181 GLU A N    1 
ATOM   2560 C CA   . GLU A 1 169 ? 2.191   -10.382 -1.877  1.00 0.57  ? 181 GLU A CA   1 
ATOM   2561 C C    . GLU A 1 169 ? 1.014   -11.262 -1.447  1.00 0.78  ? 181 GLU A C    1 
ATOM   2562 O O    . GLU A 1 169 ? 0.745   -11.426 -0.275  1.00 0.94  ? 181 GLU A O    1 
ATOM   2563 C CB   . GLU A 1 169 ? 3.191   -11.218 -2.675  1.00 0.76  ? 181 GLU A CB   1 
ATOM   2564 C CG   . GLU A 1 169 ? 4.503   -11.319 -1.893  1.00 1.43  ? 181 GLU A CG   1 
ATOM   2565 C CD   . GLU A 1 169 ? 5.447   -12.289 -2.603  1.00 1.89  ? 181 GLU A CD   1 
ATOM   2566 O OE1  . GLU A 1 169 ? 5.246   -13.485 -2.469  1.00 2.52  ? 181 GLU A OE1  1 
ATOM   2567 O OE2  . GLU A 1 169 ? 6.355   -11.820 -3.269  1.00 2.36  ? 181 GLU A OE2  1 
ATOM   2568 H H    . GLU A 1 169 ? 3.004   -10.399 0.116   1.00 0.64  ? 181 GLU A H    1 
ATOM   2569 H HA   . GLU A 1 169 ? 1.830   -9.569  -2.490  1.00 0.52  ? 181 GLU A HA   1 
ATOM   2570 H HB2  . GLU A 1 169 ? 2.788   -12.208 -2.834  1.00 1.42  ? 181 GLU A HB2  1 
ATOM   2571 H HB3  . GLU A 1 169 ? 3.378   -10.746 -3.628  1.00 1.39  ? 181 GLU A HB3  1 
ATOM   2572 H HG2  . GLU A 1 169 ? 4.963   -10.343 -1.837  1.00 2.09  ? 181 GLU A HG2  1 
ATOM   2573 H HG3  . GLU A 1 169 ? 4.301   -11.681 -0.897  1.00 2.07  ? 181 GLU A HG3  1 
ATOM   2574 N N    . CYS A 1 170 ? 0.312   -11.828 -2.393  1.00 0.87  ? 182 CYS A N    1 
ATOM   2575 C CA   . CYS A 1 170 ? -0.853  -12.702 -2.060  1.00 1.17  ? 182 CYS A CA   1 
ATOM   2576 C C    . CYS A 1 170 ? -1.798  -11.997 -1.075  1.00 0.87  ? 182 CYS A C    1 
ATOM   2577 O O    . CYS A 1 170 ? -2.066  -12.516 -0.011  1.00 0.78  ? 182 CYS A O    1 
ATOM   2578 C CB   . CYS A 1 170 ? -0.346  -14.001 -1.429  1.00 1.56  ? 182 CYS A CB   1 
ATOM   2579 S SG   . CYS A 1 170 ? -1.542  -15.325 -1.731  1.00 2.49  ? 182 CYS A SG   1 
ATOM   2580 H H    . CYS A 1 170 ? 0.553   -11.678 -3.332  1.00 0.79  ? 182 CYS A H    1 
ATOM   2581 H HA   . CYS A 1 170 ? -1.393  -12.935 -2.962  1.00 1.48  ? 182 CYS A HA   1 
ATOM   2582 H HB2  . CYS A 1 170 ? 0.604   -14.267 -1.869  1.00 1.62  ? 182 CYS A HB2  1 
ATOM   2583 H HB3  . CYS A 1 170 ? -0.224  -13.861 -0.365  1.00 1.75  ? 182 CYS A HB3  1 
ATOM   2584 H HG   . CYS A 1 170 ? -1.554  -15.505 -2.673  1.00 2.74  ? 182 CYS A HG   1 
ATOM   2585 N N    . PRO A 1 171 ? -2.280  -10.837 -1.458  1.00 0.78  ? 183 PRO A N    1 
ATOM   2586 C CA   . PRO A 1 171 ? -3.196  -10.042 -0.628  1.00 0.57  ? 183 PRO A CA   1 
ATOM   2587 C C    . PRO A 1 171 ? -4.622  -10.608 -0.720  1.00 0.43  ? 183 PRO A C    1 
ATOM   2588 O O    . PRO A 1 171 ? -5.398  -10.511 0.218   1.00 0.36  ? 183 PRO A O    1 
ATOM   2589 C CB   . PRO A 1 171 ? -3.144  -8.639  -1.214  1.00 0.73  ? 183 PRO A CB   1 
ATOM   2590 C CG   . PRO A 1 171 ? -2.821  -8.907  -2.703  1.00 0.91  ? 183 PRO A CG   1 
ATOM   2591 C CD   . PRO A 1 171 ? -1.961  -10.194 -2.755  1.00 0.99  ? 183 PRO A CD   1 
ATOM   2592 H HA   . PRO A 1 171 ? -2.861  -10.026 0.396   1.00 0.50  ? 183 PRO A HA   1 
ATOM   2593 H HB2  . PRO A 1 171 ? -4.094  -8.143  -1.101  1.00 0.70  ? 183 PRO A HB2  1 
ATOM   2594 H HB3  . PRO A 1 171 ? -2.352  -8.064  -0.763  1.00 0.84  ? 183 PRO A HB3  1 
ATOM   2595 H HG2  . PRO A 1 171 ? -3.738  -9.049  -3.259  1.00 0.85  ? 183 PRO A HG2  1 
ATOM   2596 H HG3  . PRO A 1 171 ? -2.262  -8.080  -3.115  1.00 1.10  ? 183 PRO A HG3  1 
ATOM   2597 H HD2  . PRO A 1 171 ? -2.258  -10.820 -3.586  1.00 1.05  ? 183 PRO A HD2  1 
ATOM   2598 H HD3  . PRO A 1 171 ? -0.914  -9.946  -2.808  1.00 1.15  ? 183 PRO A HD3  1 
ATOM   2599 N N    . GLU A 1 172 ? -4.958  -11.196 -1.848  1.00 0.57  ? 184 GLU A N    1 
ATOM   2600 C CA   . GLU A 1 172 ? -6.322  -11.787 -2.054  1.00 0.50  ? 184 GLU A CA   1 
ATOM   2601 C C    . GLU A 1 172 ? -7.348  -10.683 -2.340  1.00 0.49  ? 184 GLU A C    1 
ATOM   2602 O O    . GLU A 1 172 ? -7.978  -10.159 -1.443  1.00 0.77  ? 184 GLU A O    1 
ATOM   2603 C CB   . GLU A 1 172 ? -6.751  -12.580 -0.814  1.00 0.72  ? 184 GLU A CB   1 
ATOM   2604 C CG   . GLU A 1 172 ? -7.820  -13.603 -1.204  1.00 0.91  ? 184 GLU A CG   1 
ATOM   2605 C CD   . GLU A 1 172 ? -7.825  -14.747 -0.189  1.00 1.56  ? 184 GLU A CD   1 
ATOM   2606 O OE1  . GLU A 1 172 ? -8.466  -14.598 0.838   1.00 2.28  ? 184 GLU A OE1  1 
ATOM   2607 O OE2  . GLU A 1 172 ? -7.188  -15.752 -0.456  1.00 2.11  ? 184 GLU A OE2  1 
ATOM   2608 H H    . GLU A 1 172 ? -4.301  -11.249 -2.573  1.00 0.77  ? 184 GLU A H    1 
ATOM   2609 H HA   . GLU A 1 172 ? -6.287  -12.456 -2.902  1.00 0.55  ? 184 GLU A HA   1 
ATOM   2610 H HB2  . GLU A 1 172 ? -5.894  -13.092 -0.401  1.00 0.96  ? 184 GLU A HB2  1 
ATOM   2611 H HB3  . GLU A 1 172 ? -7.156  -11.903 -0.076  1.00 0.77  ? 184 GLU A HB3  1 
ATOM   2612 H HG2  . GLU A 1 172 ? -8.789  -13.124 -1.215  1.00 1.35  ? 184 GLU A HG2  1 
ATOM   2613 H HG3  . GLU A 1 172 ? -7.601  -13.996 -2.185  1.00 1.25  ? 184 GLU A HG3  1 
ATOM   2614 N N    . GLY A 1 173 ? -7.524  -10.333 -3.590  1.00 0.49  ? 185 GLY A N    1 
ATOM   2615 C CA   . GLY A 1 173 ? -8.512  -9.268  -3.946  1.00 0.70  ? 185 GLY A CA   1 
ATOM   2616 C C    . GLY A 1 173 ? -8.067  -7.931  -3.352  1.00 0.69  ? 185 GLY A C    1 
ATOM   2617 O O    . GLY A 1 173 ? -8.631  -7.452  -2.389  1.00 1.19  ? 185 GLY A O    1 
ATOM   2618 H H    . GLY A 1 173 ? -7.008  -10.775 -4.297  1.00 0.58  ? 185 GLY A H    1 
ATOM   2619 H HA2  . GLY A 1 173 ? -8.574  -9.182  -5.022  1.00 0.81  ? 185 GLY A HA2  1 
ATOM   2620 H HA3  . GLY A 1 173 ? -9.481  -9.530  -3.549  1.00 0.91  ? 185 GLY A HA3  1 
ATOM   2621 N N    . LEU A 1 174 ? -7.055  -7.328  -3.914  1.00 0.37  ? 186 LEU A N    1 
ATOM   2622 C CA   . LEU A 1 174 ? -6.570  -6.032  -3.376  1.00 0.54  ? 186 LEU A CA   1 
ATOM   2623 C C    . LEU A 1 174 ? -6.021  -5.153  -4.515  1.00 0.45  ? 186 LEU A C    1 
ATOM   2624 O O    . LEU A 1 174 ? -6.770  -4.434  -5.140  1.00 0.42  ? 186 LEU A O    1 
ATOM   2625 C CB   . LEU A 1 174 ? -5.488  -6.335  -2.342  1.00 0.75  ? 186 LEU A CB   1 
ATOM   2626 C CG   . LEU A 1 174 ? -6.151  -6.496  -0.977  1.00 1.01  ? 186 LEU A CG   1 
ATOM   2627 C CD1  . LEU A 1 174 ? -6.507  -7.964  -0.747  1.00 1.73  ? 186 LEU A CD1  1 
ATOM   2628 C CD2  . LEU A 1 174 ? -5.196  -6.024  0.123   1.00 1.50  ? 186 LEU A CD2  1 
ATOM   2629 H H    . LEU A 1 174 ? -6.611  -7.731  -4.680  1.00 0.51  ? 186 LEU A H    1 
ATOM   2630 H HA   . LEU A 1 174 ? -7.389  -5.515  -2.898  1.00 0.73  ? 186 LEU A HA   1 
ATOM   2631 H HB2  . LEU A 1 174 ? -4.984  -7.251  -2.612  1.00 0.96  ? 186 LEU A HB2  1 
ATOM   2632 H HB3  . LEU A 1 174 ? -4.775  -5.528  -2.309  1.00 0.68  ? 186 LEU A HB3  1 
ATOM   2633 H HG   . LEU A 1 174 ? -7.053  -5.907  -0.958  1.00 1.02  ? 186 LEU A HG   1 
ATOM   2634 H HD11 . LEU A 1 174 ? -6.287  -8.532  -1.639  1.00 2.07  ? 186 LEU A HD11 1 
ATOM   2635 H HD12 . LEU A 1 174 ? -5.926  -8.349  0.077   1.00 2.32  ? 186 LEU A HD12 1 
ATOM   2636 H HD13 . LEU A 1 174 ? -7.558  -8.049  -0.516  1.00 2.14  ? 186 LEU A HD13 1 
ATOM   2637 H HD21 . LEU A 1 174 ? -4.184  -6.023  -0.255  1.00 1.92  ? 186 LEU A HD21 1 
ATOM   2638 H HD22 . LEU A 1 174 ? -5.466  -5.024  0.429   1.00 1.99  ? 186 LEU A HD22 1 
ATOM   2639 H HD23 . LEU A 1 174 ? -5.263  -6.690  0.970   1.00 1.92  ? 186 LEU A HD23 1 
ATOM   2640 N N    . ALA A 1 175 ? -4.730  -5.213  -4.780  1.00 0.45  ? 187 ALA A N    1 
ATOM   2641 C CA   . ALA A 1 175 ? -4.098  -4.398  -5.875  1.00 0.41  ? 187 ALA A CA   1 
ATOM   2642 C C    . ALA A 1 175 ? -4.708  -2.984  -5.995  1.00 0.40  ? 187 ALA A C    1 
ATOM   2643 O O    . ALA A 1 175 ? -4.260  -2.052  -5.352  1.00 0.42  ? 187 ALA A O    1 
ATOM   2644 C CB   . ALA A 1 175 ? -4.242  -5.146  -7.203  1.00 0.40  ? 187 ALA A CB   1 
ATOM   2645 H H    . ALA A 1 175 ? -4.159  -5.808  -4.256  1.00 0.50  ? 187 ALA A H    1 
ATOM   2646 H HA   . ALA A 1 175 ? -3.047  -4.295  -5.653  1.00 0.45  ? 187 ALA A HA   1 
ATOM   2647 H HB1  . ALA A 1 175 ? -5.256  -5.500  -7.309  1.00 1.03  ? 187 ALA A HB1  1 
ATOM   2648 H HB2  . ALA A 1 175 ? -4.006  -4.478  -8.019  1.00 1.06  ? 187 ALA A HB2  1 
ATOM   2649 H HB3  . ALA A 1 175 ? -3.564  -5.986  -7.218  1.00 1.17  ? 187 ALA A HB3  1 
ATOM   2650 N N    . GLN A 1 176 ? -5.717  -2.806  -6.813  1.00 0.40  ? 188 GLN A N    1 
ATOM   2651 C CA   . GLN A 1 176 ? -6.322  -1.451  -6.963  1.00 0.40  ? 188 GLN A CA   1 
ATOM   2652 C C    . GLN A 1 176 ? -7.200  -1.121  -5.756  1.00 0.38  ? 188 GLN A C    1 
ATOM   2653 O O    . GLN A 1 176 ? -7.087  -0.064  -5.173  1.00 0.37  ? 188 GLN A O    1 
ATOM   2654 C CB   . GLN A 1 176 ? -7.172  -1.409  -8.232  1.00 0.46  ? 188 GLN A CB   1 
ATOM   2655 C CG   . GLN A 1 176 ? -6.268  -1.556  -9.457  1.00 1.09  ? 188 GLN A CG   1 
ATOM   2656 C CD   . GLN A 1 176 ? -7.098  -1.371  -10.728 1.00 1.60  ? 188 GLN A CD   1 
ATOM   2657 O OE1  . GLN A 1 176 ? -7.824  -0.405  -10.859 1.00 2.19  ? 188 GLN A OE1  1 
ATOM   2658 N NE2  . GLN A 1 176 ? -7.022  -2.263  -11.678 1.00 2.03  ? 188 GLN A NE2  1 
ATOM   2659 H H    . GLN A 1 176 ? -6.072  -3.556  -7.332  1.00 0.40  ? 188 GLN A H    1 
ATOM   2660 H HA   . GLN A 1 176 ? -5.534  -0.716  -7.040  1.00 0.41  ? 188 GLN A HA   1 
ATOM   2661 H HB2  . GLN A 1 176 ? -7.888  -2.217  -8.212  1.00 0.91  ? 188 GLN A HB2  1 
ATOM   2662 H HB3  . GLN A 1 176 ? -7.695  -0.465  -8.284  1.00 0.92  ? 188 GLN A HB3  1 
ATOM   2663 H HG2  . GLN A 1 176 ? -5.490  -0.806  -9.421  1.00 1.51  ? 188 GLN A HG2  1 
ATOM   2664 H HG3  . GLN A 1 176 ? -5.822  -2.539  -9.460  1.00 1.61  ? 188 GLN A HG3  1 
ATOM   2665 H HE21 . GLN A 1 176 ? -6.438  -3.042  -11.573 1.00 2.27  ? 188 GLN A HE21 1 
ATOM   2666 H HE22 . GLN A 1 176 ? -7.550  -2.153  -12.496 1.00 2.46  ? 188 GLN A HE22 1 
ATOM   2667 N N    . ASP A 1 177 ? -8.078  -2.007  -5.377  1.00 0.40  ? 189 ASP A N    1 
ATOM   2668 C CA   . ASP A 1 177 ? -8.955  -1.720  -4.209  1.00 0.40  ? 189 ASP A CA   1 
ATOM   2669 C C    . ASP A 1 177 ? -8.090  -1.472  -2.967  1.00 0.35  ? 189 ASP A C    1 
ATOM   2670 O O    . ASP A 1 177 ? -8.333  -0.553  -2.203  1.00 0.36  ? 189 ASP A O    1 
ATOM   2671 C CB   . ASP A 1 177 ? -9.888  -2.908  -3.968  1.00 0.44  ? 189 ASP A CB   1 
ATOM   2672 C CG   . ASP A 1 177 ? -11.273 -2.593  -4.537  1.00 0.94  ? 189 ASP A CG   1 
ATOM   2673 O OD1  . ASP A 1 177 ? -11.365 -2.384  -5.735  1.00 1.58  ? 189 ASP A OD1  1 
ATOM   2674 O OD2  . ASP A 1 177 ? -12.217 -2.566  -3.764  1.00 1.58  ? 189 ASP A OD2  1 
ATOM   2675 H H    . ASP A 1 177 ? -8.163  -2.856  -5.858  1.00 0.44  ? 189 ASP A H    1 
ATOM   2676 H HA   . ASP A 1 177 ? -9.549  -0.840  -4.416  1.00 0.42  ? 189 ASP A HA   1 
ATOM   2677 H HB2  . ASP A 1 177 ? -9.490  -3.783  -4.458  1.00 0.73  ? 189 ASP A HB2  1 
ATOM   2678 H HB3  . ASP A 1 177 ? -9.971  -3.093  -2.908  1.00 0.56  ? 189 ASP A HB3  1 
ATOM   2679 N N    . VAL A 1 178 ? -7.078  -2.274  -2.749  1.00 0.33  ? 190 VAL A N    1 
ATOM   2680 C CA   . VAL A 1 178 ? -6.220  -2.051  -1.546  1.00 0.30  ? 190 VAL A CA   1 
ATOM   2681 C C    . VAL A 1 178 ? -5.549  -0.686  -1.644  1.00 0.29  ? 190 VAL A C    1 
ATOM   2682 O O    . VAL A 1 178 ? -5.445  0.029   -0.673  1.00 0.27  ? 190 VAL A O    1 
ATOM   2683 C CB   . VAL A 1 178 ? -5.151  -3.133  -1.435  1.00 0.29  ? 190 VAL A CB   1 
ATOM   2684 C CG1  . VAL A 1 178 ? -4.255  -3.106  -2.666  1.00 0.36  ? 190 VAL A CG1  1 
ATOM   2685 C CG2  . VAL A 1 178 ? -4.302  -2.884  -0.188  1.00 0.45  ? 190 VAL A CG2  1 
ATOM   2686 H H    . VAL A 1 178 ? -6.885  -3.012  -3.370  1.00 0.34  ? 190 VAL A H    1 
ATOM   2687 H HA   . VAL A 1 178 ? -6.841  -2.079  -0.665  1.00 0.30  ? 190 VAL A HA   1 
ATOM   2688 H HB   . VAL A 1 178 ? -5.629  -4.089  -1.357  1.00 0.36  ? 190 VAL A HB   1 
ATOM   2689 H HG11 . VAL A 1 178 ? -4.866  -3.174  -3.547  1.00 1.03  ? 190 VAL A HG11 1 
ATOM   2690 H HG12 . VAL A 1 178 ? -3.694  -2.183  -2.685  1.00 1.08  ? 190 VAL A HG12 1 
ATOM   2691 H HG13 . VAL A 1 178 ? -3.572  -3.943  -2.633  1.00 1.09  ? 190 VAL A HG13 1 
ATOM   2692 H HG21 . VAL A 1 178 ? -4.942  -2.592  0.631   1.00 1.20  ? 190 VAL A HG21 1 
ATOM   2693 H HG22 . VAL A 1 178 ? -3.772  -3.789  0.073   1.00 1.25  ? 190 VAL A HG22 1 
ATOM   2694 H HG23 . VAL A 1 178 ? -3.591  -2.096  -0.389  1.00 0.93  ? 190 VAL A HG23 1 
ATOM   2695 N N    . ILE A 1 179 ? -5.091  -0.310  -2.806  1.00 0.32  ? 191 ILE A N    1 
ATOM   2696 C CA   . ILE A 1 179 ? -4.435  1.019   -2.935  1.00 0.33  ? 191 ILE A CA   1 
ATOM   2697 C C    . ILE A 1 179 ? -5.430  2.103   -2.504  1.00 0.33  ? 191 ILE A C    1 
ATOM   2698 O O    . ILE A 1 179 ? -5.070  3.091   -1.890  1.00 0.33  ? 191 ILE A O    1 
ATOM   2699 C CB   . ILE A 1 179 ? -4.018  1.238   -4.393  1.00 0.37  ? 191 ILE A CB   1 
ATOM   2700 C CG1  . ILE A 1 179 ? -2.773  0.398   -4.697  1.00 0.45  ? 191 ILE A CG1  1 
ATOM   2701 C CG2  . ILE A 1 179 ? -3.707  2.716   -4.632  1.00 0.39  ? 191 ILE A CG2  1 
ATOM   2702 C CD1  . ILE A 1 179 ? -1.547  1.028   -4.029  1.00 0.54  ? 191 ILE A CD1  1 
ATOM   2703 H H    . ILE A 1 179 ? -5.180  -0.898  -3.590  1.00 0.36  ? 191 ILE A H    1 
ATOM   2704 H HA   . ILE A 1 179 ? -3.564  1.055   -2.298  1.00 0.34  ? 191 ILE A HA   1 
ATOM   2705 H HB   . ILE A 1 179 ? -4.825  0.933   -5.045  1.00 0.38  ? 191 ILE A HB   1 
ATOM   2706 H HG12 . ILE A 1 179 ? -2.914  -0.602  -4.316  1.00 0.61  ? 191 ILE A HG12 1 
ATOM   2707 H HG13 . ILE A 1 179 ? -2.617  0.359   -5.764  1.00 0.83  ? 191 ILE A HG13 1 
ATOM   2708 H HG21 . ILE A 1 179 ? -2.980  3.053   -3.909  1.00 1.11  ? 191 ILE A HG21 1 
ATOM   2709 H HG22 . ILE A 1 179 ? -3.309  2.843   -5.628  1.00 0.97  ? 191 ILE A HG22 1 
ATOM   2710 H HG23 . ILE A 1 179 ? -4.612  3.297   -4.531  1.00 1.06  ? 191 ILE A HG23 1 
ATOM   2711 H HD11 . ILE A 1 179 ? -1.857  1.588   -3.160  1.00 1.07  ? 191 ILE A HD11 1 
ATOM   2712 H HD12 . ILE A 1 179 ? -0.862  0.249   -3.729  1.00 1.08  ? 191 ILE A HD12 1 
ATOM   2713 H HD13 . ILE A 1 179 ? -1.057  1.689   -4.728  1.00 1.34  ? 191 ILE A HD13 1 
ATOM   2714 N N    . SER A 1 180 ? -6.684  1.919   -2.821  1.00 0.37  ? 192 SER A N    1 
ATOM   2715 C CA   . SER A 1 180 ? -7.714  2.924   -2.438  1.00 0.40  ? 192 SER A CA   1 
ATOM   2716 C C    . SER A 1 180 ? -7.894  2.931   -0.918  1.00 0.39  ? 192 SER A C    1 
ATOM   2717 O O    . SER A 1 180 ? -8.220  3.941   -0.332  1.00 0.43  ? 192 SER A O    1 
ATOM   2718 C CB   . SER A 1 180 ? -9.045  2.569   -3.105  1.00 0.44  ? 192 SER A CB   1 
ATOM   2719 O OG   . SER A 1 180 ? -10.001 3.580   -2.812  1.00 1.14  ? 192 SER A OG   1 
ATOM   2720 H H    . SER A 1 180 ? -6.949  1.115   -3.310  1.00 0.41  ? 192 SER A H    1 
ATOM   2721 H HA   . SER A 1 180 ? -7.399  3.904   -2.766  1.00 0.41  ? 192 SER A HA   1 
ATOM   2722 H HB2  . SER A 1 180 ? -8.911  2.506   -4.172  1.00 0.96  ? 192 SER A HB2  1 
ATOM   2723 H HB3  . SER A 1 180 ? -9.390  1.614   -2.732  1.00 1.11  ? 192 SER A HB3  1 
ATOM   2724 H HG   . SER A 1 180 ? -10.176 4.067   -3.621  1.00 1.51  ? 192 SER A HG   1 
ATOM   2725 N N    . THR A 1 181 ? -7.693  1.813   -0.274  1.00 0.38  ? 193 THR A N    1 
ATOM   2726 C CA   . THR A 1 181 ? -7.863  1.777   1.216   1.00 0.39  ? 193 THR A CA   1 
ATOM   2727 C C    . THR A 1 181 ? -6.719  2.525   1.898   1.00 0.35  ? 193 THR A C    1 
ATOM   2728 O O    . THR A 1 181 ? -6.936  3.476   2.623   1.00 0.41  ? 193 THR A O    1 
ATOM   2729 C CB   . THR A 1 181 ? -7.870  0.336   1.737   1.00 0.41  ? 193 THR A CB   1 
ATOM   2730 O OG1  . THR A 1 181 ? -7.722  -0.578  0.664   1.00 0.77  ? 193 THR A OG1  1 
ATOM   2731 C CG2  . THR A 1 181 ? -9.189  0.077   2.452   1.00 0.69  ? 193 THR A CG2  1 
ATOM   2732 H H    . THR A 1 181 ? -7.436  1.005   -0.769  1.00 0.40  ? 193 THR A H    1 
ATOM   2733 H HA   . THR A 1 181 ? -8.798  2.251   1.475   1.00 0.43  ? 193 THR A HA   1 
ATOM   2734 H HB   . THR A 1 181 ? -7.059  0.204   2.435   1.00 0.60  ? 193 THR A HB   1 
ATOM   2735 H HG1  . THR A 1 181 ? -8.002  -1.443  0.971   1.00 0.81  ? 193 THR A HG1  1 
ATOM   2736 H HG21 . THR A 1 181 ? -9.951  0.711   2.030   1.00 1.22  ? 193 THR A HG21 1 
ATOM   2737 H HG22 . THR A 1 181 ? -9.471  -0.957  2.326   1.00 1.32  ? 193 THR A HG22 1 
ATOM   2738 H HG23 . THR A 1 181 ? -9.080  0.297   3.502   1.00 1.31  ? 193 THR A HG23 1 
ATOM   2739 N N    . ILE A 1 182 ? -5.505  2.094   1.681   1.00 0.33  ? 194 ILE A N    1 
ATOM   2740 C CA   . ILE A 1 182 ? -4.342  2.769   2.319   1.00 0.32  ? 194 ILE A CA   1 
ATOM   2741 C C    . ILE A 1 182 ? -4.410  4.273   2.050   1.00 0.33  ? 194 ILE A C    1 
ATOM   2742 O O    . ILE A 1 182 ? -4.095  5.071   2.903   1.00 0.36  ? 194 ILE A O    1 
ATOM   2743 C CB   . ILE A 1 182 ? -3.044  2.189   1.757   1.00 0.32  ? 194 ILE A CB   1 
ATOM   2744 C CG1  . ILE A 1 182 ? -2.985  0.694   2.079   1.00 0.37  ? 194 ILE A CG1  1 
ATOM   2745 C CG2  . ILE A 1 182 ? -1.849  2.891   2.404   1.00 0.34  ? 194 ILE A CG2  1 
ATOM   2746 C CD1  . ILE A 1 182 ? -2.254  -0.046  0.960   1.00 0.36  ? 194 ILE A CD1  1 
ATOM   2747 H H    . ILE A 1 182 ? -5.359  1.322   1.102   1.00 0.36  ? 194 ILE A H    1 
ATOM   2748 H HA   . ILE A 1 182 ? -4.375  2.596   3.387   1.00 0.33  ? 194 ILE A HA   1 
ATOM   2749 H HB   . ILE A 1 182 ? -3.014  2.333   0.686   1.00 0.32  ? 194 ILE A HB   1 
ATOM   2750 H HG12 . ILE A 1 182 ? -2.459  0.548   3.012   1.00 0.43  ? 194 ILE A HG12 1 
ATOM   2751 H HG13 . ILE A 1 182 ? -3.989  0.306   2.168   1.00 0.50  ? 194 ILE A HG13 1 
ATOM   2752 H HG21 . ILE A 1 182 ? -1.946  3.959   2.278   1.00 0.96  ? 194 ILE A HG21 1 
ATOM   2753 H HG22 . ILE A 1 182 ? -1.820  2.654   3.457   1.00 0.95  ? 194 ILE A HG22 1 
ATOM   2754 H HG23 . ILE A 1 182 ? -0.936  2.554   1.935   1.00 1.06  ? 194 ILE A HG23 1 
ATOM   2755 H HD11 . ILE A 1 182 ? -1.354  0.491   0.702   1.00 1.04  ? 194 ILE A HD11 1 
ATOM   2756 H HD12 . ILE A 1 182 ? -1.997  -1.040  1.296   1.00 1.14  ? 194 ILE A HD12 1 
ATOM   2757 H HD13 . ILE A 1 182 ? -2.896  -0.112  0.095   1.00 1.03  ? 194 ILE A HD13 1 
ATOM   2758 N N    . GLY A 1 183 ? -4.828  4.672   0.877   1.00 0.34  ? 195 GLY A N    1 
ATOM   2759 C CA   . GLY A 1 183 ? -4.917  6.134   0.587   1.00 0.37  ? 195 GLY A CA   1 
ATOM   2760 C C    . GLY A 1 183 ? -6.021  6.741   1.457   1.00 0.37  ? 195 GLY A C    1 
ATOM   2761 O O    . GLY A 1 183 ? -5.894  7.834   1.982   1.00 0.39  ? 195 GLY A O    1 
ATOM   2762 H H    . GLY A 1 183 ? -5.088  4.015   0.193   1.00 0.35  ? 195 GLY A H    1 
ATOM   2763 H HA2  . GLY A 1 183 ? -3.974  6.609   0.815   1.00 0.37  ? 195 GLY A HA2  1 
ATOM   2764 H HA3  . GLY A 1 183 ? -5.159  6.284   -0.453  1.00 0.40  ? 195 GLY A HA3  1 
ATOM   2765 N N    . GLN A 1 184 ? -7.105  6.033   1.616   1.00 0.37  ? 196 GLN A N    1 
ATOM   2766 C CA   . GLN A 1 184 ? -8.221  6.551   2.450   1.00 0.38  ? 196 GLN A CA   1 
ATOM   2767 C C    . GLN A 1 184 ? -7.708  6.805   3.866   1.00 0.37  ? 196 GLN A C    1 
ATOM   2768 O O    . GLN A 1 184 ? -7.555  7.934   4.278   1.00 0.43  ? 196 GLN A O    1 
ATOM   2769 C CB   . GLN A 1 184 ? -9.352  5.522   2.491   1.00 0.41  ? 196 GLN A CB   1 
ATOM   2770 C CG   . GLN A 1 184 ? -10.049 5.477   1.130   1.00 0.91  ? 196 GLN A CG   1 
ATOM   2771 C CD   . GLN A 1 184 ? -11.224 6.457   1.125   1.00 1.05  ? 196 GLN A CD   1 
ATOM   2772 O OE1  . GLN A 1 184 ? -11.866 6.659   2.137   1.00 1.61  ? 196 GLN A OE1  1 
ATOM   2773 N NE2  . GLN A 1 184 ? -11.534 7.077   0.020   1.00 1.67  ? 196 GLN A NE2  1 
ATOM   2774 H H    . GLN A 1 184 ? -7.181  5.158   1.187   1.00 0.37  ? 196 GLN A H    1 
ATOM   2775 H HA   . GLN A 1 184 ? -8.588  7.475   2.028   1.00 0.41  ? 196 GLN A HA   1 
ATOM   2776 H HB2  . GLN A 1 184 ? -8.945  4.548   2.721   1.00 0.78  ? 196 GLN A HB2  1 
ATOM   2777 H HB3  . GLN A 1 184 ? -10.066 5.803   3.249   1.00 0.75  ? 196 GLN A HB3  1 
ATOM   2778 H HG2  . GLN A 1 184 ? -9.347  5.753   0.357   1.00 1.56  ? 196 GLN A HG2  1 
ATOM   2779 H HG3  . GLN A 1 184 ? -10.415 4.478   0.946   1.00 1.52  ? 196 GLN A HG3  1 
ATOM   2780 H HE21 . GLN A 1 184 ? -11.016 6.914   -0.796  1.00 2.22  ? 196 GLN A HE21 1 
ATOM   2781 H HE22 . GLN A 1 184 ? -12.284 7.707   0.006   1.00 1.95  ? 196 GLN A HE22 1 
ATOM   2782 N N    . ALA A 1 185 ? -7.439  5.763   4.614   1.00 0.31  ? 197 ALA A N    1 
ATOM   2783 C CA   . ALA A 1 185 ? -6.933  5.951   6.006   1.00 0.30  ? 197 ALA A CA   1 
ATOM   2784 C C    . ALA A 1 185 ? -5.721  6.899   6.010   1.00 0.31  ? 197 ALA A C    1 
ATOM   2785 O O    . ALA A 1 185 ? -5.427  7.538   7.001   1.00 0.33  ? 197 ALA A O    1 
ATOM   2786 C CB   . ALA A 1 185 ? -6.525  4.593   6.581   1.00 0.29  ? 197 ALA A CB   1 
ATOM   2787 H H    . ALA A 1 185 ? -7.568  4.852   4.259   1.00 0.30  ? 197 ALA A H    1 
ATOM   2788 H HA   . ALA A 1 185 ? -7.717  6.371   6.615   1.00 0.33  ? 197 ALA A HA   1 
ATOM   2789 H HB1  . ALA A 1 185 ? -7.376  3.927   6.566   1.00 0.92  ? 197 ALA A HB1  1 
ATOM   2790 H HB2  . ALA A 1 185 ? -5.729  4.173   5.984   1.00 0.95  ? 197 ALA A HB2  1 
ATOM   2791 H HB3  . ALA A 1 185 ? -6.185  4.719   7.598   1.00 0.91  ? 197 ALA A HB3  1 
ATOM   2792 N N    . PHE A 1 186 ? -5.019  6.996   4.911   1.00 0.33  ? 198 PHE A N    1 
ATOM   2793 C CA   . PHE A 1 186 ? -3.830  7.900   4.844   1.00 0.35  ? 198 PHE A CA   1 
ATOM   2794 C C    . PHE A 1 186 ? -4.259  9.348   5.101   1.00 0.38  ? 198 PHE A C    1 
ATOM   2795 O O    . PHE A 1 186 ? -3.652  10.054  5.881   1.00 0.40  ? 198 PHE A O    1 
ATOM   2796 C CB   . PHE A 1 186 ? -3.213  7.817   3.443   1.00 0.35  ? 198 PHE A CB   1 
ATOM   2797 C CG   . PHE A 1 186 ? -1.892  7.083   3.481   1.00 0.34  ? 198 PHE A CG   1 
ATOM   2798 C CD1  . PHE A 1 186 ? -1.788  5.843   4.123   1.00 1.31  ? 198 PHE A CD1  1 
ATOM   2799 C CD2  . PHE A 1 186 ? -0.772  7.640   2.853   1.00 1.21  ? 198 PHE A CD2  1 
ATOM   2800 C CE1  . PHE A 1 186 ? -0.564  5.162   4.138   1.00 1.33  ? 198 PHE A CE1  1 
ATOM   2801 C CE2  . PHE A 1 186 ? 0.452   6.959   2.865   1.00 1.21  ? 198 PHE A CE2  1 
ATOM   2802 C CZ   . PHE A 1 186 ? 0.555   5.720   3.508   1.00 0.42  ? 198 PHE A CZ   1 
ATOM   2803 H H    . PHE A 1 186 ? -5.273  6.474   4.125   1.00 0.34  ? 198 PHE A H    1 
ATOM   2804 H HA   . PHE A 1 186 ? -3.097  7.603   5.582   1.00 0.37  ? 198 PHE A HA   1 
ATOM   2805 H HB2  . PHE A 1 186 ? -3.890  7.293   2.787   1.00 0.37  ? 198 PHE A HB2  1 
ATOM   2806 H HB3  . PHE A 1 186 ? -3.055  8.816   3.065   1.00 0.38  ? 198 PHE A HB3  1 
ATOM   2807 H HD1  . PHE A 1 186 ? -2.651  5.413   4.608   1.00 2.22  ? 198 PHE A HD1  1 
ATOM   2808 H HD2  . PHE A 1 186 ? -0.852  8.595   2.358   1.00 2.12  ? 198 PHE A HD2  1 
ATOM   2809 H HE1  . PHE A 1 186 ? -0.484  4.206   4.633   1.00 2.24  ? 198 PHE A HE1  1 
ATOM   2810 H HE2  . PHE A 1 186 ? 1.315   7.390   2.380   1.00 2.12  ? 198 PHE A HE2  1 
ATOM   2811 H HZ   . PHE A 1 186 ? 1.498   5.194   3.517   1.00 0.48  ? 198 PHE A HZ   1 
ATOM   2812 N N    . GLU A 1 187 ? -5.293  9.801   4.441   1.00 0.45  ? 199 GLU A N    1 
ATOM   2813 C CA   . GLU A 1 187 ? -5.744  11.213  4.642   1.00 0.50  ? 199 GLU A CA   1 
ATOM   2814 C C    . GLU A 1 187 ? -6.799  11.309  5.754   1.00 0.48  ? 199 GLU A C    1 
ATOM   2815 O O    . GLU A 1 187 ? -7.679  12.145  5.705   1.00 0.57  ? 199 GLU A O    1 
ATOM   2816 C CB   . GLU A 1 187 ? -6.341  11.738  3.335   1.00 0.65  ? 199 GLU A CB   1 
ATOM   2817 C CG   . GLU A 1 187 ? -5.577  12.987  2.890   1.00 1.23  ? 199 GLU A CG   1 
ATOM   2818 C CD   . GLU A 1 187 ? -6.028  13.390  1.485   1.00 1.70  ? 199 GLU A CD   1 
ATOM   2819 O OE1  . GLU A 1 187 ? -7.020  12.849  1.025   1.00 2.40  ? 199 GLU A OE1  1 
ATOM   2820 O OE2  . GLU A 1 187 ? -5.374  14.233  0.893   1.00 2.12  ? 199 GLU A OE2  1 
ATOM   2821 H H    . GLU A 1 187 ? -5.765  9.217   3.804   1.00 0.49  ? 199 GLU A H    1 
ATOM   2822 H HA   . GLU A 1 187 ? -4.893  11.821  4.909   1.00 0.56  ? 199 GLU A HA   1 
ATOM   2823 H HB2  . GLU A 1 187 ? -6.263  10.977  2.572   1.00 1.10  ? 199 GLU A HB2  1 
ATOM   2824 H HB3  . GLU A 1 187 ? -7.379  11.990  3.488   1.00 1.28  ? 199 GLU A HB3  1 
ATOM   2825 H HG2  . GLU A 1 187 ? -5.776  13.795  3.579   1.00 1.89  ? 199 GLU A HG2  1 
ATOM   2826 H HG3  . GLU A 1 187 ? -4.518  12.777  2.879   1.00 1.77  ? 199 GLU A HG3  1 
ATOM   2827 N N    . LEU A 1 188 ? -6.726  10.474  6.755   1.00 0.56  ? 200 LEU A N    1 
ATOM   2828 C CA   . LEU A 1 188 ? -7.731  10.543  7.851   1.00 0.64  ? 200 LEU A CA   1 
ATOM   2829 C C    . LEU A 1 188 ? -7.288  11.559  8.906   1.00 0.77  ? 200 LEU A C    1 
ATOM   2830 O O    . LEU A 1 188 ? -7.920  12.578  9.101   1.00 1.12  ? 200 LEU A O    1 
ATOM   2831 C CB   . LEU A 1 188 ? -7.850  9.171   8.501   1.00 0.85  ? 200 LEU A CB   1 
ATOM   2832 C CG   . LEU A 1 188 ? -9.122  8.478   8.019   1.00 1.07  ? 200 LEU A CG   1 
ATOM   2833 C CD1  . LEU A 1 188 ? -10.336 9.110   8.700   1.00 1.60  ? 200 LEU A CD1  1 
ATOM   2834 C CD2  . LEU A 1 188 ? -9.260  8.624   6.502   1.00 1.04  ? 200 LEU A CD2  1 
ATOM   2835 H H    . LEU A 1 188 ? -6.016  9.803   6.790   1.00 0.67  ? 200 LEU A H    1 
ATOM   2836 H HA   . LEU A 1 188 ? -8.691  10.834  7.452   1.00 0.66  ? 200 LEU A HA   1 
ATOM   2837 H HB2  . LEU A 1 188 ? -6.990  8.572   8.236   1.00 0.82  ? 200 LEU A HB2  1 
ATOM   2838 H HB3  . LEU A 1 188 ? -7.891  9.289   9.571   1.00 1.06  ? 200 LEU A HB3  1 
ATOM   2839 H HG   . LEU A 1 188 ? -9.066  7.435   8.274   1.00 1.59  ? 200 LEU A HG   1 
ATOM   2840 H HD11 . LEU A 1 188 ? -10.232 9.027   9.771   1.00 2.10  ? 200 LEU A HD11 1 
ATOM   2841 H HD12 . LEU A 1 188 ? -10.402 10.152  8.424   1.00 1.94  ? 200 LEU A HD12 1 
ATOM   2842 H HD13 . LEU A 1 188 ? -11.233 8.597   8.385   1.00 2.10  ? 200 LEU A HD13 1 
ATOM   2843 H HD21 . LEU A 1 188 ? -8.314  8.915   6.081   1.00 1.59  ? 200 LEU A HD21 1 
ATOM   2844 H HD22 . LEU A 1 188 ? -9.568  7.680   6.076   1.00 1.49  ? 200 LEU A HD22 1 
ATOM   2845 H HD23 . LEU A 1 188 ? -10.001 9.378   6.279   1.00 1.52  ? 200 LEU A HD23 1 
ATOM   2846 N N    . ARG A 1 189 ? -6.209  11.291  9.593   1.00 0.72  ? 201 ARG A N    1 
ATOM   2847 C CA   . ARG A 1 189 ? -5.739  12.245  10.636  1.00 0.93  ? 201 ARG A CA   1 
ATOM   2848 C C    . ARG A 1 189 ? -4.283  12.644  10.366  1.00 0.69  ? 201 ARG A C    1 
ATOM   2849 O O    . ARG A 1 189 ? -4.024  13.640  9.719   1.00 0.89  ? 201 ARG A O    1 
ATOM   2850 C CB   . ARG A 1 189 ? -5.854  11.591  12.016  1.00 1.36  ? 201 ARG A CB   1 
ATOM   2851 C CG   . ARG A 1 189 ? -7.309  11.637  12.485  1.00 1.92  ? 201 ARG A CG   1 
ATOM   2852 C CD   . ARG A 1 189 ? -7.351  11.958  13.980  1.00 2.24  ? 201 ARG A CD   1 
ATOM   2853 N NE   . ARG A 1 189 ? -8.755  11.865  14.470  1.00 2.90  ? 201 ARG A NE   1 
ATOM   2854 C CZ   . ARG A 1 189 ? -9.071  12.345  15.641  1.00 3.49  ? 201 ARG A CZ   1 
ATOM   2855 N NH1  . ARG A 1 189 ? -9.067  13.635  15.839  1.00 4.30  ? 201 ARG A NH1  1 
ATOM   2856 N NH2  . ARG A 1 189 ? -9.389  11.536  16.614  1.00 3.74  ? 201 ARG A NH2  1 
ATOM   2857 H H    . ARG A 1 189 ? -5.714  10.463  9.425   1.00 0.74  ? 201 ARG A H    1 
ATOM   2858 H HA   . ARG A 1 189 ? -6.358  13.130  10.611  1.00 1.15  ? 201 ARG A HA   1 
ATOM   2859 H HB2  . ARG A 1 189 ? -5.526  10.563  11.955  1.00 1.33  ? 201 ARG A HB2  1 
ATOM   2860 H HB3  . ARG A 1 189 ? -5.234  12.126  12.720  1.00 1.74  ? 201 ARG A HB3  1 
ATOM   2861 H HG2  . ARG A 1 189 ? -7.840  12.401  11.936  1.00 2.44  ? 201 ARG A HG2  1 
ATOM   2862 H HG3  . ARG A 1 189 ? -7.774  10.678  12.311  1.00 2.18  ? 201 ARG A HG3  1 
ATOM   2863 H HD2  . ARG A 1 189 ? -6.736  11.251  14.517  1.00 2.61  ? 201 ARG A HD2  1 
ATOM   2864 H HD3  . ARG A 1 189 ? -6.978  12.958  14.145  1.00 2.44  ? 201 ARG A HD3  1 
ATOM   2865 H HE   . ARG A 1 189 ? -9.442  11.443  13.912  1.00 3.28  ? 201 ARG A HE   1 
ATOM   2866 H HH11 . ARG A 1 189 ? -8.823  14.255  15.094  1.00 4.54  ? 201 ARG A HH11 1 
ATOM   2867 H HH12 . ARG A 1 189 ? -9.308  14.004  16.737  1.00 4.89  ? 201 ARG A HH12 1 
ATOM   2868 H HH21 . ARG A 1 189 ? -9.391  10.548  16.463  1.00 3.59  ? 201 ARG A HH21 1 
ATOM   2869 H HH22 . ARG A 1 189 ? -9.630  11.905  17.512  1.00 4.39  ? 201 ARG A HH22 1 
ATOM   2870 N N    . PHE A 1 190 ? -3.327  11.884  10.851  1.00 0.54  ? 202 PHE A N    1 
ATOM   2871 C CA   . PHE A 1 190 ? -1.898  12.244  10.610  1.00 0.57  ? 202 PHE A CA   1 
ATOM   2872 C C    . PHE A 1 190 ? -1.663  13.690  11.060  1.00 0.76  ? 202 PHE A C    1 
ATOM   2873 O O    . PHE A 1 190 ? -0.855  14.399  10.492  1.00 0.96  ? 202 PHE A O    1 
ATOM   2874 C CB   . PHE A 1 190 ? -1.591  12.114  9.117   1.00 0.59  ? 202 PHE A CB   1 
ATOM   2875 C CG   . PHE A 1 190 ? -0.142  11.737  8.903   1.00 0.55  ? 202 PHE A CG   1 
ATOM   2876 C CD1  . PHE A 1 190 ? 0.856   12.186  9.782   1.00 1.38  ? 202 PHE A CD1  1 
ATOM   2877 C CD2  . PHE A 1 190 ? 0.207   10.939  7.808   1.00 1.28  ? 202 PHE A CD2  1 
ATOM   2878 C CE1  . PHE A 1 190 ? 2.192   11.837  9.563   1.00 1.40  ? 202 PHE A CE1  1 
ATOM   2879 C CE2  . PHE A 1 190 ? 1.546   10.588  7.593   1.00 1.33  ? 202 PHE A CE2  1 
ATOM   2880 C CZ   . PHE A 1 190 ? 2.537   11.037  8.469   1.00 0.70  ? 202 PHE A CZ   1 
ATOM   2881 H H    . PHE A 1 190 ? -3.547  11.082  11.370  1.00 0.70  ? 202 PHE A H    1 
ATOM   2882 H HA   . PHE A 1 190 ? -1.258  11.580  11.172  1.00 0.76  ? 202 PHE A HA   1 
ATOM   2883 H HB2  . PHE A 1 190 ? -2.222  11.349  8.691   1.00 0.75  ? 202 PHE A HB2  1 
ATOM   2884 H HB3  . PHE A 1 190 ? -1.791  13.055  8.629   1.00 0.67  ? 202 PHE A HB3  1 
ATOM   2885 H HD1  . PHE A 1 190 ? 0.599   12.795  10.630  1.00 2.27  ? 202 PHE A HD1  1 
ATOM   2886 H HD2  . PHE A 1 190 ? -0.558  10.591  7.131   1.00 2.15  ? 202 PHE A HD2  1 
ATOM   2887 H HE1  . PHE A 1 190 ? 2.959   12.183  10.240  1.00 2.28  ? 202 PHE A HE1  1 
ATOM   2888 H HE2  . PHE A 1 190 ? 1.813   9.969   6.750   1.00 2.21  ? 202 PHE A HE2  1 
ATOM   2889 H HZ   . PHE A 1 190 ? 3.570   10.768  8.301   1.00 0.82  ? 202 PHE A HZ   1 
ATOM   2890 N N    . LYS A 1 191 ? -2.367  14.127  12.074  1.00 1.26  ? 203 LYS A N    1 
ATOM   2891 C CA   . LYS A 1 191 ? -2.196  15.525  12.570  1.00 1.61  ? 203 LYS A CA   1 
ATOM   2892 C C    . LYS A 1 191 ? -2.242  16.496  11.389  1.00 1.33  ? 203 LYS A C    1 
ATOM   2893 O O    . LYS A 1 191 ? -1.293  17.203  11.128  1.00 1.82  ? 203 LYS A O    1 
ATOM   2894 C CB   . LYS A 1 191 ? -0.846  15.654  13.280  1.00 2.16  ? 203 LYS A CB   1 
ATOM   2895 C CG   . LYS A 1 191 ? -0.941  15.036  14.677  1.00 2.79  ? 203 LYS A CG   1 
ATOM   2896 C CD   . LYS A 1 191 ? 0.404   15.184  15.393  1.00 3.36  ? 203 LYS A CD   1 
ATOM   2897 C CE   . LYS A 1 191 ? 0.222   16.027  16.656  1.00 4.19  ? 203 LYS A CE   1 
ATOM   2898 N NZ   . LYS A 1 191 ? 0.075   15.130  17.836  1.00 4.77  ? 203 LYS A NZ   1 
ATOM   2899 H H    . LYS A 1 191 ? -3.013  13.532  12.510  1.00 1.56  ? 203 LYS A H    1 
ATOM   2900 H HA   . LYS A 1 191 ? -2.991  15.762  13.262  1.00 2.02  ? 203 LYS A HA   1 
ATOM   2901 H HB2  . LYS A 1 191 ? -0.088  15.138  12.708  1.00 2.41  ? 203 LYS A HB2  1 
ATOM   2902 H HB3  . LYS A 1 191 ? -0.583  16.697  13.367  1.00 2.37  ? 203 LYS A HB3  1 
ATOM   2903 H HG2  . LYS A 1 191 ? -1.709  15.544  15.243  1.00 3.19  ? 203 LYS A HG2  1 
ATOM   2904 H HG3  . LYS A 1 191 ? -1.188  13.989  14.592  1.00 3.05  ? 203 LYS A HG3  1 
ATOM   2905 H HD2  . LYS A 1 191 ? 0.777   14.206  15.662  1.00 3.64  ? 203 LYS A HD2  1 
ATOM   2906 H HD3  . LYS A 1 191 ? 1.110   15.670  14.736  1.00 3.47  ? 203 LYS A HD3  1 
ATOM   2907 H HE2  . LYS A 1 191 ? 1.084   16.663  16.792  1.00 4.52  ? 203 LYS A HE2  1 
ATOM   2908 H HE3  . LYS A 1 191 ? -0.663  16.638  16.556  1.00 4.45  ? 203 LYS A HE3  1 
ATOM   2909 H HZ1  . LYS A 1 191 ? -0.483  14.294  17.570  1.00 5.05  ? 203 LYS A HZ1  1 
ATOM   2910 H HZ2  . LYS A 1 191 ? 1.015   14.827  18.161  1.00 5.10  ? 203 LYS A HZ2  1 
ATOM   2911 H HZ3  . LYS A 1 191 ? -0.410  15.641  18.602  1.00 4.91  ? 203 LYS A HZ3  1 
ATOM   2912 N N    . GLN A 1 192 ? -3.336  16.525  10.674  1.00 1.57  ? 204 GLN A N    1 
ATOM   2913 C CA   . GLN A 1 192 ? -3.457  17.437  9.503   1.00 1.68  ? 204 GLN A CA   1 
ATOM   2914 C C    . GLN A 1 192 ? -3.209  18.875  9.943   1.00 1.41  ? 204 GLN A C    1 
ATOM   2915 O O    . GLN A 1 192 ? -4.110  19.579  10.354  1.00 1.75  ? 204 GLN A O    1 
ATOM   2916 C CB   . GLN A 1 192 ? -4.861  17.320  8.908   1.00 2.45  ? 204 GLN A CB   1 
ATOM   2917 C CG   . GLN A 1 192 ? -4.913  18.060  7.571   1.00 3.39  ? 204 GLN A CG   1 
ATOM   2918 C CD   . GLN A 1 192 ? -5.360  17.095  6.471   1.00 4.31  ? 204 GLN A CD   1 
ATOM   2919 O OE1  . GLN A 1 192 ? -6.310  17.362  5.762   1.00 4.59  ? 204 GLN A OE1  1 
ATOM   2920 N NE2  . GLN A 1 192 ? -4.710  15.977  6.297   1.00 5.09  ? 204 GLN A NE2  1 
ATOM   2921 H H    . GLN A 1 192 ? -4.077  15.941  10.905  1.00 2.20  ? 204 GLN A H    1 
ATOM   2922 H HA   . GLN A 1 192 ? -2.728  17.160  8.756   1.00 1.91  ? 204 GLN A HA   1 
ATOM   2923 H HB2  . GLN A 1 192 ? -5.100  16.278  8.754   1.00 2.69  ? 204 GLN A HB2  1 
ATOM   2924 H HB3  . GLN A 1 192 ? -5.576  17.758  9.588   1.00 2.51  ? 204 GLN A HB3  1 
ATOM   2925 H HG2  . GLN A 1 192 ? -5.615  18.878  7.641   1.00 3.63  ? 204 GLN A HG2  1 
ATOM   2926 H HG3  . GLN A 1 192 ? -3.932  18.444  7.333   1.00 3.47  ? 204 GLN A HG3  1 
ATOM   2927 H HE21 . GLN A 1 192 ? -3.944  15.761  6.868   1.00 5.15  ? 204 GLN A HE21 1 
ATOM   2928 H HE22 . GLN A 1 192 ? -4.989  15.352  5.595   1.00 5.76  ? 204 GLN A HE22 1 
ATOM   2929 N N    . TYR A 1 193 ? -1.990  19.310  9.858   1.00 1.14  ? 205 TYR A N    1 
ATOM   2930 C CA   . TYR A 1 193 ? -1.663  20.705  10.269  1.00 1.40  ? 205 TYR A CA   1 
ATOM   2931 C C    . TYR A 1 193 ? -2.099  21.679  9.171   1.00 1.52  ? 205 TYR A C    1 
ATOM   2932 O O    . TYR A 1 193 ? -2.426  22.818  9.437   1.00 1.67  ? 205 TYR A O    1 
ATOM   2933 C CB   . TYR A 1 193 ? -0.155  20.836  10.503  1.00 1.73  ? 205 TYR A CB   1 
ATOM   2934 C CG   . TYR A 1 193 ? 0.593   20.370  9.276   1.00 1.34  ? 205 TYR A CG   1 
ATOM   2935 C CD1  . TYR A 1 193 ? 0.719   21.218  8.169   1.00 1.92  ? 205 TYR A CD1  1 
ATOM   2936 C CD2  . TYR A 1 193 ? 1.160   19.091  9.247   1.00 1.60  ? 205 TYR A CD2  1 
ATOM   2937 C CE1  . TYR A 1 193 ? 1.412   20.786  7.033   1.00 2.27  ? 205 TYR A CE1  1 
ATOM   2938 C CE2  . TYR A 1 193 ? 1.853   18.659  8.110   1.00 2.03  ? 205 TYR A CE2  1 
ATOM   2939 C CZ   . TYR A 1 193 ? 1.979   19.506  7.003   1.00 2.20  ? 205 TYR A CZ   1 
ATOM   2940 O OH   . TYR A 1 193 ? 2.662   19.080  5.882   1.00 2.98  ? 205 TYR A OH   1 
ATOM   2941 H H    . TYR A 1 193 ? -1.287  18.713  9.523   1.00 1.12  ? 205 TYR A H    1 
ATOM   2942 H HA   . TYR A 1 193 ? -2.188  20.940  11.183  1.00 1.55  ? 205 TYR A HA   1 
ATOM   2943 H HB2  . TYR A 1 193 ? 0.089   21.869  10.702  1.00 2.35  ? 205 TYR A HB2  1 
ATOM   2944 H HB3  . TYR A 1 193 ? 0.131   20.229  11.349  1.00 2.19  ? 205 TYR A HB3  1 
ATOM   2945 H HD1  . TYR A 1 193 ? 0.282   22.205  8.192   1.00 2.57  ? 205 TYR A HD1  1 
ATOM   2946 H HD2  . TYR A 1 193 ? 1.063   18.437  10.101  1.00 2.12  ? 205 TYR A HD2  1 
ATOM   2947 H HE1  . TYR A 1 193 ? 1.509   21.440  6.178   1.00 3.02  ? 205 TYR A HE1  1 
ATOM   2948 H HE2  . TYR A 1 193 ? 2.291   17.674  8.087   1.00 2.72  ? 205 TYR A HE2  1 
ATOM   2949 H HH   . TYR A 1 193 ? 3.546   18.822  6.154   1.00 3.23  ? 205 TYR A HH   1 
ATOM   2950 N N    . LEU A 1 194 ? -2.108  21.238  7.940   1.00 1.56  ? 206 LEU A N    1 
ATOM   2951 C CA   . LEU A 1 194 ? -2.522  22.133  6.821   1.00 1.80  ? 206 LEU A CA   1 
ATOM   2952 C C    . LEU A 1 194 ? -1.608  23.360  6.772   1.00 2.05  ? 206 LEU A C    1 
ATOM   2953 O O    . LEU A 1 194 ? -1.728  24.273  7.564   1.00 2.53  ? 206 LEU A O    1 
ATOM   2954 C CB   . LEU A 1 194 ? -3.969  22.582  7.030   1.00 1.76  ? 206 LEU A CB   1 
ATOM   2955 C CG   . LEU A 1 194 ? -4.869  21.352  7.160   1.00 1.73  ? 206 LEU A CG   1 
ATOM   2956 C CD1  . LEU A 1 194 ? -6.210  21.762  7.771   1.00 1.78  ? 206 LEU A CD1  1 
ATOM   2957 C CD2  . LEU A 1 194 ? -5.104  20.746  5.774   1.00 2.06  ? 206 LEU A CD2  1 
ATOM   2958 H H    . LEU A 1 194 ? -1.840  20.314  7.751   1.00 1.49  ? 206 LEU A H    1 
ATOM   2959 H HA   . LEU A 1 194 ? -2.446  21.595  5.888   1.00 1.90  ? 206 LEU A HA   1 
ATOM   2960 H HB2  . LEU A 1 194 ? -4.036  23.177  7.929   1.00 1.68  ? 206 LEU A HB2  1 
ATOM   2961 H HB3  . LEU A 1 194 ? -4.288  23.170  6.183   1.00 1.97  ? 206 LEU A HB3  1 
ATOM   2962 H HG   . LEU A 1 194 ? -4.391  20.622  7.798   1.00 1.67  ? 206 LEU A HG   1 
ATOM   2963 H HD11 . LEU A 1 194 ? -6.037  22.388  8.633   1.00 1.98  ? 206 LEU A HD11 1 
ATOM   2964 H HD12 . LEU A 1 194 ? -6.787  22.308  7.039   1.00 2.09  ? 206 LEU A HD12 1 
ATOM   2965 H HD13 . LEU A 1 194 ? -6.754  20.878  8.071   1.00 2.08  ? 206 LEU A HD13 1 
ATOM   2966 H HD21 . LEU A 1 194 ? -4.154  20.587  5.286   1.00 2.23  ? 206 LEU A HD21 1 
ATOM   2967 H HD22 . LEU A 1 194 ? -5.619  19.802  5.876   1.00 2.51  ? 206 LEU A HD22 1 
ATOM   2968 H HD23 . LEU A 1 194 ? -5.704  21.422  5.183   1.00 2.38  ? 206 LEU A HD23 1 
ATOM   2969 N N    . ARG A 1 195 ? -0.694  23.387  5.842   1.00 1.95  ? 207 ARG A N    1 
ATOM   2970 C CA   . ARG A 1 195 ? 0.228   24.553  5.736   1.00 2.21  ? 207 ARG A CA   1 
ATOM   2971 C C    . ARG A 1 195 ? -0.569  25.802  5.356   1.00 2.48  ? 207 ARG A C    1 
ATOM   2972 O O    . ARG A 1 195 ? -1.682  25.648  4.882   1.00 2.92  ? 207 ARG A O    1 
ATOM   2973 C CB   . ARG A 1 195 ? 1.282   24.273  4.662   1.00 2.50  ? 207 ARG A CB   1 
ATOM   2974 C CG   . ARG A 1 195 ? 2.670   24.621  5.204   1.00 2.76  ? 207 ARG A CG   1 
ATOM   2975 C CD   . ARG A 1 195 ? 3.736   23.894  4.383   1.00 3.27  ? 207 ARG A CD   1 
ATOM   2976 N NE   . ARG A 1 195 ? 5.053   24.004  5.070   1.00 3.68  ? 207 ARG A NE   1 
ATOM   2977 C CZ   . ARG A 1 195 ? 6.073   24.525  4.445   1.00 4.35  ? 207 ARG A CZ   1 
ATOM   2978 N NH1  . ARG A 1 195 ? 6.232   24.313  3.167   1.00 4.90  ? 207 ARG A NH1  1 
ATOM   2979 N NH2  . ARG A 1 195 ? 6.935   25.256  5.097   1.00 4.84  ? 207 ARG A NH2  1 
ATOM   2980 O OXT  . ARG A 1 195 ? -0.052  26.891  5.546   1.00 2.78  ? 207 ARG A OXT  1 
ATOM   2981 H H    . ARG A 1 195 ? -0.616  22.642  5.212   1.00 1.90  ? 207 ARG A H    1 
ATOM   2982 H HA   . ARG A 1 195 ? 0.717   24.712  6.686   1.00 2.32  ? 207 ARG A HA   1 
ATOM   2983 H HB2  . ARG A 1 195 ? 1.252   23.227  4.392   1.00 2.70  ? 207 ARG A HB2  1 
ATOM   2984 H HB3  . ARG A 1 195 ? 1.077   24.876  3.791   1.00 2.80  ? 207 ARG A HB3  1 
ATOM   2985 H HG2  . ARG A 1 195 ? 2.825   25.688  5.135   1.00 2.99  ? 207 ARG A HG2  1 
ATOM   2986 H HG3  . ARG A 1 195 ? 2.741   24.313  6.237   1.00 3.02  ? 207 ARG A HG3  1 
ATOM   2987 H HD2  . ARG A 1 195 ? 3.467   22.853  4.286   1.00 3.70  ? 207 ARG A HD2  1 
ATOM   2988 H HD3  . ARG A 1 195 ? 3.803   24.342  3.403   1.00 3.53  ? 207 ARG A HD3  1 
ATOM   2989 H HE   . ARG A 1 195 ? 5.154   23.686  5.992   1.00 3.81  ? 207 ARG A HE   1 
ATOM   2990 H HH11 . ARG A 1 195 ? 5.572   23.753  2.667   1.00 4.89  ? 207 ARG A HH11 1 
ATOM   2991 H HH12 . ARG A 1 195 ? 7.014   24.712  2.687   1.00 5.56  ? 207 ARG A HH12 1 
ATOM   2992 H HH21 . ARG A 1 195 ? 6.813   25.418  6.077   1.00 4.81  ? 207 ARG A HH21 1 
ATOM   2993 H HH22 . ARG A 1 195 ? 7.717   25.655  4.618   1.00 5.47  ? 207 ARG A HH22 1 
ATOM   2994 N N    . HIS B 2 1   ? -1.396  5.952   -8.268  1.00 1.09  ? 483 HIS B N    1 
ATOM   2995 C CA   . HIS B 2 1   ? -1.609  4.899   -7.235  1.00 0.69  ? 483 HIS B CA   1 
ATOM   2996 C C    . HIS B 2 1   ? -0.489  4.969   -6.194  1.00 0.66  ? 483 HIS B C    1 
ATOM   2997 O O    . HIS B 2 1   ? -0.121  3.978   -5.596  1.00 1.01  ? 483 HIS B O    1 
ATOM   2998 C CB   . HIS B 2 1   ? -1.600  3.522   -7.902  1.00 0.65  ? 483 HIS B CB   1 
ATOM   2999 C CG   . HIS B 2 1   ? -2.942  3.260   -8.529  1.00 0.58  ? 483 HIS B CG   1 
ATOM   3000 N ND1  . HIS B 2 1   ? -4.130  3.571   -7.887  1.00 0.69  ? 483 HIS B ND1  1 
ATOM   3001 C CD2  . HIS B 2 1   ? -3.300  2.719   -9.739  1.00 0.64  ? 483 HIS B CD2  1 
ATOM   3002 C CE1  . HIS B 2 1   ? -5.138  3.218   -8.706  1.00 0.79  ? 483 HIS B CE1  1 
ATOM   3003 N NE2  . HIS B 2 1   ? -4.687  2.693   -9.849  1.00 0.66  ? 483 HIS B NE2  1 
ATOM   3004 H H1   . HIS B 2 1   ? -0.383  6.181   -8.324  1.00 1.50  ? 483 HIS B H1   1 
ATOM   3005 H H2   . HIS B 2 1   ? -1.726  5.605   -9.190  1.00 1.31  ? 483 HIS B H2   1 
ATOM   3006 H H3   . HIS B 2 1   ? -1.931  6.805   -8.009  1.00 1.53  ? 483 HIS B H3   1 
ATOM   3007 H HA   . HIS B 2 1   ? -2.561  5.057   -6.750  1.00 0.75  ? 483 HIS B HA   1 
ATOM   3008 H HB2  . HIS B 2 1   ? -0.834  3.497   -8.665  1.00 0.90  ? 483 HIS B HB2  1 
ATOM   3009 H HB3  . HIS B 2 1   ? -1.394  2.764   -7.161  1.00 0.72  ? 483 HIS B HB3  1 
ATOM   3010 H HD1  . HIS B 2 1   ? -4.220  3.974   -6.999  1.00 0.82  ? 483 HIS B HD1  1 
ATOM   3011 H HD2  . HIS B 2 1   ? -2.610  2.366   -10.492 1.00 0.82  ? 483 HIS B HD2  1 
ATOM   3012 H HE1  . HIS B 2 1   ? -6.184  3.343   -8.468  1.00 1.05  ? 483 HIS B HE1  1 
ATOM   3013 N N    . ILE B 2 2   ? 0.056   6.134   -5.972  1.00 0.67  ? 484 ILE B N    1 
ATOM   3014 C CA   . ILE B 2 2   ? 1.151   6.264   -4.969  1.00 0.60  ? 484 ILE B CA   1 
ATOM   3015 C C    . ILE B 2 2   ? 0.585   6.842   -3.671  1.00 0.54  ? 484 ILE B C    1 
ATOM   3016 O O    . ILE B 2 2   ? 0.566   8.039   -3.467  1.00 0.62  ? 484 ILE B O    1 
ATOM   3017 C CB   . ILE B 2 2   ? 2.237   7.192   -5.517  1.00 0.72  ? 484 ILE B CB   1 
ATOM   3018 C CG1  . ILE B 2 2   ? 2.764   6.631   -6.840  1.00 0.79  ? 484 ILE B CG1  1 
ATOM   3019 C CG2  . ILE B 2 2   ? 3.388   7.283   -4.512  1.00 0.79  ? 484 ILE B CG2  1 
ATOM   3020 C CD1  . ILE B 2 2   ? 3.067   7.782   -7.800  1.00 0.89  ? 484 ILE B CD1  1 
ATOM   3021 H H    . ILE B 2 2   ? -0.254  6.923   -6.463  1.00 0.99  ? 484 ILE B H    1 
ATOM   3022 H HA   . ILE B 2 2   ? 1.575   5.290   -4.774  1.00 0.59  ? 484 ILE B HA   1 
ATOM   3023 H HB   . ILE B 2 2   ? 1.822   8.176   -5.680  1.00 0.81  ? 484 ILE B HB   1 
ATOM   3024 H HG12 . ILE B 2 2   ? 3.666   6.066   -6.657  1.00 0.82  ? 484 ILE B HG12 1 
ATOM   3025 H HG13 . ILE B 2 2   ? 2.018   5.985   -7.279  1.00 0.80  ? 484 ILE B HG13 1 
ATOM   3026 H HG21 . ILE B 2 2   ? 2.992   7.471   -3.526  1.00 1.00  ? 484 ILE B HG21 1 
ATOM   3027 H HG22 . ILE B 2 2   ? 3.936   6.353   -4.508  1.00 1.36  ? 484 ILE B HG22 1 
ATOM   3028 H HG23 . ILE B 2 2   ? 4.049   8.089   -4.794  1.00 1.48  ? 484 ILE B HG23 1 
ATOM   3029 H HD11 . ILE B 2 2   ? 3.439   8.629   -7.242  1.00 1.31  ? 484 ILE B HD11 1 
ATOM   3030 H HD12 . ILE B 2 2   ? 3.813   7.467   -8.515  1.00 1.43  ? 484 ILE B HD12 1 
ATOM   3031 H HD13 . ILE B 2 2   ? 2.165   8.063   -8.323  1.00 1.37  ? 484 ILE B HD13 1 
ATOM   3032 N N    . ILE B 2 3   ? 0.124   5.997   -2.790  1.00 0.44  ? 485 ILE B N    1 
ATOM   3033 C CA   . ILE B 2 3   ? -0.441  6.490   -1.502  1.00 0.41  ? 485 ILE B CA   1 
ATOM   3034 C C    . ILE B 2 3   ? 0.603   7.342   -0.779  1.00 0.42  ? 485 ILE B C    1 
ATOM   3035 O O    . ILE B 2 3   ? 1.678   6.880   -0.446  1.00 0.49  ? 485 ILE B O    1 
ATOM   3036 C CB   . ILE B 2 3   ? -0.821  5.296   -0.623  1.00 0.38  ? 485 ILE B CB   1 
ATOM   3037 C CG1  . ILE B 2 3   ? -1.663  4.305   -1.427  1.00 0.39  ? 485 ILE B CG1  1 
ATOM   3038 C CG2  . ILE B 2 3   ? -1.628  5.773   0.583   1.00 0.45  ? 485 ILE B CG2  1 
ATOM   3039 C CD1  . ILE B 2 3   ? -2.593  5.065   -2.375  1.00 0.47  ? 485 ILE B CD1  1 
ATOM   3040 H H    . ILE B 2 3   ? 0.150   5.035   -2.976  1.00 0.41  ? 485 ILE B H    1 
ATOM   3041 H HA   . ILE B 2 3   ? -1.316  7.089   -1.698  1.00 0.47  ? 485 ILE B HA   1 
ATOM   3042 H HB   . ILE B 2 3   ? 0.077   4.806   -0.280  1.00 0.35  ? 485 ILE B HB   1 
ATOM   3043 H HG12 . ILE B 2 3   ? -1.008  3.664   -1.996  1.00 0.37  ? 485 ILE B HG12 1 
ATOM   3044 H HG13 . ILE B 2 3   ? -2.254  3.705   -0.751  1.00 0.40  ? 485 ILE B HG13 1 
ATOM   3045 H HG21 . ILE B 2 3   ? -1.811  6.834   0.499   1.00 1.02  ? 485 ILE B HG21 1 
ATOM   3046 H HG22 . ILE B 2 3   ? -2.569  5.245   0.614   1.00 1.09  ? 485 ILE B HG22 1 
ATOM   3047 H HG23 . ILE B 2 3   ? -1.075  5.573   1.487   1.00 1.21  ? 485 ILE B HG23 1 
ATOM   3048 H HD11 . ILE B 2 3   ? -2.927  5.975   -1.900  1.00 0.96  ? 485 ILE B HD11 1 
ATOM   3049 H HD12 . ILE B 2 3   ? -2.063  5.307   -3.284  1.00 1.12  ? 485 ILE B HD12 1 
ATOM   3050 H HD13 . ILE B 2 3   ? -3.448  4.451   -2.609  1.00 1.09  ? 485 ILE B HD13 1 
ATOM   3051 N N    . GLU B 2 4   ? 0.292   8.585   -0.532  1.00 0.38  ? 486 GLU B N    1 
ATOM   3052 C CA   . GLU B 2 4   ? 1.259   9.473   0.171   1.00 0.41  ? 486 GLU B CA   1 
ATOM   3053 C C    . GLU B 2 4   ? 0.505   10.324  1.193   1.00 0.41  ? 486 GLU B C    1 
ATOM   3054 O O    . GLU B 2 4   ? -0.648  10.659  1.005   1.00 0.44  ? 486 GLU B O    1 
ATOM   3055 C CB   . GLU B 2 4   ? 1.953   10.376  -0.847  1.00 0.46  ? 486 GLU B CB   1 
ATOM   3056 C CG   . GLU B 2 4   ? 2.820   9.519   -1.770  1.00 0.52  ? 486 GLU B CG   1 
ATOM   3057 C CD   . GLU B 2 4   ? 3.263   10.351  -2.975  1.00 0.63  ? 486 GLU B CD   1 
ATOM   3058 O OE1  . GLU B 2 4   ? 3.935   11.348  -2.767  1.00 1.13  ? 486 GLU B OE1  1 
ATOM   3059 O OE2  . GLU B 2 4   ? 2.924   9.976   -4.085  1.00 1.39  ? 486 GLU B OE2  1 
ATOM   3060 H H    . GLU B 2 4   ? -0.581  8.934   -0.808  1.00 0.37  ? 486 GLU B H    1 
ATOM   3061 H HA   . GLU B 2 4   ? 1.996   8.869   0.680   1.00 0.44  ? 486 GLU B HA   1 
ATOM   3062 H HB2  . GLU B 2 4   ? 1.209   10.901  -1.430  1.00 0.48  ? 486 GLU B HB2  1 
ATOM   3063 H HB3  . GLU B 2 4   ? 2.577   11.090  -0.330  1.00 0.50  ? 486 GLU B HB3  1 
ATOM   3064 H HG2  . GLU B 2 4   ? 3.689   9.174   -1.229  1.00 0.56  ? 486 GLU B HG2  1 
ATOM   3065 H HG3  . GLU B 2 4   ? 2.249   8.669   -2.112  1.00 0.56  ? 486 GLU B HG3  1 
ATOM   3066 N N    . ASN B 2 5   ? 1.141   10.670  2.277   1.00 0.47  ? 487 ASN B N    1 
ATOM   3067 C CA   . ASN B 2 5   ? 0.453   11.492  3.311   1.00 0.49  ? 487 ASN B CA   1 
ATOM   3068 C C    . ASN B 2 5   ? 0.895   12.957  3.196   1.00 0.50  ? 487 ASN B C    1 
ATOM   3069 O O    . ASN B 2 5   ? 1.951   13.244  2.667   1.00 0.51  ? 487 ASN B O    1 
ATOM   3070 C CB   . ASN B 2 5   ? 0.817   10.956  4.696   1.00 0.53  ? 487 ASN B CB   1 
ATOM   3071 C CG   . ASN B 2 5   ? 0.095   9.628   4.934   1.00 0.92  ? 487 ASN B CG   1 
ATOM   3072 O OD1  . ASN B 2 5   ? -1.117  9.564   4.886   1.00 1.71  ? 487 ASN B OD1  1 
ATOM   3073 N ND2  . ASN B 2 5   ? 0.794   8.556   5.193   1.00 1.25  ? 487 ASN B ND2  1 
ATOM   3074 H H    . ASN B 2 5   ? 2.069   10.385  2.414   1.00 0.55  ? 487 ASN B H    1 
ATOM   3075 H HA   . ASN B 2 5   ? -0.614  11.420  3.167   1.00 0.53  ? 487 ASN B HA   1 
ATOM   3076 H HB2  . ASN B 2 5   ? 1.885   10.801  4.751   1.00 0.70  ? 487 ASN B HB2  1 
ATOM   3077 H HB3  . ASN B 2 5   ? 0.517   11.667  5.448   1.00 0.61  ? 487 ASN B HB3  1 
ATOM   3078 H HD21 . ASN B 2 5   ? 1.772   8.607   5.233   1.00 1.73  ? 487 ASN B HD21 1 
ATOM   3079 H HD22 . ASN B 2 5   ? 0.341   7.701   5.349   1.00 1.50  ? 487 ASN B HD22 1 
ATOM   3080 N N    . PRO B 2 6   ? 0.067   13.840  3.700   1.00 0.53  ? 488 PRO B N    1 
ATOM   3081 C CA   . PRO B 2 6   ? 0.327   15.286  3.679   1.00 0.60  ? 488 PRO B CA   1 
ATOM   3082 C C    . PRO B 2 6   ? 1.375   15.675  4.734   1.00 0.64  ? 488 PRO B C    1 
ATOM   3083 O O    . PRO B 2 6   ? 1.832   16.801  4.770   1.00 0.73  ? 488 PRO B O    1 
ATOM   3084 C CB   . PRO B 2 6   ? -1.007  15.946  4.005   1.00 0.67  ? 488 PRO B CB   1 
ATOM   3085 C CG   . PRO B 2 6   ? -1.741  14.859  4.827   1.00 0.61  ? 488 PRO B CG   1 
ATOM   3086 C CD   . PRO B 2 6   ? -1.219  13.484  4.341   1.00 0.54  ? 488 PRO B CD   1 
ATOM   3087 H HA   . PRO B 2 6   ? 0.653   15.592  2.699   1.00 0.63  ? 488 PRO B HA   1 
ATOM   3088 H HB2  . PRO B 2 6   ? -0.854  16.842  4.594   1.00 0.73  ? 488 PRO B HB2  1 
ATOM   3089 H HB3  . PRO B 2 6   ? -1.558  16.163  3.105   1.00 0.72  ? 488 PRO B HB3  1 
ATOM   3090 H HG2  . PRO B 2 6   ? -1.526  14.988  5.879   1.00 0.62  ? 488 PRO B HG2  1 
ATOM   3091 H HG3  . PRO B 2 6   ? -2.805  14.924  4.657   1.00 0.67  ? 488 PRO B HG3  1 
ATOM   3092 H HD2  . PRO B 2 6   ? -1.066  12.818  5.178   1.00 0.52  ? 488 PRO B HD2  1 
ATOM   3093 H HD3  . PRO B 2 6   ? -1.892  13.051  3.619   1.00 0.57  ? 488 PRO B HD3  1 
ATOM   3094 N N    . GLN B 2 7   ? 1.762   14.769  5.595   1.00 0.65  ? 489 GLN B N    1 
ATOM   3095 C CA   . GLN B 2 7   ? 2.774   15.117  6.630   1.00 0.74  ? 489 GLN B CA   1 
ATOM   3096 C C    . GLN B 2 7   ? 4.170   14.780  6.108   1.00 0.79  ? 489 GLN B C    1 
ATOM   3097 O O    . GLN B 2 7   ? 5.090   15.566  6.212   1.00 1.04  ? 489 GLN B O    1 
ATOM   3098 C CB   . GLN B 2 7   ? 2.497   14.314  7.903   1.00 0.79  ? 489 GLN B CB   1 
ATOM   3099 C CG   . GLN B 2 7   ? 2.012   15.255  9.008   1.00 1.13  ? 489 GLN B CG   1 
ATOM   3100 C CD   . GLN B 2 7   ? 3.214   15.951  9.649   1.00 1.87  ? 489 GLN B CD   1 
ATOM   3101 O OE1  . GLN B 2 7   ? 4.069   16.471  8.959   1.00 2.26  ? 489 GLN B OE1  1 
ATOM   3102 N NE2  . GLN B 2 7   ? 3.318   15.983  10.949  1.00 2.77  ? 489 GLN B NE2  1 
ATOM   3103 H H    . GLN B 2 7   ? 1.391   13.864  5.564   1.00 0.65  ? 489 GLN B H    1 
ATOM   3104 H HA   . GLN B 2 7   ? 2.716   16.173  6.850   1.00 0.80  ? 489 GLN B HA   1 
ATOM   3105 H HB2  . GLN B 2 7   ? 1.737   13.573  7.702   1.00 0.80  ? 489 GLN B HB2  1 
ATOM   3106 H HB3  . GLN B 2 7   ? 3.403   13.823  8.224   1.00 1.02  ? 489 GLN B HB3  1 
ATOM   3107 H HG2  . GLN B 2 7   ? 1.348   15.995  8.586   1.00 1.63  ? 489 GLN B HG2  1 
ATOM   3108 H HG3  . GLN B 2 7   ? 1.486   14.686  9.760   1.00 1.12  ? 489 GLN B HG3  1 
ATOM   3109 H HE21 . GLN B 2 7   ? 2.629   15.564  11.506  1.00 3.12  ? 489 GLN B HE21 1 
ATOM   3110 H HE22 . GLN B 2 7   ? 4.085   16.426  11.369  1.00 3.36  ? 489 GLN B HE22 1 
HETATM 3111 N N    . PTR B 2 8   ? 4.332   13.615  5.546   1.00 0.75  ? 490 PTR B N    1 
HETATM 3112 C CA   . PTR B 2 8   ? 5.666   13.224  5.016   1.00 0.82  ? 490 PTR B CA   1 
HETATM 3113 C C    . PTR B 2 8   ? 5.841   13.797  3.608   1.00 0.80  ? 490 PTR B C    1 
HETATM 3114 O O    . PTR B 2 8   ? 6.790   14.502  3.330   1.00 1.45  ? 490 PTR B O    1 
HETATM 3115 C CB   . PTR B 2 8   ? 5.762   11.697  4.973   1.00 0.97  ? 490 PTR B CB   1 
HETATM 3116 C CG   . PTR B 2 8   ? 7.122   11.258  5.463   1.00 0.79  ? 490 PTR B CG   1 
HETATM 3117 C CD1  . PTR B 2 8   ? 7.230   10.478  6.621   1.00 1.30  ? 490 PTR B CD1  1 
HETATM 3118 C CD2  . PTR B 2 8   ? 8.273   11.624  4.756   1.00 1.61  ? 490 PTR B CD2  1 
HETATM 3119 C CE1  . PTR B 2 8   ? 8.490   10.066  7.072   1.00 1.43  ? 490 PTR B CE1  1 
HETATM 3120 C CE2  . PTR B 2 8   ? 9.532   11.212  5.207   1.00 1.80  ? 490 PTR B CE2  1 
HETATM 3121 C CZ   . PTR B 2 8   ? 9.640   10.432  6.364   1.00 1.28  ? 490 PTR B CZ   1 
HETATM 3122 O OH   . PTR B 2 8   ? 10.900  10.021  6.815   1.00 1.70  ? 490 PTR B OH   1 
HETATM 3123 P P    . PTR B 2 8   ? 11.824  11.088  7.479   1.00 2.39  ? 490 PTR B P    1 
HETATM 3124 O O1P  . PTR B 2 8   ? 12.379  11.915  6.292   1.00 3.02  ? 490 PTR B O1P  1 
HETATM 3125 O O2P  . PTR B 2 8   ? 12.982  10.268  8.104   1.00 2.84  ? 490 PTR B O2P  1 
HETATM 3126 O O3P  . PTR B 2 8   ? 10.869  11.864  8.503   1.00 2.88  ? 490 PTR B O3P  1 
HETATM 3127 H H    . PTR B 2 8   ? 3.576   12.997  5.472   1.00 0.84  ? 490 PTR B H    1 
HETATM 3128 H HA   . PTR B 2 8   ? 6.438   13.616  5.659   1.00 0.93  ? 490 PTR B HA   1 
HETATM 3129 H HB2  . PTR B 2 8   ? 5.618   11.356  3.960   1.00 1.27  ? 490 PTR B HB2  1 
HETATM 3130 H HB3  . PTR B 2 8   ? 4.998   11.272  5.607   1.00 1.25  ? 490 PTR B HB3  1 
HETATM 3131 H HD1  . PTR B 2 8   ? 6.342   10.196  7.166   1.00 2.12  ? 490 PTR B HD1  1 
HETATM 3132 H HD2  . PTR B 2 8   ? 8.189   12.225  3.864   1.00 2.43  ? 490 PTR B HD2  1 
HETATM 3133 H HE1  . PTR B 2 8   ? 8.573   9.464   7.965   1.00 2.22  ? 490 PTR B HE1  1 
HETATM 3134 H HE2  . PTR B 2 8   ? 10.419  11.496  4.663   1.00 2.70  ? 490 PTR B HE2  1 
HETATM 3135 H HO3P . PTR B 2 8   ? 11.231  12.706  8.745   1.00 3.16  ? 490 PTR B HO3P 1 
ATOM   3136 N N    . PHE B 2 9   ? 4.934   13.505  2.717   1.00 0.67  ? 491 PHE B N    1 
ATOM   3137 C CA   . PHE B 2 9   ? 5.054   14.040  1.331   1.00 0.65  ? 491 PHE B CA   1 
ATOM   3138 C C    . PHE B 2 9   ? 4.119   15.239  1.168   1.00 0.81  ? 491 PHE B C    1 
ATOM   3139 O O    . PHE B 2 9   ? 2.912   15.111  1.234   1.00 1.36  ? 491 PHE B O    1 
ATOM   3140 C CB   . PHE B 2 9   ? 4.670   12.952  0.326   1.00 0.73  ? 491 PHE B CB   1 
ATOM   3141 C CG   . PHE B 2 9   ? 5.873   12.089  0.034   1.00 0.64  ? 491 PHE B CG   1 
ATOM   3142 C CD1  . PHE B 2 9   ? 6.421   11.291  1.044   1.00 1.35  ? 491 PHE B CD1  1 
ATOM   3143 C CD2  . PHE B 2 9   ? 6.440   12.085  -1.246  1.00 1.31  ? 491 PHE B CD2  1 
ATOM   3144 C CE1  . PHE B 2 9   ? 7.535   10.488  0.776   1.00 1.37  ? 491 PHE B CE1  1 
ATOM   3145 C CE2  . PHE B 2 9   ? 7.554   11.281  -1.515  1.00 1.48  ? 491 PHE B CE2  1 
ATOM   3146 C CZ   . PHE B 2 9   ? 8.101   10.483  -0.503  1.00 0.98  ? 491 PHE B CZ   1 
ATOM   3147 H H    . PHE B 2 9   ? 4.173   12.936  2.960   1.00 1.12  ? 491 PHE B H    1 
ATOM   3148 H HA   . PHE B 2 9   ? 6.073   14.351  1.154   1.00 0.64  ? 491 PHE B HA   1 
ATOM   3149 H HB2  . PHE B 2 9   ? 3.881   12.342  0.740   1.00 0.88  ? 491 PHE B HB2  1 
ATOM   3150 H HB3  . PHE B 2 9   ? 4.328   13.413  -0.589  1.00 0.98  ? 491 PHE B HB3  1 
ATOM   3151 H HD1  . PHE B 2 9   ? 5.984   11.295  2.029   1.00 2.18  ? 491 PHE B HD1  1 
ATOM   3152 H HD2  . PHE B 2 9   ? 6.017   12.701  -2.026  1.00 2.08  ? 491 PHE B HD2  1 
ATOM   3153 H HE1  . PHE B 2 9   ? 7.957   9.872   1.556   1.00 2.15  ? 491 PHE B HE1  1 
ATOM   3154 H HE2  . PHE B 2 9   ? 7.991   11.277  -2.502  1.00 2.33  ? 491 PHE B HE2  1 
ATOM   3155 H HZ   . PHE B 2 9   ? 8.960   9.862   -0.711  1.00 1.20  ? 491 PHE B HZ   1 
ATOM   3156 N N    . SER B 2 10  ? 4.665   16.405  0.956   1.00 1.04  ? 492 SER B N    1 
ATOM   3157 C CA   . SER B 2 10  ? 3.807   17.612  0.789   1.00 1.20  ? 492 SER B CA   1 
ATOM   3158 C C    . SER B 2 10  ? 3.758   18.003  -0.689  1.00 1.24  ? 492 SER B C    1 
ATOM   3159 O O    . SER B 2 10  ? 4.776   18.196  -1.323  1.00 1.86  ? 492 SER B O    1 
ATOM   3160 C CB   . SER B 2 10  ? 4.389   18.768  1.603   1.00 1.81  ? 492 SER B CB   1 
ATOM   3161 O OG   . SER B 2 10  ? 3.704   19.968  1.267   1.00 2.28  ? 492 SER B OG   1 
ATOM   3162 H H    . SER B 2 10  ? 5.641   16.487  0.906   1.00 1.48  ? 492 SER B H    1 
ATOM   3163 H HA   . SER B 2 10  ? 2.808   17.393  1.137   1.00 1.52  ? 492 SER B HA   1 
ATOM   3164 H HB2  . SER B 2 10  ? 4.264   18.571  2.654   1.00 2.39  ? 492 SER B HB2  1 
ATOM   3165 H HB3  . SER B 2 10  ? 5.443   18.868  1.380   1.00 2.12  ? 492 SER B HB3  1 
ATOM   3166 H HG   . SER B 2 10  ? 4.360   20.659  1.143   1.00 2.74  ? 492 SER B HG   1 
ATOM   3167 N N    . ASP B 2 11  ? 2.583   18.122  -1.243  1.00 1.51  ? 493 ASP B N    1 
ATOM   3168 C CA   . ASP B 2 11  ? 2.472   18.501  -2.680  1.00 2.18  ? 493 ASP B CA   1 
ATOM   3169 C C    . ASP B 2 11  ? 1.392   19.572  -2.845  1.00 2.34  ? 493 ASP B C    1 
ATOM   3170 O O    . ASP B 2 11  ? 0.277   19.288  -3.234  1.00 3.07  ? 493 ASP B O    1 
ATOM   3171 C CB   . ASP B 2 11  ? 2.099   17.267  -3.504  1.00 3.03  ? 493 ASP B CB   1 
ATOM   3172 C CG   . ASP B 2 11  ? 3.332   16.767  -4.259  1.00 3.73  ? 493 ASP B CG   1 
ATOM   3173 O OD1  . ASP B 2 11  ? 4.422   16.904  -3.729  1.00 4.26  ? 493 ASP B OD1  1 
ATOM   3174 O OD2  . ASP B 2 11  ? 3.165   16.255  -5.354  1.00 4.18  ? 493 ASP B OD2  1 
ATOM   3175 H H    . ASP B 2 11  ? 1.773   17.963  -0.715  1.00 1.76  ? 493 ASP B H    1 
ATOM   3176 H HA   . ASP B 2 11  ? 3.420   18.890  -3.023  1.00 2.46  ? 493 ASP B HA   1 
ATOM   3177 H HB2  . ASP B 2 11  ? 1.739   16.490  -2.846  1.00 3.14  ? 493 ASP B HB2  1 
ATOM   3178 H HB3  . ASP B 2 11  ? 1.327   17.527  -4.212  1.00 3.45  ? 493 ASP B HB3  1 
ATOM   3179 N N    . ALA B 2 12  ? 1.713   20.803  -2.553  1.00 2.21  ? 494 ALA B N    1 
ATOM   3180 C CA   . ALA B 2 12  ? 0.704   21.890  -2.694  1.00 2.75  ? 494 ALA B CA   1 
ATOM   3181 C C    . ALA B 2 12  ? 1.383   23.247  -2.495  1.00 3.32  ? 494 ALA B C    1 
ATOM   3182 O O    . ALA B 2 12  ? 2.562   23.346  -2.789  1.00 3.74  ? 494 ALA B O    1 
ATOM   3183 C CB   . ALA B 2 12  ? -0.391  21.709  -1.641  1.00 3.18  ? 494 ALA B CB   1 
ATOM   3184 O OXT  . ALA B 2 12  ? 0.711   24.164  -2.051  1.00 3.85  ? 494 ALA B OXT  1 
ATOM   3185 H H    . ALA B 2 12  ? 2.619   21.012  -2.240  1.00 2.20  ? 494 ALA B H    1 
ATOM   3186 H HA   . ALA B 2 12  ? 0.266   21.848  -3.680  1.00 3.11  ? 494 ALA B HA   1 
ATOM   3187 H HB1  . ALA B 2 12  ? -0.853  20.740  -1.765  1.00 3.44  ? 494 ALA B HB1  1 
ATOM   3188 H HB2  . ALA B 2 12  ? 0.043   21.777  -0.654  1.00 3.48  ? 494 ALA B HB2  1 
ATOM   3189 H HB3  . ALA B 2 12  ? -1.137  22.481  -1.760  1.00 3.61  ? 494 ALA B HB3  1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   13  13  GLY GLY A . n 
A 1 2   SER 2   14  14  SER SER A . n 
A 1 3   HIS 3   15  15  HIS HIS A . n 
A 1 4   MET 4   16  16  MET MET A . n 
A 1 5   GLY 5   17  17  GLY GLY A . n 
A 1 6   GLN 6   18  18  GLN GLN A . n 
A 1 7   LEU 7   19  19  LEU LEU A . n 
A 1 8   GLY 8   20  20  GLY GLY A . n 
A 1 9   GLY 9   21  21  GLY GLY A . n 
A 1 10  GLU 10  22  22  GLU GLU A . n 
A 1 11  GLU 11  23  23  GLU GLU A . n 
A 1 12  TRP 12  24  24  TRP TRP A . n 
A 1 13  THR 13  25  25  THR THR A . n 
A 1 14  ARG 14  26  26  ARG ARG A . n 
A 1 15  HIS 15  27  27  HIS HIS A . n 
A 1 16  GLY 16  28  28  GLY GLY A . n 
A 1 17  SER 17  29  29  SER SER A . n 
A 1 18  PHE 18  30  30  PHE PHE A . n 
A 1 19  VAL 19  31  31  VAL VAL A . n 
A 1 20  ASN 20  32  32  ASN ASN A . n 
A 1 21  LYS 21  33  33  LYS LYS A . n 
A 1 22  PRO 22  34  34  PRO PRO A . n 
A 1 23  THR 23  35  35  THR THR A . n 
A 1 24  ARG 24  36  36  ARG ARG A . n 
A 1 25  GLY 25  37  37  GLY GLY A . n 
A 1 26  TRP 26  38  38  TRP TRP A . n 
A 1 27  LEU 27  39  39  LEU LEU A . n 
A 1 28  HIS 28  40  40  HIS HIS A . n 
A 1 29  PRO 29  41  41  PRO PRO A . n 
A 1 30  ASN 30  42  42  ASN ASN A . n 
A 1 31  ASP 31  43  43  ASP ASP A . n 
A 1 32  LYS 32  44  44  LYS LYS A . n 
A 1 33  VAL 33  45  45  VAL VAL A . n 
A 1 34  MET 34  46  46  MET MET A . n 
A 1 35  GLY 35  47  47  GLY GLY A . n 
A 1 36  PRO 36  48  48  PRO PRO A . n 
A 1 37  GLY 37  49  49  GLY GLY A . n 
A 1 38  VAL 38  50  50  VAL VAL A . n 
A 1 39  SER 39  51  51  SER SER A . n 
A 1 40  TYR 40  52  52  TYR TYR A . n 
A 1 41  LEU 41  53  53  LEU LEU A . n 
A 1 42  VAL 42  54  54  VAL VAL A . n 
A 1 43  ARG 43  55  55  ARG ARG A . n 
A 1 44  TYR 44  56  56  TYR TYR A . n 
A 1 45  MET 45  57  57  MET MET A . n 
A 1 46  GLY 46  58  58  GLY GLY A . n 
A 1 47  CYS 47  59  59  CYS CYS A . n 
A 1 48  VAL 48  60  60  VAL VAL A . n 
A 1 49  GLU 49  61  61  GLU GLU A . n 
A 1 50  VAL 50  62  62  VAL VAL A . n 
A 1 51  LEU 51  63  63  LEU LEU A . n 
A 1 52  GLN 52  64  64  GLN GLN A . n 
A 1 53  SER 53  65  65  SER SER A . n 
A 1 54  MET 54  66  66  MET MET A . n 
A 1 55  ARG 55  67  67  ARG ARG A . n 
A 1 56  ALA 56  68  68  ALA ALA A . n 
A 1 57  LEU 57  69  69  LEU LEU A . n 
A 1 58  ASP 58  70  70  ASP ASP A . n 
A 1 59  PHE 59  71  71  PHE PHE A . n 
A 1 60  ASN 60  72  72  ASN ASN A . n 
A 1 61  THR 61  73  73  THR THR A . n 
A 1 62  ARG 62  74  74  ARG ARG A . n 
A 1 63  THR 63  75  75  THR THR A . n 
A 1 64  GLN 64  76  76  GLN GLN A . n 
A 1 65  VAL 65  77  77  VAL VAL A . n 
A 1 66  THR 66  78  78  THR THR A . n 
A 1 67  ARG 67  79  79  ARG ARG A . n 
A 1 68  GLU 68  80  80  GLU GLU A . n 
A 1 69  ALA 69  81  81  ALA ALA A . n 
A 1 70  ILE 70  82  82  ILE ILE A . n 
A 1 71  SER 71  83  83  SER SER A . n 
A 1 72  LEU 72  84  84  LEU LEU A . n 
A 1 73  VAL 73  85  85  VAL VAL A . n 
A 1 74  CYS 74  86  86  CYS CYS A . n 
A 1 75  GLU 75  87  87  GLU GLU A . n 
A 1 76  ALA 76  88  88  ALA ALA A . n 
A 1 77  VAL 77  89  89  VAL VAL A . n 
A 1 78  PRO 78  90  90  PRO PRO A . n 
A 1 79  GLY 79  91  91  GLY GLY A . n 
A 1 80  ALA 80  92  92  ALA ALA A . n 
A 1 81  LYS 81  93  93  LYS LYS A . n 
A 1 82  GLY 82  94  94  GLY GLY A . n 
A 1 83  ALA 83  95  95  ALA ALA A . n 
A 1 84  THR 84  96  96  THR THR A . n 
A 1 85  ARG 85  97  97  ARG ARG A . n 
A 1 86  ARG 86  98  98  ARG ARG A . n 
A 1 87  ARG 87  99  99  ARG ARG A . n 
A 1 88  LYS 88  100 100 LYS LYS A . n 
A 1 89  PRO 89  101 101 PRO PRO A . n 
A 1 90  CYS 90  102 102 CYS CYS A . n 
A 1 91  SER 91  103 103 SER SER A . n 
A 1 92  ARG 92  104 104 ARG ARG A . n 
A 1 93  PRO 93  105 105 PRO PRO A . n 
A 1 94  LEU 94  106 106 LEU LEU A . n 
A 1 95  SER 95  107 107 SER SER A . n 
A 1 96  SER 96  108 108 SER SER A . n 
A 1 97  ILE 97  109 109 ILE ILE A . n 
A 1 98  LEU 98  110 110 LEU LEU A . n 
A 1 99  GLY 99  111 111 GLY GLY A . n 
A 1 100 ARG 100 112 112 ARG ARG A . n 
A 1 101 SER 101 113 113 SER SER A . n 
A 1 102 ASN 102 114 114 ASN ASN A . n 
A 1 103 LEU 103 115 115 LEU LEU A . n 
A 1 104 LYS 104 116 116 LYS LYS A . n 
A 1 105 PHE 105 117 117 PHE PHE A . n 
A 1 106 ALA 106 118 118 ALA ALA A . n 
A 1 107 GLY 107 119 119 GLY GLY A . n 
A 1 108 MET 108 120 120 MET MET A . n 
A 1 109 PRO 109 121 121 PRO PRO A . n 
A 1 110 ILE 110 122 122 ILE ILE A . n 
A 1 111 THR 111 123 123 THR THR A . n 
A 1 112 LEU 112 124 124 LEU LEU A . n 
A 1 113 THR 113 125 125 THR THR A . n 
A 1 114 VAL 114 126 126 VAL VAL A . n 
A 1 115 SER 115 127 127 SER SER A . n 
A 1 116 THR 116 128 128 THR THR A . n 
A 1 117 SER 117 129 129 SER SER A . n 
A 1 118 SER 118 130 130 SER SER A . n 
A 1 119 LEU 119 131 131 LEU LEU A . n 
A 1 120 ASN 120 132 132 ASN ASN A . n 
A 1 121 LEU 121 133 133 LEU LEU A . n 
A 1 122 MET 122 134 134 MET MET A . n 
A 1 123 ALA 123 135 135 ALA ALA A . n 
A 1 124 ALA 124 136 136 ALA ALA A . n 
A 1 125 ASP 125 137 137 ASP ASP A . n 
A 1 126 CYS 126 138 138 CYS CYS A . n 
A 1 127 LYS 127 139 139 LYS LYS A . n 
A 1 128 GLN 128 140 140 GLN GLN A . n 
A 1 129 ILE 129 141 141 ILE ILE A . n 
A 1 130 ILE 130 142 142 ILE ILE A . n 
A 1 131 ALA 131 143 143 ALA ALA A . n 
A 1 132 ASN 132 144 144 ASN ASN A . n 
A 1 133 HIS 133 145 145 HIS HIS A . n 
A 1 134 HIS 134 146 146 HIS HIS A . n 
A 1 135 MET 135 147 147 MET MET A . n 
A 1 136 GLN 136 148 148 GLN GLN A . n 
A 1 137 SER 137 149 149 SER SER A . n 
A 1 138 ILE 138 150 150 ILE ILE A . n 
A 1 139 SER 139 151 151 SER SER A . n 
A 1 140 PHE 140 152 152 PHE PHE A . n 
A 1 141 ALA 141 153 153 ALA ALA A . n 
A 1 142 SER 142 154 154 SER SER A . n 
A 1 143 GLY 143 155 155 GLY GLY A . n 
A 1 144 GLY 144 156 156 GLY GLY A . n 
A 1 145 ASP 145 157 157 ASP ASP A . n 
A 1 146 PRO 146 158 158 PRO PRO A . n 
A 1 147 ASP 147 159 159 ASP ASP A . n 
A 1 148 THR 148 160 160 THR THR A . n 
A 1 149 ALA 149 161 161 ALA ALA A . n 
A 1 150 GLU 150 162 162 GLU GLU A . n 
A 1 151 TYR 151 163 163 TYR TYR A . n 
A 1 152 VAL 152 164 164 VAL VAL A . n 
A 1 153 ALA 153 165 165 ALA ALA A . n 
A 1 154 TYR 154 166 166 TYR TYR A . n 
A 1 155 VAL 155 167 167 VAL VAL A . n 
A 1 156 ALA 156 168 168 ALA ALA A . n 
A 1 157 LYS 157 169 169 LYS LYS A . n 
A 1 158 ASP 158 170 170 ASP ASP A . n 
A 1 159 PRO 159 171 171 PRO PRO A . n 
A 1 160 VAL 160 172 172 VAL VAL A . n 
A 1 161 ASN 161 173 173 ASN ASN A . n 
A 1 162 GLN 162 174 174 GLN GLN A . n 
A 1 163 ARG 163 175 175 ARG ARG A . n 
A 1 164 ALA 164 176 176 ALA ALA A . n 
A 1 165 CYS 165 177 177 CYS CYS A . n 
A 1 166 HIS 166 178 178 HIS HIS A . n 
A 1 167 ILE 167 179 179 ILE ILE A . n 
A 1 168 LEU 168 180 180 LEU LEU A . n 
A 1 169 GLU 169 181 181 GLU GLU A . n 
A 1 170 CYS 170 182 182 CYS CYS A . n 
A 1 171 PRO 171 183 183 PRO PRO A . n 
A 1 172 GLU 172 184 184 GLU GLU A . n 
A 1 173 GLY 173 185 185 GLY GLY A . n 
A 1 174 LEU 174 186 186 LEU LEU A . n 
A 1 175 ALA 175 187 187 ALA ALA A . n 
A 1 176 GLN 176 188 188 GLN GLN A . n 
A 1 177 ASP 177 189 189 ASP ASP A . n 
A 1 178 VAL 178 190 190 VAL VAL A . n 
A 1 179 ILE 179 191 191 ILE ILE A . n 
A 1 180 SER 180 192 192 SER SER A . n 
A 1 181 THR 181 193 193 THR THR A . n 
A 1 182 ILE 182 194 194 ILE ILE A . n 
A 1 183 GLY 183 195 195 GLY GLY A . n 
A 1 184 GLN 184 196 196 GLN GLN A . n 
A 1 185 ALA 185 197 197 ALA ALA A . n 
A 1 186 PHE 186 198 198 PHE PHE A . n 
A 1 187 GLU 187 199 199 GLU GLU A . n 
A 1 188 LEU 188 200 200 LEU LEU A . n 
A 1 189 ARG 189 201 201 ARG ARG A . n 
A 1 190 PHE 190 202 202 PHE PHE A . n 
A 1 191 LYS 191 203 203 LYS LYS A . n 
A 1 192 GLN 192 204 204 GLN GLN A . n 
A 1 193 TYR 193 205 205 TYR TYR A . n 
A 1 194 LEU 194 206 206 LEU LEU A . n 
A 1 195 ARG 195 207 207 ARG ARG A . n 
B 2 1   HIS 1   483 483 HIS HIS B . n 
B 2 2   ILE 2   484 484 ILE ILE B . n 
B 2 3   ILE 3   485 485 ILE ILE B . n 
B 2 4   GLU 4   486 486 GLU GLU B . n 
B 2 5   ASN 5   487 487 ASN ASN B . n 
B 2 6   PRO 6   488 488 PRO PRO B . n 
B 2 7   GLN 7   489 489 GLN GLN B . n 
B 2 8   PTR 8   490 490 PTR PTR B . n 
B 2 9   PHE 9   491 491 PHE PHE B . n 
B 2 10  SER 10  492 492 SER SER B . n 
B 2 11  ASP 11  493 493 ASP ASP B . n 
B 2 12  ALA 12  494 494 ALA ALA B . n 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    B 
_pdbx_struct_mod_residue.label_comp_id    PTR 
_pdbx_struct_mod_residue.label_seq_id     8 
_pdbx_struct_mod_residue.auth_asym_id     B 
_pdbx_struct_mod_residue.auth_comp_id     PTR 
_pdbx_struct_mod_residue.auth_seq_id      490 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   TYR 
_pdbx_struct_mod_residue.details          O-PHOSPHOTYROSINE 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1997-05-15 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR 'model building' . ? 1 
X-PLOR refinement       . ? 2 
X-PLOR phasing          . ? 3 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 HIS A 15  ? ? 179.71  -37.51  
2  1 MET A 16  ? ? -54.61  -79.38  
3  1 GLN A 18  ? ? 41.05   -159.82 
4  1 LEU A 19  ? ? 58.00   -179.58 
5  1 GLU A 22  ? ? -162.16 29.87   
6  1 TRP A 24  ? ? 35.87   50.31   
7  1 THR A 25  ? ? -162.02 60.58   
8  1 HIS A 27  ? ? -68.64  -169.59 
9  1 PHE A 30  ? ? 38.46   -88.72  
10 1 VAL A 31  ? ? 82.93   -49.86  
11 1 THR A 35  ? ? -60.67  -100.22 
12 1 ARG A 36  ? ? 173.83  -34.61  
13 1 TRP A 38  ? ? 54.34   -166.37 
14 1 VAL A 50  ? ? -58.21  174.79  
15 1 SER A 51  ? ? -167.33 93.61   
16 1 LEU A 63  ? ? -140.71 28.36   
17 1 SER A 65  ? ? -62.97  -172.84 
18 1 LEU A 69  ? ? -117.64 -73.11  
19 1 ASP A 70  ? ? 59.02   108.89  
20 1 GLU A 87  ? ? -100.38 -68.06  
21 1 PRO A 90  ? ? -44.97  155.49  
22 1 ALA A 92  ? ? -72.85  -164.40 
23 1 ALA A 95  ? ? 177.44  39.62   
24 1 ARG A 98  ? ? -167.32 36.95   
25 1 ARG A 99  ? ? 56.00   86.35   
26 1 PRO A 101 ? ? -70.32  -83.74  
27 1 CYS A 102 ? ? 62.98   157.50  
28 1 SER A 103 ? ? -65.30  -157.72 
29 1 ARG A 104 ? ? -161.75 67.13   
30 1 PRO A 105 ? ? -48.15  93.81   
31 1 LEU A 106 ? ? -172.85 125.52  
32 1 SER A 107 ? ? -105.09 -62.84  
33 1 ILE A 109 ? ? -154.31 83.19   
34 1 LEU A 110 ? ? 173.70  -168.69 
35 1 ARG A 112 ? ? 175.65  140.81  
36 1 LEU A 115 ? ? -96.20  53.19   
37 1 THR A 128 ? ? -65.26  94.96   
38 1 SER A 129 ? ? 73.49   36.53   
39 1 SER A 130 ? ? -152.04 70.95   
40 1 ASP A 137 ? ? -104.89 -69.01  
41 1 LYS A 139 ? ? 54.23   70.89   
42 1 GLN A 140 ? ? -142.18 -158.45 
43 1 ILE A 142 ? ? -66.46  92.61   
44 1 ALA A 143 ? ? 62.71   122.87  
45 1 HIS A 145 ? ? -157.46 53.23   
46 1 MET A 147 ? ? -168.44 67.18   
47 1 GLN A 148 ? ? -158.63 -41.19  
48 1 SER A 149 ? ? -104.27 -87.95  
49 1 ILE A 150 ? ? 50.89   -154.13 
50 1 SER A 151 ? ? -176.60 -52.93  
51 1 SER A 154 ? ? -177.22 -172.35 
52 1 PRO A 158 ? ? -74.69  -168.09 
53 1 ASP A 159 ? ? 68.73   -84.64  
54 1 GLU A 162 ? ? 179.82  -48.57  
55 1 LYS A 169 ? ? -173.50 145.12  
56 1 ASP A 170 ? ? 174.54  -58.88  
57 1 ASN A 173 ? ? -97.53  36.87   
58 1 GLU A 184 ? ? 77.31   89.09   
59 1 LEU A 186 ? ? -147.53 -93.03  
60 1 ALA A 187 ? ? 37.59   -91.42  
61 1 GLN A 196 ? ? -59.03  -71.69  
62 1 GLU A 199 ? ? -91.32  32.49   
63 1 ARG A 201 ? ? -125.00 -86.85  
64 1 GLN A 204 ? ? -56.54  91.94   
65 1 LEU A 206 ? ? 59.17   103.66  
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1  1 ARG A 26  ? ? 0.231 'SIDE CHAIN' 
2  1 ARG A 36  ? ? 0.239 'SIDE CHAIN' 
3  1 ARG A 55  ? ? 0.192 'SIDE CHAIN' 
4  1 ARG A 67  ? ? 0.295 'SIDE CHAIN' 
5  1 ARG A 74  ? ? 0.192 'SIDE CHAIN' 
6  1 ARG A 79  ? ? 0.316 'SIDE CHAIN' 
7  1 ARG A 97  ? ? 0.317 'SIDE CHAIN' 
8  1 ARG A 98  ? ? 0.254 'SIDE CHAIN' 
9  1 ARG A 99  ? ? 0.233 'SIDE CHAIN' 
10 1 ARG A 104 ? ? 0.298 'SIDE CHAIN' 
11 1 ARG A 112 ? ? 0.317 'SIDE CHAIN' 
12 1 ARG A 175 ? ? 0.191 'SIDE CHAIN' 
13 1 ARG A 201 ? ? 0.296 'SIDE CHAIN' 
14 1 ARG A 207 ? ? 0.183 'SIDE CHAIN' 
#