data_1SHU
# 
_entry.id   1SHU 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1SHU         
RCSB  RCSB021718   
WWPDB D_1000021718 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1SHT 
_pdbx_database_related.details        
'Crystal Structure of the von Willebrand factor A domain of human capillary morphogenesis protein 2 without a disulfide bond' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1SHU 
_pdbx_database_status.recvd_initial_deposition_date   2004-02-26 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Lacy, D.B.'        1 
'Wigelsworth, D.J.' 2 
'Scobie, H.M.'      3 
'Young, J.A.T.'     4 
'Collier, R.J.'     5 
# 
_citation.id                        primary 
_citation.title                     
'Crystal Structure of the von Willebrand factor A domain of human capillary morphogenesis protein 2: an anthrax toxin receptor' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            101 
_citation.page_first                6367 
_citation.page_last                 6372 
_citation.year                      2004 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15079089 
_citation.pdbx_database_id_DOI      10.1073/pnas.0401506101 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Lacy, D.B.'        1 
primary 'Wigelsworth, D.J.' 2 
primary 'Scobie, H.M.'      3 
primary 'Young, J.A.T.'     4 
primary 'Collier, R.J.'     5 
# 
_cell.entry_id           1SHU 
_cell.length_a           57.419 
_cell.length_b           57.419 
_cell.length_c           111.459 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1SHU 
_symmetry.space_group_name_H-M             'P 41 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                92 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Anthrax toxin receptor 2' 19897.842 1   ? ? 'VWA domain' ? 
2 non-polymer syn 'MAGNESIUM ION'            24.305    1   ? ? ?            ? 
3 water       nat water                      18.015    154 ? ? ?            ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Capillary morphogenesis protein-2, CMG-2' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSCRRAFDLYFVLDKSGSVANNWIEIYNFVQQLAERFVSPEMRLSFIVFSSQATIILPLTGDRGKISKGLEDLKRVSPVG
ETYIHEGLKLANEQIQKAGGLKTSSIIIALTDGKLDGLVPSYAEKEAKISRSLGASVYCVGVLDFEQAQLERIADSKEQV
FPVKGGFQALKGIINSILAQSC
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSCRRAFDLYFVLDKSGSVANNWIEIYNFVQQLAERFVSPEMRLSFIVFSSQATIILPLTGDRGKISKGLEDLKRVSPVG
ETYIHEGLKLANEQIQKAGGLKTSSIIIALTDGKLDGLVPSYAEKEAKISRSLGASVYCVGVLDFEQAQLERIADSKEQV
FPVKGGFQALKGIINSILAQSC
;
_entity_poly.pdbx_strand_id                 X 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   CYS n 
1 4   ARG n 
1 5   ARG n 
1 6   ALA n 
1 7   PHE n 
1 8   ASP n 
1 9   LEU n 
1 10  TYR n 
1 11  PHE n 
1 12  VAL n 
1 13  LEU n 
1 14  ASP n 
1 15  LYS n 
1 16  SER n 
1 17  GLY n 
1 18  SER n 
1 19  VAL n 
1 20  ALA n 
1 21  ASN n 
1 22  ASN n 
1 23  TRP n 
1 24  ILE n 
1 25  GLU n 
1 26  ILE n 
1 27  TYR n 
1 28  ASN n 
1 29  PHE n 
1 30  VAL n 
1 31  GLN n 
1 32  GLN n 
1 33  LEU n 
1 34  ALA n 
1 35  GLU n 
1 36  ARG n 
1 37  PHE n 
1 38  VAL n 
1 39  SER n 
1 40  PRO n 
1 41  GLU n 
1 42  MET n 
1 43  ARG n 
1 44  LEU n 
1 45  SER n 
1 46  PHE n 
1 47  ILE n 
1 48  VAL n 
1 49  PHE n 
1 50  SER n 
1 51  SER n 
1 52  GLN n 
1 53  ALA n 
1 54  THR n 
1 55  ILE n 
1 56  ILE n 
1 57  LEU n 
1 58  PRO n 
1 59  LEU n 
1 60  THR n 
1 61  GLY n 
1 62  ASP n 
1 63  ARG n 
1 64  GLY n 
1 65  LYS n 
1 66  ILE n 
1 67  SER n 
1 68  LYS n 
1 69  GLY n 
1 70  LEU n 
1 71  GLU n 
1 72  ASP n 
1 73  LEU n 
1 74  LYS n 
1 75  ARG n 
1 76  VAL n 
1 77  SER n 
1 78  PRO n 
1 79  VAL n 
1 80  GLY n 
1 81  GLU n 
1 82  THR n 
1 83  TYR n 
1 84  ILE n 
1 85  HIS n 
1 86  GLU n 
1 87  GLY n 
1 88  LEU n 
1 89  LYS n 
1 90  LEU n 
1 91  ALA n 
1 92  ASN n 
1 93  GLU n 
1 94  GLN n 
1 95  ILE n 
1 96  GLN n 
1 97  LYS n 
1 98  ALA n 
1 99  GLY n 
1 100 GLY n 
1 101 LEU n 
1 102 LYS n 
1 103 THR n 
1 104 SER n 
1 105 SER n 
1 106 ILE n 
1 107 ILE n 
1 108 ILE n 
1 109 ALA n 
1 110 LEU n 
1 111 THR n 
1 112 ASP n 
1 113 GLY n 
1 114 LYS n 
1 115 LEU n 
1 116 ASP n 
1 117 GLY n 
1 118 LEU n 
1 119 VAL n 
1 120 PRO n 
1 121 SER n 
1 122 TYR n 
1 123 ALA n 
1 124 GLU n 
1 125 LYS n 
1 126 GLU n 
1 127 ALA n 
1 128 LYS n 
1 129 ILE n 
1 130 SER n 
1 131 ARG n 
1 132 SER n 
1 133 LEU n 
1 134 GLY n 
1 135 ALA n 
1 136 SER n 
1 137 VAL n 
1 138 TYR n 
1 139 CYS n 
1 140 VAL n 
1 141 GLY n 
1 142 VAL n 
1 143 LEU n 
1 144 ASP n 
1 145 PHE n 
1 146 GLU n 
1 147 GLN n 
1 148 ALA n 
1 149 GLN n 
1 150 LEU n 
1 151 GLU n 
1 152 ARG n 
1 153 ILE n 
1 154 ALA n 
1 155 ASP n 
1 156 SER n 
1 157 LYS n 
1 158 GLU n 
1 159 GLN n 
1 160 VAL n 
1 161 PHE n 
1 162 PRO n 
1 163 VAL n 
1 164 LYS n 
1 165 GLY n 
1 166 GLY n 
1 167 PHE n 
1 168 GLN n 
1 169 ALA n 
1 170 LEU n 
1 171 LYS n 
1 172 GLY n 
1 173 ILE n 
1 174 ILE n 
1 175 ASN n 
1 176 SER n 
1 177 ILE n 
1 178 LEU n 
1 179 ALA n 
1 180 GLN n 
1 181 SER n 
1 182 CYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'ANTXR2, CMG2' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21.DE3 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pGEX-4T-1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ANTR2_HUMAN 
_struct_ref.pdbx_db_accession          P58335 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SCRRAFDLYFVLDKSGSVANNWIEIYNFVQQLAERFVSPEMRLSFIVFSSQATIILPLTGDRGKISKGLEDLKRVSPVGE
TYIHEGLKLANEQIQKAGGLKTSSIIIALTDGKLDGLVPSYAEKEAKISRSLGASVYCVGVLDFEQAQLERIADSKEQVF
PVKGGFQALKGIINSILAQSC
;
_struct_ref.pdbx_align_begin           38 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1SHU 
_struct_ref_seq.pdbx_strand_id                X 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 182 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P58335 
_struct_ref_seq.db_align_beg                  38 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  218 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       38 
_struct_ref_seq.pdbx_auth_seq_align_end       218 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1SHU 
_struct_ref_seq_dif.mon_id                       GLY 
_struct_ref_seq_dif.pdbx_pdb_strand_id           X 
_struct_ref_seq_dif.seq_num                      1 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P58335 
_struct_ref_seq_dif.db_mon_id                    ? 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          ? 
_struct_ref_seq_dif.details                      'CLONING ARTIFACT' 
_struct_ref_seq_dif.pdbx_auth_seq_num            37 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
MG  non-polymer         . 'MAGNESIUM ION' ? 'Mg 2'           24.305  
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1SHU 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   47.22 
_exptl_crystal.description           ? 
_exptl_crystal.density_Matthews      2.35 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
'PEG3350, magnesium chloride, bis-tris, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2003-10-17 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'horizontally bent, Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9186 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CHESS BEAMLINE F1' 
_diffrn_source.pdbx_synchrotron_site       CHESS 
_diffrn_source.pdbx_synchrotron_beamline   F1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9186 
# 
_reflns.entry_id                     1SHU 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            1.5 
_reflns.d_resolution_low             28.75 
_reflns.number_all                   30193 
_reflns.number_obs                   30193 
_reflns.percent_possible_obs         98.2 
_reflns.pdbx_Rmerge_I_obs            0.045 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        33.3 
_reflns.B_iso_Wilson_estimate        16.4 
_reflns.pdbx_redundancy              7.1 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.5 
_reflns_shell.d_res_low              1.55 
_reflns_shell.percent_possible_all   90.5 
_reflns_shell.Rmerge_I_obs           0.174 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    7.7 
_reflns_shell.pdbx_redundancy        4.2 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      2728 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1SHU 
_refine.ls_number_reflns_obs                     28635 
_refine.ls_number_reflns_all                     28635 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             28.75 
_refine.ls_d_res_high                            1.50 
_refine.ls_percent_reflns_obs                    100.00 
_refine.ls_R_factor_obs                          0.1881 
_refine.ls_R_factor_all                          0.1881 
_refine.ls_R_factor_R_work                       0.18668 
_refine.ls_R_factor_R_free                       0.21549 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  1492 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.957 
_refine.correlation_coeff_Fo_to_Fc_free          0.950 
_refine.B_iso_mean                               16.871 
_refine.aniso_B[1][1]                            0.44 
_refine.aniso_B[2][2]                            0.44 
_refine.aniso_B[3][3]                            -0.87 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      1SHT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             anisotropic 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.093 
_refine.pdbx_overall_ESU_R_Free                  0.077 
_refine.overall_SU_ML                            0.049 
_refine.overall_SU_B                             1.262 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1396 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         1 
_refine_hist.number_atoms_solvent             154 
_refine_hist.number_atoms_total               1551 
_refine_hist.d_res_high                       1.50 
_refine_hist.d_res_low                        28.75 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.014 0.022 ? 1418 'X-RAY DIFFRACTION' ? 
r_bond_other_d           0.002 0.020 ? 1329 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.465 1.975 ? 1910 'X-RAY DIFFRACTION' ? 
r_angle_other_deg        0.846 3.000 ? 3098 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   6.073 5.000 ? 180  'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.086 0.200 ? 219  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.011 0.020 ? 1568 'X-RAY DIFFRACTION' ? 
r_gen_planes_other       0.015 0.020 ? 279  'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.207 0.200 ? 307  'X-RAY DIFFRACTION' ? 
r_nbd_other              0.244 0.200 ? 1495 'X-RAY DIFFRACTION' ? 
r_nbtor_other            0.079 0.200 ? 842  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.123 0.200 ? 88   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.190 0.200 ? 12   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other     0.349 0.200 ? 36   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.145 0.200 ? 13   'X-RAY DIFFRACTION' ? 
r_mcbond_it              1.378 1.500 ? 895  'X-RAY DIFFRACTION' ? 
r_mcangle_it             2.174 2.000 ? 1436 'X-RAY DIFFRACTION' ? 
r_scbond_it              2.543 3.000 ? 523  'X-RAY DIFFRACTION' ? 
r_scangle_it             3.944 4.500 ? 474  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr       1.514 2.000 ? 1418 'X-RAY DIFFRACTION' ? 
r_sphericity_free        4.153 2.000 ? 155  'X-RAY DIFFRACTION' ? 
r_sphericity_bonded      2.984 2.000 ? 1396 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.500 
_refine_ls_shell.d_res_low                        1.539 
_refine_ls_shell.number_reflns_R_work             1863 
_refine_ls_shell.R_factor_R_work                  0.173 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.23 
_refine_ls_shell.R_factor_R_free_error            0.077 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             115 
_refine_ls_shell.number_reflns_obs                1863 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1SHU 
_struct.title                     
'Crystal Structure of the von Willebrand factor A domain of human capillary morphogenesis protein 2: an anthrax toxin receptor' 
_struct.pdbx_descriptor           'Anthrax toxin receptor 2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1SHU 
_struct_keywords.pdbx_keywords   'MEMBRANE PROTEIN' 
_struct_keywords.text            'alpha/beta Rossmann fold, MEMBRANE PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 16  ? ASN A 21  ? SER X 52  ASN X 57  5 ? 6  
HELX_P HELX_P2 2 ASN A 22  ? PHE A 37  ? ASN X 58  PHE X 73  1 ? 16 
HELX_P HELX_P3 3 ASP A 62  ? ARG A 75  ? ASP X 98  ARG X 111 1 ? 14 
HELX_P HELX_P4 4 TYR A 83  ? GLY A 99  ? TYR X 119 GLY X 135 1 ? 17 
HELX_P HELX_P5 5 GLY A 100 ? THR A 103 ? GLY X 136 THR X 139 5 ? 4  
HELX_P HELX_P6 6 LEU A 118 ? LEU A 133 ? LEU X 154 LEU X 169 1 ? 16 
HELX_P HELX_P7 7 GLU A 146 ? ALA A 154 ? GLU X 182 ALA X 190 1 ? 9  
HELX_P HELX_P8 8 SER A 156 ? GLU A 158 ? SER X 192 GLU X 194 5 ? 3  
HELX_P HELX_P9 9 PHE A 167 ? GLN A 180 ? PHE X 203 GLN X 216 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 3 SG ? ? ? 1_555 A CYS 182 SG  ? ? X CYS 39  X CYS 218 1_555 ? ? ? ? ? ? ? 2.064 ? 
metalc1 metalc ? ? B MG  . MG ? ? ? 1_555 C HOH .   O   ? ? X MG  219 X HOH 222 1_555 ? ? ? ? ? ? ? 2.062 ? 
metalc2 metalc ? ? B MG  . MG ? ? ? 1_555 C HOH .   O   ? ? X MG  219 X HOH 220 1_555 ? ? ? ? ? ? ? 1.996 ? 
metalc3 metalc ? ? B MG  . MG ? ? ? 1_555 A SER 16  OG  ? ? X MG  219 X SER 52  1_555 ? ? ? ? ? ? ? 2.144 ? 
metalc4 metalc ? ? B MG  . MG ? ? ? 1_555 A SER 18  OG  ? ? X MG  219 X SER 54  1_555 ? ? ? ? ? ? ? 2.157 ? 
metalc5 metalc ? ? B MG  . MG ? ? ? 1_555 A THR 82  OG1 ? ? X MG  219 X THR 118 1_555 ? ? ? ? ? ? ? 2.147 ? 
metalc6 metalc ? ? B MG  . MG ? ? ? 1_555 A GLU 158 OE2 ? ? X MG  219 X GLU 194 3_545 ? ? ? ? ? ? ? 2.022 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   6 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ALA A 53  ? THR A 60  ? ALA X 89  THR X 96  
A 2 MET A 42  ? PHE A 49  ? MET X 78  PHE X 85  
A 3 PHE A 7   ? ASP A 14  ? PHE X 43  ASP X 50  
A 4 SER A 105 ? THR A 111 ? SER X 141 THR X 147 
A 5 SER A 136 ? GLY A 141 ? SER X 172 GLY X 177 
A 6 VAL A 160 ? PRO A 162 ? VAL X 196 PRO X 198 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O THR A 60  ? O THR X 96  N LEU A 44  ? N LEU X 80  
A 2 3 O ILE A 47  ? O ILE X 83  N LEU A 13  ? N LEU X 49  
A 3 4 N TYR A 10  ? N TYR X 46  O ILE A 106 ? O ILE X 142 
A 4 5 N ALA A 109 ? N ALA X 145 O VAL A 140 ? O VAL X 176 
A 5 6 N GLY A 141 ? N GLY X 177 O PHE A 161 ? O PHE X 197 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    6 
_struct_site.details              'BINDING SITE FOR RESIDUE MG X 219' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 6 SER A 16  ? SER X 52  . ? 1_555 ? 
2 AC1 6 SER A 18  ? SER X 54  . ? 1_555 ? 
3 AC1 6 THR A 82  ? THR X 118 . ? 1_555 ? 
4 AC1 6 GLU A 158 ? GLU X 194 . ? 3_545 ? 
5 AC1 6 HOH C .   ? HOH X 220 . ? 1_555 ? 
6 AC1 6 HOH C .   ? HOH X 222 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1SHU 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1SHU 
_atom_sites.fract_transf_matrix[1][1]   0.017416 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017416 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008972 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . SER A 1 2   ? 45.005 19.184 -21.303 1.00 19.31 ? 38  SER X N   1 
ATOM   2    C  CA  . SER A 1 2   ? 46.478 18.957 -21.191 1.00 17.49 ? 38  SER X CA  1 
ATOM   3    C  C   . SER A 1 2   ? 46.905 18.285 -19.898 1.00 16.73 ? 38  SER X C   1 
ATOM   4    O  O   . SER A 1 2   ? 46.186 18.326 -18.891 1.00 18.30 ? 38  SER X O   1 
ATOM   5    C  CB  . SER A 1 2   ? 47.196 20.298 -21.259 1.00 17.94 ? 38  SER X CB  1 
ATOM   6    O  OG  . SER A 1 2   ? 46.961 20.970 -22.460 1.00 19.92 ? 38  SER X OG  1 
ATOM   7    N  N   . CYS A 1 3   ? 48.108 17.722 -19.889 1.00 15.15 ? 39  CYS X N   1 
ATOM   8    C  CA  . CYS A 1 3   ? 48.641 17.074 -18.700 1.00 14.19 ? 39  CYS X CA  1 
ATOM   9    C  C   . CYS A 1 3   ? 48.903 18.108 -17.601 1.00 14.78 ? 39  CYS X C   1 
ATOM   10   O  O   . CYS A 1 3   ? 49.151 19.276 -17.889 1.00 15.33 ? 39  CYS X O   1 
ATOM   11   C  CB  . CYS A 1 3   ? 49.880 16.244 -19.034 1.00 14.33 ? 39  CYS X CB  1 
ATOM   12   S  SG  . CYS A 1 3   ? 51.397 17.206 -19.422 1.00 15.86 ? 39  CYS X SG  1 
ATOM   13   N  N   . ARG A 1 4   ? 48.811 17.663 -16.348 1.00 15.37 ? 40  ARG X N   1 
ATOM   14   C  CA  . ARG A 1 4   ? 48.967 18.538 -15.187 1.00 16.40 ? 40  ARG X CA  1 
ATOM   15   C  C   . ARG A 1 4   ? 50.057 18.034 -14.275 1.00 16.32 ? 40  ARG X C   1 
ATOM   16   O  O   . ARG A 1 4   ? 50.381 16.873 -14.292 1.00 16.46 ? 40  ARG X O   1 
ATOM   17   C  CB  . ARG A 1 4   ? 47.630 18.634 -14.417 1.00 17.96 ? 40  ARG X CB  1 
ATOM   18   C  CG  . ARG A 1 4   ? 46.551 19.473 -15.114 1.00 22.55 ? 40  ARG X CG  1 
ATOM   19   C  CD  . ARG A 1 4   ? 45.179 19.402 -14.464 1.00 27.86 ? 40  ARG X CD  1 
ATOM   20   N  NE  . ARG A 1 4   ? 44.606 18.057 -14.584 1.00 32.84 ? 40  ARG X NE  1 
ATOM   21   C  CZ  . ARG A 1 4   ? 43.309 17.755 -14.456 1.00 36.06 ? 40  ARG X CZ  1 
ATOM   22   N  NH1 . ARG A 1 4   ? 42.399 18.693 -14.192 1.00 37.76 ? 40  ARG X NH1 1 
ATOM   23   N  NH2 . ARG A 1 4   ? 42.927 16.495 -14.590 1.00 36.37 ? 40  ARG X NH2 1 
ATOM   24   N  N   . ARG A 1 5   ? 50.644 18.941 -13.479 1.00 17.14 ? 41  ARG X N   1 
ATOM   25   C  CA  . ARG A 1 5   ? 51.558 18.557 -12.417 1.00 17.96 ? 41  ARG X CA  1 
ATOM   26   C  C   . ARG A 1 5   ? 51.012 18.895 -11.021 1.00 18.52 ? 41  ARG X C   1 
ATOM   27   O  O   . ARG A 1 5   ? 51.409 18.258 -10.070 1.00 21.68 ? 41  ARG X O   1 
ATOM   28   C  CB  . ARG A 1 5   ? 52.931 19.213 -12.629 1.00 18.98 ? 41  ARG X CB  1 
ATOM   29   C  CG  . ARG A 1 5   ? 53.660 18.674 -13.813 1.00 20.12 ? 41  ARG X CG  1 
ATOM   30   C  CD  . ARG A 1 5   ? 55.111 19.061 -13.952 1.00 21.54 ? 41  ARG X CD  1 
ATOM   31   N  NE  . ARG A 1 5   ? 55.737 18.169 -14.934 1.00 22.54 ? 41  ARG X NE  1 
ATOM   32   C  CZ  . ARG A 1 5   ? 56.205 18.525 -16.141 1.00 23.22 ? 41  ARG X CZ  1 
ATOM   33   N  NH1 . ARG A 1 5   ? 56.145 19.768 -16.553 1.00 23.35 ? 41  ARG X NH1 1 
ATOM   34   N  NH2 . ARG A 1 5   ? 56.725 17.603 -16.930 1.00 25.41 ? 41  ARG X NH2 1 
ATOM   35   N  N   . ALA A 1 6   ? 50.148 19.887 -10.909 1.00 19.30 ? 42  ALA X N   1 
ATOM   36   C  CA  . ALA A 1 6   ? 49.650 20.361 -9.599  1.00 19.74 ? 42  ALA X CA  1 
ATOM   37   C  C   . ALA A 1 6   ? 48.286 19.741 -9.306  1.00 19.49 ? 42  ALA X C   1 
ATOM   38   O  O   . ALA A 1 6   ? 47.377 19.913 -10.091 1.00 20.28 ? 42  ALA X O   1 
ATOM   39   C  CB  . ALA A 1 6   ? 49.507 21.863 -9.594  1.00 20.25 ? 42  ALA X CB  1 
ATOM   40   N  N   . PHE A 1 7   ? 48.174 19.032 -8.180  1.00 18.97 ? 43  PHE X N   1 
ATOM   41   C  CA  . PHE A 1 7   ? 46.900 18.499 -7.712  1.00 18.09 ? 43  PHE X CA  1 
ATOM   42   C  C   . PHE A 1 7   ? 46.683 18.841 -6.253  1.00 17.39 ? 43  PHE X C   1 
ATOM   43   O  O   . PHE A 1 7   ? 47.596 18.720 -5.443  1.00 18.01 ? 43  PHE X O   1 
ATOM   44   C  CB  . PHE A 1 7   ? 46.857 16.972 -7.851  1.00 18.28 ? 43  PHE X CB  1 
ATOM   45   C  CG  . PHE A 1 7   ? 46.937 16.488 -9.275  1.00 19.42 ? 43  PHE X CG  1 
ATOM   46   C  CD1 . PHE A 1 7   ? 48.157 16.260 -9.878  1.00 21.16 ? 43  PHE X CD1 1 
ATOM   47   C  CD2 . PHE A 1 7   ? 45.780 16.273 -10.012 1.00 19.32 ? 43  PHE X CD2 1 
ATOM   48   C  CE1 . PHE A 1 7   ? 48.225 15.831 -11.203 1.00 20.83 ? 43  PHE X CE1 1 
ATOM   49   C  CE2 . PHE A 1 7   ? 45.847 15.833 -11.350 1.00 19.15 ? 43  PHE X CE2 1 
ATOM   50   C  CZ  . PHE A 1 7   ? 47.050 15.614 -11.925 1.00 20.84 ? 43  PHE X CZ  1 
ATOM   51   N  N   . ASP A 1 8   ? 45.430 19.133 -5.937  1.00 16.97 ? 44  ASP X N   1 
ATOM   52   C  CA  . ASP A 1 8   ? 44.987 19.357 -4.565  1.00 16.31 ? 44  ASP X CA  1 
ATOM   53   C  C   . ASP A 1 8   ? 44.011 18.214 -4.229  1.00 15.14 ? 44  ASP X C   1 
ATOM   54   O  O   . ASP A 1 8   ? 42.954 18.094 -4.874  1.00 14.83 ? 44  ASP X O   1 
ATOM   55   C  CB  . ASP A 1 8   ? 44.230 20.660 -4.473  1.00 16.17 ? 44  ASP X CB  1 
ATOM   56   C  CG  . ASP A 1 8   ? 45.124 21.881 -4.614  1.00 17.61 ? 44  ASP X CG  1 
ATOM   57   O  OD1 . ASP A 1 8   ? 46.345 21.767 -4.408  1.00 20.00 ? 44  ASP X OD1 1 
ATOM   58   O  OD2 . ASP A 1 8   ? 44.601 22.939 -4.971  1.00 16.25 ? 44  ASP X OD2 1 
ATOM   59   N  N   . LEU A 1 9   ? 44.410 17.411 -3.253  1.00 15.43 ? 45  LEU X N   1 
ATOM   60   C  CA  . LEU A 1 9   ? 43.654 16.210 -2.825  1.00 14.52 ? 45  LEU X CA  1 
ATOM   61   C  C   . LEU A 1 9   ? 42.950 16.443 -1.487  1.00 14.19 ? 45  LEU X C   1 
ATOM   62   O  O   . LEU A 1 9   ? 43.613 16.626 -0.464  1.00 15.28 ? 45  LEU X O   1 
ATOM   63   C  CB  . LEU A 1 9   ? 44.560 15.004 -2.663  1.00 15.87 ? 45  LEU X CB  1 
ATOM   64   C  CG  . LEU A 1 9   ? 45.531 14.648 -3.791  1.00 20.50 ? 45  LEU X CG  1 
ATOM   65   C  CD1 . LEU A 1 9   ? 46.122 13.280 -3.505  1.00 23.01 ? 45  LEU X CD1 1 
ATOM   66   C  CD2 . LEU A 1 9   ? 44.893 14.703 -5.154  1.00 22.49 ? 45  LEU X CD2 1 
ATOM   67   N  N   . TYR A 1 10  ? 41.615 16.392 -1.531  1.00 12.88 ? 46  TYR X N   1 
ATOM   68   C  CA  . TYR A 1 10  ? 40.735 16.588 -0.362  1.00 12.89 ? 46  TYR X CA  1 
ATOM   69   C  C   . TYR A 1 10  ? 40.186 15.242 0.097   1.00 12.34 ? 46  TYR X C   1 
ATOM   70   O  O   . TYR A 1 10  ? 39.375 14.637 -0.614  1.00 12.90 ? 46  TYR X O   1 
ATOM   71   C  CB  . TYR A 1 10  ? 39.572 17.482 -0.723  1.00 12.10 ? 46  TYR X CB  1 
ATOM   72   C  CG  . TYR A 1 10  ? 39.992 18.888 -1.072  1.00 13.45 ? 46  TYR X CG  1 
ATOM   73   C  CD1 . TYR A 1 10  ? 40.147 19.836 -0.073  1.00 15.08 ? 46  TYR X CD1 1 
ATOM   74   C  CD2 . TYR A 1 10  ? 40.303 19.237 -2.382  1.00 14.93 ? 46  TYR X CD2 1 
ATOM   75   C  CE1 . TYR A 1 10  ? 40.562 21.120 -0.389  1.00 16.70 ? 46  TYR X CE1 1 
ATOM   76   C  CE2 . TYR A 1 10  ? 40.701 20.489 -2.706  1.00 16.07 ? 46  TYR X CE2 1 
ATOM   77   C  CZ  . TYR A 1 10  ? 40.817 21.436 -1.702  1.00 16.46 ? 46  TYR X CZ  1 
ATOM   78   O  OH  . TYR A 1 10  ? 41.230 22.708 -2.046  1.00 18.42 ? 46  TYR X OH  1 
ATOM   79   N  N   . PHE A 1 11  ? 40.651 14.750 1.231   1.00 12.66 ? 47  PHE X N   1 
ATOM   80   C  CA  . PHE A 1 11  ? 40.158 13.514 1.859   1.00 12.49 ? 47  PHE X CA  1 
ATOM   81   C  C   . PHE A 1 11  ? 38.972 13.877 2.739   1.00 12.22 ? 47  PHE X C   1 
ATOM   82   O  O   . PHE A 1 11  ? 39.129 14.634 3.710   1.00 12.63 ? 47  PHE X O   1 
ATOM   83   C  CB  . PHE A 1 11  ? 41.253 12.853 2.698   1.00 13.70 ? 47  PHE X CB  1 
ATOM   84   C  CG  . PHE A 1 11  ? 42.440 12.360 1.880   1.00 12.72 ? 47  PHE X CG  1 
ATOM   85   C  CD1 . PHE A 1 11  ? 43.486 13.214 1.597   1.00 14.54 ? 47  PHE X CD1 1 
ATOM   86   C  CD2 . PHE A 1 11  ? 42.497 11.049 1.412   1.00 14.29 ? 47  PHE X CD2 1 
ATOM   87   C  CE1 . PHE A 1 11  ? 44.558 12.780 0.876   1.00 16.06 ? 47  PHE X CE1 1 
ATOM   88   C  CE2 . PHE A 1 11  ? 43.573 10.622 0.658   1.00 15.82 ? 47  PHE X CE2 1 
ATOM   89   C  CZ  . PHE A 1 11  ? 44.624 11.487 0.429   1.00 16.87 ? 47  PHE X CZ  1 
ATOM   90   N  N   . VAL A 1 12  ? 37.808 13.318 2.417   1.00 10.60 ? 48  VAL X N   1 
ATOM   91   C  CA  . VAL A 1 12  ? 36.551 13.576 3.146   1.00 10.52 ? 48  VAL X CA  1 
ATOM   92   C  C   . VAL A 1 12  ? 36.210 12.280 3.853   1.00 10.92 ? 48  VAL X C   1 
ATOM   93   O  O   . VAL A 1 12  ? 35.796 11.306 3.210   1.00 9.95  ? 48  VAL X O   1 
ATOM   94   C  CB  . VAL A 1 12  ? 35.463 14.075 2.195   1.00 10.30 ? 48  VAL X CB  1 
ATOM   95   C  CG1 . VAL A 1 12  ? 34.122 14.222 2.920   1.00 11.29 ? 48  VAL X CG1 1 
ATOM   96   C  CG2 . VAL A 1 12  ? 35.886 15.381 1.547   1.00 10.65 ? 48  VAL X CG2 1 
ATOM   97   N  N   . LEU A 1 13  ? 36.455 12.236 5.168   1.00 10.49 ? 49  LEU X N   1 
ATOM   98   C  CA  . LEU A 1 13  ? 36.538 10.985 5.891   1.00 10.80 ? 49  LEU X CA  1 
ATOM   99   C  C   . LEU A 1 13  ? 35.387 10.804 6.874   1.00 10.37 ? 49  LEU X C   1 
ATOM   100  O  O   . LEU A 1 13  ? 35.171 11.628 7.768   1.00 11.05 ? 49  LEU X O   1 
ATOM   101  C  CB  . LEU A 1 13  ? 37.856 10.925 6.665   1.00 11.42 ? 49  LEU X CB  1 
ATOM   102  C  CG  . LEU A 1 13  ? 39.109 11.202 5.819   1.00 12.50 ? 49  LEU X CG  1 
ATOM   103  C  CD1 . LEU A 1 13  ? 40.347 11.229 6.765   1.00 15.46 ? 49  LEU X CD1 1 
ATOM   104  C  CD2 . LEU A 1 13  ? 39.251 10.222 4.693   1.00 12.76 ? 49  LEU X CD2 1 
ATOM   105  N  N   . ASP A 1 14  ? 34.655 9.708  6.685   1.00 9.35  ? 50  ASP X N   1 
ATOM   106  C  CA  . ASP A 1 14  ? 33.531 9.303  7.547   1.00 10.17 ? 50  ASP X CA  1 
ATOM   107  C  C   . ASP A 1 14  ? 34.069 8.852  8.903   1.00 10.42 ? 50  ASP X C   1 
ATOM   108  O  O   . ASP A 1 14  ? 34.775 7.843  8.985   1.00 11.25 ? 50  ASP X O   1 
ATOM   109  C  CB  . ASP A 1 14  ? 32.845 8.136  6.826   1.00 10.02 ? 50  ASP X CB  1 
ATOM   110  C  CG  . ASP A 1 14  ? 31.484 7.789  7.348   1.00 9.56  ? 50  ASP X CG  1 
ATOM   111  O  OD1 . ASP A 1 14  ? 31.201 7.979  8.540   1.00 10.03 ? 50  ASP X OD1 1 
ATOM   112  O  OD2 . ASP A 1 14  ? 30.674 7.242  6.563   1.00 10.10 ? 50  ASP X OD2 1 
ATOM   113  N  N   . LYS A 1 15  ? 33.696 9.573  9.970   1.00 10.58 ? 51  LYS X N   1 
ATOM   114  C  CA  . LYS A 1 15  ? 33.942 9.127  11.344  1.00 11.58 ? 51  LYS X CA  1 
ATOM   115  C  C   . LYS A 1 15  ? 32.618 8.950  12.100  1.00 11.94 ? 51  LYS X C   1 
ATOM   116  O  O   . LYS A 1 15  ? 32.529 9.188  13.319  1.00 12.82 ? 51  LYS X O   1 
ATOM   117  C  CB  . LYS A 1 15  ? 34.872 10.084 12.104  1.00 12.06 ? 51  LYS X CB  1 
ATOM   118  C  CG  . LYS A 1 15  ? 34.355 11.516 12.229  1.00 14.00 ? 51  LYS X CG  1 
ATOM   119  C  CD  . LYS A 1 15  ? 35.041 12.304 13.341  1.00 17.46 ? 51  LYS X CD  1 
ATOM   120  C  CE  . LYS A 1 15  ? 34.454 13.661 13.510  1.00 20.29 ? 51  LYS X CE  1 
ATOM   121  N  NZ  . LYS A 1 15  ? 34.851 14.254 14.844  1.00 23.96 ? 51  LYS X NZ  1 
ATOM   122  N  N   . SER A 1 16  ? 31.595 8.514  11.382  1.00 10.64 ? 52  SER X N   1 
ATOM   123  C  CA  . SER A 1 16  ? 30.321 8.178  12.022  1.00 10.08 ? 52  SER X CA  1 
ATOM   124  C  C   . SER A 1 16  ? 30.400 6.845  12.762  1.00 10.73 ? 52  SER X C   1 
ATOM   125  O  O   . SER A 1 16  ? 31.299 6.058  12.578  1.00 11.60 ? 52  SER X O   1 
ATOM   126  C  CB  . SER A 1 16  ? 29.206 8.140  10.986  1.00 9.55  ? 52  SER X CB  1 
ATOM   127  O  OG  . SER A 1 16  ? 29.339 7.037  10.105  1.00 9.64  ? 52  SER X OG  1 
ATOM   128  N  N   . GLY A 1 17  ? 29.422 6.589  13.624  1.00 11.49 ? 53  GLY X N   1 
ATOM   129  C  CA  . GLY A 1 17  ? 29.432 5.368  14.396  1.00 11.31 ? 53  GLY X CA  1 
ATOM   130  C  C   . GLY A 1 17  ? 29.458 4.092  13.580  1.00 11.30 ? 53  GLY X C   1 
ATOM   131  O  O   . GLY A 1 17  ? 29.999 3.063  14.022  1.00 13.43 ? 53  GLY X O   1 
ATOM   132  N  N   . SER A 1 18  ? 28.839 4.101  12.400  1.00 10.56 ? 54  SER X N   1 
ATOM   133  C  CA  . SER A 1 18  ? 28.770 2.901  11.579  1.00 10.59 ? 54  SER X CA  1 
ATOM   134  C  C   . SER A 1 18  ? 30.148 2.403  11.113  1.00 12.02 ? 54  SER X C   1 
ATOM   135  O  O   . SER A 1 18  ? 30.283 1.232  10.807  1.00 12.30 ? 54  SER X O   1 
ATOM   136  C  CB  . SER A 1 18  ? 27.871 3.098  10.365  1.00 10.55 ? 54  SER X CB  1 
ATOM   137  O  OG  . SER A 1 18  ? 28.387 4.091  9.501   1.00 9.81  ? 54  SER X OG  1 
ATOM   138  N  N   . VAL A 1 19  ? 31.134 3.288  11.020  1.00 13.49 ? 55  VAL X N   1 
ATOM   139  C  CA  . VAL A 1 19  ? 32.490 2.893  10.592  1.00 15.14 ? 55  VAL X CA  1 
ATOM   140  C  C   . VAL A 1 19  ? 33.483 2.744  11.750  1.00 16.88 ? 55  VAL X C   1 
ATOM   141  O  O   . VAL A 1 19  ? 34.680 2.578  11.517  1.00 18.97 ? 55  VAL X O   1 
ATOM   142  C  CB  . VAL A 1 19  ? 33.107 3.857  9.507   1.00 15.88 ? 55  VAL X CB  1 
ATOM   143  C  CG1 . VAL A 1 19  ? 32.208 3.978  8.303   1.00 15.63 ? 55  VAL X CG1 1 
ATOM   144  C  CG2 . VAL A 1 19  ? 33.447 5.183  10.071  1.00 16.67 ? 55  VAL X CG2 1 
ATOM   145  N  N   . ALA A 1 20  ? 33.035 2.790  13.004  1.00 17.72 ? 56  ALA X N   1 
ATOM   146  C  CA  . ALA A 1 20  ? 33.971 2.875  14.122  1.00 19.69 ? 56  ALA X CA  1 
ATOM   147  C  C   . ALA A 1 20  ? 34.976 1.723  14.150  1.00 20.89 ? 56  ALA X C   1 
ATOM   148  O  O   . ALA A 1 20  ? 36.173 1.953  14.393  1.00 22.77 ? 56  ALA X O   1 
ATOM   149  C  CB  . ALA A 1 20  ? 33.224 2.943  15.440  1.00 19.53 ? 56  ALA X CB  1 
ATOM   150  N  N   . ASN A 1 21  ? 34.498 0.519  13.865  1.00 21.85 ? 57  ASN X N   1 
ATOM   151  C  CA  . ASN A 1 21  ? 35.329 -0.689 13.925  1.00 22.94 ? 57  ASN X CA  1 
ATOM   152  C  C   . ASN A 1 21  ? 36.307 -0.806 12.759  1.00 22.72 ? 57  ASN X C   1 
ATOM   153  O  O   . ASN A 1 21  ? 37.185 -1.691 12.765  1.00 24.66 ? 57  ASN X O   1 
ATOM   154  C  CB  . ASN A 1 21  ? 34.443 -1.952 13.973  1.00 24.04 ? 57  ASN X CB  1 
ATOM   155  C  CG  . ASN A 1 21  ? 33.763 -2.147 15.324  1.00 26.85 ? 57  ASN X CG  1 
ATOM   156  O  OD1 . ASN A 1 21  ? 32.795 -2.900 15.429  1.00 32.58 ? 57  ASN X OD1 1 
ATOM   157  N  ND2 . ASN A 1 21  ? 34.255 -1.472 16.354  1.00 30.61 ? 57  ASN X ND2 1 
ATOM   158  N  N   . ASN A 1 22  ? 36.152 0.055  11.751  1.00 21.27 ? 58  ASN X N   1 
ATOM   159  C  CA  . ASN A 1 22  ? 37.029 0.057  10.568  1.00 21.47 ? 58  ASN X CA  1 
ATOM   160  C  C   . ASN A 1 22  ? 37.782 1.376  10.356  1.00 19.99 ? 58  ASN X C   1 
ATOM   161  O  O   . ASN A 1 22  ? 38.273 1.648  9.261   1.00 19.46 ? 58  ASN X O   1 
ATOM   162  C  CB  . ASN A 1 22  ? 36.237 -0.270 9.320   1.00 22.15 ? 58  ASN X CB  1 
ATOM   163  C  CG  . ASN A 1 22  ? 35.670 -1.667 9.353   1.00 25.75 ? 58  ASN X CG  1 
ATOM   164  O  OD1 . ASN A 1 22  ? 34.844 -2.010 10.222  1.00 29.80 ? 58  ASN X OD1 1 
ATOM   165  N  ND2 . ASN A 1 22  ? 36.111 -2.489 8.426   1.00 26.69 ? 58  ASN X ND2 1 
ATOM   166  N  N   . TRP A 1 23  ? 37.923 2.177  11.394  1.00 19.95 ? 59  TRP X N   1 
ATOM   167  C  CA  . TRP A 1 23  ? 38.601 3.459  11.260  1.00 19.24 ? 59  TRP X CA  1 
ATOM   168  C  C   . TRP A 1 23  ? 40.076 3.267  10.846  1.00 19.96 ? 59  TRP X C   1 
ATOM   169  O  O   . TRP A 1 23  ? 40.626 4.068  10.086  1.00 20.07 ? 59  TRP X O   1 
ATOM   170  C  CB  . TRP A 1 23  ? 38.506 4.277  12.544  1.00 19.55 ? 59  TRP X CB  1 
ATOM   171  C  CG  . TRP A 1 23  ? 39.264 5.537  12.433  1.00 17.79 ? 59  TRP X CG  1 
ATOM   172  C  CD1 . TRP A 1 23  ? 40.452 5.822  13.025  1.00 19.98 ? 59  TRP X CD1 1 
ATOM   173  C  CD2 . TRP A 1 23  ? 38.957 6.662  11.594  1.00 16.88 ? 59  TRP X CD2 1 
ATOM   174  N  NE1 . TRP A 1 23  ? 40.885 7.064  12.641  1.00 19.37 ? 59  TRP X NE1 1 
ATOM   175  C  CE2 . TRP A 1 23  ? 39.982 7.602  11.755  1.00 18.68 ? 59  TRP X CE2 1 
ATOM   176  C  CE3 . TRP A 1 23  ? 37.896 6.980  10.730  1.00 16.02 ? 59  TRP X CE3 1 
ATOM   177  C  CZ2 . TRP A 1 23  ? 39.979 8.841  11.093  1.00 18.61 ? 59  TRP X CZ2 1 
ATOM   178  C  CZ3 . TRP A 1 23  ? 37.888 8.208  10.097  1.00 16.40 ? 59  TRP X CZ3 1 
ATOM   179  C  CH2 . TRP A 1 23  ? 38.933 9.117  10.254  1.00 17.70 ? 59  TRP X CH2 1 
ATOM   180  N  N   . ILE A 1 24  ? 40.685 2.203  11.347  1.00 21.13 ? 60  ILE X N   1 
ATOM   181  C  CA  . ILE A 1 24  ? 42.048 1.826  10.966  1.00 21.83 ? 60  ILE X CA  1 
ATOM   182  C  C   . ILE A 1 24  ? 42.220 1.697  9.454   1.00 21.34 ? 60  ILE X C   1 
ATOM   183  O  O   . ILE A 1 24  ? 43.228 2.157  8.919   1.00 21.32 ? 60  ILE X O   1 
ATOM   184  C  CB  . ILE A 1 24  ? 42.482 0.501  11.666  1.00 23.16 ? 60  ILE X CB  1 
ATOM   185  C  CG1 . ILE A 1 24  ? 43.973 0.237  11.444  1.00 24.46 ? 60  ILE X CG1 1 
ATOM   186  C  CG2 . ILE A 1 24  ? 41.633 -0.667 11.171  1.00 24.44 ? 60  ILE X CG2 1 
ATOM   187  C  CD1 . ILE A 1 24  ? 44.846 1.366  11.893  1.00 26.04 ? 60  ILE X CD1 1 
ATOM   188  N  N   . GLU A 1 25  ? 41.260 1.094  8.764   1.00 21.02 ? 61  GLU X N   1 
ATOM   189  C  CA  . GLU A 1 25  ? 41.328 0.955  7.299   1.00 20.83 ? 61  GLU X CA  1 
ATOM   190  C  C   . GLU A 1 25  ? 41.321 2.296  6.623   1.00 19.35 ? 61  GLU X C   1 
ATOM   191  O  O   . GLU A 1 25  ? 41.935 2.450  5.578   1.00 18.95 ? 61  GLU X O   1 
ATOM   192  C  CB  . GLU A 1 25  ? 40.135 0.209  6.724   1.00 21.89 ? 61  GLU X CB  1 
ATOM   193  C  CG  . GLU A 1 25  ? 40.090 -1.253 7.017   1.00 24.36 ? 61  GLU X CG  1 
ATOM   194  C  CD  . GLU A 1 25  ? 39.010 -1.928 6.213   1.00 26.13 ? 61  GLU X CD  1 
ATOM   195  O  OE1 . GLU A 1 25  ? 37.836 -1.499 6.275   1.00 25.45 ? 61  GLU X OE1 1 
ATOM   196  O  OE2 . GLU A 1 25  ? 39.352 -2.876 5.500   1.00 28.52 ? 61  GLU X OE2 1 
ATOM   197  N  N   . ILE A 1 26  ? 40.514 3.223  7.142   1.00 17.71 ? 62  ILE X N   1 
ATOM   198  C  CA  . ILE A 1 26  ? 40.386 4.557  6.577   1.00 16.85 ? 62  ILE X CA  1 
ATOM   199  C  C   . ILE A 1 26  ? 41.693 5.312  6.753   1.00 17.10 ? 62  ILE X C   1 
ATOM   200  O  O   . ILE A 1 26  ? 42.229 5.841  5.800   1.00 15.34 ? 62  ILE X O   1 
ATOM   201  C  CB  . ILE A 1 26  ? 39.211 5.326  7.220   1.00 17.09 ? 62  ILE X CB  1 
ATOM   202  C  CG1 . ILE A 1 26  ? 37.893 4.608  6.865   1.00 15.70 ? 62  ILE X CG1 1 
ATOM   203  C  CG2 . ILE A 1 26  ? 39.199 6.790  6.806   1.00 16.76 ? 62  ILE X CG2 1 
ATOM   204  C  CD1 . ILE A 1 26  ? 36.647 5.145  7.619   1.00 17.65 ? 62  ILE X CD1 1 
ATOM   205  N  N   . TYR A 1 27  ? 42.187 5.337  7.988   1.00 17.23 ? 63  TYR X N   1 
ATOM   206  C  CA  . TYR A 1 27  ? 43.451 5.958  8.311   1.00 17.83 ? 63  TYR X CA  1 
ATOM   207  C  C   . TYR A 1 27  ? 44.584 5.406  7.436   1.00 17.35 ? 63  TYR X C   1 
ATOM   208  O  O   . TYR A 1 27  ? 45.319 6.199  6.848   1.00 17.40 ? 63  TYR X O   1 
ATOM   209  C  CB  . TYR A 1 27  ? 43.784 5.778  9.809   1.00 18.15 ? 63  TYR X CB  1 
ATOM   210  C  CG  . TYR A 1 27  ? 45.171 6.261  10.075  1.00 20.31 ? 63  TYR X CG  1 
ATOM   211  C  CD1 . TYR A 1 27  ? 45.416 7.611  10.222  1.00 19.23 ? 63  TYR X CD1 1 
ATOM   212  C  CD2 . TYR A 1 27  ? 46.234 5.379  10.045  1.00 22.24 ? 63  TYR X CD2 1 
ATOM   213  C  CE1 . TYR A 1 27  ? 46.721 8.087  10.420  1.00 21.72 ? 63  TYR X CE1 1 
ATOM   214  C  CE2 . TYR A 1 27  ? 47.540 5.844  10.219  1.00 22.07 ? 63  TYR X CE2 1 
ATOM   215  C  CZ  . TYR A 1 27  ? 47.757 7.189  10.399  1.00 21.79 ? 63  TYR X CZ  1 
ATOM   216  O  OH  . TYR A 1 27  ? 49.034 7.653  10.587  1.00 25.92 ? 63  TYR X OH  1 
ATOM   217  N  N   . ASN A 1 28  ? 44.688 4.084  7.336   1.00 17.62 ? 64  ASN X N   1 
ATOM   218  C  CA  . ASN A 1 28  ? 45.758 3.438  6.565   1.00 18.94 ? 64  ASN X CA  1 
ATOM   219  C  C   . ASN A 1 28  ? 45.711 3.835  5.094   1.00 18.75 ? 64  ASN X C   1 
ATOM   220  O  O   . ASN A 1 28  ? 46.757 4.076  4.476   1.00 19.00 ? 64  ASN X O   1 
ATOM   221  C  CB  . ASN A 1 28  ? 45.756 1.928  6.729   1.00 20.27 ? 64  ASN X CB  1 
ATOM   222  C  CG  . ASN A 1 28  ? 46.340 1.471  8.070   1.00 23.41 ? 64  ASN X CG  1 
ATOM   223  O  OD1 . ASN A 1 28  ? 47.028 2.231  8.772   1.00 27.63 ? 64  ASN X OD1 1 
ATOM   224  N  ND2 . ASN A 1 28  ? 46.062 0.220  8.431   1.00 25.10 ? 64  ASN X ND2 1 
ATOM   225  N  N   . PHE A 1 29  ? 44.515 3.939  4.523   1.00 17.95 ? 65  PHE X N   1 
ATOM   226  C  CA  . PHE A 1 29  ? 44.387 4.381  3.130   1.00 17.09 ? 65  PHE X CA  1 
ATOM   227  C  C   . PHE A 1 29  ? 44.937 5.781  2.954   1.00 16.41 ? 65  PHE X C   1 
ATOM   228  O  O   . PHE A 1 29  ? 45.662 6.088  2.002   1.00 16.16 ? 65  PHE X O   1 
ATOM   229  C  CB  . PHE A 1 29  ? 42.916 4.356  2.668   1.00 18.14 ? 65  PHE X CB  1 
ATOM   230  C  CG  . PHE A 1 29  ? 42.717 4.843  1.252   1.00 17.16 ? 65  PHE X CG  1 
ATOM   231  C  CD1 . PHE A 1 29  ? 42.875 3.975  0.195   1.00 18.81 ? 65  PHE X CD1 1 
ATOM   232  C  CD2 . PHE A 1 29  ? 42.418 6.174  0.993   1.00 18.29 ? 65  PHE X CD2 1 
ATOM   233  C  CE1 . PHE A 1 29  ? 42.704 4.416  -1.094  1.00 17.44 ? 65  PHE X CE1 1 
ATOM   234  C  CE2 . PHE A 1 29  ? 42.277 6.632  -0.306  1.00 19.04 ? 65  PHE X CE2 1 
ATOM   235  C  CZ  . PHE A 1 29  ? 42.429 5.737  -1.352  1.00 18.57 ? 65  PHE X CZ  1 
ATOM   236  N  N   . VAL A 1 30  ? 44.549 6.665  3.844   1.00 15.98 ? 66  VAL X N   1 
ATOM   237  C  CA  . VAL A 1 30  ? 44.965 8.053  3.790   1.00 15.89 ? 66  VAL X CA  1 
ATOM   238  C  C   . VAL A 1 30  ? 46.481 8.159  3.960   1.00 17.37 ? 66  VAL X C   1 
ATOM   239  O  O   . VAL A 1 30  ? 47.139 8.867  3.194   1.00 17.57 ? 66  VAL X O   1 
ATOM   240  C  CB  . VAL A 1 30  ? 44.247 8.880  4.848   1.00 16.84 ? 66  VAL X CB  1 
ATOM   241  C  CG1 . VAL A 1 30  ? 44.692 10.289 4.813   1.00 16.59 ? 66  VAL X CG1 1 
ATOM   242  C  CG2 . VAL A 1 30  ? 42.730 8.809  4.613   1.00 16.97 ? 66  VAL X CG2 1 
ATOM   243  N  N   . GLN A 1 31  ? 47.018 7.435  4.921   1.00 17.91 ? 67  GLN X N   1 
ATOM   244  C  CA  . GLN A 1 31  ? 48.462 7.494  5.150   1.00 18.60 ? 67  GLN X CA  1 
ATOM   245  C  C   . GLN A 1 31  ? 49.202 6.974  3.912   1.00 19.00 ? 67  GLN X C   1 
ATOM   246  O  O   . GLN A 1 31  ? 50.203 7.561  3.499   1.00 18.45 ? 67  GLN X O   1 
ATOM   247  C  CB  . GLN A 1 31  ? 48.838 6.713  6.393   1.00 19.15 ? 67  GLN X CB  1 
ATOM   248  C  CG  . GLN A 1 31  ? 50.295 6.886  6.781   1.00 22.05 ? 67  GLN X CG  1 
ATOM   249  C  CD  . GLN A 1 31  ? 51.160 5.899  6.074   1.00 25.24 ? 67  GLN X CD  1 
ATOM   250  O  OE1 . GLN A 1 31  ? 50.717 4.782  5.776   1.00 27.36 ? 67  GLN X OE1 1 
ATOM   251  N  NE2 . GLN A 1 31  ? 52.413 6.286  5.796   1.00 28.64 ? 67  GLN X NE2 1 
ATOM   252  N  N   . GLN A 1 32  ? 48.719 5.885  3.322   1.00 19.59 ? 68  GLN X N   1 
ATOM   253  C  CA  . GLN A 1 32  ? 49.386 5.302  2.144   1.00 20.48 ? 68  GLN X CA  1 
ATOM   254  C  C   . GLN A 1 32  ? 49.354 6.233  0.935   1.00 20.69 ? 68  GLN X C   1 
ATOM   255  O  O   . GLN A 1 32  ? 50.338 6.325  0.195   1.00 20.11 ? 68  GLN X O   1 
ATOM   256  C  CB  . GLN A 1 32  ? 48.823 3.923  1.818   1.00 22.05 ? 68  GLN X CB  1 
ATOM   257  C  CG  . GLN A 1 32  ? 49.275 2.862  2.818   1.00 24.29 ? 68  GLN X CG  1 
ATOM   258  C  CD  . GLN A 1 32  ? 48.621 1.500  2.637   1.00 30.01 ? 68  GLN X CD  1 
ATOM   259  O  OE1 . GLN A 1 32  ? 48.691 0.902  1.559   1.00 34.62 ? 68  GLN X OE1 1 
ATOM   260  N  NE2 . GLN A 1 32  ? 48.019 0.987  3.702   1.00 33.90 ? 68  GLN X NE2 1 
ATOM   261  N  N   . LEU A 1 33  ? 48.260 6.953  0.711   1.00 20.68 ? 69  LEU X N   1 
ATOM   262  C  CA  . LEU A 1 33  ? 48.196 7.849  -0.444  1.00 21.02 ? 69  LEU X CA  1 
ATOM   263  C  C   . LEU A 1 33  ? 49.053 9.090  -0.223  1.00 21.03 ? 69  LEU X C   1 
ATOM   264  O  O   . LEU A 1 33  ? 49.726 9.555  -1.141  1.00 20.61 ? 69  LEU X O   1 
ATOM   265  C  CB  . LEU A 1 33  ? 46.750 8.207  -0.793  1.00 21.09 ? 69  LEU X CB  1 
ATOM   266  C  CG  . LEU A 1 33  ? 46.492 8.745  -2.206  1.00 22.58 ? 69  LEU X CG  1 
ATOM   267  C  CD1 . LEU A 1 33  ? 46.898 7.710  -3.247  1.00 23.84 ? 69  LEU X CD1 1 
ATOM   268  C  CD2 . LEU A 1 33  ? 45.029 9.151  -2.439  1.00 21.35 ? 69  LEU X CD2 1 
ATOM   269  N  N   . ALA A 1 34  ? 49.077 9.587  1.007   1.00 21.69 ? 70  ALA X N   1 
ATOM   270  C  CA  . ALA A 1 34  ? 49.965 10.690 1.394   1.00 22.60 ? 70  ALA X CA  1 
ATOM   271  C  C   . ALA A 1 34  ? 51.433 10.324 1.181   1.00 23.29 ? 70  ALA X C   1 
ATOM   272  O  O   . ALA A 1 34  ? 52.220 11.131 0.676   1.00 23.53 ? 70  ALA X O   1 
ATOM   273  C  CB  . ALA A 1 34  ? 49.706 11.064 2.854   1.00 23.23 ? 70  ALA X CB  1 
ATOM   274  N  N   . GLU A 1 35  ? 51.763 9.083  1.522   1.00 23.69 ? 71  GLU X N   1 
ATOM   275  C  CA  . GLU A 1 35  ? 53.122 8.559  1.414   1.00 24.32 ? 71  GLU X CA  1 
ATOM   276  C  C   . GLU A 1 35  ? 53.532 8.510  -0.045  1.00 23.82 ? 71  GLU X C   1 
ATOM   277  O  O   . GLU A 1 35  ? 54.679 8.822  -0.378  1.00 23.90 ? 71  GLU X O   1 
ATOM   278  C  CB  . GLU A 1 35  ? 53.180 7.163  2.033   1.00 25.49 ? 71  GLU X CB  1 
ATOM   279  C  CG  . GLU A 1 35  ? 54.560 6.526  2.137   1.00 29.00 ? 71  GLU X CG  1 
ATOM   280  C  CD  . GLU A 1 35  ? 54.523 5.253  2.966   1.00 33.75 ? 71  GLU X CD  1 
ATOM   281  O  OE1 . GLU A 1 35  ? 54.613 5.355  4.220   1.00 35.55 ? 71  GLU X OE1 1 
ATOM   282  O  OE2 . GLU A 1 35  ? 54.369 4.147  2.375   1.00 36.57 ? 71  GLU X OE2 1 
ATOM   283  N  N   . ARG A 1 36  ? 52.595 8.110  -0.912  1.00 22.67 ? 72  ARG X N   1 
ATOM   284  C  CA  . ARG A 1 36  ? 52.846 8.052  -2.347  1.00 22.83 ? 72  ARG X CA  1 
ATOM   285  C  C   . ARG A 1 36  ? 53.133 9.423  -2.970  1.00 23.30 ? 72  ARG X C   1 
ATOM   286  O  O   . ARG A 1 36  ? 53.997 9.543  -3.832  1.00 22.82 ? 72  ARG X O   1 
ATOM   287  C  CB  . ARG A 1 36  ? 51.645 7.413  -3.059  1.00 22.50 ? 72  ARG X CB  1 
ATOM   288  C  CG  . ARG A 1 36  ? 51.767 7.315  -4.567  1.00 21.48 ? 72  ARG X CG  1 
ATOM   289  C  CD  . ARG A 1 36  ? 53.019 6.572  -5.010  1.00 22.51 ? 72  ARG X CD  1 
ATOM   290  N  NE  . ARG A 1 36  ? 53.176 6.505  -6.462  1.00 22.96 ? 72  ARG X NE  1 
ATOM   291  C  CZ  . ARG A 1 36  ? 53.654 7.491  -7.225  1.00 24.28 ? 72  ARG X CZ  1 
ATOM   292  N  NH1 . ARG A 1 36  ? 54.007 8.663  -6.712  1.00 24.79 ? 72  ARG X NH1 1 
ATOM   293  N  NH2 . ARG A 1 36  ? 53.766 7.304  -8.530  1.00 24.77 ? 72  ARG X NH2 1 
ATOM   294  N  N   . PHE A 1 37  ? 52.400 10.444 -2.551  1.00 24.31 ? 73  PHE X N   1 
ATOM   295  C  CA  . PHE A 1 37  ? 52.449 11.744 -3.195  1.00 25.89 ? 73  PHE X CA  1 
ATOM   296  C  C   . PHE A 1 37  ? 53.024 12.801 -2.261  1.00 27.54 ? 73  PHE X C   1 
ATOM   297  O  O   . PHE A 1 37  ? 52.275 13.413 -1.496  1.00 27.26 ? 73  PHE X O   1 
ATOM   298  C  CB  . PHE A 1 37  ? 51.046 12.156 -3.651  1.00 26.11 ? 73  PHE X CB  1 
ATOM   299  C  CG  . PHE A 1 37  ? 50.541 11.380 -4.826  1.00 27.01 ? 73  PHE X CG  1 
ATOM   300  C  CD1 . PHE A 1 37  ? 51.233 11.401 -6.034  1.00 28.03 ? 73  PHE X CD1 1 
ATOM   301  C  CD2 . PHE A 1 37  ? 49.380 10.630 -4.734  1.00 27.58 ? 73  PHE X CD2 1 
ATOM   302  C  CE1 . PHE A 1 37  ? 50.772 10.683 -7.127  1.00 27.82 ? 73  PHE X CE1 1 
ATOM   303  C  CE2 . PHE A 1 37  ? 48.909 9.917  -5.825  1.00 27.64 ? 73  PHE X CE2 1 
ATOM   304  C  CZ  . PHE A 1 37  ? 49.606 9.941  -7.019  1.00 27.99 ? 73  PHE X CZ  1 
ATOM   305  N  N   . VAL A 1 38  ? 54.338 13.030 -2.358  1.00 29.60 ? 74  VAL X N   1 
ATOM   306  C  CA  . VAL A 1 38  ? 55.070 13.900 -1.433  1.00 31.66 ? 74  VAL X CA  1 
ATOM   307  C  C   . VAL A 1 38  ? 55.505 15.273 -2.046  1.00 33.15 ? 74  VAL X C   1 
ATOM   308  O  O   . VAL A 1 38  ? 55.876 16.185 -1.308  1.00 33.97 ? 74  VAL X O   1 
ATOM   309  C  CB  . VAL A 1 38  ? 56.254 13.096 -0.804  1.00 32.16 ? 74  VAL X CB  1 
ATOM   310  C  CG1 . VAL A 1 38  ? 57.244 13.980 -0.004  1.00 33.66 ? 74  VAL X CG1 1 
ATOM   311  C  CG2 . VAL A 1 38  ? 55.706 12.006 0.093   1.00 32.23 ? 74  VAL X CG2 1 
ATOM   312  N  N   . SER A 1 39  ? 55.414 15.441 -3.363  1.00 34.37 ? 75  SER X N   1 
ATOM   313  C  CA  . SER A 1 39  ? 55.712 16.732 -4.011  1.00 35.16 ? 75  SER X CA  1 
ATOM   314  C  C   . SER A 1 39  ? 54.951 17.896 -3.378  1.00 35.37 ? 75  SER X C   1 
ATOM   315  O  O   . SER A 1 39  ? 53.819 17.724 -2.940  1.00 35.64 ? 75  SER X O   1 
ATOM   316  C  CB  . SER A 1 39  ? 55.372 16.679 -5.505  1.00 35.62 ? 75  SER X CB  1 
ATOM   317  O  OG  . SER A 1 39  ? 55.336 17.980 -6.094  1.00 36.68 ? 75  SER X OG  1 
ATOM   318  N  N   . PRO A 1 40  ? 55.545 19.091 -3.349  1.00 35.47 ? 76  PRO X N   1 
ATOM   319  C  CA  . PRO A 1 40  ? 54.854 20.269 -2.821  1.00 35.22 ? 76  PRO X CA  1 
ATOM   320  C  C   . PRO A 1 40  ? 53.708 20.727 -3.702  1.00 34.45 ? 76  PRO X C   1 
ATOM   321  O  O   . PRO A 1 40  ? 52.757 21.340 -3.190  1.00 35.04 ? 76  PRO X O   1 
ATOM   322  C  CB  . PRO A 1 40  ? 55.949 21.337 -2.814  1.00 35.40 ? 76  PRO X CB  1 
ATOM   323  C  CG  . PRO A 1 40  ? 57.211 20.580 -2.927  1.00 35.64 ? 76  PRO X CG  1 
ATOM   324  C  CD  . PRO A 1 40  ? 56.899 19.439 -3.810  1.00 35.61 ? 76  PRO X CD  1 
ATOM   325  N  N   . GLU A 1 41  ? 53.827 20.467 -5.008  1.00 33.76 ? 77  GLU X N   1 
ATOM   326  C  CA  . GLU A 1 41  ? 52.735 20.677 -5.949  1.00 32.61 ? 77  GLU X CA  1 
ATOM   327  C  C   . GLU A 1 41  ? 51.595 19.661 -5.765  1.00 30.24 ? 77  GLU X C   1 
ATOM   328  O  O   . GLU A 1 41  ? 50.570 19.799 -6.421  1.00 29.42 ? 77  GLU X O   1 
ATOM   329  C  CB  . GLU A 1 41  ? 53.239 20.672 -7.404  1.00 33.43 ? 77  GLU X CB  1 
ATOM   330  C  CG  . GLU A 1 41  ? 53.726 22.041 -7.875  1.00 35.82 ? 77  GLU X CG  1 
ATOM   331  C  CD  . GLU A 1 41  ? 53.931 22.125 -9.381  1.00 38.78 ? 77  GLU X CD  1 
ATOM   332  O  OE1 . GLU A 1 41  ? 54.604 21.229 -9.956  1.00 41.06 ? 77  GLU X OE1 1 
ATOM   333  O  OE2 . GLU A 1 41  ? 53.411 23.094 -9.996  1.00 40.85 ? 77  GLU X OE2 1 
ATOM   334  N  N   . MET A 1 42  ? 51.784 18.655 -4.900  1.00 27.99 ? 78  MET X N   1 
ATOM   335  C  CA  . MET A 1 42  ? 50.674 17.820 -4.383  1.00 26.19 ? 78  MET X CA  1 
ATOM   336  C  C   . MET A 1 42  ? 50.196 18.225 -2.973  1.00 24.40 ? 78  MET X C   1 
ATOM   337  O  O   . MET A 1 42  ? 50.691 17.704 -1.974  1.00 26.19 ? 78  MET X O   1 
ATOM   338  C  CB  . MET A 1 42  ? 51.060 16.333 -4.304  1.00 26.57 ? 78  MET X CB  1 
ATOM   339  C  CG  . MET A 1 42  ? 51.518 15.672 -5.587  1.00 28.50 ? 78  MET X CG  1 
ATOM   340  S  SD  . MET A 1 42  ? 50.235 15.632 -6.840  1.00 30.40 ? 78  MET X SD  1 
ATOM   341  C  CE  . MET A 1 42  ? 49.072 14.297 -6.219  1.00 29.50 ? 78  MET X CE  1 
ATOM   342  N  N   . ARG A 1 43  ? 49.202 19.084 -2.899  1.00 21.05 ? 79  ARG X N   1 
ATOM   343  C  CA  . ARG A 1 43  ? 48.705 19.569 -1.599  1.00 19.08 ? 79  ARG X CA  1 
ATOM   344  C  C   . ARG A 1 43  ? 47.601 18.638 -1.122  1.00 18.25 ? 79  ARG X C   1 
ATOM   345  O  O   . ARG A 1 43  ? 46.774 18.207 -1.931  1.00 18.76 ? 79  ARG X O   1 
ATOM   346  C  CB  . ARG A 1 43  ? 48.138 20.971 -1.748  1.00 17.91 ? 79  ARG X CB  1 
ATOM   347  C  CG  . ARG A 1 43  ? 49.196 21.991 -2.251  1.00 19.96 ? 79  ARG X CG  1 
ATOM   348  C  CD  . ARG A 1 43  ? 48.793 23.406 -2.084  1.00 21.14 ? 79  ARG X CD  1 
ATOM   349  N  NE  . ARG A 1 43  ? 47.740 23.774 -2.999  1.00 21.05 ? 79  ARG X NE  1 
ATOM   350  C  CZ  . ARG A 1 43  ? 47.237 24.979 -3.135  1.00 22.58 ? 79  ARG X CZ  1 
ATOM   351  N  NH1 . ARG A 1 43  ? 47.732 26.000 -2.455  1.00 25.67 ? 79  ARG X NH1 1 
ATOM   352  N  NH2 . ARG A 1 43  ? 46.278 25.191 -3.990  1.00 21.74 ? 79  ARG X NH2 1 
ATOM   353  N  N   . LEU A 1 44  ? 47.594 18.404 0.187   1.00 17.26 ? 80  LEU X N   1 
ATOM   354  C  CA  . LEU A 1 44  ? 46.572 17.572 0.865   1.00 16.34 ? 80  LEU X CA  1 
ATOM   355  C  C   . LEU A 1 44  ? 45.773 18.358 1.873   1.00 16.82 ? 80  LEU X C   1 
ATOM   356  O  O   . LEU A 1 44  ? 46.332 19.216 2.582   1.00 17.88 ? 80  LEU X O   1 
ATOM   357  C  CB  . LEU A 1 44  ? 47.205 16.405 1.614   1.00 16.62 ? 80  LEU X CB  1 
ATOM   358  C  CG  . LEU A 1 44  ? 48.301 15.615 0.928   1.00 17.26 ? 80  LEU X CG  1 
ATOM   359  C  CD1 . LEU A 1 44  ? 48.783 14.483 1.804   1.00 18.68 ? 80  LEU X CD1 1 
ATOM   360  C  CD2 . LEU A 1 44  ? 47.837 15.144 -0.469  1.00 19.58 ? 80  LEU X CD2 1 
ATOM   361  N  N   . SER A 1 45  ? 44.495 17.978 2.009   1.00 15.71 ? 81  SER X N   1 
ATOM   362  C  CA  . SER A 1 45  ? 43.589 18.438 3.083   1.00 15.18 ? 81  SER X CA  1 
ATOM   363  C  C   . SER A 1 45  ? 42.825 17.242 3.663   1.00 16.20 ? 81  SER X C   1 
ATOM   364  O  O   . SER A 1 45  ? 42.398 16.380 2.914   1.00 16.60 ? 81  SER X O   1 
ATOM   365  C  CB  . SER A 1 45  ? 42.584 19.456 2.582   1.00 15.00 ? 81  SER X CB  1 
ATOM   366  O  OG  . SER A 1 45  ? 41.665 19.891 3.623   1.00 16.06 ? 81  SER X OG  1 
ATOM   367  N  N   . PHE A 1 46  ? 42.721 17.177 4.989   1.00 15.07 ? 82  PHE X N   1 
ATOM   368  C  CA  . PHE A 1 46  ? 41.931 16.135 5.683   1.00 14.97 ? 82  PHE X CA  1 
ATOM   369  C  C   . PHE A 1 46  ? 40.693 16.763 6.314   1.00 15.06 ? 82  PHE X C   1 
ATOM   370  O  O   . PHE A 1 46  ? 40.786 17.734 7.101   1.00 15.22 ? 82  PHE X O   1 
ATOM   371  C  CB  . PHE A 1 46  ? 42.752 15.441 6.780   1.00 15.18 ? 82  PHE X CB  1 
ATOM   372  C  CG  . PHE A 1 46  ? 44.092 14.892 6.330   1.00 15.87 ? 82  PHE X CG  1 
ATOM   373  C  CD1 . PHE A 1 46  ? 44.319 14.451 5.019   1.00 16.54 ? 82  PHE X CD1 1 
ATOM   374  C  CD2 . PHE A 1 46  ? 45.112 14.729 7.273   1.00 17.93 ? 82  PHE X CD2 1 
ATOM   375  C  CE1 . PHE A 1 46  ? 45.573 13.919 4.656   1.00 18.82 ? 82  PHE X CE1 1 
ATOM   376  C  CE2 . PHE A 1 46  ? 46.363 14.221 6.923   1.00 18.60 ? 82  PHE X CE2 1 
ATOM   377  C  CZ  . PHE A 1 46  ? 46.597 13.815 5.604   1.00 18.22 ? 82  PHE X CZ  1 
ATOM   378  N  N   . ILE A 1 47  ? 39.533 16.208 5.995   1.00 14.37 ? 83  ILE X N   1 
ATOM   379  C  CA  . ILE A 1 47  ? 38.236 16.631 6.512   1.00 14.13 ? 83  ILE X CA  1 
ATOM   380  C  C   . ILE A 1 47  ? 37.570 15.414 7.126   1.00 13.94 ? 83  ILE X C   1 
ATOM   381  O  O   . ILE A 1 47  ? 37.628 14.329 6.565   1.00 14.02 ? 83  ILE X O   1 
ATOM   382  C  CB  . ILE A 1 47  ? 37.338 17.157 5.377   1.00 14.09 ? 83  ILE X CB  1 
ATOM   383  C  CG1 . ILE A 1 47  ? 37.849 18.507 4.815   1.00 14.94 ? 83  ILE X CG1 1 
ATOM   384  C  CG2 . ILE A 1 47  ? 35.859 17.284 5.827   1.00 14.87 ? 83  ILE X CG2 1 
ATOM   385  C  CD1 . ILE A 1 47  ? 37.363 18.784 3.362   1.00 16.84 ? 83  ILE X CD1 1 
ATOM   386  N  N   . VAL A 1 48  ? 37.009 15.585 8.326   1.00 12.92 ? 84  VAL X N   1 
ATOM   387  C  CA  . VAL A 1 48  ? 36.223 14.504 8.933   1.00 13.37 ? 84  VAL X CA  1 
ATOM   388  C  C   . VAL A 1 48  ? 34.774 14.939 9.114   1.00 12.83 ? 84  VAL X C   1 
ATOM   389  O  O   . VAL A 1 48  ? 34.457 16.133 9.202   1.00 13.13 ? 84  VAL X O   1 
ATOM   390  C  CB  . VAL A 1 48  ? 36.808 14.047 10.273  1.00 13.13 ? 84  VAL X CB  1 
ATOM   391  C  CG1 . VAL A 1 48  ? 38.171 13.392 10.091  1.00 13.37 ? 84  VAL X CG1 1 
ATOM   392  C  CG2 . VAL A 1 48  ? 36.869 15.209 11.301  1.00 14.30 ? 84  VAL X CG2 1 
ATOM   393  N  N   . PHE A 1 49  ? 33.870 13.943 9.093   1.00 11.34 ? 85  PHE X N   1 
ATOM   394  C  CA  . PHE A 1 49  ? 32.447 14.243 9.294   1.00 10.66 ? 85  PHE X CA  1 
ATOM   395  C  C   . PHE A 1 49  ? 31.747 13.118 10.033  1.00 10.97 ? 85  PHE X C   1 
ATOM   396  O  O   . PHE A 1 49  ? 32.036 11.952 9.862   1.00 10.87 ? 85  PHE X O   1 
ATOM   397  C  CB  . PHE A 1 49  ? 31.733 14.539 7.972   1.00 11.13 ? 85  PHE X CB  1 
ATOM   398  C  CG  . PHE A 1 49  ? 31.536 13.324 7.088   1.00 10.78 ? 85  PHE X CG  1 
ATOM   399  C  CD1 . PHE A 1 49  ? 30.422 12.496 7.250   1.00 11.85 ? 85  PHE X CD1 1 
ATOM   400  C  CD2 . PHE A 1 49  ? 32.502 12.975 6.144   1.00 12.11 ? 85  PHE X CD2 1 
ATOM   401  C  CE1 . PHE A 1 49  ? 30.265 11.370 6.452   1.00 12.50 ? 85  PHE X CE1 1 
ATOM   402  C  CE2 . PHE A 1 49  ? 32.329 11.856 5.363   1.00 10.23 ? 85  PHE X CE2 1 
ATOM   403  C  CZ  . PHE A 1 49  ? 31.204 11.053 5.523   1.00 11.25 ? 85  PHE X CZ  1 
ATOM   404  N  N   . SER A 1 50  ? 30.842 13.541 10.893  1.00 10.80 ? 86  SER X N   1 
ATOM   405  C  CA  . SER A 1 50  ? 29.807 12.665 11.461  1.00 11.11 ? 86  SER X CA  1 
ATOM   406  C  C   . SER A 1 50  ? 28.518 13.497 11.563  1.00 10.96 ? 86  SER X C   1 
ATOM   407  O  O   . SER A 1 50  ? 27.879 13.770 10.552  1.00 10.94 ? 86  SER X O   1 
ATOM   408  C  CB  . SER A 1 50  ? 30.277 12.076 12.785  1.00 12.33 ? 86  SER X CB  1 
ATOM   409  O  OG  . SER A 1 50  ? 30.609 13.089 13.716  1.00 15.14 ? 86  SER X OG  1 
ATOM   410  N  N   . SER A 1 51  ? 28.136 13.933 12.771  1.00 11.97 ? 87  SER X N   1 
ATOM   411  C  CA  . SER A 1 51  ? 26.973 14.804 12.925  1.00 13.19 ? 87  SER X CA  1 
ATOM   412  C  C   . SER A 1 51  ? 27.357 16.282 12.766  1.00 14.57 ? 87  SER X C   1 
ATOM   413  O  O   . SER A 1 51  ? 26.511 17.169 12.866  1.00 15.34 ? 87  SER X O   1 
ATOM   414  C  CB  . SER A 1 51  ? 26.357 14.605 14.305  1.00 13.98 ? 87  SER X CB  1 
ATOM   415  O  OG  . SER A 1 51  ? 27.334 14.724 15.308  1.00 14.78 ? 87  SER X OG  1 
ATOM   416  N  N   . GLN A 1 52  ? 28.655 16.516 12.551  1.00 15.94 ? 88  GLN X N   1 
ATOM   417  C  CA  . GLN A 1 52  ? 29.208 17.820 12.210  1.00 17.12 ? 88  GLN X CA  1 
ATOM   418  C  C   . GLN A 1 52  ? 30.512 17.537 11.440  1.00 17.69 ? 88  GLN X C   1 
ATOM   419  O  O   . GLN A 1 52  ? 31.032 16.423 11.494  1.00 19.33 ? 88  GLN X O   1 
ATOM   420  C  CB  . GLN A 1 52  ? 29.465 18.658 13.477  1.00 16.93 ? 88  GLN X CB  1 
ATOM   421  C  CG  . GLN A 1 52  ? 30.428 18.038 14.527  1.00 19.23 ? 88  GLN X CG  1 
ATOM   422  C  CD  . GLN A 1 52  ? 29.786 16.989 15.477  1.00 22.46 ? 88  GLN X CD  1 
ATOM   423  O  OE1 . GLN A 1 52  ? 28.604 17.029 15.719  1.00 22.72 ? 88  GLN X OE1 1 
ATOM   424  N  NE2 . GLN A 1 52  ? 30.612 16.084 16.045  1.00 26.06 ? 88  GLN X NE2 1 
ATOM   425  N  N   . ALA A 1 53  ? 31.043 18.534 10.743  1.00 16.22 ? 89  ALA X N   1 
ATOM   426  C  CA  . ALA A 1 53  ? 32.241 18.298 9.945   1.00 15.41 ? 89  ALA X CA  1 
ATOM   427  C  C   . ALA A 1 53  ? 33.306 19.306 10.329  1.00 16.10 ? 89  ALA X C   1 
ATOM   428  O  O   . ALA A 1 53  ? 32.964 20.414 10.719  1.00 17.52 ? 89  ALA X O   1 
ATOM   429  C  CB  . ALA A 1 53  ? 31.915 18.402 8.508   1.00 15.53 ? 89  ALA X CB  1 
ATOM   430  N  N   . THR A 1 54  ? 34.571 18.908 10.224  1.00 16.13 ? 90  THR X N   1 
ATOM   431  C  CA  . THR A 1 54  ? 35.695 19.778 10.542  1.00 18.24 ? 90  THR X CA  1 
ATOM   432  C  C   . THR A 1 54  ? 36.883 19.513 9.623   1.00 18.36 ? 90  THR X C   1 
ATOM   433  O  O   . THR A 1 54  ? 37.162 18.384 9.236   1.00 16.70 ? 90  THR X O   1 
ATOM   434  C  CB  . THR A 1 54  ? 36.144 19.560 11.983  1.00 19.57 ? 90  THR X CB  1 
ATOM   435  O  OG1 . THR A 1 54  ? 36.548 18.208 12.186  1.00 24.18 ? 90  THR X OG1 1 
ATOM   436  C  CG2 . THR A 1 54  ? 35.024 19.719 12.938  1.00 21.29 ? 90  THR X CG2 1 
ATOM   437  N  N   . ILE A 1 55  ? 37.591 20.594 9.328   1.00 19.49 ? 91  ILE X N   1 
ATOM   438  C  CA  . ILE A 1 55  ? 38.847 20.565 8.600   1.00 20.38 ? 91  ILE X CA  1 
ATOM   439  C  C   . ILE A 1 55  ? 39.967 20.262 9.594   1.00 20.06 ? 91  ILE X C   1 
ATOM   440  O  O   . ILE A 1 55  ? 40.363 21.151 10.375  1.00 22.47 ? 91  ILE X O   1 
ATOM   441  C  CB  . ILE A 1 55  ? 39.057 21.923 7.857   1.00 20.30 ? 91  ILE X CB  1 
ATOM   442  C  CG1 . ILE A 1 55  ? 37.962 22.129 6.797   1.00 20.60 ? 91  ILE X CG1 1 
ATOM   443  C  CG2 . ILE A 1 55  ? 40.437 21.996 7.217   1.00 21.72 ? 91  ILE X CG2 1 
ATOM   444  C  CD1 . ILE A 1 55  ? 37.894 23.501 6.136   1.00 20.92 ? 91  ILE X CD1 1 
ATOM   445  N  N   . ILE A 1 56  ? 40.437 19.024 9.638   1.00 20.12 ? 92  ILE X N   1 
ATOM   446  C  CA  . ILE A 1 56  ? 41.554 18.619 10.481  1.00 20.03 ? 92  ILE X CA  1 
ATOM   447  C  C   . ILE A 1 56  ? 42.890 19.187 9.976   1.00 19.79 ? 92  ILE X C   1 
ATOM   448  O  O   . ILE A 1 56  ? 43.706 19.702 10.771  1.00 20.33 ? 92  ILE X O   1 
ATOM   449  C  CB  . ILE A 1 56  ? 41.658 17.093 10.552  1.00 20.66 ? 92  ILE X CB  1 
ATOM   450  C  CG1 . ILE A 1 56  ? 40.393 16.494 11.211  1.00 21.04 ? 92  ILE X CG1 1 
ATOM   451  C  CG2 . ILE A 1 56  ? 42.940 16.649 11.271  1.00 21.92 ? 92  ILE X CG2 1 
ATOM   452  C  CD1 . ILE A 1 56  ? 40.256 16.728 12.698  1.00 23.53 ? 92  ILE X CD1 1 
ATOM   453  N  N   . LEU A 1 57  ? 43.119 19.048 8.666   1.00 19.27 ? 93  LEU X N   1 
ATOM   454  C  CA  . LEU A 1 57  ? 44.300 19.562 7.994   1.00 19.09 ? 93  LEU X CA  1 
ATOM   455  C  C   . LEU A 1 57  ? 43.829 20.446 6.875   1.00 18.51 ? 93  LEU X C   1 
ATOM   456  O  O   . LEU A 1 57  ? 43.387 19.961 5.831   1.00 17.35 ? 93  LEU X O   1 
ATOM   457  C  CB  . LEU A 1 57  ? 45.181 18.436 7.463   1.00 19.15 ? 93  LEU X CB  1 
ATOM   458  C  CG  . LEU A 1 57  ? 46.420 18.808 6.624   1.00 19.68 ? 93  LEU X CG  1 
ATOM   459  C  CD1 . LEU A 1 57  ? 47.533 19.319 7.563   1.00 20.97 ? 93  LEU X CD1 1 
ATOM   460  C  CD2 . LEU A 1 57  ? 46.904 17.621 5.796   1.00 20.50 ? 93  LEU X CD2 1 
ATOM   461  N  N   . PRO A 1 58  ? 43.921 21.766 7.027   1.00 18.85 ? 94  PRO X N   1 
ATOM   462  C  CA  . PRO A 1 58  ? 43.726 22.675 5.908   1.00 18.64 ? 94  PRO X CA  1 
ATOM   463  C  C   . PRO A 1 58  ? 44.742 22.411 4.780   1.00 18.49 ? 94  PRO X C   1 
ATOM   464  O  O   . PRO A 1 58  ? 45.855 21.948 5.048   1.00 18.36 ? 94  PRO X O   1 
ATOM   465  C  CB  . PRO A 1 58  ? 44.002 24.043 6.524   1.00 19.42 ? 94  PRO X CB  1 
ATOM   466  C  CG  . PRO A 1 58  ? 43.645 23.825 7.943   1.00 18.90 ? 94  PRO X CG  1 
ATOM   467  C  CD  . PRO A 1 58  ? 44.182 22.507 8.283   1.00 18.75 ? 94  PRO X CD  1 
ATOM   468  N  N   . LEU A 1 59  ? 44.279 22.611 3.553   1.00 18.52 ? 95  LEU X N   1 
ATOM   469  C  CA  . LEU A 1 59  ? 45.030 22.303 2.341   1.00 18.77 ? 95  LEU X CA  1 
ATOM   470  C  C   . LEU A 1 59  ? 46.445 22.826 2.436   1.00 19.36 ? 95  LEU X C   1 
ATOM   471  O  O   . LEU A 1 59  ? 46.635 24.020 2.681   1.00 22.25 ? 95  LEU X O   1 
ATOM   472  C  CB  . LEU A 1 59  ? 44.363 22.943 1.138   1.00 18.12 ? 95  LEU X CB  1 
ATOM   473  C  CG  . LEU A 1 59  ? 44.991 22.664 -0.235  1.00 18.76 ? 95  LEU X CG  1 
ATOM   474  C  CD1 . LEU A 1 59  ? 44.826 21.164 -0.634  1.00 18.82 ? 95  LEU X CD1 1 
ATOM   475  C  CD2 . LEU A 1 59  ? 44.340 23.540 -1.248  1.00 18.38 ? 95  LEU X CD2 1 
ATOM   476  N  N   . THR A 1 60  ? 47.411 21.936 2.262   1.00 19.75 ? 96  THR X N   1 
ATOM   477  C  CA  . THR A 1 60  ? 48.832 22.294 2.398   1.00 20.09 ? 96  THR X CA  1 
ATOM   478  C  C   . THR A 1 60  ? 49.759 21.282 1.728   1.00 20.97 ? 96  THR X C   1 
ATOM   479  O  O   . THR A 1 60  ? 49.462 20.099 1.608   1.00 19.40 ? 96  THR X O   1 
ATOM   480  C  CB  . THR A 1 60  ? 49.198 22.403 3.895   1.00 19.62 ? 96  THR X CB  1 
ATOM   481  O  OG1 . THR A 1 60  ? 50.549 22.911 4.036   1.00 20.59 ? 96  THR X OG1 1 
ATOM   482  C  CG2 . THR A 1 60  ? 49.227 21.038 4.617   1.00 19.26 ? 96  THR X CG2 1 
ATOM   483  N  N   . GLY A 1 61  ? 50.925 21.759 1.304   1.00 21.85 ? 97  GLY X N   1 
ATOM   484  C  CA  . GLY A 1 61  ? 52.001 20.896 0.876   1.00 22.88 ? 97  GLY X CA  1 
ATOM   485  C  C   . GLY A 1 61  ? 53.118 20.723 1.889   1.00 23.53 ? 97  GLY X C   1 
ATOM   486  O  O   . GLY A 1 61  ? 54.077 19.999 1.628   1.00 24.17 ? 97  GLY X O   1 
ATOM   487  N  N   . ASP A 1 62  ? 52.982 21.343 3.063   1.00 23.90 ? 98  ASP X N   1 
ATOM   488  C  CA  . ASP A 1 62  ? 54.001 21.232 4.092   1.00 24.42 ? 98  ASP X CA  1 
ATOM   489  C  C   . ASP A 1 62  ? 53.906 19.876 4.725   1.00 24.85 ? 98  ASP X C   1 
ATOM   490  O  O   . ASP A 1 62  ? 52.887 19.547 5.364   1.00 24.08 ? 98  ASP X O   1 
ATOM   491  C  CB  . ASP A 1 62  ? 53.845 22.310 5.174   1.00 24.62 ? 98  ASP X CB  1 
ATOM   492  C  CG  . ASP A 1 62  ? 54.893 22.172 6.276   1.00 24.37 ? 98  ASP X CG  1 
ATOM   493  O  OD1 . ASP A 1 62  ? 56.062 22.596 6.081   1.00 25.80 ? 98  ASP X OD1 1 
ATOM   494  O  OD2 . ASP A 1 62  ? 54.686 21.614 7.365   1.00 21.80 ? 98  ASP X OD2 1 
ATOM   495  N  N   . ARG A 1 63  ? 54.942 19.072 4.575   1.00 25.98 ? 99  ARG X N   1 
ATOM   496  C  CA  . ARG A 1 63  ? 54.903 17.701 5.083   1.00 27.26 ? 99  ARG X CA  1 
ATOM   497  C  C   . ARG A 1 63  ? 54.953 17.586 6.625   1.00 26.44 ? 99  ARG X C   1 
ATOM   498  O  O   . ARG A 1 63  ? 54.539 16.571 7.181   1.00 26.34 ? 99  ARG X O   1 
ATOM   499  C  CB  . ARG A 1 63  ? 55.963 16.835 4.383   1.00 28.47 ? 99  ARG X CB  1 
ATOM   500  C  CG  . ARG A 1 63  ? 55.429 16.080 3.117   1.00 30.75 ? 99  ARG X CG  1 
ATOM   501  C  CD  . ARG A 1 63  ? 54.722 16.952 2.047   1.00 31.53 ? 99  ARG X CD  1 
ATOM   502  N  NE  . ARG A 1 63  ? 53.790 16.176 1.228   1.00 33.11 ? 99  ARG X NE  1 
ATOM   503  C  CZ  . ARG A 1 63  ? 53.063 16.666 0.230   1.00 33.95 ? 99  ARG X CZ  1 
ATOM   504  N  NH1 . ARG A 1 63  ? 53.148 17.947 -0.118  1.00 34.99 ? 99  ARG X NH1 1 
ATOM   505  N  NH2 . ARG A 1 63  ? 52.236 15.860 -0.427  1.00 33.41 ? 99  ARG X NH2 1 
ATOM   506  N  N   . GLY A 1 64  ? 55.444 18.605 7.327   1.00 25.18 ? 100 GLY X N   1 
ATOM   507  C  CA  . GLY A 1 64  ? 55.393 18.596 8.782   1.00 24.10 ? 100 GLY X CA  1 
ATOM   508  C  C   . GLY A 1 64  ? 53.943 18.664 9.283   1.00 23.09 ? 100 GLY X C   1 
ATOM   509  O  O   . GLY A 1 64  ? 53.529 17.908 10.173  1.00 23.02 ? 100 GLY X O   1 
ATOM   510  N  N   . LYS A 1 65  ? 53.195 19.588 8.707   1.00 22.21 ? 101 LYS X N   1 
ATOM   511  C  CA  . LYS A 1 65  ? 51.762 19.719 8.946   1.00 22.03 ? 101 LYS X CA  1 
ATOM   512  C  C   . LYS A 1 65  ? 51.041 18.447 8.520   1.00 21.78 ? 101 LYS X C   1 
ATOM   513  O  O   . LYS A 1 65  ? 50.132 18.013 9.216   1.00 21.41 ? 101 LYS X O   1 
ATOM   514  C  CB  . LYS A 1 65  ? 51.181 20.951 8.228   1.00 21.56 ? 101 LYS X CB  1 
ATOM   515  C  CG  . LYS A 1 65  ? 51.544 22.326 8.869   1.00 22.66 ? 101 LYS X CG  1 
ATOM   516  C  CD  . LYS A 1 65  ? 51.088 23.493 8.009   1.00 24.15 ? 101 LYS X CD  1 
ATOM   517  C  CE  . LYS A 1 65  ? 51.321 24.874 8.680   1.00 27.02 ? 101 LYS X CE  1 
ATOM   518  N  NZ  . LYS A 1 65  ? 50.810 26.034 7.882   1.00 27.22 ? 101 LYS X NZ  1 
ATOM   519  N  N   . ILE A 1 66  ? 51.432 17.835 7.406   1.00 21.92 ? 102 ILE X N   1 
ATOM   520  C  CA  . ILE A 1 66  ? 50.751 16.613 6.963   1.00 21.46 ? 102 ILE X CA  1 
ATOM   521  C  C   . ILE A 1 66  ? 50.996 15.505 7.973   1.00 22.26 ? 102 ILE X C   1 
ATOM   522  O  O   . ILE A 1 66  ? 50.067 14.776 8.338   1.00 20.78 ? 102 ILE X O   1 
ATOM   523  C  CB  . ILE A 1 66  ? 51.191 16.200 5.529   1.00 21.15 ? 102 ILE X CB  1 
ATOM   524  C  CG1 . ILE A 1 66  ? 50.549 17.114 4.509   1.00 18.94 ? 102 ILE X CG1 1 
ATOM   525  C  CG2 . ILE A 1 66  ? 50.801 14.769 5.212   1.00 21.20 ? 102 ILE X CG2 1 
ATOM   526  C  CD1 . ILE A 1 66  ? 51.354 17.228 3.164   1.00 20.76 ? 102 ILE X CD1 1 
ATOM   527  N  N   . SER A 1 67  ? 52.218 15.415 8.487   1.00 22.74 ? 103 SER X N   1 
ATOM   528  C  CA  . SER A 1 67  ? 52.550 14.425 9.487   1.00 24.19 ? 103 SER X CA  1 
ATOM   529  C  C   . SER A 1 67  ? 51.664 14.551 10.732  1.00 23.94 ? 103 SER X C   1 
ATOM   530  O  O   . SER A 1 67  ? 51.242 13.519 11.304  1.00 23.82 ? 103 SER X O   1 
ATOM   531  C  CB  . SER A 1 67  ? 54.027 14.584 9.892   1.00 24.69 ? 103 SER X CB  1 
ATOM   532  O  OG  . SER A 1 67  ? 54.442 13.477 10.659  1.00 29.05 ? 103 SER X OG  1 
ATOM   533  N  N   . LYS A 1 68  ? 51.416 15.799 11.141  1.00 23.87 ? 104 LYS X N   1 
ATOM   534  C  CA  . LYS A 1 68  ? 50.638 16.116 12.337  1.00 24.10 ? 104 LYS X CA  1 
ATOM   535  C  C   . LYS A 1 68  ? 49.175 15.854 12.046  1.00 22.99 ? 104 LYS X C   1 
ATOM   536  O  O   . LYS A 1 68  ? 48.448 15.382 12.917  1.00 22.54 ? 104 LYS X O   1 
ATOM   537  C  CB  . LYS A 1 68  ? 50.817 17.579 12.766  1.00 24.91 ? 104 LYS X CB  1 
ATOM   538  C  CG  . LYS A 1 68  ? 49.973 18.012 13.986  1.00 26.68 ? 104 LYS X CG  1 
ATOM   539  C  CD  . LYS A 1 68  ? 50.101 17.083 15.182  1.00 29.05 ? 104 LYS X CD  1 
ATOM   540  C  CE  . LYS A 1 68  ? 49.231 17.530 16.379  1.00 30.07 ? 104 LYS X CE  1 
ATOM   541  N  NZ  . LYS A 1 68  ? 48.169 18.544 16.018  1.00 30.99 ? 104 LYS X NZ  1 
ATOM   542  N  N   . GLY A 1 69  ? 48.758 16.130 10.817  1.00 22.52 ? 105 GLY X N   1 
ATOM   543  C  CA  . GLY A 1 69  ? 47.394 15.846 10.394  1.00 21.50 ? 105 GLY X CA  1 
ATOM   544  C  C   . GLY A 1 69  ? 47.105 14.367 10.496  1.00 21.56 ? 105 GLY X C   1 
ATOM   545  O  O   . GLY A 1 69  ? 46.025 14.001 10.937  1.00 19.77 ? 105 GLY X O   1 
ATOM   546  N  N   . LEU A 1 70  ? 48.061 13.531 10.103  1.00 20.89 ? 106 LEU X N   1 
ATOM   547  C  CA  . LEU A 1 70  ? 47.970 12.086 10.225  1.00 21.74 ? 106 LEU X CA  1 
ATOM   548  C  C   . LEU A 1 70  ? 47.938 11.636 11.696  1.00 22.60 ? 106 LEU X C   1 
ATOM   549  O  O   . LEU A 1 70  ? 47.195 10.727 12.049  1.00 22.54 ? 106 LEU X O   1 
ATOM   550  C  CB  . LEU A 1 70  ? 49.093 11.410 9.452   1.00 21.59 ? 106 LEU X CB  1 
ATOM   551  C  CG  . LEU A 1 70  ? 48.939 11.445 7.928   1.00 21.08 ? 106 LEU X CG  1 
ATOM   552  C  CD1 . LEU A 1 70  ? 50.268 11.160 7.260   1.00 22.06 ? 106 LEU X CD1 1 
ATOM   553  C  CD2 . LEU A 1 70  ? 47.905 10.406 7.458   1.00 22.22 ? 106 LEU X CD2 1 
ATOM   554  N  N   . GLU A 1 71  ? 48.757 12.251 12.549  1.00 23.65 ? 107 GLU X N   1 
ATOM   555  C  CA  . GLU A 1 71  ? 48.711 11.969 13.986  1.00 25.10 ? 107 GLU X CA  1 
ATOM   556  C  C   . GLU A 1 71  ? 47.313 12.246 14.555  1.00 24.20 ? 107 GLU X C   1 
ATOM   557  O  O   . GLU A 1 71  ? 46.788 11.432 15.338  1.00 24.30 ? 107 GLU X O   1 
ATOM   558  C  CB  . GLU A 1 71  ? 49.712 12.852 14.744  1.00 26.12 ? 107 GLU X CB  1 
ATOM   559  C  CG  . GLU A 1 71  ? 51.183 12.536 14.516  1.00 29.50 ? 107 GLU X CG  1 
ATOM   560  C  CD  . GLU A 1 71  ? 52.108 13.428 15.356  1.00 34.40 ? 107 GLU X CD  1 
ATOM   561  O  OE1 . GLU A 1 71  ? 52.178 14.660 15.083  1.00 37.07 ? 107 GLU X OE1 1 
ATOM   562  O  OE2 . GLU A 1 71  ? 52.758 12.900 16.302  1.00 37.85 ? 107 GLU X OE2 1 
ATOM   563  N  N   . ASP A 1 72  ? 46.744 13.390 14.170  1.00 23.77 ? 108 ASP X N   1 
ATOM   564  C  CA  . ASP A 1 72  ? 45.381 13.784 14.557  1.00 23.93 ? 108 ASP X CA  1 
ATOM   565  C  C   . ASP A 1 72  ? 44.341 12.796 14.044  1.00 23.49 ? 108 ASP X C   1 
ATOM   566  O  O   . ASP A 1 72  ? 43.395 12.452 14.767  1.00 23.27 ? 108 ASP X O   1 
ATOM   567  C  CB  . ASP A 1 72  ? 44.996 15.161 14.017  1.00 24.02 ? 108 ASP X CB  1 
ATOM   568  C  CG  . ASP A 1 72  ? 45.764 16.302 14.647  1.00 26.18 ? 108 ASP X CG  1 
ATOM   569  O  OD1 . ASP A 1 72  ? 46.486 16.061 15.647  1.00 29.15 ? 108 ASP X OD1 1 
ATOM   570  O  OD2 . ASP A 1 72  ? 45.663 17.481 14.208  1.00 26.45 ? 108 ASP X OD2 1 
ATOM   571  N  N   . LEU A 1 73  ? 44.482 12.348 12.795  1.00 22.68 ? 109 LEU X N   1 
ATOM   572  C  CA  . LEU A 1 73  ? 43.517 11.376 12.262  1.00 21.86 ? 109 LEU X CA  1 
ATOM   573  C  C   . LEU A 1 73  ? 43.610 10.043 12.963  1.00 22.80 ? 109 LEU X C   1 
ATOM   574  O  O   . LEU A 1 73  ? 42.622 9.332  13.096  1.00 22.79 ? 109 LEU X O   1 
ATOM   575  C  CB  . LEU A 1 73  ? 43.763 11.123 10.777  1.00 21.09 ? 109 LEU X CB  1 
ATOM   576  C  CG  . LEU A 1 73  ? 43.353 12.222 9.811   1.00 19.07 ? 109 LEU X CG  1 
ATOM   577  C  CD1 . LEU A 1 73  ? 43.618 11.745 8.394   1.00 19.00 ? 109 LEU X CD1 1 
ATOM   578  C  CD2 . LEU A 1 73  ? 41.884 12.638 9.940   1.00 17.85 ? 109 LEU X CD2 1 
ATOM   579  N  N   . LYS A 1 74  ? 44.811 9.695  13.418  1.00 23.04 ? 110 LYS X N   1 
ATOM   580  C  CA  . LYS A 1 74  ? 45.063 8.394  13.997  1.00 24.90 ? 110 LYS X CA  1 
ATOM   581  C  C   . LYS A 1 74  ? 44.289 8.225  15.321  1.00 24.57 ? 110 LYS X C   1 
ATOM   582  O  O   . LYS A 1 74  ? 43.894 7.111  15.661  1.00 25.75 ? 110 LYS X O   1 
ATOM   583  C  CB  . LYS A 1 74  ? 46.574 8.213  14.234  1.00 25.51 ? 110 LYS X CB  1 
ATOM   584  C  CG  . LYS A 1 74  ? 47.032 6.799  14.016  1.00 27.94 ? 110 LYS X CG  1 
ATOM   585  C  CD  . LYS A 1 74  ? 48.560 6.670  14.113  1.00 30.77 ? 110 LYS X CD  1 
ATOM   586  C  CE  . LYS A 1 74  ? 48.971 5.300  14.641  1.00 33.04 ? 110 LYS X CE  1 
ATOM   587  N  NZ  . LYS A 1 74  ? 48.686 4.193  13.679  1.00 34.48 ? 110 LYS X NZ  1 
ATOM   588  N  N   . ARG A 1 75  ? 44.072 9.340  16.022  1.00 25.34 ? 111 ARG X N   1 
ATOM   589  C  CA  . ARG A 1 75  ? 43.378 9.370  17.312  1.00 26.21 ? 111 ARG X CA  1 
ATOM   590  C  C   . ARG A 1 75  ? 41.851 9.560  17.224  1.00 25.63 ? 111 ARG X C   1 
ATOM   591  O  O   . ARG A 1 75  ? 41.161 9.665  18.256  1.00 25.94 ? 111 ARG X O   1 
ATOM   592  C  CB  . ARG A 1 75  ? 43.980 10.478 18.185  1.00 27.28 ? 111 ARG X CB  1 
ATOM   593  C  CG  . ARG A 1 75  ? 45.388 10.156 18.732  1.00 31.48 ? 111 ARG X CG  1 
ATOM   594  C  CD  . ARG A 1 75  ? 46.330 11.361 18.947  1.00 36.31 ? 111 ARG X CD  1 
ATOM   595  N  NE  . ARG A 1 75  ? 45.625 12.642 19.061  1.00 39.84 ? 111 ARG X NE  1 
ATOM   596  C  CZ  . ARG A 1 75  ? 46.065 13.813 18.586  1.00 42.81 ? 111 ARG X CZ  1 
ATOM   597  N  NH1 . ARG A 1 75  ? 47.241 13.923 17.957  1.00 44.17 ? 111 ARG X NH1 1 
ATOM   598  N  NH2 . ARG A 1 75  ? 45.315 14.900 18.746  1.00 44.76 ? 111 ARG X NH2 1 
ATOM   599  N  N   . VAL A 1 76  ? 41.309 9.619  16.012  1.00 23.91 ? 112 VAL X N   1 
ATOM   600  C  CA  . VAL A 1 76  ? 39.883 9.906  15.860  1.00 23.10 ? 112 VAL X CA  1 
ATOM   601  C  C   . VAL A 1 76  ? 39.080 8.781  16.455  1.00 22.42 ? 112 VAL X C   1 
ATOM   602  O  O   . VAL A 1 76  ? 39.437 7.608  16.297  1.00 22.66 ? 112 VAL X O   1 
ATOM   603  C  CB  . VAL A 1 76  ? 39.523 10.114 14.366  1.00 22.45 ? 112 VAL X CB  1 
ATOM   604  C  CG1 . VAL A 1 76  ? 38.028 9.831  14.080  1.00 22.26 ? 112 VAL X CG1 1 
ATOM   605  C  CG2 . VAL A 1 76  ? 39.898 11.533 13.958  1.00 21.77 ? 112 VAL X CG2 1 
ATOM   606  N  N   . SER A 1 77  ? 37.970 9.141  17.116  1.00 22.30 ? 113 SER X N   1 
ATOM   607  C  CA  . SER A 1 77  ? 37.055 8.177  17.715  1.00 22.57 ? 113 SER X CA  1 
ATOM   608  C  C   . SER A 1 77  ? 35.665 8.256  17.076  1.00 20.37 ? 113 SER X C   1 
ATOM   609  O  O   . SER A 1 77  ? 34.874 9.110  17.468  1.00 20.54 ? 113 SER X O   1 
ATOM   610  C  CB  . SER A 1 77  ? 36.927 8.443  19.209  1.00 23.32 ? 113 SER X CB  1 
ATOM   611  O  OG  . SER A 1 77  ? 36.400 7.306  19.842  1.00 28.46 ? 113 SER X OG  1 
ATOM   612  N  N   . PRO A 1 78  ? 35.377 7.436  16.065  1.00 18.61 ? 114 PRO X N   1 
ATOM   613  C  CA  . PRO A 1 78  ? 34.108 7.618  15.348  1.00 17.30 ? 114 PRO X CA  1 
ATOM   614  C  C   . PRO A 1 78  ? 32.876 7.342  16.207  1.00 15.69 ? 114 PRO X C   1 
ATOM   615  O  O   . PRO A 1 78  ? 32.819 6.391  17.006  1.00 17.31 ? 114 PRO X O   1 
ATOM   616  C  CB  . PRO A 1 78  ? 34.187 6.609  14.213  1.00 17.56 ? 114 PRO X CB  1 
ATOM   617  C  CG  . PRO A 1 78  ? 35.681 6.367  14.043  1.00 18.93 ? 114 PRO X CG  1 
ATOM   618  C  CD  . PRO A 1 78  ? 36.203 6.389  15.436  1.00 19.21 ? 114 PRO X CD  1 
ATOM   619  N  N   . VAL A 1 79  ? 31.870 8.163  15.977  1.00 13.63 ? 115 VAL X N   1 
ATOM   620  C  CA  . VAL A 1 79  ? 30.640 8.134  16.756  1.00 12.62 ? 115 VAL X CA  1 
ATOM   621  C  C   . VAL A 1 79  ? 29.613 8.999  16.011  1.00 11.90 ? 115 VAL X C   1 
ATOM   622  O  O   . VAL A 1 79  ? 29.978 9.910  15.282  1.00 12.82 ? 115 VAL X O   1 
ATOM   623  C  CB  . VAL A 1 79  ? 30.936 8.657  18.191  1.00 13.76 ? 115 VAL X CB  1 
ATOM   624  C  CG1 . VAL A 1 79  ? 31.007 10.129 18.244  1.00 15.61 ? 115 VAL X CG1 1 
ATOM   625  C  CG2 . VAL A 1 79  ? 29.879 8.220  19.134  1.00 14.66 ? 115 VAL X CG2 1 
ATOM   626  N  N   . GLY A 1 80  ? 28.332 8.739  16.215  1.00 10.97 ? 116 GLY X N   1 
ATOM   627  C  CA  . GLY A 1 80  ? 27.280 9.599  15.726  1.00 10.72 ? 116 GLY X CA  1 
ATOM   628  C  C   . GLY A 1 80  ? 26.850 9.377  14.300  1.00 9.67  ? 116 GLY X C   1 
ATOM   629  O  O   . GLY A 1 80  ? 27.171 8.360  13.688  1.00 10.38 ? 116 GLY X O   1 
ATOM   630  N  N   . GLU A 1 81  ? 26.078 10.341 13.801  1.00 10.23 ? 117 GLU X N   1 
ATOM   631  C  CA  . GLU A 1 81  ? 25.380 10.233 12.532  1.00 9.48  ? 117 GLU X CA  1 
ATOM   632  C  C   . GLU A 1 81  ? 26.306 10.575 11.354  1.00 9.39  ? 117 GLU X C   1 
ATOM   633  O  O   . GLU A 1 81  ? 27.499 10.833 11.551  1.00 10.57 ? 117 GLU X O   1 
ATOM   634  C  CB  . GLU A 1 81  ? 24.090 11.063 12.575  1.00 9.88  ? 117 GLU X CB  1 
ATOM   635  C  CG  . GLU A 1 81  ? 22.995 10.332 13.371  1.00 10.47 ? 117 GLU X CG  1 
ATOM   636  C  CD  . GLU A 1 81  ? 21.716 11.116 13.618  1.00 12.06 ? 117 GLU X CD  1 
ATOM   637  O  OE1 . GLU A 1 81  ? 21.281 11.925 12.758  1.00 13.53 ? 117 GLU X OE1 1 
ATOM   638  O  OE2 . GLU A 1 81  ? 21.123 10.916 14.698  1.00 11.90 ? 117 GLU X OE2 1 
ATOM   639  N  N   . THR A 1 82  ? 25.759 10.519 10.133  1.00 9.19  ? 118 THR X N   1 
ATOM   640  C  CA  . THR A 1 82  ? 26.586 10.465 8.911   1.00 9.05  ? 118 THR X CA  1 
ATOM   641  C  C   . THR A 1 82  ? 26.208 11.588 7.920   1.00 9.46  ? 118 THR X C   1 
ATOM   642  O  O   . THR A 1 82  ? 25.536 11.362 6.924   1.00 9.43  ? 118 THR X O   1 
ATOM   643  C  CB  . THR A 1 82  ? 26.403 9.084  8.232   1.00 8.81  ? 118 THR X CB  1 
ATOM   644  O  OG1 . THR A 1 82  ? 26.695 8.032  9.179   1.00 8.24  ? 118 THR X OG1 1 
ATOM   645  C  CG2 . THR A 1 82  ? 27.365 8.892  7.074   1.00 9.14  ? 118 THR X CG2 1 
ATOM   646  N  N   . TYR A 1 83  ? 26.676 12.799 8.191   1.00 10.01 ? 119 TYR X N   1 
ATOM   647  C  CA  . TYR A 1 83  ? 26.295 13.965 7.373   1.00 10.51 ? 119 TYR X CA  1 
ATOM   648  C  C   . TYR A 1 83  ? 27.402 14.243 6.342   1.00 9.64  ? 119 TYR X C   1 
ATOM   649  O  O   . TYR A 1 83  ? 28.137 15.239 6.390   1.00 10.03 ? 119 TYR X O   1 
ATOM   650  C  CB  . TYR A 1 83  ? 26.011 15.187 8.248   1.00 10.39 ? 119 TYR X CB  1 
ATOM   651  C  CG  . TYR A 1 83  ? 24.936 14.972 9.308   1.00 10.80 ? 119 TYR X CG  1 
ATOM   652  C  CD1 . TYR A 1 83  ? 24.044 13.908 9.274   1.00 11.61 ? 119 TYR X CD1 1 
ATOM   653  C  CD2 . TYR A 1 83  ? 24.838 15.870 10.353  1.00 11.59 ? 119 TYR X CD2 1 
ATOM   654  C  CE1 . TYR A 1 83  ? 23.100 13.729 10.284  1.00 11.34 ? 119 TYR X CE1 1 
ATOM   655  C  CE2 . TYR A 1 83  ? 23.950 15.681 11.355  1.00 11.23 ? 119 TYR X CE2 1 
ATOM   656  C  CZ  . TYR A 1 83  ? 23.059 14.632 11.308  1.00 11.00 ? 119 TYR X CZ  1 
ATOM   657  O  OH  . TYR A 1 83  ? 22.199 14.465 12.360  1.00 12.66 ? 119 TYR X OH  1 
ATOM   658  N  N   . ILE A 1 84  ? 27.488 13.354 5.369   1.00 8.98  ? 120 ILE X N   1 
ATOM   659  C  CA  . ILE A 1 84  ? 28.543 13.430 4.348   1.00 9.35  ? 120 ILE X CA  1 
ATOM   660  C  C   . ILE A 1 84  ? 28.486 14.740 3.569   1.00 9.84  ? 120 ILE X C   1 
ATOM   661  O  O   . ILE A 1 84  ? 29.532 15.256 3.158   1.00 9.78  ? 120 ILE X O   1 
ATOM   662  C  CB  . ILE A 1 84  ? 28.506 12.163 3.426   1.00 9.38  ? 120 ILE X CB  1 
ATOM   663  C  CG1 . ILE A 1 84  ? 29.760 12.126 2.536   1.00 9.53  ? 120 ILE X CG1 1 
ATOM   664  C  CG2 . ILE A 1 84  ? 27.217 12.103 2.644   1.00 9.76  ? 120 ILE X CG2 1 
ATOM   665  C  CD1 . ILE A 1 84  ? 29.947 10.746 1.880   1.00 10.48 ? 120 ILE X CD1 1 
ATOM   666  N  N   . HIS A 1 85  ? 27.290 15.272 3.389   1.00 9.63  ? 121 HIS X N   1 
ATOM   667  C  CA  . HIS A 1 85  ? 27.123 16.553 2.673   1.00 10.64 ? 121 HIS X CA  1 
ATOM   668  C  C   . HIS A 1 85  ? 27.923 17.666 3.362   1.00 11.48 ? 121 HIS X C   1 
ATOM   669  O  O   . HIS A 1 85  ? 28.498 18.530 2.689   1.00 12.80 ? 121 HIS X O   1 
ATOM   670  C  CB  . HIS A 1 85  ? 25.635 16.876 2.520   1.00 10.23 ? 121 HIS X CB  1 
ATOM   671  C  CG  . HIS A 1 85  ? 24.934 17.021 3.820   1.00 12.20 ? 121 HIS X CG  1 
ATOM   672  N  ND1 . HIS A 1 85  ? 25.029 16.065 4.797   1.00 13.56 ? 121 HIS X ND1 1 
ATOM   673  C  CD2 . HIS A 1 85  ? 24.098 17.978 4.300   1.00 14.67 ? 121 HIS X CD2 1 
ATOM   674  C  CE1 . HIS A 1 85  ? 24.395 16.494 5.873   1.00 15.23 ? 121 HIS X CE1 1 
ATOM   675  N  NE2 . HIS A 1 85  ? 23.818 17.643 5.598   1.00 13.70 ? 121 HIS X NE2 1 
ATOM   676  N  N   . GLU A 1 86  ? 28.007 17.655 4.685   1.00 11.67 ? 122 GLU X N   1 
ATOM   677  C  CA  . GLU A 1 86  ? 28.812 18.660 5.400   1.00 12.42 ? 122 GLU X CA  1 
ATOM   678  C  C   . GLU A 1 86  ? 30.304 18.506 5.142   1.00 11.87 ? 122 GLU X C   1 
ATOM   679  O  O   . GLU A 1 86  ? 31.039 19.505 5.066   1.00 13.36 ? 122 GLU X O   1 
ATOM   680  C  CB  . GLU A 1 86  ? 28.514 18.616 6.895   1.00 12.68 ? 122 GLU X CB  1 
ATOM   681  C  CG  . GLU A 1 86  ? 27.069 18.931 7.213   1.00 13.94 ? 122 GLU X CG  1 
ATOM   682  C  CD  . GLU A 1 86  ? 26.787 18.989 8.697   1.00 19.44 ? 122 GLU X CD  1 
ATOM   683  O  OE1 . GLU A 1 86  ? 27.664 18.584 9.511   1.00 23.08 ? 122 GLU X OE1 1 
ATOM   684  O  OE2 . GLU A 1 86  ? 25.665 19.412 9.050   1.00 20.52 ? 122 GLU X OE2 1 
ATOM   685  N  N   . GLY A 1 87  ? 30.814 17.286 5.035   1.00 11.60 ? 123 GLY X N   1 
ATOM   686  C  CA  . GLY A 1 87  ? 32.210 17.101 4.712   1.00 12.43 ? 123 GLY X CA  1 
ATOM   687  C  C   . GLY A 1 87  ? 32.506 17.546 3.285   1.00 12.14 ? 123 GLY X C   1 
ATOM   688  O  O   . GLY A 1 87  ? 33.519 18.239 3.043   1.00 13.18 ? 123 GLY X O   1 
ATOM   689  N  N   . LEU A 1 88  ? 31.639 17.195 2.334   1.00 12.34 ? 124 LEU X N   1 
ATOM   690  C  CA  . LEU A 1 88  ? 31.822 17.615 0.936   1.00 12.94 ? 124 LEU X CA  1 
ATOM   691  C  C   . LEU A 1 88  ? 31.807 19.126 0.861   1.00 14.36 ? 124 LEU X C   1 
ATOM   692  O  O   . LEU A 1 88  ? 32.594 19.709 0.103   1.00 14.39 ? 124 LEU X O   1 
ATOM   693  C  CB  . LEU A 1 88  ? 30.745 17.029 0.021   1.00 12.66 ? 124 LEU X CB  1 
ATOM   694  C  CG  . LEU A 1 88  ? 30.845 15.502 -0.161  1.00 11.53 ? 124 LEU X CG  1 
ATOM   695  C  CD1 . LEU A 1 88  ? 29.603 14.977 -0.806  1.00 12.10 ? 124 LEU X CD1 1 
ATOM   696  C  CD2 . LEU A 1 88  ? 32.083 15.095 -0.990  1.00 12.99 ? 124 LEU X CD2 1 
ATOM   697  N  N   . LYS A 1 89  ? 30.943 19.782 1.639   1.00 15.04 ? 125 LYS X N   1 
ATOM   698  C  CA  . LYS A 1 89  ? 30.839 21.255 1.584   1.00 16.12 ? 125 LYS X CA  1 
ATOM   699  C  C   . LYS A 1 89  ? 32.137 21.904 2.061   1.00 16.27 ? 125 LYS X C   1 
ATOM   700  O  O   . LYS A 1 89  ? 32.547 22.911 1.469   1.00 16.84 ? 125 LYS X O   1 
ATOM   701  C  CB  . LYS A 1 89  ? 29.611 21.747 2.377   1.00 16.60 ? 125 LYS X CB  1 
ATOM   702  C  CG  . LYS A 1 89  ? 29.341 23.308 2.309   1.00 20.39 ? 125 LYS X CG  1 
ATOM   703  C  CD  . LYS A 1 89  ? 27.883 23.649 2.791   1.00 24.63 ? 125 LYS X CD  1 
ATOM   704  C  CE  . LYS A 1 89  ? 27.299 24.965 2.226   1.00 28.18 ? 125 LYS X CE  1 
ATOM   705  N  NZ  . LYS A 1 89  ? 25.802 25.084 2.478   1.00 30.13 ? 125 LYS X NZ  1 
ATOM   706  N  N   . LEU A 1 90  ? 32.854 21.326 3.015   1.00 15.55 ? 126 LEU X N   1 
ATOM   707  C  CA  . LEU A 1 90  ? 34.128 21.910 3.475   1.00 16.96 ? 126 LEU X CA  1 
ATOM   708  C  C   . LEU A 1 90  ? 35.210 21.748 2.415   1.00 16.86 ? 126 LEU X C   1 
ATOM   709  O  O   . LEU A 1 90  ? 36.078 22.599 2.263   1.00 17.85 ? 126 LEU X O   1 
ATOM   710  C  CB  . LEU A 1 90  ? 34.583 21.305 4.801   1.00 17.46 ? 126 LEU X CB  1 
ATOM   711  C  CG  . LEU A 1 90  ? 33.674 21.612 6.010   1.00 18.73 ? 126 LEU X CG  1 
ATOM   712  C  CD1 . LEU A 1 90  ? 34.248 20.998 7.264   1.00 18.53 ? 126 LEU X CD1 1 
ATOM   713  C  CD2 . LEU A 1 90  ? 33.463 23.131 6.168   1.00 20.43 ? 126 LEU X CD2 1 
ATOM   714  N  N   . ALA A 1 91  ? 35.174 20.664 1.644   1.00 15.39 ? 127 ALA X N   1 
ATOM   715  C  CA  . ALA A 1 91  ? 36.073 20.542 0.516   1.00 15.60 ? 127 ALA X CA  1 
ATOM   716  C  C   . ALA A 1 91  ? 35.724 21.624 -0.505  1.00 14.99 ? 127 ALA X C   1 
ATOM   717  O  O   . ALA A 1 91  ? 36.635 22.326 -1.006  1.00 15.52 ? 127 ALA X O   1 
ATOM   718  C  CB  . ALA A 1 91  ? 35.944 19.152 -0.105  1.00 13.73 ? 127 ALA X CB  1 
ATOM   719  N  N   . ASN A 1 92  ? 34.450 21.768 -0.840  1.00 15.12 ? 128 ASN X N   1 
ATOM   720  C  CA  . ASN A 1 92  ? 33.983 22.761 -1.836  1.00 16.68 ? 128 ASN X CA  1 
ATOM   721  C  C   . ASN A 1 92  ? 34.334 24.189 -1.467  1.00 18.45 ? 128 ASN X C   1 
ATOM   722  O  O   . ASN A 1 92  ? 34.682 24.959 -2.348  1.00 19.75 ? 128 ASN X O   1 
ATOM   723  C  CB  . ASN A 1 92  ? 32.504 22.627 -2.151  1.00 15.97 ? 128 ASN X CB  1 
ATOM   724  C  CG  . ASN A 1 92  ? 32.185 21.308 -2.859  1.00 16.07 ? 128 ASN X CG  1 
ATOM   725  O  OD1 . ASN A 1 92  ? 33.099 20.708 -3.443  1.00 14.73 ? 128 ASN X OD1 1 
ATOM   726  N  ND2 . ASN A 1 92  ? 30.926 20.873 -2.817  1.00 16.50 ? 128 ASN X ND2 1 
ATOM   727  N  N   . GLU A 1 93  ? 34.277 24.511 -0.188  1.00 19.21 ? 129 GLU X N   1 
ATOM   728  C  CA  . GLU A 1 93  ? 34.624 25.858 0.274   1.00 20.29 ? 129 GLU X CA  1 
ATOM   729  C  C   . GLU A 1 93  ? 36.109 26.142 0.061   1.00 20.66 ? 129 GLU X C   1 
ATOM   730  O  O   . GLU A 1 93  ? 36.471 27.266 -0.403  1.00 21.25 ? 129 GLU X O   1 
ATOM   731  C  CB  . GLU A 1 93  ? 34.179 26.042 1.727   1.00 20.83 ? 129 GLU X CB  1 
ATOM   732  C  CG  . GLU A 1 93  ? 32.664 26.151 1.851   1.00 22.58 ? 129 GLU X CG  1 
ATOM   733  C  CD  . GLU A 1 93  ? 32.141 26.211 3.296   1.00 25.79 ? 129 GLU X CD  1 
ATOM   734  O  OE1 . GLU A 1 93  ? 32.928 26.077 4.265   1.00 29.54 ? 129 GLU X OE1 1 
ATOM   735  O  OE2 . GLU A 1 93  ? 30.914 26.388 3.446   1.00 28.49 ? 129 GLU X OE2 1 
ATOM   736  N  N   . GLN A 1 94  ? 36.975 25.179 0.353   1.00 21.02 ? 130 GLN X N   1 
ATOM   737  C  CA  . GLN A 1 94  ? 38.420 25.330 0.123   1.00 21.52 ? 130 GLN X CA  1 
ATOM   738  C  C   . GLN A 1 94  ? 38.767 25.404 -1.369  1.00 22.43 ? 130 GLN X C   1 
ATOM   739  O  O   . GLN A 1 94  ? 39.661 26.156 -1.766  1.00 22.69 ? 130 GLN X O   1 
ATOM   740  C  CB  . GLN A 1 94  ? 39.238 24.219 0.773   1.00 20.95 ? 130 GLN X CB  1 
ATOM   741  C  CG  . GLN A 1 94  ? 39.116 24.139 2.271   1.00 21.30 ? 130 GLN X CG  1 
ATOM   742  C  CD  . GLN A 1 94  ? 40.005 23.075 2.877   1.00 21.57 ? 130 GLN X CD  1 
ATOM   743  O  OE1 . GLN A 1 94  ? 41.202 23.287 3.139   1.00 21.03 ? 130 GLN X OE1 1 
ATOM   744  N  NE2 . GLN A 1 94  ? 39.426 21.897 3.098   1.00 20.02 ? 130 GLN X NE2 1 
ATOM   745  N  N   . ILE A 1 95  ? 38.055 24.637 -2.196  1.00 22.33 ? 131 ILE X N   1 
ATOM   746  C  CA  . ILE A 1 95  ? 38.285 24.629 -3.637  1.00 22.86 ? 131 ILE X CA  1 
ATOM   747  C  C   . ILE A 1 95  ? 37.900 25.997 -4.218  1.00 25.25 ? 131 ILE X C   1 
ATOM   748  O  O   . ILE A 1 95  ? 38.662 26.559 -5.004  1.00 25.01 ? 131 ILE X O   1 
ATOM   749  C  CB  . ILE A 1 95  ? 37.488 23.468 -4.321  1.00 21.51 ? 131 ILE X CB  1 
ATOM   750  C  CG1 . ILE A 1 95  ? 38.119 22.125 -3.924  1.00 19.76 ? 131 ILE X CG1 1 
ATOM   751  C  CG2 . ILE A 1 95  ? 37.433 23.648 -5.855  1.00 21.96 ? 131 ILE X CG2 1 
ATOM   752  C  CD1 . ILE A 1 95  ? 37.194 20.932 -4.131  1.00 18.55 ? 131 ILE X CD1 1 
ATOM   753  N  N   . GLN A 1 96  ? 36.735 26.512 -3.827  1.00 27.95 ? 132 GLN X N   1 
ATOM   754  C  CA  . GLN A 1 96  ? 36.261 27.836 -4.241  1.00 30.91 ? 132 GLN X CA  1 
ATOM   755  C  C   . GLN A 1 96  ? 37.278 28.921 -3.860  1.00 32.57 ? 132 GLN X C   1 
ATOM   756  O  O   . GLN A 1 96  ? 37.516 29.828 -4.654  1.00 33.32 ? 132 GLN X O   1 
ATOM   757  C  CB  . GLN A 1 96  ? 34.884 28.154 -3.630  1.00 31.73 ? 132 GLN X CB  1 
ATOM   758  C  CG  . GLN A 1 96  ? 33.995 29.102 -4.456  1.00 34.65 ? 132 GLN X CG  1 
ATOM   759  C  CD  . GLN A 1 96  ? 32.530 29.089 -4.005  1.00 38.06 ? 132 GLN X CD  1 
ATOM   760  O  OE1 . GLN A 1 96  ? 32.125 29.891 -3.159  1.00 39.87 ? 132 GLN X OE1 1 
ATOM   761  N  NE2 . GLN A 1 96  ? 31.740 28.180 -4.569  1.00 40.56 ? 132 GLN X NE2 1 
ATOM   762  N  N   . LYS A 1 97  ? 37.898 28.801 -2.683  1.00 34.24 ? 133 LYS X N   1 
ATOM   763  C  CA  . LYS A 1 97  ? 38.844 29.807 -2.159  1.00 35.87 ? 133 LYS X CA  1 
ATOM   764  C  C   . LYS A 1 97  ? 40.213 29.693 -2.843  1.00 36.42 ? 133 LYS X C   1 
ATOM   765  O  O   . LYS A 1 97  ? 41.003 30.650 -2.866  1.00 36.90 ? 133 LYS X O   1 
ATOM   766  C  CB  . LYS A 1 97  ? 38.996 29.632 -0.638  1.00 36.43 ? 133 LYS X CB  1 
ATOM   767  C  CG  . LYS A 1 97  ? 40.080 30.479 0.050   1.00 38.33 ? 133 LYS X CG  1 
ATOM   768  C  CD  . LYS A 1 97  ? 40.153 30.172 1.547   1.00 40.48 ? 133 LYS X CD  1 
ATOM   769  C  CE  . LYS A 1 97  ? 41.442 30.695 2.187   1.00 41.61 ? 133 LYS X CE  1 
ATOM   770  N  NZ  . LYS A 1 97  ? 41.158 31.506 3.415   1.00 42.10 ? 133 LYS X NZ  1 
ATOM   771  N  N   . ALA A 1 98  ? 40.499 28.520 -3.395  1.00 36.78 ? 134 ALA X N   1 
ATOM   772  C  CA  . ALA A 1 98  ? 41.771 28.268 -4.054  1.00 37.20 ? 134 ALA X CA  1 
ATOM   773  C  C   . ALA A 1 98  ? 41.745 28.683 -5.522  1.00 37.44 ? 134 ALA X C   1 
ATOM   774  O  O   . ALA A 1 98  ? 42.801 28.718 -6.152  1.00 37.74 ? 134 ALA X O   1 
ATOM   775  C  CB  . ALA A 1 98  ? 42.145 26.810 -3.927  1.00 37.36 ? 134 ALA X CB  1 
ATOM   776  N  N   . GLY A 1 99  ? 40.560 28.994 -6.054  1.00 37.68 ? 135 GLY X N   1 
ATOM   777  C  CA  . GLY A 1 99  ? 40.389 29.367 -7.452  1.00 38.40 ? 135 GLY X CA  1 
ATOM   778  C  C   . GLY A 1 99  ? 39.168 28.822 -8.197  1.00 38.94 ? 135 GLY X C   1 
ATOM   779  O  O   . GLY A 1 99  ? 38.918 29.230 -9.328  1.00 39.13 ? 135 GLY X O   1 
ATOM   780  N  N   . GLY A 1 100 ? 38.416 27.897 -7.587  1.00 39.46 ? 136 GLY X N   1 
ATOM   781  C  CA  . GLY A 1 100 ? 37.258 27.287 -8.219  1.00 39.68 ? 136 GLY X CA  1 
ATOM   782  C  C   . GLY A 1 100 ? 37.639 26.458 -9.436  1.00 39.96 ? 136 GLY X C   1 
ATOM   783  O  O   . GLY A 1 100 ? 38.420 25.515 -9.332  1.00 40.01 ? 136 GLY X O   1 
ATOM   784  N  N   . LEU A 1 101 ? 37.116 26.840 -10.599 1.00 40.23 ? 137 LEU X N   1 
ATOM   785  C  CA  . LEU A 1 101 ? 37.413 26.144 -11.859 1.00 40.20 ? 137 LEU X CA  1 
ATOM   786  C  C   . LEU A 1 101 ? 38.881 26.285 -12.330 1.00 39.85 ? 137 LEU X C   1 
ATOM   787  O  O   . LEU A 1 101 ? 39.304 25.559 -13.235 1.00 39.92 ? 137 LEU X O   1 
ATOM   788  C  CB  . LEU A 1 101 ? 36.455 26.607 -12.967 1.00 40.35 ? 137 LEU X CB  1 
ATOM   789  C  CG  . LEU A 1 101 ? 35.081 25.922 -12.994 1.00 40.58 ? 137 LEU X CG  1 
ATOM   790  C  CD1 . LEU A 1 101 ? 34.047 26.786 -13.741 1.00 41.01 ? 137 LEU X CD1 1 
ATOM   791  C  CD2 . LEU A 1 101 ? 35.193 24.530 -13.616 1.00 40.31 ? 137 LEU X CD2 1 
ATOM   792  N  N   . LYS A 1 102 ? 39.642 27.207 -11.727 1.00 39.17 ? 138 LYS X N   1 
ATOM   793  C  CA  . LYS A 1 102 ? 41.057 27.414 -12.070 1.00 38.38 ? 138 LYS X CA  1 
ATOM   794  C  C   . LYS A 1 102 ? 41.986 26.422 -11.387 1.00 37.02 ? 138 LYS X C   1 
ATOM   795  O  O   . LYS A 1 102 ? 43.180 26.404 -11.674 1.00 37.06 ? 138 LYS X O   1 
ATOM   796  C  CB  . LYS A 1 102 ? 41.529 28.829 -11.685 1.00 38.74 ? 138 LYS X CB  1 
ATOM   797  C  CG  . LYS A 1 102 ? 40.652 29.967 -12.199 1.00 39.91 ? 138 LYS X CG  1 
ATOM   798  C  CD  . LYS A 1 102 ? 40.477 29.920 -13.723 1.00 41.23 ? 138 LYS X CD  1 
ATOM   799  C  CE  . LYS A 1 102 ? 40.423 31.332 -14.348 1.00 41.69 ? 138 LYS X CE  1 
ATOM   800  N  NZ  . LYS A 1 102 ? 39.035 31.824 -14.532 1.00 42.62 ? 138 LYS X NZ  1 
ATOM   801  N  N   . THR A 1 103 ? 41.447 25.628 -10.460 1.00 35.28 ? 139 THR X N   1 
ATOM   802  C  CA  . THR A 1 103 ? 42.249 24.692 -9.668  1.00 33.26 ? 139 THR X CA  1 
ATOM   803  C  C   . THR A 1 103 ? 42.302 23.309 -10.316 1.00 30.95 ? 139 THR X C   1 
ATOM   804  O  O   . THR A 1 103 ? 41.511 23.010 -11.207 1.00 31.49 ? 139 THR X O   1 
ATOM   805  C  CB  . THR A 1 103 ? 41.627 24.497 -8.267  1.00 33.55 ? 139 THR X CB  1 
ATOM   806  O  OG1 . THR A 1 103 ? 40.356 23.859 -8.408  1.00 33.92 ? 139 THR X OG1 1 
ATOM   807  C  CG2 . THR A 1 103 ? 41.325 25.845 -7.569  1.00 34.06 ? 139 THR X CG2 1 
ATOM   808  N  N   . SER A 1 104 ? 43.212 22.477 -9.831  1.00 28.27 ? 140 SER X N   1 
ATOM   809  C  CA  . SER A 1 104 ? 43.187 21.028 -10.123 1.00 26.32 ? 140 SER X CA  1 
ATOM   810  C  C   . SER A 1 104 ? 42.849 20.064 -8.935  1.00 23.56 ? 140 SER X C   1 
ATOM   811  O  O   . SER A 1 104 ? 43.735 19.435 -8.320  1.00 24.38 ? 140 SER X O   1 
ATOM   812  C  CB  . SER A 1 104 ? 44.512 20.634 -10.682 1.00 26.30 ? 140 SER X CB  1 
ATOM   813  O  OG  . SER A 1 104 ? 44.460 19.271 -11.028 1.00 28.00 ? 140 SER X OG  1 
ATOM   814  N  N   . SER A 1 105 ? 41.560 19.846 -8.726  1.00 19.60 ? 141 SER X N   1 
ATOM   815  C  CA  . SER A 1 105 ? 41.067 19.403 -7.416  1.00 16.61 ? 141 SER X CA  1 
ATOM   816  C  C   . SER A 1 105 ? 40.415 18.021 -7.497  1.00 14.60 ? 141 SER X C   1 
ATOM   817  O  O   . SER A 1 105 ? 39.660 17.738 -8.418  1.00 14.35 ? 141 SER X O   1 
ATOM   818  C  CB  . SER A 1 105 ? 40.053 20.413 -6.917  1.00 17.27 ? 141 SER X CB  1 
ATOM   819  O  OG  . SER A 1 105 ? 40.733 21.648 -6.607  1.00 18.89 ? 141 SER X OG  1 
ATOM   820  N  N   . ILE A 1 106 ? 40.775 17.208 -6.529  1.00 13.35 ? 142 ILE X N   1 
ATOM   821  C  CA  . ILE A 1 106 ? 40.309 15.822 -6.390  1.00 13.05 ? 142 ILE X CA  1 
ATOM   822  C  C   . ILE A 1 106 ? 39.749 15.654 -4.996  1.00 12.60 ? 142 ILE X C   1 
ATOM   823  O  O   . ILE A 1 106 ? 40.393 16.048 -4.021  1.00 13.33 ? 142 ILE X O   1 
ATOM   824  C  CB  . ILE A 1 106 ? 41.430 14.840 -6.656  1.00 13.68 ? 142 ILE X CB  1 
ATOM   825  C  CG1 . ILE A 1 106 ? 41.793 14.942 -8.148  1.00 17.05 ? 142 ILE X CG1 1 
ATOM   826  C  CG2 . ILE A 1 106 ? 41.052 13.382 -6.262  1.00 15.99 ? 142 ILE X CG2 1 
ATOM   827  C  CD1 . ILE A 1 106 ? 42.836 13.987 -8.604  1.00 18.28 ? 142 ILE X CD1 1 
ATOM   828  N  N   . ILE A 1 107 ? 38.523 15.118 -4.902  1.00 11.46 ? 143 ILE X N   1 
ATOM   829  C  CA  . ILE A 1 107 ? 37.941 14.749 -3.613  1.00 11.05 ? 143 ILE X CA  1 
ATOM   830  C  C   . ILE A 1 107 ? 37.895 13.225 -3.522  1.00 9.71  ? 143 ILE X C   1 
ATOM   831  O  O   . ILE A 1 107 ? 37.419 12.578 -4.452  1.00 11.10 ? 143 ILE X O   1 
ATOM   832  C  CB  . ILE A 1 107 ? 36.528 15.343 -3.478  1.00 11.88 ? 143 ILE X CB  1 
ATOM   833  C  CG1 . ILE A 1 107 ? 36.568 16.891 -3.413  1.00 14.05 ? 143 ILE X CG1 1 
ATOM   834  C  CG2 . ILE A 1 107 ? 35.817 14.741 -2.252  1.00 13.12 ? 143 ILE X CG2 1 
ATOM   835  C  CD1 . ILE A 1 107 ? 35.219 17.564 -3.616  1.00 15.76 ? 143 ILE X CD1 1 
ATOM   836  N  N   . ILE A 1 108 ? 38.346 12.669 -2.414  1.00 9.69  ? 144 ILE X N   1 
ATOM   837  C  CA  . ILE A 1 108 ? 38.264 11.239 -2.148  1.00 9.98  ? 144 ILE X CA  1 
ATOM   838  C  C   . ILE A 1 108 ? 37.467 11.052 -0.859  1.00 10.09 ? 144 ILE X C   1 
ATOM   839  O  O   . ILE A 1 108 ? 37.910 11.442 0.227   1.00 11.04 ? 144 ILE X O   1 
ATOM   840  C  CB  . ILE A 1 108 ? 39.652 10.578 -2.023  1.00 10.86 ? 144 ILE X CB  1 
ATOM   841  C  CG1 . ILE A 1 108 ? 40.518 10.922 -3.241  1.00 12.51 ? 144 ILE X CG1 1 
ATOM   842  C  CG2 . ILE A 1 108 ? 39.513 9.087  -1.837  1.00 12.29 ? 144 ILE X CG2 1 
ATOM   843  C  CD1 . ILE A 1 108 ? 41.982 10.505 -3.085  1.00 13.55 ? 144 ILE X CD1 1 
ATOM   844  N  N   . ALA A 1 109 ? 36.262 10.515 -1.005  1.00 9.91  ? 145 ALA X N   1 
ATOM   845  C  CA  . ALA A 1 109 ? 35.369 10.260 0.134   1.00 9.90  ? 145 ALA X CA  1 
ATOM   846  C  C   . ALA A 1 109 ? 35.513 8.827  0.611   1.00 9.29  ? 145 ALA X C   1 
ATOM   847  O  O   . ALA A 1 109 ? 35.389 7.906  -0.166  1.00 10.26 ? 145 ALA X O   1 
ATOM   848  C  CB  . ALA A 1 109 ? 33.947 10.574 -0.215  1.00 10.84 ? 145 ALA X CB  1 
ATOM   849  N  N   . LEU A 1 110 ? 35.862 8.653  1.879   1.00 9.40  ? 146 LEU X N   1 
ATOM   850  C  CA  . LEU A 1 110 ? 35.998 7.322  2.480   1.00 10.27 ? 146 LEU X CA  1 
ATOM   851  C  C   . LEU A 1 110 ? 34.781 7.116  3.364   1.00 9.82  ? 146 LEU X C   1 
ATOM   852  O  O   . LEU A 1 110 ? 34.603 7.828  4.331   1.00 11.01 ? 146 LEU X O   1 
ATOM   853  C  CB  . LEU A 1 110 ? 37.251 7.185  3.363   1.00 11.67 ? 146 LEU X CB  1 
ATOM   854  C  CG  . LEU A 1 110 ? 38.632 6.877  2.751   1.00 14.68 ? 146 LEU X CG  1 
ATOM   855  C  CD1 . LEU A 1 110 ? 38.777 5.427  2.414   1.00 17.64 ? 146 LEU X CD1 1 
ATOM   856  C  CD2 . LEU A 1 110 ? 38.924 7.781  1.631   1.00 15.14 ? 146 LEU X CD2 1 
ATOM   857  N  N   . THR A 1 111 ? 33.939 6.147  3.034   1.00 9.21  ? 147 THR X N   1 
ATOM   858  C  CA  . THR A 1 111 ? 32.648 6.008  3.707   1.00 8.83  ? 147 THR X CA  1 
ATOM   859  C  C   . THR A 1 111 ? 32.037 4.653  3.418   1.00 9.47  ? 147 THR X C   1 
ATOM   860  O  O   . THR A 1 111 ? 32.415 4.004  2.454   1.00 10.28 ? 147 THR X O   1 
ATOM   861  C  CB  . THR A 1 111 ? 31.687 7.180  3.259   1.00 9.15  ? 147 THR X CB  1 
ATOM   862  O  OG1 . THR A 1 111 ? 30.417 7.079  3.915   1.00 8.93  ? 147 THR X OG1 1 
ATOM   863  C  CG2 . THR A 1 111 ? 31.447 7.194  1.762   1.00 9.19  ? 147 THR X CG2 1 
ATOM   864  N  N   . ASP A 1 112 ? 31.088 4.233  4.252   1.00 9.46  ? 148 ASP X N   1 
ATOM   865  C  CA  . ASP A 1 112 ? 30.226 3.104  3.876   1.00 9.78  ? 148 ASP X CA  1 
ATOM   866  C  C   . ASP A 1 112 ? 29.030 3.480  3.013   1.00 9.48  ? 148 ASP X C   1 
ATOM   867  O  O   . ASP A 1 112 ? 28.310 2.618  2.526   1.00 9.75  ? 148 ASP X O   1 
ATOM   868  C  CB  . ASP A 1 112 ? 29.765 2.301  5.084   1.00 10.10 ? 148 ASP X CB  1 
ATOM   869  C  CG  . ASP A 1 112 ? 29.000 3.117  6.091   1.00 11.24 ? 148 ASP X CG  1 
ATOM   870  O  OD1 . ASP A 1 112 ? 28.438 4.167  5.710   1.00 11.13 ? 148 ASP X OD1 1 
ATOM   871  O  OD2 . ASP A 1 112 ? 28.945 2.744  7.293   1.00 11.74 ? 148 ASP X OD2 1 
ATOM   872  N  N   . GLY A 1 113 ? 28.843 4.771  2.785   1.00 9.14  ? 149 GLY X N   1 
ATOM   873  C  CA  . GLY A 1 113 ? 27.716 5.227  2.007   1.00 8.50  ? 149 GLY X CA  1 
ATOM   874  C  C   . GLY A 1 113 ? 26.328 4.927  2.577   1.00 9.14  ? 149 GLY X C   1 
ATOM   875  O  O   . GLY A 1 113 ? 25.341 4.975  1.833   1.00 10.09 ? 149 GLY X O   1 
ATOM   876  N  N   . LYS A 1 114 ? 26.272 4.636  3.870   1.00 9.33  ? 150 LYS X N   1 
ATOM   877  C  CA  . LYS A 1 114 ? 25.026 4.277  4.528   1.00 9.38  ? 150 LYS X CA  1 
ATOM   878  C  C   . LYS A 1 114 ? 24.380 5.553  5.062   1.00 8.99  ? 150 LYS X C   1 
ATOM   879  O  O   . LYS A 1 114 ? 24.676 5.988  6.172   1.00 10.39 ? 150 LYS X O   1 
ATOM   880  C  CB  . LYS A 1 114 ? 25.271 3.256  5.645   1.00 10.48 ? 150 LYS X CB  1 
ATOM   881  C  CG  . LYS A 1 114 ? 25.697 1.866  5.136   1.00 14.14 ? 150 LYS X CG  1 
ATOM   882  C  CD  . LYS A 1 114 ? 25.932 0.946  6.293   1.00 18.99 ? 150 LYS X CD  1 
ATOM   883  C  CE  . LYS A 1 114 ? 26.509 -0.402 5.894   1.00 22.21 ? 150 LYS X CE  1 
ATOM   884  N  NZ  . LYS A 1 114 ? 27.023 -1.111 7.119   1.00 26.38 ? 150 LYS X NZ  1 
ATOM   885  N  N   . LEU A 1 115 ? 23.528 6.148  4.249   1.00 9.07  ? 151 LEU X N   1 
ATOM   886  C  CA  . LEU A 1 115 ? 22.949 7.453  4.519   1.00 9.82  ? 151 LEU X CA  1 
ATOM   887  C  C   . LEU A 1 115 ? 21.464 7.320  4.897   1.00 11.28 ? 151 LEU X C   1 
ATOM   888  O  O   . LEU A 1 115 ? 20.780 6.332  4.516   1.00 12.89 ? 151 LEU X O   1 
ATOM   889  C  CB  . LEU A 1 115 ? 23.092 8.359  3.292   1.00 10.04 ? 151 LEU X CB  1 
ATOM   890  C  CG  . LEU A 1 115 ? 24.500 8.443  2.710   1.00 9.57  ? 151 LEU X CG  1 
ATOM   891  C  CD1 . LEU A 1 115 ? 24.511 9.352  1.526   1.00 10.01 ? 151 LEU X CD1 1 
ATOM   892  C  CD2 . LEU A 1 115 ? 25.551 8.878  3.754   1.00 9.53  ? 151 LEU X CD2 1 
ATOM   893  N  N   . ASP A 1 116 ? 21.023 8.294  5.681   1.00 11.32 ? 152 ASP X N   1 
ATOM   894  C  CA  . ASP A 1 116 ? 19.713 8.308  6.328   1.00 13.28 ? 152 ASP X CA  1 
ATOM   895  C  C   . ASP A 1 116 ? 18.887 9.504  5.896   1.00 13.53 ? 152 ASP X C   1 
ATOM   896  O  O   . ASP A 1 116 ? 19.395 10.603 5.657   1.00 12.16 ? 152 ASP X O   1 
ATOM   897  C  CB  . ASP A 1 116 ? 19.933 8.423  7.837   1.00 14.41 ? 152 ASP X CB  1 
ATOM   898  C  CG  . ASP A 1 116 ? 18.664 8.480  8.622   1.00 18.90 ? 152 ASP X CG  1 
ATOM   899  O  OD1 . ASP A 1 116 ? 17.902 7.506  8.521   1.00 22.45 ? 152 ASP X OD1 1 
ATOM   900  O  OD2 . ASP A 1 116 ? 18.393 9.442  9.399   1.00 22.16 ? 152 ASP X OD2 1 
ATOM   901  N  N   . GLY A 1 117 ? 17.580 9.298  5.849   1.00 14.56 ? 153 GLY X N   1 
ATOM   902  C  CA  . GLY A 1 117 ? 16.655 10.389 5.622   1.00 14.96 ? 153 GLY X CA  1 
ATOM   903  C  C   . GLY A 1 117 ? 16.947 11.190 4.367   1.00 14.45 ? 153 GLY X C   1 
ATOM   904  O  O   . GLY A 1 117 ? 16.997 10.648 3.279   1.00 15.67 ? 153 GLY X O   1 
ATOM   905  N  N   . LEU A 1 118 ? 17.129 12.490 4.537   1.00 14.74 ? 154 LEU X N   1 
ATOM   906  C  CA  . LEU A 1 118 ? 17.327 13.411 3.428   1.00 14.69 ? 154 LEU X CA  1 
ATOM   907  C  C   . LEU A 1 118 ? 18.783 13.557 3.067   1.00 12.96 ? 154 LEU X C   1 
ATOM   908  O  O   . LEU A 1 118 ? 19.096 14.290 2.126   1.00 13.22 ? 154 LEU X O   1 
ATOM   909  C  CB  . LEU A 1 118 ? 16.781 14.799 3.768   1.00 16.00 ? 154 LEU X CB  1 
ATOM   910  C  CG  . LEU A 1 118 ? 15.299 14.817 4.099   1.00 19.88 ? 154 LEU X CG  1 
ATOM   911  C  CD1 . LEU A 1 118 ? 14.932 16.232 4.520   1.00 21.80 ? 154 LEU X CD1 1 
ATOM   912  C  CD2 . LEU A 1 118 ? 14.502 14.350 2.912   1.00 21.46 ? 154 LEU X CD2 1 
ATOM   913  N  N   . VAL A 1 119 ? 19.684 12.909 3.804   1.00 12.15 ? 155 VAL X N   1 
ATOM   914  C  CA  . VAL A 1 119 ? 21.122 13.035 3.515   1.00 10.75 ? 155 VAL X CA  1 
ATOM   915  C  C   . VAL A 1 119 ? 21.498 12.640 2.081   1.00 10.64 ? 155 VAL X C   1 
ATOM   916  O  O   . VAL A 1 119 ? 22.311 13.319 1.495   1.00 11.00 ? 155 VAL X O   1 
ATOM   917  C  CB  . VAL A 1 119 ? 22.006 12.342 4.580   1.00 10.32 ? 155 VAL X CB  1 
ATOM   918  C  CG1 . VAL A 1 119 ? 23.504 12.446 4.248   1.00 9.58  ? 155 VAL X CG1 1 
ATOM   919  C  CG2 . VAL A 1 119 ? 21.755 12.959 5.946   1.00 10.23 ? 155 VAL X CG2 1 
ATOM   920  N  N   . PRO A 1 120 ? 20.950 11.577 1.497   1.00 10.68 ? 156 PRO X N   1 
ATOM   921  C  CA  . PRO A 1 120 ? 21.254 11.323 0.086   1.00 11.87 ? 156 PRO X CA  1 
ATOM   922  C  C   . PRO A 1 120 ? 20.976 12.534 -0.799  1.00 12.12 ? 156 PRO X C   1 
ATOM   923  O  O   . PRO A 1 120 ? 21.787 12.849 -1.660  1.00 12.98 ? 156 PRO X O   1 
ATOM   924  C  CB  . PRO A 1 120 ? 20.385 10.133 -0.243  1.00 11.74 ? 156 PRO X CB  1 
ATOM   925  C  CG  . PRO A 1 120 ? 20.261 9.423  1.078   1.00 12.39 ? 156 PRO X CG  1 
ATOM   926  C  CD  . PRO A 1 120 ? 20.101 10.523 2.076   1.00 12.07 ? 156 PRO X CD  1 
ATOM   927  N  N   . SER A 1 121 ? 19.853 13.210 -0.590  1.00 13.12 ? 157 SER X N   1 
ATOM   928  C  CA  . SER A 1 121 ? 19.525 14.433 -1.348  1.00 14.95 ? 157 SER X CA  1 
ATOM   929  C  C   . SER A 1 121 ? 20.586 15.492 -1.180  1.00 13.54 ? 157 SER X C   1 
ATOM   930  O  O   . SER A 1 121 ? 21.052 16.100 -2.149  1.00 14.45 ? 157 SER X O   1 
ATOM   931  C  CB  . SER A 1 121 ? 18.148 14.968 -0.909  1.00 16.77 ? 157 SER X CB  1 
ATOM   932  O  OG  . SER A 1 121 ? 17.902 16.271 -1.346  1.00 24.02 ? 157 SER X OG  1 
ATOM   933  N  N   . TYR A 1 122 ? 20.997 15.731 0.047   1.00 12.60 ? 158 TYR X N   1 
ATOM   934  C  CA  . TYR A 1 122 ? 22.001 16.742 0.302   1.00 12.02 ? 158 TYR X CA  1 
ATOM   935  C  C   . TYR A 1 122 ? 23.351 16.367 -0.289  1.00 11.86 ? 158 TYR X C   1 
ATOM   936  O  O   . TYR A 1 122 ? 24.076 17.239 -0.803  1.00 12.97 ? 158 TYR X O   1 
ATOM   937  C  CB  . TYR A 1 122 ? 22.206 16.986 1.791   1.00 12.33 ? 158 TYR X CB  1 
ATOM   938  C  CG  . TYR A 1 122 ? 20.996 17.277 2.648   1.00 13.09 ? 158 TYR X CG  1 
ATOM   939  C  CD1 . TYR A 1 122 ? 19.901 18.003 2.170   1.00 13.22 ? 158 TYR X CD1 1 
ATOM   940  C  CD2 . TYR A 1 122 ? 20.991 16.866 3.976   1.00 12.82 ? 158 TYR X CD2 1 
ATOM   941  C  CE1 . TYR A 1 122 ? 18.825 18.285 3.016   1.00 15.27 ? 158 TYR X CE1 1 
ATOM   942  C  CE2 . TYR A 1 122 ? 19.918 17.136 4.829   1.00 15.90 ? 158 TYR X CE2 1 
ATOM   943  C  CZ  . TYR A 1 122 ? 18.851 17.854 4.348   1.00 15.23 ? 158 TYR X CZ  1 
ATOM   944  O  OH  . TYR A 1 122 ? 17.793 18.101 5.223   1.00 18.22 ? 158 TYR X OH  1 
ATOM   945  N  N   . ALA A 1 123 ? 23.700 15.088 -0.170  1.00 11.62 ? 159 ALA X N   1 
ATOM   946  C  CA  . ALA A 1 123 ? 25.030 14.620 -0.589  1.00 10.81 ? 159 ALA X CA  1 
ATOM   947  C  C   . ALA A 1 123 ? 25.203 14.701 -2.098  1.00 10.69 ? 159 ALA X C   1 
ATOM   948  O  O   . ALA A 1 123 ? 26.228 15.145 -2.592  1.00 11.32 ? 159 ALA X O   1 
ATOM   949  C  CB  . ALA A 1 123 ? 25.251 13.166 -0.092  1.00 10.78 ? 159 ALA X CB  1 
ATOM   950  N  N   . GLU A 1 124 ? 24.162 14.304 -2.808  1.00 11.22 ? 160 GLU X N   1 
ATOM   951  C  CA  . GLU A 1 124 ? 24.144 14.307 -4.263  1.00 10.94 ? 160 GLU X CA  1 
ATOM   952  C  C   . GLU A 1 124 ? 24.166 15.740 -4.768  1.00 12.19 ? 160 GLU X C   1 
ATOM   953  O  O   . GLU A 1 124 ? 24.897 16.051 -5.711  1.00 13.62 ? 160 GLU X O   1 
ATOM   954  C  CB  . GLU A 1 124 ? 22.951 13.498 -4.783  1.00 11.87 ? 160 GLU X CB  1 
ATOM   955  C  CG  . GLU A 1 124 ? 23.193 12.008 -4.590  1.00 11.15 ? 160 GLU X CG  1 
ATOM   956  C  CD  . GLU A 1 124 ? 21.990 11.124 -4.836  1.00 13.74 ? 160 GLU X CD  1 
ATOM   957  O  OE1 . GLU A 1 124 ? 21.053 11.539 -5.568  1.00 14.01 ? 160 GLU X OE1 1 
ATOM   958  O  OE2 . GLU A 1 124 ? 21.995 9.988  -4.311  1.00 13.45 ? 160 GLU X OE2 1 
ATOM   959  N  N   . LYS A 1 125 ? 23.424 16.641 -4.115  1.00 13.48 ? 161 LYS X N   1 
ATOM   960  C  CA  . LYS A 1 125 ? 23.467 18.031 -4.522  1.00 15.12 ? 161 LYS X CA  1 
ATOM   961  C  C   . LYS A 1 125 ? 24.873 18.596 -4.312  1.00 13.75 ? 161 LYS X C   1 
ATOM   962  O  O   . LYS A 1 125 ? 25.376 19.348 -5.154  1.00 14.38 ? 161 LYS X O   1 
ATOM   963  C  CB  . LYS A 1 125 ? 22.432 18.845 -3.738  1.00 16.65 ? 161 LYS X CB  1 
ATOM   964  C  CG  . LYS A 1 125 ? 22.311 20.303 -4.180  1.00 21.23 ? 161 LYS X CG  1 
ATOM   965  C  CD  . LYS A 1 125 ? 21.197 21.071 -3.473  1.00 25.98 ? 161 LYS X CD  1 
ATOM   966  C  CE  . LYS A 1 125 ? 21.329 22.585 -3.728  1.00 28.87 ? 161 LYS X CE  1 
ATOM   967  N  NZ  . LYS A 1 125 ? 22.336 23.225 -2.834  1.00 30.79 ? 161 LYS X NZ  1 
ATOM   968  N  N   . GLU A 1 126 ? 25.526 18.279 -3.195  1.00 12.71 ? 162 GLU X N   1 
ATOM   969  C  CA  . GLU A 1 126 ? 26.823 18.865 -2.877  1.00 13.62 ? 162 GLU X CA  1 
ATOM   970  C  C   . GLU A 1 126 ? 27.917 18.316 -3.780  1.00 12.79 ? 162 GLU X C   1 
ATOM   971  O  O   . GLU A 1 126 ? 28.837 19.061 -4.171  1.00 13.51 ? 162 GLU X O   1 
ATOM   972  C  CB  . GLU A 1 126 ? 27.164 18.686 -1.390  1.00 13.82 ? 162 GLU X CB  1 
ATOM   973  C  CG  . GLU A 1 126 ? 28.242 19.603 -0.871  1.00 16.28 ? 162 GLU X CG  1 
ATOM   974  C  CD  . GLU A 1 126 ? 27.840 21.067 -0.927  1.00 18.53 ? 162 GLU X CD  1 
ATOM   975  O  OE1 . GLU A 1 126 ? 26.702 21.400 -0.543  1.00 20.44 ? 162 GLU X OE1 1 
ATOM   976  O  OE2 . GLU A 1 126 ? 28.681 21.884 -1.361  1.00 19.21 ? 162 GLU X OE2 1 
ATOM   977  N  N   . ALA A 1 127 ? 27.817 17.029 -4.145  1.00 11.78 ? 163 ALA X N   1 
ATOM   978  C  CA  . ALA A 1 127 ? 28.799 16.433 -5.061  1.00 11.83 ? 163 ALA X CA  1 
ATOM   979  C  C   . ALA A 1 127 ? 28.658 17.017 -6.482  1.00 11.83 ? 163 ALA X C   1 
ATOM   980  O  O   . ALA A 1 127 ? 29.657 17.189 -7.190  1.00 12.07 ? 163 ALA X O   1 
ATOM   981  C  CB  . ALA A 1 127 ? 28.674 14.911 -5.070  1.00 11.47 ? 163 ALA X CB  1 
ATOM   982  N  N   . LYS A 1 128 ? 27.431 17.368 -6.864  1.00 12.78 ? 164 LYS X N   1 
ATOM   983  C  CA  . LYS A 1 128 ? 27.181 18.036 -8.141  1.00 14.13 ? 164 LYS X CA  1 
ATOM   984  C  C   . LYS A 1 128 ? 27.841 19.423 -8.083  1.00 14.66 ? 164 LYS X C   1 
ATOM   985  O  O   . LYS A 1 128 ? 28.484 19.857 -9.059  1.00 14.72 ? 164 LYS X O   1 
ATOM   986  C  CB  . LYS A 1 128 ? 25.673 18.102 -8.434  1.00 14.69 ? 164 LYS X CB  1 
ATOM   987  C  CG  . LYS A 1 128 ? 25.295 18.837 -9.746  1.00 16.30 ? 164 LYS X CG  1 
ATOM   988  C  CD  . LYS A 1 128 ? 23.909 18.401 -10.269 1.00 18.30 ? 164 LYS X CD  1 
ATOM   989  C  CE  . LYS A 1 128 ? 22.792 18.518 -9.254  1.00 19.82 ? 164 LYS X CE  1 
ATOM   990  N  NZ  . LYS A 1 128 ? 21.424 18.277 -9.839  1.00 19.66 ? 164 LYS X NZ  1 
ATOM   991  N  N   . ILE A 1 129 ? 27.756 20.115 -6.944  1.00 14.60 ? 165 ILE X N   1 
ATOM   992  C  CA  . ILE A 1 129 ? 28.495 21.381 -6.788  1.00 15.85 ? 165 ILE X CA  1 
ATOM   993  C  C   . ILE A 1 129 ? 30.016 21.173 -6.961  1.00 14.58 ? 165 ILE X C   1 
ATOM   994  O  O   . ILE A 1 129 ? 30.660 21.905 -7.698  1.00 15.62 ? 165 ILE X O   1 
ATOM   995  C  CB  . ILE A 1 129 ? 28.147 22.093 -5.465  1.00 16.46 ? 165 ILE X CB  1 
ATOM   996  C  CG1 . ILE A 1 129 ? 26.685 22.551 -5.526  1.00 18.24 ? 165 ILE X CG1 1 
ATOM   997  C  CG2 . ILE A 1 129 ? 29.182 23.178 -5.150  1.00 17.91 ? 165 ILE X CG2 1 
ATOM   998  C  CD1 . ILE A 1 129 ? 26.038 22.775 -4.152  1.00 19.46 ? 165 ILE X CD1 1 
ATOM   999  N  N   . SER A 1 130 ? 30.582 20.133 -6.363  1.00 12.77 ? 166 SER X N   1 
ATOM   1000 C  CA  . SER A 1 130 ? 31.994 19.823 -6.514  1.00 12.86 ? 166 SER X CA  1 
ATOM   1001 C  C   . SER A 1 130 ? 32.382 19.746 -7.992  1.00 12.82 ? 166 SER X C   1 
ATOM   1002 O  O   . SER A 1 130 ? 33.387 20.334 -8.411  1.00 13.82 ? 166 SER X O   1 
ATOM   1003 C  CB  . SER A 1 130 ? 32.343 18.485 -5.843  1.00 12.85 ? 166 SER X CB  1 
ATOM   1004 O  OG  . SER A 1 130 ? 32.078 18.439 -4.438  1.00 12.88 ? 166 SER X OG  1 
ATOM   1005 N  N   . ARG A 1 131 ? 31.601 19.013 -8.766  1.00 13.24 ? 167 ARG X N   1 
ATOM   1006 C  CA  . ARG A 1 131 ? 31.864 18.883 -10.207 1.00 13.96 ? 167 ARG X CA  1 
ATOM   1007 C  C   . ARG A 1 131 ? 31.720 20.227 -10.944 1.00 15.42 ? 167 ARG X C   1 
ATOM   1008 O  O   . ARG A 1 131 ? 32.511 20.516 -11.870 1.00 16.33 ? 167 ARG X O   1 
ATOM   1009 C  CB  . ARG A 1 131 ? 31.011 17.779 -10.818 1.00 13.54 ? 167 ARG X CB  1 
ATOM   1010 C  CG  . ARG A 1 131 ? 31.592 16.382 -10.517 1.00 12.61 ? 167 ARG X CG  1 
ATOM   1011 C  CD  . ARG A 1 131 ? 30.757 15.272 -11.137 1.00 12.60 ? 167 ARG X CD  1 
ATOM   1012 N  NE  . ARG A 1 131 ? 29.543 14.979 -10.385 1.00 12.26 ? 167 ARG X NE  1 
ATOM   1013 C  CZ  . ARG A 1 131 ? 29.531 14.222 -9.291  1.00 12.05 ? 167 ARG X CZ  1 
ATOM   1014 N  NH1 . ARG A 1 131 ? 30.658 13.678 -8.825  1.00 10.24 ? 167 ARG X NH1 1 
ATOM   1015 N  NH2 . ARG A 1 131 ? 28.376 13.998 -8.648  1.00 13.73 ? 167 ARG X NH2 1 
ATOM   1016 N  N   . SER A 1 132 ? 30.762 21.054 -10.526 1.00 16.49 ? 168 SER X N   1 
ATOM   1017 C  CA  . SER A 1 132 ? 30.593 22.398 -11.121 1.00 18.01 ? 168 SER X CA  1 
ATOM   1018 C  C   . SER A 1 132 ? 31.820 23.306 -10.872 1.00 18.66 ? 168 SER X C   1 
ATOM   1019 O  O   . SER A 1 132 ? 32.064 24.263 -11.641 1.00 19.47 ? 168 SER X O   1 
ATOM   1020 C  CB  . SER A 1 132 ? 29.312 23.043 -10.581 1.00 18.80 ? 168 SER X CB  1 
ATOM   1021 O  OG  . SER A 1 132 ? 29.556 23.626 -9.297  1.00 22.31 ? 168 SER X OG  1 
ATOM   1022 N  N   . LEU A 1 133 ? 32.566 23.050 -9.802  1.00 18.55 ? 169 LEU X N   1 
ATOM   1023 C  CA  . LEU A 1 133 ? 33.799 23.749 -9.484  1.00 19.19 ? 169 LEU X CA  1 
ATOM   1024 C  C   . LEU A 1 133 ? 35.012 23.146 -10.209 1.00 19.74 ? 169 LEU X C   1 
ATOM   1025 O  O   . LEU A 1 133 ? 36.144 23.579 -10.011 1.00 20.83 ? 169 LEU X O   1 
ATOM   1026 C  CB  . LEU A 1 133 ? 34.047 23.756 -7.982  1.00 19.17 ? 169 LEU X CB  1 
ATOM   1027 C  CG  . LEU A 1 133 ? 32.984 24.433 -7.119  1.00 20.03 ? 169 LEU X CG  1 
ATOM   1028 C  CD1 . LEU A 1 133 ? 33.325 24.206 -5.670  1.00 20.00 ? 169 LEU X CD1 1 
ATOM   1029 C  CD2 . LEU A 1 133 ? 32.905 25.956 -7.429  1.00 20.80 ? 169 LEU X CD2 1 
ATOM   1030 N  N   . GLY A 1 134 ? 34.777 22.095 -10.991 1.00 19.30 ? 170 GLY X N   1 
ATOM   1031 C  CA  . GLY A 1 134 ? 35.836 21.435 -11.754 1.00 19.13 ? 170 GLY X CA  1 
ATOM   1032 C  C   . GLY A 1 134 ? 36.528 20.275 -11.054 1.00 18.48 ? 170 GLY X C   1 
ATOM   1033 O  O   . GLY A 1 134 ? 37.476 19.698 -11.574 1.00 19.99 ? 170 GLY X O   1 
ATOM   1034 N  N   . ALA A 1 135 ? 36.038 19.901 -9.873  1.00 17.29 ? 171 ALA X N   1 
ATOM   1035 C  CA  . ALA A 1 135 ? 36.675 18.855 -9.089  1.00 16.59 ? 171 ALA X CA  1 
ATOM   1036 C  C   . ALA A 1 135 ? 36.214 17.511 -9.601  1.00 14.92 ? 171 ALA X C   1 
ATOM   1037 O  O   . ALA A 1 135 ? 35.145 17.411 -10.199 1.00 16.15 ? 171 ALA X O   1 
ATOM   1038 C  CB  . ALA A 1 135 ? 36.293 18.981 -7.603  1.00 16.79 ? 171 ALA X CB  1 
ATOM   1039 N  N   . SER A 1 136 ? 37.032 16.502 -9.352  1.00 13.54 ? 172 SER X N   1 
ATOM   1040 C  CA  . SER A 1 136 ? 36.645 15.130 -9.608  1.00 13.22 ? 172 SER X CA  1 
ATOM   1041 C  C   . SER A 1 136 ? 36.477 14.409 -8.269  1.00 12.54 ? 172 SER X C   1 
ATOM   1042 O  O   . SER A 1 136 ? 37.340 14.528 -7.387  1.00 13.23 ? 172 SER X O   1 
ATOM   1043 C  CB  . SER A 1 136 ? 37.743 14.498 -10.411 1.00 14.28 ? 172 SER X CB  1 
ATOM   1044 O  OG  . SER A 1 136 ? 37.484 13.154 -10.656 1.00 18.53 ? 172 SER X OG  1 
ATOM   1045 N  N   . VAL A 1 137 ? 35.367 13.676 -8.130  1.00 10.64 ? 173 VAL X N   1 
ATOM   1046 C  CA  . VAL A 1 137 ? 35.003 12.973 -6.899  1.00 10.04 ? 173 VAL X CA  1 
ATOM   1047 C  C   . VAL A 1 137 ? 35.186 11.461 -7.045  1.00 8.01  ? 173 VAL X C   1 
ATOM   1048 O  O   . VAL A 1 137 ? 34.652 10.847 -7.995  1.00 8.97  ? 173 VAL X O   1 
ATOM   1049 C  CB  . VAL A 1 137 ? 33.535 13.283 -6.475  1.00 10.16 ? 173 VAL X CB  1 
ATOM   1050 C  CG1 . VAL A 1 137 ? 33.232 12.733 -5.129  1.00 9.58  ? 173 VAL X CG1 1 
ATOM   1051 C  CG2 . VAL A 1 137 ? 33.294 14.815 -6.476  1.00 12.16 ? 173 VAL X CG2 1 
ATOM   1052 N  N   . TYR A 1 138 ? 35.960 10.877 -6.128  1.00 8.05  ? 174 TYR X N   1 
ATOM   1053 C  CA  . TYR A 1 138 ? 36.123 9.451  -5.981  1.00 8.02  ? 174 TYR X CA  1 
ATOM   1054 C  C   . TYR A 1 138 ? 35.533 8.993  -4.667  1.00 7.62  ? 174 TYR X C   1 
ATOM   1055 O  O   . TYR A 1 138 ? 35.502 9.744  -3.687  1.00 9.40  ? 174 TYR X O   1 
ATOM   1056 C  CB  . TYR A 1 138 ? 37.603 9.096  -5.933  1.00 8.44  ? 174 TYR X CB  1 
ATOM   1057 C  CG  . TYR A 1 138 ? 38.434 9.436  -7.167  1.00 8.49  ? 174 TYR X CG  1 
ATOM   1058 C  CD1 . TYR A 1 138 ? 38.762 10.759 -7.471  1.00 9.88  ? 174 TYR X CD1 1 
ATOM   1059 C  CD2 . TYR A 1 138 ? 38.908 8.440  -8.022  1.00 9.70  ? 174 TYR X CD2 1 
ATOM   1060 C  CE1 . TYR A 1 138 ? 39.552 11.074 -8.592  1.00 11.68 ? 174 TYR X CE1 1 
ATOM   1061 C  CE2 . TYR A 1 138 ? 39.686 8.743  -9.133  1.00 9.49  ? 174 TYR X CE2 1 
ATOM   1062 C  CZ  . TYR A 1 138 ? 40.006 10.055 -9.410  1.00 10.75 ? 174 TYR X CZ  1 
ATOM   1063 O  OH  . TYR A 1 138 ? 40.792 10.405 -10.480 1.00 14.21 ? 174 TYR X OH  1 
ATOM   1064 N  N   . CYS A 1 139 ? 35.058 7.747  -4.610  1.00 7.86  ? 175 CYS X N   1 
ATOM   1065 C  CA  . CYS A 1 139 ? 34.576 7.192  -3.372  1.00 8.20  ? 175 CYS X CA  1 
ATOM   1066 C  C   . CYS A 1 139 ? 35.251 5.868  -3.109  1.00 8.39  ? 175 CYS X C   1 
ATOM   1067 O  O   . CYS A 1 139 ? 35.331 5.020  -4.003  1.00 9.88  ? 175 CYS X O   1 
ATOM   1068 C  CB  . CYS A 1 139 ? 33.067 6.960  -3.402  1.00 8.33  ? 175 CYS X CB  1 
ATOM   1069 S  SG  . CYS A 1 139 ? 32.126 8.507  -3.469  1.00 9.89  ? 175 CYS X SG  1 
ATOM   1070 N  N   . VAL A 1 140 ? 35.702 5.683  -1.871  1.00 8.55  ? 176 VAL X N   1 
ATOM   1071 C  CA  . VAL A 1 140 ? 36.366 4.464  -1.431  1.00 9.08  ? 176 VAL X CA  1 
ATOM   1072 C  C   . VAL A 1 140 ? 35.500 3.886  -0.327  1.00 8.46  ? 176 VAL X C   1 
ATOM   1073 O  O   . VAL A 1 140 ? 35.290 4.499  0.704   1.00 9.24  ? 176 VAL X O   1 
ATOM   1074 C  CB  . VAL A 1 140 ? 37.820 4.746  -0.990  1.00 9.94  ? 176 VAL X CB  1 
ATOM   1075 C  CG1 . VAL A 1 140 ? 38.499 3.467  -0.490  1.00 11.44 ? 176 VAL X CG1 1 
ATOM   1076 C  CG2 . VAL A 1 140 ? 38.611 5.381  -2.156  1.00 10.69 ? 176 VAL X CG2 1 
ATOM   1077 N  N   . GLY A 1 141 ? 34.942 2.713  -0.589  1.00 9.49  ? 177 GLY X N   1 
ATOM   1078 C  CA  . GLY A 1 141 ? 33.916 2.120  0.248   1.00 9.85  ? 177 GLY X CA  1 
ATOM   1079 C  C   . GLY A 1 141 ? 34.435 1.232  1.357   1.00 11.76 ? 177 GLY X C   1 
ATOM   1080 O  O   . GLY A 1 141 ? 35.298 0.388  1.157   1.00 12.80 ? 177 GLY X O   1 
ATOM   1081 N  N   . VAL A 1 142 ? 33.839 1.410  2.527   1.00 13.16 ? 178 VAL X N   1 
ATOM   1082 C  CA  . VAL A 1 142 ? 34.220 0.749  3.776   1.00 14.98 ? 178 VAL X CA  1 
ATOM   1083 C  C   . VAL A 1 142 ? 33.089 -0.211 4.190   1.00 16.39 ? 178 VAL X C   1 
ATOM   1084 O  O   . VAL A 1 142 ? 31.904 0.108  4.049   1.00 15.39 ? 178 VAL X O   1 
ATOM   1085 C  CB  . VAL A 1 142 ? 34.441 1.826  4.877   1.00 16.00 ? 178 VAL X CB  1 
ATOM   1086 C  CG1 . VAL A 1 142 ? 34.973 1.238  6.201   1.00 17.15 ? 178 VAL X CG1 1 
ATOM   1087 C  CG2 . VAL A 1 142 ? 35.383 2.884  4.386   1.00 16.24 ? 178 VAL X CG2 1 
ATOM   1088 N  N   . LEU A 1 143 ? 33.469 -1.382 4.694   1.00 17.81 ? 179 LEU X N   1 
ATOM   1089 C  CA  . LEU A 1 143 ? 32.516 -2.413 5.138   1.00 19.30 ? 179 LEU X CA  1 
ATOM   1090 C  C   . LEU A 1 143 ? 31.572 -2.828 4.008   1.00 19.34 ? 179 LEU X C   1 
ATOM   1091 O  O   . LEU A 1 143 ? 31.982 -2.881 2.845   1.00 19.21 ? 179 LEU X O   1 
ATOM   1092 C  CB  . LEU A 1 143 ? 31.788 -1.967 6.419   1.00 20.77 ? 179 LEU X CB  1 
ATOM   1093 C  CG  . LEU A 1 143 ? 32.673 -1.923 7.658   1.00 23.48 ? 179 LEU X CG  1 
ATOM   1094 C  CD1 . LEU A 1 143 ? 32.045 -1.044 8.753   1.00 25.69 ? 179 LEU X CD1 1 
ATOM   1095 C  CD2 . LEU A 1 143 ? 32.907 -3.367 8.162   1.00 25.16 ? 179 LEU X CD2 1 
ATOM   1096 N  N   . ASP A 1 144 ? 30.320 -3.161 4.316   1.00 19.34 ? 180 ASP X N   1 
ATOM   1097 C  CA  . ASP A 1 144 ? 29.380 -3.588 3.294   1.00 19.40 ? 180 ASP X CA  1 
ATOM   1098 C  C   . ASP A 1 144 ? 28.736 -2.352 2.692   1.00 18.26 ? 180 ASP X C   1 
ATOM   1099 O  O   . ASP A 1 144 ? 27.569 -2.054 2.909   1.00 18.88 ? 180 ASP X O   1 
ATOM   1100 C  CB  . ASP A 1 144 ? 28.331 -4.563 3.885   1.00 20.53 ? 180 ASP X CB  1 
ATOM   1101 C  CG  . ASP A 1 144 ? 27.696 -4.057 5.206   1.00 24.78 ? 180 ASP X CG  1 
ATOM   1102 O  OD1 . ASP A 1 144 ? 28.343 -3.337 6.037   1.00 28.86 ? 180 ASP X OD1 1 
ATOM   1103 O  OD2 . ASP A 1 144 ? 26.523 -4.379 5.514   1.00 29.78 ? 180 ASP X OD2 1 
ATOM   1104 N  N   . PHE A 1 145 ? 29.541 -1.603 1.936   1.00 15.30 ? 181 PHE X N   1 
ATOM   1105 C  CA  . PHE A 1 145 ? 29.145 -0.265 1.489   1.00 14.41 ? 181 PHE X CA  1 
ATOM   1106 C  C   . PHE A 1 145 ? 28.049 -0.264 0.437   1.00 13.83 ? 181 PHE X C   1 
ATOM   1107 O  O   . PHE A 1 145 ? 27.826 -1.243 -0.281  1.00 14.26 ? 181 PHE X O   1 
ATOM   1108 C  CB  . PHE A 1 145 ? 30.370 0.533  1.015   1.00 13.67 ? 181 PHE X CB  1 
ATOM   1109 C  CG  . PHE A 1 145 ? 31.052 -0.039 -0.189  1.00 14.36 ? 181 PHE X CG  1 
ATOM   1110 C  CD1 . PHE A 1 145 ? 30.662 0.347  -1.465  1.00 14.52 ? 181 PHE X CD1 1 
ATOM   1111 C  CD2 . PHE A 1 145 ? 32.122 -0.912 -0.042  1.00 14.65 ? 181 PHE X CD2 1 
ATOM   1112 C  CE1 . PHE A 1 145 ? 31.364 -0.140 -2.591  1.00 17.08 ? 181 PHE X CE1 1 
ATOM   1113 C  CE2 . PHE A 1 145 ? 32.776 -1.399 -1.157  1.00 15.93 ? 181 PHE X CE2 1 
ATOM   1114 C  CZ  . PHE A 1 145 ? 32.395 -1.028 -2.402  1.00 16.45 ? 181 PHE X CZ  1 
ATOM   1115 N  N   . GLU A 1 146 ? 27.347 0.865  0.364   1.00 12.39 ? 182 GLU X N   1 
ATOM   1116 C  CA  . GLU A 1 146 ? 26.261 1.075  -0.550  1.00 12.64 ? 182 GLU X CA  1 
ATOM   1117 C  C   . GLU A 1 146 ? 26.793 1.503  -1.904  1.00 12.06 ? 182 GLU X C   1 
ATOM   1118 O  O   . GLU A 1 146 ? 27.030 2.689  -2.177  1.00 11.33 ? 182 GLU X O   1 
ATOM   1119 C  CB  . GLU A 1 146 ? 25.333 2.135  0.033   1.00 13.22 ? 182 GLU X CB  1 
ATOM   1120 C  CG  . GLU A 1 146 ? 24.494 1.647  1.181   1.00 18.32 ? 182 GLU X CG  1 
ATOM   1121 C  CD  . GLU A 1 146 ? 23.519 0.580  0.742   1.00 23.82 ? 182 GLU X CD  1 
ATOM   1122 O  OE1 . GLU A 1 146 ? 22.692 0.861  -0.145  1.00 26.24 ? 182 GLU X OE1 1 
ATOM   1123 O  OE2 . GLU A 1 146 ? 23.610 -0.547 1.265   1.00 30.08 ? 182 GLU X OE2 1 
ATOM   1124 N  N   . GLN A 1 147 ? 26.968 0.526  -2.773  1.00 12.03 ? 183 GLN X N   1 
ATOM   1125 C  CA  . GLN A 1 147 ? 27.597 0.744  -4.077  1.00 12.11 ? 183 GLN X CA  1 
ATOM   1126 C  C   . GLN A 1 147 ? 26.910 1.801  -4.905  1.00 11.59 ? 183 GLN X C   1 
ATOM   1127 O  O   . GLN A 1 147 ? 27.553 2.714  -5.392  1.00 11.29 ? 183 GLN X O   1 
ATOM   1128 C  CB  . GLN A 1 147 ? 27.654 -0.591 -4.857  1.00 13.41 ? 183 GLN X CB  1 
ATOM   1129 C  CG  . GLN A 1 147 ? 28.202 -0.500 -6.293  1.00 13.77 ? 183 GLN X CG  1 
ATOM   1130 C  CD  . GLN A 1 147 ? 29.696 -0.414 -6.383  1.00 15.36 ? 183 GLN X CD  1 
ATOM   1131 O  OE1 . GLN A 1 147 ? 30.397 -0.901 -5.516  1.00 18.20 ? 183 GLN X OE1 1 
ATOM   1132 N  NE2 . GLN A 1 147 ? 30.193 0.203  -7.463  1.00 15.57 ? 183 GLN X NE2 1 
ATOM   1133 N  N   . ALA A 1 148 ? 25.595 1.714  -5.078  1.00 11.44 ? 184 ALA X N   1 
ATOM   1134 C  CA  . ALA A 1 148 ? 24.925 2.663  -5.920  1.00 11.43 ? 184 ALA X CA  1 
ATOM   1135 C  C   . ALA A 1 148 ? 25.007 4.087  -5.378  1.00 11.27 ? 184 ALA X C   1 
ATOM   1136 O  O   . ALA A 1 148 ? 25.169 5.045  -6.134  1.00 10.76 ? 184 ALA X O   1 
ATOM   1137 C  CB  . ALA A 1 148 ? 23.451 2.290  -6.096  1.00 12.59 ? 184 ALA X CB  1 
ATOM   1138 N  N   . GLN A 1 149 ? 24.855 4.222  -4.074  1.00 10.37 ? 185 GLN X N   1 
ATOM   1139 C  CA  . GLN A 1 149 ? 24.940 5.550  -3.465  1.00 9.65  ? 185 GLN X CA  1 
ATOM   1140 C  C   . GLN A 1 149 ? 26.328 6.153  -3.726  1.00 9.51  ? 185 GLN X C   1 
ATOM   1141 O  O   . GLN A 1 149 ? 26.460 7.365  -4.023  1.00 9.47  ? 185 GLN X O   1 
ATOM   1142 C  CB  . GLN A 1 149 ? 24.631 5.506  -1.972  1.00 9.26  ? 185 GLN X CB  1 
ATOM   1143 C  CG  . GLN A 1 149 ? 24.713 6.896  -1.292  1.00 9.38  ? 185 GLN X CG  1 
ATOM   1144 C  CD  . GLN A 1 149 ? 23.679 7.837  -1.841  1.00 10.65 ? 185 GLN X CD  1 
ATOM   1145 O  OE1 . GLN A 1 149 ? 22.488 7.742  -1.462  1.00 13.83 ? 185 GLN X OE1 1 
ATOM   1146 N  NE2 . GLN A 1 149 ? 24.068 8.692  -2.751  1.00 11.05 ? 185 GLN X NE2 1 
ATOM   1147 N  N   . LEU A 1 150 ? 27.363 5.331  -3.631  1.00 8.39  ? 186 LEU X N   1 
ATOM   1148 C  CA  . LEU A 1 150 ? 28.717 5.852  -3.891  1.00 8.45  ? 186 LEU X CA  1 
ATOM   1149 C  C   . LEU A 1 150 ? 28.911 6.205  -5.366  1.00 9.12  ? 186 LEU X C   1 
ATOM   1150 O  O   . LEU A 1 150 ? 29.610 7.153  -5.690  1.00 8.98  ? 186 LEU X O   1 
ATOM   1151 C  CB  . LEU A 1 150 ? 29.790 4.914  -3.391  1.00 8.80  ? 186 LEU X CB  1 
ATOM   1152 C  CG  . LEU A 1 150 ? 29.855 4.730  -1.874  1.00 12.82 ? 186 LEU X CG  1 
ATOM   1153 C  CD1 . LEU A 1 150 ? 31.159 3.994  -1.476  1.00 14.37 ? 186 LEU X CD1 1 
ATOM   1154 C  CD2 . LEU A 1 150 ? 29.628 6.017  -1.075  1.00 15.13 ? 186 LEU X CD2 1 
ATOM   1155 N  N   . GLU A 1 151 ? 28.297 5.435  -6.260  1.00 9.52  ? 187 GLU X N   1 
ATOM   1156 C  CA  . GLU A 1 151 ? 28.389 5.711  -7.695  1.00 9.63  ? 187 GLU X CA  1 
ATOM   1157 C  C   . GLU A 1 151 ? 27.756 7.044  -8.049  1.00 10.06 ? 187 GLU X C   1 
ATOM   1158 O  O   . GLU A 1 151 ? 28.213 7.725  -8.962  1.00 12.28 ? 187 GLU X O   1 
ATOM   1159 C  CB  . GLU A 1 151 ? 27.709 4.585  -8.502  1.00 10.09 ? 187 GLU X CB  1 
ATOM   1160 C  CG  . GLU A 1 151 ? 28.390 3.235  -8.481  1.00 11.42 ? 187 GLU X CG  1 
ATOM   1161 C  CD  . GLU A 1 151 ? 27.605 2.145  -9.207  1.00 14.58 ? 187 GLU X CD  1 
ATOM   1162 O  OE1 . GLU A 1 151 ? 26.495 2.430  -9.713  1.00 19.79 ? 187 GLU X OE1 1 
ATOM   1163 O  OE2 . GLU A 1 151 ? 28.108 1.006  -9.222  1.00 17.74 ? 187 GLU X OE2 1 
ATOM   1164 N  N   . ARG A 1 152 ? 26.678 7.400  -7.335  1.00 10.39 ? 188 ARG X N   1 
ATOM   1165 C  CA  . ARG A 1 152 ? 25.993 8.652  -7.590  1.00 11.25 ? 188 ARG X CA  1 
ATOM   1166 C  C   . ARG A 1 152 ? 26.789 9.868  -7.106  1.00 11.17 ? 188 ARG X C   1 
ATOM   1167 O  O   . ARG A 1 152 ? 26.740 10.932 -7.739  1.00 12.97 ? 188 ARG X O   1 
ATOM   1168 C  CB  . ARG A 1 152 ? 24.586 8.622  -6.977  1.00 11.90 ? 188 ARG X CB  1 
ATOM   1169 C  CG  . ARG A 1 152 ? 23.654 7.695  -7.705  1.00 12.69 ? 188 ARG X CG  1 
ATOM   1170 C  CD  . ARG A 1 152 ? 22.202 7.874  -7.279  1.00 14.61 ? 188 ARG X CD  1 
ATOM   1171 N  NE  . ARG A 1 152 ? 21.973 7.638  -5.871  1.00 14.04 ? 188 ARG X NE  1 
ATOM   1172 C  CZ  . ARG A 1 152 ? 21.600 6.478  -5.341  1.00 15.28 ? 188 ARG X CZ  1 
ATOM   1173 N  NH1 . ARG A 1 152 ? 21.495 5.386  -6.085  1.00 15.94 ? 188 ARG X NH1 1 
ATOM   1174 N  NH2 . ARG A 1 152 ? 21.376 6.394  -4.033  1.00 13.93 ? 188 ARG X NH2 1 
ATOM   1175 N  N   . ILE A 1 153 ? 27.510 9.709  -6.003  1.00 9.11  ? 189 ILE X N   1 
ATOM   1176 C  CA  . ILE A 1 153 ? 28.333 10.780 -5.436  1.00 9.23  ? 189 ILE X CA  1 
ATOM   1177 C  C   . ILE A 1 153 ? 29.616 10.981 -6.246  1.00 9.48  ? 189 ILE X C   1 
ATOM   1178 O  O   . ILE A 1 153 ? 30.034 12.106 -6.523  1.00 9.30  ? 189 ILE X O   1 
ATOM   1179 C  CB  . ILE A 1 153 ? 28.610 10.498 -3.975  1.00 8.98  ? 189 ILE X CB  1 
ATOM   1180 C  CG1 . ILE A 1 153 ? 27.306 10.616 -3.153  1.00 9.65  ? 189 ILE X CG1 1 
ATOM   1181 C  CG2 . ILE A 1 153 ? 29.729 11.368 -3.396  1.00 7.81  ? 189 ILE X CG2 1 
ATOM   1182 C  CD1 . ILE A 1 153 ? 27.396 10.081 -1.786  1.00 10.85 ? 189 ILE X CD1 1 
ATOM   1183 N  N   . ALA A 1 154 ? 30.296 9.880  -6.556  1.00 8.76  ? 190 ALA X N   1 
ATOM   1184 C  CA  . ALA A 1 154 ? 31.502 9.911  -7.398  1.00 8.34  ? 190 ALA X CA  1 
ATOM   1185 C  C   . ALA A 1 154 ? 31.169 10.341 -8.806  1.00 8.56  ? 190 ALA X C   1 
ATOM   1186 O  O   . ALA A 1 154 ? 30.017 10.376 -9.205  1.00 9.31  ? 190 ALA X O   1 
ATOM   1187 C  CB  . ALA A 1 154 ? 32.134 8.559  -7.453  1.00 8.46  ? 190 ALA X CB  1 
ATOM   1188 N  N   . ASP A 1 155 ? 32.190 10.660 -9.592  1.00 8.71  ? 191 ASP X N   1 
ATOM   1189 C  CA  . ASP A 1 155 ? 31.917 11.129 -10.959 1.00 9.44  ? 191 ASP X CA  1 
ATOM   1190 C  C   . ASP A 1 155 ? 31.245 10.063 -11.822 1.00 9.33  ? 191 ASP X C   1 
ATOM   1191 O  O   . ASP A 1 155 ? 30.523 10.365 -12.769 1.00 11.44 ? 191 ASP X O   1 
ATOM   1192 C  CB  . ASP A 1 155 ? 33.198 11.526 -11.671 1.00 10.16 ? 191 ASP X CB  1 
ATOM   1193 C  CG  . ASP A 1 155 ? 33.856 12.742 -11.110 1.00 11.43 ? 191 ASP X CG  1 
ATOM   1194 O  OD1 . ASP A 1 155 ? 33.365 13.414 -10.165 1.00 10.29 ? 191 ASP X OD1 1 
ATOM   1195 O  OD2 . ASP A 1 155 ? 34.964 13.083 -11.618 1.00 14.40 ? 191 ASP X OD2 1 
ATOM   1196 N  N   . SER A 1 156 ? 31.562 8.807  -11.531 1.00 9.32  ? 192 SER X N   1 
ATOM   1197 C  CA  . SER A 1 156 ? 30.970 7.648  -12.194 1.00 9.37  ? 192 SER X CA  1 
ATOM   1198 C  C   . SER A 1 156 ? 31.300 6.384  -11.422 1.00 9.98  ? 192 SER X C   1 
ATOM   1199 O  O   . SER A 1 156 ? 32.081 6.415  -10.485 1.00 10.06 ? 192 SER X O   1 
ATOM   1200 C  CB  . SER A 1 156 ? 31.517 7.484  -13.609 1.00 10.52 ? 192 SER X CB  1 
ATOM   1201 O  OG  . SER A 1 156 ? 32.810 6.893  -13.621 1.00 12.36 ? 192 SER X OG  1 
ATOM   1202 N  N   . LYS A 1 157 ? 30.773 5.250  -11.868 1.00 11.13 ? 193 LYS X N   1 
ATOM   1203 C  CA  . LYS A 1 157 ? 31.123 3.985  -11.241 1.00 12.35 ? 193 LYS X CA  1 
ATOM   1204 C  C   . LYS A 1 157 ? 32.600 3.624  -11.361 1.00 11.40 ? 193 LYS X C   1 
ATOM   1205 O  O   . LYS A 1 157 ? 33.105 2.831  -10.556 1.00 13.38 ? 193 LYS X O   1 
ATOM   1206 C  CB  . LYS A 1 157 ? 30.236 2.830  -11.743 1.00 14.63 ? 193 LYS X CB  1 
ATOM   1207 C  CG  . LYS A 1 157 ? 30.207 2.575  -13.184 1.00 19.48 ? 193 LYS X CG  1 
ATOM   1208 C  CD  . LYS A 1 157 ? 29.152 1.478  -13.542 1.00 24.50 ? 193 LYS X CD  1 
ATOM   1209 C  CE  . LYS A 1 157 ? 27.692 1.865  -13.281 1.00 26.78 ? 193 LYS X CE  1 
ATOM   1210 N  NZ  . LYS A 1 157 ? 26.736 0.767  -13.703 1.00 28.57 ? 193 LYS X NZ  1 
ATOM   1211 N  N   . GLU A 1 158 ? 33.326 4.232  -12.302 1.00 9.54  ? 194 GLU X N   1 
ATOM   1212 C  CA  . GLU A 1 158 ? 34.751 3.929  -12.445 1.00 9.03  ? 194 GLU X CA  1 
ATOM   1213 C  C   . GLU A 1 158 ? 35.655 4.713  -11.501 1.00 8.92  ? 194 GLU X C   1 
ATOM   1214 O  O   . GLU A 1 158 ? 36.881 4.515  -11.527 1.00 10.30 ? 194 GLU X O   1 
ATOM   1215 C  CB  . GLU A 1 158 ? 35.170 4.153  -13.896 1.00 8.51  ? 194 GLU X CB  1 
ATOM   1216 C  CG  . GLU A 1 158 ? 34.397 3.205  -14.804 1.00 8.64  ? 194 GLU X CG  1 
ATOM   1217 C  CD  . GLU A 1 158 ? 35.029 2.851  -16.127 1.00 8.99  ? 194 GLU X CD  1 
ATOM   1218 O  OE1 . GLU A 1 158 ? 35.901 3.598  -16.642 1.00 8.64  ? 194 GLU X OE1 1 
ATOM   1219 O  OE2 . GLU A 1 158 ? 34.632 1.791  -16.672 1.00 9.19  ? 194 GLU X OE2 1 
ATOM   1220 N  N   . GLN A 1 159 ? 35.050 5.524  -10.624 1.00 8.71  ? 195 GLN X N   1 
ATOM   1221 C  CA  . GLN A 1 159 ? 35.752 6.200  -9.534  1.00 8.58  ? 195 GLN X CA  1 
ATOM   1222 C  C   . GLN A 1 159 ? 35.290 5.723  -8.158  1.00 8.40  ? 195 GLN X C   1 
ATOM   1223 O  O   . GLN A 1 159 ? 35.505 6.404  -7.158  1.00 9.26  ? 195 GLN X O   1 
ATOM   1224 C  CB  . GLN A 1 159 ? 35.610 7.724  -9.652  1.00 9.03  ? 195 GLN X CB  1 
ATOM   1225 C  CG  . GLN A 1 159 ? 36.385 8.331  -10.807 1.00 9.84  ? 195 GLN X CG  1 
ATOM   1226 C  CD  . GLN A 1 159 ? 35.731 8.156  -12.104 1.00 12.21 ? 195 GLN X CD  1 
ATOM   1227 O  OE1 . GLN A 1 159 ? 34.502 8.325  -12.232 1.00 14.59 ? 195 GLN X OE1 1 
ATOM   1228 N  NE2 . GLN A 1 159 ? 36.542 7.849  -13.122 1.00 13.49 ? 195 GLN X NE2 1 
ATOM   1229 N  N   . VAL A 1 160 ? 34.696 4.542  -8.120  1.00 9.42  ? 196 VAL X N   1 
ATOM   1230 C  CA  . VAL A 1 160 ? 34.353 3.858  -6.879  1.00 9.62  ? 196 VAL X CA  1 
ATOM   1231 C  C   . VAL A 1 160 ? 35.203 2.588  -6.692  1.00 9.36  ? 196 VAL X C   1 
ATOM   1232 O  O   . VAL A 1 160 ? 35.248 1.749  -7.576  1.00 10.68 ? 196 VAL X O   1 
ATOM   1233 C  CB  . VAL A 1 160 ? 32.860 3.478  -6.879  1.00 9.77  ? 196 VAL X CB  1 
ATOM   1234 C  CG1 . VAL A 1 160 ? 32.472 2.764  -5.599  1.00 10.57 ? 196 VAL X CG1 1 
ATOM   1235 C  CG2 . VAL A 1 160 ? 31.985 4.683  -7.095  1.00 10.22 ? 196 VAL X CG2 1 
ATOM   1236 N  N   . PHE A 1 161 ? 35.770 2.424  -5.506  1.00 9.59  ? 197 PHE X N   1 
ATOM   1237 C  CA  . PHE A 1 161 ? 36.643 1.283  -5.177  1.00 10.56 ? 197 PHE X CA  1 
ATOM   1238 C  C   . PHE A 1 161 ? 36.368 0.812  -3.757  1.00 11.85 ? 197 PHE X C   1 
ATOM   1239 O  O   . PHE A 1 161 ? 36.132 1.651  -2.881  1.00 11.30 ? 197 PHE X O   1 
ATOM   1240 C  CB  . PHE A 1 161 ? 38.131 1.701  -5.208  1.00 10.69 ? 197 PHE X CB  1 
ATOM   1241 C  CG  . PHE A 1 161 ? 38.608 2.213  -6.539  1.00 10.76 ? 197 PHE X CG  1 
ATOM   1242 C  CD1 . PHE A 1 161 ? 38.497 3.559  -6.886  1.00 11.87 ? 197 PHE X CD1 1 
ATOM   1243 C  CD2 . PHE A 1 161 ? 39.181 1.354  -7.450  1.00 11.72 ? 197 PHE X CD2 1 
ATOM   1244 C  CE1 . PHE A 1 161 ? 38.941 4.016  -8.112  1.00 10.92 ? 197 PHE X CE1 1 
ATOM   1245 C  CE2 . PHE A 1 161 ? 39.610 1.802  -8.697  1.00 11.82 ? 197 PHE X CE2 1 
ATOM   1246 C  CZ  . PHE A 1 161 ? 39.505 3.118  -9.016  1.00 11.08 ? 197 PHE X CZ  1 
ATOM   1247 N  N   . PRO A 1 162 ? 36.499 -0.471 -3.471  1.00 13.11 ? 198 PRO X N   1 
ATOM   1248 C  CA  . PRO A 1 162 ? 36.503 -0.942 -2.081  1.00 13.75 ? 198 PRO X CA  1 
ATOM   1249 C  C   . PRO A 1 162 ? 37.834 -0.588 -1.421  1.00 14.20 ? 198 PRO X C   1 
ATOM   1250 O  O   . PRO A 1 162 ? 38.883 -0.670 -2.063  1.00 14.46 ? 198 PRO X O   1 
ATOM   1251 C  CB  . PRO A 1 162 ? 36.388 -2.473 -2.222  1.00 13.61 ? 198 PRO X CB  1 
ATOM   1252 C  CG  . PRO A 1 162 ? 37.098 -2.728 -3.457  1.00 15.82 ? 198 PRO X CG  1 
ATOM   1253 C  CD  . PRO A 1 162 ? 36.811 -1.562 -4.399  1.00 13.85 ? 198 PRO X CD  1 
ATOM   1254 N  N   . VAL A 1 163 ? 37.811 -0.218 -0.151  1.00 16.51 ? 199 VAL X N   1 
ATOM   1255 C  CA  . VAL A 1 163 ? 39.030 0.024  0.617   1.00 18.35 ? 199 VAL X CA  1 
ATOM   1256 C  C   . VAL A 1 163 ? 39.764 -1.277 0.925   1.00 20.85 ? 199 VAL X C   1 
ATOM   1257 O  O   . VAL A 1 163 ? 40.981 -1.269 1.096   1.00 21.12 ? 199 VAL X O   1 
ATOM   1258 C  CB  . VAL A 1 163 ? 38.747 0.819  1.925   1.00 19.02 ? 199 VAL X CB  1 
ATOM   1259 C  CG1 . VAL A 1 163 ? 38.193 -0.074 3.024   1.00 18.85 ? 199 VAL X CG1 1 
ATOM   1260 C  CG2 . VAL A 1 163 ? 40.012 1.544  2.421   1.00 19.46 ? 199 VAL X CG2 1 
ATOM   1261 N  N   . LYS A 1 164 ? 39.027 -2.376 0.938   1.00 23.89 ? 200 LYS X N   1 
ATOM   1262 C  CA  . LYS A 1 164 ? 39.607 -3.695 1.208   1.00 28.41 ? 200 LYS X CA  1 
ATOM   1263 C  C   . LYS A 1 164 ? 39.921 -4.420 -0.085  1.00 30.22 ? 200 LYS X C   1 
ATOM   1264 O  O   . LYS A 1 164 ? 39.123 -4.394 -1.003  1.00 32.21 ? 200 LYS X O   1 
ATOM   1265 C  CB  . LYS A 1 164 ? 38.610 -4.538 1.976   1.00 29.05 ? 200 LYS X CB  1 
ATOM   1266 C  CG  . LYS A 1 164 ? 38.893 -4.603 3.446   1.00 32.55 ? 200 LYS X CG  1 
ATOM   1267 C  CD  . LYS A 1 164 ? 37.866 -5.464 4.179   1.00 35.16 ? 200 LYS X CD  1 
ATOM   1268 C  CE  . LYS A 1 164 ? 38.092 -5.505 5.685   1.00 37.03 ? 200 LYS X CE  1 
ATOM   1269 N  NZ  . LYS A 1 164 ? 36.895 -5.034 6.457   1.00 38.66 ? 200 LYS X NZ  1 
ATOM   1270 N  N   . GLY A 1 165 ? 41.070 -5.069 -0.153  1.00 32.54 ? 201 GLY X N   1 
ATOM   1271 C  CA  . GLY A 1 165 ? 41.293 -6.125 -1.126  1.00 33.72 ? 201 GLY X CA  1 
ATOM   1272 C  C   . GLY A 1 165 ? 42.100 -5.768 -2.364  1.00 34.58 ? 201 GLY X C   1 
ATOM   1273 O  O   . GLY A 1 165 ? 41.766 -4.821 -3.085  1.00 34.84 ? 201 GLY X O   1 
ATOM   1274 N  N   . GLY A 1 166 ? 43.152 -6.552 -2.611  1.00 35.45 ? 202 GLY X N   1 
ATOM   1275 C  CA  . GLY A 1 166 ? 43.935 -6.498 -3.845  1.00 35.88 ? 202 GLY X CA  1 
ATOM   1276 C  C   . GLY A 1 166 ? 44.604 -5.177 -4.236  1.00 35.86 ? 202 GLY X C   1 
ATOM   1277 O  O   . GLY A 1 166 ? 44.945 -4.977 -5.417  1.00 36.96 ? 202 GLY X O   1 
ATOM   1278 N  N   . PHE A 1 167 ? 44.797 -4.284 -3.264  1.00 35.28 ? 203 PHE X N   1 
ATOM   1279 C  CA  . PHE A 1 167 ? 45.313 -2.932 -3.521  1.00 34.32 ? 203 PHE X CA  1 
ATOM   1280 C  C   . PHE A 1 167 ? 44.532 -2.206 -4.628  1.00 32.33 ? 203 PHE X C   1 
ATOM   1281 O  O   . PHE A 1 167 ? 45.079 -1.349 -5.332  1.00 32.32 ? 203 PHE X O   1 
ATOM   1282 C  CB  . PHE A 1 167 ? 46.812 -2.987 -3.841  1.00 35.26 ? 203 PHE X CB  1 
ATOM   1283 C  CG  . PHE A 1 167 ? 47.665 -3.291 -2.639  1.00 38.31 ? 203 PHE X CG  1 
ATOM   1284 C  CD1 . PHE A 1 167 ? 47.677 -4.569 -2.081  1.00 40.72 ? 203 PHE X CD1 1 
ATOM   1285 C  CD2 . PHE A 1 167 ? 48.440 -2.296 -2.049  1.00 40.25 ? 203 PHE X CD2 1 
ATOM   1286 C  CE1 . PHE A 1 167 ? 48.468 -4.859 -0.960  1.00 41.74 ? 203 PHE X CE1 1 
ATOM   1287 C  CE2 . PHE A 1 167 ? 49.242 -2.575 -0.931  1.00 41.37 ? 203 PHE X CE2 1 
ATOM   1288 C  CZ  . PHE A 1 167 ? 49.248 -3.853 -0.381  1.00 41.95 ? 203 PHE X CZ  1 
ATOM   1289 N  N   . GLN A 1 168 ? 43.242 -2.518 -4.752  1.00 29.18 ? 204 GLN X N   1 
ATOM   1290 C  CA  . GLN A 1 168 ? 42.453 -1.989 -5.849  1.00 26.58 ? 204 GLN X CA  1 
ATOM   1291 C  C   . GLN A 1 168 ? 42.293 -0.485 -5.747  1.00 23.31 ? 204 GLN X C   1 
ATOM   1292 O  O   . GLN A 1 168 ? 42.451 0.215  -6.740  1.00 22.21 ? 204 GLN X O   1 
ATOM   1293 C  CB  . GLN A 1 168 ? 41.049 -2.571 -5.867  1.00 27.09 ? 204 GLN X CB  1 
ATOM   1294 C  CG  . GLN A 1 168 ? 40.920 -4.039 -6.014  1.00 29.56 ? 204 GLN X CG  1 
ATOM   1295 C  CD  . GLN A 1 168 ? 39.529 -4.436 -5.589  1.00 32.56 ? 204 GLN X CD  1 
ATOM   1296 O  OE1 . GLN A 1 168 ? 38.550 -4.161 -6.308  1.00 31.08 ? 204 GLN X OE1 1 
ATOM   1297 N  NE2 . GLN A 1 168 ? 39.417 -5.000 -4.376  1.00 35.02 ? 204 GLN X NE2 1 
ATOM   1298 N  N   . ALA A 1 169 ? 41.930 0.010  -4.569  1.00 19.93 ? 205 ALA X N   1 
ATOM   1299 C  CA  . ALA A 1 169 ? 41.665 1.427  -4.405  1.00 17.62 ? 205 ALA X CA  1 
ATOM   1300 C  C   . ALA A 1 169 ? 42.939 2.233  -4.551  1.00 16.87 ? 205 ALA X C   1 
ATOM   1301 O  O   . ALA A 1 169 ? 42.929 3.239  -5.231  1.00 15.12 ? 205 ALA X O   1 
ATOM   1302 C  CB  . ALA A 1 169 ? 40.994 1.735  -3.072  1.00 16.46 ? 205 ALA X CB  1 
ATOM   1303 N  N   . LEU A 1 170 ? 44.038 1.800  -3.917  1.00 17.55 ? 206 LEU X N   1 
ATOM   1304 C  CA  . LEU A 1 170 ? 45.267 2.577  -3.995  1.00 17.50 ? 206 LEU X CA  1 
ATOM   1305 C  C   . LEU A 1 170 ? 45.785 2.605  -5.422  1.00 17.03 ? 206 LEU X C   1 
ATOM   1306 O  O   . LEU A 1 170 ? 46.048 3.686  -5.954  1.00 15.52 ? 206 LEU X O   1 
ATOM   1307 C  CB  . LEU A 1 170 ? 46.358 2.042  -3.030  1.00 18.38 ? 206 LEU X CB  1 
ATOM   1308 C  CG  . LEU A 1 170 ? 46.130 2.490  -1.576  1.00 20.78 ? 206 LEU X CG  1 
ATOM   1309 C  CD1 . LEU A 1 170 ? 46.942 1.638  -0.619  1.00 23.49 ? 206 LEU X CD1 1 
ATOM   1310 C  CD2 . LEU A 1 170 ? 46.419 3.958  -1.371  1.00 22.82 ? 206 LEU X CD2 1 
ATOM   1311 N  N   . LYS A 1 171 ? 45.917 1.431  -6.038  1.00 17.56 ? 207 LYS X N   1 
ATOM   1312 C  CA  . LYS A 1 171 ? 46.395 1.337  -7.417  1.00 18.56 ? 207 LYS X CA  1 
ATOM   1313 C  C   . LYS A 1 171 ? 45.472 2.112  -8.347  1.00 16.53 ? 207 LYS X C   1 
ATOM   1314 O  O   . LYS A 1 171 ? 45.930 2.867  -9.192  1.00 15.58 ? 207 LYS X O   1 
ATOM   1315 C  CB  . LYS A 1 171 ? 46.531 -0.122 -7.905  1.00 20.70 ? 207 LYS X CB  1 
ATOM   1316 C  CG  . LYS A 1 171 ? 47.885 -0.724 -7.658  1.00 25.80 ? 207 LYS X CG  1 
ATOM   1317 C  CD  . LYS A 1 171 ? 48.016 -2.174 -8.145  1.00 30.06 ? 207 LYS X CD  1 
ATOM   1318 C  CE  . LYS A 1 171 ? 47.830 -2.289 -9.641  1.00 32.04 ? 207 LYS X CE  1 
ATOM   1319 N  NZ  . LYS A 1 171 ? 48.347 -3.600 -10.191 1.00 34.14 ? 207 LYS X NZ  1 
ATOM   1320 N  N   . GLY A 1 172 ? 44.157 1.954  -8.190  1.00 15.13 ? 208 GLY X N   1 
ATOM   1321 C  CA  . GLY A 1 172 ? 43.248 2.552  -9.135  1.00 14.10 ? 208 GLY X CA  1 
ATOM   1322 C  C   . GLY A 1 172 ? 43.277 4.059  -9.076  1.00 13.07 ? 208 GLY X C   1 
ATOM   1323 O  O   . GLY A 1 172 ? 43.247 4.710  -10.098 1.00 12.49 ? 208 GLY X O   1 
ATOM   1324 N  N   . ILE A 1 173 ? 43.328 4.614  -7.873  1.00 13.27 ? 209 ILE X N   1 
ATOM   1325 C  CA  . ILE A 1 173 ? 43.357 6.051  -7.732  1.00 12.86 ? 209 ILE X CA  1 
ATOM   1326 C  C   . ILE A 1 173 ? 44.701 6.648  -8.105  1.00 12.49 ? 209 ILE X C   1 
ATOM   1327 O  O   . ILE A 1 173 ? 44.746 7.660  -8.787  1.00 12.17 ? 209 ILE X O   1 
ATOM   1328 C  CB  . ILE A 1 173 ? 42.900 6.461  -6.320  1.00 13.72 ? 209 ILE X CB  1 
ATOM   1329 C  CG1 . ILE A 1 173 ? 41.384 6.203  -6.198  1.00 13.15 ? 209 ILE X CG1 1 
ATOM   1330 C  CG2 . ILE A 1 173 ? 43.241 7.903  -6.044  1.00 15.63 ? 209 ILE X CG2 1 
ATOM   1331 C  CD1 . ILE A 1 173 ? 40.849 6.285  -4.761  1.00 16.21 ? 209 ILE X CD1 1 
ATOM   1332 N  N   . ILE A 1 174 ? 45.791 6.007  -7.678  1.00 12.57 ? 210 ILE X N   1 
ATOM   1333 C  CA  . ILE A 1 174 ? 47.125 6.492  -8.053  1.00 13.54 ? 210 ILE X CA  1 
ATOM   1334 C  C   . ILE A 1 174 ? 47.225 6.469  -9.576  1.00 12.82 ? 210 ILE X C   1 
ATOM   1335 O  O   . ILE A 1 174 ? 47.617 7.445  -10.175 1.00 13.67 ? 210 ILE X O   1 
ATOM   1336 C  CB  . ILE A 1 174 ? 48.230 5.634  -7.419  1.00 14.04 ? 210 ILE X CB  1 
ATOM   1337 C  CG1 . ILE A 1 174 ? 48.303 5.916  -5.916  1.00 15.52 ? 210 ILE X CG1 1 
ATOM   1338 C  CG2 . ILE A 1 174 ? 49.608 5.887  -8.104  1.00 15.30 ? 210 ILE X CG2 1 
ATOM   1339 C  CD1 . ILE A 1 174 ? 49.038 4.845  -5.144  1.00 17.09 ? 210 ILE X CD1 1 
ATOM   1340 N  N   . ASN A 1 175 ? 46.787 5.368  -10.203 1.00 13.20 ? 211 ASN X N   1 
ATOM   1341 C  CA  . ASN A 1 175 ? 46.918 5.277  -11.668 1.00 12.61 ? 211 ASN X CA  1 
ATOM   1342 C  C   . ASN A 1 175 ? 46.011 6.285  -12.390 1.00 12.40 ? 211 ASN X C   1 
ATOM   1343 O  O   . ASN A 1 175 ? 46.381 6.818  -13.422 1.00 12.90 ? 211 ASN X O   1 
ATOM   1344 C  CB  . ASN A 1 175 ? 46.750 3.837  -12.136 1.00 13.31 ? 211 ASN X CB  1 
ATOM   1345 C  CG  . ASN A 1 175 ? 47.974 2.985  -11.780 1.00 14.93 ? 211 ASN X CG  1 
ATOM   1346 O  OD1 . ASN A 1 175 ? 49.023 3.538  -11.486 1.00 20.91 ? 211 ASN X OD1 1 
ATOM   1347 N  ND2 . ASN A 1 175 ? 47.834 1.675  -11.784 1.00 19.52 ? 211 ASN X ND2 1 
ATOM   1348 N  N   . SER A 1 176 ? 44.837 6.578  -11.824 1.00 11.81 ? 212 SER X N   1 
ATOM   1349 C  CA  . SER A 1 176 ? 43.960 7.624  -12.349 1.00 12.01 ? 212 SER X CA  1 
ATOM   1350 C  C   . SER A 1 176 ? 44.597 9.011  -12.303 1.00 13.23 ? 212 SER X C   1 
ATOM   1351 O  O   . SER A 1 176 ? 44.490 9.775  -13.248 1.00 14.02 ? 212 SER X O   1 
ATOM   1352 C  CB  . SER A 1 176 ? 42.624 7.642  -11.580 1.00 12.67 ? 212 SER X CB  1 
ATOM   1353 O  OG  . SER A 1 176 ? 41.796 8.685  -12.064 1.00 14.23 ? 212 SER X OG  1 
ATOM   1354 N  N   . ILE A 1 177 ? 45.277 9.320  -11.202 1.00 14.03 ? 213 ILE X N   1 
ATOM   1355 C  CA  . ILE A 1 177 ? 45.988 10.602 -11.075 1.00 14.75 ? 213 ILE X CA  1 
ATOM   1356 C  C   . ILE A 1 177 ? 47.174 10.686 -12.047 1.00 15.08 ? 213 ILE X C   1 
ATOM   1357 O  O   . ILE A 1 177 ? 47.362 11.703 -12.713 1.00 15.79 ? 213 ILE X O   1 
ATOM   1358 C  CB  . ILE A 1 177 ? 46.396 10.844 -9.615  1.00 15.75 ? 213 ILE X CB  1 
ATOM   1359 C  CG1 . ILE A 1 177 ? 45.144 11.084 -8.766  1.00 16.77 ? 213 ILE X CG1 1 
ATOM   1360 C  CG2 . ILE A 1 177 ? 47.378 12.004 -9.514  1.00 17.57 ? 213 ILE X CG2 1 
ATOM   1361 C  CD1 . ILE A 1 177 ? 45.420 11.073 -7.268  1.00 18.16 ? 213 ILE X CD1 1 
ATOM   1362 N  N   . LEU A 1 178 ? 47.955 9.625  -12.130 1.00 15.09 ? 214 LEU X N   1 
ATOM   1363 C  CA  . LEU A 1 178 ? 49.091 9.581  -13.056 1.00 16.23 ? 214 LEU X CA  1 
ATOM   1364 C  C   . LEU A 1 178 ? 48.648 9.745  -14.498 1.00 16.56 ? 214 LEU X C   1 
ATOM   1365 O  O   . LEU A 1 178 ? 49.344 10.373 -15.293 1.00 17.27 ? 214 LEU X O   1 
ATOM   1366 C  CB  . LEU A 1 178 ? 49.898 8.289  -12.889 1.00 17.43 ? 214 LEU X CB  1 
ATOM   1367 C  CG  . LEU A 1 178 ? 50.672 8.171  -11.582 1.00 18.80 ? 214 LEU X CG  1 
ATOM   1368 C  CD1 . LEU A 1 178 ? 51.354 6.829  -11.482 1.00 19.94 ? 214 LEU X CD1 1 
ATOM   1369 C  CD2 . LEU A 1 178 ? 51.678 9.291  -11.339 1.00 20.71 ? 214 LEU X CD2 1 
ATOM   1370 N  N   . ALA A 1 179 ? 47.473 9.214  -14.841 1.00 16.19 ? 215 ALA X N   1 
ATOM   1371 C  CA  . ALA A 1 179 ? 46.968 9.356  -16.203 1.00 15.73 ? 215 ALA X CA  1 
ATOM   1372 C  C   . ALA A 1 179 ? 46.721 10.818 -16.603 1.00 16.24 ? 215 ALA X C   1 
ATOM   1373 O  O   . ALA A 1 179 ? 46.777 11.165 -17.791 1.00 18.11 ? 215 ALA X O   1 
ATOM   1374 C  CB  . ALA A 1 179 ? 45.712 8.479  -16.398 1.00 15.38 ? 215 ALA X CB  1 
ATOM   1375 N  N   . GLN A 1 180 ? 46.435 11.651 -15.600 1.00 15.90 ? 216 GLN X N   1 
ATOM   1376 C  CA  . GLN A 1 180 ? 46.200 13.068 -15.750 1.00 15.90 ? 216 GLN X CA  1 
ATOM   1377 C  C   . GLN A 1 180 ? 47.497 13.891 -15.674 1.00 16.28 ? 216 GLN X C   1 
ATOM   1378 O  O   . GLN A 1 180 ? 47.458 15.101 -15.886 1.00 16.48 ? 216 GLN X O   1 
ATOM   1379 C  CB  . GLN A 1 180 ? 45.253 13.564 -14.641 1.00 16.41 ? 216 GLN X CB  1 
ATOM   1380 C  CG  . GLN A 1 180 ? 43.871 12.936 -14.679 1.00 19.08 ? 216 GLN X CG  1 
ATOM   1381 C  CD  . GLN A 1 180 ? 43.096 13.231 -13.430 1.00 22.10 ? 216 GLN X CD  1 
ATOM   1382 O  OE1 . GLN A 1 180 ? 42.874 14.397 -13.110 1.00 25.85 ? 216 GLN X OE1 1 
ATOM   1383 N  NE2 . GLN A 1 180 ? 42.706 12.185 -12.691 1.00 22.77 ? 216 GLN X NE2 1 
ATOM   1384 N  N   . SER A 1 181 ? 48.600 13.226 -15.359 1.00 15.78 ? 217 SER X N   1 
ATOM   1385 C  CA  . SER A 1 181 ? 49.880 13.894 -15.025 1.00 16.89 ? 217 SER X CA  1 
ATOM   1386 C  C   . SER A 1 181 ? 50.831 14.003 -16.203 1.00 17.74 ? 217 SER X C   1 
ATOM   1387 O  O   . SER A 1 181 ? 50.746 13.223 -17.146 1.00 19.89 ? 217 SER X O   1 
ATOM   1388 C  CB  . SER A 1 181 ? 50.566 13.167 -13.874 1.00 17.03 ? 217 SER X CB  1 
ATOM   1389 O  OG  . SER A 1 181 ? 49.730 13.161 -12.713 1.00 18.81 ? 217 SER X OG  1 
ATOM   1390 N  N   . CYS A 1 182 ? 51.750 14.970 -16.138 1.00 18.02 ? 218 CYS X N   1 
ATOM   1391 C  CA  . CYS A 1 182 ? 52.773 15.100 -17.174 1.00 18.61 ? 218 CYS X CA  1 
ATOM   1392 C  C   . CYS A 1 182 ? 53.858 14.047 -16.974 1.00 19.90 ? 218 CYS X C   1 
ATOM   1393 O  O   . CYS A 1 182 ? 54.569 13.742 -17.952 1.00 21.38 ? 218 CYS X O   1 
ATOM   1394 C  CB  . CYS A 1 182 ? 53.382 16.501 -17.172 1.00 18.57 ? 218 CYS X CB  1 
ATOM   1395 S  SG  . CYS A 1 182 ? 52.216 17.784 -17.618 1.00 17.56 ? 218 CYS X SG  1 
ATOM   1396 O  OXT . CYS A 1 182 ? 53.962 13.490 -15.880 1.00 20.61 ? 218 CYS X OXT 1 
HETATM 1397 MG MG  . MG  B 2 .   ? 27.596 6.087  9.295   1.00 9.78  ? 219 MG  X MG  1 
HETATM 1398 O  O   . HOH C 3 .   ? 28.499 6.031  7.516   1.00 9.31  ? 220 HOH X O   1 
HETATM 1399 O  O   . HOH C 3 .   ? 23.137 9.852  6.809   1.00 11.27 ? 221 HOH X O   1 
HETATM 1400 O  O   . HOH C 3 .   ? 25.880 5.248  8.519   1.00 10.26 ? 222 HOH X O   1 
HETATM 1401 O  O   . HOH C 3 .   ? 41.050 4.076  -12.038 1.00 12.18 ? 223 HOH X O   1 
HETATM 1402 O  O   . HOH C 3 .   ? 22.884 9.779  9.573   1.00 12.90 ? 224 HOH X O   1 
HETATM 1403 O  O   . HOH C 3 .   ? 39.238 5.876  -11.029 1.00 11.41 ? 225 HOH X O   1 
HETATM 1404 O  O   . HOH C 3 .   ? 18.945 13.478 12.874  1.00 17.64 ? 226 HOH X O   1 
HETATM 1405 O  O   . HOH C 3 .   ? 48.127 19.425 -24.360 1.00 18.13 ? 227 HOH X O   1 
HETATM 1406 O  O   . HOH C 3 .   ? 56.379 12.117 -15.775 1.00 19.02 ? 228 HOH X O   1 
HETATM 1407 O  O   . HOH C 3 .   ? 35.155 1.191  -10.197 1.00 14.99 ? 229 HOH X O   1 
HETATM 1408 O  O   . HOH C 3 .   ? 33.632 17.047 13.100  1.00 18.16 ? 230 HOH X O   1 
HETATM 1409 O  O   . HOH C 3 .   ? 28.780 12.733 16.542  1.00 17.23 ? 231 HOH X O   1 
HETATM 1410 O  O   . HOH C 3 .   ? 48.359 5.968  -15.274 1.00 19.08 ? 232 HOH X O   1 
HETATM 1411 O  O   . HOH C 3 .   ? 35.900 6.120  -17.568 1.00 16.78 ? 233 HOH X O   1 
HETATM 1412 O  O   . HOH C 3 .   ? 36.148 -2.591 4.537   1.00 19.84 ? 234 HOH X O   1 
HETATM 1413 O  O   . HOH C 3 .   ? 19.053 13.262 -4.978  1.00 17.35 ? 235 HOH X O   1 
HETATM 1414 O  O   . HOH C 3 .   ? 20.532 11.115 10.100  1.00 18.52 ? 236 HOH X O   1 
HETATM 1415 O  O   . HOH C 3 .   ? 35.926 -2.303 1.483   1.00 19.43 ? 237 HOH X O   1 
HETATM 1416 O  O   . HOH C 3 .   ? 19.817 15.880 -4.616  1.00 17.42 ? 238 HOH X O   1 
HETATM 1417 O  O   . HOH C 3 .   ? 25.559 -2.208 -2.467  1.00 22.11 ? 239 HOH X O   1 
HETATM 1418 O  O   . HOH C 3 .   ? 41.813 23.171 -4.646  1.00 19.57 ? 240 HOH X O   1 
HETATM 1419 O  O   . HOH C 3 .   ? 57.075 23.760 4.008   1.00 17.43 ? 241 HOH X O   1 
HETATM 1420 O  O   . HOH C 3 .   ? 22.012 4.779  -8.941  1.00 24.71 ? 242 HOH X O   1 
HETATM 1421 O  O   . HOH C 3 .   ? 27.866 19.323 -11.895 1.00 19.84 ? 243 HOH X O   1 
HETATM 1422 O  O   . HOH C 3 .   ? 25.445 19.369 11.747  1.00 17.83 ? 244 HOH X O   1 
HETATM 1423 O  O   . HOH C 3 .   ? 22.626 5.134  1.547   1.00 21.10 ? 245 HOH X O   1 
HETATM 1424 O  O   . HOH C 3 .   ? 17.027 11.716 -0.018  1.00 18.65 ? 246 HOH X O   1 
HETATM 1425 O  O   . HOH C 3 .   ? 29.477 20.896 10.499  1.00 24.76 ? 247 HOH X O   1 
HETATM 1426 O  O   . HOH C 3 .   ? 23.164 2.110  -2.512  1.00 21.37 ? 248 HOH X O   1 
HETATM 1427 O  O   . HOH C 3 .   ? 29.768 22.005 6.070   1.00 24.18 ? 249 HOH X O   1 
HETATM 1428 O  O   . HOH C 3 .   ? 25.957 13.357 -6.991  1.00 20.14 ? 250 HOH X O   1 
HETATM 1429 O  O   . HOH C 3 .   ? 45.253 16.384 -16.861 1.00 25.41 ? 251 HOH X O   1 
HETATM 1430 O  O   . HOH C 3 .   ? 16.905 8.162  2.435   1.00 26.14 ? 252 HOH X O   1 
HETATM 1431 O  O   . HOH C 3 .   ? 57.971 20.556 7.156   1.00 26.78 ? 253 HOH X O   1 
HETATM 1432 O  O   . HOH C 3 .   ? 28.479 5.594  -13.745 1.00 24.24 ? 254 HOH X O   1 
HETATM 1433 O  O   . HOH C 3 .   ? 33.102 -0.220 -8.125  1.00 23.37 ? 255 HOH X O   1 
HETATM 1434 O  O   . HOH C 3 .   ? 29.226 0.235  8.127   1.00 27.23 ? 256 HOH X O   1 
HETATM 1435 O  O   . HOH C 3 .   ? 36.589 23.196 10.362  1.00 26.18 ? 257 HOH X O   1 
HETATM 1436 O  O   . HOH C 3 .   ? 47.575 22.948 6.985   1.00 24.06 ? 258 HOH X O   1 
HETATM 1437 O  O   . HOH C 3 .   ? 53.356 11.270 -14.189 1.00 27.32 ? 259 HOH X O   1 
HETATM 1438 O  O   . HOH C 3 .   ? 48.679 21.727 -5.918  1.00 24.48 ? 260 HOH X O   1 
HETATM 1439 O  O   . HOH C 3 .   ? 29.191 16.242 9.515   1.00 25.74 ? 261 HOH X O   1 
HETATM 1440 O  O   . HOH C 3 .   ? 29.389 -3.498 -1.382  1.00 32.66 ? 262 HOH X O   1 
HETATM 1441 O  O   . HOH C 3 .   ? 22.379 5.882  7.895   1.00 23.70 ? 263 HOH X O   1 
HETATM 1442 O  O   . HOH C 3 .   ? 37.283 12.353 17.258  1.00 31.67 ? 264 HOH X O   1 
HETATM 1443 O  O   . HOH C 3 .   ? 43.903 -0.625 -1.957  1.00 26.93 ? 265 HOH X O   1 
HETATM 1444 O  O   . HOH C 3 .   ? 35.759 8.252  -15.923 1.00 22.67 ? 266 HOH X O   1 
HETATM 1445 O  O   . HOH C 3 .   ? 39.880 20.612 -10.994 1.00 28.91 ? 267 HOH X O   1 
HETATM 1446 O  O   . HOH C 3 .   ? 46.157 15.082 -20.552 1.00 28.23 ? 268 HOH X O   1 
HETATM 1447 O  O   . HOH C 3 .   ? 36.247 11.460 -13.494 1.00 23.38 ? 269 HOH X O   1 
HETATM 1448 O  O   . HOH C 3 .   ? 49.686 21.799 -13.631 1.00 24.10 ? 270 HOH X O   1 
HETATM 1449 O  O   . HOH C 3 .   ? 15.764 6.927  5.771   1.00 29.16 ? 271 HOH X O   1 
HETATM 1450 O  O   . HOH C 3 .   ? 37.661 14.818 14.988  1.00 26.23 ? 272 HOH X O   1 
HETATM 1451 O  O   . HOH C 3 .   ? 30.362 12.972 -13.626 1.00 26.17 ? 273 HOH X O   1 
HETATM 1452 O  O   . HOH C 3 .   ? 19.983 2.736  -5.323  1.00 25.85 ? 274 HOH X O   1 
HETATM 1453 O  O   . HOH C 3 .   ? 44.529 23.819 -7.678  1.00 28.73 ? 275 HOH X O   1 
HETATM 1454 O  O   . HOH C 3 .   ? 54.289 13.619 -5.521  1.00 31.55 ? 276 HOH X O   1 
HETATM 1455 O  O   . HOH C 3 .   ? 20.972 5.927  -0.239  1.00 26.23 ? 277 HOH X O   1 
HETATM 1456 O  O   . HOH C 3 .   ? 40.350 17.294 -11.109 1.00 21.50 ? 278 HOH X O   1 
HETATM 1457 O  O   . HOH C 3 .   ? 48.665 19.741 10.881  1.00 26.52 ? 279 HOH X O   1 
HETATM 1458 O  O   . HOH C 3 .   ? 47.687 13.375 -19.064 1.00 27.29 ? 280 HOH X O   1 
HETATM 1459 O  O   . HOH C 3 .   ? 46.319 18.613 11.829  1.00 26.05 ? 281 HOH X O   1 
HETATM 1460 O  O   . HOH C 3 .   ? 42.223 25.807 2.595   1.00 30.17 ? 282 HOH X O   1 
HETATM 1461 O  O   . HOH C 3 .   ? 30.181 -3.174 -3.963  1.00 32.76 ? 283 HOH X O   1 
HETATM 1462 O  O   . HOH C 3 .   ? 21.292 21.218 -10.970 1.00 23.70 ? 284 HOH X O   1 
HETATM 1463 O  O   . HOH C 3 .   ? 29.378 9.593  -15.200 1.00 30.91 ? 285 HOH X O   1 
HETATM 1464 O  O   . HOH C 3 .   ? 41.290 -1.907 -2.263  1.00 22.40 ? 286 HOH X O   1 
HETATM 1465 O  O   . HOH C 3 .   ? 34.912 15.754 -12.710 1.00 29.47 ? 287 HOH X O   1 
HETATM 1466 O  O   . HOH C 3 .   ? 28.470 24.534 -1.463  1.00 32.67 ? 288 HOH X O   1 
HETATM 1467 O  O   . HOH C 3 .   ? 39.584 0.420  13.665  1.00 29.23 ? 289 HOH X O   1 
HETATM 1468 O  O   . HOH C 3 .   ? 16.191 6.851  10.221  1.00 32.15 ? 290 HOH X O   1 
HETATM 1469 O  O   . HOH C 3 .   ? 21.392 15.985 8.106   1.00 23.80 ? 291 HOH X O   1 
HETATM 1470 O  O   . HOH C 3 .   ? 17.114 13.763 7.204   1.00 28.05 ? 292 HOH X O   1 
HETATM 1471 O  O   . HOH C 3 .   ? 34.776 -5.213 4.929   1.00 36.98 ? 293 HOH X O   1 
HETATM 1472 O  O   . HOH C 3 .   ? 19.722 19.132 -7.830  1.00 29.60 ? 294 HOH X O   1 
HETATM 1473 O  O   . HOH C 3 .   ? 40.990 23.849 10.606  1.00 36.55 ? 295 HOH X O   1 
HETATM 1474 O  O   . HOH C 3 .   ? 21.003 16.516 -7.031  1.00 29.50 ? 296 HOH X O   1 
HETATM 1475 O  O   . HOH C 3 .   ? 34.155 18.433 -12.939 1.00 32.71 ? 297 HOH X O   1 
HETATM 1476 O  O   . HOH C 3 .   ? 24.019 21.015 -7.157  1.00 24.73 ? 298 HOH X O   1 
HETATM 1477 O  O   . HOH C 3 .   ? 51.554 24.614 1.006   1.00 34.55 ? 299 HOH X O   1 
HETATM 1478 O  O   . HOH C 3 .   ? 42.530 -1.137 -9.265  1.00 26.61 ? 300 HOH X O   1 
HETATM 1479 O  O   . HOH C 3 .   ? 57.613 20.048 3.250   1.00 28.80 ? 301 HOH X O   1 
HETATM 1480 O  O   . HOH C 3 .   ? 32.035 11.831 15.454  1.00 29.82 ? 302 HOH X O   1 
HETATM 1481 O  O   . HOH C 3 .   ? 23.705 20.001 -0.164  1.00 28.43 ? 303 HOH X O   1 
HETATM 1482 O  O   . HOH C 3 .   ? 31.703 -0.063 13.160  1.00 36.95 ? 304 HOH X O   1 
HETATM 1483 O  O   . HOH C 3 .   ? 25.567 20.470 1.757   1.00 26.82 ? 305 HOH X O   1 
HETATM 1484 O  O   . HOH C 3 .   ? 44.440 -1.296 6.604   1.00 31.82 ? 306 HOH X O   1 
HETATM 1485 O  O   . HOH C 3 .   ? 30.352 26.521 -9.241  1.00 38.01 ? 307 HOH X O   1 
HETATM 1486 O  O   . HOH C 3 .   ? 34.074 -4.211 1.250   1.00 32.40 ? 308 HOH X O   1 
HETATM 1487 O  O   . HOH C 3 .   ? 52.556 3.700  -6.952  1.00 34.96 ? 309 HOH X O   1 
HETATM 1488 O  O   . HOH C 3 .   ? 44.896 26.105 3.300   1.00 28.83 ? 310 HOH X O   1 
HETATM 1489 O  O   . HOH C 3 .   ? 31.222 4.508  18.139  1.00 24.63 ? 311 HOH X O   1 
HETATM 1490 O  O   . HOH C 3 .   ? 25.044 -2.232 2.606   1.00 33.29 ? 312 HOH X O   1 
HETATM 1491 O  O   . HOH C 3 .   ? 43.324 0.386  4.499   1.00 26.95 ? 313 HOH X O   1 
HETATM 1492 O  O   . HOH C 3 .   ? 36.082 -4.787 -6.563  1.00 31.72 ? 314 HOH X O   1 
HETATM 1493 O  O   . HOH C 3 .   ? 21.201 3.717  -2.756  1.00 30.58 ? 315 HOH X O   1 
HETATM 1494 O  O   . HOH C 3 .   ? 33.243 -0.991 -5.750  1.00 34.11 ? 316 HOH X O   1 
HETATM 1495 O  O   . HOH C 3 .   ? 34.993 29.574 0.124   1.00 29.75 ? 317 HOH X O   1 
HETATM 1496 O  O   . HOH C 3 .   ? 54.180 14.654 13.354  1.00 38.18 ? 318 HOH X O   1 
HETATM 1497 O  O   . HOH C 3 .   ? 41.784 26.886 0.195   1.00 29.25 ? 319 HOH X O   1 
HETATM 1498 O  O   . HOH C 3 .   ? 45.218 1.138  2.725   1.00 34.13 ? 320 HOH X O   1 
HETATM 1499 O  O   . HOH C 3 .   ? 21.615 2.702  2.347   1.00 41.94 ? 321 HOH X O   1 
HETATM 1500 O  O   . HOH C 3 .   ? 58.168 18.739 -6.470  1.00 45.82 ? 322 HOH X O   1 
HETATM 1501 O  O   . HOH C 3 .   ? 51.032 3.027  -9.968  1.00 33.13 ? 323 HOH X O   1 
HETATM 1502 O  O   . HOH C 3 .   ? 33.609 22.982 10.644  1.00 34.36 ? 324 HOH X O   1 
HETATM 1503 O  O   . HOH C 3 .   ? 18.499 8.973  12.203  1.00 38.24 ? 325 HOH X O   1 
HETATM 1504 O  O   . HOH C 3 .   ? 55.247 9.241  -10.496 1.00 40.11 ? 326 HOH X O   1 
HETATM 1505 O  O   . HOH C 3 .   ? 53.755 15.114 -13.428 1.00 34.18 ? 327 HOH X O   1 
HETATM 1506 O  O   . HOH C 3 .   ? 51.638 13.409 -19.984 1.00 28.77 ? 328 HOH X O   1 
HETATM 1507 O  O   . HOH C 3 .   ? 52.188 4.403  -0.473  1.00 30.06 ? 329 HOH X O   1 
HETATM 1508 O  O   . HOH C 3 .   ? 49.960 26.208 -0.290  1.00 32.84 ? 330 HOH X O   1 
HETATM 1509 O  O   . HOH C 3 .   ? 50.404 9.400  12.238  1.00 32.69 ? 331 HOH X O   1 
HETATM 1510 O  O   . HOH C 3 .   ? 29.830 2.535  16.789  1.00 28.02 ? 332 HOH X O   1 
HETATM 1511 O  O   . HOH C 3 .   ? 34.563 28.146 -10.885 1.00 44.18 ? 333 HOH X O   1 
HETATM 1512 O  O   . HOH C 3 .   ? 24.341 23.570 -1.196  1.00 29.22 ? 334 HOH X O   1 
HETATM 1513 O  O   . HOH C 3 .   ? 21.343 3.663  4.642   1.00 32.77 ? 335 HOH X O   1 
HETATM 1514 O  O   . HOH C 3 .   ? 58.048 16.834 0.198   1.00 45.12 ? 336 HOH X O   1 
HETATM 1515 O  O   . HOH C 3 .   ? 52.480 13.491 1.754   1.00 29.29 ? 337 HOH X O   1 
HETATM 1516 O  O   . HOH C 3 .   ? 50.383 14.527 17.668  1.00 43.57 ? 338 HOH X O   1 
HETATM 1517 O  O   . HOH C 3 .   ? 18.410 10.295 14.678  1.00 32.25 ? 339 HOH X O   1 
HETATM 1518 O  O   . HOH C 3 .   ? 52.315 10.987 11.256  1.00 32.88 ? 340 HOH X O   1 
HETATM 1519 O  O   . HOH C 3 .   ? 49.015 22.025 -17.532 1.00 31.22 ? 341 HOH X O   1 
HETATM 1520 O  O   . HOH C 3 .   ? 18.520 4.987  7.447   1.00 38.01 ? 342 HOH X O   1 
HETATM 1521 O  O   . HOH C 3 .   ? 42.057 -1.806 3.566   1.00 35.48 ? 343 HOH X O   1 
HETATM 1522 O  O   . HOH C 3 .   ? 22.294 18.214 8.113   1.00 32.47 ? 344 HOH X O   1 
HETATM 1523 O  O   . HOH C 3 .   ? 18.584 7.362  -1.630  1.00 22.48 ? 345 HOH X O   1 
HETATM 1524 O  O   . HOH C 3 .   ? 28.571 -0.875 11.122  1.00 31.10 ? 346 HOH X O   1 
HETATM 1525 O  O   . HOH C 3 .   ? 35.500 26.314 4.838   1.00 37.76 ? 347 HOH X O   1 
HETATM 1526 O  O   . HOH C 3 .   ? 17.782 11.571 -3.202  1.00 18.62 ? 348 HOH X O   1 
HETATM 1527 O  O   . HOH C 3 .   ? 40.530 15.131 -12.292 1.00 32.01 ? 349 HOH X O   1 
HETATM 1528 O  O   . HOH C 3 .   ? 18.406 6.151  3.154   1.00 35.42 ? 350 HOH X O   1 
HETATM 1529 O  O   . HOH C 3 .   ? 29.828 31.297 -2.286  1.00 47.69 ? 351 HOH X O   1 
HETATM 1530 O  O   . HOH C 3 .   ? 34.103 10.935 -15.288 1.00 30.55 ? 352 HOH X O   1 
HETATM 1531 O  O   . HOH C 3 .   ? 47.411 21.583 -12.415 1.00 28.84 ? 353 HOH X O   1 
HETATM 1532 O  O   . HOH C 3 .   ? 24.255 3.548  9.935   1.00 23.95 ? 354 HOH X O   1 
HETATM 1533 O  O   . HOH C 3 .   ? 50.071 -0.471 -11.538 1.00 37.49 ? 355 HOH X O   1 
HETATM 1534 O  O   . HOH C 3 .   ? 42.733 20.573 13.621  1.00 43.88 ? 356 HOH X O   1 
HETATM 1535 O  O   . HOH C 3 .   ? 29.566 20.011 -13.859 1.00 31.00 ? 357 HOH X O   1 
HETATM 1536 O  O   . HOH C 3 .   ? 24.515 4.394  -10.198 1.00 31.27 ? 358 HOH X O   1 
HETATM 1537 O  O   . HOH C 3 .   ? 33.541 16.348 16.115  1.00 39.32 ? 359 HOH X O   1 
HETATM 1538 O  O   . HOH C 3 .   ? 26.233 25.366 5.308   1.00 39.70 ? 360 HOH X O   1 
HETATM 1539 O  O   . HOH C 3 .   ? 53.741 10.661 8.995   1.00 42.06 ? 361 HOH X O   1 
HETATM 1540 O  O   . HOH C 3 .   ? 50.631 25.561 4.197   1.00 38.81 ? 362 HOH X O   1 
HETATM 1541 O  O   . HOH C 3 .   ? 46.099 3.669  13.505  1.00 47.27 ? 363 HOH X O   1 
HETATM 1542 O  O   . HOH C 3 .   ? 31.843 -6.268 3.848   1.00 44.61 ? 364 HOH X O   1 
HETATM 1543 O  O   . HOH C 3 .   ? 52.031 3.371  3.919   1.00 46.68 ? 365 HOH X O   1 
HETATM 1544 O  O   . HOH C 3 .   ? 55.181 22.474 10.014  1.00 34.88 ? 366 HOH X O   1 
HETATM 1545 O  O   . HOH C 3 .   ? 26.593 28.401 2.791   1.00 36.85 ? 367 HOH X O   1 
HETATM 1546 O  O   . HOH C 3 .   ? 50.201 14.480 -2.138  1.00 65.79 ? 368 HOH X O   1 
HETATM 1547 O  O   . HOH C 3 .   ? 52.443 15.485 -11.033 1.00 39.99 ? 369 HOH X O   1 
HETATM 1548 O  O   . HOH C 3 .   ? 48.249 -1.500 1.552   1.00 50.40 ? 370 HOH X O   1 
HETATM 1549 O  O   . HOH C 3 .   ? 40.296 11.867 -15.081 1.00 36.62 ? 371 HOH X O   1 
HETATM 1550 O  O   . HOH C 3 .   ? 57.161 9.074  0.772   1.00 32.47 ? 372 HOH X O   1 
HETATM 1551 O  O   . HOH C 3 .   ? 23.856 -2.589 -0.356  1.00 45.68 ? 373 HOH X O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N   . SER A 2   ? 0.2151 0.2628 0.2556 -0.0010 0.0064  0.0062  38  SER X N   
2    C  CA  . SER A 2   ? 0.2062 0.2351 0.2229 0.0010  0.0069  -0.0011 38  SER X CA  
3    C  C   . SER A 2   ? 0.1932 0.2271 0.2154 -0.0012 0.0027  -0.0057 38  SER X C   
4    O  O   . SER A 2   ? 0.2111 0.2621 0.2219 -0.0077 0.0086  -0.0066 38  SER X O   
5    C  CB  . SER A 2   ? 0.2103 0.2335 0.2376 0.0023  0.0045  -0.0012 38  SER X CB  
6    O  OG  . SER A 2   ? 0.2319 0.2722 0.2527 0.0080  0.0083  -0.0054 38  SER X OG  
7    N  N   . CYS A 3   ? 0.1815 0.2021 0.1919 -0.0086 0.0048  -0.0092 39  CYS X N   
8    C  CA  . CYS A 3   ? 0.1713 0.1815 0.1860 -0.0128 0.0066  -0.0043 39  CYS X CA  
9    C  C   . CYS A 3   ? 0.1808 0.1944 0.1863 -0.0086 0.0032  -0.0058 39  CYS X C   
10   O  O   . CYS A 3   ? 0.1905 0.2114 0.1803 -0.0057 0.0159  -0.0079 39  CYS X O   
11   C  CB  . CYS A 3   ? 0.1673 0.1893 0.1877 -0.0150 0.0005  -0.0047 39  CYS X CB  
12   S  SG  . CYS A 3   ? 0.1855 0.2179 0.1992 -0.0512 0.0235  -0.0059 39  CYS X SG  
13   N  N   . ARG A 4   ? 0.1914 0.2023 0.1902 -0.0123 0.0056  -0.0059 40  ARG X N   
14   C  CA  . ARG A 4   ? 0.2069 0.2132 0.2028 -0.0130 0.0096  -0.0078 40  ARG X CA  
15   C  C   . ARG A 4   ? 0.2129 0.2130 0.1941 -0.0146 0.0130  -0.0031 40  ARG X C   
16   O  O   . ARG A 4   ? 0.1946 0.2422 0.1885 -0.0078 0.0079  -0.0013 40  ARG X O   
17   C  CB  . ARG A 4   ? 0.2286 0.2401 0.2135 -0.0076 0.0148  -0.0087 40  ARG X CB  
18   C  CG  . ARG A 4   ? 0.2868 0.2842 0.2856 0.0048  -0.0009 -0.0037 40  ARG X CG  
19   C  CD  . ARG A 4   ? 0.3390 0.3690 0.3502 0.0004  0.0136  -0.0028 40  ARG X CD  
20   N  NE  . ARG A 4   ? 0.4219 0.4070 0.4187 -0.0119 0.0023  -0.0029 40  ARG X NE  
21   C  CZ  . ARG A 4   ? 0.4392 0.4639 0.4669 -0.0057 0.0024  -0.0026 40  ARG X CZ  
22   N  NH1 . ARG A 4   ? 0.4726 0.4767 0.4854 0.0059  0.0035  -0.0019 40  ARG X NH1 
23   N  NH2 . ARG A 4   ? 0.4519 0.4578 0.4719 -0.0020 0.0040  -0.0034 40  ARG X NH2 
24   N  N   . ARG A 5   ? 0.2155 0.2251 0.2103 -0.0186 0.0039  -0.0029 41  ARG X N   
25   C  CA  . ARG A 5   ? 0.2238 0.2350 0.2236 -0.0106 0.0015  -0.0022 41  ARG X CA  
26   C  C   . ARG A 5   ? 0.2321 0.2441 0.2274 -0.0165 -0.0004 -0.0022 41  ARG X C   
27   O  O   . ARG A 5   ? 0.2724 0.2899 0.2614 -0.0102 -0.0011 0.0011  41  ARG X O   
28   C  CB  . ARG A 5   ? 0.2324 0.2478 0.2407 -0.0129 -0.0028 -0.0062 41  ARG X CB  
29   C  CG  . ARG A 5   ? 0.2477 0.2726 0.2439 -0.0021 0.0044  0.0052  41  ARG X CG  
30   C  CD  . ARG A 5   ? 0.2658 0.2812 0.2713 -0.0084 -0.0071 0.0078  41  ARG X CD  
31   N  NE  . ARG A 5   ? 0.2705 0.3116 0.2743 -0.0085 -0.0016 0.0026  41  ARG X NE  
32   C  CZ  . ARG A 5   ? 0.2677 0.3185 0.2959 -0.0047 -0.0104 0.0014  41  ARG X CZ  
33   N  NH1 . ARG A 5   ? 0.2662 0.3334 0.2874 -0.0242 -0.0136 0.0145  41  ARG X NH1 
34   N  NH2 . ARG A 5   ? 0.3001 0.3544 0.3108 -0.0129 0.0045  -0.0067 41  ARG X NH2 
35   N  N   . ALA A 6   ? 0.2390 0.2611 0.2330 -0.0210 0.0062  -0.0058 42  ALA X N   
36   C  CA  . ALA A 6   ? 0.2468 0.2592 0.2437 -0.0148 0.0096  -0.0043 42  ALA X CA  
37   C  C   . ALA A 6   ? 0.2398 0.2573 0.2435 -0.0189 0.0039  0.0043  42  ALA X C   
38   O  O   . ALA A 6   ? 0.2407 0.2731 0.2568 -0.0301 0.0149  0.0166  42  ALA X O   
39   C  CB  . ALA A 6   ? 0.2548 0.2680 0.2464 -0.0100 0.0114  -0.0034 42  ALA X CB  
40   N  N   . PHE A 7   ? 0.2301 0.2583 0.2321 -0.0220 0.0087  -0.0033 43  PHE X N   
41   C  CA  . PHE A 7   ? 0.2286 0.2420 0.2165 -0.0170 0.0128  -0.0068 43  PHE X CA  
42   C  C   . PHE A 7   ? 0.2155 0.2397 0.2055 -0.0206 0.0144  -0.0032 43  PHE X C   
43   O  O   . PHE A 7   ? 0.2080 0.2765 0.1996 -0.0360 0.0378  -0.0083 43  PHE X O   
44   C  CB  . PHE A 7   ? 0.2280 0.2436 0.2227 -0.0210 0.0149  -0.0048 43  PHE X CB  
45   C  CG  . PHE A 7   ? 0.2477 0.2619 0.2280 -0.0141 0.0018  -0.0070 43  PHE X CG  
46   C  CD1 . PHE A 7   ? 0.2666 0.2784 0.2588 -0.0083 0.0050  -0.0080 43  PHE X CD1 
47   C  CD2 . PHE A 7   ? 0.2399 0.2640 0.2300 -0.0168 0.0012  -0.0133 43  PHE X CD2 
48   C  CE1 . PHE A 7   ? 0.2605 0.2833 0.2476 -0.0030 -0.0010 -0.0105 43  PHE X CE1 
49   C  CE2 . PHE A 7   ? 0.2468 0.2408 0.2399 -0.0144 0.0071  -0.0245 43  PHE X CE2 
50   C  CZ  . PHE A 7   ? 0.2569 0.2830 0.2519 -0.0043 0.0023  -0.0118 43  PHE X CZ  
51   N  N   . ASP A 8   ? 0.2203 0.2224 0.2019 -0.0214 0.0037  -0.0154 44  ASP X N   
52   C  CA  . ASP A 8   ? 0.2070 0.2142 0.1985 -0.0272 0.0138  -0.0018 44  ASP X CA  
53   C  C   . ASP A 8   ? 0.1832 0.1990 0.1931 -0.0262 0.0106  -0.0037 44  ASP X C   
54   O  O   . ASP A 8   ? 0.1932 0.1931 0.1769 -0.0372 0.0280  -0.0129 44  ASP X O   
55   C  CB  . ASP A 8   ? 0.2147 0.2072 0.1923 -0.0338 0.0102  -0.0011 44  ASP X CB  
56   C  CG  . ASP A 8   ? 0.2408 0.2149 0.2132 -0.0282 0.0072  -0.0085 44  ASP X CG  
57   O  OD1 . ASP A 8   ? 0.2720 0.2514 0.2362 -0.0371 0.0206  -0.0044 44  ASP X OD1 
58   O  OD2 . ASP A 8   ? 0.2363 0.1849 0.1963 -0.0679 0.0588  0.0035  44  ASP X OD2 
59   N  N   . LEU A 9   ? 0.1918 0.1990 0.1953 -0.0368 0.0115  -0.0077 45  LEU X N   
60   C  CA  . LEU A 9   ? 0.1808 0.1921 0.1787 -0.0299 0.0127  -0.0072 45  LEU X CA  
61   C  C   . LEU A 9   ? 0.1679 0.2050 0.1661 -0.0266 0.0098  -0.0091 45  LEU X C   
62   O  O   . LEU A 9   ? 0.1457 0.2450 0.1898 -0.0542 0.0298  -0.0053 45  LEU X O   
63   C  CB  . LEU A 9   ? 0.1890 0.2138 0.2001 -0.0222 -0.0008 -0.0089 45  LEU X CB  
64   C  CG  . LEU A 9   ? 0.2610 0.2741 0.2436 -0.0020 0.0104  -0.0115 45  LEU X CG  
65   C  CD1 . LEU A 9   ? 0.3049 0.2854 0.2838 0.0000  0.0035  -0.0051 45  LEU X CD1 
66   C  CD2 . LEU A 9   ? 0.2786 0.2949 0.2809 0.0041  -0.0061 -0.0003 45  LEU X CD2 
67   N  N   . TYR A 10  ? 0.1531 0.1815 0.1546 -0.0290 0.0232  -0.0222 46  TYR X N   
68   C  CA  . TYR A 10  ? 0.1686 0.1729 0.1482 -0.0198 0.0157  -0.0099 46  TYR X CA  
69   C  C   . TYR A 10  ? 0.1499 0.1674 0.1514 -0.0242 0.0108  -0.0099 46  TYR X C   
70   O  O   . TYR A 10  ? 0.1551 0.1963 0.1386 -0.0430 0.0018  -0.0047 46  TYR X O   
71   C  CB  . TYR A 10  ? 0.1563 0.1545 0.1487 -0.0322 0.0171  -0.0170 46  TYR X CB  
72   C  CG  . TYR A 10  ? 0.1893 0.1602 0.1613 -0.0234 0.0116  -0.0085 46  TYR X CG  
73   C  CD1 . TYR A 10  ? 0.2127 0.1726 0.1877 -0.0330 0.0207  -0.0144 46  TYR X CD1 
74   C  CD2 . TYR A 10  ? 0.2135 0.1741 0.1796 -0.0279 0.0154  -0.0195 46  TYR X CD2 
75   C  CE1 . TYR A 10  ? 0.2480 0.1715 0.2149 -0.0208 0.0135  -0.0011 46  TYR X CE1 
76   C  CE2 . TYR A 10  ? 0.2341 0.1907 0.1855 -0.0241 0.0324  -0.0008 46  TYR X CE2 
77   C  CZ  . TYR A 10  ? 0.2371 0.1786 0.2096 -0.0274 0.0162  -0.0064 46  TYR X CZ  
78   O  OH  . TYR A 10  ? 0.2801 0.1665 0.2532 -0.0492 0.0326  -0.0193 46  TYR X OH  
79   N  N   . PHE A 11  ? 0.1648 0.1670 0.1489 -0.0313 0.0102  -0.0154 47  PHE X N   
80   C  CA  . PHE A 11  ? 0.1583 0.1656 0.1504 -0.0188 0.0162  -0.0137 47  PHE X CA  
81   C  C   . PHE A 11  ? 0.1569 0.1627 0.1446 -0.0244 0.0174  -0.0250 47  PHE X C   
82   O  O   . PHE A 11  ? 0.1622 0.1772 0.1405 -0.0500 0.0206  -0.0362 47  PHE X O   
83   C  CB  . PHE A 11  ? 0.1799 0.1825 0.1580 -0.0120 0.0190  -0.0132 47  PHE X CB  
84   C  CG  . PHE A 11  ? 0.1508 0.1731 0.1593 -0.0089 0.0026  -0.0082 47  PHE X CG  
85   C  CD1 . PHE A 11  ? 0.1879 0.2018 0.1628 -0.0234 -0.0044 -0.0203 47  PHE X CD1 
86   C  CD2 . PHE A 11  ? 0.1759 0.1925 0.1743 -0.0054 -0.0016 -0.0155 47  PHE X CD2 
87   C  CE1 . PHE A 11  ? 0.1755 0.2282 0.2064 -0.0283 0.0006  -0.0195 47  PHE X CE1 
88   C  CE2 . PHE A 11  ? 0.1982 0.2051 0.1976 -0.0106 0.0011  -0.0194 47  PHE X CE2 
89   C  CZ  . PHE A 11  ? 0.2137 0.2199 0.2072 -0.0079 0.0187  0.0025  47  PHE X CZ  
90   N  N   . VAL A 12  ? 0.1294 0.1481 0.1252 -0.0190 0.0196  -0.0206 48  VAL X N   
91   C  CA  . VAL A 12  ? 0.1356 0.1374 0.1265 -0.0160 0.0090  -0.0152 48  VAL X CA  
92   C  C   . VAL A 12  ? 0.1416 0.1455 0.1274 -0.0204 0.0039  -0.0116 48  VAL X C   
93   O  O   . VAL A 12  ? 0.1356 0.1285 0.1140 -0.0387 0.0062  -0.0075 48  VAL X O   
94   C  CB  . VAL A 12  ? 0.1421 0.1254 0.1236 -0.0126 0.0136  -0.0140 48  VAL X CB  
95   C  CG1 . VAL A 12  ? 0.1272 0.1458 0.1558 -0.0140 0.0102  -0.0167 48  VAL X CG1 
96   C  CG2 . VAL A 12  ? 0.1512 0.1227 0.1307 -0.0075 0.0161  -0.0215 48  VAL X CG2 
97   N  N   . LEU A 13  ? 0.1248 0.1518 0.1219 -0.0285 0.0077  -0.0084 49  LEU X N   
98   C  CA  . LEU A 13  ? 0.1302 0.1533 0.1267 -0.0079 0.0032  -0.0106 49  LEU X CA  
99   C  C   . LEU A 13  ? 0.1245 0.1394 0.1299 -0.0176 0.0106  -0.0090 49  LEU X C   
100  O  O   . LEU A 13  ? 0.1304 0.1608 0.1283 -0.0263 0.0168  -0.0141 49  LEU X O   
101  C  CB  . LEU A 13  ? 0.1247 0.1705 0.1386 -0.0151 0.0042  -0.0067 49  LEU X CB  
102  C  CG  . LEU A 13  ? 0.1381 0.1811 0.1555 -0.0205 0.0102  -0.0016 49  LEU X CG  
103  C  CD1 . LEU A 13  ? 0.1662 0.2278 0.1932 -0.0130 -0.0022 -0.0088 49  LEU X CD1 
104  C  CD2 . LEU A 13  ? 0.1586 0.1768 0.1492 -0.0177 0.0242  0.0161  49  LEU X CD2 
105  N  N   . ASP A 14  ? 0.1111 0.1299 0.1142 -0.0145 0.0170  -0.0070 50  ASP X N   
106  C  CA  . ASP A 14  ? 0.1183 0.1416 0.1265 -0.0091 0.0139  0.0007  50  ASP X CA  
107  C  C   . ASP A 14  ? 0.1250 0.1389 0.1318 -0.0026 0.0112  0.0021  50  ASP X C   
108  O  O   . ASP A 14  ? 0.1304 0.1646 0.1325 0.0006  0.0203  0.0085  50  ASP X O   
109  C  CB  . ASP A 14  ? 0.1103 0.1382 0.1320 -0.0089 0.0142  0.0006  50  ASP X CB  
110  C  CG  . ASP A 14  ? 0.1137 0.1328 0.1165 -0.0034 0.0135  -0.0044 50  ASP X CG  
111  O  OD1 . ASP A 14  ? 0.1342 0.1380 0.1086 -0.0102 0.0147  -0.0115 50  ASP X OD1 
112  O  OD2 . ASP A 14  ? 0.1007 0.1449 0.1382 -0.0429 0.0181  -0.0051 50  ASP X OD2 
113  N  N   . LYS A 15  ? 0.1275 0.1483 0.1260 -0.0113 0.0092  0.0023  51  LYS X N   
114  C  CA  . LYS A 15  ? 0.1398 0.1667 0.1332 -0.0137 0.0088  0.0020  51  LYS X CA  
115  C  C   . LYS A 15  ? 0.1345 0.1818 0.1371 -0.0088 0.0028  0.0000  51  LYS X C   
116  O  O   . LYS A 15  ? 0.1425 0.2066 0.1380 -0.0180 0.0150  0.0020  51  LYS X O   
117  C  CB  . LYS A 15  ? 0.1174 0.1946 0.1461 -0.0181 0.0105  0.0044  51  LYS X CB  
118  C  CG  . LYS A 15  ? 0.1558 0.1914 0.1846 -0.0222 0.0041  0.0033  51  LYS X CG  
119  C  CD  . LYS A 15  ? 0.2215 0.2221 0.2197 -0.0201 -0.0040 -0.0092 51  LYS X CD  
120  C  CE  . LYS A 15  ? 0.2415 0.2632 0.2660 -0.0107 0.0017  -0.0086 51  LYS X CE  
121  N  NZ  . LYS A 15  ? 0.2924 0.3195 0.2984 -0.0243 -0.0106 -0.0301 51  LYS X NZ  
122  N  N   . SER A 16  ? 0.1274 0.1576 0.1191 -0.0139 0.0094  -0.0006 52  SER X N   
123  C  CA  . SER A 16  ? 0.1246 0.1331 0.1254 -0.0098 0.0097  0.0050  52  SER X CA  
124  C  C   . SER A 16  ? 0.1333 0.1444 0.1300 0.0108  0.0119  0.0094  52  SER X C   
125  O  O   . SER A 16  ? 0.1480 0.1580 0.1346 0.0158  0.0221  0.0102  52  SER X O   
126  C  CB  . SER A 16  ? 0.1300 0.1249 0.1078 -0.0041 0.0072  -0.0029 52  SER X CB  
127  O  OG  . SER A 16  ? 0.1258 0.1196 0.1209 -0.0126 0.0108  -0.0087 52  SER X OG  
128  N  N   . GLY A 17  ? 0.1409 0.1503 0.1453 0.0051  0.0158  0.0103  53  GLY X N   
129  C  CA  . GLY A 17  ? 0.1347 0.1549 0.1401 0.0075  0.0089  0.0101  53  GLY X CA  
130  C  C   . GLY A 17  ? 0.1397 0.1450 0.1444 0.0033  0.0074  0.0110  53  GLY X C   
131  O  O   . GLY A 17  ? 0.1693 0.1778 0.1631 0.0217  0.0038  0.0286  53  GLY X O   
132  N  N   . SER A 18  ? 0.1447 0.1306 0.1260 0.0126  0.0074  0.0097  54  SER X N   
133  C  CA  . SER A 18  ? 0.1417 0.1296 0.1310 -0.0043 0.0049  0.0131  54  SER X CA  
134  C  C   . SER A 18  ? 0.1567 0.1546 0.1451 0.0039  0.0026  0.0087  54  SER X C   
135  O  O   . SER A 18  ? 0.1409 0.1647 0.1616 0.0181  0.0147  0.0158  54  SER X O   
136  C  CB  . SER A 18  ? 0.1441 0.1187 0.1378 -0.0014 0.0070  0.0131  54  SER X CB  
137  O  OG  . SER A 18  ? 0.1248 0.1218 0.1262 0.0084  0.0308  0.0249  54  SER X OG  
138  N  N   . VAL A 19  ? 0.1638 0.1749 0.1739 0.0042  0.0079  0.0115  55  VAL X N   
139  C  CA  . VAL A 19  ? 0.1823 0.2010 0.1920 0.0084  0.0165  0.0063  55  VAL X CA  
140  C  C   . VAL A 19  ? 0.1991 0.2292 0.2129 0.0093  0.0105  0.0024  55  VAL X C   
141  O  O   . VAL A 19  ? 0.2024 0.2703 0.2478 0.0138  0.0092  0.0177  55  VAL X O   
142  C  CB  . VAL A 19  ? 0.1894 0.2110 0.2027 -0.0042 0.0071  0.0056  55  VAL X CB  
143  C  CG1 . VAL A 19  ? 0.1871 0.2118 0.1947 0.0128  0.0115  0.0126  55  VAL X CG1 
144  C  CG2 . VAL A 19  ? 0.2007 0.2229 0.2094 -0.0022 0.0163  0.0001  55  VAL X CG2 
145  N  N   . ALA A 20  ? 0.2179 0.2385 0.2166 0.0063  0.0123  0.0105  56  ALA X N   
146  C  CA  . ALA A 20  ? 0.2410 0.2595 0.2476 0.0047  0.0053  0.0014  56  ALA X CA  
147  C  C   . ALA A 20  ? 0.2615 0.2684 0.2635 0.0078  0.0010  0.0060  56  ALA X C   
148  O  O   . ALA A 20  ? 0.2788 0.2979 0.2885 0.0118  -0.0011 0.0102  56  ALA X O   
149  C  CB  . ALA A 20  ? 0.2447 0.2597 0.2374 0.0007  0.0043  0.0058  56  ALA X CB  
150  N  N   . ASN A 21  ? 0.2727 0.2804 0.2771 0.0049  0.0082  0.0089  57  ASN X N   
151  C  CA  . ASN A 21  ? 0.2871 0.2891 0.2952 0.0044  0.0052  0.0057  57  ASN X CA  
152  C  C   . ASN A 21  ? 0.2815 0.2858 0.2957 0.0040  0.0059  0.0056  57  ASN X C   
153  O  O   . ASN A 21  ? 0.2972 0.3065 0.3330 0.0133  0.0088  0.0216  57  ASN X O   
154  C  CB  . ASN A 21  ? 0.3028 0.3002 0.3104 0.0018  0.0033  0.0039  57  ASN X CB  
155  C  CG  . ASN A 21  ? 0.3436 0.3417 0.3348 0.0045  0.0077  0.0114  57  ASN X CG  
156  O  OD1 . ASN A 21  ? 0.3980 0.4106 0.4291 -0.0201 0.0074  0.0020  57  ASN X OD1 
157  N  ND2 . ASN A 21  ? 0.4061 0.3719 0.3847 0.0001  -0.0039 -0.0007 57  ASN X ND2 
158  N  N   . ASN A 22  ? 0.2563 0.2705 0.2812 0.0035  0.0049  0.0087  58  ASN X N   
159  C  CA  . ASN A 22  ? 0.2631 0.2727 0.2796 0.0062  0.0055  0.0031  58  ASN X CA  
160  C  C   . ASN A 22  ? 0.2404 0.2619 0.2572 0.0097  0.0027  0.0079  58  ASN X C   
161  O  O   . ASN A 22  ? 0.2211 0.2708 0.2474 0.0188  0.0061  0.0197  58  ASN X O   
162  C  CB  . ASN A 22  ? 0.2796 0.2784 0.2835 0.0056  0.0071  -0.0008 58  ASN X CB  
163  C  CG  . ASN A 22  ? 0.3296 0.3125 0.3360 -0.0100 0.0088  0.0002  58  ASN X CG  
164  O  OD1 . ASN A 22  ? 0.3879 0.3686 0.3756 -0.0167 0.0327  0.0040  58  ASN X OD1 
165  N  ND2 . ASN A 22  ? 0.3362 0.3297 0.3480 -0.0110 0.0142  -0.0048 58  ASN X ND2 
166  N  N   . TRP A 23  ? 0.2351 0.2604 0.2624 0.0121  0.0056  0.0051  59  TRP X N   
167  C  CA  . TRP A 23  ? 0.2312 0.2528 0.2469 0.0084  0.0034  0.0071  59  TRP X CA  
168  C  C   . TRP A 23  ? 0.2385 0.2633 0.2566 0.0035  0.0076  0.0080  59  TRP X C   
169  O  O   . TRP A 23  ? 0.2354 0.2685 0.2586 0.0106  0.0107  0.0241  59  TRP X O   
170  C  CB  . TRP A 23  ? 0.2381 0.2518 0.2526 0.0051  0.0000  0.0052  59  TRP X CB  
171  C  CG  . TRP A 23  ? 0.2043 0.2462 0.2254 0.0020  0.0023  0.0051  59  TRP X CG  
172  C  CD1 . TRP A 23  ? 0.2440 0.2746 0.2403 -0.0014 -0.0114 0.0051  59  TRP X CD1 
173  C  CD2 . TRP A 23  ? 0.1996 0.2375 0.2042 -0.0003 -0.0032 0.0056  59  TRP X CD2 
174  N  NE1 . TRP A 23  ? 0.2170 0.2655 0.2532 0.0003  -0.0193 0.0102  59  TRP X NE1 
175  C  CE2 . TRP A 23  ? 0.2167 0.2594 0.2333 -0.0005 -0.0105 0.0046  59  TRP X CE2 
176  C  CE3 . TRP A 23  ? 0.1804 0.2337 0.1944 0.0053  0.0067  -0.0064 59  TRP X CE3 
177  C  CZ2 . TRP A 23  ? 0.2030 0.2660 0.2378 -0.0045 -0.0048 0.0031  59  TRP X CZ2 
178  C  CZ3 . TRP A 23  ? 0.1959 0.2301 0.1971 0.0026  -0.0016 -0.0145 59  TRP X CZ3 
179  C  CH2 . TRP A 23  ? 0.2233 0.2379 0.2112 -0.0083 0.0011  0.0043  59  TRP X CH2 
180  N  N   . ILE A 24  ? 0.2567 0.2765 0.2693 0.0040  0.0079  0.0096  60  ILE X N   
181  C  CA  . ILE A 24  ? 0.2657 0.2848 0.2789 0.0048  0.0043  0.0077  60  ILE X CA  
182  C  C   . ILE A 24  ? 0.2608 0.2756 0.2742 0.0034  0.0057  0.0025  60  ILE X C   
183  O  O   . ILE A 24  ? 0.2365 0.2986 0.2747 0.0115  0.0072  0.0069  60  ILE X O   
184  C  CB  . ILE A 24  ? 0.2929 0.2913 0.2954 0.0049  0.0053  0.0048  60  ILE X CB  
185  C  CG1 . ILE A 24  ? 0.3050 0.3176 0.3067 0.0030  0.0015  0.0109  60  ILE X CG1 
186  C  CG2 . ILE A 24  ? 0.3089 0.3093 0.3103 -0.0008 0.0019  0.0068  60  ILE X CG2 
187  C  CD1 . ILE A 24  ? 0.3295 0.3317 0.3279 -0.0010 0.0043  0.0020  60  ILE X CD1 
188  N  N   . GLU A 25  ? 0.2547 0.2804 0.2636 0.0028  0.0065  0.0048  61  GLU X N   
189  C  CA  . GLU A 25  ? 0.2505 0.2753 0.2654 0.0049  0.0043  -0.0006 61  GLU X CA  
190  C  C   . GLU A 25  ? 0.2318 0.2577 0.2457 0.0039  0.0062  -0.0016 61  GLU X C   
191  O  O   . GLU A 25  ? 0.2032 0.2662 0.2503 0.0048  0.0141  0.0084  61  GLU X O   
192  C  CB  . GLU A 25  ? 0.2694 0.2852 0.2771 -0.0034 0.0046  -0.0012 61  GLU X CB  
193  C  CG  . GLU A 25  ? 0.3054 0.3056 0.3143 0.0098  0.0013  0.0005  61  GLU X CG  
194  C  CD  . GLU A 25  ? 0.3270 0.3359 0.3299 -0.0015 -0.0021 -0.0004 61  GLU X CD  
195  O  OE1 . GLU A 25  ? 0.3366 0.3264 0.3037 0.0101  0.0072  0.0134  61  GLU X OE1 
196  O  OE2 . GLU A 25  ? 0.3623 0.3511 0.3699 0.0058  -0.0056 -0.0101 61  GLU X OE2 
197  N  N   . ILE A 26  ? 0.2053 0.2478 0.2195 -0.0020 0.0067  -0.0032 62  ILE X N   
198  C  CA  . ILE A 26  ? 0.1950 0.2364 0.2086 -0.0011 0.0024  -0.0043 62  ILE X CA  
199  C  C   . ILE A 26  ? 0.1936 0.2449 0.2109 -0.0047 0.0002  0.0054  62  ILE X C   
200  O  O   . ILE A 26  ? 0.1261 0.2605 0.1960 0.0043  0.0016  0.0071  62  ILE X O   
201  C  CB  . ILE A 26  ? 0.2013 0.2332 0.2145 0.0028  0.0003  -0.0056 62  ILE X CB  
202  C  CG1 . ILE A 26  ? 0.1882 0.2121 0.1963 -0.0058 0.0137  0.0019  62  ILE X CG1 
203  C  CG2 . ILE A 26  ? 0.1778 0.2355 0.2232 0.0038  -0.0052 -0.0079 62  ILE X CG2 
204  C  CD1 . ILE A 26  ? 0.2172 0.2299 0.2234 0.0015  0.0118  -0.0128 62  ILE X CD1 
205  N  N   . TYR A 27  ? 0.1985 0.2474 0.2085 -0.0022 0.0008  0.0085  63  TYR X N   
206  C  CA  . TYR A 27  ? 0.2142 0.2476 0.2154 0.0003  -0.0003 0.0032  63  TYR X CA  
207  C  C   . TYR A 27  ? 0.2045 0.2440 0.2105 -0.0015 -0.0020 0.0025  63  TYR X C   
208  O  O   . TYR A 27  ? 0.1754 0.2888 0.1968 0.0047  -0.0037 0.0019  63  TYR X O   
209  C  CB  . TYR A 27  ? 0.2125 0.2585 0.2186 -0.0010 -0.0018 0.0053  63  TYR X CB  
210  C  CG  . TYR A 27  ? 0.2496 0.2769 0.2452 -0.0087 -0.0096 0.0000  63  TYR X CG  
211  C  CD1 . TYR A 27  ? 0.2370 0.2671 0.2263 -0.0150 -0.0052 0.0122  63  TYR X CD1 
212  C  CD2 . TYR A 27  ? 0.2640 0.3014 0.2796 -0.0049 -0.0021 0.0017  63  TYR X CD2 
213  C  CE1 . TYR A 27  ? 0.2534 0.2982 0.2734 -0.0110 -0.0038 0.0089  63  TYR X CE1 
214  C  CE2 . TYR A 27  ? 0.2511 0.3065 0.2809 -0.0027 -0.0131 -0.0014 63  TYR X CE2 
215  C  CZ  . TYR A 27  ? 0.2541 0.2971 0.2765 -0.0025 -0.0009 0.0100  63  TYR X CZ  
216  O  OH  . TYR A 27  ? 0.2636 0.3737 0.3472 -0.0184 -0.0230 0.0042  63  TYR X OH  
217  N  N   . ASN A 28  ? 0.1993 0.2540 0.2159 0.0049  0.0010  0.0051  64  ASN X N   
218  C  CA  . ASN A 28  ? 0.2187 0.2633 0.2377 0.0009  0.0015  -0.0023 64  ASN X CA  
219  C  C   . ASN A 28  ? 0.2119 0.2670 0.2334 -0.0043 0.0016  0.0006  64  ASN X C   
220  O  O   . ASN A 28  ? 0.1793 0.2990 0.2435 -0.0106 0.0089  -0.0057 64  ASN X O   
221  C  CB  . ASN A 28  ? 0.2350 0.2770 0.2582 -0.0040 0.0063  0.0014  64  ASN X CB  
222  C  CG  . ASN A 28  ? 0.2790 0.3133 0.2972 0.0071  -0.0051 0.0038  64  ASN X CG  
223  O  OD1 . ASN A 28  ? 0.3296 0.3616 0.3584 -0.0018 -0.0140 -0.0050 64  ASN X OD1 
224  N  ND2 . ASN A 28  ? 0.2988 0.3354 0.3195 0.0070  0.0058  0.0130  64  ASN X ND2 
225  N  N   . PHE A 29  ? 0.1904 0.2603 0.2311 0.0003  0.0049  0.0059  65  PHE X N   
226  C  CA  . PHE A 29  ? 0.1914 0.2417 0.2161 0.0026  0.0029  -0.0029 65  PHE X CA  
227  C  C   . PHE A 29  ? 0.1768 0.2448 0.2017 -0.0020 -0.0023 -0.0021 65  PHE X C   
228  O  O   . PHE A 29  ? 0.1477 0.2777 0.1885 -0.0080 0.0095  -0.0076 65  PHE X O   
229  C  CB  . PHE A 29  ? 0.2050 0.2567 0.2275 -0.0012 -0.0015 0.0003  65  PHE X CB  
230  C  CG  . PHE A 29  ? 0.1882 0.2425 0.2212 -0.0066 0.0055  -0.0030 65  PHE X CG  
231  C  CD1 . PHE A 29  ? 0.2098 0.2701 0.2349 -0.0073 0.0054  -0.0026 65  PHE X CD1 
232  C  CD2 . PHE A 29  ? 0.2002 0.2653 0.2293 -0.0001 0.0012  0.0000  65  PHE X CD2 
233  C  CE1 . PHE A 29  ? 0.1943 0.2582 0.2100 0.0016  0.0048  -0.0111 65  PHE X CE1 
234  C  CE2 . PHE A 29  ? 0.2241 0.2559 0.2434 0.0118  -0.0048 0.0008  65  PHE X CE2 
235  C  CZ  . PHE A 29  ? 0.2117 0.2674 0.2263 -0.0023 -0.0024 -0.0044 65  PHE X CZ  
236  N  N   . VAL A 30  ? 0.1766 0.2394 0.1912 -0.0001 0.0023  -0.0047 66  VAL X N   
237  C  CA  . VAL A 30  ? 0.1783 0.2296 0.1957 0.0033  0.0011  -0.0018 66  VAL X CA  
238  C  C   . VAL A 30  ? 0.1952 0.2461 0.2186 -0.0060 0.0008  0.0038  66  VAL X C   
239  O  O   . VAL A 30  ? 0.1886 0.2770 0.2019 -0.0119 0.0050  0.0023  66  VAL X O   
240  C  CB  . VAL A 30  ? 0.1958 0.2450 0.1989 -0.0002 0.0038  -0.0043 66  VAL X CB  
241  C  CG1 . VAL A 30  ? 0.1900 0.2453 0.1948 0.0102  0.0145  -0.0078 66  VAL X CG1 
242  C  CG2 . VAL A 30  ? 0.1969 0.2323 0.2153 -0.0030 0.0044  0.0001  66  VAL X CG2 
243  N  N   . GLN A 31  ? 0.1987 0.2597 0.2219 -0.0081 0.0060  0.0036  67  GLN X N   
244  C  CA  . GLN A 31  ? 0.2113 0.2586 0.2365 0.0000  -0.0026 0.0015  67  GLN X CA  
245  C  C   . GLN A 31  ? 0.2216 0.2630 0.2369 -0.0022 0.0018  0.0052  67  GLN X C   
246  O  O   . GLN A 31  ? 0.1895 0.2844 0.2271 -0.0040 0.0013  0.0004  67  GLN X O   
247  C  CB  . GLN A 31  ? 0.2170 0.2709 0.2397 0.0012  0.0049  -0.0001 67  GLN X CB  
248  C  CG  . GLN A 31  ? 0.2473 0.3105 0.2798 -0.0084 -0.0093 0.0057  67  GLN X CG  
249  C  CD  . GLN A 31  ? 0.3093 0.3248 0.3246 0.0047  -0.0034 -0.0088 67  GLN X CD  
250  O  OE1 . GLN A 31  ? 0.3158 0.3518 0.3718 -0.0069 -0.0008 0.0033  67  GLN X OE1 
251  N  NE2 . GLN A 31  ? 0.3351 0.3795 0.3733 -0.0097 0.0037  0.0074  67  GLN X NE2 
252  N  N   . GLN A 32  ? 0.2309 0.2696 0.2437 0.0031  0.0045  -0.0010 68  GLN X N   
253  C  CA  . GLN A 32  ? 0.2436 0.2791 0.2554 0.0040  0.0056  -0.0022 68  GLN X CA  
254  C  C   . GLN A 32  ? 0.2433 0.2856 0.2572 0.0044  0.0094  -0.0011 68  GLN X C   
255  O  O   . GLN A 32  ? 0.2278 0.3031 0.2331 -0.0046 0.0203  0.0047  68  GLN X O   
256  C  CB  . GLN A 32  ? 0.2730 0.2938 0.2709 0.0015  0.0081  -0.0042 68  GLN X CB  
257  C  CG  . GLN A 32  ? 0.2977 0.3241 0.3010 0.0138  0.0000  0.0025  68  GLN X CG  
258  C  CD  . GLN A 32  ? 0.3788 0.3698 0.3917 -0.0035 -0.0026 0.0016  68  GLN X CD  
259  O  OE1 . GLN A 32  ? 0.4510 0.4402 0.4241 0.0008  -0.0011 -0.0081 68  GLN X OE1 
260  N  NE2 . GLN A 32  ? 0.4269 0.4355 0.4257 -0.0005 0.0137  0.0078  68  GLN X NE2 
261  N  N   . LEU A 33  ? 0.2437 0.2840 0.2581 0.0056  0.0026  0.0036  69  LEU X N   
262  C  CA  . LEU A 33  ? 0.2566 0.2795 0.2625 0.0010  0.0033  0.0020  69  LEU X CA  
263  C  C   . LEU A 33  ? 0.2555 0.2793 0.2642 0.0042  0.0001  0.0036  69  LEU X C   
264  O  O   . LEU A 33  ? 0.2365 0.2866 0.2599 0.0019  -0.0025 0.0128  69  LEU X O   
265  C  CB  . LEU A 33  ? 0.2584 0.2812 0.2616 0.0105  0.0057  0.0004  69  LEU X CB  
266  C  CG  . LEU A 33  ? 0.2816 0.2910 0.2852 0.0054  -0.0036 0.0014  69  LEU X CG  
267  C  CD1 . LEU A 33  ? 0.2967 0.3102 0.2987 0.0042  0.0045  -0.0071 69  LEU X CD1 
268  C  CD2 . LEU A 33  ? 0.2613 0.2918 0.2581 -0.0016 0.0019  -0.0030 69  LEU X CD2 
269  N  N   . ALA A 34  ? 0.2682 0.2825 0.2734 0.0026  0.0066  -0.0028 70  ALA X N   
270  C  CA  . ALA A 34  ? 0.2825 0.2903 0.2856 0.0034  0.0019  -0.0027 70  ALA X CA  
271  C  C   . ALA A 34  ? 0.2866 0.3030 0.2951 -0.0027 0.0025  -0.0005 70  ALA X C   
272  O  O   . ALA A 34  ? 0.2712 0.3041 0.3185 -0.0047 0.0020  -0.0007 70  ALA X O   
273  C  CB  . ALA A 34  ? 0.2977 0.2932 0.2916 0.0012  0.0036  -0.0014 70  ALA X CB  
274  N  N   . GLU A 35  ? 0.2880 0.3128 0.2990 -0.0006 0.0015  -0.0026 71  GLU X N   
275  C  CA  . GLU A 35  ? 0.2965 0.3200 0.3076 -0.0017 0.0011  -0.0036 71  GLU X CA  
276  C  C   . GLU A 35  ? 0.2897 0.3154 0.3000 -0.0057 -0.0001 -0.0046 71  GLU X C   
277  O  O   . GLU A 35  ? 0.2864 0.3235 0.2981 -0.0122 0.0095  -0.0064 71  GLU X O   
278  C  CB  . GLU A 35  ? 0.3175 0.3281 0.3226 -0.0006 -0.0009 -0.0038 71  GLU X CB  
279  C  CG  . GLU A 35  ? 0.3525 0.3789 0.3705 0.0074  -0.0020 -0.0079 71  GLU X CG  
280  C  CD  . GLU A 35  ? 0.4409 0.4188 0.4226 0.0014  -0.0016 0.0090  71  GLU X CD  
281  O  OE1 . GLU A 35  ? 0.4515 0.4638 0.4352 -0.0029 -0.0035 0.0001  71  GLU X OE1 
282  O  OE2 . GLU A 35  ? 0.4808 0.4500 0.4586 0.0041  -0.0022 -0.0066 71  GLU X OE2 
283  N  N   . ARG A 36  ? 0.2742 0.3010 0.2860 -0.0033 0.0009  -0.0003 72  ARG X N   
284  C  CA  . ARG A 36  ? 0.2790 0.2982 0.2900 -0.0045 -0.0011 -0.0042 72  ARG X CA  
285  C  C   . ARG A 36  ? 0.2881 0.3033 0.2937 -0.0068 -0.0010 -0.0025 72  ARG X C   
286  O  O   . ARG A 36  ? 0.2801 0.2996 0.2874 -0.0129 0.0028  -0.0005 72  ARG X O   
287  C  CB  . ARG A 36  ? 0.2699 0.2981 0.2867 -0.0068 -0.0012 -0.0014 72  ARG X CB  
288  C  CG  . ARG A 36  ? 0.2619 0.2735 0.2806 -0.0144 0.0000  -0.0064 72  ARG X CG  
289  C  CD  . ARG A 36  ? 0.2756 0.2877 0.2918 0.0024  0.0005  -0.0024 72  ARG X CD  
290  N  NE  . ARG A 36  ? 0.2667 0.3166 0.2888 -0.0017 -0.0051 -0.0077 72  ARG X NE  
291  C  CZ  . ARG A 36  ? 0.2999 0.3176 0.3050 -0.0008 -0.0025 -0.0015 72  ARG X CZ  
292  N  NH1 . ARG A 36  ? 0.3066 0.3249 0.3104 -0.0070 0.0100  0.0010  72  ARG X NH1 
293  N  NH2 . ARG A 36  ? 0.2868 0.3418 0.3125 -0.0035 0.0007  0.0014  72  ARG X NH2 
294  N  N   . PHE A 37  ? 0.2997 0.3181 0.3056 -0.0009 -0.0003 -0.0038 73  PHE X N   
295  C  CA  . PHE A 37  ? 0.3231 0.3292 0.3315 -0.0019 -0.0002 -0.0017 73  PHE X CA  
296  C  C   . PHE A 37  ? 0.3491 0.3491 0.3481 -0.0016 0.0004  -0.0062 73  PHE X C   
297  O  O   . PHE A 37  ? 0.3359 0.3491 0.3508 -0.0096 0.0040  -0.0080 73  PHE X O   
298  C  CB  . PHE A 37  ? 0.3291 0.3313 0.3314 0.0005  0.0000  -0.0016 73  PHE X CB  
299  C  CG  . PHE A 37  ? 0.3431 0.3406 0.3424 -0.0003 -0.0011 -0.0048 73  PHE X CG  
300  C  CD1 . PHE A 37  ? 0.3563 0.3583 0.3502 -0.0004 -0.0029 0.0003  73  PHE X CD1 
301  C  CD2 . PHE A 37  ? 0.3425 0.3578 0.3475 -0.0018 -0.0001 -0.0029 73  PHE X CD2 
302  C  CE1 . PHE A 37  ? 0.3565 0.3477 0.3528 -0.0001 -0.0006 -0.0059 73  PHE X CE1 
303  C  CE2 . PHE A 37  ? 0.3482 0.3508 0.3509 0.0018  -0.0021 -0.0047 73  PHE X CE2 
304  C  CZ  . PHE A 37  ? 0.3503 0.3601 0.3528 -0.0029 -0.0012 0.0003  73  PHE X CZ  
305  N  N   . VAL A 38  ? 0.3706 0.3753 0.3788 -0.0031 0.0046  -0.0006 74  VAL X N   
306  C  CA  . VAL A 38  ? 0.3996 0.4008 0.4023 -0.0028 -0.0008 -0.0030 74  VAL X CA  
307  C  C   . VAL A 38  ? 0.4191 0.4186 0.4217 -0.0047 0.0010  0.0002  74  VAL X C   
308  O  O   . VAL A 38  ? 0.4286 0.4259 0.4361 -0.0071 0.0052  -0.0020 74  VAL X O   
309  C  CB  . VAL A 38  ? 0.4066 0.4047 0.4103 -0.0016 0.0006  -0.0011 74  VAL X CB  
310  C  CG1 . VAL A 38  ? 0.4261 0.4240 0.4285 -0.0012 -0.0043 -0.0032 74  VAL X CG1 
311  C  CG2 . VAL A 38  ? 0.4047 0.4046 0.4151 -0.0012 0.0000  -0.0015 74  VAL X CG2 
312  N  N   . SER A 39  ? 0.4332 0.4382 0.4345 -0.0023 0.0025  0.0009  75  SER X N   
313  C  CA  . SER A 39  ? 0.4446 0.4442 0.4469 -0.0024 0.0025  -0.0002 75  SER X CA  
314  C  C   . SER A 39  ? 0.4465 0.4459 0.4514 -0.0028 0.0025  0.0003  75  SER X C   
315  O  O   . SER A 39  ? 0.4497 0.4495 0.4547 -0.0066 0.0058  -0.0015 75  SER X O   
316  C  CB  . SER A 39  ? 0.4502 0.4530 0.4500 -0.0024 0.0023  0.0024  75  SER X CB  
317  O  OG  . SER A 39  ? 0.4709 0.4579 0.4648 0.0015  0.0100  -0.0027 75  SER X OG  
318  N  N   . PRO A 40  ? 0.4462 0.4494 0.4520 -0.0033 0.0008  -0.0026 76  PRO X N   
319  C  CA  . PRO A 40  ? 0.4433 0.4446 0.4501 -0.0034 -0.0002 0.0002  76  PRO X CA  
320  C  C   . PRO A 40  ? 0.4330 0.4370 0.4390 -0.0052 0.0008  -0.0023 76  PRO X C   
321  O  O   . PRO A 40  ? 0.4417 0.4408 0.4487 -0.0095 0.0022  -0.0069 76  PRO X O   
322  C  CB  . PRO A 40  ? 0.4431 0.4468 0.4549 -0.0043 0.0000  -0.0007 76  PRO X CB  
323  C  CG  . PRO A 40  ? 0.4469 0.4505 0.4567 -0.0014 -0.0001 -0.0028 76  PRO X CG  
324  C  CD  . PRO A 40  ? 0.4480 0.4497 0.4553 -0.0027 0.0020  -0.0010 76  PRO X CD  
325  N  N   . GLU A 41  ? 0.4213 0.4301 0.4310 -0.0058 -0.0004 0.0004  77  GLU X N   
326  C  CA  . GLU A 41  ? 0.4106 0.4159 0.4125 -0.0046 0.0015  0.0007  77  GLU X CA  
327  C  C   . GLU A 41  ? 0.3828 0.3891 0.3770 -0.0021 0.0024  0.0011  77  GLU X C   
328  O  O   . GLU A 41  ? 0.3658 0.3891 0.3630 -0.0071 0.0073  -0.0067 77  GLU X O   
329  C  CB  . GLU A 41  ? 0.4173 0.4320 0.4207 -0.0015 0.0039  -0.0020 77  GLU X CB  
330  C  CG  . GLU A 41  ? 0.4522 0.4486 0.4602 -0.0026 -0.0025 0.0037  77  GLU X CG  
331  C  CD  . GLU A 41  ? 0.4932 0.4962 0.4839 -0.0044 0.0046  0.0032  77  GLU X CD  
332  O  OE1 . GLU A 41  ? 0.5137 0.5117 0.5345 0.0003  0.0086  -0.0074 77  GLU X OE1 
333  O  OE2 . GLU A 41  ? 0.5170 0.5129 0.5221 0.0049  -0.0017 0.0087  77  GLU X OE2 
334  N  N   . MET A 42  ? 0.3510 0.3581 0.3541 -0.0029 0.0041  -0.0069 78  MET X N   
335  C  CA  . MET A 42  ? 0.3318 0.3388 0.3241 -0.0047 0.0061  -0.0062 78  MET X CA  
336  C  C   . MET A 42  ? 0.3075 0.3134 0.3060 -0.0062 0.0034  -0.0020 78  MET X C   
337  O  O   . MET A 42  ? 0.3282 0.3445 0.3223 -0.0065 0.0036  -0.0047 78  MET X O   
338  C  CB  . MET A 42  ? 0.3310 0.3410 0.3375 -0.0089 0.0038  0.0000  78  MET X CB  
339  C  CG  . MET A 42  ? 0.3594 0.3680 0.3552 -0.0075 0.0113  -0.0010 78  MET X CG  
340  S  SD  . MET A 42  ? 0.3711 0.4013 0.3825 -0.0322 0.0174  -0.0106 78  MET X SD  
341  C  CE  . MET A 42  ? 0.3802 0.3651 0.3754 -0.0088 0.0138  0.0033  78  MET X CE  
342  N  N   . ARG A 43  ? 0.2692 0.2774 0.2531 -0.0202 0.0132  -0.0095 79  ARG X N   
343  C  CA  . ARG A 43  ? 0.2367 0.2503 0.2378 -0.0245 0.0146  -0.0011 79  ARG X CA  
344  C  C   . ARG A 43  ? 0.2262 0.2417 0.2254 -0.0326 0.0081  -0.0020 79  ARG X C   
345  O  O   . ARG A 43  ? 0.2401 0.2560 0.2165 -0.0502 0.0222  -0.0120 79  ARG X O   
346  C  CB  . ARG A 43  ? 0.2225 0.2324 0.2257 -0.0266 0.0181  -0.0104 79  ARG X CB  
347  C  CG  . ARG A 43  ? 0.2355 0.2606 0.2620 -0.0239 0.0203  -0.0038 79  ARG X CG  
348  C  CD  . ARG A 43  ? 0.2729 0.2607 0.2696 -0.0227 0.0179  0.0015  79  ARG X CD  
349  N  NE  . ARG A 43  ? 0.2690 0.2528 0.2779 -0.0284 0.0182  0.0004  79  ARG X NE  
350  C  CZ  . ARG A 43  ? 0.2892 0.2805 0.2881 -0.0063 0.0134  0.0032  79  ARG X CZ  
351  N  NH1 . ARG A 43  ? 0.3385 0.3065 0.3303 -0.0206 -0.0055 -0.0127 79  ARG X NH1 
352  N  NH2 . ARG A 43  ? 0.2750 0.2647 0.2862 -0.0381 0.0176  -0.0009 79  ARG X NH2 
353  N  N   . LEU A 44  ? 0.2146 0.2261 0.2148 -0.0372 0.0128  -0.0079 80  LEU X N   
354  C  CA  . LEU A 44  ? 0.1963 0.2180 0.2064 -0.0279 0.0096  -0.0099 80  LEU X CA  
355  C  C   . LEU A 44  ? 0.2002 0.2218 0.2170 -0.0251 0.0099  -0.0181 80  LEU X C   
356  O  O   . LEU A 44  ? 0.2145 0.2382 0.2264 -0.0389 0.0250  -0.0254 80  LEU X O   
357  C  CB  . LEU A 44  ? 0.1965 0.2185 0.2163 -0.0276 0.0060  -0.0142 80  LEU X CB  
358  C  CG  . LEU A 44  ? 0.1971 0.2286 0.2300 -0.0167 0.0057  -0.0094 80  LEU X CG  
359  C  CD1 . LEU A 44  ? 0.2330 0.2329 0.2437 -0.0149 0.0041  -0.0116 80  LEU X CD1 
360  C  CD2 . LEU A 44  ? 0.2285 0.2709 0.2442 -0.0139 0.0059  -0.0021 80  LEU X CD2 
361  N  N   . SER A 45  ? 0.1922 0.2042 0.2004 -0.0342 0.0166  -0.0261 81  SER X N   
362  C  CA  . SER A 45  ? 0.1925 0.1979 0.1863 -0.0321 0.0153  -0.0212 81  SER X CA  
363  C  C   . SER A 45  ? 0.1986 0.2207 0.1962 -0.0339 0.0181  -0.0138 81  SER X C   
364  O  O   . SER A 45  ? 0.2003 0.2546 0.1757 -0.0448 0.0253  -0.0278 81  SER X O   
365  C  CB  . SER A 45  ? 0.1895 0.1943 0.1862 -0.0342 0.0185  -0.0216 81  SER X CB  
366  O  OG  . SER A 45  ? 0.2120 0.2015 0.1966 -0.0468 0.0382  -0.0393 81  SER X OG  
367  N  N   . PHE A 46  ? 0.1855 0.2130 0.1738 -0.0411 0.0111  -0.0095 82  PHE X N   
368  C  CA  . PHE A 46  ? 0.1788 0.1969 0.1929 -0.0223 0.0102  -0.0094 82  PHE X CA  
369  C  C   . PHE A 46  ? 0.1879 0.2008 0.1834 -0.0250 0.0124  -0.0221 82  PHE X C   
370  O  O   . PHE A 46  ? 0.1919 0.1994 0.1869 -0.0423 0.0336  -0.0385 82  PHE X O   
371  C  CB  . PHE A 46  ? 0.1792 0.2072 0.1901 -0.0245 0.0091  -0.0118 82  PHE X CB  
372  C  CG  . PHE A 46  ? 0.1814 0.2309 0.1904 -0.0224 0.0072  -0.0102 82  PHE X CG  
373  C  CD1 . PHE A 46  ? 0.1948 0.2312 0.2024 -0.0275 0.0013  -0.0200 82  PHE X CD1 
374  C  CD2 . PHE A 46  ? 0.2163 0.2558 0.2089 -0.0107 -0.0087 -0.0140 82  PHE X CD2 
375  C  CE1 . PHE A 46  ? 0.2246 0.2699 0.2203 0.0021  -0.0032 -0.0077 82  PHE X CE1 
376  C  CE2 . PHE A 46  ? 0.2198 0.2623 0.2247 -0.0188 -0.0101 -0.0131 82  PHE X CE2 
377  C  CZ  . PHE A 46  ? 0.1989 0.2699 0.2234 -0.0084 0.0134  -0.0052 82  PHE X CZ  
378  N  N   . ILE A 47  ? 0.1816 0.1851 0.1793 -0.0258 0.0062  -0.0174 83  ILE X N   
379  C  CA  . ILE A 47  ? 0.1832 0.1749 0.1786 -0.0221 0.0122  -0.0126 83  ILE X CA  
380  C  C   . ILE A 47  ? 0.1756 0.1787 0.1751 -0.0205 0.0175  -0.0103 83  ILE X C   
381  O  O   . ILE A 47  ? 0.1651 0.2104 0.1571 -0.0476 0.0281  -0.0201 83  ILE X O   
382  C  CB  . ILE A 47  ? 0.1805 0.1706 0.1841 -0.0160 0.0108  -0.0067 83  ILE X CB  
383  C  CG1 . ILE A 47  ? 0.2014 0.1694 0.1969 -0.0157 0.0108  -0.0129 83  ILE X CG1 
384  C  CG2 . ILE A 47  ? 0.1818 0.1937 0.1891 -0.0209 -0.0018 -0.0200 83  ILE X CG2 
385  C  CD1 . ILE A 47  ? 0.2349 0.1906 0.2143 -0.0234 0.0103  -0.0006 83  ILE X CD1 
386  N  N   . VAL A 48  ? 0.1607 0.1740 0.1561 -0.0361 0.0123  -0.0126 84  VAL X N   
387  C  CA  . VAL A 48  ? 0.1647 0.1757 0.1675 -0.0209 0.0063  -0.0072 84  VAL X CA  
388  C  C   . VAL A 48  ? 0.1581 0.1666 0.1626 -0.0184 0.0105  -0.0041 84  VAL X C   
389  O  O   . VAL A 48  ? 0.1458 0.1971 0.1558 -0.0329 0.0226  -0.0198 84  VAL X O   
390  C  CB  . VAL A 48  ? 0.1626 0.1714 0.1647 -0.0135 0.0027  -0.0013 84  VAL X CB  
391  C  CG1 . VAL A 48  ? 0.1567 0.1971 0.1542 -0.0169 -0.0097 -0.0052 84  VAL X CG1 
392  C  CG2 . VAL A 48  ? 0.1612 0.2036 0.1782 -0.0159 0.0094  -0.0134 84  VAL X CG2 
393  N  N   . PHE A 49  ? 0.1403 0.1484 0.1419 -0.0159 0.0105  -0.0154 85  PHE X N   
394  C  CA  . PHE A 49  ? 0.1339 0.1331 0.1379 -0.0112 0.0060  -0.0063 85  PHE X CA  
395  C  C   . PHE A 49  ? 0.1333 0.1397 0.1437 -0.0093 0.0078  -0.0073 85  PHE X C   
396  O  O   . PHE A 49  ? 0.1331 0.1370 0.1428 -0.0161 0.0208  -0.0052 85  PHE X O   
397  C  CB  . PHE A 49  ? 0.1405 0.1384 0.1440 -0.0107 0.0062  -0.0078 85  PHE X CB  
398  C  CG  . PHE A 49  ? 0.1463 0.1232 0.1401 -0.0089 0.0104  -0.0056 85  PHE X CG  
399  C  CD1 . PHE A 49  ? 0.1431 0.1681 0.1390 -0.0115 0.0036  -0.0022 85  PHE X CD1 
400  C  CD2 . PHE A 49  ? 0.1740 0.1436 0.1424 0.0000  0.0125  -0.0077 85  PHE X CD2 
401  C  CE1 . PHE A 49  ? 0.1473 0.1638 0.1637 -0.0069 -0.0011 0.0032  85  PHE X CE1 
402  C  CE2 . PHE A 49  ? 0.1177 0.1402 0.1307 -0.0122 -0.0047 -0.0030 85  PHE X CE2 
403  C  CZ  . PHE A 49  ? 0.1464 0.1317 0.1491 -0.0202 -0.0050 -0.0047 85  PHE X CZ  
404  N  N   . SER A 50  ? 0.1273 0.1402 0.1426 -0.0139 0.0205  -0.0116 86  SER X N   
405  C  CA  . SER A 50  ? 0.1349 0.1428 0.1442 -0.0140 0.0110  -0.0066 86  SER X CA  
406  C  C   . SER A 50  ? 0.1367 0.1394 0.1403 -0.0110 0.0064  -0.0022 86  SER X C   
407  O  O   . SER A 50  ? 0.1285 0.1438 0.1433 -0.0190 0.0160  0.0037  86  SER X O   
408  C  CB  . SER A 50  ? 0.1477 0.1567 0.1637 -0.0084 0.0086  -0.0019 86  SER X CB  
409  O  OG  . SER A 50  ? 0.1843 0.2051 0.1858 0.0038  0.0031  -0.0245 86  SER X OG  
410  N  N   . SER A 51  ? 0.1518 0.1532 0.1497 -0.0084 0.0090  -0.0070 87  SER X N   
411  C  CA  . SER A 51  ? 0.1694 0.1653 0.1663 -0.0014 0.0086  0.0005  87  SER X CA  
412  C  C   . SER A 51  ? 0.1853 0.1777 0.1904 -0.0032 0.0092  -0.0030 87  SER X C   
413  O  O   . SER A 51  ? 0.2017 0.1948 0.1861 -0.0050 0.0232  -0.0099 87  SER X O   
414  C  CB  . SER A 51  ? 0.1862 0.1646 0.1801 -0.0077 0.0170  -0.0011 87  SER X CB  
415  O  OG  . SER A 51  ? 0.2077 0.1902 0.1637 -0.0107 0.0294  0.0052  87  SER X OG  
416  N  N   . GLN A 52  ? 0.2001 0.1892 0.2163 -0.0041 0.0162  0.0016  88  GLN X N   
417  C  CA  . GLN A 52  ? 0.2126 0.2084 0.2293 -0.0068 0.0169  -0.0022 88  GLN X CA  
418  C  C   . GLN A 52  ? 0.2227 0.2055 0.2437 -0.0017 0.0220  0.0018  88  GLN X C   
419  O  O   . GLN A 52  ? 0.2273 0.2143 0.2926 -0.0025 0.0376  -0.0027 88  GLN X O   
420  C  CB  . GLN A 52  ? 0.2148 0.1957 0.2324 -0.0129 0.0205  -0.0063 88  GLN X CB  
421  C  CG  . GLN A 52  ? 0.2296 0.2422 0.2588 0.0051  0.0106  -0.0114 88  GLN X CG  
422  C  CD  . GLN A 52  ? 0.2769 0.2662 0.3100 -0.0076 -0.0039 0.0033  88  GLN X CD  
423  O  OE1 . GLN A 52  ? 0.2771 0.2703 0.3158 -0.0084 0.0149  -0.0044 88  GLN X OE1 
424  N  NE2 . GLN A 52  ? 0.3265 0.3039 0.3597 0.0105  -0.0077 0.0140  88  GLN X NE2 
425  N  N   . ALA A 53  ? 0.2101 0.1867 0.2195 -0.0136 0.0195  -0.0104 89  ALA X N   
426  C  CA  . ALA A 53  ? 0.1949 0.1849 0.2057 -0.0116 0.0120  -0.0080 89  ALA X CA  
427  C  C   . ALA A 53  ? 0.2112 0.1891 0.2112 -0.0142 0.0149  -0.0029 89  ALA X C   
428  O  O   . ALA A 53  ? 0.2342 0.2097 0.2215 -0.0177 0.0452  -0.0129 89  ALA X O   
429  C  CB  . ALA A 53  ? 0.2082 0.1722 0.2097 -0.0172 0.0114  -0.0011 89  ALA X CB  
430  N  N   . THR A 54  ? 0.2057 0.1983 0.2085 -0.0202 0.0108  -0.0087 90  THR X N   
431  C  CA  . THR A 54  ? 0.2266 0.2286 0.2376 -0.0154 0.0104  -0.0086 90  THR X CA  
432  C  C   . THR A 54  ? 0.2346 0.2291 0.2340 -0.0119 0.0154  -0.0095 90  THR X C   
433  O  O   . THR A 54  ? 0.2050 0.2108 0.2187 -0.0391 0.0181  -0.0182 90  THR X O   
434  C  CB  . THR A 54  ? 0.2396 0.2522 0.2515 -0.0073 0.0015  -0.0102 90  THR X CB  
435  O  OG1 . THR A 54  ? 0.3017 0.2842 0.3328 -0.0088 -0.0051 -0.0043 90  THR X OG1 
436  C  CG2 . THR A 54  ? 0.2626 0.2961 0.2501 -0.0153 0.0094  0.0019  90  THR X CG2 
437  N  N   . ILE A 55  ? 0.2509 0.2442 0.2452 -0.0192 0.0077  -0.0170 91  ILE X N   
438  C  CA  . ILE A 55  ? 0.2614 0.2590 0.2538 -0.0067 0.0112  -0.0137 91  ILE X CA  
439  C  C   . ILE A 55  ? 0.2566 0.2591 0.2464 -0.0129 0.0103  -0.0160 91  ILE X C   
440  O  O   . ILE A 55  ? 0.2906 0.2863 0.2766 -0.0294 -0.0051 -0.0348 91  ILE X O   
441  C  CB  . ILE A 55  ? 0.2680 0.2508 0.2525 -0.0047 0.0094  -0.0197 91  ILE X CB  
442  C  CG1 . ILE A 55  ? 0.2641 0.2600 0.2586 -0.0083 0.0154  -0.0025 91  ILE X CG1 
443  C  CG2 . ILE A 55  ? 0.2752 0.2733 0.2765 -0.0139 0.0066  -0.0198 91  ILE X CG2 
444  C  CD1 . ILE A 55  ? 0.2670 0.2590 0.2687 -0.0011 0.0068  -0.0161 91  ILE X CD1 
445  N  N   . ILE A 56  ? 0.2476 0.2659 0.2509 -0.0207 0.0098  -0.0079 92  ILE X N   
446  C  CA  . ILE A 56  ? 0.2508 0.2681 0.2420 -0.0158 0.0088  -0.0081 92  ILE X CA  
447  C  C   . ILE A 56  ? 0.2432 0.2714 0.2372 -0.0240 0.0017  -0.0147 92  ILE X C   
448  O  O   . ILE A 56  ? 0.2491 0.2899 0.2331 -0.0418 -0.0070 -0.0250 92  ILE X O   
449  C  CB  . ILE A 56  ? 0.2526 0.2748 0.2572 -0.0113 0.0102  -0.0017 92  ILE X CB  
450  C  CG1 . ILE A 56  ? 0.2496 0.2787 0.2710 -0.0135 0.0098  0.0027  92  ILE X CG1 
451  C  CG2 . ILE A 56  ? 0.2685 0.2908 0.2736 -0.0076 0.0039  -0.0074 92  ILE X CG2 
452  C  CD1 . ILE A 56  ? 0.2924 0.3072 0.2944 -0.0123 -0.0003 -0.0052 92  ILE X CD1 
453  N  N   . LEU A 57  ? 0.2348 0.2676 0.2295 -0.0294 0.0049  -0.0134 93  LEU X N   
454  C  CA  . LEU A 57  ? 0.2347 0.2489 0.2415 -0.0221 0.0047  -0.0105 93  LEU X CA  
455  C  C   . LEU A 57  ? 0.2270 0.2468 0.2294 -0.0257 0.0064  -0.0123 93  LEU X C   
456  O  O   . LEU A 57  ? 0.1944 0.2341 0.2307 -0.0667 0.0128  -0.0310 93  LEU X O   
457  C  CB  . LEU A 57  ? 0.2359 0.2575 0.2340 -0.0200 0.0036  -0.0072 93  LEU X CB  
458  C  CG  . LEU A 57  ? 0.2385 0.2566 0.2523 -0.0167 0.0078  -0.0038 93  LEU X CG  
459  C  CD1 . LEU A 57  ? 0.2592 0.2704 0.2671 -0.0190 -0.0021 -0.0047 93  LEU X CD1 
460  C  CD2 . LEU A 57  ? 0.2480 0.2743 0.2564 -0.0114 0.0087  -0.0077 93  LEU X CD2 
461  N  N   . PRO A 58  ? 0.2433 0.2407 0.2319 -0.0267 0.0044  -0.0231 94  PRO X N   
462  C  CA  . PRO A 58  ? 0.2391 0.2352 0.2338 -0.0174 0.0036  -0.0190 94  PRO X CA  
463  C  C   . PRO A 58  ? 0.2343 0.2334 0.2347 -0.0129 0.0083  -0.0177 94  PRO X C   
464  O  O   . PRO A 58  ? 0.2433 0.2345 0.2198 -0.0275 0.0268  -0.0179 94  PRO X O   
465  C  CB  . PRO A 58  ? 0.2491 0.2419 0.2468 -0.0228 0.0028  -0.0156 94  PRO X CB  
466  C  CG  . PRO A 58  ? 0.2469 0.2398 0.2313 -0.0221 0.0018  -0.0177 94  PRO X CG  
467  C  CD  . PRO A 58  ? 0.2392 0.2468 0.2262 -0.0188 0.0026  -0.0226 94  PRO X CD  
468  N  N   . LEU A 59  ? 0.2328 0.2273 0.2435 -0.0161 0.0145  -0.0065 95  LEU X N   
469  C  CA  . LEU A 59  ? 0.2350 0.2360 0.2422 -0.0181 0.0100  -0.0121 95  LEU X CA  
470  C  C   . LEU A 59  ? 0.2366 0.2442 0.2546 -0.0196 0.0071  -0.0097 95  LEU X C   
471  O  O   . LEU A 59  ? 0.2924 0.2721 0.2807 -0.0300 0.0182  -0.0157 95  LEU X O   
472  C  CB  . LEU A 59  ? 0.2169 0.2296 0.2417 -0.0250 0.0093  -0.0120 95  LEU X CB  
473  C  CG  . LEU A 59  ? 0.2361 0.2384 0.2380 -0.0210 0.0087  -0.0123 95  LEU X CG  
474  C  CD1 . LEU A 59  ? 0.2371 0.2389 0.2389 -0.0159 0.0076  -0.0117 95  LEU X CD1 
475  C  CD2 . LEU A 59  ? 0.2289 0.2245 0.2449 -0.0226 0.0092  -0.0184 95  LEU X CD2 
476  N  N   . THR A 60  ? 0.2340 0.2569 0.2593 -0.0279 0.0064  -0.0163 96  THR X N   
477  C  CA  . THR A 60  ? 0.2329 0.2640 0.2662 -0.0227 0.0070  -0.0079 96  THR X CA  
478  C  C   . THR A 60  ? 0.2605 0.2648 0.2714 -0.0183 0.0143  -0.0066 96  THR X C   
479  O  O   . THR A 60  ? 0.2189 0.2596 0.2585 -0.0388 0.0201  -0.0385 96  THR X O   
480  C  CB  . THR A 60  ? 0.2266 0.2572 0.2614 -0.0211 0.0029  -0.0121 96  THR X CB  
481  O  OG1 . THR A 60  ? 0.2248 0.2953 0.2621 -0.0493 0.0070  -0.0308 96  THR X OG1 
482  C  CG2 . THR A 60  ? 0.2212 0.2647 0.2458 -0.0138 -0.0004 -0.0130 96  THR X CG2 
483  N  N   . GLY A 61  ? 0.2588 0.2874 0.2837 -0.0218 0.0025  -0.0131 97  GLY X N   
484  C  CA  . GLY A 61  ? 0.2872 0.2907 0.2912 -0.0077 0.0015  -0.0080 97  GLY X CA  
485  C  C   . GLY A 61  ? 0.2869 0.3010 0.3058 -0.0111 0.0015  -0.0082 97  GLY X C   
486  O  O   . GLY A 61  ? 0.2774 0.3194 0.3215 -0.0172 -0.0010 -0.0117 97  GLY X O   
487  N  N   . ASP A 62  ? 0.2939 0.3079 0.3062 -0.0165 0.0103  -0.0057 98  ASP X N   
488  C  CA  . ASP A 62  ? 0.3035 0.3187 0.3055 -0.0089 0.0079  -0.0043 98  ASP X CA  
489  C  C   . ASP A 62  ? 0.3060 0.3234 0.3145 -0.0115 0.0031  -0.0029 98  ASP X C   
490  O  O   . ASP A 62  ? 0.2953 0.3251 0.2945 -0.0284 0.0170  -0.0048 98  ASP X O   
491  C  CB  . ASP A 62  ? 0.3061 0.3141 0.3151 -0.0150 0.0088  -0.0027 98  ASP X CB  
492  C  CG  . ASP A 62  ? 0.3032 0.3199 0.3027 -0.0226 0.0030  -0.0026 98  ASP X CG  
493  O  OD1 . ASP A 62  ? 0.3013 0.3456 0.3334 -0.0216 0.0177  -0.0012 98  ASP X OD1 
494  O  OD2 . ASP A 62  ? 0.2514 0.2631 0.3136 -0.0624 -0.0107 -0.0102 98  ASP X OD2 
495  N  N   . ARG A 63  ? 0.3273 0.3316 0.3281 -0.0076 0.0119  -0.0032 99  ARG X N   
496  C  CA  . ARG A 63  ? 0.3456 0.3437 0.3462 -0.0060 0.0031  -0.0008 99  ARG X CA  
497  C  C   . ARG A 63  ? 0.3388 0.3306 0.3350 -0.0093 0.0044  -0.0023 99  ARG X C   
498  O  O   . ARG A 63  ? 0.3281 0.3359 0.3365 -0.0127 0.0076  0.0000  99  ARG X O   
499  C  CB  . ARG A 63  ? 0.3598 0.3581 0.3635 -0.0012 0.0044  0.0009  99  ARG X CB  
500  C  CG  . ARG A 63  ? 0.3894 0.3915 0.3872 -0.0033 0.0017  -0.0053 99  ARG X CG  
501  C  CD  . ARG A 63  ? 0.3943 0.3991 0.4044 -0.0029 0.0012  0.0000  99  ARG X CD  
502  N  NE  . ARG A 63  ? 0.4119 0.4303 0.4156 0.0013  -0.0015 -0.0051 99  ARG X NE  
503  C  CZ  . ARG A 63  ? 0.4286 0.4342 0.4270 -0.0025 -0.0014 -0.0001 99  ARG X CZ  
504  N  NH1 . ARG A 63  ? 0.4469 0.4434 0.4388 -0.0034 0.0031  0.0014  99  ARG X NH1 
505  N  NH2 . ARG A 63  ? 0.4291 0.4235 0.4166 -0.0015 -0.0017 -0.0055 99  ARG X NH2 
506  N  N   . GLY A 64  ? 0.3149 0.3212 0.3206 -0.0107 0.0067  -0.0002 100 GLY X N   
507  C  CA  . GLY A 64  ? 0.2940 0.3101 0.3116 -0.0105 0.0012  -0.0041 100 GLY X CA  
508  C  C   . GLY A 64  ? 0.2865 0.2969 0.2938 -0.0110 -0.0023 -0.0060 100 GLY X C   
509  O  O   . GLY A 64  ? 0.2625 0.3143 0.2976 -0.0225 -0.0061 -0.0089 100 GLY X O   
510  N  N   . LYS A 65  ? 0.2651 0.2900 0.2886 -0.0113 -0.0002 -0.0094 101 LYS X N   
511  C  CA  . LYS A 65  ? 0.2703 0.2858 0.2809 -0.0131 0.0020  -0.0087 101 LYS X CA  
512  C  C   . LYS A 65  ? 0.2731 0.2813 0.2729 -0.0184 0.0088  -0.0068 101 LYS X C   
513  O  O   . LYS A 65  ? 0.2397 0.2913 0.2822 -0.0399 0.0084  -0.0140 101 LYS X O   
514  C  CB  . LYS A 65  ? 0.2667 0.2787 0.2735 -0.0130 0.0051  -0.0087 101 LYS X CB  
515  C  CG  . LYS A 65  ? 0.2799 0.2919 0.2890 -0.0118 -0.0022 -0.0157 101 LYS X CG  
516  C  CD  . LYS A 65  ? 0.2967 0.3158 0.3050 -0.0088 0.0006  -0.0046 101 LYS X CD  
517  C  CE  . LYS A 65  ? 0.3466 0.3335 0.3464 0.0024  -0.0003 -0.0062 101 LYS X CE  
518  N  NZ  . LYS A 65  ? 0.3507 0.3424 0.3409 -0.0068 0.0031  0.0036  101 LYS X NZ  
519  N  N   . ILE A 66  ? 0.2748 0.2773 0.2805 -0.0212 0.0086  -0.0101 102 ILE X N   
520  C  CA  . ILE A 66  ? 0.2667 0.2769 0.2716 -0.0184 0.0054  -0.0093 102 ILE X CA  
521  C  C   . ILE A 66  ? 0.2749 0.2908 0.2798 -0.0136 0.0023  -0.0055 102 ILE X C   
522  O  O   . ILE A 66  ? 0.2515 0.2870 0.2509 -0.0367 -0.0020 -0.0227 102 ILE X O   
523  C  CB  . ILE A 66  ? 0.2664 0.2688 0.2683 -0.0178 0.0089  -0.0067 102 ILE X CB  
524  C  CG1 . ILE A 66  ? 0.2195 0.2563 0.2437 -0.0258 0.0156  -0.0111 102 ILE X CG1 
525  C  CG2 . ILE A 66  ? 0.2722 0.2684 0.2646 -0.0181 0.0035  -0.0061 102 ILE X CG2 
526  C  CD1 . ILE A 66  ? 0.2512 0.2780 0.2594 -0.0178 0.0170  -0.0099 102 ILE X CD1 
527  N  N   . SER A 67  ? 0.2787 0.2978 0.2874 -0.0154 -0.0021 -0.0073 103 SER X N   
528  C  CA  . SER A 67  ? 0.2938 0.3174 0.3076 -0.0078 -0.0016 -0.0023 103 SER X CA  
529  C  C   . SER A 67  ? 0.2968 0.3145 0.2982 -0.0102 -0.0048 -0.0016 103 SER X C   
530  O  O   . SER A 67  ? 0.2792 0.3319 0.2938 -0.0254 -0.0147 -0.0038 103 SER X O   
531  C  CB  . SER A 67  ? 0.2898 0.3311 0.3169 -0.0072 -0.0019 -0.0024 103 SER X CB  
532  O  OG  . SER A 67  ? 0.3622 0.3643 0.3773 -0.0061 0.0020  0.0030  103 SER X OG  
533  N  N   . LYS A 68  ? 0.2896 0.3186 0.2986 -0.0078 0.0012  -0.0006 104 LYS X N   
534  C  CA  . LYS A 68  ? 0.2937 0.3182 0.3037 -0.0065 0.0022  -0.0047 104 LYS X CA  
535  C  C   . LYS A 68  ? 0.2801 0.3087 0.2844 -0.0100 -0.0026 -0.0017 104 LYS X C   
536  O  O   . LYS A 68  ? 0.2657 0.3150 0.2755 -0.0176 0.0009  -0.0135 104 LYS X O   
537  C  CB  . LYS A 68  ? 0.3049 0.3244 0.3170 -0.0060 0.0037  -0.0015 104 LYS X CB  
538  C  CG  . LYS A 68  ? 0.3332 0.3468 0.3335 -0.0021 0.0037  -0.0091 104 LYS X CG  
539  C  CD  . LYS A 68  ? 0.3673 0.3694 0.3669 0.0041  -0.0059 -0.0009 104 LYS X CD  
540  C  CE  . LYS A 68  ? 0.3819 0.3859 0.3747 0.0029  0.0013  -0.0052 104 LYS X CE  
541  N  NZ  . LYS A 68  ? 0.3981 0.3894 0.3898 0.0036  -0.0046 -0.0062 104 LYS X NZ  
542  N  N   . GLY A 69  ? 0.2679 0.3073 0.2803 -0.0122 0.0001  -0.0034 105 GLY X N   
543  C  CA  . GLY A 69  ? 0.2579 0.2922 0.2665 -0.0117 -0.0007 -0.0033 105 GLY X CA  
544  C  C   . GLY A 69  ? 0.2614 0.2955 0.2619 -0.0127 -0.0012 -0.0074 105 GLY X C   
545  O  O   . GLY A 69  ? 0.2273 0.2986 0.2251 -0.0315 0.0065  -0.0257 105 GLY X O   
546  N  N   . LEU A 70  ? 0.2533 0.2847 0.2554 -0.0161 -0.0056 -0.0057 106 LEU X N   
547  C  CA  . LEU A 70  ? 0.2684 0.2881 0.2693 -0.0078 -0.0055 -0.0031 106 LEU X CA  
548  C  C   . LEU A 70  ? 0.2841 0.2998 0.2747 -0.0145 -0.0033 -0.0004 106 LEU X C   
549  O  O   . LEU A 70  ? 0.2667 0.3229 0.2665 -0.0148 -0.0037 0.0069  106 LEU X O   
550  C  CB  . LEU A 70  ? 0.2634 0.2929 0.2639 -0.0166 -0.0072 -0.0022 106 LEU X CB  
551  C  CG  . LEU A 70  ? 0.2662 0.2761 0.2584 -0.0079 0.0016  -0.0007 106 LEU X CG  
552  C  CD1 . LEU A 70  ? 0.2694 0.2826 0.2860 -0.0081 -0.0012 0.0047  106 LEU X CD1 
553  C  CD2 . LEU A 70  ? 0.2757 0.2979 0.2705 -0.0126 -0.0013 0.0001  106 LEU X CD2 
554  N  N   . GLU A 71  ? 0.2858 0.3218 0.2908 -0.0119 -0.0022 -0.0019 107 GLU X N   
555  C  CA  . GLU A 71  ? 0.3118 0.3331 0.3085 -0.0058 -0.0003 -0.0001 107 GLU X CA  
556  C  C   . GLU A 71  ? 0.2977 0.3238 0.2978 -0.0082 -0.0039 0.0000  107 GLU X C   
557  O  O   . GLU A 71  ? 0.2879 0.3451 0.2903 -0.0111 -0.0031 0.0014  107 GLU X O   
558  C  CB  . GLU A 71  ? 0.3283 0.3445 0.3194 -0.0089 -0.0067 -0.0034 107 GLU X CB  
559  C  CG  . GLU A 71  ? 0.3633 0.3877 0.3696 0.0071  0.0031  -0.0020 107 GLU X CG  
560  C  CD  . GLU A 71  ? 0.4286 0.4378 0.4403 -0.0125 -0.0106 -0.0072 107 GLU X CD  
561  O  OE1 . GLU A 71  ? 0.4678 0.4566 0.4839 -0.0059 -0.0086 -0.0012 107 GLU X OE1 
562  O  OE2 . GLU A 71  ? 0.4763 0.4820 0.4799 0.0011  -0.0160 0.0040  107 GLU X OE2 
563  N  N   . ASP A 72  ? 0.2955 0.3183 0.2892 -0.0088 -0.0004 -0.0073 108 ASP X N   
564  C  CA  . ASP A 72  ? 0.2984 0.3199 0.2907 -0.0083 -0.0024 -0.0081 108 ASP X CA  
565  C  C   . ASP A 72  ? 0.2893 0.3200 0.2830 -0.0135 0.0003  -0.0084 108 ASP X C   
566  O  O   . ASP A 72  ? 0.2750 0.3450 0.2641 -0.0185 0.0015  -0.0089 108 ASP X O   
567  C  CB  . ASP A 72  ? 0.3046 0.3231 0.2847 -0.0083 -0.0004 -0.0042 108 ASP X CB  
568  C  CG  . ASP A 72  ? 0.3321 0.3326 0.3300 -0.0111 -0.0006 -0.0006 108 ASP X CG  
569  O  OD1 . ASP A 72  ? 0.3641 0.3982 0.3451 -0.0223 -0.0144 -0.0032 108 ASP X OD1 
570  O  OD2 . ASP A 72  ? 0.3220 0.3336 0.3491 -0.0223 0.0003  -0.0008 108 ASP X OD2 
571  N  N   . LEU A 73  ? 0.2737 0.3127 0.2753 -0.0132 0.0033  -0.0049 109 LEU X N   
572  C  CA  . LEU A 73  ? 0.2642 0.2953 0.2707 -0.0065 -0.0007 -0.0046 109 LEU X CA  
573  C  C   . LEU A 73  ? 0.2776 0.3067 0.2816 -0.0084 -0.0042 -0.0003 109 LEU X C   
574  O  O   . LEU A 73  ? 0.2688 0.3216 0.2755 -0.0127 -0.0067 0.0000  109 LEU X O   
575  C  CB  . LEU A 73  ? 0.2504 0.2873 0.2635 -0.0067 -0.0039 -0.0042 109 LEU X CB  
576  C  CG  . LEU A 73  ? 0.2350 0.2527 0.2367 -0.0028 0.0076  -0.0083 109 LEU X CG  
577  C  CD1 . LEU A 73  ? 0.2256 0.2694 0.2266 -0.0059 0.0003  -0.0098 109 LEU X CD1 
578  C  CD2 . LEU A 73  ? 0.2194 0.2587 0.1999 -0.0144 -0.0074 -0.0064 109 LEU X CD2 
579  N  N   . LYS A 74  ? 0.2715 0.3045 0.2992 -0.0045 -0.0049 -0.0006 110 LYS X N   
580  C  CA  . LYS A 74  ? 0.3007 0.3277 0.3177 -0.0013 -0.0042 0.0043  110 LYS X CA  
581  C  C   . LYS A 74  ? 0.2939 0.3261 0.3133 0.0004  -0.0065 0.0083  110 LYS X C   
582  O  O   . LYS A 74  ? 0.2963 0.3522 0.3298 -0.0078 -0.0078 0.0119  110 LYS X O   
583  C  CB  . LYS A 74  ? 0.3029 0.3401 0.3260 -0.0010 -0.0037 0.0033  110 LYS X CB  
584  C  CG  . LYS A 74  ? 0.3486 0.3530 0.3599 -0.0011 -0.0045 -0.0001 110 LYS X CG  
585  C  CD  . LYS A 74  ? 0.3679 0.4030 0.3982 0.0028  -0.0038 -0.0020 110 LYS X CD  
586  C  CE  . LYS A 74  ? 0.4223 0.4117 0.4214 0.0017  -0.0006 0.0028  110 LYS X CE  
587  N  NZ  . LYS A 74  ? 0.4368 0.4345 0.4387 -0.0024 -0.0037 -0.0065 110 LYS X NZ  
588  N  N   . ARG A 75  ? 0.3087 0.3415 0.3124 -0.0052 -0.0070 0.0040  111 ARG X N   
589  C  CA  . ARG A 75  ? 0.3210 0.3482 0.3265 0.0000  0.0008  0.0019  111 ARG X CA  
590  C  C   . ARG A 75  ? 0.3145 0.3498 0.3095 -0.0015 -0.0001 0.0038  111 ARG X C   
591  O  O   . ARG A 75  ? 0.3103 0.3689 0.3063 -0.0068 0.0023  -0.0001 111 ARG X O   
592  C  CB  . ARG A 75  ? 0.3445 0.3544 0.3376 -0.0054 0.0062  -0.0015 111 ARG X CB  
593  C  CG  . ARG A 75  ? 0.3911 0.4103 0.3945 0.0086  -0.0018 0.0030  111 ARG X CG  
594  C  CD  . ARG A 75  ? 0.4603 0.4587 0.4603 -0.0111 -0.0002 -0.0006 111 ARG X CD  
595  N  NE  . ARG A 75  ? 0.5054 0.5015 0.5067 0.0099  -0.0012 -0.0045 111 ARG X NE  
596  C  CZ  . ARG A 75  ? 0.5476 0.5355 0.5434 -0.0057 -0.0005 0.0021  111 ARG X CZ  
597  N  NH1 . ARG A 75  ? 0.5522 0.5649 0.5610 0.0005  0.0008  -0.0047 111 ARG X NH1 
598  N  NH2 . ARG A 75  ? 0.5658 0.5634 0.5712 0.0063  0.0014  -0.0034 111 ARG X NH2 
599  N  N   . VAL A 76  ? 0.2834 0.3311 0.2937 -0.0044 0.0000  0.0008  112 VAL X N   
600  C  CA  . VAL A 76  ? 0.2830 0.3123 0.2820 0.0025  -0.0049 0.0014  112 VAL X CA  
601  C  C   . VAL A 76  ? 0.2709 0.3040 0.2769 0.0021  -0.0068 -0.0017 112 VAL X C   
602  O  O   . VAL A 76  ? 0.2540 0.3222 0.2848 0.0048  -0.0094 0.0014  112 VAL X O   
603  C  CB  . VAL A 76  ? 0.2747 0.3019 0.2764 0.0012  -0.0046 0.0015  112 VAL X CB  
604  C  CG1 . VAL A 76  ? 0.2715 0.3070 0.2672 -0.0010 -0.0002 0.0023  112 VAL X CG1 
605  C  CG2 . VAL A 76  ? 0.2631 0.2999 0.2641 -0.0105 -0.0061 -0.0018 112 VAL X CG2 
606  N  N   . SER A 77  ? 0.2700 0.3013 0.2757 0.0005  -0.0055 -0.0015 113 SER X N   
607  C  CA  . SER A 77  ? 0.2739 0.3019 0.2817 0.0004  -0.0073 0.0038  113 SER X CA  
608  C  C   . SER A 77  ? 0.2476 0.2760 0.2500 -0.0029 -0.0021 0.0033  113 SER X C   
609  O  O   . SER A 77  ? 0.2480 0.2906 0.2416 -0.0061 -0.0084 0.0080  113 SER X O   
610  C  CB  . SER A 77  ? 0.2802 0.3106 0.2952 -0.0001 -0.0039 -0.0019 113 SER X CB  
611  O  OG  . SER A 77  ? 0.3546 0.3628 0.3637 -0.0052 0.0027  0.0200  113 SER X OG  
612  N  N   . PRO A 78  ? 0.2183 0.2560 0.2326 0.0011  0.0043  0.0079  114 PRO X N   
613  C  CA  . PRO A 78  ? 0.2017 0.2400 0.2153 0.0025  0.0058  0.0069  114 PRO X CA  
614  C  C   . PRO A 78  ? 0.1820 0.2185 0.1954 0.0049  0.0068  0.0082  114 PRO X C   
615  O  O   . PRO A 78  ? 0.1973 0.2444 0.2159 0.0122  0.0207  0.0092  114 PRO X O   
616  C  CB  . PRO A 78  ? 0.1989 0.2452 0.2228 0.0080  -0.0009 0.0032  114 PRO X CB  
617  C  CG  . PRO A 78  ? 0.2115 0.2649 0.2428 0.0080  0.0076  0.0032  114 PRO X CG  
618  C  CD  . PRO A 78  ? 0.2389 0.2528 0.2379 0.0030  -0.0011 0.0037  114 PRO X CD  
619  N  N   . VAL A 79  ? 0.1589 0.1941 0.1646 -0.0022 0.0093  0.0075  115 VAL X N   
620  C  CA  . VAL A 79  ? 0.1563 0.1711 0.1517 -0.0052 0.0086  0.0099  115 VAL X CA  
621  C  C   . VAL A 79  ? 0.1382 0.1732 0.1407 -0.0065 0.0040  0.0034  115 VAL X C   
622  O  O   . VAL A 79  ? 0.1489 0.1863 0.1520 -0.0062 0.0087  0.0119  115 VAL X O   
623  C  CB  . VAL A 79  ? 0.1678 0.1886 0.1664 -0.0048 0.0052  0.0014  115 VAL X CB  
624  C  CG1 . VAL A 79  ? 0.1979 0.2096 0.1855 -0.0115 0.0072  0.0024  115 VAL X CG1 
625  C  CG2 . VAL A 79  ? 0.1822 0.2034 0.1711 -0.0041 0.0043  0.0103  115 VAL X CG2 
626  N  N   . GLY A 80  ? 0.1365 0.1510 0.1291 -0.0081 0.0064  0.0028  116 GLY X N   
627  C  CA  . GLY A 80  ? 0.1335 0.1433 0.1303 -0.0090 0.0057  0.0053  116 GLY X CA  
628  C  C   . GLY A 80  ? 0.1225 0.1220 0.1229 -0.0043 0.0046  0.0034  116 GLY X C   
629  O  O   . GLY A 80  ? 0.1223 0.1425 0.1293 -0.0048 0.0134  0.0026  116 GLY X O   
630  N  N   . GLU A 81  ? 0.1322 0.1273 0.1289 -0.0095 0.0086  0.0113  117 GLU X N   
631  C  CA  . GLU A 81  ? 0.1221 0.1180 0.1201 -0.0053 0.0085  0.0057  117 GLU X CA  
632  C  C   . GLU A 81  ? 0.1235 0.1159 0.1173 -0.0087 0.0026  0.0116  117 GLU X C   
633  O  O   . GLU A 81  ? 0.1387 0.1383 0.1244 -0.0112 0.0077  0.0045  117 GLU X O   
634  C  CB  . GLU A 81  ? 0.1265 0.1255 0.1234 -0.0035 0.0066  0.0098  117 GLU X CB  
635  C  CG  . GLU A 81  ? 0.1327 0.1253 0.1396 -0.0119 0.0154  0.0078  117 GLU X CG  
636  C  CD  . GLU A 81  ? 0.1502 0.1600 0.1479 0.0040  0.0137  0.0080  117 GLU X CD  
637  O  OE1 . GLU A 81  ? 0.1743 0.1711 0.1687 0.0064  0.0210  0.0178  117 GLU X OE1 
638  O  OE2 . GLU A 81  ? 0.1502 0.1543 0.1474 0.0029  0.0096  0.0206  117 GLU X OE2 
639  N  N   . THR A 82  ? 0.1204 0.1187 0.1098 -0.0100 0.0061  -0.0033 118 THR X N   
640  C  CA  . THR A 82  ? 0.1200 0.1129 0.1109 -0.0115 0.0054  -0.0007 118 THR X CA  
641  C  C   . THR A 82  ? 0.1245 0.1198 0.1148 -0.0041 0.0032  -0.0017 118 THR X C   
642  O  O   . THR A 82  ? 0.1303 0.1141 0.1138 -0.0223 0.0064  0.0112  118 THR X O   
643  C  CB  . THR A 82  ? 0.1125 0.1075 0.1145 0.0014  0.0001  0.0017  118 THR X CB  
644  O  OG1 . THR A 82  ? 0.1037 0.0908 0.1183 0.0043  0.0102  0.0018  118 THR X OG1 
645  C  CG2 . THR A 82  ? 0.1270 0.0996 0.1205 -0.0157 0.0029  0.0013  118 THR X CG2 
646  N  N   . TYR A 83  ? 0.1382 0.1187 0.1232 -0.0010 0.0064  -0.0023 119 TYR X N   
647  C  CA  . TYR A 83  ? 0.1480 0.1227 0.1285 -0.0029 0.0125  -0.0016 119 TYR X CA  
648  C  C   . TYR A 83  ? 0.1334 0.1113 0.1213 -0.0168 0.0146  -0.0011 119 TYR X C   
649  O  O   . TYR A 83  ? 0.1480 0.1008 0.1324 -0.0276 0.0191  -0.0055 119 TYR X O   
650  C  CB  . TYR A 83  ? 0.1436 0.1249 0.1261 0.0021  0.0104  -0.0061 119 TYR X CB  
651  C  CG  . TYR A 83  ? 0.1442 0.1329 0.1333 -0.0035 0.0142  -0.0063 119 TYR X CG  
652  C  CD1 . TYR A 83  ? 0.1532 0.1441 0.1437 -0.0017 0.0233  -0.0053 119 TYR X CD1 
653  C  CD2 . TYR A 83  ? 0.1543 0.1387 0.1472 -0.0072 0.0073  -0.0084 119 TYR X CD2 
654  C  CE1 . TYR A 83  ? 0.1485 0.1418 0.1403 -0.0031 0.0101  0.0020  119 TYR X CE1 
655  C  CE2 . TYR A 83  ? 0.1465 0.1389 0.1413 0.0062  0.0085  -0.0189 119 TYR X CE2 
656  C  CZ  . TYR A 83  ? 0.1298 0.1457 0.1423 0.0027  0.0112  0.0045  119 TYR X CZ  
657  O  OH  . TYR A 83  ? 0.1624 0.1631 0.1554 0.0363  0.0428  -0.0081 119 TYR X OH  
658  N  N   . ILE A 84  ? 0.1227 0.0929 0.1254 -0.0164 0.0103  -0.0030 120 ILE X N   
659  C  CA  . ILE A 84  ? 0.1291 0.1074 0.1188 -0.0026 0.0061  -0.0010 120 ILE X CA  
660  C  C   . ILE A 84  ? 0.1309 0.1069 0.1359 -0.0120 0.0089  -0.0014 120 ILE X C   
661  O  O   . ILE A 84  ? 0.1293 0.1120 0.1301 -0.0186 0.0257  0.0027  120 ILE X O   
662  C  CB  . ILE A 84  ? 0.1308 0.1101 0.1153 -0.0053 0.0186  -0.0002 120 ILE X CB  
663  C  CG1 . ILE A 84  ? 0.1197 0.1182 0.1239 0.0025  0.0129  -0.0081 120 ILE X CG1 
664  C  CG2 . ILE A 84  ? 0.1321 0.1131 0.1257 0.0061  0.0198  -0.0024 120 ILE X CG2 
665  C  CD1 . ILE A 84  ? 0.1483 0.1114 0.1382 0.0024  0.0104  -0.0061 120 ILE X CD1 
666  N  N   . HIS A 85  ? 0.1440 0.0980 0.1238 -0.0104 0.0075  0.0009  121 HIS X N   
667  C  CA  . HIS A 85  ? 0.1600 0.1149 0.1290 -0.0077 0.0099  0.0018  121 HIS X CA  
668  C  C   . HIS A 85  ? 0.1706 0.1243 0.1411 -0.0119 0.0121  -0.0028 121 HIS X C   
669  O  O   . HIS A 85  ? 0.2184 0.1246 0.1431 -0.0179 0.0366  -0.0081 121 HIS X O   
670  C  CB  . HIS A 85  ? 0.1571 0.1058 0.1256 0.0001  0.0172  0.0083  121 HIS X CB  
671  C  CG  . HIS A 85  ? 0.1641 0.1583 0.1410 0.0151  0.0238  0.0042  121 HIS X CG  
672  N  ND1 . HIS A 85  ? 0.1992 0.1603 0.1557 0.0072  0.0314  0.0057  121 HIS X ND1 
673  C  CD2 . HIS A 85  ? 0.2164 0.1553 0.1853 0.0140  0.0216  0.0021  121 HIS X CD2 
674  C  CE1 . HIS A 85  ? 0.2361 0.1904 0.1519 0.0218  0.0399  0.0154  121 HIS X CE1 
675  N  NE2 . HIS A 85  ? 0.1808 0.1678 0.1719 0.0094  0.0152  0.0023  121 HIS X NE2 
676  N  N   . GLU A 86  ? 0.1659 0.1277 0.1495 -0.0242 0.0091  0.0012  122 GLU X N   
677  C  CA  . GLU A 86  ? 0.1744 0.1350 0.1625 -0.0165 0.0087  -0.0080 122 GLU X CA  
678  C  C   . GLU A 86  ? 0.1652 0.1263 0.1595 -0.0185 0.0120  -0.0115 122 GLU X C   
679  O  O   . GLU A 86  ? 0.2056 0.1336 0.1683 -0.0472 0.0389  -0.0198 122 GLU X O   
680  C  CB  . GLU A 86  ? 0.1826 0.1356 0.1635 -0.0173 0.0009  -0.0098 122 GLU X CB  
681  C  CG  . GLU A 86  ? 0.1979 0.1493 0.1823 -0.0035 -0.0026 -0.0176 122 GLU X CG  
682  C  CD  . GLU A 86  ? 0.2573 0.2553 0.2259 0.0007  0.0121  -0.0008 122 GLU X CD  
683  O  OE1 . GLU A 86  ? 0.2869 0.3210 0.2687 0.0032  -0.0016 -0.0059 122 GLU X OE1 
684  O  OE2 . GLU A 86  ? 0.2634 0.2667 0.2493 -0.0001 0.0093  -0.0175 122 GLU X OE2 
685  N  N   . GLY A 87  ? 0.1514 0.1270 0.1623 -0.0171 0.0204  -0.0098 123 GLY X N   
686  C  CA  . GLY A 87  ? 0.1614 0.1464 0.1642 -0.0129 0.0091  -0.0079 123 GLY X CA  
687  C  C   . GLY A 87  ? 0.1599 0.1469 0.1542 -0.0221 0.0131  -0.0056 123 GLY X C   
688  O  O   . GLY A 87  ? 0.1827 0.1526 0.1655 -0.0542 0.0216  -0.0328 123 GLY X O   
689  N  N   . LEU A 88  ? 0.1774 0.1476 0.1438 -0.0250 0.0135  -0.0021 124 LEU X N   
690  C  CA  . LEU A 88  ? 0.1805 0.1558 0.1552 -0.0109 0.0100  -0.0024 124 LEU X CA  
691  C  C   . LEU A 88  ? 0.2072 0.1610 0.1772 -0.0092 0.0165  -0.0039 124 LEU X C   
692  O  O   . LEU A 88  ? 0.2497 0.1252 0.1717 -0.0319 0.0334  -0.0224 124 LEU X O   
693  C  CB  . LEU A 88  ? 0.1821 0.1505 0.1484 -0.0047 0.0143  -0.0071 124 LEU X CB  
694  C  CG  . LEU A 88  ? 0.1564 0.1305 0.1510 0.0026  0.0133  0.0004  124 LEU X CG  
695  C  CD1 . LEU A 88  ? 0.1671 0.1463 0.1462 0.0118  -0.0016 -0.0037 124 LEU X CD1 
696  C  CD2 . LEU A 88  ? 0.1776 0.1587 0.1571 -0.0069 0.0239  -0.0108 124 LEU X CD2 
697  N  N   . LYS A 89  ? 0.2291 0.1566 0.1857 -0.0127 0.0271  -0.0019 125 LYS X N   
698  C  CA  . LYS A 89  ? 0.2278 0.1789 0.2055 -0.0032 0.0149  -0.0020 125 LYS X CA  
699  C  C   . LYS A 89  ? 0.2351 0.1821 0.2009 -0.0082 0.0196  -0.0059 125 LYS X C   
700  O  O   . LYS A 89  ? 0.2847 0.1513 0.2037 -0.0282 0.0337  -0.0164 125 LYS X O   
701  C  CB  . LYS A 89  ? 0.2256 0.1906 0.2141 -0.0096 0.0195  -0.0023 125 LYS X CB  
702  C  CG  . LYS A 89  ? 0.2840 0.2196 0.2711 0.0040  0.0082  -0.0034 125 LYS X CG  
703  C  CD  . LYS A 89  ? 0.3104 0.3044 0.3209 -0.0022 0.0134  -0.0039 125 LYS X CD  
704  C  CE  . LYS A 89  ? 0.3485 0.3512 0.3709 0.0104  0.0005  0.0010  125 LYS X CE  
705  N  NZ  . LYS A 89  ? 0.3576 0.3885 0.3987 0.0085  0.0066  -0.0025 125 LYS X NZ  
706  N  N   . LEU A 90  ? 0.2183 0.1796 0.1927 -0.0153 0.0218  -0.0100 126 LEU X N   
707  C  CA  . LEU A 90  ? 0.2275 0.1997 0.2171 -0.0130 0.0098  -0.0083 126 LEU X CA  
708  C  C   . LEU A 90  ? 0.2274 0.1931 0.2199 -0.0259 0.0169  -0.0187 126 LEU X C   
709  O  O   . LEU A 90  ? 0.2613 0.1990 0.2178 -0.0517 0.0413  -0.0164 126 LEU X O   
710  C  CB  . LEU A 90  ? 0.2324 0.2078 0.2231 -0.0134 0.0067  -0.0117 126 LEU X CB  
711  C  CG  . LEU A 90  ? 0.2439 0.2197 0.2477 -0.0176 0.0106  -0.0195 126 LEU X CG  
712  C  CD1 . LEU A 90  ? 0.2501 0.2074 0.2465 -0.0192 0.0169  -0.0219 126 LEU X CD1 
713  C  CD2 . LEU A 90  ? 0.2793 0.2402 0.2567 -0.0002 0.0106  -0.0109 126 LEU X CD2 
714  N  N   . ALA A 91  ? 0.2192 0.1706 0.1946 -0.0292 0.0254  -0.0165 127 ALA X N   
715  C  CA  . ALA A 91  ? 0.2171 0.1783 0.1971 -0.0162 0.0165  -0.0148 127 ALA X CA  
716  C  C   . ALA A 91  ? 0.2153 0.1639 0.1903 -0.0151 0.0241  -0.0170 127 ALA X C   
717  O  O   . ALA A 91  ? 0.2382 0.1567 0.1946 -0.0489 0.0414  -0.0301 127 ALA X O   
718  C  CB  . ALA A 91  ? 0.1957 0.1435 0.1825 -0.0316 0.0283  -0.0084 127 ALA X CB  
719  N  N   . ASN A 92  ? 0.2228 0.1720 0.1796 -0.0137 0.0188  -0.0142 128 ASN X N   
720  C  CA  . ASN A 92  ? 0.2399 0.1836 0.2100 -0.0094 0.0103  -0.0115 128 ASN X CA  
721  C  C   . ASN A 92  ? 0.2706 0.1950 0.2353 -0.0078 0.0137  -0.0010 128 ASN X C   
722  O  O   . ASN A 92  ? 0.3054 0.1911 0.2538 -0.0278 0.0371  0.0024  128 ASN X O   
723  C  CB  . ASN A 92  ? 0.2415 0.1623 0.2027 -0.0043 0.0156  -0.0117 128 ASN X CB  
724  C  CG  . ASN A 92  ? 0.2278 0.1619 0.2207 -0.0098 0.0099  -0.0166 128 ASN X CG  
725  O  OD1 . ASN A 92  ? 0.2373 0.1205 0.2017 -0.0272 0.0304  0.0121  128 ASN X OD1 
726  N  ND2 . ASN A 92  ? 0.2537 0.1528 0.2205 -0.0181 0.0240  -0.0004 128 ASN X ND2 
727  N  N   . GLU A 93  ? 0.2735 0.2115 0.2448 -0.0218 0.0152  -0.0028 129 GLU X N   
728  C  CA  . GLU A 93  ? 0.2858 0.2254 0.2594 -0.0115 0.0069  -0.0060 129 GLU X CA  
729  C  C   . GLU A 93  ? 0.2898 0.2346 0.2603 -0.0109 0.0077  -0.0018 129 GLU X C   
730  O  O   . GLU A 93  ? 0.3170 0.2085 0.2818 -0.0265 0.0276  -0.0100 129 GLU X O   
731  C  CB  . GLU A 93  ? 0.2901 0.2326 0.2687 -0.0137 0.0093  -0.0062 129 GLU X CB  
732  C  CG  . GLU A 93  ? 0.3003 0.2603 0.2972 -0.0028 0.0021  -0.0074 129 GLU X CG  
733  C  CD  . GLU A 93  ? 0.3473 0.3102 0.3221 -0.0087 0.0077  -0.0031 129 GLU X CD  
734  O  OE1 . GLU A 93  ? 0.4025 0.3653 0.3544 0.0038  -0.0005 0.0088  129 GLU X OE1 
735  O  OE2 . GLU A 93  ? 0.3746 0.3500 0.3576 0.0088  0.0179  -0.0072 129 GLU X OE2 
736  N  N   . GLN A 94  ? 0.2848 0.2460 0.2679 -0.0137 0.0068  -0.0103 130 GLN X N   
737  C  CA  . GLN A 94  ? 0.2855 0.2612 0.2708 -0.0129 0.0021  -0.0106 130 GLN X CA  
738  C  C   . GLN A 94  ? 0.2951 0.2786 0.2784 -0.0198 0.0089  -0.0051 130 GLN X C   
739  O  O   . GLN A 94  ? 0.3209 0.2480 0.2930 -0.0383 0.0188  -0.0167 130 GLN X O   
740  C  CB  . GLN A 94  ? 0.2746 0.2577 0.2636 -0.0159 0.0017  -0.0098 130 GLN X CB  
741  C  CG  . GLN A 94  ? 0.2936 0.2564 0.2591 -0.0212 0.0087  -0.0185 130 GLN X CG  
742  C  CD  . GLN A 94  ? 0.2901 0.2784 0.2510 -0.0139 0.0070  -0.0141 130 GLN X CD  
743  O  OE1 . GLN A 94  ? 0.2847 0.2658 0.2481 -0.0369 0.0270  -0.0381 130 GLN X OE1 
744  N  NE2 . GLN A 94  ? 0.2884 0.2485 0.2237 -0.0350 0.0281  -0.0343 130 GLN X NE2 
745  N  N   . ILE A 95  ? 0.3055 0.2605 0.2822 -0.0219 0.0098  -0.0065 131 ILE X N   
746  C  CA  . ILE A 95  ? 0.3027 0.2792 0.2864 -0.0121 0.0069  0.0008  131 ILE X CA  
747  C  C   . ILE A 95  ? 0.3376 0.3021 0.3194 -0.0055 0.0073  0.0039  131 ILE X C   
748  O  O   . ILE A 95  ? 0.3485 0.2868 0.3146 -0.0112 0.0248  -0.0024 131 ILE X O   
749  C  CB  . ILE A 95  ? 0.2801 0.2706 0.2663 -0.0032 0.0056  -0.0024 131 ILE X CB  
750  C  CG1 . ILE A 95  ? 0.2622 0.2458 0.2427 -0.0214 0.0153  0.0038  131 ILE X CG1 
751  C  CG2 . ILE A 95  ? 0.2929 0.2679 0.2736 0.0007  0.0078  0.0008  131 ILE X CG2 
752  C  CD1 . ILE A 95  ? 0.2549 0.2250 0.2249 -0.0148 0.0161  -0.0121 131 ILE X CD1 
753  N  N   . GLN A 96  ? 0.3613 0.3453 0.3553 -0.0056 0.0128  0.0029  132 GLN X N   
754  C  CA  . GLN A 96  ? 0.4005 0.3830 0.3906 0.0008  0.0042  0.0037  132 GLN X CA  
755  C  C   . GLN A 96  ? 0.4215 0.4008 0.4150 -0.0053 0.0048  0.0021  132 GLN X C   
756  O  O   . GLN A 96  ? 0.4470 0.3963 0.4225 -0.0013 0.0100  0.0068  132 GLN X O   
757  C  CB  . GLN A 96  ? 0.4076 0.3942 0.4037 -0.0025 0.0059  -0.0005 132 GLN X CB  
758  C  CG  . GLN A 96  ? 0.4459 0.4353 0.4352 0.0027  -0.0020 0.0004  132 GLN X CG  
759  C  CD  . GLN A 96  ? 0.4703 0.4878 0.4880 0.0007  0.0024  -0.0007 132 GLN X CD  
760  O  OE1 . GLN A 96  ? 0.5073 0.5036 0.5038 0.0008  0.0041  -0.0059 132 GLN X OE1 
761  N  NE2 . GLN A 96  ? 0.5140 0.5093 0.5179 -0.0078 -0.0039 -0.0062 132 GLN X NE2 
762  N  N   . LYS A 97  ? 0.4403 0.4240 0.4364 -0.0043 0.0017  0.0012  133 LYS X N   
763  C  CA  . LYS A 97  ? 0.4560 0.4484 0.4584 -0.0046 0.0007  -0.0007 133 LYS X CA  
764  C  C   . LYS A 97  ? 0.4615 0.4555 0.4665 -0.0055 0.0043  0.0000  133 LYS X C   
765  O  O   . LYS A 97  ? 0.4721 0.4544 0.4754 -0.0082 0.0056  -0.0003 133 LYS X O   
766  C  CB  . LYS A 97  ? 0.4644 0.4568 0.4630 -0.0041 0.0016  0.0013  133 LYS X CB  
767  C  CG  . LYS A 97  ? 0.4839 0.4841 0.4884 -0.0055 -0.0028 -0.0023 133 LYS X CG  
768  C  CD  . LYS A 97  ? 0.5185 0.5149 0.5044 -0.0004 0.0000  0.0009  133 LYS X CD  
769  C  CE  . LYS A 97  ? 0.5253 0.5309 0.5247 -0.0024 -0.0023 -0.0009 133 LYS X CE  
770  N  NZ  . LYS A 97  ? 0.5356 0.5415 0.5225 0.0000  0.0006  -0.0047 133 LYS X NZ  
771  N  N   . ALA A 98  ? 0.4681 0.4585 0.4708 -0.0050 0.0038  -0.0010 134 ALA X N   
772  C  CA  . ALA A 98  ? 0.4722 0.4668 0.4743 -0.0025 0.0028  -0.0022 134 ALA X CA  
773  C  C   . ALA A 98  ? 0.4788 0.4666 0.4768 -0.0040 0.0023  -0.0026 134 ALA X C   
774  O  O   . ALA A 98  ? 0.4844 0.4679 0.4814 -0.0053 0.0071  -0.0075 134 ALA X O   
775  C  CB  . ALA A 98  ? 0.4748 0.4683 0.4762 -0.0035 0.0028  -0.0007 134 ALA X CB  
776  N  N   . GLY A 99  ? 0.4802 0.4694 0.4818 -0.0023 0.0029  -0.0026 135 GLY X N   
777  C  CA  . GLY A 99  ? 0.4895 0.4820 0.4875 -0.0020 0.0018  0.0004  135 GLY X CA  
778  C  C   . GLY A 99  ? 0.4964 0.4903 0.4927 -0.0021 0.0007  0.0013  135 GLY X C   
779  O  O   . GLY A 99  ? 0.5023 0.4871 0.4971 -0.0023 0.0028  0.0033  135 GLY X O   
780  N  N   . GLY A 100 ? 0.5030 0.4981 0.4982 -0.0030 0.0020  0.0009  136 GLY X N   
781  C  CA  . GLY A 100 ? 0.5053 0.5011 0.5009 -0.0012 0.0020  0.0019  136 GLY X CA  
782  C  C   . GLY A 100 ? 0.5105 0.5024 0.5054 -0.0014 0.0006  0.0007  136 GLY X C   
783  O  O   . GLY A 100 ? 0.5152 0.4988 0.5058 -0.0034 0.0053  0.0010  136 GLY X O   
784  N  N   . LEU A 101 ? 0.5149 0.5060 0.5076 -0.0009 0.0010  -0.0002 137 LEU X N   
785  C  CA  . LEU A 101 ? 0.5111 0.5074 0.5088 -0.0010 0.0014  -0.0008 137 LEU X CA  
786  C  C   . LEU A 101 ? 0.5073 0.5017 0.5049 -0.0020 0.0018  -0.0020 137 LEU X C   
787  O  O   . LEU A 101 ? 0.5134 0.4980 0.5052 -0.0009 0.0052  -0.0034 137 LEU X O   
788  C  CB  . LEU A 101 ? 0.5128 0.5092 0.5110 -0.0016 0.0002  -0.0005 137 LEU X CB  
789  C  CG  . LEU A 101 ? 0.5130 0.5153 0.5134 -0.0016 0.0000  -0.0005 137 LEU X CG  
790  C  CD1 . LEU A 101 ? 0.5183 0.5199 0.5198 0.0006  -0.0001 0.0012  137 LEU X CD1 
791  C  CD2 . LEU A 101 ? 0.5144 0.5083 0.5087 0.0001  0.0008  0.0025  137 LEU X CD2 
792  N  N   . LYS A 102 ? 0.4965 0.4955 0.4963 -0.0033 0.0017  -0.0014 138 LYS X N   
793  C  CA  . LYS A 102 ? 0.4880 0.4839 0.4863 0.0000  0.0008  0.0001  138 LYS X CA  
794  C  C   . LYS A 102 ? 0.4725 0.4666 0.4675 -0.0030 0.0041  0.0019  138 LYS X C   
795  O  O   . LYS A 102 ? 0.4719 0.4646 0.4713 -0.0046 0.0053  0.0003  138 LYS X O   
796  C  CB  . LYS A 102 ? 0.4909 0.4893 0.4915 -0.0026 0.0028  -0.0005 138 LYS X CB  
797  C  CG  . LYS A 102 ? 0.5062 0.5009 0.5091 0.0027  0.0006  0.0024  138 LYS X CG  
798  C  CD  . LYS A 102 ? 0.5221 0.5258 0.5184 0.0012  -0.0002 0.0022  138 LYS X CD  
799  C  CE  . LYS A 102 ? 0.5293 0.5241 0.5305 0.0022  0.0008  0.0003  138 LYS X CE  
800  N  NZ  . LYS A 102 ? 0.5361 0.5409 0.5422 0.0058  -0.0014 0.0023  138 LYS X NZ  
801  N  N   . THR A 103 ? 0.4494 0.4433 0.4478 -0.0029 0.0017  0.0014  139 THR X N   
802  C  CA  . THR A 103 ? 0.4259 0.4174 0.4201 -0.0046 0.0044  -0.0028 139 THR X CA  
803  C  C   . THR A 103 ? 0.3978 0.3887 0.3894 -0.0049 0.0030  0.0044  139 THR X C   
804  O  O   . THR A 103 ? 0.4116 0.3858 0.3991 -0.0123 0.0039  -0.0008 139 THR X O   
805  C  CB  . THR A 103 ? 0.4252 0.4260 0.4235 -0.0033 0.0035  -0.0019 139 THR X CB  
806  O  OG1 . THR A 103 ? 0.4353 0.4262 0.4270 -0.0188 0.0051  0.0059  139 THR X OG1 
807  C  CG2 . THR A 103 ? 0.4327 0.4246 0.4366 -0.0021 0.0059  -0.0047 139 THR X CG2 
808  N  N   . SER A 104 ? 0.3641 0.3541 0.3559 -0.0092 0.0096  -0.0016 140 SER X N   
809  C  CA  . SER A 104 ? 0.3392 0.3360 0.3249 -0.0031 0.0075  0.0040  140 SER X CA  
810  C  C   . SER A 104 ? 0.2894 0.3112 0.2944 -0.0049 0.0108  0.0044  140 SER X C   
811  O  O   . SER A 104 ? 0.2951 0.3486 0.2825 -0.0092 0.0271  0.0129  140 SER X O   
812  C  CB  . SER A 104 ? 0.3257 0.3435 0.3299 -0.0037 0.0045  0.0071  140 SER X CB  
813  O  OG  . SER A 104 ? 0.3565 0.3512 0.3559 -0.0089 0.0054  0.0015  140 SER X OG  
814  N  N   . SER A 105 ? 0.2645 0.2439 0.2362 -0.0210 0.0159  -0.0007 141 SER X N   
815  C  CA  . SER A 105 ? 0.2270 0.1909 0.2129 -0.0279 0.0099  0.0016  141 SER X CA  
816  C  C   . SER A 105 ? 0.1907 0.1775 0.1863 -0.0205 0.0114  -0.0067 141 SER X C   
817  O  O   . SER A 105 ? 0.2008 0.1703 0.1742 -0.0360 0.0226  0.0151  141 SER X O   
818  C  CB  . SER A 105 ? 0.2391 0.1954 0.2216 -0.0301 0.0133  0.0022  141 SER X CB  
819  O  OG  . SER A 105 ? 0.2629 0.1922 0.2626 -0.0601 0.0196  -0.0097 141 SER X OG  
820  N  N   . ILE A 106 ? 0.1795 0.1588 0.1689 -0.0337 0.0199  -0.0056 142 ILE X N   
821  C  CA  . ILE A 106 ? 0.1755 0.1594 0.1606 -0.0288 0.0106  -0.0002 142 ILE X CA  
822  C  C   . ILE A 106 ? 0.1565 0.1698 0.1521 -0.0328 0.0079  0.0044  142 ILE X C   
823  O  O   . ILE A 106 ? 0.1690 0.1981 0.1391 -0.0533 0.0199  0.0062  142 ILE X O   
824  C  CB  . ILE A 106 ? 0.1792 0.1748 0.1657 -0.0282 0.0081  -0.0001 142 ILE X CB  
825  C  CG1 . ILE A 106 ? 0.2328 0.2156 0.1991 -0.0113 0.0170  0.0123  142 ILE X CG1 
826  C  CG2 . ILE A 106 ? 0.2277 0.1828 0.1970 -0.0070 0.0107  -0.0022 142 ILE X CG2 
827  C  CD1 . ILE A 106 ? 0.2232 0.2332 0.2379 -0.0085 0.0142  0.0043  142 ILE X CD1 
828  N  N   . ILE A 107 ? 0.1401 0.1502 0.1450 -0.0282 0.0009  0.0003  143 ILE X N   
829  C  CA  . ILE A 107 ? 0.1493 0.1379 0.1325 -0.0121 -0.0002 -0.0042 143 ILE X CA  
830  C  C   . ILE A 107 ? 0.1182 0.1302 0.1203 -0.0201 0.0062  -0.0013 143 ILE X C   
831  O  O   . ILE A 107 ? 0.1509 0.1410 0.1297 -0.0288 0.0000  -0.0153 143 ILE X O   
832  C  CB  . ILE A 107 ? 0.1591 0.1471 0.1451 -0.0110 0.0096  0.0027  143 ILE X CB  
833  C  CG1 . ILE A 107 ? 0.1929 0.1638 0.1771 -0.0154 0.0014  -0.0060 143 ILE X CG1 
834  C  CG2 . ILE A 107 ? 0.1643 0.1786 0.1554 -0.0047 0.0215  -0.0005 143 ILE X CG2 
835  C  CD1 . ILE A 107 ? 0.2126 0.1727 0.2134 -0.0126 0.0106  0.0005  143 ILE X CD1 
836  N  N   . ILE A 108 ? 0.1156 0.1315 0.1210 -0.0197 -0.0003 -0.0113 144 ILE X N   
837  C  CA  . ILE A 108 ? 0.1277 0.1313 0.1201 -0.0098 0.0073  -0.0026 144 ILE X CA  
838  C  C   . ILE A 108 ? 0.1241 0.1454 0.1135 -0.0124 0.0050  -0.0058 144 ILE X C   
839  O  O   . ILE A 108 ? 0.1309 0.1531 0.1354 -0.0366 0.0072  -0.0204 144 ILE X O   
840  C  CB  . ILE A 108 ? 0.1357 0.1429 0.1340 -0.0142 0.0038  -0.0049 144 ILE X CB  
841  C  CG1 . ILE A 108 ? 0.1493 0.1756 0.1502 -0.0007 0.0123  -0.0009 144 ILE X CG1 
842  C  CG2 . ILE A 108 ? 0.1533 0.1544 0.1591 0.0024  -0.0014 -0.0009 144 ILE X CG2 
843  C  CD1 . ILE A 108 ? 0.1627 0.1782 0.1736 -0.0001 -0.0023 0.0064  144 ILE X CD1 
844  N  N   . ALA A 109 ? 0.1311 0.1218 0.1233 -0.0170 0.0132  -0.0197 145 ALA X N   
845  C  CA  . ALA A 109 ? 0.1383 0.1268 0.1109 -0.0069 0.0087  -0.0088 145 ALA X CA  
846  C  C   . ALA A 109 ? 0.1097 0.1292 0.1140 -0.0114 0.0144  -0.0061 145 ALA X C   
847  O  O   . ALA A 109 ? 0.1382 0.1287 0.1227 -0.0226 0.0204  -0.0038 145 ALA X O   
848  C  CB  . ALA A 109 ? 0.1490 0.1237 0.1391 -0.0011 0.0102  -0.0146 145 ALA X CB  
849  N  N   . LEU A 110 ? 0.1083 0.1393 0.1094 -0.0084 0.0102  0.0000  146 LEU X N   
850  C  CA  . LEU A 110 ? 0.1266 0.1391 0.1244 -0.0061 0.0048  -0.0005 146 LEU X CA  
851  C  C   . LEU A 110 ? 0.1140 0.1319 0.1271 -0.0082 0.0114  -0.0085 146 LEU X C   
852  O  O   . LEU A 110 ? 0.1398 0.1382 0.1401 -0.0166 0.0083  -0.0087 146 LEU X O   
853  C  CB  . LEU A 110 ? 0.1365 0.1606 0.1461 -0.0036 0.0024  0.0000  146 LEU X CB  
854  C  CG  . LEU A 110 ? 0.1571 0.1951 0.2054 -0.0080 -0.0013 0.0053  146 LEU X CG  
855  C  CD1 . LEU A 110 ? 0.2209 0.2296 0.2197 0.0091  0.0011  -0.0125 146 LEU X CD1 
856  C  CD2 . LEU A 110 ? 0.1644 0.2249 0.1859 0.0195  0.0074  0.0021  146 LEU X CD2 
857  N  N   . THR A 111 ? 0.1129 0.1162 0.1206 -0.0058 0.0160  -0.0108 147 THR X N   
858  C  CA  . THR A 111 ? 0.1105 0.1146 0.1103 -0.0069 0.0121  -0.0023 147 THR X CA  
859  C  C   . THR A 111 ? 0.1206 0.1172 0.1219 -0.0022 0.0101  -0.0046 147 THR X C   
860  O  O   . THR A 111 ? 0.1241 0.1364 0.1299 -0.0105 0.0249  -0.0096 147 THR X O   
861  C  CB  . THR A 111 ? 0.1050 0.1225 0.1200 -0.0044 0.0135  0.0014  147 THR X CB  
862  O  OG1 . THR A 111 ? 0.0911 0.1094 0.1384 -0.0048 0.0232  0.0048  147 THR X OG1 
863  C  CG2 . THR A 111 ? 0.1084 0.1035 0.1372 -0.0132 0.0076  -0.0108 147 THR X CG2 
864  N  N   . ASP A 112 ? 0.1300 0.1139 0.1153 -0.0047 0.0150  0.0023  148 ASP X N   
865  C  CA  . ASP A 112 ? 0.1216 0.1182 0.1317 -0.0005 0.0117  -0.0022 148 ASP X CA  
866  C  C   . ASP A 112 ? 0.1193 0.1152 0.1256 -0.0069 0.0137  -0.0066 148 ASP X C   
867  O  O   . ASP A 112 ? 0.0959 0.1185 0.1557 -0.0167 0.0165  -0.0068 148 ASP X O   
868  C  CB  . ASP A 112 ? 0.1231 0.1270 0.1334 -0.0017 0.0141  0.0041  148 ASP X CB  
869  C  CG  . ASP A 112 ? 0.1354 0.1331 0.1585 -0.0035 0.0088  -0.0007 148 ASP X CG  
870  O  OD1 . ASP A 112 ? 0.1373 0.1290 0.1563 -0.0034 0.0049  -0.0112 148 ASP X OD1 
871  O  OD2 . ASP A 112 ? 0.1343 0.1619 0.1497 0.0122  0.0255  0.0053  148 ASP X OD2 
872  N  N   . GLY A 113 ? 0.1170 0.1081 0.1220 0.0057  0.0086  -0.0073 149 GLY X N   
873  C  CA  . GLY A 113 ? 0.1022 0.1034 0.1172 0.0017  0.0101  0.0014  149 GLY X CA  
874  C  C   . GLY A 113 ? 0.1104 0.1122 0.1247 0.0021  0.0097  -0.0006 149 GLY X C   
875  O  O   . GLY A 113 ? 0.1221 0.1173 0.1437 -0.0176 0.0135  -0.0115 149 GLY X O   
876  N  N   . LYS A 114 ? 0.1096 0.1188 0.1262 -0.0008 0.0140  -0.0102 150 LYS X N   
877  C  CA  . LYS A 114 ? 0.1096 0.1152 0.1315 -0.0033 0.0065  -0.0063 150 LYS X CA  
878  C  C   . LYS A 114 ? 0.1062 0.1109 0.1245 -0.0035 0.0084  -0.0048 150 LYS X C   
879  O  O   . LYS A 114 ? 0.1248 0.1275 0.1423 0.0040  -0.0122 -0.0096 150 LYS X O   
880  C  CB  . LYS A 114 ? 0.1218 0.1379 0.1384 0.0005  0.0156  0.0007  150 LYS X CB  
881  C  CG  . LYS A 114 ? 0.1726 0.1763 0.1882 0.0128  0.0143  -0.0090 150 LYS X CG  
882  C  CD  . LYS A 114 ? 0.2468 0.2351 0.2395 0.0027  0.0161  0.0142  150 LYS X CD  
883  C  CE  . LYS A 114 ? 0.2886 0.2612 0.2938 0.0033  0.0145  0.0008  150 LYS X CE  
884  N  NZ  . LYS A 114 ? 0.3488 0.3305 0.3229 0.0038  0.0047  0.0177  150 LYS X NZ  
885  N  N   . LEU A 115 ? 0.1114 0.1020 0.1312 -0.0147 0.0037  -0.0028 151 LEU X N   
886  C  CA  . LEU A 115 ? 0.1188 0.1189 0.1351 -0.0011 0.0021  -0.0109 151 LEU X CA  
887  C  C   . LEU A 115 ? 0.1330 0.1404 0.1550 -0.0048 0.0032  -0.0099 151 LEU X C   
888  O  O   . LEU A 115 ? 0.1196 0.1642 0.2060 -0.0070 0.0094  -0.0194 151 LEU X O   
889  C  CB  . LEU A 115 ? 0.1210 0.1260 0.1344 -0.0074 0.0046  -0.0115 151 LEU X CB  
890  C  CG  . LEU A 115 ? 0.1286 0.1024 0.1325 -0.0044 0.0086  -0.0061 151 LEU X CG  
891  C  CD1 . LEU A 115 ? 0.1423 0.1237 0.1144 0.0009  0.0100  -0.0105 151 LEU X CD1 
892  C  CD2 . LEU A 115 ? 0.1358 0.0945 0.1317 -0.0070 0.0079  0.0067  151 LEU X CD2 
893  N  N   . ASP A 116 ? 0.1296 0.1395 0.1608 0.0033  0.0100  -0.0030 152 ASP X N   
894  C  CA  . ASP A 116 ? 0.1526 0.1760 0.1758 0.0038  0.0086  0.0011  152 ASP X CA  
895  C  C   . ASP A 116 ? 0.1641 0.1675 0.1823 0.0009  0.0047  0.0005  152 ASP X C   
896  O  O   . ASP A 116 ? 0.1440 0.1482 0.1697 0.0085  0.0105  -0.0018 152 ASP X O   
897  C  CB  . ASP A 116 ? 0.1656 0.1970 0.1848 -0.0001 0.0017  0.0014  152 ASP X CB  
898  C  CG  . ASP A 116 ? 0.2244 0.2533 0.2401 0.0050  0.0164  0.0022  152 ASP X CG  
899  O  OD1 . ASP A 116 ? 0.2769 0.2781 0.2977 -0.0178 0.0048  0.0114  152 ASP X OD1 
900  O  OD2 . ASP A 116 ? 0.2911 0.2673 0.2834 -0.0008 0.0313  -0.0036 152 ASP X OD2 
901  N  N   . GLY A 117 ? 0.1670 0.1843 0.2019 0.0041  0.0129  0.0109  153 GLY X N   
902  C  CA  . GLY A 117 ? 0.1751 0.1937 0.1996 0.0111  0.0071  0.0077  153 GLY X CA  
903  C  C   . GLY A 117 ? 0.1557 0.1972 0.1959 0.0067  0.0064  0.0060  153 GLY X C   
904  O  O   . GLY A 117 ? 0.1576 0.2133 0.2243 0.0188  0.0017  0.0015  153 GLY X O   
905  N  N   . LEU A 118 ? 0.1710 0.1971 0.1919 0.0154  0.0154  0.0040  154 LEU X N   
906  C  CA  . LEU A 118 ? 0.1815 0.1846 0.1919 0.0082  0.0139  0.0044  154 LEU X CA  
907  C  C   . LEU A 118 ? 0.1629 0.1572 0.1721 0.0114  0.0084  0.0118  154 LEU X C   
908  O  O   . LEU A 118 ? 0.1820 0.1558 0.1644 0.0255  0.0317  0.0135  154 LEU X O   
909  C  CB  . LEU A 118 ? 0.2039 0.1975 0.2063 0.0084  0.0096  0.0078  154 LEU X CB  
910  C  CG  . LEU A 118 ? 0.2353 0.2583 0.2614 0.0034  0.0103  0.0028  154 LEU X CG  
911  C  CD1 . LEU A 118 ? 0.2690 0.2717 0.2876 0.0081  0.0160  0.0038  154 LEU X CD1 
912  C  CD2 . LEU A 118 ? 0.2517 0.2748 0.2888 -0.0039 -0.0017 -0.0045 154 LEU X CD2 
913  N  N   . VAL A 119 ? 0.1439 0.1608 0.1568 0.0084  0.0112  0.0083  155 VAL X N   
914  C  CA  . VAL A 119 ? 0.1336 0.1369 0.1377 0.0059  0.0119  0.0006  155 VAL X CA  
915  C  C   . VAL A 119 ? 0.1290 0.1351 0.1399 0.0046  0.0066  -0.0020 155 VAL X C   
916  O  O   . VAL A 119 ? 0.1126 0.1626 0.1424 -0.0002 0.0061  -0.0055 155 VAL X O   
917  C  CB  . VAL A 119 ? 0.1229 0.1342 0.1348 -0.0003 0.0062  -0.0057 155 VAL X CB  
918  C  CG1 . VAL A 119 ? 0.1151 0.1172 0.1316 0.0016  -0.0029 -0.0089 155 VAL X CG1 
919  C  CG2 . VAL A 119 ? 0.1252 0.1362 0.1272 -0.0044 0.0124  -0.0006 155 VAL X CG2 
920  N  N   . PRO A 120 ? 0.1166 0.1478 0.1412 0.0070  0.0065  -0.0025 156 PRO X N   
921  C  CA  . PRO A 120 ? 0.1409 0.1582 0.1519 0.0061  0.0035  -0.0064 156 PRO X CA  
922  C  C   . PRO A 120 ? 0.1514 0.1613 0.1476 -0.0030 0.0039  -0.0050 156 PRO X C   
923  O  O   . PRO A 120 ? 0.1625 0.1738 0.1569 -0.0018 0.0177  -0.0052 156 PRO X O   
924  C  CB  . PRO A 120 ? 0.1417 0.1518 0.1526 0.0111  0.0101  -0.0103 156 PRO X CB  
925  C  CG  . PRO A 120 ? 0.1535 0.1491 0.1681 0.0025  0.0062  0.0001  156 PRO X CG  
926  C  CD  . PRO A 120 ? 0.1428 0.1571 0.1585 0.0079  0.0011  -0.0017 156 PRO X CD  
927  N  N   . SER A 121 ? 0.1618 0.1686 0.1682 0.0026  0.0070  0.0031  157 SER X N   
928  C  CA  . SER A 121 ? 0.1909 0.1903 0.1866 0.0053  0.0067  0.0060  157 SER X CA  
929  C  C   . SER A 121 ? 0.1742 0.1709 0.1690 0.0159  0.0085  0.0025  157 SER X C   
930  O  O   . SER A 121 ? 0.1889 0.1974 0.1627 0.0201  0.0219  0.0077  157 SER X O   
931  C  CB  . SER A 121 ? 0.1893 0.2175 0.2302 0.0060  0.0004  0.0102  157 SER X CB  
932  O  OG  . SER A 121 ? 0.3018 0.2736 0.3372 0.0048  -0.0021 0.0056  157 SER X OG  
933  N  N   . TYR A 122 ? 0.1561 0.1629 0.1596 0.0162  0.0056  0.0065  158 TYR X N   
934  C  CA  . TYR A 122 ? 0.1478 0.1507 0.1580 0.0144  0.0057  0.0016  158 TYR X CA  
935  C  C   . TYR A 122 ? 0.1464 0.1417 0.1624 0.0053  0.0072  -0.0024 158 TYR X C   
936  O  O   . TYR A 122 ? 0.1721 0.1606 0.1601 0.0081  0.0178  0.0073  158 TYR X O   
937  C  CB  . TYR A 122 ? 0.1549 0.1522 0.1614 0.0128  0.0058  0.0037  158 TYR X CB  
938  C  CG  . TYR A 122 ? 0.1583 0.1594 0.1797 0.0171  0.0052  0.0022  158 TYR X CG  
939  C  CD1 . TYR A 122 ? 0.1732 0.1498 0.1793 0.0108  0.0084  0.0103  158 TYR X CD1 
940  C  CD2 . TYR A 122 ? 0.1598 0.1528 0.1743 0.0135  0.0093  -0.0102 158 TYR X CD2 
941  C  CE1 . TYR A 122 ? 0.1851 0.1885 0.2064 0.0247  0.0154  0.0055  158 TYR X CE1 
942  C  CE2 . TYR A 122 ? 0.1865 0.2272 0.1905 0.0097  0.0168  0.0062  158 TYR X CE2 
943  C  CZ  . TYR A 122 ? 0.1851 0.2033 0.1902 0.0279  0.0223  -0.0032 158 TYR X CZ  
944  O  OH  . TYR A 122 ? 0.1963 0.2570 0.2386 0.0247  0.0470  0.0135  158 TYR X OH  
945  N  N   . ALA A 123 ? 0.1405 0.1411 0.1596 0.0037  0.0106  0.0014  159 ALA X N   
946  C  CA  . ALA A 123 ? 0.1358 0.1312 0.1434 0.0126  0.0027  0.0026  159 ALA X CA  
947  C  C   . ALA A 123 ? 0.1362 0.1248 0.1451 0.0087  0.0089  -0.0026 159 ALA X C   
948  O  O   . ALA A 123 ? 0.1549 0.1286 0.1463 0.0171  0.0143  0.0039  159 ALA X O   
949  C  CB  . ALA A 123 ? 0.1467 0.1226 0.1402 0.0026  0.0068  0.0000  159 ALA X CB  
950  N  N   . GLU A 124 ? 0.1435 0.1531 0.1298 0.0027  0.0109  0.0012  160 GLU X N   
951  C  CA  . GLU A 124 ? 0.1449 0.1440 0.1267 0.0084  0.0149  -0.0024 160 GLU X CA  
952  C  C   . GLU A 124 ? 0.1648 0.1564 0.1420 0.0101  0.0170  0.0050  160 GLU X C   
953  O  O   . GLU A 124 ? 0.1978 0.1732 0.1461 0.0176  0.0286  0.0239  160 GLU X O   
954  C  CB  . GLU A 124 ? 0.1579 0.1606 0.1324 0.0050  0.0156  0.0015  160 GLU X CB  
955  C  CG  . GLU A 124 ? 0.1345 0.1590 0.1302 0.0128  0.0049  -0.0036 160 GLU X CG  
956  C  CD  . GLU A 124 ? 0.1766 0.1710 0.1744 0.0036  0.0003  -0.0061 160 GLU X CD  
957  O  OE1 . GLU A 124 ? 0.1626 0.1826 0.1871 0.0198  -0.0095 -0.0287 160 GLU X OE1 
958  O  OE2 . GLU A 124 ? 0.1647 0.1791 0.1672 0.0197  -0.0086 -0.0016 160 GLU X OE2 
959  N  N   . LYS A 125 ? 0.1739 0.1681 0.1700 0.0090  0.0166  0.0049  161 LYS X N   
960  C  CA  . LYS A 125 ? 0.2004 0.1848 0.1891 0.0104  0.0083  0.0061  161 LYS X CA  
961  C  C   . LYS A 125 ? 0.1878 0.1610 0.1735 0.0105  0.0154  0.0022  161 LYS X C   
962  O  O   . LYS A 125 ? 0.2078 0.1719 0.1664 0.0255  0.0272  0.0162  161 LYS X O   
963  C  CB  . LYS A 125 ? 0.2146 0.2049 0.2132 0.0096  0.0143  -0.0001 161 LYS X CB  
964  C  CG  . LYS A 125 ? 0.2847 0.2508 0.2711 0.0050  0.0075  0.0190  161 LYS X CG  
965  C  CD  . LYS A 125 ? 0.3241 0.3268 0.3362 0.0103  0.0071  0.0007  161 LYS X CD  
966  C  CE  . LYS A 125 ? 0.3743 0.3514 0.3712 -0.0010 0.0021  0.0014  161 LYS X CE  
967  N  NZ  . LYS A 125 ? 0.3751 0.3974 0.3972 -0.0014 -0.0087 -0.0069 161 LYS X NZ  
968  N  N   . GLU A 126 ? 0.1737 0.1428 0.1664 0.0124  0.0160  0.0037  162 GLU X N   
969  C  CA  . GLU A 126 ? 0.1891 0.1551 0.1732 0.0082  0.0066  -0.0012 162 GLU X CA  
970  C  C   . GLU A 126 ? 0.1686 0.1448 0.1724 0.0024  0.0092  0.0018  162 GLU X C   
971  O  O   . GLU A 126 ? 0.2022 0.1402 0.1707 0.0097  0.0258  -0.0021 162 GLU X O   
972  C  CB  . GLU A 126 ? 0.1901 0.1603 0.1745 0.0072  0.0115  0.0008  162 GLU X CB  
973  C  CG  . GLU A 126 ? 0.2219 0.1911 0.2052 -0.0053 0.0134  -0.0031 162 GLU X CG  
974  C  CD  . GLU A 126 ? 0.2428 0.2075 0.2536 0.0043  0.0092  0.0030  162 GLU X CD  
975  O  OE1 . GLU A 126 ? 0.2910 0.2279 0.2575 0.0118  0.0232  0.0034  162 GLU X OE1 
976  O  OE2 . GLU A 126 ? 0.3055 0.1965 0.2278 0.0047  0.0435  -0.0036 162 GLU X OE2 
977  N  N   . ALA A 127 ? 0.1568 0.1347 0.1559 0.0060  0.0127  0.0021  163 ALA X N   
978  C  CA  . ALA A 127 ? 0.1626 0.1346 0.1523 0.0081  0.0078  0.0035  163 ALA X CA  
979  C  C   . ALA A 127 ? 0.1595 0.1414 0.1483 0.0032  0.0125  0.0033  163 ALA X C   
980  O  O   . ALA A 127 ? 0.1656 0.1273 0.1656 0.0221  0.0262  0.0085  163 ALA X O   
981  C  CB  . ALA A 127 ? 0.1590 0.1297 0.1471 0.0042  0.0200  0.0027  163 ALA X CB  
982  N  N   . LYS A 128 ? 0.1711 0.1592 0.1549 0.0077  0.0139  0.0063  164 LYS X N   
983  C  CA  . LYS A 128 ? 0.1837 0.1834 0.1695 0.0068  0.0064  0.0074  164 LYS X CA  
984  C  C   . LYS A 128 ? 0.2041 0.1735 0.1793 0.0129  0.0091  0.0123  164 LYS X C   
985  O  O   . LYS A 128 ? 0.2269 0.1639 0.1683 0.0242  0.0349  0.0110  164 LYS X O   
986  C  CB  . LYS A 128 ? 0.1919 0.1877 0.1782 0.0118  0.0004  0.0127  164 LYS X CB  
987  C  CG  . LYS A 128 ? 0.2200 0.2085 0.1906 0.0099  0.0055  0.0212  164 LYS X CG  
988  C  CD  . LYS A 128 ? 0.2383 0.2341 0.2229 0.0114  -0.0058 0.0028  164 LYS X CD  
989  C  CE  . LYS A 128 ? 0.2334 0.2645 0.2552 0.0002  -0.0044 0.0057  164 LYS X CE  
990  N  NZ  . LYS A 128 ? 0.2236 0.2607 0.2625 0.0283  -0.0255 0.0079  164 LYS X NZ  
991  N  N   . ILE A 129 ? 0.2075 0.1693 0.1778 0.0089  0.0096  0.0125  165 ILE X N   
992  C  CA  . ILE A 129 ? 0.2180 0.1880 0.1960 0.0018  0.0133  0.0040  165 ILE X CA  
993  C  C   . ILE A 129 ? 0.2046 0.1646 0.1848 -0.0038 0.0108  0.0062  165 ILE X C   
994  O  O   . ILE A 129 ? 0.2347 0.1508 0.2079 -0.0061 0.0525  0.0048  165 ILE X O   
995  C  CB  . ILE A 129 ? 0.2340 0.1929 0.1984 -0.0007 0.0051  0.0049  165 ILE X CB  
996  C  CG1 . ILE A 129 ? 0.2519 0.2119 0.2289 0.0003  0.0150  0.0016  165 ILE X CG1 
997  C  CG2 . ILE A 129 ? 0.2429 0.2144 0.2230 0.0012  0.0038  -0.0059 165 ILE X CG2 
998  C  CD1 . ILE A 129 ? 0.2724 0.2337 0.2330 0.0150  0.0067  0.0008  165 ILE X CD1 
999  N  N   . SER A 130 ? 0.1804 0.1312 0.1734 -0.0054 0.0139  0.0055  166 SER X N   
1000 C  CA  . SER A 130 ? 0.1764 0.1462 0.1660 -0.0073 0.0104  0.0039  166 SER X CA  
1001 C  C   . SER A 130 ? 0.1705 0.1486 0.1678 -0.0047 0.0172  0.0013  166 SER X C   
1002 O  O   . SER A 130 ? 0.2068 0.1337 0.1844 -0.0224 0.0368  0.0047  166 SER X O   
1003 C  CB  . SER A 130 ? 0.1748 0.1485 0.1649 0.0020  0.0149  0.0063  166 SER X CB  
1004 O  OG  . SER A 130 ? 0.2095 0.1159 0.1640 -0.0035 0.0305  -0.0013 166 SER X OG  
1005 N  N   . ARG A 131 ? 0.1815 0.1627 0.1588 -0.0030 0.0227  0.0040  167 ARG X N   
1006 C  CA  . ARG A 131 ? 0.1917 0.1721 0.1666 0.0010  0.0097  0.0056  167 ARG X CA  
1007 C  C   . ARG A 131 ? 0.2120 0.1828 0.1910 0.0047  0.0186  0.0119  167 ARG X C   
1008 O  O   . ARG A 131 ? 0.2282 0.1890 0.2029 -0.0056 0.0300  0.0152  167 ARG X O   
1009 C  CB  . ARG A 131 ? 0.1860 0.1570 0.1711 0.0063  0.0123  0.0139  167 ARG X CB  
1010 C  CG  . ARG A 131 ? 0.1612 0.1493 0.1684 0.0106  0.0144  0.0067  167 ARG X CG  
1011 C  CD  . ARG A 131 ? 0.1703 0.1628 0.1454 -0.0059 0.0089  0.0087  167 ARG X CD  
1012 N  NE  . ARG A 131 ? 0.1532 0.1651 0.1473 0.0061  0.0059  -0.0137 167 ARG X NE  
1013 C  CZ  . ARG A 131 ? 0.1581 0.1379 0.1618 -0.0030 0.0084  -0.0071 167 ARG X CZ  
1014 N  NH1 . ARG A 131 ? 0.1249 0.1286 0.1354 -0.0079 0.0209  0.0047  167 ARG X NH1 
1015 N  NH2 . ARG A 131 ? 0.1510 0.1910 0.1795 0.0122  0.0150  0.0067  167 ARG X NH2 
1016 N  N   . SER A 132 ? 0.2301 0.1889 0.2073 0.0065  0.0243  0.0193  168 SER X N   
1017 C  CA  . SER A 132 ? 0.2468 0.2107 0.2267 0.0069  0.0088  0.0126  168 SER X CA  
1018 C  C   . SER A 132 ? 0.2594 0.2161 0.2334 0.0000  0.0116  0.0135  168 SER X C   
1019 O  O   . SER A 132 ? 0.3024 0.2014 0.2357 -0.0118 0.0180  0.0273  168 SER X O   
1020 C  CB  . SER A 132 ? 0.2565 0.2147 0.2431 0.0082  0.0111  0.0151  168 SER X CB  
1021 O  OG  . SER A 132 ? 0.3228 0.2536 0.2712 0.0174  0.0048  0.0128  168 SER X OG  
1022 N  N   . LEU A 133 ? 0.2565 0.2118 0.2364 0.0001  0.0112  0.0107  169 LEU X N   
1023 C  CA  . LEU A 133 ? 0.2571 0.2262 0.2457 0.0012  0.0068  0.0080  169 LEU X CA  
1024 C  C   . LEU A 133 ? 0.2637 0.2379 0.2482 0.0000  0.0109  0.0035  169 LEU X C   
1025 O  O   . LEU A 133 ? 0.2903 0.2354 0.2657 -0.0172 0.0226  0.0051  169 LEU X O   
1026 C  CB  . LEU A 133 ? 0.2585 0.2146 0.2553 0.0019  0.0059  0.0078  169 LEU X CB  
1027 C  CG  . LEU A 133 ? 0.2812 0.2199 0.2596 -0.0022 0.0124  -0.0005 169 LEU X CG  
1028 C  CD1 . LEU A 133 ? 0.2731 0.2228 0.2640 -0.0012 0.0114  0.0002  169 LEU X CD1 
1029 C  CD2 . LEU A 133 ? 0.2918 0.2324 0.2658 0.0018  0.0115  0.0102  169 LEU X CD2 
1030 N  N   . GLY A 134 ? 0.2601 0.2302 0.2427 -0.0101 0.0153  0.0041  170 GLY X N   
1031 C  CA  . GLY A 134 ? 0.2484 0.2326 0.2457 -0.0010 0.0089  0.0053  170 GLY X CA  
1032 C  C   . GLY A 134 ? 0.2412 0.2275 0.2335 -0.0023 0.0119  0.0028  170 GLY X C   
1033 O  O   . GLY A 134 ? 0.2532 0.2434 0.2629 -0.0041 0.0174  0.0031  170 GLY X O   
1034 N  N   . ALA A 135 ? 0.2306 0.2112 0.2148 -0.0043 0.0140  -0.0013 171 ALA X N   
1035 C  CA  . ALA A 135 ? 0.2143 0.2104 0.2056 -0.0063 0.0084  -0.0039 171 ALA X CA  
1036 C  C   . ALA A 135 ? 0.1950 0.1858 0.1861 -0.0070 0.0112  0.0043  171 ALA X C   
1037 O  O   . ALA A 135 ? 0.2073 0.1943 0.2119 -0.0092 0.0090  -0.0016 171 ALA X O   
1038 C  CB  . ALA A 135 ? 0.2251 0.2099 0.2027 0.0003  0.0089  -0.0072 171 ALA X CB  
1039 N  N   . SER A 136 ? 0.1880 0.1609 0.1652 -0.0161 0.0153  -0.0013 172 SER X N   
1040 C  CA  . SER A 136 ? 0.1781 0.1591 0.1648 -0.0144 0.0008  0.0024  172 SER X CA  
1041 C  C   . SER A 136 ? 0.1649 0.1609 0.1504 -0.0205 0.0021  -0.0010 172 SER X C   
1042 O  O   . SER A 136 ? 0.1685 0.1726 0.1615 -0.0456 -0.0008 0.0197  172 SER X O   
1043 C  CB  . SER A 136 ? 0.1881 0.1728 0.1815 -0.0121 0.0054  -0.0036 172 SER X CB  
1044 O  OG  . SER A 136 ? 0.2573 0.1949 0.2518 -0.0157 0.0058  -0.0040 172 SER X OG  
1045 N  N   . VAL A 137 ? 0.1461 0.1297 0.1283 -0.0175 0.0042  -0.0033 173 VAL X N   
1046 C  CA  . VAL A 137 ? 0.1294 0.1232 0.1285 -0.0041 0.0035  -0.0012 173 VAL X CA  
1047 C  C   . VAL A 137 ? 0.1005 0.1017 0.1019 -0.0121 0.0064  -0.0008 173 VAL X C   
1048 O  O   . VAL A 137 ? 0.0896 0.1245 0.1266 -0.0077 0.0013  -0.0081 173 VAL X O   
1049 C  CB  . VAL A 137 ? 0.1359 0.1188 0.1314 0.0000  -0.0001 -0.0030 173 VAL X CB  
1050 C  CG1 . VAL A 137 ? 0.1187 0.1010 0.1440 0.0008  0.0016  0.0023  173 VAL X CG1 
1051 C  CG2 . VAL A 137 ? 0.1662 0.1256 0.1699 -0.0015 0.0076  -0.0034 173 VAL X CG2 
1052 N  N   . TYR A 138 ? 0.0961 0.0968 0.1130 -0.0126 0.0030  -0.0117 174 TYR X N   
1053 C  CA  . TYR A 138 ? 0.0960 0.1005 0.1082 -0.0023 0.0039  -0.0035 174 TYR X CA  
1054 C  C   . TYR A 138 ? 0.0979 0.0863 0.1053 -0.0108 0.0108  -0.0048 174 TYR X C   
1055 O  O   . TYR A 138 ? 0.1317 0.0999 0.1255 -0.0408 0.0172  -0.0059 174 TYR X O   
1056 C  CB  . TYR A 138 ? 0.0975 0.1051 0.1177 0.0000  0.0021  -0.0061 174 TYR X CB  
1057 C  CG  . TYR A 138 ? 0.0996 0.1089 0.1139 -0.0077 0.0029  -0.0143 174 TYR X CG  
1058 C  CD1 . TYR A 138 ? 0.1134 0.1270 0.1348 -0.0125 0.0266  0.0039  174 TYR X CD1 
1059 C  CD2 . TYR A 138 ? 0.1171 0.1371 0.1141 -0.0046 0.0049  -0.0139 174 TYR X CD2 
1060 C  CE1 . TYR A 138 ? 0.1535 0.1365 0.1538 -0.0180 0.0294  -0.0004 174 TYR X CE1 
1061 C  CE2 . TYR A 138 ? 0.1148 0.1254 0.1201 -0.0061 0.0126  -0.0079 174 TYR X CE2 
1062 C  CZ  . TYR A 138 ? 0.1217 0.1491 0.1374 -0.0099 0.0213  0.0068  174 TYR X CZ  
1063 O  OH  . TYR A 138 ? 0.1548 0.2168 0.1681 -0.0375 0.0418  0.0061  174 TYR X OH  
1064 N  N   . CYS A 139 ? 0.0985 0.0853 0.1146 -0.0077 0.0033  -0.0062 175 CYS X N   
1065 C  CA  . CYS A 139 ? 0.0961 0.1042 0.1109 0.0038  0.0046  -0.0023 175 CYS X CA  
1066 C  C   . CYS A 139 ? 0.1018 0.1019 0.1150 0.0045  0.0024  -0.0017 175 CYS X C   
1067 O  O   . CYS A 139 ? 0.1256 0.1200 0.1297 0.0183  0.0007  -0.0087 175 CYS X O   
1068 C  CB  . CYS A 139 ? 0.1020 0.1041 0.1103 -0.0083 0.0023  -0.0028 175 CYS X CB  
1069 S  SG  . CYS A 139 ? 0.1118 0.1105 0.1531 -0.0077 0.0104  -0.0074 175 CYS X SG  
1070 N  N   . VAL A 140 ? 0.0987 0.1116 0.1143 -0.0031 0.0071  -0.0086 176 VAL X N   
1071 C  CA  . VAL A 140 ? 0.1083 0.1190 0.1174 -0.0030 0.0003  0.0012  176 VAL X CA  
1072 C  C   . VAL A 140 ? 0.1056 0.1103 0.1052 0.0079  0.0040  -0.0039 176 VAL X C   
1073 O  O   . VAL A 140 ? 0.1263 0.1067 0.1181 -0.0006 0.0085  -0.0123 176 VAL X O   
1074 C  CB  . VAL A 140 ? 0.1187 0.1290 0.1297 -0.0048 0.0028  -0.0001 176 VAL X CB  
1075 C  CG1 . VAL A 140 ? 0.1193 0.1615 0.1536 0.0022  -0.0014 0.0156  176 VAL X CG1 
1076 C  CG2 . VAL A 140 ? 0.1099 0.1517 0.1446 0.0088  0.0068  0.0113  176 VAL X CG2 
1077 N  N   . GLY A 141 ? 0.1160 0.1235 0.1211 0.0019  0.0079  -0.0012 177 GLY X N   
1078 C  CA  . GLY A 141 ? 0.1226 0.1203 0.1312 -0.0004 0.0095  -0.0019 177 GLY X CA  
1079 C  C   . GLY A 141 ? 0.1509 0.1452 0.1506 0.0038  0.0011  0.0000  177 GLY X C   
1080 O  O   . GLY A 141 ? 0.1631 0.1616 0.1613 0.0155  0.0187  0.0044  177 GLY X O   
1081 N  N   . VAL A 142 ? 0.1691 0.1697 0.1611 0.0109  0.0093  0.0003  178 VAL X N   
1082 C  CA  . VAL A 142 ? 0.1920 0.1837 0.1934 0.0081  0.0053  0.0092  178 VAL X CA  
1083 C  C   . VAL A 142 ? 0.1976 0.2071 0.2178 0.0024  0.0006  0.0102  178 VAL X C   
1084 O  O   . VAL A 142 ? 0.1916 0.1793 0.2138 0.0200  0.0238  0.0165  178 VAL X O   
1085 C  CB  . VAL A 142 ? 0.2049 0.2097 0.1934 0.0033  -0.0044 0.0054  178 VAL X CB  
1086 C  CG1 . VAL A 142 ? 0.2267 0.2154 0.2093 0.0003  -0.0029 0.0172  178 VAL X CG1 
1087 C  CG2 . VAL A 142 ? 0.2123 0.2009 0.2037 -0.0021 -0.0043 -0.0044 178 VAL X CG2 
1088 N  N   . LEU A 143 ? 0.2272 0.2134 0.2360 0.0056  0.0051  0.0070  179 LEU X N   
1089 C  CA  . LEU A 143 ? 0.2492 0.2283 0.2556 0.0022  0.0076  0.0072  179 LEU X CA  
1090 C  C   . LEU A 143 ? 0.2472 0.2290 0.2583 0.0029  0.0078  0.0119  179 LEU X C   
1091 O  O   . LEU A 143 ? 0.2534 0.2197 0.2568 0.0028  0.0100  0.0039  179 LEU X O   
1092 C  CB  . LEU A 143 ? 0.2734 0.2460 0.2694 0.0019  0.0103  0.0099  179 LEU X CB  
1093 C  CG  . LEU A 143 ? 0.3018 0.2900 0.3000 0.0065  0.0033  0.0013  179 LEU X CG  
1094 C  CD1 . LEU A 143 ? 0.3408 0.3192 0.3159 0.0094  0.0045  -0.0028 179 LEU X CD1 
1095 C  CD2 . LEU A 143 ? 0.3350 0.3065 0.3144 0.0010  0.0010  0.0120  179 LEU X CD2 
1096 N  N   . ASP A 144 ? 0.2478 0.2258 0.2611 -0.0006 0.0044  0.0196  180 ASP X N   
1097 C  CA  . ASP A 144 ? 0.2448 0.2322 0.2599 0.0001  0.0098  0.0108  180 ASP X CA  
1098 C  C   . ASP A 144 ? 0.2229 0.2200 0.2506 -0.0021 0.0109  0.0144  180 ASP X C   
1099 O  O   . ASP A 144 ? 0.2335 0.2127 0.2710 -0.0089 0.0240  0.0232  180 ASP X O   
1100 C  CB  . ASP A 144 ? 0.2582 0.2382 0.2834 -0.0057 0.0100  0.0135  180 ASP X CB  
1101 C  CG  . ASP A 144 ? 0.3160 0.3135 0.3118 0.0037  0.0074  0.0010  180 ASP X CG  
1102 O  OD1 . ASP A 144 ? 0.3679 0.3531 0.3753 -0.0177 0.0058  -0.0023 180 ASP X OD1 
1103 O  OD2 . ASP A 144 ? 0.3494 0.3846 0.3973 -0.0181 0.0082  0.0051  180 ASP X OD2 
1104 N  N   . PHE A 145 ? 0.1876 0.1817 0.2120 0.0046  0.0120  0.0126  181 PHE X N   
1105 C  CA  . PHE A 145 ? 0.1802 0.1670 0.2002 0.0003  0.0108  -0.0010 181 PHE X CA  
1106 C  C   . PHE A 145 ? 0.1790 0.1608 0.1857 0.0005  0.0124  -0.0043 181 PHE X C   
1107 O  O   . PHE A 145 ? 0.1879 0.1545 0.1995 -0.0105 0.0148  -0.0071 181 PHE X O   
1108 C  CB  . PHE A 145 ? 0.1799 0.1545 0.1848 0.0015  0.0073  -0.0042 181 PHE X CB  
1109 C  CG  . PHE A 145 ? 0.1734 0.1707 0.2012 -0.0049 0.0152  0.0021  181 PHE X CG  
1110 C  CD1 . PHE A 145 ? 0.1719 0.1792 0.2006 -0.0189 0.0084  -0.0174 181 PHE X CD1 
1111 C  CD2 . PHE A 145 ? 0.1917 0.1625 0.2023 -0.0113 0.0056  -0.0032 181 PHE X CD2 
1112 C  CE1 . PHE A 145 ? 0.2133 0.2158 0.2197 -0.0070 0.0116  -0.0011 181 PHE X CE1 
1113 C  CE2 . PHE A 145 ? 0.1962 0.1808 0.2280 0.0037  0.0078  -0.0127 181 PHE X CE2 
1114 C  CZ  . PHE A 145 ? 0.1995 0.1975 0.2278 -0.0132 0.0194  -0.0113 181 PHE X CZ  
1115 N  N   . GLU A 146 ? 0.1631 0.1349 0.1727 -0.0072 0.0084  -0.0047 182 GLU X N   
1116 C  CA  . GLU A 146 ? 0.1657 0.1440 0.1703 -0.0153 0.0080  -0.0033 182 GLU X CA  
1117 C  C   . GLU A 146 ? 0.1566 0.1407 0.1609 -0.0147 0.0102  -0.0121 182 GLU X C   
1118 O  O   . GLU A 146 ? 0.1361 0.1226 0.1718 -0.0288 0.0095  -0.0156 182 GLU X O   
1119 C  CB  . GLU A 146 ? 0.1711 0.1509 0.1803 -0.0114 -0.0005 -0.0106 182 GLU X CB  
1120 C  CG  . GLU A 146 ? 0.2371 0.2313 0.2277 0.0000  0.0060  0.0060  182 GLU X CG  
1121 C  CD  . GLU A 146 ? 0.3024 0.2871 0.3154 -0.0159 -0.0040 -0.0062 182 GLU X CD  
1122 O  OE1 . GLU A 146 ? 0.3307 0.3117 0.3545 -0.0177 -0.0208 -0.0003 182 GLU X OE1 
1123 O  OE2 . GLU A 146 ? 0.4003 0.3465 0.3960 -0.0072 -0.0074 0.0209  182 GLU X OE2 
1124 N  N   . GLN A 147 ? 0.1518 0.1365 0.1685 -0.0132 0.0079  -0.0151 183 GLN X N   
1125 C  CA  . GLN A 147 ? 0.1517 0.1430 0.1651 -0.0154 0.0077  -0.0149 183 GLN X CA  
1126 C  C   . GLN A 147 ? 0.1421 0.1426 0.1555 -0.0115 0.0086  -0.0180 183 GLN X C   
1127 O  O   . GLN A 147 ? 0.1381 0.1244 0.1661 -0.0253 0.0172  -0.0250 183 GLN X O   
1128 C  CB  . GLN A 147 ? 0.1826 0.1510 0.1760 -0.0092 0.0060  -0.0145 183 GLN X CB  
1129 C  CG  . GLN A 147 ? 0.1800 0.1616 0.1815 -0.0036 0.0158  -0.0216 183 GLN X CG  
1130 C  CD  . GLN A 147 ? 0.1956 0.1935 0.1942 -0.0014 0.0064  -0.0120 183 GLN X CD  
1131 O  OE1 . GLN A 147 ? 0.2493 0.2097 0.2322 0.0191  -0.0012 -0.0144 183 GLN X OE1 
1132 N  NE2 . GLN A 147 ? 0.2209 0.1664 0.2043 -0.0239 0.0116  -0.0133 183 GLN X NE2 
1133 N  N   . ALA A 148 ? 0.1330 0.1371 0.1647 -0.0162 0.0063  -0.0143 184 ALA X N   
1134 C  CA  . ALA A 148 ? 0.1362 0.1455 0.1524 -0.0103 0.0013  -0.0148 184 ALA X CA  
1135 C  C   . ALA A 148 ? 0.1369 0.1361 0.1552 -0.0103 0.0045  -0.0078 184 ALA X C   
1136 O  O   . ALA A 148 ? 0.1345 0.1252 0.1491 -0.0255 -0.0044 -0.0113 184 ALA X O   
1137 C  CB  . ALA A 148 ? 0.1455 0.1472 0.1854 -0.0237 -0.0053 -0.0181 184 ALA X CB  
1138 N  N   . GLN A 149 ? 0.1171 0.1282 0.1486 -0.0085 0.0088  -0.0117 185 GLN X N   
1139 C  CA  . GLN A 149 ? 0.1165 0.1137 0.1364 -0.0010 0.0040  -0.0068 185 GLN X CA  
1140 C  C   . GLN A 149 ? 0.1133 0.1137 0.1341 -0.0013 0.0050  -0.0071 185 GLN X C   
1141 O  O   . GLN A 149 ? 0.1144 0.1098 0.1354 -0.0051 0.0179  -0.0164 185 GLN X O   
1142 C  CB  . GLN A 149 ? 0.1052 0.1065 0.1400 -0.0045 0.0060  -0.0165 185 GLN X CB  
1143 C  CG  . GLN A 149 ? 0.1205 0.1141 0.1218 -0.0114 0.0141  -0.0161 185 GLN X CG  
1144 C  CD  . GLN A 149 ? 0.1404 0.1229 0.1413 -0.0020 0.0095  -0.0164 185 GLN X CD  
1145 O  OE1 . GLN A 149 ? 0.1427 0.1617 0.2209 0.0178  0.0307  -0.0280 185 GLN X OE1 
1146 N  NE2 . GLN A 149 ? 0.1354 0.1295 0.1546 0.0047  0.0211  -0.0163 185 GLN X NE2 
1147 N  N   . LEU A 150 ? 0.1045 0.0962 0.1179 -0.0068 0.0088  -0.0048 186 LEU X N   
1148 C  CA  . LEU A 150 ? 0.1014 0.1002 0.1194 -0.0043 -0.0007 -0.0023 186 LEU X CA  
1149 C  C   . LEU A 150 ? 0.1121 0.1104 0.1237 -0.0030 0.0058  -0.0101 186 LEU X C   
1150 O  O   . LEU A 150 ? 0.1138 0.0935 0.1336 0.0000  -0.0053 -0.0053 186 LEU X O   
1151 C  CB  . LEU A 150 ? 0.1007 0.0971 0.1362 -0.0082 0.0125  -0.0032 186 LEU X CB  
1152 C  CG  . LEU A 150 ? 0.1620 0.1599 0.1649 -0.0047 -0.0068 0.0122  186 LEU X CG  
1153 C  CD1 . LEU A 150 ? 0.1746 0.1948 0.1764 -0.0058 -0.0050 0.0140  186 LEU X CD1 
1154 C  CD2 . LEU A 150 ? 0.1830 0.2100 0.1816 -0.0054 0.0058  0.0015  186 LEU X CD2 
1155 N  N   . GLU A 151 ? 0.1148 0.1207 0.1261 -0.0054 0.0049  -0.0136 187 GLU X N   
1156 C  CA  . GLU A 151 ? 0.1191 0.1220 0.1246 -0.0006 -0.0010 -0.0114 187 GLU X CA  
1157 C  C   . GLU A 151 ? 0.1216 0.1353 0.1253 -0.0041 -0.0026 -0.0037 187 GLU X C   
1158 O  O   . GLU A 151 ? 0.1461 0.1560 0.1644 -0.0055 -0.0079 -0.0037 187 GLU X O   
1159 C  CB  . GLU A 151 ? 0.1177 0.1294 0.1363 -0.0096 0.0000  -0.0096 187 GLU X CB  
1160 C  CG  . GLU A 151 ? 0.1391 0.1485 0.1462 -0.0058 0.0124  -0.0145 187 GLU X CG  
1161 C  CD  . GLU A 151 ? 0.1948 0.1890 0.1701 -0.0118 -0.0002 -0.0195 187 GLU X CD  
1162 O  OE1 . GLU A 151 ? 0.2498 0.2440 0.2580 -0.0060 -0.0271 -0.0390 187 GLU X OE1 
1163 O  OE2 . GLU A 151 ? 0.2545 0.2062 0.2134 -0.0129 0.0027  -0.0158 187 GLU X OE2 
1164 N  N   . ARG A 152 ? 0.1278 0.1277 0.1392 0.0011  0.0033  -0.0099 188 ARG X N   
1165 C  CA  . ARG A 152 ? 0.1390 0.1437 0.1445 0.0035  0.0011  -0.0014 188 ARG X CA  
1166 C  C   . ARG A 152 ? 0.1435 0.1377 0.1430 0.0041  0.0012  0.0010  188 ARG X C   
1167 O  O   . ARG A 152 ? 0.1726 0.1443 0.1756 0.0031  0.0048  0.0099  188 ARG X O   
1168 C  CB  . ARG A 152 ? 0.1413 0.1530 0.1578 0.0065  0.0026  -0.0031 188 ARG X CB  
1169 C  CG  . ARG A 152 ? 0.1470 0.1571 0.1777 0.0109  0.0027  0.0024  188 ARG X CG  
1170 C  CD  . ARG A 152 ? 0.1573 0.2061 0.1917 -0.0024 0.0044  0.0064  188 ARG X CD  
1171 N  NE  . ARG A 152 ? 0.1347 0.2028 0.1956 0.0013  -0.0017 -0.0088 188 ARG X NE  
1172 C  CZ  . ARG A 152 ? 0.1841 0.2001 0.1963 0.0048  0.0037  0.0006  188 ARG X CZ  
1173 N  NH1 . ARG A 152 ? 0.1692 0.2084 0.2280 -0.0086 -0.0091 -0.0106 188 ARG X NH1 
1174 N  NH2 . ARG A 152 ? 0.1409 0.1982 0.1899 0.0045  0.0050  -0.0054 188 ARG X NH2 
1175 N  N   . ILE A 153 ? 0.1192 0.1092 0.1176 0.0132  0.0119  -0.0001 189 ILE X N   
1176 C  CA  . ILE A 153 ? 0.1097 0.1075 0.1336 0.0129  0.0086  -0.0029 189 ILE X CA  
1177 C  C   . ILE A 153 ? 0.1170 0.1111 0.1320 0.0030  0.0113  0.0006  189 ILE X C   
1178 O  O   . ILE A 153 ? 0.1179 0.1007 0.1346 -0.0004 0.0217  -0.0045 189 ILE X O   
1179 C  CB  . ILE A 153 ? 0.1184 0.0861 0.1364 0.0048  0.0125  -0.0015 189 ILE X CB  
1180 C  CG1 . ILE A 153 ? 0.1265 0.1046 0.1352 -0.0016 0.0134  -0.0134 189 ILE X CG1 
1181 C  CG2 . ILE A 153 ? 0.0898 0.0991 0.1076 0.0195  0.0109  -0.0006 189 ILE X CG2 
1182 C  CD1 . ILE A 153 ? 0.1283 0.1429 0.1408 -0.0111 -0.0006 -0.0153 189 ILE X CD1 
1183 N  N   . ALA A 154 ? 0.1075 0.0979 0.1274 0.0064  0.0158  0.0065  190 ALA X N   
1184 C  CA  . ALA A 154 ? 0.1011 0.1021 0.1135 -0.0079 0.0134  0.0010  190 ALA X CA  
1185 C  C   . ALA A 154 ? 0.1031 0.1033 0.1186 -0.0029 0.0088  0.0049  190 ALA X C   
1186 O  O   . ALA A 154 ? 0.1055 0.1311 0.1171 0.0094  0.0206  0.0140  190 ALA X O   
1187 C  CB  . ALA A 154 ? 0.0867 0.1171 0.1175 -0.0011 0.0053  0.0050  190 ALA X CB  
1188 N  N   . ASP A 155 ? 0.1041 0.1135 0.1133 0.0092  0.0163  0.0010  191 ASP X N   
1189 C  CA  . ASP A 155 ? 0.1157 0.1166 0.1264 0.0098  0.0007  0.0023  191 ASP X CA  
1190 C  C   . ASP A 155 ? 0.1125 0.1181 0.1238 0.0100  0.0009  -0.0020 191 ASP X C   
1191 O  O   . ASP A 155 ? 0.1416 0.1378 0.1552 0.0169  -0.0024 -0.0061 191 ASP X O   
1192 C  CB  . ASP A 155 ? 0.1152 0.1306 0.1400 0.0043  -0.0002 -0.0021 191 ASP X CB  
1193 C  CG  . ASP A 155 ? 0.1442 0.1424 0.1474 -0.0049 0.0133  -0.0122 191 ASP X CG  
1194 O  OD1 . ASP A 155 ? 0.1425 0.1062 0.1420 -0.0224 0.0164  -0.0101 191 ASP X OD1 
1195 O  OD2 . ASP A 155 ? 0.1512 0.2050 0.1907 -0.0525 0.0238  -0.0182 191 ASP X OD2 
1196 N  N   . SER A 156 ? 0.1142 0.1119 0.1280 0.0057  -0.0010 -0.0109 192 SER X N   
1197 C  CA  . SER A 156 ? 0.1041 0.1241 0.1275 -0.0021 -0.0005 -0.0112 192 SER X CA  
1198 C  C   . SER A 156 ? 0.1188 0.1302 0.1300 0.0024  0.0077  -0.0107 192 SER X C   
1199 O  O   . SER A 156 ? 0.1198 0.1300 0.1322 0.0071  0.0065  -0.0197 192 SER X O   
1200 C  CB  . SER A 156 ? 0.1309 0.1373 0.1314 -0.0054 -0.0007 -0.0076 192 SER X CB  
1201 O  OG  . SER A 156 ? 0.1689 0.1439 0.1568 0.0202  0.0180  -0.0125 192 SER X OG  
1202 N  N   . LYS A 157 ? 0.1272 0.1458 0.1497 -0.0070 0.0072  -0.0088 193 LYS X N   
1203 C  CA  . LYS A 157 ? 0.1528 0.1554 0.1608 0.0012  0.0028  -0.0076 193 LYS X CA  
1204 C  C   . LYS A 157 ? 0.1472 0.1373 0.1487 0.0022  0.0086  -0.0016 193 LYS X C   
1205 O  O   . LYS A 157 ? 0.1779 0.1615 0.1688 0.0091  0.0115  0.0103  193 LYS X O   
1206 C  CB  . LYS A 157 ? 0.1756 0.1681 0.2119 -0.0031 0.0002  0.0016  193 LYS X CB  
1207 C  CG  . LYS A 157 ? 0.2500 0.2417 0.2483 0.0001  0.0037  -0.0063 193 LYS X CG  
1208 C  CD  . LYS A 157 ? 0.3092 0.3046 0.3169 -0.0190 -0.0103 -0.0108 193 LYS X CD  
1209 C  CE  . LYS A 157 ? 0.3367 0.3331 0.3476 -0.0013 -0.0020 -0.0126 193 LYS X CE  
1210 N  NZ  . LYS A 157 ? 0.3485 0.3565 0.3805 -0.0067 -0.0089 -0.0140 193 LYS X NZ  
1211 N  N   . GLU A 158 ? 0.1198 0.1176 0.1248 0.0008  0.0041  -0.0125 194 GLU X N   
1212 C  CA  . GLU A 158 ? 0.1104 0.1149 0.1176 -0.0015 0.0031  -0.0116 194 GLU X CA  
1213 C  C   . GLU A 158 ? 0.1090 0.1194 0.1104 -0.0007 0.0064  -0.0137 194 GLU X C   
1214 O  O   . GLU A 158 ? 0.1308 0.1309 0.1297 0.0211  0.0021  -0.0150 194 GLU X O   
1215 C  CB  . GLU A 158 ? 0.1100 0.1060 0.1071 -0.0034 0.0092  -0.0110 194 GLU X CB  
1216 C  CG  . GLU A 158 ? 0.0827 0.1300 0.1155 -0.0010 -0.0019 -0.0053 194 GLU X CG  
1217 C  CD  . GLU A 158 ? 0.1097 0.1082 0.1236 -0.0001 0.0054  -0.0126 194 GLU X CD  
1218 O  OE1 . GLU A 158 ? 0.1110 0.0854 0.1316 0.0069  0.0103  -0.0202 194 GLU X OE1 
1219 O  OE2 . GLU A 158 ? 0.1137 0.1068 0.1288 0.0098  0.0057  -0.0182 194 GLU X OE2 
1220 N  N   . GLN A 159 ? 0.1066 0.1116 0.1128 0.0017  0.0109  -0.0056 195 GLN X N   
1221 C  CA  . GLN A 159 ? 0.1084 0.1059 0.1116 0.0004  0.0063  0.0026  195 GLN X CA  
1222 C  C   . GLN A 159 ? 0.1055 0.1071 0.1062 0.0044  0.0074  -0.0057 195 GLN X C   
1223 O  O   . GLN A 159 ? 0.1257 0.1151 0.1110 -0.0075 0.0082  -0.0072 195 GLN X O   
1224 C  CB  . GLN A 159 ? 0.1243 0.1091 0.1096 -0.0012 0.0081  -0.0007 195 GLN X CB  
1225 C  CG  . GLN A 159 ? 0.1313 0.1128 0.1296 0.0010  0.0154  -0.0069 195 GLN X CG  
1226 C  CD  . GLN A 159 ? 0.1578 0.1519 0.1540 -0.0032 0.0058  -0.0028 195 GLN X CD  
1227 O  OE1 . GLN A 159 ? 0.1764 0.1625 0.2153 0.0037  0.0029  0.0004  195 GLN X OE1 
1228 N  NE2 . GLN A 159 ? 0.1693 0.1727 0.1702 -0.0118 0.0164  -0.0242 195 GLN X NE2 
1229 N  N   . VAL A 160 ? 0.1268 0.1148 0.1163 0.0017  0.0134  -0.0062 196 VAL X N   
1230 C  CA  . VAL A 160 ? 0.1206 0.1221 0.1228 0.0019  -0.0014 -0.0031 196 VAL X CA  
1231 C  C   . VAL A 160 ? 0.1198 0.1142 0.1217 0.0024  0.0097  -0.0068 196 VAL X C   
1232 O  O   . VAL A 160 ? 0.1479 0.1068 0.1508 0.0170  0.0085  -0.0223 196 VAL X O   
1233 C  CB  . VAL A 160 ? 0.1198 0.1195 0.1317 -0.0071 0.0046  -0.0038 196 VAL X CB  
1234 C  CG1 . VAL A 160 ? 0.1286 0.1300 0.1430 -0.0015 -0.0083 0.0079  196 VAL X CG1 
1235 C  CG2 . VAL A 160 ? 0.1368 0.1280 0.1234 0.0024  0.0100  -0.0073 196 VAL X CG2 
1236 N  N   . PHE A 161 ? 0.1245 0.1116 0.1280 0.0040  0.0078  -0.0047 197 PHE X N   
1237 C  CA  . PHE A 161 ? 0.1323 0.1349 0.1339 0.0140  0.0060  -0.0010 197 PHE X CA  
1238 C  C   . PHE A 161 ? 0.1598 0.1472 0.1431 0.0123  0.0062  0.0005  197 PHE X C   
1239 O  O   . PHE A 161 ? 0.1721 0.1254 0.1318 0.0176  0.0048  -0.0101 197 PHE X O   
1240 C  CB  . PHE A 161 ? 0.1411 0.1315 0.1335 0.0073  -0.0017 -0.0004 197 PHE X CB  
1241 C  CG  . PHE A 161 ? 0.1372 0.1355 0.1359 0.0051  0.0029  0.0060  197 PHE X CG  
1242 C  CD1 . PHE A 161 ? 0.1496 0.1397 0.1616 0.0057  0.0086  -0.0045 197 PHE X CD1 
1243 C  CD2 . PHE A 161 ? 0.1536 0.1377 0.1539 -0.0029 0.0153  0.0045  197 PHE X CD2 
1244 C  CE1 . PHE A 161 ? 0.1301 0.1294 0.1550 -0.0044 0.0079  -0.0122 197 PHE X CE1 
1245 C  CE2 . PHE A 161 ? 0.1488 0.1606 0.1396 -0.0057 0.0042  -0.0033 197 PHE X CE2 
1246 C  CZ  . PHE A 161 ? 0.1284 0.1544 0.1381 -0.0066 0.0242  -0.0003 197 PHE X CZ  
1247 N  N   . PRO A 162 ? 0.1779 0.1581 0.1618 0.0092  0.0056  -0.0058 198 PRO X N   
1248 C  CA  . PRO A 162 ? 0.1855 0.1655 0.1712 0.0068  0.0128  0.0032  198 PRO X CA  
1249 C  C   . PRO A 162 ? 0.1830 0.1708 0.1857 -0.0011 0.0105  0.0069  198 PRO X C   
1250 O  O   . PRO A 162 ? 0.1869 0.1817 0.1805 0.0143  0.0203  0.0056  198 PRO X O   
1251 C  CB  . PRO A 162 ? 0.1731 0.1615 0.1822 0.0095  0.0041  0.0072  198 PRO X CB  
1252 C  CG  . PRO A 162 ? 0.2223 0.1816 0.1970 0.0043  0.0047  0.0028  198 PRO X CG  
1253 C  CD  . PRO A 162 ? 0.1975 0.1591 0.1696 0.0090  0.0151  -0.0053 198 PRO X CD  
1254 N  N   . VAL A 163 ? 0.2072 0.2140 0.2060 -0.0072 0.0125  0.0014  199 VAL X N   
1255 C  CA  . VAL A 163 ? 0.2291 0.2354 0.2325 0.0021  0.0001  0.0069  199 VAL X CA  
1256 C  C   . VAL A 163 ? 0.2604 0.2678 0.2637 0.0115  0.0023  0.0037  199 VAL X C   
1257 O  O   . VAL A 163 ? 0.2527 0.2704 0.2791 0.0198  -0.0084 0.0097  199 VAL X O   
1258 C  CB  . VAL A 163 ? 0.2373 0.2484 0.2368 -0.0017 0.0035  0.0054  199 VAL X CB  
1259 C  CG1 . VAL A 163 ? 0.2434 0.2417 0.2308 0.0049  -0.0055 0.0159  199 VAL X CG1 
1260 C  CG2 . VAL A 163 ? 0.2394 0.2504 0.2495 -0.0035 0.0007  0.0023  199 VAL X CG2 
1261 N  N   . LYS A 164 ? 0.3006 0.3033 0.3036 0.0076  0.0025  0.0051  200 LYS X N   
1262 C  CA  . LYS A 164 ? 0.3646 0.3506 0.3643 0.0070  -0.0029 0.0041  200 LYS X CA  
1263 C  C   . LYS A 164 ? 0.3910 0.3750 0.3822 0.0027  -0.0009 -0.0005 200 LYS X C   
1264 O  O   . LYS A 164 ? 0.4230 0.3992 0.4014 0.0013  -0.0086 -0.0012 200 LYS X O   
1265 C  CB  . LYS A 164 ? 0.3672 0.3607 0.3756 0.0063  0.0032  0.0032  200 LYS X CB  
1266 C  CG  . LYS A 164 ? 0.4162 0.4158 0.4045 0.0037  -0.0062 -0.0014 200 LYS X CG  
1267 C  CD  . LYS A 164 ? 0.4391 0.4462 0.4506 -0.0012 0.0042  0.0036  200 LYS X CD  
1268 C  CE  . LYS A 164 ? 0.4738 0.4707 0.4624 0.0032  -0.0001 0.0003  200 LYS X CE  
1269 N  NZ  . LYS A 164 ? 0.4841 0.4916 0.4930 0.0041  0.0063  -0.0020 200 LYS X NZ  
1270 N  N   . GLY A 165 ? 0.4110 0.4088 0.4162 -0.0014 0.0010  -0.0001 201 GLY X N   
1271 C  CA  . GLY A 165 ? 0.4302 0.4244 0.4263 0.0002  0.0030  -0.0022 201 GLY X CA  
1272 C  C   . GLY A 165 ? 0.4394 0.4378 0.4365 0.0003  0.0043  0.0022  201 GLY X C   
1273 O  O   . GLY A 165 ? 0.4483 0.4320 0.4431 0.0041  0.0048  0.0011  201 GLY X O   
1274 N  N   . GLY A 166 ? 0.4489 0.4470 0.4507 0.0034  0.0023  0.0021  202 GLY X N   
1275 C  CA  . GLY A 166 ? 0.4548 0.4542 0.4540 0.0004  0.0024  0.0016  202 GLY X CA  
1276 C  C   . GLY A 166 ? 0.4531 0.4532 0.4562 -0.0002 0.0001  -0.0010 202 GLY X C   
1277 O  O   . GLY A 166 ? 0.4647 0.4685 0.4709 0.0001  0.0066  -0.0021 202 GLY X O   
1278 N  N   . PHE A 167 ? 0.4430 0.4457 0.4519 -0.0003 0.0005  -0.0004 203 PHE X N   
1279 C  CA  . PHE A 167 ? 0.4322 0.4358 0.4360 0.0022  -0.0008 0.0035  203 PHE X CA  
1280 C  C   . PHE A 167 ? 0.4018 0.4095 0.4168 -0.0009 0.0037  0.0021  203 PHE X C   
1281 O  O   . PHE A 167 ? 0.4058 0.4040 0.4180 0.0028  0.0056  0.0082  203 PHE X O   
1282 C  CB  . PHE A 167 ? 0.4416 0.4451 0.4527 -0.0006 0.0024  0.0014  203 PHE X CB  
1283 C  CG  . PHE A 167 ? 0.4819 0.4946 0.4791 0.0031  -0.0069 0.0033  203 PHE X CG  
1284 C  CD1 . PHE A 167 ? 0.5222 0.5063 0.5186 -0.0035 -0.0029 0.0034  203 PHE X CD1 
1285 C  CD2 . PHE A 167 ? 0.5136 0.5025 0.5130 -0.0017 -0.0022 -0.0028 203 PHE X CD2 
1286 C  CE1 . PHE A 167 ? 0.5308 0.5275 0.5274 -0.0008 -0.0066 0.0033  203 PHE X CE1 
1287 C  CE2 . PHE A 167 ? 0.5261 0.5248 0.5208 0.0000  -0.0038 -0.0014 203 PHE X CE2 
1288 C  CZ  . PHE A 167 ? 0.5332 0.5277 0.5330 0.0004  -0.0038 0.0018  203 PHE X CZ  
1289 N  N   . GLN A 168 ? 0.3721 0.3672 0.3692 0.0015  0.0013  0.0040  204 GLN X N   
1290 C  CA  . GLN A 168 ? 0.3385 0.3315 0.3398 0.0012  0.0076  -0.0010 204 GLN X CA  
1291 C  C   . GLN A 168 ? 0.2999 0.2951 0.2905 -0.0042 0.0093  0.0000  204 GLN X C   
1292 O  O   . GLN A 168 ? 0.2904 0.2759 0.2776 -0.0028 0.0075  0.0006  204 GLN X O   
1293 C  CB  . GLN A 168 ? 0.3465 0.3401 0.3426 -0.0056 0.0031  -0.0005 204 GLN X CB  
1294 C  CG  . GLN A 168 ? 0.3824 0.3637 0.3768 0.0024  0.0040  -0.0004 204 GLN X CG  
1295 C  CD  . GLN A 168 ? 0.3989 0.4188 0.4194 -0.0079 0.0041  0.0076  204 GLN X CD  
1296 O  OE1 . GLN A 168 ? 0.4151 0.3902 0.3756 -0.0060 0.0030  -0.0037 204 GLN X OE1 
1297 N  NE2 . GLN A 168 ? 0.4519 0.4525 0.4260 -0.0025 -0.0013 0.0075  204 GLN X NE2 
1298 N  N   . ALA A 169 ? 0.2500 0.2513 0.2558 -0.0066 0.0054  0.0088  205 ALA X N   
1299 C  CA  . ALA A 169 ? 0.2126 0.2336 0.2232 -0.0020 0.0008  0.0085  205 ALA X CA  
1300 C  C   . ALA A 169 ? 0.2002 0.2191 0.2215 0.0004  -0.0053 0.0103  205 ALA X C   
1301 O  O   . ALA A 169 ? 0.1518 0.2227 0.1998 0.0060  -0.0030 0.0215  205 ALA X O   
1302 C  CB  . ALA A 169 ? 0.1986 0.2097 0.2171 -0.0014 -0.0039 0.0058  205 ALA X CB  
1303 N  N   . LEU A 170 ? 0.2030 0.2330 0.2304 0.0016  -0.0055 0.0145  206 LEU X N   
1304 C  CA  . LEU A 170 ? 0.2052 0.2299 0.2297 -0.0003 -0.0062 0.0076  206 LEU X CA  
1305 C  C   . LEU A 170 ? 0.1957 0.2243 0.2268 0.0020  -0.0076 0.0058  206 LEU X C   
1306 O  O   . LEU A 170 ? 0.1447 0.2343 0.2106 -0.0006 -0.0103 0.0142  206 LEU X O   
1307 C  CB  . LEU A 170 ? 0.2144 0.2408 0.2430 0.0028  -0.0026 0.0138  206 LEU X CB  
1308 C  CG  . LEU A 170 ? 0.2515 0.2794 0.2585 -0.0023 -0.0028 0.0071  206 LEU X CG  
1309 C  CD1 . LEU A 170 ? 0.2877 0.3136 0.2909 0.0013  -0.0078 0.0104  206 LEU X CD1 
1310 C  CD2 . LEU A 170 ? 0.2852 0.2975 0.2842 0.0046  -0.0089 -0.0029 206 LEU X CD2 
1311 N  N   . LYS A 171 ? 0.2046 0.2336 0.2287 0.0065  -0.0052 0.0034  207 LYS X N   
1312 C  CA  . LYS A 171 ? 0.2299 0.2378 0.2376 0.0029  0.0022  0.0006  207 LYS X CA  
1313 C  C   . LYS A 171 ? 0.1992 0.2158 0.2130 -0.0015 0.0076  -0.0028 207 LYS X C   
1314 O  O   . LYS A 171 ? 0.1841 0.1909 0.2168 0.0032  0.0211  -0.0090 207 LYS X O   
1315 C  CB  . LYS A 171 ? 0.2659 0.2574 0.2631 0.0049  0.0034  -0.0001 207 LYS X CB  
1316 C  CG  . LYS A 171 ? 0.3109 0.3362 0.3330 0.0043  -0.0064 0.0008  207 LYS X CG  
1317 C  CD  . LYS A 171 ? 0.3815 0.3688 0.3917 0.0007  0.0029  -0.0075 207 LYS X CD  
1318 C  CE  . LYS A 171 ? 0.4078 0.4101 0.3994 0.0008  0.0000  -0.0016 207 LYS X CE  
1319 N  NZ  . LYS A 171 ? 0.4270 0.4227 0.4473 0.0071  0.0014  -0.0047 207 LYS X NZ  
1320 N  N   . GLY A 172 ? 0.1820 0.1890 0.2037 0.0077  0.0053  -0.0114 208 GLY X N   
1321 C  CA  . GLY A 172 ? 0.1733 0.1789 0.1833 -0.0045 0.0075  -0.0043 208 GLY X CA  
1322 C  C   . GLY A 172 ? 0.1481 0.1753 0.1732 0.0005  0.0030  -0.0020 208 GLY X C   
1323 O  O   . GLY A 172 ? 0.1205 0.1995 0.1544 -0.0057 0.0065  -0.0039 208 GLY X O   
1324 N  N   . ILE A 173 ? 0.1451 0.1879 0.1709 0.0010  -0.0003 0.0024  209 ILE X N   
1325 C  CA  . ILE A 173 ? 0.1469 0.1816 0.1599 0.0001  -0.0007 -0.0080 209 ILE X CA  
1326 C  C   . ILE A 173 ? 0.1513 0.1658 0.1573 -0.0002 0.0069  -0.0042 209 ILE X C   
1327 O  O   . ILE A 173 ? 0.1332 0.1831 0.1460 0.0033  0.0063  -0.0167 209 ILE X O   
1328 C  CB  . ILE A 173 ? 0.1569 0.1969 0.1672 0.0062  0.0031  -0.0060 209 ILE X CB  
1329 C  CG1 . ILE A 173 ? 0.1555 0.1761 0.1678 -0.0086 -0.0007 0.0026  209 ILE X CG1 
1330 C  CG2 . ILE A 173 ? 0.1858 0.2078 0.2002 0.0090  0.0061  -0.0078 209 ILE X CG2 
1331 C  CD1 . ILE A 173 ? 0.2008 0.2188 0.1960 0.0038  0.0024  -0.0056 209 ILE X CD1 
1332 N  N   . ILE A 174 ? 0.1498 0.1684 0.1594 -0.0041 0.0040  0.0008  210 ILE X N   
1333 C  CA  . ILE A 174 ? 0.1536 0.1926 0.1682 -0.0037 0.0025  -0.0068 210 ILE X CA  
1334 C  C   . ILE A 174 ? 0.1498 0.1762 0.1608 -0.0080 -0.0001 -0.0104 210 ILE X C   
1335 O  O   . ILE A 174 ? 0.1453 0.2048 0.1690 -0.0052 0.0043  -0.0225 210 ILE X O   
1336 C  CB  . ILE A 174 ? 0.1614 0.1977 0.1740 -0.0052 0.0016  -0.0037 210 ILE X CB  
1337 C  CG1 . ILE A 174 ? 0.1777 0.2285 0.1833 0.0037  -0.0053 -0.0035 210 ILE X CG1 
1338 C  CG2 . ILE A 174 ? 0.1685 0.2172 0.1956 -0.0065 0.0027  -0.0010 210 ILE X CG2 
1339 C  CD1 . ILE A 174 ? 0.2011 0.2203 0.2278 0.0052  0.0039  0.0078  210 ILE X CD1 
1340 N  N   . ASN A 175 ? 0.1580 0.1838 0.1595 -0.0073 -0.0006 -0.0149 211 ASN X N   
1341 C  CA  . ASN A 175 ? 0.1543 0.1705 0.1543 -0.0076 0.0049  -0.0057 211 ASN X CA  
1342 C  C   . ASN A 175 ? 0.1596 0.1587 0.1527 -0.0048 0.0039  -0.0096 211 ASN X C   
1343 O  O   . ASN A 175 ? 0.1433 0.1807 0.1659 -0.0149 0.0118  -0.0105 211 ASN X O   
1344 C  CB  . ASN A 175 ? 0.1706 0.1802 0.1548 -0.0095 0.0038  -0.0030 211 ASN X CB  
1345 C  CG  . ASN A 175 ? 0.1837 0.2006 0.1829 0.0052  0.0093  -0.0109 211 ASN X CG  
1346 O  OD1 . ASN A 175 ? 0.2352 0.2666 0.2925 0.0141  -0.0022 -0.0179 211 ASN X OD1 
1347 N  ND2 . ASN A 175 ? 0.2845 0.2323 0.2248 0.0140  -0.0111 -0.0082 211 ASN X ND2 
1348 N  N   . SER A 176 ? 0.1423 0.1635 0.1429 -0.0057 0.0039  -0.0066 212 SER X N   
1349 C  CA  . SER A 176 ? 0.1498 0.1592 0.1469 -0.0059 0.0016  -0.0038 212 SER X CA  
1350 C  C   . SER A 176 ? 0.1688 0.1672 0.1666 0.0004  0.0000  -0.0042 212 SER X C   
1351 O  O   . SER A 176 ? 0.1887 0.1681 0.1759 -0.0208 -0.0003 -0.0041 212 SER X O   
1352 C  CB  . SER A 176 ? 0.1456 0.1695 0.1660 -0.0001 0.0004  -0.0061 212 SER X CB  
1353 O  OG  . SER A 176 ? 0.2010 0.1683 0.1711 0.0056  0.0046  -0.0161 212 SER X OG  
1354 N  N   . ILE A 177 ? 0.1792 0.1797 0.1740 -0.0101 -0.0015 -0.0008 213 ILE X N   
1355 C  CA  . ILE A 177 ? 0.1897 0.1845 0.1860 -0.0098 -0.0002 -0.0025 213 ILE X CA  
1356 C  C   . ILE A 177 ? 0.1860 0.1945 0.1923 -0.0110 -0.0048 -0.0032 213 ILE X C   
1357 O  O   . ILE A 177 ? 0.2012 0.1978 0.2009 -0.0091 0.0075  -0.0072 213 ILE X O   
1358 C  CB  . ILE A 177 ? 0.2008 0.1988 0.1986 -0.0101 -0.0004 -0.0022 213 ILE X CB  
1359 C  CG1 . ILE A 177 ? 0.2205 0.2115 0.2048 -0.0079 0.0014  0.0005  213 ILE X CG1 
1360 C  CG2 . ILE A 177 ? 0.2341 0.2122 0.2211 -0.0166 -0.0014 -0.0087 213 ILE X CG2 
1361 C  CD1 . ILE A 177 ? 0.2440 0.2351 0.2109 -0.0124 -0.0058 -0.0054 213 ILE X CD1 
1362 N  N   . LEU A 178 ? 0.1846 0.1910 0.1977 -0.0147 0.0042  -0.0064 214 LEU X N   
1363 C  CA  . LEU A 178 ? 0.1971 0.2114 0.2081 -0.0138 0.0054  -0.0013 214 LEU X CA  
1364 C  C   . LEU A 178 ? 0.2028 0.2166 0.2094 -0.0124 0.0066  -0.0033 214 LEU X C   
1365 O  O   . LEU A 178 ? 0.2108 0.2300 0.2154 -0.0253 0.0194  -0.0064 214 LEU X O   
1366 C  CB  . LEU A 178 ? 0.2098 0.2263 0.2261 -0.0104 0.0090  -0.0021 214 LEU X CB  
1367 C  CG  . LEU A 178 ? 0.2387 0.2418 0.2336 -0.0066 0.0030  0.0074  214 LEU X CG  
1368 C  CD1 . LEU A 178 ? 0.2429 0.2485 0.2661 -0.0054 0.0042  0.0075  214 LEU X CD1 
1369 C  CD2 . LEU A 178 ? 0.2580 0.2709 0.2579 -0.0111 -0.0082 0.0051  214 LEU X CD2 
1370 N  N   . ALA A 179 ? 0.1982 0.2146 0.2021 -0.0132 0.0063  -0.0012 215 ALA X N   
1371 C  CA  . ALA A 179 ? 0.1927 0.2075 0.1971 -0.0062 0.0056  -0.0022 215 ALA X CA  
1372 C  C   . ALA A 179 ? 0.2016 0.2172 0.1981 -0.0113 0.0040  -0.0010 215 ALA X C   
1373 O  O   . ALA A 179 ? 0.2332 0.2474 0.2073 -0.0188 0.0117  0.0090  215 ALA X O   
1374 C  CB  . ALA A 179 ? 0.1978 0.2024 0.1841 -0.0123 0.0045  -0.0029 215 ALA X CB  
1375 N  N   . GLN A 180 ? 0.1991 0.2148 0.1900 -0.0132 0.0097  -0.0020 216 GLN X N   
1376 C  CA  . GLN A 180 ? 0.1918 0.2121 0.2001 -0.0086 0.0047  -0.0081 216 GLN X CA  
1377 C  C   . GLN A 180 ? 0.2062 0.2124 0.1997 -0.0146 0.0101  -0.0041 216 GLN X C   
1378 O  O   . GLN A 180 ? 0.2081 0.2211 0.1969 -0.0136 0.0135  -0.0085 216 GLN X O   
1379 C  CB  . GLN A 180 ? 0.2020 0.2145 0.2070 -0.0108 0.0074  -0.0111 216 GLN X CB  
1380 C  CG  . GLN A 180 ? 0.2297 0.2432 0.2521 -0.0180 -0.0053 -0.0055 216 GLN X CG  
1381 C  CD  . GLN A 180 ? 0.2521 0.2868 0.3006 -0.0033 0.0139  -0.0073 216 GLN X CD  
1382 O  OE1 . GLN A 180 ? 0.3015 0.3058 0.3747 -0.0218 0.0112  -0.0162 216 GLN X OE1 
1383 N  NE2 . GLN A 180 ? 0.2780 0.2867 0.3002 -0.0064 0.0085  -0.0127 216 GLN X NE2 
1384 N  N   . SER A 181 ? 0.1993 0.2012 0.1990 -0.0186 0.0071  -0.0077 217 SER X N   
1385 C  CA  . SER A 181 ? 0.2048 0.2212 0.2156 -0.0137 0.0025  -0.0041 217 SER X CA  
1386 C  C   . SER A 181 ? 0.2202 0.2284 0.2252 -0.0082 0.0052  -0.0069 217 SER X C   
1387 O  O   . SER A 181 ? 0.2458 0.2697 0.2401 -0.0233 0.0088  -0.0129 217 SER X O   
1388 C  CB  . SER A 181 ? 0.2040 0.2284 0.2144 -0.0118 0.0050  -0.0061 217 SER X CB  
1389 O  OG  . SER A 181 ? 0.2355 0.2551 0.2239 -0.0264 0.0048  -0.0183 217 SER X OG  
1390 N  N   . CYS A 182 ? 0.2209 0.2345 0.2293 -0.0094 0.0077  -0.0004 218 CYS X N   
1391 C  CA  . CYS A 182 ? 0.2278 0.2422 0.2371 -0.0039 0.0077  -0.0045 218 CYS X CA  
1392 C  C   . CYS A 182 ? 0.2428 0.2615 0.2519 -0.0002 0.0050  -0.0025 218 CYS X C   
1393 O  O   . CYS A 182 ? 0.2509 0.2845 0.2769 -0.0147 0.0149  -0.0155 218 CYS X O   
1394 C  CB  . CYS A 182 ? 0.2203 0.2456 0.2395 -0.0113 0.0081  -0.0053 218 CYS X CB  
1395 S  SG  . CYS A 182 ? 0.2084 0.2303 0.2282 -0.0447 0.0241  -0.0083 218 CYS X SG  
1396 O  OXT . CYS A 182 ? 0.2468 0.2697 0.2664 0.0004  0.0070  0.0043  218 CYS X OXT 
1397 MG MG  . MG  B .   ? 0.1257 0.1261 0.1195 -0.0085 0.0214  0.0225  219 MG  X MG  
1398 O  O   . HOH C .   ? 0.1225 0.1222 0.1089 -0.0138 0.0308  -0.0079 220 HOH X O   
1399 O  O   . HOH C .   ? 0.1311 0.1300 0.1670 0.0017  0.0041  0.0156  221 HOH X O   
1400 O  O   . HOH C .   ? 0.1224 0.1238 0.1435 0.0081  -0.0011 -0.0102 222 HOH X O   
1401 O  O   . HOH C .   ? 0.1672 0.1514 0.1439 0.0049  0.0277  -0.0165 223 HOH X O   
1402 O  O   . HOH C .   ? 0.1182 0.2013 0.1706 -0.0221 0.0152  -0.0060 224 HOH X O   
1403 O  O   . HOH C .   ? 0.1484 0.1336 0.1515 -0.0008 0.0044  -0.0188 225 HOH X O   
1404 O  O   . HOH C .   ? 0.2215 0.2250 0.2234 0.0219  0.0084  0.0037  226 HOH X O   
1405 O  O   . HOH C .   ? 0.2090 0.2653 0.2143 0.0046  0.0078  -0.0210 227 HOH X O   
1406 O  O   . HOH C .   ? 0.2049 0.2461 0.2716 -0.0431 0.0215  0.0150  228 HOH X O   
1407 O  O   . HOH C .   ? 0.2119 0.1641 0.1933 0.0277  0.0099  -0.0074 229 HOH X O   
1408 O  O   . HOH C .   ? 0.1993 0.2697 0.2210 -0.0279 0.0445  0.0178  230 HOH X O   
1409 O  O   . HOH C .   ? 0.1945 0.2312 0.2288 -0.0063 0.0219  0.0200  231 HOH X O   
1410 O  O   . HOH C .   ? 0.2285 0.2554 0.2410 -0.0041 0.0435  -0.0301 232 HOH X O   
1411 O  O   . HOH C .   ? 0.2431 0.1726 0.2216 0.0117  -0.0016 -0.0001 233 HOH X O   
1412 O  O   . HOH C .   ? 0.2398 0.2285 0.2852 0.0334  -0.0057 0.0294  234 HOH X O   
1413 O  O   . HOH C .   ? 0.2106 0.1987 0.2499 0.0356  -0.0057 -0.0139 235 HOH X O   
1414 O  O   . HOH C .   ? 0.2481 0.2106 0.2449 -0.0001 0.0208  -0.0107 236 HOH X O   
1415 O  O   . HOH C .   ? 0.2452 0.2092 0.2835 0.0330  0.0214  0.0368  237 HOH X O   
1416 O  O   . HOH C .   ? 0.2327 0.2107 0.2182 0.0417  -0.0068 -0.0136 238 HOH X O   
1417 O  O   . HOH C .   ? 0.3238 0.2114 0.3048 -0.0357 -0.0013 -0.0134 239 HOH X O   
1418 O  O   . HOH C .   ? 0.2880 0.1916 0.2639 -0.0591 0.0572  0.0077  240 HOH X O   
1419 O  O   . HOH C .   ? 0.2114 0.1886 0.2620 -0.0870 0.0272  -0.0126 241 HOH X O   
1420 O  O   . HOH C .   ? 0.3309 0.3406 0.2673 -0.0146 -0.0140 -0.0287 242 HOH X O   
1421 O  O   . HOH C .   ? 0.2469 0.2638 0.2430 0.0181  0.0025  0.0241  243 HOH X O   
1422 O  O   . HOH C .   ? 0.2420 0.1920 0.2432 -0.0111 0.0304  0.0074  244 HOH X O   
1423 O  O   . HOH C .   ? 0.2519 0.2897 0.2600 -0.0215 0.0122  -0.0353 245 HOH X O   
1424 O  O   . HOH C .   ? 0.1939 0.2274 0.2873 0.0476  0.0355  0.0114  246 HOH X O   
1425 O  O   . HOH C .   ? 0.3214 0.3030 0.3163 0.0001  0.0034  -0.0104 247 HOH X O   
1426 O  O   . HOH C .   ? 0.2684 0.2436 0.2999 -0.0475 -0.0033 -0.0069 248 HOH X O   
1427 O  O   . HOH C .   ? 0.3464 0.2705 0.3018 -0.0029 0.0360  -0.0237 249 HOH X O   
1428 O  O   . HOH C .   ? 0.2947 0.2251 0.2451 0.0041  0.0275  -0.0286 250 HOH X O   
1429 O  O   . HOH C .   ? 0.3016 0.3517 0.3122 -0.0101 0.0113  0.0018  251 HOH X O   
1430 O  O   . HOH C .   ? 0.3315 0.3246 0.3369 -0.0092 0.0114  -0.0031 252 HOH X O   
1431 O  O   . HOH C .   ? 0.3449 0.3176 0.3548 -0.0397 0.0240  0.0042  253 HOH X O   
1432 O  O   . HOH C .   ? 0.2463 0.3237 0.3510 -0.0242 -0.0481 -0.0175 254 HOH X O   
1433 O  O   . HOH C .   ? 0.2792 0.2545 0.3540 0.0062  0.0293  -0.0285 255 HOH X O   
1434 O  O   . HOH C .   ? 0.4162 0.3020 0.3164 0.0103  0.0118  0.0163  256 HOH X O   
1435 O  O   . HOH C .   ? 0.3512 0.2971 0.3462 -0.0252 0.0317  -0.0305 257 HOH X O   
1436 O  O   . HOH C .   ? 0.2883 0.3091 0.3167 -0.0480 0.0158  -0.0244 258 HOH X O   
1437 O  O   . HOH C .   ? 0.3292 0.3697 0.3391 0.0045  0.0025  0.0000  259 HOH X O   
1438 O  O   . HOH C .   ? 0.3164 0.3230 0.2907 -0.0437 0.0484  -0.0180 260 HOH X O   
1439 O  O   . HOH C .   ? 0.3247 0.3313 0.3218 -0.0101 0.0116  -0.0018 261 HOH X O   
1440 O  O   . HOH C .   ? 0.4134 0.3933 0.4341 0.0107  -0.0036 -0.0186 262 HOH X O   
1441 O  O   . HOH C .   ? 0.2908 0.2958 0.3137 0.0154  -0.0071 0.0007  263 HOH X O   
1442 O  O   . HOH C .   ? 0.3955 0.4252 0.3825 -0.0041 0.0088  -0.0074 264 HOH X O   
1443 O  O   . HOH C .   ? 0.3454 0.3666 0.3111 -0.0107 0.0046  0.0172  265 HOH X O   
1444 O  O   . HOH C .   ? 0.3151 0.2868 0.2593 0.0058  -0.0015 -0.0203 266 HOH X O   
1445 O  O   . HOH C .   ? 0.3673 0.3673 0.3639 -0.0174 0.0127  0.0196  267 HOH X O   
1446 O  O   . HOH C .   ? 0.3539 0.3606 0.3580 -0.0263 0.0102  -0.0022 268 HOH X O   
1447 O  O   . HOH C .   ? 0.2834 0.3026 0.3020 -0.0267 0.0351  -0.0134 269 HOH X O   
1448 O  O   . HOH C .   ? 0.3319 0.2515 0.3321 -0.0244 0.0189  0.0029  270 HOH X O   
1449 O  O   . HOH C .   ? 0.3735 0.3446 0.3898 -0.0105 0.0033  0.0095  271 HOH X O   
1450 O  O   . HOH C .   ? 0.3293 0.3526 0.3147 -0.0084 -0.0024 -0.0152 272 HOH X O   
1451 O  O   . HOH C .   ? 0.3494 0.3182 0.3265 0.0092  -0.0041 0.0000  273 HOH X O   
1452 O  O   . HOH C .   ? 0.3161 0.3304 0.3356 -0.0151 0.0065  -0.0048 274 HOH X O   
1453 O  O   . HOH C .   ? 0.3960 0.3339 0.3614 -0.0114 0.0083  -0.0256 275 HOH X O   
1454 O  O   . HOH C .   ? 0.3972 0.4090 0.3925 -0.0169 -0.0034 0.0033  276 HOH X O   
1455 O  O   . HOH C .   ? 0.3387 0.3205 0.3371 -0.0005 0.0166  0.0063  277 HOH X O   
1456 O  O   . HOH C .   ? 0.2913 0.2807 0.2446 -0.0222 0.0170  -0.0146 278 HOH X O   
1457 O  O   . HOH C .   ? 0.3516 0.3589 0.2971 -0.0326 0.0039  -0.0338 279 HOH X O   
1458 O  O   . HOH C .   ? 0.3461 0.3433 0.3474 -0.0228 0.0138  -0.0274 280 HOH X O   
1459 O  O   . HOH C .   ? 0.3072 0.3632 0.3193 -0.0341 -0.0058 -0.0210 281 HOH X O   
1460 O  O   . HOH C .   ? 0.3806 0.3704 0.3951 -0.0355 0.0165  -0.0103 282 HOH X O   
1461 O  O   . HOH C .   ? 0.3989 0.4025 0.4432 -0.0017 -0.0066 -0.0010 283 HOH X O   
1462 O  O   . HOH C .   ? 0.2784 0.2806 0.3413 -0.0045 -0.0302 -0.0057 284 HOH X O   
1463 O  O   . HOH C .   ? 0.3806 0.4212 0.3724 0.0095  -0.0099 -0.0057 285 HOH X O   
1464 O  O   . HOH C .   ? 0.2441 0.3131 0.2938 0.0174  -0.0045 0.0284  286 HOH X O   
1465 O  O   . HOH C .   ? 0.3960 0.3710 0.3527 -0.0054 0.0032  0.0156  287 HOH X O   
1466 O  O   . HOH C .   ? 0.4608 0.3825 0.3979 0.0060  0.0093  0.0016  288 HOH X O   
1467 O  O   . HOH C .   ? 0.3701 0.3969 0.3433 -0.0104 -0.0078 0.0382  289 HOH X O   
1468 O  O   . HOH C .   ? 0.3952 0.4207 0.4055 -0.0136 0.0051  -0.0068 290 HOH X O   
1469 O  O   . HOH C .   ? 0.3533 0.2888 0.2622 0.0383  0.0304  -0.0186 291 HOH X O   
1470 O  O   . HOH C .   ? 0.3813 0.3492 0.3352 -0.0021 0.0190  -0.0082 292 HOH X O   
1471 O  O   . HOH C .   ? 0.4790 0.4474 0.4785 0.0031  0.0035  0.0093  293 HOH X O   
1472 O  O   . HOH C .   ? 0.3865 0.3766 0.3616 -0.0106 0.0008  -0.0001 294 HOH X O   
1473 O  O   . HOH C .   ? 0.4543 0.4603 0.4741 -0.0093 -0.0033 -0.0151 295 HOH X O   
1474 O  O   . HOH C .   ? 0.3822 0.4007 0.3379 -0.0012 -0.0041 0.0189  296 HOH X O   
1475 O  O   . HOH C .   ? 0.4153 0.4330 0.3945 -0.0075 0.0166  -0.0021 297 HOH X O   
1476 O  O   . HOH C .   ? 0.3089 0.3077 0.3230 0.0091  -0.0071 0.0228  298 HOH X O   
1477 O  O   . HOH C .   ? 0.4366 0.4389 0.4370 -0.0111 0.0003  -0.0086 299 HOH X O   
1478 O  O   . HOH C .   ? 0.3325 0.3372 0.3413 0.0063  -0.0018 -0.0024 300 HOH X O   
1479 O  O   . HOH C .   ? 0.3542 0.3644 0.3757 -0.0208 0.0053  0.0037  301 HOH X O   
1480 O  O   . HOH C .   ? 0.3851 0.3789 0.3690 -0.0137 -0.0067 0.0056  302 HOH X O   
1481 O  O   . HOH C .   ? 0.3545 0.3406 0.3851 0.0058  0.0045  -0.0080 303 HOH X O   
1482 O  O   . HOH C .   ? 0.4672 0.4575 0.4791 -0.0048 -0.0121 0.0172  304 HOH X O   
1483 O  O   . HOH C .   ? 0.3787 0.2980 0.3423 -0.0044 0.0221  0.0082  305 HOH X O   
1484 O  O   . HOH C .   ? 0.4048 0.3792 0.4247 0.0132  -0.0075 0.0062  306 HOH X O   
1485 O  O   . HOH C .   ? 0.4880 0.4673 0.4887 -0.0019 0.0031  -0.0105 307 HOH X O   
1486 O  O   . HOH C .   ? 0.4178 0.3653 0.4477 -0.0040 0.0007  0.0038  308 HOH X O   
1487 O  O   . HOH C .   ? 0.4242 0.4478 0.4563 -0.0007 0.0071  0.0031  309 HOH X O   
1488 O  O   . HOH C .   ? 0.3579 0.3333 0.4040 -0.0257 0.0127  -0.0177 310 HOH X O   
1489 O  O   . HOH C .   ? 0.3144 0.3284 0.2929 -0.0047 0.0105  0.0135  311 HOH X O   
1490 O  O   . HOH C .   ? 0.4105 0.4130 0.4411 -0.0129 -0.0047 0.0092  312 HOH X O   
1491 O  O   . HOH C .   ? 0.2982 0.3921 0.3335 0.0310  0.0097  -0.0132 313 HOH X O   
1492 O  O   . HOH C .   ? 0.4156 0.3905 0.3991 -0.0021 0.0025  -0.0034 314 HOH X O   
1493 O  O   . HOH C .   ? 0.3838 0.3781 0.3999 0.0011  0.0124  0.0115  315 HOH X O   
1494 O  O   . HOH C .   ? 0.4186 0.4324 0.4447 0.0073  0.0025  -0.0138 316 HOH X O   
1495 O  O   . HOH C .   ? 0.4035 0.3335 0.3932 -0.0065 0.0150  -0.0237 317 HOH X O   
1496 O  O   . HOH C .   ? 0.4878 0.4912 0.4716 0.0082  -0.0026 0.0055  318 HOH X O   
1497 O  O   . HOH C .   ? 0.3782 0.3375 0.3954 -0.0153 0.0045  -0.0114 319 HOH X O   
1498 O  O   . HOH C .   ? 0.4227 0.4335 0.4403 0.0002  0.0174  -0.0066 320 HOH X O   
1499 O  O   . HOH C .   ? 0.5380 0.5150 0.5405 -0.0049 0.0039  0.0038  321 HOH X O   
1500 O  O   . HOH C .   ? 0.5747 0.5720 0.5942 -0.0038 0.0008  -0.0038 322 HOH X O   
1501 O  O   . HOH C .   ? 0.4040 0.4216 0.4331 -0.0051 -0.0166 -0.0062 323 HOH X O   
1502 O  O   . HOH C .   ? 0.4395 0.4228 0.4429 -0.0041 0.0139  -0.0107 324 HOH X O   
1503 O  O   . HOH C .   ? 0.4843 0.4847 0.4837 0.0063  -0.0039 -0.0012 325 HOH X O   
1504 O  O   . HOH C .   ? 0.4997 0.5134 0.5108 0.0011  0.0038  0.0020  326 HOH X O   
1505 O  O   . HOH C .   ? 0.4349 0.4378 0.4258 -0.0127 -0.0034 -0.0066 327 HOH X O   
1506 O  O   . HOH C .   ? 0.4089 0.3627 0.3212 0.0197  0.0062  0.0017  328 HOH X O   
1507 O  O   . HOH C .   ? 0.3523 0.3917 0.3981 0.0163  0.0225  -0.0133 329 HOH X O   
1508 O  O   . HOH C .   ? 0.4305 0.4089 0.4083 -0.0136 -0.0011 -0.0167 330 HOH X O   
1509 O  O   . HOH C .   ? 0.3822 0.4575 0.4021 -0.0101 -0.0093 0.0000  331 HOH X O   
1510 O  O   . HOH C .   ? 0.3527 0.3788 0.3332 0.0108  0.0057  0.0255  332 HOH X O   
1511 O  O   . HOH C .   ? 0.5588 0.5569 0.5630 0.0015  0.0062  0.0022  333 HOH X O   
1512 O  O   . HOH C .   ? 0.3590 0.3582 0.3928 -0.0037 0.0162  -0.0143 334 HOH X O   
1513 O  O   . HOH C .   ? 0.4159 0.3789 0.4502 -0.0105 0.0008  0.0038  335 HOH X O   
1514 O  O   . HOH C .   ? 0.5665 0.5750 0.5729 0.0006  0.0020  -0.0009 336 HOH X O   
1515 O  O   . HOH C .   ? 0.3643 0.3909 0.3577 -0.0014 0.0100  -0.0085 337 HOH X O   
1516 O  O   . HOH C .   ? 0.5528 0.5561 0.5464 -0.0059 -0.0088 -0.0071 338 HOH X O   
1517 O  O   . HOH C .   ? 0.4242 0.3859 0.4150 0.0057  0.0029  -0.0044 339 HOH X O   
1518 O  O   . HOH C .   ? 0.3894 0.4363 0.4234 -0.0106 -0.0069 0.0013  340 HOH X O   
1519 O  O   . HOH C .   ? 0.4232 0.3739 0.3892 0.0009  0.0169  -0.0077 341 HOH X O   
1520 O  O   . HOH C .   ? 0.4804 0.4725 0.4912 -0.0037 0.0048  0.0060  342 HOH X O   
1521 O  O   . HOH C .   ? 0.4483 0.4520 0.4475 0.0091  -0.0099 0.0073  343 HOH X O   
1522 O  O   . HOH C .   ? 0.4180 0.4103 0.4051 0.0111  0.0187  0.0053  344 HOH X O   
1523 O  O   . HOH C .   ? 0.2786 0.2758 0.2995 -0.0123 0.0031  -0.0151 345 HOH X O   
1524 O  O   . HOH C .   ? 0.4004 0.3698 0.4114 -0.0056 0.0104  -0.0023 346 HOH X O   
1525 O  O   . HOH C .   ? 0.4911 0.4694 0.4741 -0.0051 0.0074  0.0035  347 HOH X O   
1526 O  O   . HOH C .   ? 0.2312 0.2293 0.2468 0.0248  0.0105  -0.0194 348 HOH X O   
1527 O  O   . HOH C .   ? 0.3954 0.4059 0.4150 -0.0144 0.0065  -0.0128 349 HOH X O   
1528 O  O   . HOH C .   ? 0.4533 0.4350 0.4573 0.0048  -0.0210 0.0002  350 HOH X O   
1529 O  O   . HOH C .   ? 0.5995 0.6067 0.6057 -0.0024 -0.0010 0.0000  351 HOH X O   
1530 O  O   . HOH C .   ? 0.3886 0.4259 0.3461 -0.0119 0.0010  -0.0064 352 HOH X O   
1531 O  O   . HOH C .   ? 0.3731 0.3756 0.3469 -0.0194 0.0182  -0.0011 353 HOH X O   
1532 O  O   . HOH C .   ? 0.3045 0.2966 0.3086 0.0252  0.0366  -0.0042 354 HOH X O   
1533 O  O   . HOH C .   ? 0.4501 0.4756 0.4987 0.0072  -0.0045 -0.0003 355 HOH X O   
1534 O  O   . HOH C .   ? 0.5489 0.5646 0.5538 -0.0003 -0.0016 -0.0018 356 HOH X O   
1535 O  O   . HOH C .   ? 0.4155 0.3962 0.3661 -0.0013 0.0052  0.0147  357 HOH X O   
1536 O  O   . HOH C .   ? 0.3653 0.4118 0.4108 -0.0004 -0.0141 -0.0071 358 HOH X O   
1537 O  O   . HOH C .   ? 0.4827 0.5149 0.4962 -0.0023 0.0003  -0.0019 359 HOH X O   
1538 O  O   . HOH C .   ? 0.5044 0.4965 0.5072 0.0062  0.0019  0.0043  360 HOH X O   
1539 O  O   . HOH C .   ? 0.5311 0.5369 0.5298 -0.0012 -0.0038 -0.0073 361 HOH X O   
1540 O  O   . HOH C .   ? 0.4896 0.4914 0.4934 -0.0040 -0.0011 -0.0078 362 HOH X O   
1541 O  O   . HOH C .   ? 0.5927 0.6037 0.5994 -0.0028 -0.0037 0.0013  363 HOH X O   
1542 O  O   . HOH C .   ? 0.5649 0.5556 0.5743 0.0025  0.0015  0.0048  364 HOH X O   
1543 O  O   . HOH C .   ? 0.5860 0.5912 0.5965 0.0090  0.0006  0.0000  365 HOH X O   
1544 O  O   . HOH C .   ? 0.4338 0.4432 0.4480 -0.0063 -0.0195 -0.0072 366 HOH X O   
1545 O  O   . HOH C .   ? 0.4550 0.4624 0.4828 0.0018  -0.0036 0.0081  367 HOH X O   
1546 O  O   . HOH C .   ? 0.8335 0.8314 0.8347 -0.0006 0.0005  -0.0008 368 HOH X O   
1547 O  O   . HOH C .   ? 0.5115 0.4976 0.5102 0.0041  -0.0019 -0.0003 369 HOH X O   
1548 O  O   . HOH C .   ? 0.6368 0.6436 0.6346 -0.0032 -0.0052 0.0049  370 HOH X O   
1549 O  O   . HOH C .   ? 0.4498 0.4687 0.4726 0.0074  -0.0023 0.0074  371 HOH X O   
1550 O  O   . HOH C .   ? 0.4118 0.4102 0.4114 -0.0119 -0.0164 -0.0030 372 HOH X O   
1551 O  O   . HOH C .   ? 0.5877 0.5779 0.5699 -0.0017 0.0025  0.0000  373 HOH X O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   37  ?   ?   ?   X . n 
A 1 2   SER 2   38  38  SER SER X . n 
A 1 3   CYS 3   39  39  CYS CYS X . n 
A 1 4   ARG 4   40  40  ARG ARG X . n 
A 1 5   ARG 5   41  41  ARG ARG X . n 
A 1 6   ALA 6   42  42  ALA ALA X . n 
A 1 7   PHE 7   43  43  PHE PHE X . n 
A 1 8   ASP 8   44  44  ASP ASP X . n 
A 1 9   LEU 9   45  45  LEU LEU X . n 
A 1 10  TYR 10  46  46  TYR TYR X . n 
A 1 11  PHE 11  47  47  PHE PHE X . n 
A 1 12  VAL 12  48  48  VAL VAL X . n 
A 1 13  LEU 13  49  49  LEU LEU X . n 
A 1 14  ASP 14  50  50  ASP ASP X . n 
A 1 15  LYS 15  51  51  LYS LYS X . n 
A 1 16  SER 16  52  52  SER SER X . n 
A 1 17  GLY 17  53  53  GLY GLY X . n 
A 1 18  SER 18  54  54  SER SER X . n 
A 1 19  VAL 19  55  55  VAL VAL X . n 
A 1 20  ALA 20  56  56  ALA ALA X . n 
A 1 21  ASN 21  57  57  ASN ASN X . n 
A 1 22  ASN 22  58  58  ASN ASN X . n 
A 1 23  TRP 23  59  59  TRP TRP X . n 
A 1 24  ILE 24  60  60  ILE ILE X . n 
A 1 25  GLU 25  61  61  GLU GLU X . n 
A 1 26  ILE 26  62  62  ILE ILE X . n 
A 1 27  TYR 27  63  63  TYR TYR X . n 
A 1 28  ASN 28  64  64  ASN ASN X . n 
A 1 29  PHE 29  65  65  PHE PHE X . n 
A 1 30  VAL 30  66  66  VAL VAL X . n 
A 1 31  GLN 31  67  67  GLN GLN X . n 
A 1 32  GLN 32  68  68  GLN GLN X . n 
A 1 33  LEU 33  69  69  LEU LEU X . n 
A 1 34  ALA 34  70  70  ALA ALA X . n 
A 1 35  GLU 35  71  71  GLU GLU X . n 
A 1 36  ARG 36  72  72  ARG ARG X . n 
A 1 37  PHE 37  73  73  PHE PHE X . n 
A 1 38  VAL 38  74  74  VAL VAL X . n 
A 1 39  SER 39  75  75  SER SER X . n 
A 1 40  PRO 40  76  76  PRO PRO X . n 
A 1 41  GLU 41  77  77  GLU GLU X . n 
A 1 42  MET 42  78  78  MET MET X . n 
A 1 43  ARG 43  79  79  ARG ARG X . n 
A 1 44  LEU 44  80  80  LEU LEU X . n 
A 1 45  SER 45  81  81  SER SER X . n 
A 1 46  PHE 46  82  82  PHE PHE X . n 
A 1 47  ILE 47  83  83  ILE ILE X . n 
A 1 48  VAL 48  84  84  VAL VAL X . n 
A 1 49  PHE 49  85  85  PHE PHE X . n 
A 1 50  SER 50  86  86  SER SER X . n 
A 1 51  SER 51  87  87  SER SER X . n 
A 1 52  GLN 52  88  88  GLN GLN X . n 
A 1 53  ALA 53  89  89  ALA ALA X . n 
A 1 54  THR 54  90  90  THR THR X . n 
A 1 55  ILE 55  91  91  ILE ILE X . n 
A 1 56  ILE 56  92  92  ILE ILE X . n 
A 1 57  LEU 57  93  93  LEU LEU X . n 
A 1 58  PRO 58  94  94  PRO PRO X . n 
A 1 59  LEU 59  95  95  LEU LEU X . n 
A 1 60  THR 60  96  96  THR THR X . n 
A 1 61  GLY 61  97  97  GLY GLY X . n 
A 1 62  ASP 62  98  98  ASP ASP X . n 
A 1 63  ARG 63  99  99  ARG ARG X . n 
A 1 64  GLY 64  100 100 GLY GLY X . n 
A 1 65  LYS 65  101 101 LYS LYS X . n 
A 1 66  ILE 66  102 102 ILE ILE X . n 
A 1 67  SER 67  103 103 SER SER X . n 
A 1 68  LYS 68  104 104 LYS LYS X . n 
A 1 69  GLY 69  105 105 GLY GLY X . n 
A 1 70  LEU 70  106 106 LEU LEU X . n 
A 1 71  GLU 71  107 107 GLU GLU X . n 
A 1 72  ASP 72  108 108 ASP ASP X . n 
A 1 73  LEU 73  109 109 LEU LEU X . n 
A 1 74  LYS 74  110 110 LYS LYS X . n 
A 1 75  ARG 75  111 111 ARG ARG X . n 
A 1 76  VAL 76  112 112 VAL VAL X . n 
A 1 77  SER 77  113 113 SER SER X . n 
A 1 78  PRO 78  114 114 PRO PRO X . n 
A 1 79  VAL 79  115 115 VAL VAL X . n 
A 1 80  GLY 80  116 116 GLY GLY X . n 
A 1 81  GLU 81  117 117 GLU GLU X . n 
A 1 82  THR 82  118 118 THR THR X . n 
A 1 83  TYR 83  119 119 TYR TYR X . n 
A 1 84  ILE 84  120 120 ILE ILE X . n 
A 1 85  HIS 85  121 121 HIS HIS X . n 
A 1 86  GLU 86  122 122 GLU GLU X . n 
A 1 87  GLY 87  123 123 GLY GLY X . n 
A 1 88  LEU 88  124 124 LEU LEU X . n 
A 1 89  LYS 89  125 125 LYS LYS X . n 
A 1 90  LEU 90  126 126 LEU LEU X . n 
A 1 91  ALA 91  127 127 ALA ALA X . n 
A 1 92  ASN 92  128 128 ASN ASN X . n 
A 1 93  GLU 93  129 129 GLU GLU X . n 
A 1 94  GLN 94  130 130 GLN GLN X . n 
A 1 95  ILE 95  131 131 ILE ILE X . n 
A 1 96  GLN 96  132 132 GLN GLN X . n 
A 1 97  LYS 97  133 133 LYS LYS X . n 
A 1 98  ALA 98  134 134 ALA ALA X . n 
A 1 99  GLY 99  135 135 GLY GLY X . n 
A 1 100 GLY 100 136 136 GLY GLY X . n 
A 1 101 LEU 101 137 137 LEU LEU X . n 
A 1 102 LYS 102 138 138 LYS LYS X . n 
A 1 103 THR 103 139 139 THR THR X . n 
A 1 104 SER 104 140 140 SER SER X . n 
A 1 105 SER 105 141 141 SER SER X . n 
A 1 106 ILE 106 142 142 ILE ILE X . n 
A 1 107 ILE 107 143 143 ILE ILE X . n 
A 1 108 ILE 108 144 144 ILE ILE X . n 
A 1 109 ALA 109 145 145 ALA ALA X . n 
A 1 110 LEU 110 146 146 LEU LEU X . n 
A 1 111 THR 111 147 147 THR THR X . n 
A 1 112 ASP 112 148 148 ASP ASP X . n 
A 1 113 GLY 113 149 149 GLY GLY X . n 
A 1 114 LYS 114 150 150 LYS LYS X . n 
A 1 115 LEU 115 151 151 LEU LEU X . n 
A 1 116 ASP 116 152 152 ASP ASP X . n 
A 1 117 GLY 117 153 153 GLY GLY X . n 
A 1 118 LEU 118 154 154 LEU LEU X . n 
A 1 119 VAL 119 155 155 VAL VAL X . n 
A 1 120 PRO 120 156 156 PRO PRO X . n 
A 1 121 SER 121 157 157 SER SER X . n 
A 1 122 TYR 122 158 158 TYR TYR X . n 
A 1 123 ALA 123 159 159 ALA ALA X . n 
A 1 124 GLU 124 160 160 GLU GLU X . n 
A 1 125 LYS 125 161 161 LYS LYS X . n 
A 1 126 GLU 126 162 162 GLU GLU X . n 
A 1 127 ALA 127 163 163 ALA ALA X . n 
A 1 128 LYS 128 164 164 LYS LYS X . n 
A 1 129 ILE 129 165 165 ILE ILE X . n 
A 1 130 SER 130 166 166 SER SER X . n 
A 1 131 ARG 131 167 167 ARG ARG X . n 
A 1 132 SER 132 168 168 SER SER X . n 
A 1 133 LEU 133 169 169 LEU LEU X . n 
A 1 134 GLY 134 170 170 GLY GLY X . n 
A 1 135 ALA 135 171 171 ALA ALA X . n 
A 1 136 SER 136 172 172 SER SER X . n 
A 1 137 VAL 137 173 173 VAL VAL X . n 
A 1 138 TYR 138 174 174 TYR TYR X . n 
A 1 139 CYS 139 175 175 CYS CYS X . n 
A 1 140 VAL 140 176 176 VAL VAL X . n 
A 1 141 GLY 141 177 177 GLY GLY X . n 
A 1 142 VAL 142 178 178 VAL VAL X . n 
A 1 143 LEU 143 179 179 LEU LEU X . n 
A 1 144 ASP 144 180 180 ASP ASP X . n 
A 1 145 PHE 145 181 181 PHE PHE X . n 
A 1 146 GLU 146 182 182 GLU GLU X . n 
A 1 147 GLN 147 183 183 GLN GLN X . n 
A 1 148 ALA 148 184 184 ALA ALA X . n 
A 1 149 GLN 149 185 185 GLN GLN X . n 
A 1 150 LEU 150 186 186 LEU LEU X . n 
A 1 151 GLU 151 187 187 GLU GLU X . n 
A 1 152 ARG 152 188 188 ARG ARG X . n 
A 1 153 ILE 153 189 189 ILE ILE X . n 
A 1 154 ALA 154 190 190 ALA ALA X . n 
A 1 155 ASP 155 191 191 ASP ASP X . n 
A 1 156 SER 156 192 192 SER SER X . n 
A 1 157 LYS 157 193 193 LYS LYS X . n 
A 1 158 GLU 158 194 194 GLU GLU X . n 
A 1 159 GLN 159 195 195 GLN GLN X . n 
A 1 160 VAL 160 196 196 VAL VAL X . n 
A 1 161 PHE 161 197 197 PHE PHE X . n 
A 1 162 PRO 162 198 198 PRO PRO X . n 
A 1 163 VAL 163 199 199 VAL VAL X . n 
A 1 164 LYS 164 200 200 LYS LYS X . n 
A 1 165 GLY 165 201 201 GLY GLY X . n 
A 1 166 GLY 166 202 202 GLY GLY X . n 
A 1 167 PHE 167 203 203 PHE PHE X . n 
A 1 168 GLN 168 204 204 GLN GLN X . n 
A 1 169 ALA 169 205 205 ALA ALA X . n 
A 1 170 LEU 170 206 206 LEU LEU X . n 
A 1 171 LYS 171 207 207 LYS LYS X . n 
A 1 172 GLY 172 208 208 GLY GLY X . n 
A 1 173 ILE 173 209 209 ILE ILE X . n 
A 1 174 ILE 174 210 210 ILE ILE X . n 
A 1 175 ASN 175 211 211 ASN ASN X . n 
A 1 176 SER 176 212 212 SER SER X . n 
A 1 177 ILE 177 213 213 ILE ILE X . n 
A 1 178 LEU 178 214 214 LEU LEU X . n 
A 1 179 ALA 179 215 215 ALA ALA X . n 
A 1 180 GLN 180 216 216 GLN GLN X . n 
A 1 181 SER 181 217 217 SER SER X . n 
A 1 182 CYS 182 218 218 CYS CYS X . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 MG  1   219 3   MG  MG  X . 
C 3 HOH 1   220 1   HOH HOH X . 
C 3 HOH 2   221 2   HOH HOH X . 
C 3 HOH 3   222 3   HOH HOH X . 
C 3 HOH 4   223 4   HOH HOH X . 
C 3 HOH 5   224 5   HOH HOH X . 
C 3 HOH 6   225 6   HOH HOH X . 
C 3 HOH 7   226 7   HOH HOH X . 
C 3 HOH 8   227 8   HOH HOH X . 
C 3 HOH 9   228 9   HOH HOH X . 
C 3 HOH 10  229 10  HOH HOH X . 
C 3 HOH 11  230 11  HOH HOH X . 
C 3 HOH 12  231 12  HOH HOH X . 
C 3 HOH 13  232 13  HOH HOH X . 
C 3 HOH 14  233 14  HOH HOH X . 
C 3 HOH 15  234 15  HOH HOH X . 
C 3 HOH 16  235 16  HOH HOH X . 
C 3 HOH 17  236 17  HOH HOH X . 
C 3 HOH 18  237 18  HOH HOH X . 
C 3 HOH 19  238 19  HOH HOH X . 
C 3 HOH 20  239 20  HOH HOH X . 
C 3 HOH 21  240 21  HOH HOH X . 
C 3 HOH 22  241 22  HOH HOH X . 
C 3 HOH 23  242 23  HOH HOH X . 
C 3 HOH 24  243 24  HOH HOH X . 
C 3 HOH 25  244 25  HOH HOH X . 
C 3 HOH 26  245 26  HOH HOH X . 
C 3 HOH 27  246 27  HOH HOH X . 
C 3 HOH 28  247 28  HOH HOH X . 
C 3 HOH 29  248 29  HOH HOH X . 
C 3 HOH 30  249 30  HOH HOH X . 
C 3 HOH 31  250 31  HOH HOH X . 
C 3 HOH 32  251 32  HOH HOH X . 
C 3 HOH 33  252 33  HOH HOH X . 
C 3 HOH 34  253 34  HOH HOH X . 
C 3 HOH 35  254 35  HOH HOH X . 
C 3 HOH 36  255 36  HOH HOH X . 
C 3 HOH 37  256 37  HOH HOH X . 
C 3 HOH 38  257 38  HOH HOH X . 
C 3 HOH 39  258 39  HOH HOH X . 
C 3 HOH 40  259 40  HOH HOH X . 
C 3 HOH 41  260 41  HOH HOH X . 
C 3 HOH 42  261 42  HOH HOH X . 
C 3 HOH 43  262 43  HOH HOH X . 
C 3 HOH 44  263 44  HOH HOH X . 
C 3 HOH 45  264 45  HOH HOH X . 
C 3 HOH 46  265 46  HOH HOH X . 
C 3 HOH 47  266 47  HOH HOH X . 
C 3 HOH 48  267 48  HOH HOH X . 
C 3 HOH 49  268 49  HOH HOH X . 
C 3 HOH 50  269 50  HOH HOH X . 
C 3 HOH 51  270 51  HOH HOH X . 
C 3 HOH 52  271 52  HOH HOH X . 
C 3 HOH 53  272 53  HOH HOH X . 
C 3 HOH 54  273 54  HOH HOH X . 
C 3 HOH 55  274 55  HOH HOH X . 
C 3 HOH 56  275 56  HOH HOH X . 
C 3 HOH 57  276 57  HOH HOH X . 
C 3 HOH 58  277 58  HOH HOH X . 
C 3 HOH 59  278 59  HOH HOH X . 
C 3 HOH 60  279 60  HOH HOH X . 
C 3 HOH 61  280 61  HOH HOH X . 
C 3 HOH 62  281 62  HOH HOH X . 
C 3 HOH 63  282 63  HOH HOH X . 
C 3 HOH 64  283 64  HOH HOH X . 
C 3 HOH 65  284 65  HOH HOH X . 
C 3 HOH 66  285 66  HOH HOH X . 
C 3 HOH 67  286 67  HOH HOH X . 
C 3 HOH 68  287 68  HOH HOH X . 
C 3 HOH 69  288 69  HOH HOH X . 
C 3 HOH 70  289 70  HOH HOH X . 
C 3 HOH 71  290 71  HOH HOH X . 
C 3 HOH 72  291 72  HOH HOH X . 
C 3 HOH 73  292 73  HOH HOH X . 
C 3 HOH 74  293 74  HOH HOH X . 
C 3 HOH 75  294 75  HOH HOH X . 
C 3 HOH 76  295 76  HOH HOH X . 
C 3 HOH 77  296 77  HOH HOH X . 
C 3 HOH 78  297 78  HOH HOH X . 
C 3 HOH 79  298 79  HOH HOH X . 
C 3 HOH 80  299 80  HOH HOH X . 
C 3 HOH 81  300 81  HOH HOH X . 
C 3 HOH 82  301 82  HOH HOH X . 
C 3 HOH 83  302 83  HOH HOH X . 
C 3 HOH 84  303 84  HOH HOH X . 
C 3 HOH 85  304 85  HOH HOH X . 
C 3 HOH 86  305 86  HOH HOH X . 
C 3 HOH 87  306 87  HOH HOH X . 
C 3 HOH 88  307 88  HOH HOH X . 
C 3 HOH 89  308 89  HOH HOH X . 
C 3 HOH 90  309 90  HOH HOH X . 
C 3 HOH 91  310 91  HOH HOH X . 
C 3 HOH 92  311 92  HOH HOH X . 
C 3 HOH 93  312 93  HOH HOH X . 
C 3 HOH 94  313 94  HOH HOH X . 
C 3 HOH 95  314 95  HOH HOH X . 
C 3 HOH 96  315 96  HOH HOH X . 
C 3 HOH 97  316 97  HOH HOH X . 
C 3 HOH 98  317 98  HOH HOH X . 
C 3 HOH 99  318 99  HOH HOH X . 
C 3 HOH 100 319 100 HOH HOH X . 
C 3 HOH 101 320 101 HOH HOH X . 
C 3 HOH 102 321 102 HOH HOH X . 
C 3 HOH 103 322 103 HOH HOH X . 
C 3 HOH 104 323 104 HOH HOH X . 
C 3 HOH 105 324 105 HOH HOH X . 
C 3 HOH 106 325 106 HOH HOH X . 
C 3 HOH 107 326 107 HOH HOH X . 
C 3 HOH 108 327 108 HOH HOH X . 
C 3 HOH 109 328 109 HOH HOH X . 
C 3 HOH 110 329 110 HOH HOH X . 
C 3 HOH 111 330 111 HOH HOH X . 
C 3 HOH 112 331 112 HOH HOH X . 
C 3 HOH 113 332 113 HOH HOH X . 
C 3 HOH 114 333 114 HOH HOH X . 
C 3 HOH 115 334 115 HOH HOH X . 
C 3 HOH 116 335 116 HOH HOH X . 
C 3 HOH 117 336 117 HOH HOH X . 
C 3 HOH 118 337 118 HOH HOH X . 
C 3 HOH 119 338 119 HOH HOH X . 
C 3 HOH 120 339 120 HOH HOH X . 
C 3 HOH 121 340 121 HOH HOH X . 
C 3 HOH 122 341 122 HOH HOH X . 
C 3 HOH 123 342 123 HOH HOH X . 
C 3 HOH 124 343 124 HOH HOH X . 
C 3 HOH 125 344 125 HOH HOH X . 
C 3 HOH 126 345 126 HOH HOH X . 
C 3 HOH 127 346 127 HOH HOH X . 
C 3 HOH 128 347 128 HOH HOH X . 
C 3 HOH 129 348 129 HOH HOH X . 
C 3 HOH 130 349 130 HOH HOH X . 
C 3 HOH 131 350 131 HOH HOH X . 
C 3 HOH 132 351 132 HOH HOH X . 
C 3 HOH 133 352 133 HOH HOH X . 
C 3 HOH 134 353 134 HOH HOH X . 
C 3 HOH 135 354 135 HOH HOH X . 
C 3 HOH 136 355 136 HOH HOH X . 
C 3 HOH 137 356 137 HOH HOH X . 
C 3 HOH 138 357 138 HOH HOH X . 
C 3 HOH 139 358 139 HOH HOH X . 
C 3 HOH 140 359 140 HOH HOH X . 
C 3 HOH 141 360 141 HOH HOH X . 
C 3 HOH 142 361 142 HOH HOH X . 
C 3 HOH 143 362 143 HOH HOH X . 
C 3 HOH 144 363 144 HOH HOH X . 
C 3 HOH 145 364 145 HOH HOH X . 
C 3 HOH 146 365 146 HOH HOH X . 
C 3 HOH 147 366 147 HOH HOH X . 
C 3 HOH 148 367 148 HOH HOH X . 
C 3 HOH 149 368 149 HOH HOH X . 
C 3 HOH 150 369 150 HOH HOH X . 
C 3 HOH 151 370 151 HOH HOH X . 
C 3 HOH 152 371 152 HOH HOH X . 
C 3 HOH 153 372 153 HOH HOH X . 
C 3 HOH 154 373 154 HOH HOH X . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? C HOH .  ? X HOH 222 ? 1_555 MG ? B MG . ? X MG 219 ? 1_555 O   ? C HOH .   ? X HOH 220 ? 1_555 91.7  ? 
2  O   ? C HOH .  ? X HOH 222 ? 1_555 MG ? B MG . ? X MG 219 ? 1_555 OG  ? A SER 16  ? X SER 52  ? 1_555 177.6 ? 
3  O   ? C HOH .  ? X HOH 220 ? 1_555 MG ? B MG . ? X MG 219 ? 1_555 OG  ? A SER 16  ? X SER 52  ? 1_555 88.9  ? 
4  O   ? C HOH .  ? X HOH 222 ? 1_555 MG ? B MG . ? X MG 219 ? 1_555 OG  ? A SER 18  ? X SER 54  ? 1_555 88.0  ? 
5  O   ? C HOH .  ? X HOH 220 ? 1_555 MG ? B MG . ? X MG 219 ? 1_555 OG  ? A SER 18  ? X SER 54  ? 1_555 83.9  ? 
6  OG  ? A SER 16 ? X SER 52  ? 1_555 MG ? B MG . ? X MG 219 ? 1_555 OG  ? A SER 18  ? X SER 54  ? 1_555 94.3  ? 
7  O   ? C HOH .  ? X HOH 222 ? 1_555 MG ? B MG . ? X MG 219 ? 1_555 OG1 ? A THR 82  ? X THR 118 ? 1_555 89.9  ? 
8  O   ? C HOH .  ? X HOH 220 ? 1_555 MG ? B MG . ? X MG 219 ? 1_555 OG1 ? A THR 82  ? X THR 118 ? 1_555 99.6  ? 
9  OG  ? A SER 16 ? X SER 52  ? 1_555 MG ? B MG . ? X MG 219 ? 1_555 OG1 ? A THR 82  ? X THR 118 ? 1_555 87.7  ? 
10 OG  ? A SER 18 ? X SER 54  ? 1_555 MG ? B MG . ? X MG 219 ? 1_555 OG1 ? A THR 82  ? X THR 118 ? 1_555 176.0 ? 
11 O   ? C HOH .  ? X HOH 222 ? 1_555 MG ? B MG . ? X MG 219 ? 1_555 OE2 ? A GLU 158 ? X GLU 194 ? 3_545 92.4  ? 
12 O   ? C HOH .  ? X HOH 220 ? 1_555 MG ? B MG . ? X MG 219 ? 1_555 OE2 ? A GLU 158 ? X GLU 194 ? 3_545 170.4 ? 
13 OG  ? A SER 16 ? X SER 52  ? 1_555 MG ? B MG . ? X MG 219 ? 1_555 OE2 ? A GLU 158 ? X GLU 194 ? 3_545 87.4  ? 
14 OG  ? A SER 18 ? X SER 54  ? 1_555 MG ? B MG . ? X MG 219 ? 1_555 OE2 ? A GLU 158 ? X GLU 194 ? 3_545 87.6  ? 
15 OG1 ? A THR 82 ? X THR 118 ? 1_555 MG ? B MG . ? X MG 219 ? 1_555 OE2 ? A GLU 158 ? X GLU 194 ? 3_545 89.1  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-04-13 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement       5.1.24 ? 1 
HKL-2000  'data reduction' .      ? 2 
SCALEPACK 'data scaling'   .      ? 3 
MOLREP    phasing          .      ? 4 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_1             X 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_1              98 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CG 
_pdbx_validate_rmsd_angle.auth_asym_id_2             X 
_pdbx_validate_rmsd_angle.auth_comp_id_2             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_2              98 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             OD2 
_pdbx_validate_rmsd_angle.auth_asym_id_3             X 
_pdbx_validate_rmsd_angle.auth_comp_id_3             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_3              98 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                124.02 
_pdbx_validate_rmsd_angle.angle_target_value         118.30 
_pdbx_validate_rmsd_angle.angle_deviation            5.72 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.90 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 SER X 86  ? ? -142.09 -104.86 
2 1 LEU X 179 ? ? 57.63   -146.07 
# 
_pdbx_unobs_or_zero_occ_residues.id               1 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_residues.polymer_flag     Y 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id     X 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id     GLY 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id      37 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_residues.label_asym_id    A 
_pdbx_unobs_or_zero_occ_residues.label_comp_id    GLY 
_pdbx_unobs_or_zero_occ_residues.label_seq_id     1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MAGNESIUM ION' MG  
3 water           HOH 
#